2WWMC

Crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
b'GSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
total genus 16
structure length 98
sequence length 98
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wwmC00
1XF2B 4BUGA 4MJ4A 1KLUA 1A6UH 5DHXB 3VFVB 4UINL 4LVHC 4XPHL 4CMMB 4Z7VA 5I6XC 5J1AA 1CYGA 1PBYA 4G6AD 2H32H 5EZLA 5HD8C 3Q6FA 4I0PB 4JRWA 1KJVB 5A1AA 3S7GA 4LKXA 4L4VA 5DRXB 4F58L 3PWNA 5TDOA 3OXRA 5EU3A 1EHXA 2VJXA 3FTGA 3UO1L 1T2QH 1G9MC 2YC1B 4X6DB 2A6IA 1A6VL 5C07E 5I0DA 5HY9A 1CFBA 1VERA 3PXJA 3GK8H 5BRZD 1NGQL 4P5KB 2BY0A 4OM1L 1CXHA 4P4KB 2E3VA 3SE9L 2E9WA 5I8EA 2X4SA 1PG7H 3VDBA 4LLYA 1XGPA 4J12A 3WFEL 2LABA 3BXNA 1AKJD 4LEXL 2ZNXA 4NZRL 2UZXB 1U8MB 2E7MA 5F3HA 4PREA 1BZ7B 2GY5A 2XWBB 4S1DD 4OT1H 4V2BA 3MRFA 1NCWH 1ROWA 4OCWH 2ICWA 2V7HB 5DQDH 1BQHG 3QHZL 4QRUB 4JR9H 5C0BA 4KVCH 2IMMA 1KLUB 4RISH 3JWDC 2VZOA 2M1KA 3D85D 1YEHH 4Z7VB 5EIIA 1CIDA 1WISA 4I0PD 4JDTH 5EZLB 1Z5LA 3Q6FB 5DO2D 4XP6L 4KXZH 1CFTB 4L4VB 3DX6A 1INDH 1EHLL 1JMZA 3PWNB 3OXRB 5L88H 5ITBL 4PYGA 1KBGL 4PJXF 4L3EE 2XZCL 2VDPH 3B5TA 3RIAF 2A6IB 4FQQA 5LGHL 5KVEL 4P2QA 4U05A 5EN2A 3QIUC 3R0NA 4P4KD 2YD9A 2E7HA 3BX7C 1IAIH 4LF3A 1SM3L 4LPUA 2I5YH 4WI2A 5I8EB 4K9EL 1TITA 4POYA 1IILE 4LLYB 2HTKD 3QH3A 3BXNB 1JHKL 1JYNA 3PABB 3PDGA 4PREB 5F3HB 5DFVD 5IMOA 3MRFB 3KJ6L 2EE2A 5A2JH 4IRJA 5IKCB 4ELMA 4G6ML 2XKNA 1P1ZA 2WQRA 1F90L 1P4LB 3WXWL 1UZ8A 3WO3B 3ZTJH 1AGEA 4G8GA 5IESL 3TT1H 5JQ6H 2AERT 1KCSH 4LPVA 5MEQA 4QRPE 5E4IA 3L3IA 1OVZA 1N64L 1Z5LB 4L4VD 1DLFH 5GRUH 2XTJE 1RIUH 3WL9A 3S35H 4DCQA 2V2XA 4MNQE 1YMHA 2YK1H 3F58H 4X0KA 4BSWA 3B8YA 4IJ3C 3TYFA 4WU5A 3B9KC 4FQQB 4NBXB 4X4ZA 4YBQD 2PYFA 2AEIT 5C0JA 1A7PH 1SMAA 3RZCB 1MI5E 5KVDL 3RKDC 4BQ6A 4EN3A 3VI3F 2V2TA 1B3JA 3BHBB 4UNUA 4D94A 4O58L 3WJJA 4HIEA 4WFFE 2N7BA 1V3LA 3VJ6A 1YYMH 1HHKA 4U1SA 4ZO6A 1GC1L 1EVUA 1IAOB 5IMOB 3MRCA 4Y1AA 1CL7H 1ITCA 2UVFA 4IRJB 5C70A 5C0BD 4ODTH 4CW1A 5ISZA 3K3QA 4MGXA 3MACL 4G8GB 5E2WL 4QRRA 1J8KA 4M6NH 5GRVK 4U3HA 1KPVA 4N0FB 5MEQB 1S7TA 3L3IB 1I8IA 3MOBH 4PJFE 2B4CH 2NXYD 3ZT6A 1QPXA 1FVCB 2Y7QA 4DK3A 4GRWE 1VDGA 3NAAH 4YDLC 4DCQB 1AH1A 4U6XB 3BIKA 2V2XB 2EH8L 4KWUA 1KG0A 1YMHB 2D7QA 2EDFA 1Z9OA 3WXVH 4BSWB 3HNVH 4OF6A 5IEHA 4HUVA 2QSCL 3CFJA 4JZJA 3V4PL 3C8HA 4KGJA 1LGVA 1KTKE 1YN6B 4P2QD 4Q9RL 4PTUB 5BCAA 2PYFB 4PTTA 3RZCD 5C0JB 1RMFL 2FJGB 3NGBB 4Z7NF 1IJ9A 3T77A 3O6FC 4OGYL 1WTLA 3TVMC 3MXVL 3MRLA 3QXDA 4NKOB 5ADOH 3QZWB 5EIVA 4HULB 3X14A 5GJTL 3THML 2R69H 2HVJA 3DSFH 3MGOB 3PWVA 5INDA 1T1XA 1E4WL 3DRTA 5LWYH 3G08A 2DKMA 4HIEB 3FB7A 5I1AB 3T2QA 5JLZA 2D0FA 5IBLC 3VJ6B 4KK5C 1HHKB 4U1SB 5FO7A 3BVNA 4UT9H 2GITA 3MRCB 4IRJD 2O5ZH 4K8RL 4JQXA 1FIEA 1H5BA 4NO3A 1OP3H 4O02L 1S5HA 3MV9A 4CW1B 1DQDL 1FNGA 4G8GD 1BJ1H 1HKLH 2VXUL 1XGUA 4XC1H 3OB0H 5KSBA 4QRRB 1PKQA 3DUSA 3L7EA 1NGZA 4ALAL 2ATPA 1S7TB 3CFEB 2VDNH 5TE6L 3ILPA 4XBGA 1Q0YH 1OM3H 3BPLC 2Y7QB 2I9LA 1SYSA 4CN6A 4O4YH 4HGMA 3CDGB 4NKIH 4I9WE 3BIKB 1KG0B 5I1JH 3ARUA 3JZ7A 4N5UA 3SKMA 3STBA 2EXWC 4P2OC 5IEHB 4NQTA 3CFJB 3GMQA 4JZJB 3ZO0A 4RWYL 5BZDA 4PTTB 4PG9A 4EN3D 4QOKA 1QNZL 3T77B 3FO2A 3MRLB 4NN7B 3RGVC 1INEL 3QXDB 4IEFB 3X14B 4CU7A 1MCBA 4YK4C 2HVJB 4CN1A 5INDB 2B8OT 3DRTB 3KXFB 3QXAB 1MFCH 4NQCA 4ELME 5JLZB 5CZXD 5ABDE 5IG7A 1T7WA 4MQ7A 3PHQB 2R56H 1N59B 5CP3H 4H26B 1MCFA 4Y1AD 1CFQA 1SVCP 4HW6A 1BREA 2VC2H 1QSEA 3MNWB 4PB9H 1H5BB 5LAXB 5BS0E 1MREL 5ISZD 3LN5A 4F7EB 5LQBH 1S5HB 3MV9B 3BFOA 2ESVB 4QRRD 1XGUB 4OIIL 5KSBB 1PKQB 3DUSB 3O4LA 5C0NC 4Y4FA 4MA1B 4XBGB 4XPBL 4RMVA 4L9DA 5JIHA 3CMGA 1RUQH 4J3OC 2I9LB 2CGRH 1EK3A 3WHE1 1ZLUK 4HUNB 4PJEE 2GJ6E 4XTRC 2ENSA 4H20L 3MLUH 1CICB 4BQ8A 2K1MA 3GMQB 4TPRH 3QDJE 5B22A 5BZDB 2EIDA 2CUMA 2VLRB 2J4WH 4U3CA 1LNUA 4DUXA 1FL5A 3BZ4A 4JHAL 3ZSTA 4Y19A 1WZLA 1A6PA 4PJIB 5FYKE 3FO2B 3M8OL 4L3CB 1ZGLP 5FUOL 5DJ6A 2FWOA 3KXFD 5C1MB 5I71C 4P5MA 4PRBB 3C5SA 3FOLA 4NQCB 1R3IH 3F7VA 1LE9A 5IG7B 4GQ9H 4N8CH 1QVOB 3NCEB 1XR9A 4NDMA 1CFQB 3VFMB 1FE8L 3BP5A 1H9VA 3U7WH 3EW3B 2HFGH 1MHCA 1YNLH 4ETYA 3MV9D 3GKZA 3OPZL 3PP3K 2AJVH 4A2MA 3QFJA 3STZA 2AQ2A 5F7LB 1MWAL 1U8NA 2NPLX 1S7XB 1J1PH 1OAUL 3ZDYF 1G9NH 4KJYB 1JZ7A 4Y4FB 5DK0B 5C0IA 4ISVA 4YGVA 4IIQC 3X3GH 3ULUL 2YD8A 1IGJA 3MJ7A 1J11A 3U4BL 5E1HB 1JBJA 3DI2B 2B0SH 3FT4A 2ORBL 1NMCB 3NH7L 1CTOA 2JJSA 1T1ZA 5EULV 1LP9E 2EE9A 4H0IA 4YO0A 2VLRD 2IH3A 5DMKA 2A9NL 4XNQA 2XZQH 1LNUB 4DN4H 2R2HA 3EYFA 2YN3A 3BZ4B 4QOKD 4Y19B 3ZE2E 1I9EA 1OGAA 5C0CE 5T3XL 1N5AB 1A3LH 3BKCL 3HHRB 2RAMA 4LVHB 2NCMA 2LAGB 5DJ6B 4OZHF 4PJ9C 1G84A 3V6OC 2FWOB 5I6XB 4P5MB 4NQCD 3MLVH 3SDAA 1BFTA 3EHBD 3C5SB 4RBPH 3FOLB 4TTDD 1LE9B 4XWOD 3KPRB 3ULSA 5JDJA 2R0KL 4I2XE 4P5TA 4NDMB 2G75B 3BP5B 1HXYA 1MHEB 3WFHA 1MHCB 2VDMH 2Y5TA 3TNNA 4WTXA 5J06A 4MZ3A 2EE3A 1EZVY 5C9JB 3LY6A 4M7LH 1NL0H 2E9JA 5E5MA 1FAIH 1LDPH 3QFJB 1T3FA 3STZB 2E27H 4ODVL 3QIUA 4GAGH 3S3JA 3CH1A 5E2UH 2NY1C 4Y4FD 2GIYA 4X4MA 3C08L 2HWZH 2Y9RT 2ZUQC 4YE4H 5C0IB 4NN6C 2FEDC 1QFWM 1E4KC 4PJXB 3IU3A 5FECA 2MHAA 4HAFA 1ZHNA 2R4SH 3R4DA 4LKCB 4WDIA 2NW2B 2R2BA 4JB9L 1J1XL 4YH6A 3T3ME 4HUMB 5IR1A 1T1ZB 4HEME 4PJ5B 3GSNL 5DMKB 4RCAA 1KNOA 4Y19D 2R2HB 3EYFB 1QLFA 3FT2A 4JG0L 1OGAB 5DFTA 3RWEA 4G9FB 3UROR 4FQXC 5GHWL 4OF0A 5I15H 4NCDA 5HD8D 1U91B 4AL8L 3MV01 5I8CA 1U8IA 5A40E 3ULSB 1JGEB 1VFBB 3RNKA 5E2TH 1HINH 1CIUA 3GRWL 4LSQL 3O4LE 1HXYB 3WFHB 1XH3A 2HLFC 1HSBA 5ICXA 3RVWC 4OCRH 4BFIA 5TDNB 1JPTL 3O41A 5E2VH 3QFJD 3KWWB 5E5MB 4QKXB 3R06A 4X5WA 1TZGL 3ALXA 3EFDL 3WN5C 3QIUB 1UM5L 3ZMRA 5T33L 2QLVB 3AROA 3VXUE 2HJKB 4XPAL 5JA9A 4F9PC 2PTVA 2D4DA 3L3HA 5T1KA 4PPTA 1JHTB 3IU3B 4PLKC 5FECB 2MHAB 5SWZB 1J0IA 3BMVA 5FYJD 3FFDB 3K4AA 4YDIL 5D70L 4XVUC 1R5VB 1II4E 4KK9C 3U9PL 2IQ9H 1A4KA 4Q9BA 3B4NA 4Y16C 1E4XI 2GYSA 4LVEA 3STLA 2GY7B 1GGIL 4U0RC 2YBRA 5TQ2L 2X1OA 3N1QC 1QLFB 1OGAD 2F5BH 5HI3C 4L8SC 4HS3A 5IB5B 3RWEB 3IDMA 4JGJA 1OTTD 3MRPA 4NWTL 3DX7A 5CILH 3DXAB 5I8CB 1Q94B 4H88L 1TETL 3TH2T 4EDXA 4P5TD 1WBYA 1LWRA 1MRDL 4Z7QF 3QIBA 4OLVL 5FOBA 4OI7A 4YHPA 4UIMA 1XH3B 2XPGA 4IJ3B 4K3JH 3L6FB 4C56A 4BFIB 1XT5A 1ACZA 1LO2L 3MBEC 3O41B 4DAGH 4JY5H 2IAMC 2VDQH 5JOFB 4BSVA 4X5WB 3B9KB 4HDIA 3QIUD 1OB1A 3HI5H 3WJLC 4ZUSA 5B39A 3O6FA 4NQDB 3AS1A 3JWOC 2UY7A 1A6WL 3P0VL 4GW1A 2FCBA 3L3HB 5T1KB 2PYEA 1RUAH 2H9GB 1DUZA 1SEBA 2KH2B 2WK2A 4N0UA 5DQJB 4F58H 3BZEA 1QO3A 3U1SH 1DQMH 5DGRA 1I9IL 3STLB 1YUHA 1N2RB 1KLGA 4CVZA 4R7DB 5ITFA 1CWVA 2GT9B 3TYGH 1IAMA 3W9EA 4X6CF 3MV8A 3VXTA 3LV3A 3V8CA 3RVVC 1TJGH 3MJGX 2BOCA 2DQCH 4EJ1C 1SJEA 3MRPB 1NBYA 4P4RA 2CR3A 2DBLL 1O7SA 3U4AA 4ZFFA 4EDXB 1SMOA 1WBYB 2VZ1A 1FL3A 4YDLB 1N6VA 2NY0D 1CFSA 3CUPA 4OSUL 5MHSD 4YHPB 4M6MH 3ZKQD 1HHGA 3H3KA 4TOYH 3G04B 4JFPA 5HSFA 4RRPA 3ARRA 1A2YB 3FOMA 1Q0XL 3KNBA 2BSRB 1T89C 1IM3A 4HDIB 2DQTH 3FONB 4YHZL 5D7IF 3M45A 3S3PA 5B39B 3O6FB 3TVMB 2EEDA 2M2DA 5CSZA 2IMNA 3SDXE 1TLKA 3IS0X 4KGLA 4XP6H 5T1KD 4ODHH 5E6YA 4NFDA 2PYEB 3O8XC 5JHDA 1I1AA 1WBXA 3MV7B 4MHHG 1CR9L 1QBBA 3BZEB 4UT7H 1QO3B 2NY7H 1B0RA 4KHXH 4X98B 5ITBH 1KGCE 1RK0A 1T7YA 3LKQA 3JV5A 1BM3L 3DVGA 2A6KB 5DVNA 1KLGB 5H35A 1JZ3A 4CVZB 5HYSG 2ZCHL 1KELL 2HP4A 4M4PA 3LN9A 1S3KL 4UDTA 1BJ1J 4YUEL 1SM3H 3DHJA 1B4JL 1R5IB 5DUML 3PJSA 4K94C 4ZYKA 3WV0A 2XICA 1AE6H 1SJEB 1F13A 4LPXA 1NBYB 4P4RB 2WBKA 4HS8H 1TCRA 3BPLB 5AZ2L 4ZFFB 1ZANH 2R23B 4F7TA 1JNLH 4Y4HA 4DFHA 1FL3B 3QIBD 5JMRA 3CUPB 1CFSB 5D7LE 3S36H 1RZKH 1RJLA 1CG9A 3BH9A 4XMKL 5GGSB 5IROA 5AEAA 4JFXB 1HHGB 4P2OB 4JFPB 3E6FA 3C5ZC 1GAFL 2XOTA 3MZGB 3SDYH 1N8ZA 2CJUL 3KNBB 5DJYB 5L2KB 1IM3B 2EDRA 3IAPA 5IMMB 5GS2H 3O6FD 3MLXH 3L5XL 2WUCL 1QFUH 4NBZB 1DBJL 5CSZB 3RGVB 1UEYA 3DROA 1QZ1A 4YK4B 1U8PA 4QXGL 1JWMB 4S1RH 5JMOC 4HK3J 2PYED 3MV7D 4W68A 4HLZH 1WBXB 4TUKH 5IBLD 4KK5D 3MRHB 1WK0A 3C6LC 3LKQB 5H35B 1YY8A 2R8SL 1GPOH 4TVPL 3BIAX 3BT2L 3MV8D 3FO1A 1TNNA 2UY6A 4DEPC 4UV7L 5GGTL 4U6YA 2R15A 2Y06H 4PJHF 4K23L 2FX7H 4BKLA 1TCRB 4JE4B 2D03L 4N0YH 4KV5E 4C56E 5F7WC 4NNYA 5F7EL 1O0VA 4HGKC 4OJFL 1INQA 1EUTA 1RJLB 2EXWD 3BH9B 4NKMA 4G80A 4GJTB 4P2OD 4OLWH 1A47A 1EO8L 1BF2A 1YC7A 3SCMC 5HHVH 3VGEA 5DS8A 5L2KD 3BRDA 2VUYA 1N8ZB 1MRCH 3BEVA 1T0PB 5FFLA 3SGDH 2AXFA 4N0UE 3LS4H 4LCCC 5CZVL 4NRZA 3DROB 2V5SA 3INUL 2CMRL 2JIXA 2YPVL 4PJ9A 3V6OA 3VG9C 2F54A 4PJAA 5I71B 2YKLL 3E3QE 1I1AD 1FV1A 2VE6A 1XGTB 2ICES 4ZUUA 3OF6A 3CSBA 4WWKA 3GO1L 1U95B 2PO6C 5GJSH 4WUUB 4FN0A 1T03L 5KVFL 2IBZX 4OF3A 3X11A 3VRIA 2FIRT 1O7VA 4OZHB 4K9EC 1YY8B 5IFAL 3QQ3B 4O00A 3P3YA 4Z78A 3WFBL 1B6UA 1MY7A 1XF5A 2DJUA 4JHZA 3CK0L 5C0ND 1UCBL 8FABA 4EZMA 5IEKB 4KTDL 4FABH 4S11A 1X5IA 3K8KA 5C8JA 4IIQB 1E4KA 4Y4HD 4NNYB 4GMSH 3QCTH 2VLKE 4XTRD 4M9PA 1INQB 1AFVL 2D7TL 4NKMB 4QGTA 2VLJB 1FFOA 2WUBH 1Z0MA 3AUVA 3CVIH 1FFNA 5ALCL 5EU6E 4EXPX 5D6DC 3GMOA 4F15C 3BEVB 4EOWH 5E99H 3EGSA 5JHDE 1KB5H 4JREC 5DRNB 1IQDA 4R8WH 3PF2A 1EFXB 4FQXA 2JIXB 1KN4H 4PJ9B 1ACYH 2F54B 5EBWA 3GBNH 4NC2B 5I1DB 1QR1A 1CGXA 1LO0L 1IGFL 4WUUD 1R3LA 2ZPKL 3O81A 2AEQH 3U4EA 4EBQL 5JZ7C 4CVXA 5EG6C 3O4OC 3UZQA 2HG5A 4CKVX 3VRIB 5JW3H 4H1LG 3UBXB 1KEGL 3ULVH 4Z78B 5TF0A 5HYIA 3OAZH 4BYHA 3BKMH 1DCLA 8FABB 2ITCA 3H3BC 1GC1C 25C8L 3HG1E 2NY1B 2DIAA 4OLUL 4QCIA 2AABH 5EOQL 3Q1SH 3BESR 2ZUQB 2X42A 2YUVA 4L8CB 4F9PA 2EYTA 4I13B 4NN6B 3MRJB 5E5RB 1BVLA 1GIGL 4KI5C 1YEGH 1TIUA 4IRZH 2XQBH 5CBEA 1FFOB 4Y16A 4M5ZL 3EYUH 1RAMA 1FFNB 2BSED 4GG6A 3GMOB 5E8EA 5TJWK 4JM4H 2ICEA 5DJ8A 1FNEB 2GQHA 4QYOA 4BSJA 5C0RH 5IW6B 3RI5K 1IQDB 2ADFL 3BZFA 1EFXD 1V8HA 1UC6A 3DRQA 5CMAB 3F6IA 2JIXD 4PJ9D 4FQXB 2F54D 3HUJF 4Q9QL 1DLHB 1G0XA 3HNTL 3C5JA 3TBWA 3OF6D 3G5XA 5AG9A 4WWKD 1QR1B 5F1OB 1R3LB 2DLTA 4CVXB 5D6CA 2YMXH 1UADC 4P3CL 4EIZC 4EI5C 5FGCE 3MBEA 3VA6A 3SE8H 5LBSH 3KPPA 3MZTA 3WN5B 2NY1D 3WJLA 2ITCB 5IJKC 4XBEL 4ZDHA 4IHOB 2AS5M 4K8RC 4RDQF 2WBJC 4MNGE 1LE5B 1PVHA 4XPTH 1NANH 5EUKA 3S34H 1A6AA 1CBVL 4L1DA 1S5IH 5DJZA 4DKFH 5FB8B 5CD3A 1JPSL 3BDYH 4Y16B 3X12A 3BYTA 5KAQF 5DA0B 4OD2A 4U1KA 2Z8WC 4U0RB 3B8SA 4UU9B 4PJAE 1FN4B 3NCCB 1NCAL 3EYOA 1MCCA 43CAA 4PJBF 4QYOB 4XP1H 4L8SB 2GTZB 3BZFB 3GHBL 3FRPG 1JRHH 4FQXD 3U9UA 2EH7L 4R90L 1TTGA 3C60A 1C1EH 3IFPA 3MYJA 3ORJA 1VGEH 3C5JB 3TBWB 1RJZB 3QFDA 2RIKA 4UILL 3LEVL 1BQLL 5ID0A 2JB6A 1JGVH 3NZHH 1D5XB 5FCUL 5D6CB 2HLFD 4ZS6C 3LQAL 5F1NA 3RVWD 5C0GA 1VFMA 3MBEB 2NX5A 2IAMB 2QADC 1KB9J 1M7DA 4JVPA 5CJ8A 3KPPB 4ZDHB 4KMTL 4JO1L 4YDJA 5TE7L 2IFGA 2B7DT 4KRMB 2V2WB 4DKAA 2WQ8A 3O6LL 1OPGH 2P5EA 4PLKD 3TBSB 5EUKB 3O8XA 2QHRH 4JVUA 4LMQI 2ZCLH 2V7NA 4FP8L 4XVUD 1JYVA 4UAOC 4KK9D 3LB6C 4Y16D 2QJDA 1N7MH 4YXHH 3X12B 3CLFH 3ET9F 1RIVH 4U1KB 2K7QA 5DD0H 5BO1H 1DQLL 1G0DA 1MQKH 4M93C 5T5NF 4AG4H 5HI3D 4YX2H 3EYOB 4E42A 43CAB 5HYJE 2DQFA 4P59H 2DQJL 5CBAB 1UWGL 4DN3L 2A74B 1YEJL 2UWEF 4LOUC 1U8JB 5GXBB 3QFDB 4YHYC 4Q9CA 5GS0L 4E0RA 3D18A 3GMNA 1S7SA 4KDTC 4LAQL 1T4KA 5MEPA 4LSDA 4Z0XA 5ID0B 3VFUA 2ZUSA 4YDKH 4KY1H 2MCPH 5F1NB 2GAZA 3MBED 4KRPC 4LDLB 1S9WB 4HAGA 1W72H 2NX5B 1EBPA 4RMSA 3SJVA 4CJ1A 3E8UL 3WDIA 1M7DB 3JWNC 5D5MA 5EUOF 1SEQL 3TF7C 4QO1A 2DQHL 3P4OA 1FG2A 1W0VB 3L3KB 2XWTA 5T3ZD 1IC4H 1KPRA 2DOCA 3TFKC 5JXAH 3UBXI 2P5EB 3ZDZE 3O8XB 5J0BA 3HI1B 1IKNC 5ESAA 3F12A 4GLRI 1PKOA 1RHFA 4FTVA 1C8PA 3T0EE 2IADA 3C6LA 4Z6AT 4TULL 1IEBA 4LSTH 4IS6B 3ZTNL 3ULUC 3KPMA 2DQFB 2DF3A 3NCMA 4IRSC 5BOZG 5FA4A 1B90A 1UB6A 1AR2A 5HDBF 5DJDB 2Z0BA 5IW1A 1PLGH 3HTLX 4P2YA 5I16B 3ISWA 3GMNB 2WLZA 5EU7C 1RZJL 1T4KB 4YIQA 5CGTA 5IB1B 5FUZL 4M03A 3O0RH 4OGXH 1VA9A 2GAZB 1DUYA 5EOTB 1FPTH 2V9TA 1S78C 5ENWA 1LK3L 3BRFA 4DW2L 3C5ZB 2AK4B 2NX5D 4RGNE 5DEFA 5MENA 4ZXBA 3BJ91 4JZOA 3SKOA 5D5MB 1QKZL 3IRZA 4OM0L 3IFNL 2VR5A 1AP2B 4LCCA 4WW2C 3CC5A 4PB0L 3G6AA 1FG2B 2XWTB 2P5ED 4F37F 5FGBC 1KPRB 1YYLL 3O8XD 3RWCA 3ULUF 1VKXA 1H15A 2P8LA 4Z7WE 4DOHE 3T3PE 2F5AL 1P4BL 4FTVB 1BP3B 3DNKA 1NMBH 2NZ9C 1IM9A 1LO2H 4MS8C 1Y18B 4WI3A 3C6LB 4LHJB 4LCYB 3BSZL 2FO4A 3BD5A 5T1MB 2PW1A 3KPMB 2UZYB 3D69A 2R1XA 3G6JF 3VWJA 5I1HL 1U9KA 2VITA 1UVQA 2DWDB 4DEPB 4Z76A 2JJWA 1F4YL 2N56A 4RIRA 1NAKH 5IW1B 3TZVC 1E28B 3QI9A 4LHQB 3V79C 2BVUA 4X7DC 3I84A 3GSWB 5MERA 5JIPA 2WV3A 1I3GH 3PWLA 3MLZL 1MF2L 4N8VG 4YIQB 2NYYC 2Y6SC 1WV7T 4FFYH 3HRPA 2AK4D 3SCMB 3SJVD 1IARB 1KC5H 1PX4A 2G5BA 4MDIB 2DLEA 4LLQA 4B53A 3VXRA 4JZOB 4X6DE 2J8UA 4AIXA 4NZUH 4LCCB 3CC5B 3RVXC 3KLAA 3UEZA 3ZT5A 5B8CC 1CU4L 3UTPE 4KJWC 1FCGA 1F02I 4PYHA 3VG9B 3S96A 1VKXB 5HDQH 2DQDL 2BMKA 3MRKA 4FTVD 5FHAL 4ODUA 2PO6B 3ZL4L 4UB0L 3C6LD 2YD4A 5GGVL 1DQTA 5I19H 2A9ML 2OLDA 2MKWA 3VH8A 2FO4B 5I76A 2PW1B 3GMRB 4TNWK 3O9WC 2DMBA 3D69B 1S7WB 2R1XB 2E7BA 3BWAA 2VITB 1W8NA 4HKXA 4RIRB 4PV8A 5DWUL 1AQKL 1ES0A 2Q20A 4I48A 5MERB 1A7QL 3PWLB 3WBDA 4APQC 3GGWA 4KDWA 3HR6A 1BM3H 5CHNB 1WCBA 3QT2A 4NBYB 1JN6A 1KELH 1KF9B 4LEOB 3W81A 4ZXBD 5C09E 5MEND 2G5BB 4XZUA 1B2WL 2Q7YA 2EDTA 4F15B 2J8UB 1WSST 3H7BB 1NLDL 4JN1L 3CU1A 4I18C 1TVHB 2DLIA 4JREB 3T0VA 3UC0H 1GGBH 3O11A 1NUDA 3HMXL 1XF1A 3WFCL 5KN5A 5L9DL 4WEBL 1CQYA 2QQNH 2V9RA 3CXDL 1MFEH 2X40A 4PJ8C 2ZSWB 2PR4L 5ALBH 3LAFA 3MR9B 2BMKB 4JRYE 2IC2A 4OCSL 4PRDA 1HHHA 2PO6D 4L29A 4U7KA 1QACA 2HJFB 3NPSC 5SV4A 2PKDA 15C8L 4FFZH 1I85C 5GRYA 5C2UB 4YDVA 4ZOCA 3O4OB 1LHZA 3WE6A 3VH8B 3HUJB 4LLMA 4EI5A 3VWJD 1F6AA 3E1F1 1EEZA 4HIHA 3QXVA 4P23C 4AZ8A 1OT2A 1NGPL 32C2A 3QI9D 4HKXB 2ZUTA 4PV9A 5BW7C 5IJKA 5MI0C 4JHBA 3EZ8A 4FXGB 1ES0B 1K4CA 2AJUH 2WBJA 4I48B 4NUGH 3MXWL 4JFFA 5IQ9A 3U7AA 1P84J 2PTTB 5D7SL 1XZ0A 3GGWB 5KZCB 5J3HC 2DICA 2QSVA 5GS2D 2CK0L 4LQFL 1KUMA 2KDGA 1AD9B 2F53B 2BVTA 2NMSA 3VXRD 4AEIH 5BOPA 2Q7YB 2WW8A 1RU9H 3U36A 3FQWB 1UGNA 2FX8L 1P6AB 1I7RB 2DDQH 4IOIB 5KW9H 3IDXH 2PETA 3VXSA 1W0WB 5BZWA 1WZKA 3IT8D 3KDMA 5F7NC 4OZIA 2X4TB 1JZ4A 4EUPA 1HHHB 2X5PA 5E8NA 3VFTA 4PJBB 1GOGA 2VOTA 4YDVB 5FDWB 2CRIA 4GUPA 4EI5B 4LLMB 3EO1A 2CDGA 2Z93A 1AD0A 5DJAA 5KS9F 1KENH 3ZKSD 3SQBA 3VD4A 3QCUL 4PV9B 2YKLH 1R6VA 1KIUA 2QSQA 2HN7A 2Q3ZA 1K4CB 3A67L 4FFVC 5FYLH 2WBJB 5IB2A 4KI5D 4JFFB 5IQ9B 2FECL 5KZCD 1T03H 2JF1A 1AXTL 5HXMA 1IBGH 4R4FH 2QEJA 4QHMA 4KTEL 3C8KB 1HIML 4LGSB 1ZLVH 4LSSL 2KQMA 3U6RA 3RUGF 3U36B 2MQ0A 2UUDH 1BAFL 5BZWB 4ONHB 4U31A 4E9LA 5J11C 5DSCA 3A6CH 4PJGA 4OZIB 4EUPB 4KDTA 1AFVH 4ZSOB 5E8NB 2JLLA 3GMPB 1LILA 4MXWL 4EI5D 4LSVH 1OP3K 5FV2A 4GUPB 3NIGE 1UM6L 4I77L 3R8QA 2CDGB 2VXQH 1AD0B 2GHWB 2QADB 5DJAB 4WJ5B 2BNRA 1A6ZA 3M07A 1NAMH 4D8PB 1FBIL 4B41A 3NCYS 4K8RD 5GRZA 2CIKA 1IGFH 2WBJD 5AD0A 1QSFE 4ZQKB 1BFOA 5DRWA 4JFFD 4LPTA 3MRMA 5IB2B 4Y5VC 4JVWA 4PFEA 4EBQH 4BFEA 1CXEA 5K9KA 3SKNA 1X4ZA 4UOW1 4UAOB 4WTWA 3QO0B 3KPLB 5EA0H 1OP9A 4MJIA 2B39A 1AI1L 4DGVH 4KZEL 5CINH 3V4VL 5LXGH 3P2TA 3MRDA 4NNPL 4HK3N 4LCUA 3DGGA 3MGTA 4U6HB 1ZHBA 2DTSA 3U6RB 4M93B 2OS7A 4MCZA 4HFWA 3PDOB 1JJUA 1HNGA 3K2MC 3BN9C 4IRSA 4LSPH 4RNRB 3DV4A 1AC0A 3VXSD 4MB3A 4URTB 1NSNL 4XC3H 4NQVA 4O2CB 4PJGB 3DBXA 1JVKA 1QYGH 4RAUB 1BVZA 4MMZC 4YHYB 3ULVD 5E6IC 4WEUD 2FYYA 5DMIH 3K2UL 4CRPA 5DTFA 5JO5A 3MREA 2XZAL 1FLRH 4ZS6D 3P30H 2Q8AL 2XA8H 1IGIH 5CUSH 3MOAH 1FIGH 4KRPB 5D2NC 1CT8A 1MCLA 1T7VA 5HHME 3IDIA 4ELKA 3IDJA 2YN5A 4G7YL 2ESVE 2BNRB 3FQTA 1MJ7H 3V0VB 1FO0L 4WW2A 2BSTA 3MLWH 2E8YA 4O5LL 4C83B 4U6VH 5DRWB 3MRMB 4IDJH 1ETZA 1KN2H 1KFAH 3LB6D 1BIIA 3SKNB 2BXZA 2A83A 1MWAB 3BO8A 1I3VA 4X9IA 4JFDA 3DO7B 5CCKL 3GSQB 4H25A 2R1WA 3CSYA 4N90D 5C2BL 4BZ2H 3MRDB 2K7PA 2P46B 4NJAH 3DGGB 1EAPB 4NQUA 2OXGA 1JNJA 4MCZB 3HLAB 4HFWB 3HE6C 4IRSB 4PR5A 3VFSA 3F65A 1JYXA 2H6PA 3DV4B 1FGVH 1CF8L 4OBRA 4J3VA 1OWWA 3TZVA 3CU7A 3L3JA 4LOUD 1RUPH 3HPLA 3DBXB 1FRGL 3GSNA 2FL5A 3VI4E 4JCMA 1MFDH 2MTPA 1N6QH 1ZVYA 4QHKI 4KQ4L 2FYYB 1W72A 3CPLA 3W11C 1A7RH 1HQRA 5DTFB 3T65B 5FAAA 2IANB 4KRPD 4AQOA 4DKDC 1WJ3A 3OJ2C 4NSKA 4GRMA 4J4PC 1CZ8L 1JZ2A 2JE8A 3IDIB 5LCVH 3IDJB 2WAHA 2BNRD 3GUTA 4PRPE 3FQTB 3QR2A 3LRSB 4WW2B 3GRWA 2APTA 5B8CA 3TFKD 3O3EA 2D4FA 1XF4A 4PY7B 2HKFL 3QXWA 1ETZB 2WANA 5DC0A 1BIIB 4HMDA 4HCRL 2A83B 2NLJA 3BO8B 3ARVA 1CGVA 1DL7L 2RBLA 1EMTH 4AIZB 2LVCA 4HXBL 1J7VR 4IRSD 4UUJA 2MPAH 3VFSB 2V5YA 3KPSB 4RFOL 3RWHA 3JUZA 1P7KA 2ZG3A 3MRBB 2JELL 1YNKH 3TZVB 3L3JB 4XCCH 3CAFA 4M43L 3T1FA 2W0PA 1C5CL 3GSNB 4XXCC 5GSVB 5FM5O 2AI0H 1OP5H 3NCFB 5T3XD 3QUML 3S5LA 3KPRE 2ZKHL 2IAND 5D72H 3UJJH 1S78D 4JANA 3D39A 1YECL 3QYCA 1T7ZA 4GRMB 3TIEB 1MH5A 2AKRA 4XAWH 1WTGT 1RZFH 2DQJH 3H42L 3H9SA 4KKBC 4KPHH 5E8DH 4I18A 1A22B 2W9DH 3VFGL 1HWGB 4N1EA 3PXHA 3QUYC 4N9GA 3C8DA 5B8CB 5C0FA 4PG2C 4UT6H 2NQCA 1NGXB 1XF4B 1UWEL 4ZODA 5HYQA 3UPAA 1R3JB 4PJXE 3KPNA 1F3JA 2DKUA 3FMGH 2NLJB 1CLZH 1NMAH 2APFA 4JFDD 4MS8D 2DLHA 4PJ5E 4ONFL 1BVKA 3DVIA 1P4IH 3O9WB 1MJ8H 1T0MB 4P2RE 1CD1A 4P23A 2C3GA 3BW9A 3TZVD 1RK1A 1P7KB 5BW7A 3BAEH 2H1PL 4G9FE 4ZOAA 2HRPL 4FG6C 1FGNH 3I6LD 3UXFA 4TSCL 4OCLC 3VWKC 3JV6B 3QEQA 4JRXA 4QTHB 3VFRB 4OD3H 2NYYD 4APQB 1QHPA 5FUCC 5I1CL 1ZT4B 1BD2A 4JANB 3ZKND 3SGKC 1XIWC 4ZNEE 1MH5B 2AKRB 3OZ9H 3U7YH 4I8DA 4MQXC 2ADJA 3H9SB 5AUMA 3U30C 3WHE0 3A6BH 43C9B 4I18B 4M8QA 2A6DA 3RVXD 4JKPH 4XP5H 4NO5A 5LVEA 4N9GB 2KPNA 3LQAC 2AJYL 1G9EA 1BQHA 4PJ8B 1RZJH 3QCVL 1UWXK 3IYLW 5HYQB 4ZFZA 4BZ1H 3OL2A 3PQYA 1ADQL 1L6XA 5SWZE 5GGQH 5HHPA 3ARQA 3NPSB 1DBML 1NANI 4PIRF 3SN6N 1C16B 3ARDA 5IHUH 2MNUA 4TVSa 2VNCA 3VI3E 1BVKB 1A7NL 1BX2B 4YHMH 1CDIA 1IT9L 1I3RA 3IFNH 1VEOA 4ODSH 5IBUG 1CD1B 4F2MA 4P23B 2YSSB 2H8PB 2ZUUA 1RK1B 5MI0B 4MB4A 3DX8A 4OZGF 2Q76B 3GNMH 3DXAE 1LEGB 2ED7A 5C9KA 3SDDC 2VSCA 1F5WA 1G7MA 4HBCL 1N26A 2VDKH 3LS5H 4Y88A 5KS9B 3B3IB 1C5DA 1EVTC 3D39D 4AEFA 1BD2B 3ZHLA 2NR6C 4JPVL 3S88L 1KB9K 2O5XL 5DMGC 3UYOD 1MJUH 2OR9H 3H9SD 3C6SB 3ETBF 1T66C 5GS0C 2ADJB 2YD1A 5EZOL 4CADB 1YQVH 4N1CA 2FGWL 4HF5L 4QXTB 3KR3H 1CK0H 4H5SA 1CDYA 3WIHH 1IEHA 4M8QB 2A6DB 1X5XA 4NO5B 4NQDE 5EWIL 4LGPB 1NCUA 4YXLL 4R2GD 4PJ8D 3CNKA 1B0GA 1BQHB 2VDOL 3B9VA 3GIZH 4AENA 4G5ZH 4ZFZB 2V17H 4EKXA 5IV2A 4D9QD 2G5RA 3P4NB 3QWOA 2V9QA 2OSLA 1R3KA 2VWEC 1I3RB 4MVBD 3RY4A 1AQDA 3HKFA 1ONQA 4P23D 2XTLA 1MRFH 5E4EC 3HZVB 3GFUA 4WV1C 2R9HD 1MFBH 1D7FA 5F8RC 3BEWB 4FMFA 3QEQD 4R96A 1YY9D 4JRXD 4K7PL 5EC2A 3ROLA 1WIUA 2OMNA 4DGIL 5J3HD 2CRZA 1BD2D 1C5DB 5GGTA 1Z6JT 1KCUL 5D7KE 5ANMA 5CLTA 2OTWA 2RR3A 3BIBX 4U1GC 1GCFA 3VGHA 3I2CL 5TFSL 4KJQC 2BVOA 1RZJC 5TH2A 4P49A 1W0YT 4S1QH 3CFCH 3LPFA 4UIKL 35C8H 1A7QH 2QBWA 5J11B 5HHXH 4AENB 2X9XA 4JAMA 3DI3B 3PQYD 5HVFB 1MOEA 4R7NB 4TNVF 5IV2B 5E6IA 2OJZL 5CJQL 4HJJL 2HH0L 3NCYP 4K55A 3RZWA 3ARDD 3QWOB 2FIKA 3IJSB 3TBVA 1ZVSA 2OSLB 5D2NA 5IVXF 4Y4KA 1FZJA 1PY4A 3IFLL 4DTGH 4KMLB 3VD5A 3WYRA 5I1KL 5C86A 5KJRH 5DHVB 5BV7H 1ONQB 4MA8H 3ESVF 4TUJA 2H2PD 3AU1A 1RURL 5EORL 3F62A 2ZG1A 3GBML 4NRYA 2O61B 1Z3GL 3FN3A 4OCSH 4PRHE 4KRLB 3KYKL 4OGAC 4CNIB 3WIIH 2VDRL 4UV4L 4Y5VB 4HUWB 5EC2B 3V6FA 4POZC 5C08A 3FQXA 3T2PA 3IETB 3N85H 3V95A 1RUKL 3HE7C 3FN0L 3HNSH 3ALPA 2OTWB 3LDBC 2XQYK 3V7AE 3GI8L 2BVOB 5L2KE 3HS0A 5ESVA 3LEYL 3MJ6A 4HC1L 1E0OB 2ZSVA 1VPOL 4CVWA 5GGSY 2FD6H 3AREC 3MXWH 1UXWA 2XT1B 3CFDB 4JAMB 5D7SH 1NFDA 5BVJA 3PP3H 4M7JL 1FCCA 5SWSB 1R0AL 1G6RH 5E6IB 4HPOH 1HWHB 1UA6L 2C1OA 3TBVB 1W2KT 1GH7A 1ZVSB 3T2NH 5D2NB 3ECBA 4NQSB 1UM4H 3OKMB 3BQUC 2KKQA 3W9DA 3EYSH 5L8LB 4J4PA 2NY6D 3QDME 4RWHA 3RY5A 4WU7B 1YDPA 3DVNA 3CSPA 4LHUB 4TUJB 3RU8L 5DD5H 1I9RL 4R0LA 4Y5YC 3AU1B 2AGJL 1MPAL 1L7TL 4Z8FL 3PNWB 4AM0B 3I85A 2JB5H 4TVPD 1K8IB 2APVA 4PJ7A 5GGRY 4L5FL 1CI5A 4XBPA 3BP4A 1U8OA 2PNDA 5C08B 1TCMA 3FQXB 3O2VL 1XR8A 4C4KO 3R1GH 4LIQE 2ZCKL 3HI6H 3RIFF 3UPCA 5J6GA 1HILA 4U1HB 4FQ1L 4XAKE 2VLMD 4W6WB 3ZDYE 3MRQA 1LO3L 3OTTA 4YFLF 2P47B 2HMIC 3HS0B 4LP5A 2CO6B 3BN9D 1KOAA 5K9OA 1DSFL 2ZSVB 4F7MA 1G7PA 3HE6B 1KJ3H 2X7LB 3JV4A 2D0HA 2I07A 3A67H 2ATKB 1T2XA 5D8JL 1UXWB 1MHHB 4K2UH 3U48A 3OXSA 5SWSD 4XXCA 1NFDB 2Y23A 2VL5B 2J1KA 3QDGE 4L1HA 5E6ID 3ROOA 1ZTXH 5FKPA 1WZ1H 2Q8BL 4WUUE 5ADPL 4PJDF 4AMKL 4OTXL 4Y4KD 4GW4A 1QFWH 3ECBB 5M7QA 2W9EH 4OZHE 2BNQA 2C3HA 4YHNA 3MLYL 1YDPB 1WEJH 3DVNB 4HIIA 4LHUD 3UDWC 2F8OA 4PUBL 2R4RL 4QWWC 5D2LA 3QUYA 5L7XL 5ANME 5JR1H 5HHQA 3OKEA 3M17A 1XGRA 1OQOA 5C08D 2FBJL 1OCWH 1QFPA 2P49B 2V6HA 3BP4B 4XMPL 1S9XA 1XR8B 2BRRL 4YZFF 3V5KB 3IFOA 2ZG2A 4GAJH 5JIIA 5L8KB 1OTSC 5F3BA 1HILB 2VLJE 1KSRA 2F58H 4XNYL 2Y4SA 3MRQB 4KZDL 1LEIB 2Q86B 4OLZH 4K3DL 3WKMH 3DX9B 5K9OB 1YC8A 4F7MB 3GM8A 5DXWA 3WLWD 3ILQC 4JFQA 1LD9B 3NFNA 2I07B 1DN2A 1CGSL 3KHOA 3L5WB 3I50H 4EVNB 1Y0LA 1P7HL 3FCTA 3OXSB 3V5HB 3VWKA 2L7UA 3ROOB 3W11D 5FKPB 2JCCA 4H1LH 2X9WA 2EE6A 5FYLE 4JO2L 3HC4H 2B5IC 2HYMA 3MA9L 2XKUA 3QDAA 3EOTH 4GW4B 3S6CA 4F9LA 4J4PD 3SGKA 4A6YL 1DP0A 1IFHL 2BNQB 5F1SA 4YHNB 3OAZK 4HIIB 3SBWC 1CLYL 4YHLL 3Q6GL 3RL2A 4LRNL 5D2LB 4DKEH 3QUYB 4KQ3H 5J56B 1P84K 3M1BA 4M6OH 5HHQB 4XVTH 5IMLB 3K2UH 2BDNH 2XZAH 1M71B 1S9XB 4HMEA 1X5LA 3IFOB 5F3BB 1NDGA 4QHUA 4GMTH 3IVKA 3UTZA 1MELA 2D9CA 2DLFL 1KACB 5SX4H 2P44B 3GI9H 4HG4K 1RUMH 4WFHD 3NFSL 1Y0LB 1CXFA 3FCTB 1NEZA 4DZBA 3VWKB 4XMLH 1KEML 4WFED 2BOBB 1RZ8A 2XXCB 3MUY1 1A6UL 3OKKA 5DLMH 3VMOA 3A6OA 3BN3B 1N5YH 4HGWB 1TDQA 2BNQD 4OZGB 1H3VA 1XIWB 3L7FA 4X7FC 1VGKA 2ADIB 2FR4A 2YOCA 5HI4C 1SVZA 5DD3H 4NPYB 3IDNA 1NGYA 3QBTB 3U30B 1NGWA 1M1SA 4PJ7E 5B3JF 1RY7B 1MFAH 5F72S 3QUYD 1KPUA 5JUEH 3MRNB 4Z7QE 1JL8A 4MXQC 1T2QL 2BVQA 3FFCA 4G43A 4JM2A 1A02N 5DQ9A 4GKOA 3SY0A 1OAQH 2X4UA 3GK8L 1YEFH 1NDGB 4QHUB 2BY2A 3V4UH 4KUZH 4JFHE 1NH6A 1WLHA 5DUBA 1PG7L 5ICZA 1WC7B 3F7YA 1A4JA 1DN0A 2BC4B 4FG6D 1JWSA 1KJ2L 3AM8C 4HHAB 4OT1L 3JTTA 1S7VA 3ARFA 3VWKD 1NCWL 1NEZB 4DZBB 3TIDA 4G8FB 4FXKB 1BQSA 4OCWL 3EO9H 2PW2A 4GG8B 3SDDB 3OGOE 5DQDL 2YD2A 3NACH 4RMUA 4KVCL 5L2JB 1EX0A 1WAAA 4X6CE 3GB7B 4RISL 4P3WA 1YEHL 1U3YA 3QIWC 5KG9A 5E1AA 1QBMH 3L7FB 3O6MH 3QUXC 1VGKB 4MQXD 2FR4B 4JDTL 1FNFA 4J3WA 3PHOA 1ZEAH 1XGQA 1NGYB 4JPWH 3OKYA 2BJMH 3ES6A 4HQQH 4MX7A 1INDL 4NC0B 4F7PB 4PJCF 1KPUB 2ARJQ 5EU4A 3IXAA 5D7JC 3HB3C 5L88L 1C5BH 5HGDA 5J13C 4YJZL 3FFCB 3F7PC 3QWRA 4HUXB 2VDPL 5DQ9B 3I6GA 4Z7UA 1G7LA 5AG8A 5JW4M 1KTRL 3SY0B 3PWPB 2X4UB 5D7IE 5ERWA 3RWIA 4G6AC 3AXLA 5INCA 3REWB 1IAIL 5JNYB 5ICZB 3VFGH 3P0GB 3F7YB 3H9ZA 2RCSH 3F7RA 5E4EB 1A1NA 1DN0B 2D31A 2JCCE 4Q74A 5CWSB 1YZZA 1KIPB 2E6QA 2LU7A 4LPCA 3OR6B 4WV1B 3WUZA 1S7VB 3JTTB 1QRNB 2P5WB 4EQ3A 5IVXB 4LLWB 2X4NB 3GJEA 2UVEA 4KKAC 2XQYG 3TPUA 4QY8A 4QXWA 2NR6D 2J8HA 3TT1L 2DI8A 3WDJA 5JQ6L 3CX5J 1T22B 3HE7A 3DYPA 1KCSL 5DMGD 2RGSA 3QNZA 4U1GB 1T66D 2BCKA 5GS0D 4HH9A 4U1IB 1XGQB 3DTXA 5EO1A 1DLFL 3ES6B 5GRUL 3RVTC 1RIUL 4MX7B 3S35L 3W5MA 1F4WH 5EU4B 3O3DA 3WS3A 3F58L 2YK1L 3SGEI 2AW2A 5HGDB 3AREA 4LAJH 3FFCD 4JM2D 5DJ0A 1SBSH 3I6GB 4Z7UB 1JZ6A 1G7LB 4GXUN 4NJ9H 3PWPD 2CXGA 1A7PL 5E5UB 5L9DH 1FQ9C 4JLRA 3QZWG 1HCVA 4MSWA 4ODWA 2OCFD 3VXOA 3RWIB 3AXLB 2ENYA 4QHKJ 1TVDA 4AT6A 2JKXA 4YAQA 4YR6A 1WFTA 1DEDA 3VU2A 4E41E 5JW4R 4Y5XC 1YYML 1A1NB 2D31B 2DQGH 4LDOB 5EPMB 3UTOA 4XCFH 2D7OA 4MD0B 3ARFD 3IKKA 1TZHB 2VB5A 1CL7L 1P6FA 2XTJC 2Y07H 4KROC 4L3AA 1XCTA 1KYOJ 4ODTL 4QXUH 1IAKA 3OAUH 3FJTA 3GJEB 1R5WB 4QY8B 1DE4A 4M6NL 3HE7B 3WO4C 1L0YA 1ZS8A 3LDBB 3KG5A 4LU5H 2CDEA 4R4NC 5FM4A 5FYKU 2AK4E 3FQNA 4P3DB 2BCKB 4KHTH 2HTKC 4KJQD 4Z5RA 3MOBL 4U7MA 4PJHE 2B4CL 4R3SB 2EIZA 5AWNH 3DTXB 2W60B 2K9UA 1KJMB 2EDKA 3NAAL 4RGOH 3WS3B 5DZNA 3D3VA 1UCTA 3WXVL 3AREB 3HNVL 4I0KA 3QWRD 1KTDA 1YMME 5DJ0B 4PRIB 4PS4H 3V2AR 4KK6C 2O5XH 4JLRB 4M48H 3HMXA 4MSWB 4ODWB 1PEWA 5ADOL 1V05A 2R69L 3DSFL 5LWYL 2C4FT 4YR6B 4DVRH 3DURA 3W2DH 1LDSA 5EWIH 3CMOH 4OLEA 1HHJA 2DQEH 4Y5YB 4F33A 2YUWA 4UT9L 2VRAA 4XXDA 4PJDB 2ZWLT 2O5ZL 4OGAD 5E8OB 2VN4A 2YPLA 1ZA3A 4ZD3H 1AGBA 3RA7H 3BDXA 4HWZB 1DANU 3DETC 2DM4A 4XNZC 5EB9A 3VXNA 2DWEA 4XC1L 3HE7D 1DE4B 3OJMB 4PRAB 5IGXH 2AP2A 3ZYJA 3QA3A 3GSRA 4ORGA 4LNRA 2CDEB 4TUOA 3FQNB 2P45B 1Q0YL 1OM3L 2EIZB 1K8DB 4Z7VF 4O4YL 4NKIL 4NYLA 5CEXB 3P9WB 2P7TA 4U2ZA 2XN9E 5I1JL 1G6RA 5FYKH 3ARED 4M02A 3BH8A 3FAXA 3FT3A 1L9MA 5IW3A 3IXTA 2XWJA 5TGBA 4KJPC 1QLRA 2BHUA 4KDVA 1PJ9A 4RQQA 4XP9H 3SKUD 5BV7B 3I3BA 2GSIA 1F97A 4X7SH 5J4MA 2NXYC 1ORQA 3GSVB 1KT2A 2EZ0D 4C54A 1F11A 3DURB 1MFCL 3LKPB 5EZIH 3VXQB 2OQJA 2DB8A 1PZ5A 4XCYA 1HHJB 2R56L 1EZVX 1H8NA 1I9JH 5JIKA 1QEWA 4LNVA 4XXDB 2VC2L 1HH6A 4PB9L 3WNPA 1ZA3B 1AGBB 3D25A 2R2EA 3G9AB 3MBXH 3LSOA 4OUUB 5F96H 2ZOKB 1QA9A 5LQBL 2HA1A 2DWEB 1CVSC 2G60H 1MNUH 3IFLH 4ORGB 5GRWA 4LNRB 5C7XL 4CL7A 5FGSA 3NA9H 1NDMA 4Y8AA 5HPMA 1RUQL 4OUOA 1RURH 2P1YA 2CGRL 1U3HA 4JFEB 4W70A 5CIPH 3BGFC 3D3VD 5CEZH 3MLUL 1VESA 2VDRH 3BH8B 4KVNH 4GBXC 3FT3B 5C71A 1A8JH 3IXTB 4TPRL 1PY9A 2HFEA 2J4WL 4H8WH 1KCLA 1DEEA 1T21B 4HPYH 4QRQA 3MLTA 4RQQB 3IKCA 4RA0C 2Z8SA 2GSIB 3EKCA 1N0XH 2B5IB 4OAWA 4WEMB 1FJ1A 3HUJE 1A7BA 3P9LB 1F11B 2VXVH 1R3IL 2OQJB 2PN5A 2W0FA 4NZJA 4GQ9L 4N8CL 4PRNB 5I1EL 4QWWD 3EJJX 1QEWB 2YPLD 2ILLA 3IJHA 3FKUS 1OAYH 3U7WL 1WWCA 2ZOLB 2VISA 1F4XH 2HFGL 1YNLL 5H37G 5HGAB 3O2DH 4PGBA 5KOVC 2AJVL 1QA9B 2DTMH 1QQDA 4EN3C 1SJXA 5FO9A 2X09A 4ELMF 3KYOB 1OTSD 2NY2D 1J1PL 3WJJC 1G9NL 5HHNA 2EDYA 3BGMB 2OBGA 2F53E 3MUGB 1I9RH 3X3GL 1AIFB 1EO7A 5E9DE 4XNUH 1IKFH 2YWYA 5DC9B 2B0SL 4C55A 3L3GA 5CD5C 4H1LA 4YFDB 3P4MB 3V0AC 1CFVH 3B5GA 3LN4B 2XZQL 4ONGH 3ELAT 4DN4L 5BJTA 1DEEB 4QRQB 3MLTB 1G7JA 4D0CA 3IKCB 2OK0H 4RZCA 4PJBE 1A3LL 4OAWB 2IBBA 5C07A 3VD3A 3QIWA 4LGRB 5F6HI 3QUXA 4XGZB 3MLVL 1FZMA 5ILTH 1T6VN 4WI4A 4X6FA 3T0DA 3OWEA 3QHFH 1BECA 1I1YA 3IJHB 4QHLA 5LGJA 4FZ8H 3W5NA 3DUHA 4QGYA 1SYVA 2VDML 4M1DH 4M7LL 1NL0L 1V3KA 1QQDB 1LDPL 1C12A 3IAGC 2E27L 1ZLVK 1MIMH 4GAGL 5E2UL 3N50A 1NC4A 4PJCB 3NN8A 5HHNB 3CLEH 2HWZL 5JXEA 5JW5B 5JORA 2Q3AA 2X9YA 1U3HD 2YWZA 2BY1A 3MUHL 2OZ4H 2R4SL 1RHHA 2UUDK 2XA3A 5DF0A 3TNMB 4HMCA 4ZFGH 5JOPD 3L3GB 2P8MA 2FGZA 3B6SA 5D1XC 4NWUH 2BRRH 1MEXH 5DRZA 1J0JA 2NY5H 4ZSOE 4D0CB 3MRGB 1CDHA 4L3EA 2AXHA 1EGJH 4G9DB 4HD9A 3QIWB 3WLBA 2A0LC 4CBPA 5I15L 1J8HE 3QUXB 1FZMB 2UWEE 5B3NA 2FHFA 3SQOH 3I3DA 3HAEB 2F9BT 5E2TL 1HINL 5D7JB 5CKAA 3VRJA 5IIEA 1I1YB 2LAAA 4MXQD 2DRUA 5LGJB 3HFMH 5J13B 1SJHA 3KS0H 4OCRL 1BBJA 5E2VL 3TBYB 5A2FA 5CAYB 3FRPA 2BNUA 4NHCH 1VFUA 2X4RA 5DD1L 4KTYA 1OSPH 4WW1A 5FK9A 5F9JA 1D3CA 1FO0B 4QNPF 2HT4C 3LIZH 5EUOE 1IQWH 3ZDXF 1S9VA 5JORB 5KSBF 2WINA 3S37H 4QRPA 1RHHB 4HCRA 5IF0B 2OR7A 2P8MB 3MODL 2IQ9L 4JQVA 4NHUB 3VMNA 5C3LD 4MNQA 3LPGA 1HQ4B 2FEEL 4I1NB 5DRZB 5JQHC 1UACH 4WI9A 2F5BL 5HDLA 1FVEA 3GSOA 4L3EB 5C07D 3QIWD 3QEHB 2VQ1A 5HDBE 2DJSA 3P0YH 3QUXD 4GKSA 3GMMB 1IGCH 1MI5A 1NCCH 3OKLA 1KTLB 3CZFA 5CEYA 3WS6C 2MOVA 5GIRA 3QUMA 4N0CC 1RSFA 1A14H 3VRJB 5HVWA 3F8UB 4JQIH 4K3JL 1PG7X 2VXTH 3EFFB 4DAGL 1GZPA 3NFPA 4JY5L 4K3HA 2VDQL 2VAAB 2DJ4A 4Z7OF 2BNUB 2EDQA 5B39G 3U2SB 1NC4D 3HI5L 1F6LL 3D85B 3HRZA 4L8BA 3U0WH 5CJOH 1S9VB 1S7RA 2NW3A 3GZKA 1KIRA 2WINB 1H3PH 3ULUE 1RUAL 3FRUA 4BUHA 1HOCA 2VH5H 3SO3C 4B5EA 2I26N 4Y5XB 3FO9B 4U1JB 4PJFA 3U1SL 2C1PA 3WHXA 1DQML 4MMXC 1X44A 1ZSDA 4ZPTA 5HHOE 1N6UA 2XTJB 1LO5A 4MNQB 4KROB 3OB8A 2FECI 1K4DA 3TYGL 4KKAD 2I60H 5C6TH 4L3ED 5EO9A 5DD6A 3UTQA 3NZ8A 3G6JE 2B1HH 3D9AH 1K9TA 1L9NA 3WO4B 2VQ1B 1TJGL 1NKOA 1IZJA 4GKSB 3ZYIA 5AZEH 2DQCL 4N68A 1MI5B 4CDGC 3OKLB 1P5UA 4GT7A 2YD3A 2VZVA 5GIRB 3RVTD 3QUMB 2JJSC 1KJ2H 5HVGB 1WUNT 2HTLC 1M4KA 2R0ZL 4JN2B 3V7AG 3DHMA 3FQRB 1I4FA 3S9DB 4M6ML 4RA3A 3QSKB 4TOYL 4RRPG 5ICYA 1AXSB 1GZPB 3NFPB 3OKNA 3QRGH 2DQTL 3KLSA 4PGDA 1ODAA 1OTTC 4X7EC 5J1AB 1ZGLA 1JHLH 2P8PA 3SDAC 4Z77A 5J89A 4XCEA 3CFKA 1S7RB 4N0RA 4LKXB 3MJ8A 4ODHL 1PSKH 5IM7A 4QRPD 4P5TC 4ZOBA 1HOCB 2BP3A 1ADQA 4UT7L 5EU3B 5TDOB 2NY7L 4KHXL 3VDCA 2OP4H 3FTGB 4PJFB 5FOJA 3DMMC 3WHXB 3KPSE 1ZSDB 2XTJD 4X5XA 3EZJB 4GRWB 3GJFH 4MNQD 4KROD 1OP5K 2EKJA 1LO5B 5HY9B 3L1OH 1K4DB 5EBLA 5H8DA 4YHKH 3VGAC 3S35X 4XNZB 4OB5H 5EO9B 5IBTH 3NZ8B 1EXUA 2IFFH 1CD0A 5ESQA 2X4SB 3B2UC 4R4ND 5E6ZA 5D1QA 1MI5D 2AJ3A 1AE6L 1XGPB 3ESUF 4HS8L 4S0SD 4WCYH 5KANI 3AGVA 1ZANL 3DOSA 5GS3A 2VABA 1NLBH 2R1YA 1JNLL 5HDOA 5DHYA 4WFFD 4UOW0 3UJIH 1JPFA 3S36L 3SDCC 2ZUXA 1RZKL 1I4FB 4GBXA 2ICWB 1JF1A 1PX3A 5J7CC 1TMCB 3PGFH 5C0BB 4HWEL 1KCRH 1WWWX 3SDYL 3OKNB 4KK6D 1AR1C 4AH2A 3MLXL 5EIIB 5BS0A 3TO4C 1QFUL 1ZGLB 2P8PB 4Z77B 2Z35A 3MUZ1 4XCEB 3CFKB 4WY7H 4FQCH 2NXYB 3GM0A 3MJ8B 4S1RL 2RFXA 4N8VA 3DX6B 5M95B 4TUKL 2QSTA 2NY0C 4B7IA 5JHLH 3IGAA 1CGTA 2W9LA 4X5XB 1CFNA 2F74A 1HHIA 2CKBH 1BJMA 4PJEA 2YA1A 4XB8A 1FZKA 4P2QB 3DETD 2GJ6A 5DT1H 5EN2B 1U36A 1GPOL 4OV5A 5EBLB 4WFGE 5I2IA 3L3OA 3KAAA 1DR9A 3QDJA 2GEEA 1EXUB 1NCDH 4HFUH 4FXLA 2AJZA 4LF3B 4GW5A 1YEKH 1OARH 2Y06L 4J8RA 5KVMC 2FX7L 4NKQB 3HC0A 3QH3B 1WVZA 3OG4B 4TSAH 4N0YL 2XY2A 2VABB 3EOYG 2FNBA 3BGFB 3P73A 1XGYH 4JO3L 4ELMB 2XKNB 1P1ZB 2X4PA 4GBXB 4OLWL 4KJPD 5HHVL 1UZ8B 1MSPA 1T83C 4WO4C 4YWGH 1CDBA 3DLQR 1MRCL 1AGEB 1TNMA 4X8JA 5BS0B 3LS4L 4GXVH 1T20A 3RPIA 5J1SC 4JKMA 3I6KA 4N8VB 4PBWD 3WL9B 3CDFA 4X0KB 3QIBC 2G2RA 5GJSL 3TYFB 1WWBX 3I3EA 4XNXH 3TC9A 1BEYH 4WU5B 4LCWE 3MC0A 1CFNB 2F74B 4I9WD 3UBXG 1JGDA 1FZKB 5MP6H 5A16A 4EN3B 3L3OB 3VGDA 1LO4H 1V3JA 2V2TB 1LP9A 4P9HH 2CH8A 1NBQA 2AJZB 1F6FB 4GW5B 5KS9E 5D1QD 3MA7A 5CIPA 4FABL 1MCHA 3H8NA 4ERSH 1JTOA 1G7IA 2ZUYA 5C0CA 3P9MA 4GMSL 2W65A 3QCTL 1TJHH 1FG9C 3VCLA 4Y1AB 1IGYA 4GBXD 4R6UA 2KUTA 4ZFOA 4FRWA 2WUBL 5D1XA 1DTUA 3CVIL 5ISZB 4I2XA 1A5FH 1H8SA 4EOWL 2XIDA 4X9GA 1UB5A 7FABH 4X8JB 5E99L 4HC1A 1KPVB 4HKJA 5BS0D 2D7PA 1BWMA 1KB5L 3AAZA 4R8WL 3RUGE 3CVHH 4OV6F 1I8IB 4NKDA 1T20B 4J3SA 3O45A 1KN4L 2YS4A 1I8MA 1ACYL 3GBNL 3ARGA 3I6KB 1BPVA 5E08H 5FM8A 1ITBB 6CGTA 4IOFC 5EO0A 1IMHC 4HUVB 2AEQL 3Q5OA 1JGDB 2GJ6D 5FKAA 5JW3L 3RL1A 4NQEE 3ULVL 3LQZA 5A16B 4F7CA 3QDJD 3C2AH 3CX5K 5I1IH 1LP9B 2QHLA 3BKML 4ZTOH 3GHEH 1B0WA 5AYUH 2H2SC 4WTZG 3PWVB 4HJ0C 1T1XB 3MA7B 3G08B 2A1WH 1S8DA 3FB7B 2AABL 4QF1A 1I1AC 5FYKD 3Q1SL 1K3ZA 5C0CB 3BUYA 5D71H 3P9MB 1I1FA 5FO7B 4FQPA 3BVNB 1FSKC 2GITB 2Y5EA 1YEGL 3FB5A 2DD8L 3VCLB 5CD5D 4IRZL 4K3EH 2XQBL 3DWTA 4NO3B 1R3HA 3WUWG 3EYUL 1WT5C 3L5HA 5D1XB 5IQ7H 3VDAA 4I2XB 1FNGB 1VCAA 1WZMA 2B4CC 3NIFF 3K8MA 3L7EB 4JM4L 1UB5B 4L4TE 5FA3A 1NGZB 4HKJB 1CE1H 5C0RL 1F42A 2ATPB 3AAZB 5K33A 5C7XH 3ILPB 1QFHA 3T8XA 3TO2A 2ICWI 3TJEH 1I8MB 1SYSB 4Y2DA 5D93C 4Y4HC 1TXKA 3VXUA 3WS6A 4NGHH 3PV7A 5IROC 3SKMB 4BFBD 2H26A 1NBVH 1UKQA 5HTSA 2YMXL 2BX5A 5FKAB 4PG9B 3QJFA 3L5IA 3KS0J 4QOKB 4K07A 3SE8L 1DBAH 5LBSL 1ZT1A 1REIA 2ZP0T 2BK8A 3IAQA 2OZ4A 1WFUA 4QF1B 1OD9A 5C0CD 4FQIH 4UTAH 1R24A 5C92A 3BUYB 4MQ7B 2QQLH 1AGDA 5I1EH 1I1FB 2J88H 2A77H 4XPTL 3S34L 5C0AE 2P43B 5IWLA 3FB5B 1QSEB 1S5IL 4DKFL 3BDYL 5D1XD 3LN5B 2DYPA 3O4LB 3VD9A 5FA3B 4YEFA 4XP1L 4U3XA 5TF1H 1JRHL 3JV0A 3T8XB 1K6QH 3TO2B 3V52H 2A0LD 5BMFH 1A0QH 5LKNA 4MXVF 1C1EL 4JEGB 3BOVA 1VGEL 2D0GA 1FHGA 2H26B 1WFNA 1JGVL 3NZHL 1X5HA 3HMWH 1AGFA 1FL5B 1QSVA 4A6YA 5CEZE 2YR3A 5KVGH 4AYFA 3MGAA 3QAZC 4PP2A 4TQEH 1GGCH 3WD5H 2HT4D 3QISA 3OKOA 3BKYH 4MD4A 1M05A 3F7VB 4WWKC 3SGJA 1OPGL 1AGDB 3V7MA 1JZ5A 4AEHH 2QHRL 3PGDA 1XR9B 1IL1A 1QSED 2ZCLL 3SO3B 4MJ5A 4OFYA 3W82A 3DMMA 1N7ML 4YXHL 2A2QT 3CLFL 3EBAA 1RIVL 2C5DC 3QQ9C 5DD0L 1J5OH 3O4LD 1FFRA 5HGHA 5BO1L 1U8NB 1MQKL 4AG4L 4YX2L 4H0GA 2KBGA 4P59L 4UNTA 1YNTA 2KZ1B 4DZ8A 1UKSA 4ISVB 4YGVB 4OF7A 1CN4A 1XMWA 1Q9LA 2B1AH 4J3TA 1MFNA 4CU6A 1JK8A 1IGJB 3MJ7B 3VXUD 3BD3A 4PLNC 3SDXA 3FT4B 5F70A 4N0CD 4J3XA 1HH9A 4PJAF 3TN0C 4MA3A 1Z2KA 4YO0B 2IH3B 4KY1L 4YDKL 3SDCA 2MCPL 3EDDA 4XNQB 5T1DH 1AGFB 1NBZA 4M3KB 3IF1A 3WMSA 1WBZA 4A6YB 2VZSA 3W39A 2ARJA 3RBSA 1W72L 2H32A 3N1MC 4HV8A 4WIQA 1EA9C 2D7NA 4PP2B 4RMQA 3OKOB 3TO4A 4MD4B 1M05B 1PD6A 3SDAB 4HLJA 4HH8A 1IC4L 2X4QA 5JXAL 3MFFA 3MROA 2UV3A 4P5TB 1DBBH 1NUFA 2ZUVA 3TWCH 1DBKH 3DMMB 2NXZC 2Y5TB 3TNNB 3UTSE 1G9NC 3MYZA 1BMGA 1T3FB 4LSTL 4CVUA 5DD1H 3JUYA 5D7LA 1KCVH 3CH1B 4F37K 3VGAB 3TA3A 4P9ML 3G6DH 4OD1H 2JK5A 1Q9LB 3BISA 1KJ2A 4FQ2H 1PLGL 1JK8B 1AC6A 1ZHNB 1UWXH 4LARH 4WDIB 2R2BB 4MNHA 4UTBH 3MLRH 5IR1B 3MODH 4OCXH 2HTLD 4M5YH 1G1YA 5JTWA 4YQXH 4NRXA 3EOBA 3O0RL 3SDCB 4OGXL 2IPTL 1FPTL 4JHWH 1KNOB 3DECA 1KIQA 3NCBB 2ARJB 1T83A 2H32B 3FT2B 4WO4A 1F8TH 2F8XC 1U8QA 3UZVB 3T09A 3WIFA 3SDAD 3TO4B 1NCBL 1HYRC 3T0BA 1U8IB 3NIDF 1P69B 2X4QB 3MROB 4Q6YA 4RFNC 1GGUA 3RNKB 4AY0A 3GJFA 5H2BA 4X4XA 2NY0B 2FB4H 1NMBL 3DMMD 5F6HJ 1DVFC 3ARXA 5IFJA 1HSBB 1XF3A 2ZNWA 5ICXB 3TP4A 4ZNCD 1TQBC 3R06B 2ZJSH 5T1LA 1K3IA 5D7LB 3MNZA 2GJZA 3AVEA 2VIRA 4RGNC 3ZDZF 4GG6F 2OL3L 3B2UD 1NAKL 4JDVA 1G7HA 1KJ2B 1I7ZA 4OZGE 4HK0A 1LEKA 4MNHB 4U1NA 2VDLL 2WMPA 1I3GL 1A4KB 3S98A 3SDCD 1ZA6A 3EOBB 2FSEA 3PP4H 4NRXB 4OGZA 3RJDA 2EEBA 1JGLH 4ETQA 4FFYL 2YBRB 2E7LC 5IOPA 1KGCD 2ED9A 2BHYA 1UT9A 1KC5L 4WO4B 4M1GH 1D5IH 4HS3B 4OKVA 1U8QB 1AR1D 3FZUC 3IDMB 3VE0A 3TO4D 1NUNB 3WIFB 3C60C 3HPJA 4NZUL 4JO4H 3DX7B 2F19H 2GCYA 1KCKA 2PF6A 3MCLH 5HI5C 1L7IH 1MCOH 5HDQL 4J6RH 2CKBA 1W8OA 5H2BB 2R0ZH 3QIBB 4X4XB 5FOBB 4GAFB 4YHIA 1U8HA 4UIMB 2XPGB 1RULH 4C56B 1VEMA 1SQ2N 5A3ID 2XXMB 1WFOA 3VH8G 2VLKA 5I19L 4BSVB 5D7LD 4MCYA 1YJDH 3P11H 1KXQE 3P77A 1OB1B 4ZUSB 1H8OA 3TJHD 4XHQA 1FC1A 1AY1H 2YD7A 3CFBA 2W92A 2X2YA 3S36X 5GPRA 2Y1VA 4Y8DC 5EU6A 4U49A 4QTIH 4GW1B 3LKNA 4JDVB 1G7HB 2AV7A 1I7ZB 4N0UB 1DUZB 1L0XA 1SEBB 4HK0B 3S8WA 1LEKB 2X1QA 2WP3T 4OZFG 5C0DA 3LKSA 5I1GH 4KRNA 4HS6A 4X7CC 3OR7A 4Q58C 1Q1JH 1YUHB 1T5WA 5FEBA 3L9RA 1P5VA 2A73A 5ITFB 5IOPB 4RDQG 3W9EB 1WT5A 4WO4D 5DJCA 3MV8B 3VXTB 4OKVB 3LV3B 3VE0B 2BOCB 2CO7B 3UC0L 1GGBL 4P48A 3ZLQC 2VZ3A 5FXCH 2QQNL 5T5FH 5KAQG 1MFEL 3KLHC 4LIQL 5CGYD 5AAWA 2IWGA 5ALBL 3HG1A 3V5DA 3U79A 4C56D 3MX0A 4ZTPH 3SKJH 4WHTA 4FFZL 2M26A 4HWEH 3FOMB 2VLKB 5T1LD 4YC2C 1QRNE 4ZO9A 2P5WE 3P77B 5J6HA 4B0MM 4HIXH 3E0GA 5IVXE 4KUCD 3D0VA 3CFBB 4ZOEA 5EU6B 2H45A 5HGBA 4LPWA 5CLWA 5ACMA 2JJVA 5JHDB 1I1AB 3RVUD 2AJUL 1B0RB 1ZV5A 4NUGL 3BUTA 2YRPA 3RWFA 5BVPH 1FSKB 3LKSB 4HS6B 1RK0B 4S1SH 1X5YA 2UYLA 3DGCR 3DVGB 4ZAKC 3L9RB 2IG2H 2VMFA 4DQOH 4FZEH 4Q6IA 3CVHA 5DJCB 5C6PB 2EDXA 1H3TA 4AEIL 4UDTB 3LCYA 2EC8A 3VFWA 3TH4T 2O93L 3V0WH 4NO2A 1RU9L 3PJSB 3IJYA 4ZYKB 4HXAH 1A3RH 4LVOC 4NFBA 3AB0C 2DDQL 5KW9L 1A7OH 3IDXL 5D5MF 4R97C 5D93B 4F7TB 4Y4HB 1Q72H 4EUPG 3HG1B 3LH2H 3V5DB 2BRQA 3O3UN 1Y6NR 5T5NG 5F7HA 2GUOA 2VQTA 4IOFD 1CG9B 4JO3H 3E6FB 3BGAA 4MNGA 2VLKD 5BQ7A 3B9AA 4NT6A 4ZXBC 3RX8A 3MJ9H 2IEPA 2GK0A 4XVSL 3TCLA 5J6HB 3MO1A 4PLJC 3AFLA 2IF7A 3Q0HA 5EU6D 3LPWA 1KENL 2H2SD 1RIHH 4HJ0D 1V7MH 4MYWB 2VERN 1U8PB 5CP3A 3ZKXC 5HGBB 5JHDD 3CZJA 3X13A 4F3FA 3ARZA 5FYLL 5B38A 5EZJA 2HLAA 3RWFB 1BFVH 1P2CA 4GO6B 3GDBA 1IBGL 4R4FL 5L6YH 4LBEA 2EDEA 5HYFA 2NY4C 2EDWA 3FO1B 3VWJC 2VAJA 3VFWB 5EC1A 4PRIE 3IJYB 3QI9C 4U6YB 1FYTE 2MWCA 2KQNA 4ZPVA 4BKLB 2HJLA 1RZKC 1EUUA 3V6BR 3HG1D 4MB5A 1EHAA 4L9LC 3A6CL 4KK8D 4KXZI 2GUOB 4G80B 3HC3H 3TN0A 4D9RE 1T04A 4LDEB 4X4YA 7CGTA 1L0QA 5DS8B 3S97C 5BQ7B 1IC5L 4NT6B 4G6KH 4E5XA 1MQ8A 1PG7W 4LSVL 3O2WH 4PJDE 2GK0B 1CXKA 2MCG1 1UH4A 1E4XH 3MO1B 2AXFB 1M6OA 2VXQL 2FLRT 4NRZB 3QAZB 1IE5A 4OFIA 1NAML 4PJAB 3UTTA 2IALA 3RWJA 1FV1B 1IGML 2VE6B 3X13B 4ZUUB 5HYJA 1FNAA 1IAII 4TSBH 4WWKB 4F3FB 5DR5H 5B38B 4TRPH 2Z8RA 1EJOH 1N3NA 5F89A 2ARWA 3X11B 2OX5A 4LBEB 2NTFA 3B5HA 3KLDA 5EA0L 4YZFE 4DGVL 4MJ6A 4WGVB 3IDGA 4R4BA 5M94B 3ARBC 1XF5B 5CINL 5LXGL 2BVPA 1WF5A 1MCPH 5ETUA 5EC1B 5IHBA 4JG1H 1EIBA 1RVFH 3BD4A 5C8JB 4GAYA 4LSPL 4LSRH 1N4XH 4L8DA 2HJLB 5GS1A 4FNLH 3IU4H 4XC3L 2J8UF 4OFPA 1QYGL 2DD8H 1HEZA 3PGCA 3QEUA 1GOHA 4AJ0A 1HNFA 4NZTH 5DMIL 3TN0B 1T04B 3VFPA 2CLZA 3C2SA 4X4YB 5GRJH 1FLRL 3P30L 2IQAA 1FFPA 2XA8L 1IGIL 4HWBH 5CUSL 3MOAL 1FIGL 1QD0A 1CDJA 2GTWA 1F2QA 4UBDC 1MLBA 3EGSB 4ZUTA 5FYJU 1M6OB 1GYAA 3T0EA 1MJ7L 5EBWB 4M61A 2IALB 3RWJB 3B2VH 3MLWL 3S3SA 1BOYA 2DL9A 3NABH 4U6VL 4IDJL 4WI5A 3FN9A 2VL4A 4YXKL 4FS0A 4D9LH 3U4EB 1KN2L 1JFQH 1N3NB 5F89B 5L0QC 4JFEE 1KFAL 2HG5B 1DVFA 2AEPH 1JPST 2NTFB 2NXZB 3H6JA 3QQ9D 4KI5F 3K81A 1CL7I 1MUJA 3IDGB 3QULA 5BXFA 2BVPB 4BZ2L 3ZE1F 2BVEA 4NJAL 4RX4A 5DK2A 3UYRH 2E6JA 3ZHKA 5KSUA 1J0KA 4OQTH 5CJBA 4QCIB 4GAYB 2FX9H 4GS7C 4L8DB 3VW3H 1FGVL 1AO7E 2EYTB 5CZKA 1OAZH 1BVLB 1RUPL 4NM8H 5IHLB 1MCSA 1MFDL 5IB4A 1RI8A 1N6QL 1G9MH 2FJFA 3TN0D 3DIFA 5CBEB 2X44D 1ND0A 5H37H 2GSGA 1A7RL 4ENED 4Z7WA 1YEEH 3G5ZA 2IQAB 4GG6B 4H0HB 2E7LA 4QRSA 5E8EB 4ZMAT 2ICEB 5DJ8B 2HFFA 1MLBB 4AK1A 4NOFA 5LCVL 3DRQB 5KSAA 1YPZA 4LPYA 1Z9MA 5B3JE 5HYJD 3G5XB 5FYJH 1EERB 1XF2A 4RGMC 4V1DE 3ULVC 4R26H 4RFNB 2O5YH 2N7AA 1OGTA 2YA2A 2NXZD 1DVFB 3D2UA 5K9JH 1TQBB 4G7VH 1KJVA 3JWDH 3BWUC 3QULB 1CLOH 4LFHG 1EMTL 5BXFB 1HZHH 3KYMA 1U3ZA 2DQUH 5DRXA 2EDDA 2QV2A 2I24N 5KSUB 4DUWA 5I30H 1OHQA 4RGNB 4ZUWA 2MPAL 4M3JA 1MIEH 5ECJE 1YNKL 4X6DA 4YNYA 4XCCL 2YUZA 4RMTA 5EOCH 1A6AB 4PD4J 1VB9A 5IB4B 5DJZB 3E6HA 3X3FH 2AI0L 5CD3B 1OD7A 3DIFB 1ND0B 2GSGB 4P4KA 1ZHKA 1JUFA 4OD2B 4OZIF 5I0ZA 5D72L 3UJJL 4G6JH 5I9QC 3UTTE 1X6LA 4O2FA 3ULVF 2HFFB 3EYQC 3T0ED 1FORH 4XAWL 3MCKA 1BZ7A 1RZFL 2VKWA 2XWBA 4X8XA 3U9UB 4KPHL 5E8DL 5GISH 2W9DL 2XI9A 3C60B 3IFPB 3MYJB 5I73C 4JGUA 2M8XA 2V7HA 2XZZA 4PJCE 5I75C 4UT6L 4D3CH 1J0HA 4DJMA 3B9DA 3B83A 2JB6B 3WDHA 2ED8A 1OGTB 3MLSH 1DVFD 2ICWJ 3FMGL 5C0GB 1CLZL 3QNXA 1NMAL 1NCTA 2C3VA 3D2UB 1ZLSH 5FHBH 3CDCA 1CFTA 4RX4D 3VXME 3KYMB 3RTQC 1P4IL 4RGND 1MJ8L 1QP1A 4ZUWB 2RB8A 4YDJB 3B43A 2GKIA 4PGCA 5C09A 1NEUA 3SE4A 4O51A 3DYMA 3BAEL 1X5KA 1IC7H 4YNYB 1FGNL 3K1KC 4M00A 2V7NB 1RFDH 2AQ3A 3E6HB 4OD3L 3W0WE 2FATH 1ZHKB 4PJGF 3VXPA 5HBBA 1JUFB 4JFZH 4JRYA 4ZAKA 3C87A 5F9OH 1A64A 4O2FB 5K9QI 4E42B 5CGMA 3OZ9L 3U7YL 4P9MH 5KSAD 3FZUD 3PABA 3RWDA 3MCKB 2J5LC 2YZ1A 3I9GH 1Z9LA 2B2XH 2LU4A 3C60D 3A6BL 5IKCA 4JKPL 4XP5L 3H9HA 5A2IH 3LMJH 3QG6A 2X4OA 1P4LA 1BF8A 4E0RB 3D18B 1S7SB 5HI5D 3N1FC 3Q48A 4M8VA 5MEPB 4BZ1L 4Z0XB 3VFUB 4Q0XH 5GGQL 3D2UD 2IPTH 3QNXB 2C3VB 5EBGA 3HR5A 2GW5A 5GRVL 4BK4A 1EV2E 3SJVB 4YFEA 5J9PA 5TQ0H 4Q97A 5IHUL 3OG6B 4YC2B 2AK1L 4YHML 3IDYC 4WNQA 1U92A 4ODSL 1NCBH 3P4OB 4FFWC 5C09B 4PGCB 5BRZE 4O51B 3ZE0F 4HJGA 1B6DA 5F6IC 5ESAB 3GNML 3F12B 5IFHH 3RZCA 4TYUA 3UTPD 2FHCA 2IADB 3BHBA 2AXJA 3VXPB 2VDKL 3LS5L 1YPZE 4JRYB 1IEBB 4NCC2 4ZAKB 5DA4A 1MJUL 2OR9L 1B88A 2ITDA 5FA4B 5K59E 3RWDB 1UB6B 2OL3H 2QQKL 1IAOA 3PE9A 1YQVL 1GHFH 3KR3L 1CK0L 1JTPA 3TH3T 3WIHL 1SHMA 4LVOB 3H9HB 3AB0B 3QG6B 1OAKH 2X4OB 4QRTA 5F97E 2D7MA 2CDFA 3KLHD 1QPPA 2VDLH 1FZOA 3GIZL 4R97B 3RJQB 4L9LA 4G5ZL 4WW2F 4KMQA 2D2OA 2V17L 1BGXH 4N0FA 1DUYB 5ENWB 1X6NA 1SJVA 2WIIA 1F2XK 3HR5B 1JNNH 3LZFH 3ZKNC 4RFEA 5DEFB 1CE6A 1CLCA 1FVCA 5J9PB 2HFTA 5MENB 2FBOJ 4ZXBB 1FAKT 2L0DA 3SKOB 1MCWM 4U6XA 4WNQB 1U92B 4P2CG 3UX9B 1L6ZA 1NUGA 5C09D 3K74B 3G6AB 3NVQA 1MRFL 3O6KH 2Y36H 1F3DJ 4RMRA 3ZKXB 3RWCB 4HJGB 1YN6A 4TNVK 1H15B 2P8LB 3G5YA 4MLIA 1U8KA 4PTUA 1MFBL 2FJGA 4OCYH 1PW3A 1IM9B 4NKOA 3QZWA 4Y7MA 3KPTA 4JRYD 3MGOA 4ZAKD 1UKTA 1U6AL 2NY4B 1ZAGA 4XH2A 5I1AA 3CIQA 1EHNA 4XVJH 3ARBA 3LD8C 3VWJB 2ITDB 1UVQB 2XG4A 4Z76B 3QI9B 4Z7VE 1OAXH 2C4FU 5TE4H 4S1QL 3CFCL 4QRTB 2IPUG 2CDFB 35C8L 1FZOB 5HHXL 4HSQA 4L9LB 4L4VE 3QXTA 3MJ9A 4P46C 4WHYG 3CFEA 1QSFA 1AHWC 2UZIH 3P4LA 2WIIB 4WUKH 3GJFK 4RFEB 1AJ7H 1CE6B 3QPXH 4LLQB 3CDGA 3VXRB 4YEEA 1HK6A 4DTGL 1UZ6E 3ZT7A 4PLJD 4M62H 4LHUG 1FDLH 5F7YC 5KJRL 4XPFL 5BV7L 3KLAB 5IT2H 4HT1H 1X5ZA 5TPWH 4MA8L 3UPRA 3N9GH 4NIKB 5GGUA 3QRFM 4R2GC 3S96B 4LIQH 3C9NA 3G5YB 2XNAA 1U8KB 3MRKB 2J7LA 4ODUB 3WIIL 1IM9D 4G3YH 1QR4A 3NMEA 4EEEA 4RSVA 1F3RB 4QLRA 5I8OH 2OR8A 2NY4D 3N85L 3KXFA 5I76B 3QXAA 4XH2B 1HDMA 2IGFL 5CP7A 3HNSL 2DN7A 3PHQA 3ARBB 3BWAB 4MVBC 5KTEH 5C0BE 1N59A 5F9WC 2FEEI 1V7NL 4H26A 3REVA 1PGRB 4PV8B 3MNWA 4POUB 4JCLA 3DPBA 5LAXA 4W6XB 2R9HC 1QG3A 4F7EA 1YY9C 2FD6L 2Q6WA 2ESVA 3T1WA 2BFVH 3RIFK 1P53A 3Q2CA 2EDNA 1QLEH 2OMBA 1G6RL 1QSFB 2FH8A 1WCBB 1KB5A 1JN6B 4HPOL 5HGGS 4XZUB 1MLCA 3T2NL 1UM4L 3K8LA 3EYSL 3SOBH 4P2QE 1HYSC 3O11B 1CICA 5KN5B 3UPRB 5DD5L 3WFDH 5GGUB 2VLRA 3C9NB 4QHNA 2XNAB 4PRDB 4L29B 4PJIA 2JB5L 3I02A 2R39A 3OSKA 4L3CA 4MA7L 4RAHA 5JOEA 5GZOC 4PGZA 5L0QB 2VTFA 5A2LH 2E7CA 3ARDC 3WE6B 5J1TC 3R1GL 4XVSH 4PRBA 3HI6L 1HDMB 2NTSP 4FQJH 3ARBD 1E6JH 2EYRA 5CP7B 1F6AB 3QG7H 2FH6A 4XP4H 1EEZB 4HIHB 1JGUH 1QVOA 3REVB 1MAMH 3LKRA 32C2B 4G8GE 3VFMA 2H2PC 1J0YA 1KJ3L 3ZZ1A 5HHMB 4GS7B 4HKZA 4F57H 1CGUA 4K2UL 2Q6WB 4PRPA 5DDHA 1CD8A 5C0EA 1F4HA 1XZ0B 1S7XA 1WGOA 4HWBA 3FHAA 1QSFD 1ZTXL 3FO0H 4KJYA 1KB5B 1WZ1L 5DK0A 4GLRH 1D5BA 1MLCB 4UBDD 1QFWL 4X80H 2W9EL 1J86A 1NCNA 1K2DA 3UAJD 1WEJL 1MHPH 1T1WA 3VXSB 2KZWA 3KDMB 3K1DA 4QHNB 2W0KA 3OGCA 1D6VH 3OMZA 4NC1E 4FHBD 4RGMB 5JR1L 3VFTB 3I02B 1N5AA 3PIQA 4F8QA 1OCWL 1CS6A 1IC5H 2CR6A 1EAJA 4L4JA 4Y1AE 1EDQA 3EO1B 4D0DA 4GAJL 4OQTA 2EC9T 2Z93B 5EIQA 2EYRB 5K93A 2F58L 2NY6C 3KPRA 3BE1L 4K7PY 5ISZE 4BH7A 3LKOA 3LKRB 4OLZL 3RTQA 4QRRE 2G75A 3WKML 1MHEA 1IGMH 2VZUA 5HHMD 2HN7B 4JPKH 4OFDA 4HKZB 4I3SL 4MAUH 5C9JA 2ESVD 3I50L 4M7KH 1XFPA 4PRPB 5DDHB 2X05A 4HWNA 5EOCJ