2WWMC

Crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
GSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
total genus 16
structure length 98
sequence length 98
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wwmC00
2WZPD 3O8XB 2BX5A 2APFA 4U1MA 3QFJD 4F3FA 2H6PA 3TWCH 4KROB 4YHZL 4YX2H 3FO2A 3GJFK 5J11B 1KOAA 4MAUH 4OKVB 1PZUB 4KZDL 1V7NL 2VDMH 4XP5H 4KRMB 3VJ6A 4XGZB 1HXMA 3K4AA 1UQSA 1Q1JH 4GG8A 2NXYD 4P5TA 4XP9H 2CLZA 1BIIA 2B0SH 3C60B 4HKJA 4ONHA 5DHYB 2AV1A 4O58L 4M9PA 2Q3AA 3IDUA 3I50H 1LEIB 1ZVSA 3H9SB 5T5NF 5BW7C 3MRGB 2FEEI 4QHUB 4XCCL 5A2LH 4CVUA 3NAAL 4QOKB 4Q9CA 1FVCB 5T33L 2BC4B 3BPLC 3CCHB 5GGVH 4AQ1B 2MMXA 3VXSB 2M1KA 5EU3B 4EIZC 2V2XA 3GBML 2ZCKH 4BSVA 2XKNB 4Y4HC 1EAJA 2R8SH 5HYIA 3PXJA 4ZUWB 1GCFA 5HVWA 4MA3B 1OP5K 4QXUL 4DZBB 4KFZC 4OJFL 4LHJB 5GS1C 3D25B 5TH2B 1Z0NA 2DLFL 4FABH 5EU6D 1UJ3C 5A1AA 3TBVB 5CBEB 2GUOA 2Q87A 4KQ3L 4K8RL 3SE9H 4NCC1 2CIIB 4RMUA 1MY5A 2P44B 1U8QB 1IAMA 3MBED 3MOAL 4H1LA 4RGOH 1I8IB 4HIJB 4Z7VB 1WBXB 2QADB 4L4TE 1A4KA 3Q5TA 1QEWA 2YPLD 4P2RA 4YHLH 4IRJB 5FCUH 2GT9B 3P0VH 1CICC 5ICZB 5C6WH 4J1UB 4W4OA 3T2QA 4LFHD 3QRGL 3KPLB 1CTOA 2R2HA 2UVEA 1ETZA 4PP2B 5BS0B 4JFEB 3MV7E 3HNTL 1CDGA 5FHAH 3U36B 2OLDA 1EFXA 3CFBB 4PJ5A 3HI5L 3UBXG 1NDMA 4JFDE 5C0CA 1C5CH 4JQXC 5D7KE 1UACH 5C08E 4L29A 1HEZA 1TQBB 5EBWB 1DN0B 2E9IA 5L6YL 2XWJA 2LU7A 3Q5YA 4PJEA 4XNZB 3S4SG 1QNZH 1DVFB 4BFEA 1YEEH 1LEGA 3OAUL 4R7NB 5DF0A 1T2XA 3KWWA 2ZUWA 4RMTA 1KIQB 3HZYA 1BJ1H 4PV8B 4DQOL 1ZLUH 1AXIB 3HFML 2X7LB 1L0XA 1SY6L 4MVBC 1FG2B 1KACB 3VFRA 4DGVH 2J8UA 4PD4K 5T1KB 5AUMA 5D96C 3GMMB 3MRLB 4MNQB 2Y6SC 5JXEC 3UYOD 1HHGB 3H7BA 2IGFL 2WQ8A 3IU4L 5D7JA 4BUGA 3F7VA 3ULUF 3V0VB 4I3GA 1DQQA 2CO6B 4YHYB 4FQLL 4EN3C 3I85A 5DD0H 2LFGA 3UYPA 1J5OL 3W0WD 4WY7L 4Y0GA 3STLB 2ARJA 3EDJA 3V2AR 1QVOB 3BQUC 2XPGB 3VFWB 4WW2C 2BFVH 4HKBA 1F8TL 4P46C 3EHBC 4F9LA 3O2WH 3CDCA 1HKFA 3CFJA 3S37H 3AS3A 3PG2A 4LCWA 3MRFA 2OMBA 5KTEL 1FSKB 1X44A 5IMOB 3T0ED 5C9JB 4MXWL 4LIQE 1GPOH 4HPOH 5IFAL 4ODUB 5KVMC 4KUCF 4PB9L 1G9MH 1V5JA 1MPAL 3SGDI 5GGUA 2BHZA 5CIPA 3K1KC 4XNYL 5ADPL 4MB4A 1UZ8B 4BK5A 3D85B 1LO0H 3FAWA 3TBTA 4MA1C 4NSKB 3UCRA 4IBLT 4RNRA 5HSFA 2DD8H 2OR9L 1H3PL 5KOVC 4NO5B 5L0QB 2ESVB 1T5XA 4HS3B 5ICXA 1JWUB 1HWGB 2AXGB 3AVEA 4WENB 5EUKB 3ARDC 1HHHB 1S9VA 2OJEA 1BBDH 3T08A 5DK2B 1T21A 4H0HB 3HMWL 3LDBB 1AP2A 4NC1E 1H0DA 3G5XB 3MNZA 5ACMA 3TZVD 2H32H 5ALCH 5D7LB 5A2KH 2R2BA 3NZ8A 5DMGD 3L6FA 3DECA 1J8HA 1JVKA 1LVEA 1NFDF 2H2SC 2X10A 4M6OH 4JFOA 3TWCL 3SDXB 4P4KD 3T1FB 4ZXBD 2NY7H 4YX2L 4LPXA 4JDZA 1FPTH 1QA9A 3QI9A 3BPOB 2R39A 4MAUL 4PJ8C 1AD0B 3DUSA 2VDML 3FCTB 3EFFA 4XP5L 4ZAKD 1KUMA 1P4LA 3DUHA 3V6FB 5F7NC 3JV5A 1Q1JL 3SCMC 4NQCD 2IMMA 2NXZC 3ZTJG 3UBXI 5KSUA 4XP9L 5I16B 6FABH 1G1CA 3IJSA 3DO7B 3FO0H 3MBXH 1AE6H 3SDCB 4NKDB 3BKYH 5C0BB 3I50L 2IAMB 1FNSH 2PCPB 3IDMB 1U8NA 4JO1H 4MDIA 1OP5H 5GGVL 5JO5A 1LNUA 5TE7H 4MAYD 4QYOA 1T89A 5J4MA 3ZT7A 3EJJX 2F54D 1WZ1H 3QUZC 4JHAH 1CLZH 3I3EA 2ZCKL 4PJHA 4D0CB 2VIRA 5C09D 4KRNA 1MJJA 5TDPA 1R5IB 2W59A 5IWLA 5I6XB 2R8SL 3ILQC 1CD0A 4GW5A 1YEDB 4MJ2A 1U58A 5BJTA 2NW3B 1Z3GH 1C16B 1RUAH 4L3EA 1YA5A 4WJ5A 3W2DH 4FABL 3WXWH 5JMRA 4HWBH 4ODWB 4NZTH 4ZPTB 4P57A 5TE6H 5DFVD 4PJ7B 3SE9L 4YEFA 4U6HA 3H8NA 4P23A 4X98A 1QSEB 3SKOB 1SY6A 4KAQH 2EXWC 4XCEA 4RGOL 1WIOA 3EKCA 4HUXA 3EZJB 3B9KB 1MUJA 1A6VH 4YHLL 4C83A 3DROA 3VWJC 3L3HA 3AS0A 1I7TA 4FFZH 3P0VL 2P5WD 4PJ9C 4MJ6B 3IS1X 3TNMA 5FK9B 4XP1H 4ZODA 1K4CB 3G5VA 4MSWB 5B3NA 2VZ3A 5FHAL 3WEXA 4HXBH 5JQ6H 1FGVH 1FN4A 2JKXA 2H3NB 1C5CL 1K5NA 1UACL 3IXTA 4NN5C 4OGXH 4X8JB 3ALXA 1WC7A 5E0QA 4PTUA 3LRSB 3OXRB 3JUYA 4HMEA 1BBJB 1QNZL 2RIKA 1JTOA 4QRPA 3BISA 3O41B 2AERT 4HBQA 1KPUB 3UTTA 1UB6A 4F58H 1UM5H 1YEEL 2ADIB 3MV9A 3UTSD 5F89B 3MRJA 3HMXH 3WFBH 3QXUA 3MLPA 4P2CG 3MFFA 4NQXB 2FLRT 4GKSA 3W39B 3VXPA 3VFTA 4JFDB 4QY8A 3B6SA 3MOQA 3BRDA 5ESQB 3HE7A 1XT5A 4DGVL 3GDBA 4HIHA 2VE6B 2VN4A 5IB1B 2VXUH 4JLRB 5I1CH 3MUGB 1FL6A 4KJWC 5HHXH 5KSBA 2W0FB 2FR4A 1VGEL 2DJUA 1HILA 3BVNB 1IQWH 4NRXB 4UOW0 2LAGB 1ORSA 4LSDA 3PWPD 3A67H 3S5LA 5FYLD 1A6UH 5TDNB 4LVEA 1AKJD 5DD0L 5D71H 4JQIL 1DANT 5HGBA 2KPNA 4BZ2H 4AJ0A 4M8QA 4LVOC 1H3TA 3NIGE 3TYFA 1EGJA 2L7UA 5IMMB 2H9GA 3LQZB 4OIIH 3FT4B 5JQHC 3VFPA 2BFVL 1T0PB 3TFKC 3GSOB 3OKMB 2WNGA 2EYRA 3O2WL 3S37L 2VRAA 4MZ3A 4G8FA 4J4PD 1OY3B 1WFOA 3EJZC 2E7HA 4PRPD 4M7LH 3BPCA 3EUUA 5BRZB 5CEZH 4CW1A 3B3IA 4QRRD 3WIFA 1GPOL 4HPOL 1J0JA 1MCEA 1WAAF 1G9ML 2ZOKB 1MSPA 2A6DA 1S7XB 5C0AA 4DWHA 3VXTA 1V3LA 1LP9A 1LO0L 3G9AB 3H9HA 1Q9WB 3QDMD 4XP6H 3PQYE 2DD8L 4M00A 5JW4N 1G7IB 1GOFA 1BMGA 1S7TB 2V5RA 3WS6A 3MYJA 4XWOC 1BBDL 2G5BB 2YUVA 4J2XA 2NQCA 5CJXC 4GRWH 1A2YA 1RJYA 1T7ZA 4E41D 2HLAA 5ALCL 1CYGA 2QSTA 2F53A 1DBAH 4IRSC 1I3VA 3I2CH 3ZDZF 3LN9A 3EYOB 4M6OL 1VA9A 3VH8G 2NY7L 2A9NH 5E08H 2WBKA 1FPTL 1M7DB 4PYGA 4KRPC 4FFYH 1W0VB 5B8CA 3HRZA 1OAKH 4OF8A 2YS4A 2W9DH 3FN3A 3FO0L 3FQXA 3MBXL 1AE6L 1GOGA 2BNQA 3CPLA 5F97E 3ZKMD 1FNSL 4HIIA 5I76B 5L8LB 2LAAA 4JO1L 2KKQA 5EU6A 1GL4B 3OR7B 5HYQA 1EZVY 5TE7L 2PW2B 3FN0H 4PV9A 1WZ1L 1YNTB 4JHAL 1CLZL 4N9GB 3QQ9D 5IEKB 1B2WH 1B90A 4IEFB 5ICYB 3LQAH 2F74B 4RBPH 2CRMA 5CWSB 2K9UA 5JDSB 1NEZB 1YECH 1UVQB 2YPLA 3S3PA 1Z3GL 3OR6A 3X13A 1X5JA 2Q86B 1RUAL 2UZIH 4OZIE 3ZDXF 3W2DL 3WXWL 2QKIB 4ELKB 1MFEH 4HWBL 4NZTL 3GMNA 5TE6L 3ZL4H 5IBLD 1NGWA 3SBWA 3RX8A 3MR9B 4JDVB 3ET9F 4KAQL 2D2OA 4LNRB 1XCQA 2RGSA 4YNYB 4HH9A 3BD4A 5F6IC 4MMXC 1A6VL 1FYHB 2ZSWA 2JJTC 3IFOB 2H1PH 3ARBB 2XA8H 1BD2E 4FFZL 1XIWB 1Q9KB 3RDTC 2P8LA 3BWAA 4GXUM 3BP7B 3TO4C 4ODXB 3EYQD 5ILTH 4XP1L 6CGTA 5F7UA 2JTDA 1X7QB 4UUJB 4PGCA 2YOCA 3ZYOA 1I7RA 4HXBL 4ZYKA 5JQ6L 3IYLW 1FGVL 2OI9C 1A1MA 1HXYB 4Z7WE 5FGCB 1T5WA 1G7QB 4EVNA 2HFEA 3SGEH 1WK0A 4OGXL 4UDUB 4G6AC 3HB3C 2VYRE 5EO0A 5EULV 1EEQA 4F58L 1UM5L 5HI5D 5IG7B 1V3KA 4L9LA 5JHDE 3HPLB 3WFBL 1P7KA 5J89A 1U8HA 4N90D 3VWKB 1GH7A 1D5BB 1DANU 3DGGA 1VFBA 1FYTB 2VXVH 1I3RA 4DZ8A 3VU2A 3BOVA 3QUKB 4NGHH 2V7HA 5SWSE 5I8CA 3A6OA 2VXUL 3K0WA 2PYFB 3QNYB 3O3BA 5D2NB 3VFGH 1PYWA 1RHFA 2D31B 2C7UB 5I1CL 1PJ9A 1XR8A 5HHXL 4LQFH 2CJUH 3K2MC 4KKNA 4UV7H 3L9RA 4Y4KD 4YIQA 3RKDC 1IQWL 43C9A 2HN7A 3ARUA 2DJ4A 3A67L 4L4VB 4DVBA 3ARFC 2VLJD 1A6UL 4Y8DC 2XNAA 4WV1C 5D71L 2WM0A 1OQXA 4BZ2L 4FZ8H 1CR9H 3UZEA 2GAZB 1IEBB 3NH7H 3GJFA 4HJGB 3REVB 4LSSH 5ANMA 4OIIL 1RZ7H 5FB8B 3DIFB 3IF1B 2X70B 3HC3H 4MCZA 5SWZB 1ND0B 3CDFA 3D18B 4G5ZH 1YMMB 4APQA 5DUBA 1NUDA 3BKCH 4LL9A 2QR0A 4M7LL 2X4SB 5CEZL 12E8H 5LAXB 2ICES 43CAB 4U1NA 5IVXB 5C07A 3TIEA 1AGDB 4LASH 4XBEH 1VESA 5J13C 4XNUH 4AEHH 1S7WB 4WEMB 1FCCA 4DOHE 5I1AB 4K23H 4FQJH 1JPGB 3NZHH 4OZGF 4WWKC 4W6XB 4AIXA 5FECA 1QOKA 2PTTB 1OT1A 4XP6L 2NY4C 3BZEA 4NZJA 3FO9B 2DQCH 5EWIH 2GTZA 1U8OA 4EI6A 4MNGA 1L7TH 1GGYA 1I8LA 4P4KA 4B7IA 1XR9A 5E2TH 1RHHB 1HYRC 4NO0A 3SOBH 3K8KA 4JG1H 2R69H 4JZNA 4M1CD 5I1JH 4Z7QE 3VXQA 4ZAKA 1JNLH 1JPST 1A5FH 2ZP0T 3I75B 3TCXA 3CSYB 5ID0B 2V5MA 5GRWA 1A3RH 4NQCA 3R0NA 4JM4H 1Q0XH 4RFNB 4YHPA 2WWMD 1DBAL 4Y5XC 5IHUH 5DEZA 4JPIB 3DX9B 3QWRD 5DVNA 1LEKB 4X80H 3I2CL 5EC1B 3VGBA 3MRMB 3NCYP 1NC4A 1C7TA 4Q58C 1PY4A 4YO0A 2APXA 5DD6B 2IH1B 1J18A 2A9NL 3GSVA 5E08L 3BUYB 2IMNA 4DFIA 2E27H 1CDUA 2R4SH 4FFYL 5C09A 4LLUA 3RUGF 1OAKL 3NFNA 2HA1A 2W9DL 3RTQA 3HE6D 1BVLB 2DIBA 3RPKA 2NY6B 4I77H 4EI5C 1P5VA 2V7NB 5F7LB 5JPMB 1OWWA 4YBQC 5GJSH 1IGMH 1GOHA 3PP4H 4PJBA 3FN0L 2YEZA 4LOUC 4N5EC 1A4JB 2BY3A 5I9QC 4P2RE 4FQXA 4HUUA 5AD0B 1B2WL 2DYPB 4R2GC 3DI3B 3LQAL 3F65A 1U91B 1YQVH 2EDKA 4JFZH 3WNOA 1RMFL 2JJVA 4NO2A 1FDLH 1YECL 3F7RA 3QA3A 3C5ZB 2C3VA 2SEBA 1AGCB 2UZIL 2WK2A 3T4AB 5FOBB 4F7EB 5MENA 5C0DA 3GMRB 1FZJA 4U1GB 4OFVA 1MFEL 5JLZB 2P5WA 1F13A 4PJ5E 5C0CE 3ZL4L 1D3CA 5DTFB 4PJFF 3F7QA 4HS6B 3MA9H 2RFXB 4IS6A 3FQTA 1C1EH 4KI1A 4PJEE 2Y1VA 3G6JA 2Q6WA 3CH1B 2HJFA 5LVEA 2EE6A 5LBSH 4R97C 4LSVH 2VABA 4NWTH 4Z7UA 4LP5A 3Q6FA 5DJXB 5J56B 5FF6A 4PREB 4LSQH 1UB5B 3GMOB 1R3HB 2C1PA 4WHYH 2H1PL 2DLGA 3ZYIA 1K8IB 3TVMB 2XA8L 1C5BH 5KVGH 3SGDH 3R06B 1NFIA 4JJHA 1AY1H 4KQ4H 2D0GA 3IDJA 3SDDC 4I5BA 5DO2C 1XF5B 3UTSA 1BZ7B 3QISA 5ILTL 3WCYA 2YD6A 3GMQB 2J8UE 1PD6A 1RULH 5J7CC 1OTUC 4HUWB 4O02H 2C4XA 1FVEB 3U4EB 3Q2CA 4Q9QH 3RX7A 3UTZA 4XVUD 3QHFH 4XT1C 5HHQB 5J9PB 1BD2B 1OTSD 4MWFA 2AGJH 5F1NB 3DVNA 2BVYA 4UTAH 1NCCH 5JOFA 5MEOB 3BH9A 5F8RC 1T66C 1HNFA 4LHUB 1FNGA 3NGBC 4F9PA 1A3LH 1RVFH 4WCYH 2EE3A 5FKPB 3ALWA 3LKSA 1A6ZA 5HHOA 3PWPA 4QCIA 2VXVL 4RAVA 2AW2A 4NQED 5D7SH 4ENEC 2QSQA 3BO8B 4NGHL 2C5DC 1OAQH 1TJIL 4JFPB 1GHFL 5B4MC 4QXTB 4YPJA 3GSNB 4LCWE 1HH6A 5K33A 4S1RH 3VFGL 1L0QA 1QFWI 5DQJB 2A9MH 1P9MA 2VXTH 4LQFL 2CJUL 2DLTA 4UV7L 4BFBD 3GUTA 4I18A 2A1WH 3WDHA 3VW3L 2R15A 4PRPA 3DXAA 3VI3F 4GBXB 5H94A 1TVHA 3BDXA 1REIA 4UZGA 1SMAA 4QRRA 2FEEL 5FV2A 4WFED 5T3XH 4FZ8L 1EDQA 1CG9B 3NH7L 4H5SB 1U6AH 5SWSB 5FDWA 3RY6A 3VGFA 4LSSL 3BDYH 1RZ7L 1HKLH 5E4IA 5EPMA 1QBBA 4HIEB 4HZLA 5KSAD 3HC3L 2VLLB 3F58H 5I1DB 3D3VD 1DN2A 1IKNA 1RZJH 4B50A 3HRPA 3QDMA 4FQQA 1CBVH 1ZS8A 5E8PA 3KG5A 5IMKA 1DE4B 3T0XA 3QCTH 4G5ZL 4PLKD 5BCAA 1D5ZA 4G8EA 4XBGA 3BKCL 3BP6A 1XCTB 12E8L 3QDGB 1OGTA 4LASL 1L7IH 4XBEL 4NN7B 3K4ZA 4XNUL 4JVPA 1SMOA 4XZUB 5DA4A 4AEHL 3QIBD 1J8HE 1QSFD 3QNZB 5IB4A 5CD3A 2OL3A 4K23L 4E41A 4FQJL 2VLKD 3NZHL 1EX0A 1QSVA 1K3IA 1C5DA 3MUJA 4ZO7A 5FA4B 5J1AB 4QTHB 5GGTH 3PWJB 2BERA 2E9WA 5E1HB 2DQCL 1I9IH 2JF1A 2EDTA 1ACYH 2DM2A 4Q2ZA 1L7TL 2YSSA 1Y6MR 3QNXA 4BKLA 3LD8C 4TTDD 4QHNA 5E2TL 4G43A 3SOBL 2XA3A 3GHBH 4JG1L 2R69L 3KJ6H 4JGJA 5I1JL 3MJ7B 1JNLL 3R1GH 1A5FL 3D0LB 4U1MB 1DBJH 1XGQA 4DOHB 1A3RL 3U7WH 1N5YH 1Q0XL 5IHUL 4X6CA 4NKQB 4BQCA 5EOQH 3FO2B 1WQVT 4X80L 4OZ4A 1MCNA 2EEBA 2XYCA 3WYRA 2Z31B 4PJHE 3U6RA 1FJ1A 2ADGA 4QRSB 2PTVA 3ULVF 2C26A 2A6KA 5DS8A 1IM3B 2OTWA 1IARB 4QWWD 1BIIB 4HKJB 5DGQA 5D5MF 1SYVB 2E27L 4K71C 3DLQR 3CVHB 2R4SL 1HHJA 3JBG7 4CMHB 4L3EE 1SHMA 2BZDA 3HAEH 1MHPH 4M4RA 1WWWX 3KYNA 4JPWH 2BVTA 1ZHBA 3EO0B 3KNBA 5B39G 1ES0B 2DLEA 4I77L 3BGFC 1AO7A 1EEUA 4ONOA 1JMZA 1XH3B 5IROA 2ATPA 2NY0D 1IGML 5GJSL 4HJ0D 1I8KA 3PP4L 5E56A 1UM4H 4PLOB 1MF2H 5F1SA 2CQVA 4UQ3B 1M6OB 1RK1A 5TFSH 4RFEB 4OZFB 3KLAA 5IKCA 5FM8A 3FAXA 3HI6H 3VRIB 3FB8A 3QXDB 2XIDA 2GJZA 3NABH 1YQVL 4JFZL 1UT9A 2J88H 3EYVB 1FDLL 4HS8H 4LCCC 4G42A 1WVZA 4PJXA 4Y2DC 3P4MB 4ORZC 2ADJB 3L95A 2X5PA 2ICWB 3ZKQD 4X6FA 4X7EC 2YXFA 3GSWB 3OV6A 5SV3A 2ZKHH 4H1LB 4HCRH 3TLRA 3MA9L 1KB5B 1C1EL 4P2RB 3MUY1 1GGTA 1WT5A 3ES6B 4UDTB 1YY8B 4QRPE 1OM3H 1OW0C 3TN0A 2PUQT 4XMKH 3UTTE 5LBSL 4LSVL 4NWTL 4GT7A 3RGVA 3MV9E 4LSQL 1EZVX 4PJGA 2A83B 1JGVH 2R2HB 1ETZB 1C5BL 5KVGL 4FQHA 1IEAB 3HG1D 5I8EA 1AY1L 2XTJD 4KQ4L 1NDMB 5C0CB 2NY5C 1U93A 1G9NC 1HEZB 2CK0H 3IDNA 4GAYA 3IFNL 3MROA 1RULL 5DEGB 4K3EH 4PJEB 4GRLC 4N8CL 3C87A 1IC5H 2E3VA 3FB5B 4O02L 4WTZA 3TJHD 4GKZA 4DN4H 5JOPD 1GC1C 4YBLB 3INUH 1OHQA 4C59B 4Q9QL 3LEXA 4O51B 5KSBE 3GIVB 3QHFL 3QPQD 3WLWC 3ECBA 4NKMB 3MNWA 5ETUA 1KT2A 1KJVA 4ZS7H 5FUCC 4UTAL 1NCCL 1JCKA 3MRCA 4Y4KA 1JJUA 2VH5L 4XTRD 1A3LL 1RVFL 4WCYL 3QHTC 4X5WB 3AAZA 2E6QA 5C0JA 4P59H 4X9HA 1KTDB 5E70A 4HUNB 5D7SL 1B6DA 1OAQL 3TBWA 3V5DA 5MHSE 1BF2A 3I3BA 4L8SA 5D7JB 3FO1A 1N2RB 2P1YA 1HHKA 1S7QB 3D2UD 1F3DJ 2ATKB 4S1RL 5DC4B 3RWEA 1ZGLB 3SE8H 3O9WD 5C3TA 3WJLC 4G7YL 1DFBL 2A9ML 3WIIH 4BZYA 1P4IH 2VXTL 3TT3L 4GS7B 5GRXG 2QJDA 4HGWA 1R24A 4XBPB 4Z76A 4ODTH 2A1WL 4IDJH 2LQRA 2ARJB 5T1MA 5C0AE 5DVKA 3RX5A 5JW4R 4DGIH 3BW9A 5MEPA 1LP9E 1QO3B 2Z8WC 3MRQB 4HKBB 5DI8B 3BEWB 1OQOA 4I4WA 5T3XL 4FRWA 1U6AL 3CFJB 2YBRA 5JIHA 4U0QB 3BDYL 1HKLL 2D03H 4ACPA 1CLCA 2I26N 3QDHA 3GMPB 3F58L 3KPSB 3G5YB 3MRFB 4F15C 5KZCD 2IBZY 1B0GA 1RZJL 2P8MA 2WQRA 1CBVL 1I1RA 2Q8BH 2KUTA 1SEBB 3S35H 2WUBH 3QCTL 4EUPH 4RWYH 1CIUA 4GOSA 3BRGC 5GGUB 2CDGA 5HI3C 1TJGH 5CEYB 2F53E 2MQCA 4MQTB 1L7IL 4YDJB 1QBLH 4MVBD 4H25A 4MJ4A 5CGYC 3ZKXB 5DMKA 3PJSA 3O8XC 1MHHB 2V2TA 4U1LB 2F15A 4L9DA 3PWNB 5ICXB 3AU1B 4KROC 1I7UA 2EYTA 2VZ1A 5F70A 3SE4C 4R90H 5GGTL 2PO6B 3QWRA 2OJEB 3T2NH 1I9IL 1XGPA 1ACYL 1AP2B 3IAGC 2HKFH 1TIUA 4TNWF 1T2JA 4CGTA 2ZUQB 2YHGA 3C60C 3ZDYE 3C9NB 2BNQE 3T77B 1YEKH 3T09A 3GHBL 4EN3D 3KJ6L 3M1BB 4HEME 5F71A 1LE5B 3R1GL 2HVKB 2X1OA 1JI1A 1J10A 1DBJL 1QR4A 3QCVH 1N5YL 3OBAA 2NTFB 5EU6E 3B5HA 1BJ1J 1YPZF 4OLWH 3L1OL 2NNAB 3BAEH 4L8CA 3U83A 1DBKH 5EOQL 5BXFB 4NKOA 1ZA6B 5C3LD 4M7JH 3EYSH 3ME0A 3B9DA 3EFFB 4AZ8A 2P5EB 1F6FB 3F7YB 3DV6A 4I2XA 4S0SD 4YGVB 1CGWA 2W0LA 3KJ4B 3IJSB 5I1KH 2YPVH 2YPLE 1RV6X 3U7YH 1MHPL 2FRGP 1U8NB 3MRBB 4JPWL 5HYSG 2FZ3A 4GUPB 5F9AC 1LNUB 1BVKA 3GI8H 5EBMA 4R4ND 2HG5B 3HC4H 1LGVA 4PJHB 3W9DA 5TDPB 1KBGH 1F4HA 5F7FA 5DVLA 1UM4L 1MF2L 5T3ZD 4Z78B 5BJTB 2QADC 5TFSL 4RGND 2EDFA 3HI6L 2LVEA 1MFNA 4IRJC 4F80A 3NABL 3ZKND 1Z5LA 5M7QA 4D0BB 2J88L 3EJYD 5E03A 2A38A 1K9TA 4HS8L 5EO9A 4XVTH 2WBJD 5D2LA 4CU7A 4P23B 4X98B 2DLHA 3KLDA 5LGJA 3WXVL 3KS0J 4Q7DA 5E8DH 1R3KA 4WO4D 2ZKHL 4XCEB 4HCRL 5C2UB 4LPVA 3UX9B 1TQBC 2XZQH 1BFOA 3SN6N 4D9QD 5CZXD 5ESVB 4NJ9H 1QKZH 1MUJB 4XNZC 1OM3L 1I1AD 2YZ1A 3DROB 4XMKL 3L3HB 4C56B 2MKWA 1DVFC 3L3DA 2NXZD 3L7EA 3I6GA 1H5BB 1WCQA 5DJZB 2DICA 1IQDB 4KTDH 2DQTH 2P42B 1JGVL 1OAZL 4YR6B 3KPTA 5ADOL 3UBXA 4A2LA 3LQMA 4Q6IC 3LKOA 1KCUH 3WEXB 5DYOA 3RVVC 4QXWA 4P0DA 3AM8C 5SWQA 1K5NB 5ECJE 4UNVA 2CK0L 3BFOA 4XWGH 2WAHA 4PLJD 1WC7B 1YUHA 4H26B 4PTUB 4K3EL 3T04D 2VL5A 1J8KA 3W11C 1UZ6E 2NR6C 1IC5L 4NO3B 2P45B 3INUL 1UCBH 4BH8B 1WLHA 3MRJB 2W91A 2BNUB 2I25N 4JQVA 5TDOA 3ZT6A 4HJJH 2CLVA 4CN6A 4YHYC 5JHLL 3VFTB 4ZS7L 5T5FH 1YDPA 3OPZL 1GGBH 2YD8A 2Z0BA 2GITB 4HIHB 4RA0C 1RZKC 4Y5VA 5ANME 3SKNA 4DK6A 5EA0H 4YHKH 4P59L 1VFOA 3IKKA 3WKNA 2X4UB 4HQQH 1LMKA 3S3SA 1EVTC 1U95A 1QRND 2FR4B 1I1FB 1G7PA 2K3TA 5C0FB 3PNWA 3SE8L 1ZANH 4OF3A 5GGTA 1FSKC 3BN9C 3WIIL 3MZGB 3D3VA 1P4IL 4GAFB 1EJ6A 4JG0H 5FO7A 5C07E 3S5LB 1HINH 1BX2A 1N6VA 4YDIH 1HDMA 1MI5D 5HGBB 4ODTL 3G5ZA 4IDJL 1KNOA 2CRIA 4F2MA 4KJYB 4NUGH 4DGIL 4RAUB 4JRWA 2B1HH 1CLOH 3P4LA 4FFWD 2CRZA 2Z91A 2DM3A 3C5SB 5B38B 2R0KH 4OIBA 1I85A 2BRQA 2D03L 2FX9H 2AQ3A 4MNGE 4G8FB 5TPWH 5L0QC 3DSNA 5FM4A 4JFXA 3QEUA 1UA6H 2Q8BL 3L5XH 3KLHC 3S35L 2WUBL 2V2WA 3KPRA 4RWYL 4DKFH 5D72H 3LDBC 5F7DB 2WANA 4U1KB 1C08A 3IJYA 5H35B 2A6DB 1TJGL 2DWEA 4NQCE 4PRID 3WHE0 4K55A 3GB7A 3MFGB 5D1XA 4R3SB 3VXTB 1VERA 1QBLL 3AY4C 3H9HB 4AK1A 4JM2A 4MXQD 2BVPA 3MRKB 3C8HA 4MQ7A 2ZNXA 2G60H 1ZA3A 3QFJB 1KCVH 2BMKA 2CXGA 3MYJB 2AEQH 1BQLH 4R90L 3T2NL 3L7FB 3BPOC 3BKJH 3NBNA 4LSRH 4X4XA 3TYGH 3MQIA 5C09E 4LLVA 3H6JA 4U2YA 4JRXD 2HKFL 2AEWA 5HTSA 3E2HB 1RJYB 4AEIH 2HLAB 1JGDA 2AJVH 3ULVH 1CZ8H 1X5LA 1YEKL 3SDCC 3KAAA 3EO9H 1NLDH 2IAMC 1NGQL 3QIWA 4F37K 5HYJD 1IGYA 4PD4J 3PGCB 3QCVL 1X3DA 5EIVA 5D1ZD 4OLWL 1F42A 4GG6F 3BAEL 3CU1A 1DBKL 4NWUH 4PJBE 3EYSL 4WHTB 3NFPB 4KTYA 5B8CB 3HRZB 2BOBA 4HK0A 1EO7A 3OKEB 5GS0D 5I6XC 2DB8A 4WEUD 5F8QC 3CX5J 5I1KL 2YPVL 4M93B 5D7IA 3D69B 5HHVH 3U7YL 3D39D 5HI4C 1D9KA 1TVBA 2VNCA 4AH2A 5MENE 5CHNB 3IETB 2P5WE 2HFFA 5EU6B 4X5XB 1RZ8B 1CU4H 2YD3A 3GI8L 1ZHNA 3O45B 3HC4L 1QR1A 3HKFA 4OFDA 4X6DF 5EIIA 1X6NA 3G6JE 5CINH 1T7XA 1KBGL 1NKRA 5ERWA 3S98A 1QFWH 3C6LD 3MBEB 1FL5B 2FNBA 4Z7UE 3BIKA 1YEGH 2CDFB 4NNXB 5FYJD 5BZDA 4HWEH 4XC1H 5C8JB 2YPLB 3B9KC 2H2PD 5B22A 1S8DA 3MA7B 3X13B 3CIQA 3VMPA 4P3DB 1DQDH 3SKJH 3GMNB 1KTRL 1FL3A 4XVTL 1IAOA 4PJIF 3UTSE 2X4OA 1DBMH 1E28B 4OZGB 1QLRB 1NBQA 1VEPA 1C12A 5BW7A 1U3ZA 5E8DL 1MJUH 3DARA 1G6VK 5KS9A 2J4WH 3FB6A 2YRZA 1A1NA 4JFFD 3AFLA 4YHNA 4ZQKA 4M03A 5AAMA 4HH9B 4UT6H 1A22B 5GRUH 1CXFA 1QKZL 4RMVA 3AGVA 2VR5A 2UWEA 1MIEH 2ZSWB 4NQVB 5C0IA 3O2DH 4Y4HA 3P4NB 5H37H 4OLYH 4WEBH 2DQHH 5JPNB 4L4TD 4PG9A 5I17B 4HWZB 2WINB 3OKOB 3VI4E 4KTDL 4NCC2 2AKRA 5E7BA 3VRJB 2DQTL 5CEZE 3O3UN 5GS1A 1A9BB 5BQ7B 4X4YA 4YHIA 5BVPH 5E24E 1KCUL 4G9FD 3BJ91 4ZYKB 5HHOE 3PWPE 1UJ3A 5FYLE 5HDBF 4JFYB 3BXNA 1JWMA 1HWHB 5IB2A 3ESVF 3MV7D 2M2DA 4RMSA 3OMZA 2A74B 2D7QA 4NIKB 4FG6D 1BECA 4WHCA 4KI5E 5D7KD 5C08D 3WLBA 1ZHKB 1UCBL 4LLQA 4XNQA 1M05B 3HZVA 4Y4FD 3CLFH 5EU4A 1AGBA 3D2UA 4PRPE 3DXAE 1NH6A 4MD5B 2EDLA 5IQ7H 2DWDB 4HJJL 5KSVA 4EUPA 4QHLA 4QRRE 1G0XA 4FXKA 3FONA 5T5FL 4GRWE 1I3RB 3FOLA 4DZ8B 3OL2A 4I1NB 1GGBL 5J6GA 3RIAK 3L5IA 4R9HA 3P3YA 3UMTA 1WIPA 5CSZA 3W0WB 1H8OA 1AFVH 2R2EA 3GSRA 4WWID 3TA3D 1CLYH 1KTLA 2YRLA 3O3BB 4RQQA 5EA0L 3ZHDA 4YHKL 1LDPH 4OD2A 4JQXA 4HQQL 3QDME 4N8VG 3KHOA 1MFAH 1TQCB 3SY0A 5IFJA 2EE2A 1JZ6A 1PG7H 3GHEH 4KK9C 1ZANL 5F6HI 1IZJA 3T0EB 4JG0L 4CDHA 3TO4D 1HINL 3N85H 3KYMA 2IQAA 4G9DA 4PJFB 2VKXA 1KV3A 1Y6KR 3H7LA 4R4FH 3GSXB 4E41E 5DFTA 3RVUD 4NUGL 2DN7A 2B1HL 1CLOL 4BH7A 5DJ2B 5IVNA 4PRBA 2DDQH 1OSZB 4UAOB 2R0KL 4PGZA 3HZKA 4M9OA 5TPWL 5KAQG 1F3JB 2FX9L 1KLGB 2ICEB 5DUBB 4R7DB 4Q97A 1UA6L 1FBIH 1KLUB 2G9HB 5JXEA 3L5XL 1HQRA 3HNSH 3ARGD 1VFUA 1MCQA 3T3PF 3U2SA 4DKFL 5D72L 2R0LH 3U1SH 2GI7A 1JPFA 4XPBH 1EFQA 3TZVB 1X6LA 5DMJB 3SGKA 4YFLI 4X6CE 2B2XH 3SE3A 1WBYA 4EN3A 1VKXA 1CGYA 4RISH 4UTBH 4OZHA 2JJWA 2G60L 3P73A 4EI6B 4EXPX 2YR3A 3CC5A 1KCVL 3OWEA 3BQUA 5GPRA 4WW2A 4P4KB 1K3ZA 5HHPA 4P46A 4ZXBB 2AEQL 4U1JA 1BQLL 1RAMA 4JN2B 3BKJL 4LSRL 4BQ6A 3TYGL 4JZNB 4WU7B 4F8TA 5D9SB 4ZAKB 1VFAA 3QB7C 5IJVA 4D3CH 4AEIL 3P77B 4L8BB 4NQCB 2AJVL 3ULVL 3Q48A 1CZ8L 4YZFF 3BD5A 1GJIA 2Y7QA 4JKKA 5MI0B 2IBZX 3EO9L 3QXVA 1NLDL 3ARYA 4LF3A 4DAGH 1LK2B 3BYYA 1AO7E 3VH8A 4G6FD 1FFOA 3EOTH 4TVPD 3RWCB 1R5VA 4IM8A 4QKXB 4YO0B 3VMOA 4Y7MA 4NWUL 2VISB 1N64H 2ZUYA 4MAYB 4QF1A 5EUOA 1P1ZA 4ZFOL 1IEHA 2F54B 4XVJH 3MLVH 1S9YB 3G08B 1QLFA 5C09B 4J7RA 4LLUB 2CLRA 5K9OA 1PZ5B 1U8PA 4KKLC 4NT6A 1YN6A 2RQ8A 5HD8D 1S7UA 3VDBA 4PJXE 3LN5A 4XNMA 3AUVA 4PRNB 1R3JA 4PRDA 2Y36H 5HVFB 1LO5B 2G2RB 1CU4L 2AK4A 4PJBB 4HKZB 3RL2A 4X6BA 2FO1A 5CINL 1AGFB 4HUUB 3M45A 5GGVY 5HBBA 3H0TB 3E3QC 1QFWL 5IM7B 2MCG1 1YEGL 4KJQD 2D3VA 1DLHB 1FZOB 2X1WL 4OF6A 4HWEL 4PJ8A 4XC1L 4I0CC 2C3VB 4PJGE 4G80B 3RIFF 5F7WC 3ARBC 4OLXH 2EDHA 3SCMA 1XIWC 2CDEB 1FVDA 4HW6A 4QRUA 4ZOCA 1DQDL 3SKJL 2P5WB 2KZ1B 2YN5A 1CFSA 4YUEH 1DBML 1BP3B 1PFCA 5JMOC 2DI8A 3DX7B 4J3WA 4Q0XH 3KLSA 5E6ID 4OLZH 5F9JB 1JYNA 4ALAH 3U0PA 3QEQA 3RWHA 3W5MA 1MJUL 2Q6WB 2R1XA 2HJFB 2XT1B 4KVNH 2UZXB 2J4WL 4ZOBA 4Z7UB 4IOSD 3QUZA 4LAJH 5FF6B 4UT6L 3DVGA 5GRUL 1F58H 1MIEL 3O2DL 3HI1B 4OLYL 4WEBL 2DQHL 3G9VA 3IDGA 5I1EH 4YXHH 3MGOB 4M5ZH 4PJCA 4I3SH 3U4BH 4I5BB 1T4KA 2XZCH 3UTSB 1G0DA 3MLXH 4P4RB 4LAQH 4MLSA 4JR9L 5BVPL 1LD9B 1QQDA 5EBLB 4JRYA 4IMKC 2YD5A 3VWKC 3MLWH 5GS2H 3ZHLA 4XVSH 4XI5C 4DFHA 2H8PB 3DRTB 3UTZB 1YC8A 2A0LD 4EEEA 1QBMH 3EZ8A 3RAJH 3ILPB 3UPRB 4I13B 5D93B 5J3HC 5D2NC 3QDJA 1UJTA 1VADA 1NAMB 5KVFH 1IAII 3DVNB 4Z0XB 3CLFL 5HY9B 3BH9B 3C8KA 5BZWA 5F96H 1CFQA 2Z4QB 3SDYH 3VWJA 5IQ7L 4CVXA 4TQEH 2IPKA 2J8HA 4PJ9A 4QCIB 2FHFA 1AKJB 1B88A 4MB3A 3O6FD 1WUNT 1W72H 1X5ZA 1AFVL 1ORQA 3UP1A 1RFDH 1CLYL 4PBVC 1PDKA 3PHOA 4LRIA 1OSPL 5ACLA 4S1DC 3KPNB 1LDPL 1ITBB 2A77L 1MFAL 4A6YB 3T0AA 3REWA 2HRLA 4I18B 1PG7L 3GHEL 4P5KA 5E8NB 2O61A 3MRNB 4PRPB 1U3HD 2PW1B 2EH8H 2VITB 1JN6A 2AJZB 3KPOB 4QRRB 3N85L 1O0VA 1HK6A 4FN0A 2AJXL 2AP2A 5L2KA 2AJYH 3C5JA 5JZ7D 4R4FL 3EOBB 4PRIA 1U8IB 5EPMB 5HJ3A 1DEEB 3G6AA 1KIPA 4HZLB 3P11H 3N1MC 4R96A 3QDMB 3DMMD 2DDQL 5E8PB 4P2OD 5GRJH 3FKUS 3G04A 4NHUB 3VD5A 1KPVA 4KKCC 2ZWLT 3BP6B 1MCPH 4ZFOA 2V5YA 1XGTB 1FBIL 3PHQA 1D5XA 3HNSL 2IADB 32C2A 4MX7A 4BZ1H 2R0LL 5DDHA 3U1SL 4HSQA 4JRXA 4XPBL 2OL3B 4HUMB 4E41B 1MCOH 3BHBA 4RFNC 2B2XL 4RISL 4UTBL 3FT3B 5HYJA 1AQKH 2HP4A 4I0PD 4CJ0A 1AQDA 3JVGC 3QNXB 4BKLB 5DRNB 4I2XE 1IC1A 2DS4A 3MCG1 4U7KA 3PQYD 1OB1A 1LE9A 1FGNH 3ETBF 3ARSA 5D6DC 2X4TA 4D8PA 5HYFA 5IMLA 4D3CL 1AD9B 1XGQB 3CFKA 3F6IA 2UYLB 3EYUH 4HAGA 4C54A 1RSFA 2HJKB 4LSUL 3NPSB 1MEXH 2DOCA 4ORGB 2NY6C 3OXSA 4DAGL 1WITA 1FLTX 3D39A 3MREB 4NC2B 2J1KA 3S88H 3W5NA 1RIUH 3EOTL 4WI7A 2A6IA 4IIQB 2VDLH 3HR5A 4JCLA 1N64L 3QUMH 4XVJL 4OIAA 4D94A 2BVEA 1NANI 4OCSH 1CCZA 2OJZH 2XWBA 4HX1B 2ICCA 3VD3A 5C0GB 2MHAA 2ZZUT 3FQNA 5I2IA 3O2DA 3P9LA 3IVKA 3C5ZC 5D2LE 2CKBB 3MJ8A 2ID5A 5CJXA 5IF0B 3AMLA 4U1GC 4RCAA 3OB0H 1JFQH 2H26B 4HWUA 1HSBB 1UFUA 3QUYD 3PWVB 3U79A 5FKAA 1YEHH 3QJFA 4U1HA 1MCWM 4F7CA 5GIRA 5DRXB 3KLAB 1BM3H 3WN5B 2X40A 3GJEB 4CUCA 4OGZA 1FZMB 1NFKA 3L5WA 4O2CB 5FUZH 4JFQA 5CP3H 1OAUH 4JFFA 1FLRH 2GY5A 2LTQB 3PGFH 4G42B 3ZE2E 2Q20A 4NM4H 1XMWA 5KANG 5IJKC 3GGWA 3TVMC 4OLXL 5F3HA 1U36A 4X6FB 1HCFX 3NCYS 4YUEL 4NHCH 4Q0XL 4ZFZA 4OLZL 1UYWH 4G9FA 5T3XE 1RURH 2ZG3A 4KVNL 2R9HD 2ZSVB 5L2JB 3DX6B 1QFHA 1FFNB 1OLZA 1F58L 2CPCA 2VJXA 4E42A 3FQRA 4OF5A 1R3IH 5JNYB 1QHOA 5I1EL 4M5ZL 4I3SL 3U4BL 5HDLA 2DL9A 2YA1A 1HSAA 1U93B 1WZLA 2XZCL 3MLXL 4Y4FA 4ZO6A 4LAQL 3IDNB 4GAYB 1YPZB 2XRAH 2GKIA 4QRQA 1INDH 3LSOA 2AXHA 4MDJB 3QO1A 3MLWL 5CGTA 1G7JA 4XVSL 5FYKD 1U8MB 4G6MH 2NCMA 3L3OA 3LEXB 3HLAA 1QBML 2FL5B 4X7SH 2WIMA 3UYRH 1TITA 3K8LA 1EVUA 4IHOB 3ECBB 3CGTA 1NC2A 1OTTC 5F7YC 3U9UA 3D3VE 5EFIA 1WCBA 5KVFL 3MNWB 3QCUH 1OF2A 1KT2B 1W0WA 2BVOA 1JK8A 4HDIB 3MRCB 3U82B 4Y4KB 5IESH 5F96L 3SDYL 1FFRA 4GBXC 1AGEA 4TQEL 5KG9A 2Q1EA 1KENH 5JHDD 3PDGA 3TO4A 2X4NA 2VLJB 3EDEA 5K9JH 1BVZA 4MCYA 4XC3H 2BRRH 3JZ7A 5JIPA 1CFTB 3O81A 1W72L 3TCLA 5KVEH 4LHQB 4KMTH 1RFDL 5DK0B 1HHKB 3DX8A 3RWEB 3VFOB 1F6LL 2N4IA 5BV7B 5IV2A 3KPRE 4HGWB 3QIUD 1JZ8A 5DQ9B 4Z76B 3GK8H 3BZ4B 1BEYH 1BAFH 1DR9A 1JHKH 2EH8L 2HTLD 2X1PA 3VXOA 4Y2OA 1HE7A 4JKWA 5FO8B 1T1ZA 1A9EB 4K7PH 4V2CB 5EZOH 4GQ9H 1T1YA 4NN7C 2WP3T 3ARGA 1NBZA 2AJYL 2ITCB 1CGSH 3NCMA 5CSBA 3O3DB 3P11L 3DRQB 2P8MB 4TTGA 5JW5A 2FEDD 1IM9D 5GRJL 1U9KA 2Z93A 2PXYD 4PJDA 1XF2A 5I8OH 1NCWH 3EBAA 1I1YA 4K3DH 1LILA 5KN5B 4YFDB 1MCPL 3DTXA 3RVTC 4YWGL 2HT4C 4FHBD 5ISZD 5F88A 2FJFA 4BZ1L 5DMKB 3TIDA 1G9NH 4ZSOB 1J0YA 4UINL 4FXGB 5TQ2H 4PGEA 1FO0B 1MCOL 3ARFA 3VCLA 1I7UB 3MJ9H 3KPMA 2IJ0C 1BHGA 1FE8H 1NUNB 3FHQA 1GC1H 1AQKL 2Z31C 5E4EB 1CI5A 3PIQB 5KANI 4NP4H 3BJLA 1F3RB 5ACZA 2GK2A 3OX8B 1D5MB 3LPFA 1FGNL 3ULUC 5D7IE 1W8OA 2HRPH 5C71A 3UZQA 1MCCA 4Y1AA 3OKDB 4WUUD 4HHAB 4P5TD 4CMHC 2O5ZH 3RZCD 1MVUB 4NQTA 1BGXH 4MJIA 3EYUL 4XX1G 5IHZA 1A6PA 3HE6B 4KHXH 4M62L 1EERB 5F21B 4QT5A 1MEXL 4EBQH 3U4AA 3RKPA 4NKOB 2DBJA 4E5XA 1JYWA 3S88L 5JW3H 1RIUL 4KK5D 5DRZA 2VAJA 2VDLL 1INQA 3VFNA 3GIZL 3QWOA 4J8RA 2MCPH 4WWKA 3MTRA 1GIGH 3QUML 5KJRH 3KYAA 3B5TA 1EMTH 1OPGL 4OCSL 1TTGA 2OJZL 1YYLH 1GYAA 3CSBA 4X7FC 1N5AA 4LLWB 4M5YH 5EZJB 5B39A 2DMBA 4WI8A 2OQJA 4WW1B 5CGYD 1DL7L 4FQ1H 4R4BA 2HT2C 1NGXB 2YD2A 2XZZA 2RCSH 1LDSA 5KS9E 2LE9A 3O4LA 4L8DB 3UTQB 1YEHL 4JZOA 2LVCA 4ERSH 1BM3L 2UWEE 3OKNB 5FUZL 1Z5LB 3CUPA 3NN8B 1T0MB 3QEGH 1OAUL 3RPIA 4KDWA 1FLRL 3PGFL 1F4XH 2Z92B 1H15B 4NM4L 4OV6F 2Y23A 1U8KA 1S9KC 3IJHB 5AZ2H 3WL9A 1KJMB 4LLMB 4HG4K 3KPPB 4NHCL 1GZQA 1BFOB 3S97C 4CNIA 4O5LH 3IDYB 1EFXD 4EI5A 1PSKH 3SKUD 4PJ5D 1UYWL 4W68A 1LWRA 4Y8AA 1N59B 1RURL 2MFNA 3L3DB 4YBLC 4YJZL 3DYPA 4OKDA 5DK3A 4UQ2B 3FJTA 3NCEB 4C57C 1OP3K 5E8OA 1R3IL 4ISVA 1GGCH 3X14B 4KK6C 1QFPA 5JORA 1OWRM 2EDDA 3TT1H 3WS3A 2XRAL 4FFVC 3S4SB 5IB5A 4GG6B 1QBAA 1AHWB 1INDL 1M1SA 1YUHB 1AC0A 4NPYB 2VL5B 3O11B 3HUJA 2C1OA 4XH2A 2XICA 2R4RH 4G6ML 3F12B 4NQEB 4U2ZA 1EEYB 1K8DB 3GRWH 3K4DA 3UYRL 1NJ9A 4X7SL 3VD4A 3V79C 2CIKB 5D7JC 2PYED 3ZE1E 5IBTH 4L3AA 1SM3H 3IFPB 1CGVA 2P8PA 5TDOB 3ZE0E 1QP1A 4O00A 5A2JH 2WWKO 4WU5A 3JWDC 4OF0A 3QCUL 4KJPC 1TTFA 4GS7C 3VGDA 4JO3H 2BSRB 2X09A 3PV6A 1NCTA 4PBWD 5IESL 2Q7NA 5DRWA 4Y5VB 1U3HA 3OJMB 1KENL 3SKNB 5DJCA 2I07A 5E9DA 5M94B 4X6DB 1YQ2A 5IGXH 5K9JL 5CJ5A 3FZUD 3SDDA 2R0WH 1JRHI 4XC3L 4DK3A 2BRRL 4WVRA 3OF6D 5KVEL 4UBDC 4KMTL 1G7PB 5T5NG 1H3XA 5KSAB 1DVFD 4BFGA 3N1PC 3D3VB 3I02B 4JVUA 3RQ3A 3DMMA 4LCWD 2CO7B 4I0KA 4P2OA 1CDCA 3GSQA 4B5EA 1X9QA 5FGSA 2OK0H 3GK8L 1BEYL 1BAFL 3KDMA 2KL6A 1JHKL 2UVFA 1S9WA 4PJIB 1KNOB 1PLGH 3EIFA 1HI6A 2Q7YB 4ZNEE 3IDIB 5DUPH 2Q3ZA 4K7PL 5EZOL 3JWNC 5HVHB 4GQ9L 3ZKXC 3RFZC 1J88A 3QIBB 2EH7H 4OZHE 1QSFB 1CGSL 4LPTA 4JPKH 4ELMA 3W11D 2VLKB 3MZTA 4O2FA 4XCNB 1P7QA 5GSRA 2YC1A 1FFPB 2PO6C 4G6KH 4XHJC 2X89D 3QG6A 4M7KH 1SJEB 5I8OL 1MVFA 1NCWL 3QULA 4K3DL 3DETC 2R29H 1C08B 1F4AA 4L3CB 3BP5B 1TFHA 4ZNCD 2ZUQC 1CQYA 2JCCA 4ZPVB 5F1IB 2BVPB 5K9QI 1YMHB 2NY5L 4EJ1C 1RPQA 1G9NL 4PGBA 2HLFC 4BSJA 5TQ2L 1N4XH 2X42A 2BMKB 3MJ9L 5DURD 1J8HD 1TTUA 1MELA 5I75B 1P84K 4FQCH 5EUOE 1FE8L 4G8GA 1JPSH 1JV5A 4K8RD 4LRNH 1GC1L 2YD9A 1F02I 3D48R 4UOJA 4LLVB 4NP4L 4OM0H 5DC0A 4FXLA 1XEDA 1N3NB 1JGDB 2EIEA 5T3ZE 3KJ4C 2HRPL 3A6CH 1WBZA 5IVZB 1EEZA 4N0FB 2O5ZL 3TJEH 5DXWA 1BGXL 1JNHA 1KPRA 5DD5H 4KHXL 3IU3B 2F5AH 1RZKH 1W0YT 3RWIB 2AK4E 3RA7H 4EBQL 3GNMH 3SHSA 3X12B 5JW3L 5L9DH 3VXUD 1H3GA 4FA8A 3QO0B 1CXKA 1RZGA 4HK0B 2MCPL 2NY0B 1GIGL 2XKUA 4GJTB 1QYGL 4HIXH 5KJRL 1EMTL 1IAIH 3B2UC 3T65B 4JAMB 1YYLL 2BVQB 3B9AA 4M5YL 4MHHG 1ZHLA 4AH2B 3U48A 2RR3A 2QQLH 1PQZA 2HFFB 2ZG1A 4V1DA 5GISH 1T20A 1JF6A 3M07A 4L3ED 4FQ1L 1ZHNB 3HS0A 3S9DB 2OYPA 4NOFA 3LHPH 3QEQE 4X5LA 3WBDA 4TNVK 1J1OH 2AQ2A 5ERWB 2RCSL 5C0EA 5EU5A 3BIKB 2XN9A 2J6EH 2OSLB 4ERSL 5FFLA 2QTEA 1KN2H 4S2SA 4F7PB 3D6GA 1JF1B 2VN7A 2BOCA 3NIGF 2ENYA 3QEGL 1H5BC 4EXKA 4IMLB 5CLTA 4PJCE 1F4XL 4NQSA 2X4OB 2YPKB 3V52H 3O6MH 1MH5A 1X4XA 3QEHB 4CMMB 1WWCA 3NCFB 3MRDB 2IH3B 4LGRB 2FLBT 4JRYE 4JE4B 4WTZG 2A73A 2B7DT 3PXHA 1X5AA 3HG1B 4KDVA 5AZ2L 2FD6H 1DQJA 2XTJB 5DJ0A 1N6UA 3TEUA 4HT1H 1GVIA 1IGIH 3E6HA 4TN9A 5KS9B 3K46A 3EDDA 4S1SH 3DUUA 4ZQKB 4O5LL 1PSKL 4ONGH 1RK0B 2UWEB 4HV8B 3QDJE 4YBHA 4XHQA 3MCKA 5FA3B 4F57H 2DRUA 4PP1C 4JY6B 2E7LA 5MEQB 1I75A 3MXWH 4QRPD 1U42A 4LDOB 3UTTD 1J12A 5GS1B 1GGCL 2AJ3A 3MV9D 5GGSA 5ENWA 1HYSC 3NCJH 3MLYH 3TT1L 4LCCA 1JWMB 2BSTB 5F72S 4MNHA 2Y5TB 5EN2B 4LLAA 3MRRA 3CSGA 5CD5D 3RVXC 4GMSL 5DJDA 3HE7D 5J06A 4AIZB 2R4RL 3T0WA 1JHTA 4G3YH 2FJHA 5JOEA 3FB7B 1HZHH 3GRWL 2P47B 1B4RA 3AREC 5IBTL 5E1AB 1SM3L 5EU4B 1AGBB 3D2UB 1S3KH 1OW0A 3O9WB 5SV4A 3UAJD 1ADQH 2WV3A 4XPGH 5KSVB 4FXKB 4JO3L 1HHIA 4F8QA 4BFIA 3F5WB 1F90H 3PWLA 1RU9H 4M1GH 3VXNB 1MJ8H 5L2KE 3ARPA 3T1WA 2NYYC 3H3PH 2X4PA 4PRIE 1A1OA 1M71A 3MC0A 5IGXL 2R0WL 4P3WA 3RWJA 1I7ZB 5DMIH 1NGZB 3BKMH 2NY1D 2F8VA 4V2BA 1NANH 2N56A 4GRLA 4DN3H 3QZWG 5MHSD 5KZCB 5E8EA 1TPXB 1IM9A 3KYMB 5C92A 2IQAB 3JTSA 3CFIC 2OK0L 5F3BA 5K9KB 4KK8C 5HHMD 4JRXE 4Z8FH 1PLGL 3OGCA 3MNVA 4YK4B 2FX8H 5DUPL 5ISZA 2EDRA 5BVJB 4PRBB 5HGGS 3VFUA 4Y5YB 2EH7L 1E4XH 5HYJE 5C0AD 1D6EA 1RQ5A 3HZKB 4U6TA 4PJAA 2W38A 4JPKL 4MHHI 1RJLB 3FFDB 4OZIF 1J9CT 3KXFA 3LKNA 4LKXB 3CFEA 4WGVB 7CGTA 4M7KL 4CVZA 3FT2A 2DI7A 4LK4A 2X9WA 2R29L 4LGPB 4PGDA 5A3ID 3E2HC 2KQMA 3WJLA 2DBLH 5J6HA 4NFBA 2VQ1A 3I6KA 4XB8A 1E6JH 4ZFGH 3U0TA 3LKPA 4E0RB 3D39E 3UJTL 4R8WH 4WUUA 3BESR 1Q38A 4CADB 2F53D 3NACH 3RZCA 3VXMA 3CC5B 1GGIH 1U8JB 2FSEA 2QL1A 2Y4SA 4JKMA 4MD0B 4FQCL 4GW4A 4OCNC 5IEHB 1JPSL 2P24B 4LRNL 5CAYB 4JJ5A 4OM0L 5B8CC 1UKSA 1VFAB 5GRZA 5ID1A 5IJVB 4WHYG 4Z7WF 5DGRA 5FYJE 2UUDK 3A6CL 3DURB 5CP7A 1UCTA 3L3KA 1TCRB 5IFHH 3TJEL 1FFOB 1NDGA 2BNQD 5DD5L 1R5VB 2F5AL 1RZKL 3RA7L 4J3TA 2ICWI 1BOGB 3GNML 3T3ME 2CD0A 1NGYA 5L9DL 3O8XA 3RZWA 1MY7A 5DLMH 4F7MA 1TZIA 2D7PA 5K9OB 1R6VA 5GZND 4NT6B 3MBEC 3LS5H 5EC2B 4HIXL 4JFFE 2EKSA 2V9QA 1IAIL 2Y06H 3BGAA 1EBPA 4OKVA 4RGNB 1C7SA 4CN1A 5MERA 4G8IB 3T0BA 4K94C 3P9MB 4X9GA 2CUIA 1NUFA 2QQLL 1ZT4B 4MJ5A 5DHYA 5GISL 3RL2B 2WBJB 4QHMB 1LEIA 3RJQB 3LHPL 1IZKA 4G9FE 4JFHE 2WIIB 4Z18A 5T1LD 4CN4A 3H9SA 4ZDHB 1G6RB 2ZOLA 1J1OL 2AQ1A 4JZJA 4QHUA 4WO4B 4ZFFA 2BC4A 2J6EL 3VXSA 4S11A 4U1SA 1KN2L 4CDGC 3FFCB 2PTUA 4N0CD 1MCLA 2XKNA 1I1AB 5TF0A 3GRWA 2NXZB 4ZUWA 5JW4Q 4DUWA 4HK3N 5DJ6B 2FYYA 3V52L 4MA3A 1CFSB 3O6ML 2B1AH 5CJ8A 4DZBA 1WV7T 1UH2A 2A6JB 3D25A 1S5HB 5GSVA 2QV2A 3MRHB 1IGCH 2FD6L 5J8OA 4HT1L 1IGIL 3TBVA 3DBXB 1PKQB 4ZTPH 4S1SL 2HJLA 4ONGL 5CUSH 5HHNA 1U8LA 2GW5A 2KDGA 1R0AH 3RVWD 4F57L 3QQ4B 2OTUB 3O3AB 1I8IA 3IDGB 4XPTH 4HIJA 4Z7VA 1WBXA 1V3MA 3MXWL 1T4KB 4LPCA 1UWGH 2PYEA 3RWGA 3CAFA 4LKCB 1RD6A 4W81A 2ORBH 3NCJL 3MLYL 3CFCH 1EK3A 2GT9A 3FQUB 5DVMA 5CBAB 2Q8AH 5ICZA 4J1UA 3WHXB 5DJ8B 3KPLA 1ZV5A 1CWVA 4PP2A 3S96B 5BS0A 4RA3A 4Z7QF 5J0BA 1AXSB 3CFBA 3HPJB 2R1WB 4G3YL 1HZHL 1TQCC 3TGXA 1DN0A 4NZRH 2AI0H 3OF6A 1T1WA 1QRNB 5H8DA 4P9HC 1S3KL 5BZWB 1CFQB 1VACB 3UO1H 3ARZA 1DVFA 4CVXB 1ADQL 4XPGL 3IXAB 3T0EC 2ED7A 3MO1B 4M02A 2IG2H 4R7NA 1F90L 4JANB 1MI5B 2XXMB 4NUJB 1RU9L 4M1GL 4RDQF 1MJ8L 5F1OB 1ORQB 3U0WH 3H3PL 4PV8A 4Q6IA 4AEEA 4N8VA 3ROLB 1IGJB 2X7LA 3AM8A 4X9IA 4B7LA 2EDXA 5DMIL 1I3GH 1KC5H 1OCWH 4KKBC 1DSFH 4UAOC 3BKML 4PJDE 5T1KA 1OT2A 3REWB 2E8ZA 2Y9RT 4URTB 3GMMA 2P7TB 1CDYA 4WI6A 2O61B 4DN3L 3MRLA 2E8YA 2Z8RA 4MNQA 5H2BA 1Q8MA 3HAEG 1HHGA 4APQD 3H2WA 4GRMB 1UEMA 2X89A 1AR1D 3KPQA 2I27N 1Z9LA 4Z8FL 5C07D 3MOBH 1J0IA 3V0VA 3TZVC 2FGWH 4PRIB 5HJ3B 3G6AB 2X4RB 1UKQA 5DMGC 2E6PA 1E4XL 3G04B 4OUUB 3STLA 4TVPE 2EYSA 2BDNH 5FHBH 2XPGA 3C8DA 5B3JE 1I8LC 4P4KC 4DTGH 3PHQB 4ZXBC 1D5XB 1HH9B 2JLLA 2PF6A 4IDLA 3GSUB 3IGAB 2IBGA 3JUZA 2UY6A 4MX7B 4Y1AE 5DDHB 1CXIA 4ZAKC 4JRXB 4PJEF 5B38G 4NO0D 4MJIE 1WIUA 2DJSA 1KJ3H 1MWAB 2DBLL 4OCXH 1E6JL 5MI0C 4ZFGL 3ROOA 5IUSA 4W4NA 3PHSA 4ODUA 4R8WL 3SO3B 4MA8H 5HYJB 3NACL 2B0SL 1WJ3A 1ZKAA 1GZPB 1GGIL 5IK3B 2Z35B 1ED3B 2NW2B 5D1ZB 1DP0A 2UUDH 3MMEB 3NMEA 4YE4H 2EIDA 4PS4H 1EBAA 1LE9B 4MAYC 1RUPH 4NSKA 1NC4D 3WNMA 3VXUA 2J8UF 5IW6B 4TSCH 1YEJH 5IMLB 2ESVA 2J6EA 4Y16C 1JWUA 1S9XB 2AXGA 3CFKB 5EUKA 5J57B 3K2UH 4F33A 1EPFA 3D39B 2NY3D 5IFHL 3RTQD 3G5XA 3U30B 2NLJB 3WFZA 1OGAD 3HR5B 3BP4A 3AY4A 1T6WA 3O4LE 3NA4A 3J8F7 3WFEH 2NTSP 1E27B 1Y0LB 4O9HH 5DFVC 1G84A 5IB3B 3VMNA 4AENA 4JHWH 3K1DA 4KKCD 5FCSH 4RBPK 3L3GB 3SDXA 3T1FA 2W1NA 3C6LB 3LS5L 3UDWC 1B0RB 4CAGA 4NNYB 4FQXD 1JWSA 2Y06L 1MCSA 3P9LB 5GZOD 25C8H 4BSWB 1AD0A 3V6FA 3TBSA 4PR5A 5I1LA 5I16A 3LS4H 5DWUH 1PEZA 3DO7A 1WEJH 5FCUL 1KEMH 5MEND 2FJGB 1M4KA 1JRHH 5C0BA 4OQ1A 1ZK9A 2IAMA 4AL8H 5LG1A 2PCPA 5GIRB 1NKOA 4WI4A 3IDMA 2MWCA 3CJJA 3FHAA 3QR2A 4LEXH 3RNKB 5K59E 2DF3A 4JFFB 1AR2A 1T03H 1MCKA 1R5IA 3UROR 1F6AB 3GGWB 5LKNA 4L4TB 3OKKB 3GKWH 4X99B 1N26A 2B1AL 1ADQA 3U9PH 2NW3A 5C86A 3STZB 3TPUB 4ZFZB 5HPMA 4G9FB 3HUJE 1G7HA 1IGCL 2COQA 4MZ2A 4ODWA 4ZPTA 3ULVC 4ZTPL 3DV4B 3OAYK 4I3RH 4PJ7A 3V0WH 3MV7B 2ADFH 4QRTB 5CUSL 4C4KT 1QSEA 1PW3A 3SKOA 5D93C 1R0AL 4EUPG 5C08B 3D87B 2DIAA 4XB7A 4XPTL 3WDIA 1NCDH 8FABB 1YEIH 1HSAB 1UWGL 3B9KA 4Y4FB 3CH8A 4QRQB 4U6YB 2EZ0C 3LSOB 3SDAD 2ORBL 3CFCL 4OV5B 3N0PB 5CEZD 5E9DE 4M7ZB 3T8XA 2Q8AL 4MJ6A 4ZUSB 5LXGH 5A16A 4J23A 5HHOD 1K4CA 4MSWA 3TA3B 5A40E 4YFEA 4JREB 3K7UA 5EFIB 3VFVA 3IB4A 4NZRL 2AI0L 4KI5D 4OB5H 4CBPA 4AEFA 3OXRA 2GQHA 4J4PC 4PJHF 2ZUTA 3UO1L 1RZIB 1AGEB 1KPUA 3IDXH 3PABB 3TO4B 2ADIA 2IG2L 1FAKT 3DXAD 5F89A 4MCYB 1P6AB 3TCLB 3U0WL 4NQXA 4ELME 3W39A 1IKNC 2L7JA 5ESQA 1I3GL 1KC5L 1OCWL 1CFNA 1IJ9A 1DSFL 5IBUG 5IV2B 2VE6A 3DHMA 5IB1A 4U0RB 1P7HL 2QLVB 3MUGA 1WICA 1T1ZB 3WJJA 1IILE 3FRUA 1AIFB 5CMAB 2JCCE 3RL1A 2W0FA 3ARGB 3BVNA 1NBZB 4FQ2H 3MOBL 2B4CC 2FGWL 3WIHH 3L5JA 1CXHA 1QFWM 2DMKA 4PTTB 2HMID 4TRPH 3JXAA 5TDNA 4G8GE 4WDIB 3OAZK 1EXUB 3QXTA 2BDNL 5IMMA 1I1YB 3LQZA 1J0HA 4K2UH 4M8VA 5FHBL 3FT4A 4PY7A 1X5IA 5I66B 1JBJA 4DTGL 2HVJB 3OKMA 4XXCC 5E5RB 3LH2H 3O0RH 5I73B 2X4QB 4JY4A 4CL7A 5BRZA 3JV6B 1KJ3L 4OCXL 1T22B 4P3CH 3NPSC 1S78D 5BMFH 3ZKMC 3Q3GB 4MA8L 3ULSA 2ZOKA 6FABL 4G6FB 1B4JH 4IIQC 4FP8H 1MCIA 3BKYL 3VG0H 5FGBC 2D4DA 4YE4L 2VSCA 5ACZB 4PS4L 3GSNH 3O3EB 3LB6D 2FH8A 1Q9WA 1RUPL 4Z0BH 2XXCB 3BGMB 3QQ9C 1R3LB 4TSCL 1YEJL 1P5UA 1G7IA 2BCKB 3PDDA 4UU9B 4ZUVB 1S7TA 2DKUA 5IHZB 4NM8H 5IR1A 4A2MA 3K2UL 2G5BA 1Z9SA 5KSBF 1ONQA 5GGRA 5DRZB 4RIRB 1INQB 3RWFA 5D1QD 3VFNB 2FB4H 4FTVD 3WFEL 1AO7D 5CCKH 2XN9E 5IBLC 4O9HL 4XXDB 3D0VB 4JHWL 2DMCA 3WN5C 1CFVH 4NQUA 5T1LA 1X5FA 3EYOA 2HAZA 3R4DA 3T0VA 3RVTD 5EZLB 1BWMA 4UNUA 1MAJA 25C8L 2LTQC 5I0DA 1QSZA 2DTSA 3LS4L 5DWUL 1WEJL 1MHEB 1KEML 1YJDC 3EYQC 1JRHL 4AL8L 1ZMYA 4JZOB 5I76A 4OGAD 2DQIH 3LKRB 5E6IB 3BUTA 2N7AA 4LEXL 2IWGA 3OR7A 5FYKE 3RPIB 2PW2A 1LP9F 3IFLH 1YNTA 4IOFD 2GK0B 1T03L 4N9GA 4TUJA 4DGYH 3TN0D 4KU1A 2RJMA 3OKLB 3PV7A 3Q5OA 1ZEAH 5IEKA 1NCBH 2FDBP 3P40A 3WNNA 3RGVD 1A02N 3QXAB 2F74A 1CDBA 3OAYH 5HI5C 3GKWL 5JDSA 1BREA 3SEPA 1UVQA 3FOMB 3U9PL 5BOPA 1F11B 3WFHA 2Q86A 4CNIB 3BI9X 5HGDA 4U3HA 1MLCB 4B41A 2QKIA 3V5KA 3OG4B 2BXZA 3HMXL 3MSPA 4I3RL 1UC6A 1A7RH 2A2QT 3MLZH 2ADFL 3MR9A 4JDVA 3ULUH 5E8OB 5BOZG 4X0KB 1BPVA 35C8H 3CVHH 2VDPH 5LQBH 2VR4A 4LNRA 1ZSDB 1YEIL 3WE6B 4YNYA 4D0DB 5DFWH 4Y4KC 4ZTOH 5GRVL 3IFOA 3ARBA 4X7TA 1XIWA 3O2VH 3QP3A 1Q9KA 1J11A 4XH2B 1CIDA 4ODXA 5LXGL 1VCAA 3ZDYF 3O6FB 1XGRA 2J12B 1U92A 4QEGA 1X7QA 3UTPE 5IW1B 1CK0H 4NKIH 3TNNB 4K9EC 1MNUH 4OZFH 2P8PB 2H32A 1G7QA 3AROA 3SKMA 4WU5B 4GW1B 3P30H 4R0LB 3I9GH 4UDUA 5BV7C 4LBEB 2GSGA 5F9OH 4OB5L 2FHCA 5DEFB 2VUOA 3QBTB 4JDTH 1RJZB 1MFBH 1U3HB 3MJGX 2C3GA 3IDXL 1UADC 2E9JA 2B39A 3OHXA 5ISZE 3PDOB 3BH8B 5FUCE 3HR6A 3HPLA 2J3SA 5CFHA 1QFUH 4KDTC 3LZFH 1TMCB 4PJAE 4H1LH 2XFXB 3VWKA 4I9WE 2ITDB 1IKFH 1D5BA 4K07A 1KB5H 1MFDH 1FYTA 3KXFE 2XQYK 1TCMA 3DMMB 3QUKA 4P2OB 3GSQB 4WTWA 2DTMH 1UKTA 2PYFA 3QNYA 4JGUA 3KDMB 5D2NA 1S9WB 2C7UA 1HI6B 1UENA 1Q94A 1IGTB 3X17A 3OAZH 3VXRD 3H42H 4BQ8A 4TUOB 1HOCB 5F6HJ 4OF7A 4BELD 4M1CC 4WUUE 5EORH 4FQ2L 4HLJA 3PL6D 3VXME 4XCFH 3WIHL 1T0NB 1GAFH 3LRHA 4HUVB 4L4VA 4TRPL 2AV7B 3EAKA 4O2FB 2HT3D 4M61B 4O2EB 5HPOA 5GSRB 2YC1B 3U46A 2GAZA 3QG6B 3REVA 4HJGA 2N7BA 5E4EC 1L6XA 3HZMB 4I0PB 4K2UL 3DIFA 3WFCH 4S1QH 5FDYA 3IF1A 2X70A 4KV5E 4HWBA 4KJPD 3PQYB 4D9LH 5SWZA 4X7CC 1JUFA 3D18A 1R5WB 1YMMA 3LH2L 1RY7B 3O0RL 2Q76A 2X4SA 4JKLA 4LCIH 4HUKB 43CAA 4HEPG 3HE6C 5IVXA 1OL0A 1AGDA 4P3CL 4BJLA 5BMFL 5ITBH 1OD9A 1VGKB 2EXYD 4UIMB 1S7WA 1FHGA 1B4JL 4EDWH 3RHWF 1YY9D 3E6FA 4HKXA 5I1AA 4FP8L 1JPGA 3VG0L 5C0ND 1OGAA 5E5MB 2ZUUA 3GSNL 2VKWA 5H37G 4Z0BL 3FO9A 3JWDH 1EEZB 3QQ3A 4HLZH 1H8NA 5EOCJ 1UZ6F 1RHHA 1SBSH 4H0IA 5INCB 5EOTB 2D0FA 1XF4A 5ID0A 3I75A 2CKNA 4PPTA 2FB4L 3DYOA 3QUYB 3MRIA 5CCKL 1F5WA 4PRAB 2BP3A 3VXSE 4QO1A 2FO4B 4JPIA 4M4PA 2PO6D 3DX9A 1LEKA 2HTKD 4LCYB 3HMXA 1P6FA 4ZUUB 5EC1A 1ZE3C 1CFVL 3MRMA 3W81A 3JVGA 1WZKA 3WUWB 4PG2C 5HYSB 3EYFA 3AXLA 4KGJA 1NBYA 4HMCA 4HD9A 3BUYA 3QXWA 3CDGB 1O7SA 3HS0B 2NZ9D 3V8CA 2B5IB 1I9EA 4XCCH 3LV3B 1BVLA 4PIRF 1Z0MA 5EU5B 2LV4A 3QH3B 4MD4B 5D6CA 2M26A 4OZIB 5CS7A 5EH1A 1KJ2B 2DQIL 3IDYC 5E2JA 5JIIA 3PGDB 4U4BA 3VE0B 1CE6B 3GKZA 3HTLX 2PN5A 2V6HA 5JPMA 1MLBB 3EOYG 4Z7VE 3IFLL 1QUNA 1XF3A 3DGCR 4XVUC 4DGYL 4NQSB 2NY2D 2PYEE 1ZEAL 1NCBL 2YKLH 1MJ7H 2XWTB 4OCYH 3B9EA 5T1DH 2W60A 1UH3A 1OTSC 4JEGB 2AXFB 1T80A 3E6HB 1AGCA 3BGFB 3T4AA 1AHWC 5BS0E 5FOBA 3CU7A 1SJHA 2F58H 3SDAA 3H9ZA 3X3FH 5JLZA 2KZWA 3MCKB 5DTFA 1D7FA 4HS6A 1A7RL 3QUXD 2RFXA 3MLZL 1DQTA 5T3XD 1Q0YH 4Z7WB 5DHVB 3ULUL 35C8L 3CH1A 3CVHL 5I74B 5KW9H 2VDPL 4H8WC 5LQBL 2JB6B 4Q6YA 4BM7A 1FV1B 4Z5RB 5DJAA 2BSED 4PREA 2NPLX 1UB5A 4MNHB 3ARWA 1PG7W 3FTGB 1R3HA 4ZTOL 1QPXA 1ZT1A 4GAGH 4Y5VC 1K8IA 3TVMA 5IJKA 3MRRB 4KPHH 3O2VL 5JHDB 1K4DB 2R1YB 4K7FB 3V95A 4ZG1A 1JYXA 4J3UA 3WIHA 3GMQA 1UXSB 1CK0L 4NKIL 3PE9A 1SYSA 2BSSA 4MNQE 1CR9L 5KSAC 2IPUG 1IL1B 3P30L 3I9GL 1G7MA 4PJBF 5F9OL 4AT6A 1HHIB 3QIUB 1M7XA 4BFIB 4PLKC 4JDTL 3CNKA 1DDHA 4XRCB 1FIEA 2FX7H 1MFBL 4MXVE 5HHQA 5J9PA 2IALB 2OXHA 5BO1H 5F1NA 5CJQH 5HVHC 3RWJB 1QFUL 3LZFL 2JK5B 3QIBC 5I30H 3ZO0A 5FKPA 1IKFL 1KB5L 4I48B 4NRZA 1MFDL 3ARTA 2AVGA 3BT2H 1CT8B 5E6YA 1IM9B 2ED9A 1MHCA 4JFPA 5E94B 3SPVA 4QXTA 2PXYB 2OR7A 3GSNA 5IHLB 4R6UA 2R23B 3D9AH 3OGCB 3G6JF 4TTDC 3SGJC 3ZKSD 3KPRD 5EWIL 4WI5A 4FQPA 4Z7UF 4HG4J 1A7OH 5EORL 1I4FB 1J5OH 1D6EB 5D1XD 4U3CA 4XCFL 3KGRA 4ZS6D 1YNLH 1GAFL 4JM2D 5HGHB 1BLNB 1TLKA 3TESA 5INDA 5I75C 1F8TH 2UZYB 2W07A 4UB0H 2E6JA 4F3FB 1CG9A 4H5SA 4JM4L 2WLYA 5SWSA 3VXUE 2H6PB 3ARED 4CVZB 2ESVE 3WFCL 2E7CA 4S1QL 5GQBA 1YC7A 3NTCH 4POZD 4MQXD 2VLLA 5I1DA 5HDOA 3VRLE 2CGRH 4QWWC 4D9LL 2VQ1B 3KR3H 1DE4A 3VJ6B 3LKPB 1HXMB 3CZFA 4HZAA 5C0RH 1UQSB 4GG8B 4WUUB 4YXLH 4P5TB 2CLZB 3RZCB 4ONHB 3QDGA 4LCIL 2AV1B 2BVUA 3QIWD 5ITBL 3VI4F 4GW4B 1Y6NR 4XZUA 1ZVSB 4RZCA 4KKAD 4EDWL 4JJ5B 3QNZA 3NIDE 4RSVA 5D1QA 5ID1B 3SDXE 2NY0C 1T83C 4FTVA 4HJ0C 2V2XB 5FA4A 4GMTH 5J1AA 4QTHA 4BSVB 3JWDL 4YAQA 3KVQA 1NDGB 1OAXH 1I3UA 2OX5A 4KI5F 1SBSL 1D9KD 2IBBA 1EGJH 4NN6B 3HCVA 3MJ7A 5C0BE 4P2YA 1HN1A 4S10A 2HKHH 3D0LA 3QJHA 4F7MB 5I8KH 2GUOB 1TZIB 2HH0H 5CZVH 3LPWA 3V6OA 2EKSB 4GRWF 1JNNH 2Z31A 1WFNA 1LHZA 4QRSA 5MERB 3TH2T 1G9EA 3JV4A 1IM3A 1A4KB 4LPYA 2FH6A 1QEWB 4P99A 2G75A 4MJ5B 4UOW1 2OP4H 1SYVA 2CH8A 2GIYA 2VZOA 1ZVYA 3CVHA 5I19H 1RZFH 2MPAH 3OQ3B 2MOVA 2ZOLB 4JZJB 4I8DA 5GS3A 2XTJC 4ZFFB 3EO0A 2VDRH 1F3DH 4PJ7E 1ES0A 4WFGD 4GFTB 4U1SB 1EFXB 3P0YH 1QSEE 4PJ5B 3I6LE 1T1XA 1XH3A 4L29B 4QTIH 1ZLVH 2XQBH 4M43H 3TJHC 2XWJB 2OCFD 1KELH 1NPUA 5I0ZA 2FYYB 4UQ3A 4Z7NE 1M6OA 4Y4HD 4RFEA 3BIBX 1JGEA 4OZFA 3ZZ1A 2X9YA 2NZIA 2YKLL 3QPQC 1MJ7L 3VRIA 1ZXQA 4OCYL 5T1DL 3QXDA 5GSVB 4MA7H 2C4FT 1LEGB 3KWWB 3EYVA 4LVNB 3HZYB 2JIXD 1P84J 2GSIA 2HJLB 2Y72A 2Y07H 2AGJL 2FIKA 3P4MA 5HHNB 1U8LB 5FYJU 4XTRC 2F58L 2ADJA 4NFCA 3X3FL 1EHXA 2ICWA 1I9JH 2CR6A 3GSWA 3VFRB 4N0UA 2J8UB 1XGUA 1A6AA 5AUMB 5GGQH 3FRPG 4HBCH 4X6CF 3WKMH 1Q0YL 5DMYA 1KB5A 3WNLA 4GXVH 2PYEB 3RWGB 3ES6A 2VMFA 1YY8A 4KRLB 4UDTA 1GRWA 2EDBA 3O9WC 3H7BB 5KW9L 1HCVA 2O5XH 3F7VB 3CX2A 3VGAB 4ZMAT 1DQQB 5HHME 2A83A 2IEPA 4GAGL 5HGAA 4KPHL 1CICD 2J8OA 1BF8A 4HGKC 1WZMA 1IEAA 3ZSSA 4RX4A 1BWWA 3EFDH 4CU6A 4JCMA 1NFDA 4G6JH 5AYUH 4WNQA 1T1WB 5DEGA 3GEWB 5L8KB 3FB5A 2YD7A 1TPXC 3QFDA 2C3XA 4LCWB 4O51A 4K94H 4HPYH 3GIVA 1KIUA 4K3JH 2FX7L 1EO8H 4Q6IB 1QZ1A 5BO1L 4N8VB 4NKMA 4YK4C 5CGMA 5CJQL 1VPOH 3VXRA 1MAKA 3B2VH 4Y5YC 5TE4H 5CIPB 5I30L 3DNKA 3QZWA 2XV6B 3TP4A 4PJXF 5IT2H 3PL6A 4X5WA 2VDOH 3TBTB 1KTDA 5H2BB 3BT2L 1JNJA 4RNRB 2FWOA 3KPQB 3MLRH 1N2RA 1T5XB 1VGEH 2DM4A 3BZDA 1S7QA 2ATKA 2Y6SD 5JXED 2F8XC 3D9AL 1ZGLA 1KXTB 1S9VB 5BRZE 1OOAA 5GGSY 5J11C 2DQGH 1RI8A 3CX5K 5FGRA 3SGKC 1T21B 5E2WH 1H0DB 3SE3C 1A7OL 4XBPA 3MNZB 4JQIH 1V3JA 4PJGF 2R2BB 1EHAA 4K7PY 1YNLL 2EYSB 3NZ8B 2XI9A 4KZEH 3L6FB 2VXSH 5DURB 1QO3A 1J8HB 3MRQA 3UEZA 5DI8A 3BEWA 4UB0L 3V6ZA 2VR9A 2VZTA 3U7WL 3BWUC 3BQUD 4JFOB 4P46D 4GO6B 4XPHH 2D7TH 1N7MH 3EHBD 3NTCL 3GMPA 3G5YA 3KPSA 4JDZB 4LLDA 2CGRL 1QA9B 3HC0A 3QI9B 2I9TA 5AAWA 3DUSB 1SEBA 3KR3L 3ROOB 1P4LB 2HWZH 5C0RL 3KS0H 1A64A 4YXLL 5KSUB 2IFFH 4WI3A 5CEYA 5CSGA 4YDJA 2OMNA 1PG7X 4KKBD 5DZLA 3Q1SH 4R4NC 1MHHA 4MDIB 3VXUB 4NRYA 4U1LA 1L0YA 4XMPH 3PWNA 5JO5B 1MIMH 3CXHJ 4QYOB 5HDQH 5AYQA 3AU1A 3WD5H 4GMTL 4P9HH 2VIRB 2PO6A 1MJJB 5LJYH 4RGNC 4F33B 4GW5B 3ARDD 1N0XH 1U58B 3T2OA 1OAXL 3ZKNC 2FECI 3EJYC 3BP4B 3GJFH 1EGJL 3C9NA 3T77A 3EDKA 3M1BA 4L3EB 4WJ5B 1JZ2A 1LE5A 2WBJC 2HVKA 4AENB 2HKHL 5I8KL 4P57B 2AK4D 2LU4A 2NTFA 2HH0L 5CZVL 2NNAA 3R0MA 1S7RA 4WO4C 4U6HB 1FG9C 5BXFA 4W70A 1ZA6A 3Q6GH 1JWSB 2H2SD 1JNNL 3LEYH 5CZXC 5FXCH 1OAYH 1CS6A 2P5EA 4HUXB 1X5GA 2GJJA 1I1AC 3F7YA 3TBSB 4PR5B 5I1LB 2EIBA 4PJ8D 4YGVA 4ETQA 5EU7C 1B0WA 1SEQH 2OP4L 4C83B 4Z7OE 2APVA 5I19L 3MCLH 1I7TB 3SCMD 2C4FU 1RZFL 1J05A 2MPAL 1IC4H 1XAUA 3MRBA 3TNMB 1A7BA 4RGMB 4GUPA 1SJXA 2VDRL 3G5VB 1MCDA 5MP6H 4PY8I 2HG5A 1I9RH 3QEQD 1MCHA 3P0YL 4PLJC 1FN4B 1PY9A 5E7FA 2GJ6D 3E3QE 1DQMH 3IXTB 4QTIL 4Y16D 2XQBL 3QUZD 4M43L 3K74B 1KELL 3QUXA 1BOYA 4Z78A 1T6VN 3AB0B 4QRPB 4DN4L 3ILQD 3UTTB 1UB6B 2GTWA 5HPMB 1ZLSH 1WAAA 4MA7L 2VWEE 1G7HB 3MV9B 2VLRD 4D0BA 4DKEH 1ZWIA 5ITFA 3MFFB 3MV8D 4KGLA 2Y07L 3H3KA 4JRYD 2MQ0A 5F9DC 3V7AG 4QNPE 2OR8A 4GKSB 3VXPB 5FGCE 1I9JL 4QY8B 3B6SB 1FNAA 4QHKJ 3HE7B 1FZKA 4RFOH 5GGQL 4Q9RH 4HBCL 3WKML 1UXWA 1HNGA 1FH5H 3QDJD 5ESVA 2EXWD 4GXVL 1FL6B 4C56A 1H5BA 5KSBB 2O5XL 5DJZA 1HILB 1IQDA 4XCYA 3T8XB 5FV1L 3VWJD 5A16B 4YR6A 1ORSB 2MJWA 2IFGA 4PJ9D 3X3GH 4J12A 4LRIC 3TH4T 4HFWA 1FYTE 3EFDL 3VFVB 4M8QB 4TPRH 3TYFB 3BD3A 4FFWC 4G6JL 4TULH 5AYUL 2H9GB 4OAWA 4OFYD 2EIZA 4H26A 3VFPB 2NY1B 4OLVH 5D2NE 1E4KC 1EAPA 2EYRB 3EDFA 4NO3A 3DJ9A 1BQHG 1EHNA 4ZO9A 4BH8A 4K94L 4HPYL 4M6AA 2P46B 4WUKH 3BPCB 2WLZA 4K3JL 5HHMB 2BNUA 4OSUH 4CW1B 3B3IB 1EO8L 3WIFB 4L4VE 1K6QH 4Z77A 1VPOL 5L2KD 3ULVD 1IAIM 3B2VL 4MXQC 1CFNB 5TE4L 3T0DA 2GITA 5C0AB 5IT2L 5D2LF 1LP9B 5LGHH 2CK2A 3HAEA 4NNPH 2VDOL 4P5MA 2H41A 2X4UA 4U49A 1Q9LA 2JB5H 5SWZE 3FRUB 2W65A 1II4E 3RL1B 1EHLH 4EQ2A 1I1FA 3MLRL 1YMME 3AREA 5C0FA 4KJWD 2EZ0D 4ONFH 2DQGL 5IVXE 2Z8SA 1TZHA 5E2WL 4TNWK 3MLUH 1A2YB 3KYKH 3SO3C 1UH4A 2F53B 2NXYB 3ZE2F 5JTWA 2I9TB 4N0RA 1ZT7A 5DT1H 4KJYA 4KZEL 4PY7B 1OGAE 5D1ZC 5DZOA 4RAUA 2VXSL 1CE1H 1S5IH 3C5SA 5B38A 2IPUK 4XX1E 1NAMH 3TFKD 4XPHL 2D7TL 1N7ML 4JY4B 1TZGH 1QG3A 4M7JL 5GS0C 4HCRA 3EJZD 2HWZL 5FEBA 5F7DA 5FYLH 3ULSB 4U1KA 3DO3A 2IFFL 3FQXB 3U30C 3RNQA 3VGHA 5H35A 2BNQB 3CPLB 4R3SA