2WWMC

Crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
GSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/structural protein
molecule keywords OBSCURIN-LIKE PROTEIN 1
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 98
sequence length 98
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wwmC00
3TBSA 3U7WL 4PRAA 4LCYB 2WBJA 2FJGB 3I6GA 1FLRL 1RUKL 4NRZA 4QRPD 5IB4A 2Z8RA 3D25A 3V6BR 4Y19E 3VD5A 1P9MC 4CU8A 1ITBB 4L3CA 4RGMB 4JRXD 5D1ZC 3MNVA 4G42A 3MMEA 3D85A 2D31A 5BOZG 1N5AB 4P5TD 4QHKI 2H2SC 4EN3A 2C9AA 3NFPB 3WO4B 5ILTL 4U0RC 2VLRD 3HI6L 4F7CB 4L8CA 4H88L 5ID1A 3EDFA 5KJRL 5E6YA 3DVGB 3KYKL 1CICD 4KFZC 1XGTA 4E41E 2VZUA 1QHOA 1JWMA 3MJ7B 3W9EB 2B1AH 1P7KA 1UYWH 4Y7MA 4LSTL 1MHHA 1V5JA 4ONGH 4XPHH 4KJWC 4QT5B 5TE4H 1KIQA 4TNVF 1GGIH 1MFBH 4PJHB 5KSAB 3B9KB 3TZVB 4JANA 2CLRB 3S4SG 2ADIA 3VXRA 2HG5B 4P2CG 1DUYA 1QRNE 4HKBB 1TQCB 2RJMA 2AKRB 5E6IC 2YK1H 5TE7L 5DRWA 3P0VH 2WAHA 4ZXBC 1IC5H 3GKWH 4KUCD 3FT4A 5DMKA 3KS0J 1ACZA 1EERB 1QSEA 1J8KA 3QPQD 4X9FA 1HWHB 2X05A 1FZJB 1OF2B 3BP4B 5LCVH 3SE3A 3QH3B 5C0RL 2YEZA 3WKMH 3CXHK 4YXLH 1JHKL 4Z7WA 3DROA 3DHJA 4ENEC 1HH9B 1KEGH 2CDEB 3QQ9C 4OM1H 3IDMA 4OCYL 4LCIH 5F72S 2X1OA 2FB4L 4XPTH 1K2DB 4WW2A 4WI3A 1UXSA 5FUZL 3QQ4B 4RGNB 3G9VA 2Z91A 3NABL 3ROLA 5I73C 1J0YA 3L5JA 5CCKL 2X4NB 4XP4H 3O3UN 4PPTA 3OQ3B 4X8XA 1LHZA 1ZSDA 3WJLA 4MWFA 1I9IL 3MLXH 3M8OL 2B39A 5CJBA 3VXPB 5IGXL 2Q8AH 1RJCA 2NY0C 3QHFL 1OTSD 3HC0A 1PLGH 4N8CL 4NQDB 2O93L 2HLFC 1UADC 3QDJD 4OD2B 1QFPA 3IKKA 1KN4H 4XP9L 4KK8C 5ISZB 1I85A 1X9QA 2WUCH 4JFFD 4K8RC 3PWNA 3SHSA 5K9KA 4OFVA 5HHOD 1KOAA 4M8QB 3SKJH 1QLRB 1I1YB 5F3HB 3EOBB 2CO6B 3UJIL 2VABB 1FH5H 3MROB 4M43L 5JNYB 2NXYD 3EDDA 2J5LB 5GGRB 2GJZB 1NCCH 4X99A 4Q58C 3V8CA 4KZEH 1M71A 4NZUH 4TOYL 1KCKA 3FB6A 2J8UB 2VLLA 1AP2B 1IAOA 4M00A 3H6JA 5F88A 5T3ZD 3SGEI 2VN7A 3Q48A 3RWEB 4X0KA 5GGSA 5KVEH 2HFFA 1JYVA 4X6BA 3C5ZB 1BQHG 4WI5A 2NY4D 1S7WA 3VGBA 1QBML 4F7EB 4Q6IB 1IKFL 1IM3B 4DN4H 2CKBA 1UB6B 3CFDB 2XA3A 1N4XL 4Y4HC 1ZEAL 5IJVB 4C56B 1J10A 5F3BA 3MV7D 3FO1B 3C8KA 5DURB 2NY6D 4Z0BH 1V3MA 1JP5A 5JOFB 3S98A 2HKHL 4PJ9A 2NXZD 1E4WL 1HXMB 1KFAL 1K85A 4JO2H 1UKSA 2C1PB 5I1IH 4PGDA 1EPFA 4OKVA 1NFIA 4JFOA 3DHMA 5GS0D 3SCMC 3MLPA 3MV8A 3D9AH 5DQDH 3LB6D 2B4CH 3SDCD 3ARDC 3HUJA 1DBKH 5IMKA 5JHLL 4QRQB 2EH8H 1WFUA 4NO3A 3VH8A 1L4IA 1ZHKB 2DF3A 3E0GA 4OZFG 5IW1B 4P2QD 3OKNA 3GHBH 4ZS7L 1I1CA 4A6YL 1NGQL 4HF5L 4HX1B 4H26B 2AEPH 3UO1H 3UPAA 2JB6A 1UM5H 1FGVL 2X09A 4L3EA 4TVPL 5GJTL 4ZYKA 4IOIA 2D3VA 4YHLL 2R2BA 4P57B 5D7JC 3JWNC 4A2LA 5IF0A 4FP8L 3MJ8A 1QLEL 3O9WC 4NKDA 3WDHA 4JFZH 3BXNA 2C3WA 4NGHH 4WFHD 3QUMH 3MYJB 5KW9L 1JCKA 1OM3L 3MLZH 4S1QL 3DX7B 4WUUA 3L3OA 4GKSB 3CH1B 1P53A 5FA4B 1DQJA 5DYOA 3VFGH 4BH7B 1LE9B 1K5NB 4U3HA 2VLME 4H8WH 2W60A 3CFEA 4HFUH 4M4RA 4P9ML 1ZHLB 4GRLC 3ES6A 1XH3B 4KV5E 1MI5D 3D2UD 2ZPKH 3UDWA 5DQJA 4W4OA 2FGWH 2A9MH 4AEFA 3CSYA 4LQ1A 5EZIL 3SE8L 5EA0H 4KROB 3THMH 3JTSA 4ZOCA 1MJJB 1CZ8L 4GKZB 5DRNA 4XAWH 2C5DC 5DUPL 2GTWA 1X5JA 5CZXD 3CVIL 3UTOA 1UWXH 1BBDH 5LAXA 5J3HD 1KPVB 2I9LA 4PLKD 3GI9L 4JGJA 2NW2B 4MXWH 4KWUA 4OLZL 5M94B 1YYLL 3NA4A 2F19L 3MJGX 5I6XB 3U7YL 1JK8B 4RISL 1FFOB 3PDGA 3OKDB 4PJ8B 3LZFL 2WMPA 4LAQH 1OB1A 4IEFB 5C0NC 4XPGL 4K3GA 1MNUH 1LO5A 4POZD 4X6EB 3DX8B 2YKLH 2DBJA 1RSFA 2VC2H 3VI4E 2Y9RT 4EQ2A 1JWUB 3QCUH 2ZJSL 1NCDL 3HUJF 5E2VH 3BZEB 2C3VA 1RUPL 2HYMA 1AE6H 4B53A 1I9JL 3ROOA 2VAAA 4Y4FD 1IAIH 1YZZA 1KJVA 5IW3A 3CUPB 1V05A 2OS7A 3HE7A 5I1HH 3D0LB 1AY1H 3ZE1F 3IAPA 3P9MB 2RCSH 4GAJL 3CVHL 3O6FD 3QJFA 1PSKH 1HYSD 3U0TB 5GRUH 4YBQC 1BLNB 1R5WA 1O0VA 3IFNH 1S7TA 2GI7A 5TPWL 4NHCH 5L88L 1ZT4B 1LILA 4HWNA 4X4XB 5C70A 3I2CH 3BDYH 1NLBL 1JJUA 3QFDB 4PRIE 2B20A 5FYLH 2E6JA 1SEQH 4JM2A 1CXFA 1YEDA 5IT2L 1LEGB 2NPLX 4AJ0A 1IGFL 2FSEA 1PG7X 4L1HA 1HHJA 3TBSB 4DZ8A 3BD4A 3BJLA 2WBJB 4PRAB 4DQOL 3I6GB 1A7NH 4NRZB 1A47A 3TPUA 5IB4B 4ORZC 4LSPH 4PS4H 4XGZA 3D25B 1PEZA 1EBPA 2ITDA 2IPUG 1RZJC 1BPVA 4WRLA 4L3CB 4B41A 5D7KD 3MNVB 4G42B 3MMEB 4X5LA 5L2KA 4Y4KC 3D85B 1MAKA 2D31B 3PWPD 1BQLL 3HFML 1S7VA 3KPSE 4C4KO 1YDPA 4EN3B 4KQ3H 3VGAB 2MQ0A 2EO1A 2BRRL 3DVFA 2DQEL 4L8CB 1H3TA 5ID1B 4NOFA 4GXVH 4PJGF 1MRCL 1YC8A 3EYQD 1XGTB 5GRXG 3MRDA 2FX7H 1JWMB 3WJJA 4OZIE 5FO7A 1P7KB 2V5TA 1OAQH 1KLUA 1MHHB 1A02N 1HDMA 2APFA 5HI4D 1KIQB 2DM2A 3U6RA 4NT6A 3T0EE 4IRJC 4JANB 4LSRH 3EYVA 4H1LG 2ADIB 3VXRB 1DUYB 4UQ2A 4FMKA 3LPFA 1VFBA 4YNYA 5JPMA 5BRZD 3S36H 5CFHA 1NMBL 4RMTA 1FP5A 1EHLH 1MWAL 4OF5A 5DRWB 5EU3A 3ULVL 4TPRH 3FT4B 1OD9A 2ZUSA 5DMKB 1T4KA 1R0AH 1QSEB 1UVQA 3BZ4A 2FR4A 3L6FA 5D4QA 1SYSA 5TF1H 3P30L 3MRIA 2YEZB 4MDIA 5E56A 2OTUA 3GSRA 4Z0XA 3IXTA 1J1PL 2BNRA 1IBGL 3DROB 5CEZD 5E2UL 2Z31A 3DVNA 3IDMB 4LNRA 2CLZA 4UZGA 3QZWG 3MJ9A 2OI9C 4WW2B 5HVHC 1UXSB 3O0RH 4U1GB 3QEGH 5CJXC 2Z91B 4PP1D 5FM5O 5HHME 3ROLB 1JHTA 3KPRE 3QG6A 2LTQC 3VGHA 4YXKH 2A2QT 3EYOA 2Y4SA 4PJDE 1GAFL 1J8HE 2BVEA 4G43A 5DD6A 3UROR 1ZSDB 5E08L 2XA8L 4MWFB 4OF8A 2OTWA 4F58L 3FQWA 3I75A 3N06B 3HC0B 2YA2A 2AXJA 3CFIC 4CJ1A 2R0KL 3QDGD 5AG9A 3K2UL 1C1EL 1T1XA 3PWNB 2IFFH 1KB5A 1I1AD 2BXYA 3NA9H 3D39D 5IHLB 1BM3L 5K9KB 1AO7D 4Y8DC 4X80L 1Q9OA 5LKNA 5FAAA 3RPIA 5JHDD 4NWUL 1QFHA 3E8UL 2XYCA 3ULUH 4GBXA 4QGYA 1MFCL 4YDLC 3ULUE 3JWDL 4X99B 2XTJD 1M71B 1ZTXL 4EUPA 3LMJH 4ODTH 4Z7OE 3FB6B 2NNAA 2VLLB 1IAOB 1L7TH 1NKRA 1KGCD 4RA3A 4RFEA 3S3SA 2C4FU 5F88B 2BNQA 1FCGA 4OFKA 1CIDA 4U1HA 4XWGL 3O4OB 4BQBA 4X0KB 5GGSB 2HFFB 4X6BB 2OXHA 5CJQL 4M1DL 1S7WB 4A6YA 1EVTC 3H9SE 4OFIA 1N59A 2CKBB 3AREC 4LSSH 3LEXA 1NBZA 4LVEA 4UMGA 1EGJL 5I16A 4J4PC 2IPTH 5CD5C 3I02A 4I0PC 2OK0H 5F3BB 3C8KB 1S9VA 2E7BA 1A22B 5F6HI 3R4DA 4PJ9B 1A3LH 2YR3A 3MNWA 4ACPA 4XNZB 3CFKA 3TH2T 4PGDB 1HKFA 3KPPA 4AENA 1F13A 2A9NL 4Q9RH 2NY7H 2SEBA 5JXAL 3QI9C 2GAZA 1NFIB 4JFOB 1Z6JT 4HS8H 4WHDA 1S5HA 3MV8B 2XICA 3LEVL 3HUJB 5IMKB 3KR3H 1KTDA 5F7DA 1MCWM 4NO3B 3VH8B 4UV4L 5I1EL 1OW0C 5F8QC 1KCRH 1LD9A 2GY7B 3OKNB 1BGXH 4S1RL 4NQEA 5FM8A 3OR6A 2HFEA 4XC3L 1Z0MA 3TBVA 1UWGL 1T66D 4KGLA 4KKCD 3TESA 3OZ9L 1PY9A 5ICXA 6CGTA 2PTVA 5DA0B 3RTQD 4ZSOA 1PDKA 2JB6B 2R0ZH 2X9YA 1DQML 2Z0BA 4L3EB 4RRPA 4ZYKB 1JE6A 1YEGL 4IOIB 3VWKC 4D0CA 2R2BB 3B8SA 4FQ2L 1P2CA 3GJFK 2UY7A 4XHJD 1VGEH 5E4EC 4Z7QE 2NY2C 1A14H 5IF0B 3NIDF 4LIQH 3MJ8B 5DXWA 4NKDB 4M4PA 4X6DE 5HYIA 3BXNB 1NCAL 1IT9H 2BSTA 4FZEL 2GUOA 4QHLA 3OKEA 1OAUH 4WUUB 4L4VE 5L0QB 2DQJL 4G6AC 3L3OB 3SDAC 4NQCE 1SJEA 1GC1L 2JK5A 5HDOA 1A0QL 3ZSSA 1DQJB 3LHPL 5DYOB 5IQ7H 2W60B 1DBBH 3CFEB 1ZWIA 2AP2A 2XXCB 4K2UH 4R4BA 1PQZA 1FNEA 3ES6B 2CIIA 1WBZA 1A6VL 2I5YH 4DKFL 4HD9A 5CZVL 4X9GA 5DQJB 2A6JA 4HXBH 4HH8A 3CSYB 4MDJA 4OM0H 4RCAA 1CD9B 3PABA 1A1MA 1KTRL 2JJWA 3JTSB 4KK6D 1OVZA 3FT2A 5DRNB 1C8PA 4LPVA 3QFJD 2X1WL 3SPVA 5KAQG 2GTWB 3CVHA 3TJEL 4PLOB 4ONFH 2KZ1B 3FN3A 5LAXB 2I9LB 4HCRL 4GMSL 2Y6SD 4XI5D 4UQ3A 1SEBA 3I3EA 1BF8A 3U9PL 3ZE0E 5ALCH 4M7LH 3QISA 1VADA 4PBWD 1QSZA 1VEMA 3NZHH 4JN2A 5J06A 2IALA 5SX5K 1ZGLM 4CJ0A 2VNCA 1DBML 3VXSE 1OB1B 2B0SL 1HYRC 2EO9A 25C8H 2G5BA 5K33A 3VMNA 1LO5B 1IAII 3OAYK 2VLKA 4MXQC 3WO4C 5ADOL 1A8JH 1FPTL 5E2TH 1A7OH 4Q97A 3WNKA 1PFCA 4JFFE 1RZJH 5F7KC 4TQEH 2C3VB 3MCKA 3MOAH 5KVFL 3PL6C 3ROOB 5JO5A 2VAAB 1KJVB 4KRPD 4ELMA 1E28A 5E00A 3HE7B 4UB0L 1U8QA 4GS7B 1A6WL 2CQVA 32C2A 4JFHD 4UIMA 5F9WB 3L5XH 3SN6N 1SYVA 3QJFB 2XFXA 1N5YH 2H45A 3TBTA 4KHTL 5KSAC 1R5WB 3DI3B 5D2NA 1S7TB 4OUOA 3WDIA 1QSFD 4L8DA 4LVNB 1IARB 5I1LA 4K7PY 1NCWH 2JJUA 4JVUA 2DI9A 4KAQH 4QHNA 3FAWA 3W5NA 4PG2A 3ABZA 4JM2B 5K9OB 2IF7A 5T3ZH 1YEDB 3VFVA 5T3ZE 5TJWK 5DHVH 2FSEB 1HHJB 2FX8L 4DZ8B 3KNBA 3GO1L 5EDXA 1ZLVH 3G6JE 2Q76A 4CU6A 4J1UA 5EOCL 3IFOA 3QG7L 3TPUB 3CX2A 4XGZB 4BELD 4D0DA 2IBGA 2ITDB 3L3GB 5IQ9A 4XWOD 5E7BA 2ADGA 3P4LA 1VPOH 1H3VA 3W0WD 3LS5H 5L2KB 4PV8A 3WE6A 2I27N 1FG2A 2OR8A 2XQYG 1S7VB 1IGTA 1YDPB 3BT2H 3OKLA 1XF4A 4JKKA 2AJVH 4C57C 3JUZA 4RGNC 1CGUA 4QRRA 2PXYC 4JDTL 2ILLA 1J1OH 5KVGH 1YC7A 3HI1A 2Y23A 1XT5A 3MRDB 1CGXA 5DA4A 1EK3A 5T1MA 5DSCA 5FO7B 1IE5A 4NNYA 4FQJH 1KLUB 5B3JF 1MCOL 3WNPA 1HDMB 1JPGA 2FHCA 4G6FB 2Y07L 4PB0H 1EFXD 3U6RB 4NT6B 4POUB 1VB9A 3HC4H 2BDNL 4P2QE 4TULH 3D69A 3T77A 3O41A 3EYVB 5I74B 3VFMB 2PTUA 3C9NA 1OAXH 3HPLA 2X4RA 4UQ2B 4XCEA 1VFBB 4YNYB 5J12B 5JPMB 1CLOL 3WEXA 2JTDA 4K7FA 3TF7C 4JQIH 2GHWB 2DQFA 5EU3B 4NRXA 5F9OH 5I18H 3TCLB 2AJ3A 1T4KB 2GIYA 4P23D 2A38A 2FECL 1UVQB 3BZ4B 1KENL 5T1LD 3RJDA 4OLWL 2J5LC 3EJZD 2FR4B 4OBRA 5HHVH 4TSBL 3L6FB 4WDIA 1SYSB 2O26U 5E8DL 3AROA 3BH8A 1CDUA 1BJ8A 2YMXH 3MRIB 4YE4H 4MDIB 2OTUB 3GSRB 1KCUH 4Z0XB 2GJ6D 3IXTB 3QA3A 1YMME 2BNRB 2EDYA 3QXAA 5INDA 1CBVL 5D1ZD 4Q9CA 2Z31B 2DS4A 4FABL 3NCCB 1K6QL 3DVNB 1KC5H 4LNRB 1QSVA 2CLZB 1BWMA 4O58L 1DQDH 1D6EA 1F4AA 1X4YA 3D0VA 1S9XA 3C08L 5FYJD 5B3NA 4PJXF 1MI5E 3FT3A 1JHTB 4Q6IC 2Y7QA 5H37H 3T0AA 5JXEA 3QG6B 2EDTA 3EYOB 1E6JH 4HJ0C 5D7LD 4OCSL 4KJPC 4G43B 5DD6B 4ISVA 4NFCA 2OTWB 3Q0HA 1O5DT 1PKQA 4KQ4H 4UT6L 5DZOA 2YHGA 3FQWB 3I75B 4P4KB 2ERJB 3DMMC 5I0DA 1FLTX 1RK0A 1G7LA 2XZZA 3VXME 3GK8L 3JV6A 1T1XB 1MCPL 3V95A 1KB5B 4N0FA 2Y36L 4A2MA 4QXGL 3OF6D 4GJTB 1CF8H 1Q9OB 1T5XA 1EGJA 4DAGL 3JWOL 3RPIB 4ZXBD 1VEOA 3HNTL 4JHZA 4XBGA 4BZ2L 5FDWA 1DTUA 4GBXB 4JO1H 1I8LA 3IFLH 1WAAA 1QBBA 5C9JA 1DUZA 3VWJA 4EUPB 4XT1C 1LK3L 1UWEL 3UTSA 4YFLI 2D9QB 2ZSVA 3K80A 3DUHA 2NNAB 4XCFH 4ENED 4RFEB 1C5DA 2BNQB 4U1HB 1NC2D 1X4ZA 3NOIA 1JV5A 5TQ0L 3X3GL 4JFYA 3GNMH 5C0JA 1GPOL 3KJ6H 4QOKE 1B2WH 5C0DA 1C7SA 5BV7H 2DYPD 1UM6L 3V9FA 1BREA 2N56A 4RX4D 1KJ3H 4A6YB 1HH6A 1N59B 4HBCH 4OCWL 3LEXB 1NBZB 2LV4A 3ET9F 5I16B 1Q1JL 3DARA 3I02B 5CUSH 2W59A 5C6TL 1S9VB 2FX9H 2HWZL 2DI7A 2NY0D 5DO2D 4EI5D 1RUQH 5CJOL 1I7UA 4JG0H 3HAEG 4WY7L 1ZAGA 2BP3A 3MNWB 1OLZA 1U8LA 1XZ0A 3CFKB 4KK8D 2Y06H 3KPPB 4MZ2A 4AENB 4K8RD 4RMVA 1I3UA 2GAZB 1DLHA 2HMID 3EJYD 5BO1H 3H42H 1S5HB 2Z9TA 1ZVHA 4G3YL 1L0XA 4O9HL 4XVUC 1KTDB 1DSFL 4JR9H 1T1YA 5F7DB 3GDBA 3FKUS 1YECH 2VTFA 2AEWA 1C12A 1LD9B 4MMZC 4OZGA 4DVBB 4MNQA 1OAZH 4NQEB 2X4PA 4Q2ZA 3OR6B 2HFEB 2OCFD 2CGRL 2OTPA 1WBXA 4BFIA 3TBVB 3B5HA 3TT1H 1CQKA 3ZKQD 3ALPA 4XNUL 5ICXB 4ZSOB 3V4PL 3U9UA 2P5WD 2R29H 4LARH 2MPAL 2CLVA 4D0CB 4MA1B 5DK3A 1P2CB 3A0OA 5D1QD 1YEEH 3HRZA 1KBGL 1TJIL 5KZCB 2F54A 3DJ9A 5I0ZA 1CGWA 5D5MA 1NEZG 1H8SA 3PGDA 1RIUH 2DQHL 2BSTB 2GUOB 4QHLB 1MUJA 3OKEB 4Y4HD 1SM3H 1T0PB 4BH8A 1SJEB 1J9CT 2JK5B 5GIRB 4NC1C 3QYCA 3OXSA 1J86A 1J88A 3FRUA 4AQOA 1ZWIB 1MSPA 2EICA 4R4BB 1PQZB 4D0BA 1FNEB 1B0GA 2CIIB 1WWBX 4GG6A 1WBZB 1JNLL 1NGXA 5EOTA 5TE6L 1KPRA 2A6JB 1TZHA 2K3TA 4YHIA 1PZ5A 4MDJB 3GI8H 4JFED 5CEZH 3SCMD 3PABB 1A1MB 2X89D 4NO0A 4LSUH 5HYJA 3FT2B 3FOLA 4IOFC 4YDJA 3SPVB 1P4IH 4KUCF 2XN9E 2WBJC 2VXVH 4OCMC 4ZDHA 3CVHB 2GITA 4P2RA 3HLAA 4I3SH 5DT1H 4R26H 1KTKE 1SEBB 4UQ3B 2R56H 4FS0A 1IMHC 2G9HA 1VADB 3WSQH 3H9YA 3BO8A 5DEFA 5DUBA 2RBLA 4JN2B 2IALB 2BY3A 1Q0XL 4KXZH 4U1IA 4EXPX 2C3GA 1T83C 1WEJH 4IOSD 5M7QA 3ORJA 3F12A 2G5BB 2ZOKA 4EN3C 3GMPA 2VLKB 5C0AE 3QXUA 2AVGA 5D7JD 3ZHKA 4EVNA 3O9WD 1A3QA 2N4IA 2B1AL 1UYWL 2V5MA 2K1MA 3MCKB 4ONGL 1PD6A 3DTXA 4YWGH 4XPHL 3R0MA 5JO5B 1I1FA 4ELMB 1W72H 1GGIL 1E28B 1MFBL 5E00B 4MD4A 2APWA 32C2B 5FOBA 4UIMB 5CSGA 3BJ91 1SYVB 2XFXB 3MUGA 3S4SA 4JPKH 3D1MC 4WEBH 3TBTB 3TIEA 3MGAA 4U6XA 5D2NB 1EVUA 3STLA 3RIAF 4FTVD 2E9WA 4GRLD 5JOEA 4L8DB 2YK1L 5I1LB 1ZK9A 5A3IC 3P0VL 4QKXB 1I7ZA 1IC5L 4QHNB 3GKWL 4RFOH 4PRHA 4N0CC 5FGSA 5BCAA 3HCVA 3U7AA 4QCIA 3VFVB 1YQ2A 3LRGA 5HGGS 2YS4A 5D5MF 3T0WA 3CIQA 2BCKA 3MV9D 4PJEE 3KNBB 5LCVL 1L6ZA 2Q76B 3WKML 4J1UB 5FGCB 4MJIA 5C9KA 4YXLL 2W38A 4MA3A 2MCPH 1CGYA 4Q9BA 1KEGL 4J3TA 4D0DB 5IQ9B 4OM1L 2ADGB 4LCIL 4XPTL 2V7HA 3PV7A 4J2XA 4L1DA 1G7JA 3SY0B 4PV8B 3WE6B 5MEND 3PV6A 1FG2B 5C0ND 2JJSA 5EU5A 5C09D 4WW2C 4OLYH 5C0CE 4NO5A 1IGTB 3OKLB 1XF4B 4XP4L 4U1GC 2QSTA 2FATH 1VESA 4DTGH 3NTCH 4QRRB 5C0FA 2D03H 2JJVA 3MLXL 3DLQR 1PG7H 5E70A 3O3BA 2Q8AL 4ODHH 1B88A 1PLGL 2EZ0C 5T1MB 5DSCB 3TWCH 2QLVB 4NNYB 4LASH 5MEPA 4UDTA 3ZKXC 1QA9A 2PNDA 1KN4L 1JPGB 1S78C 1JHLH 2WUCL 5CIPH 5CZKA 3EZJB 3ME0A 1YJDH 4G8GA 3ARBA 4NKMA 3D69B 3I3DA 3T77B 3ULSA 4PGJA 3O41B 3BW9A 1I85C 4U1SB 3QWRD 1UACH 3C9NB 3V4VH 3SKJL 3HPLB 2X4RB 4ALAH 4XCEB 1JUFA 1R5VA 3WEXB 4K7FB 1JGEA 1FH5L 4BSVA 2DQFB 4NRXB 2Q3AA 1NCCL 4QYOA 3BDXA 2CO7B 2X4TA 4KZEL 2ZG3A 2AJ3B 5IBUG 4Q9QL 4NZUL 2EDDA 1DE4A 3EBAA 2O5XH 1BMGA 3BGMA 4WDIB 3MO1A 3BH8B 2AJYH 2E7HA 3HPJA 1F4WH 1MQ8A 5KVEL 3QA3B 5INDB 5E1AA 3QIWA 3ZT5A 2ED8A 1KSRA 3O4OC 1NAMH 3FO2A 4DN4L 3BAEH 1D6EB 1Z5LA 1NGWA 1LEIA 3D0VB 2V5SA 1S9XB 2NX5E 3QQNA 2EYSA 4QLRA 1EV2E 2Y7QB 1MLCA 4Z0BL 4WWKD 3WIHH 1SJVA 4HSQA 1AKJA 4ISVB 3EKCA 4JO2L 3T4YA 1PKQB 4OCRH 5I1IL 4Y16A 4PJ9C 2DJSA 3D9AL 5DQDL 3D18A 1RK0B 1HEZA 1G7LB 4N0UA 3N1MC 4X7CC 3JV6B 2B4CL 2DICA 5FUCC 4N0FB 1DBKL 2F5AH 1C5BH 3AY4A 5CLWA 3K4ZA 3IDIA 3KLAA 2CKNA 2EH8L 5KBNC 1T5XB 4U7KA 2FJHA 3GHBL 4X4MA 2PUQT 1X6NA 3QAZC 4BFGA 3RX8A 2APBA 5GS2D 4XBGB 3GKZA 5FDWB 4UV7H 1D5MA 4YHKH 1CDJA 2AEPL 3UO1L 2YPLE 4HPOH 5C9JB 2AQ2A 1DUZB 1UM5L 1UG9A 3C5JA 5SWZE 3UTSB 2ZSVB 2D7OA 1I75A 5IVXE 5J89A 1C5DB 2Q7YA 3RWCA 5EH1A 4OSUH 3OXRA 2QHRH 4JFZL 4IRSA 1JV5B 2NY3B 4JFYB 5C0BE 5C0JB 4NGHL 2BHUA 1M4KA 3BP7A 3QUML 3ILQC 4S10A 1PYWA 5C0DB 1X7QA 3MLZL 1E4KA 5KSBE 1HH6B 3VFGL 3PDOA 4H8WL 3WHXA 4HFUL 2EEDA 2DMKA 2ZSWA 1N64H 4K94C 2VDNH 5DLML 2ZPKL 2AJUH 1I7UB 4ONOA 1S7SA 2FGWL 2A9ML 5EA0L 4AM0A 1U8LB 4JZNA 1XF5A 3THML 1JZ5A 1XZ0B 4ODVH 2E7LA 4HK3J 3UDWC 4W4OC 4GXUM 4XAWL 5HVWA 1DLHB 5ENWA 1J7VR 4RSVA 3RIFK 1I3GH 1BBDL 1ERNA 4NC1E 1NPUA 4WO4A 3MBEA 4MXWL 3S7GA 1T1YB 4LRNH 3DV4A 1GHFH 4YZFF 1C12B 2ICCA 4OZGB 5CILH 4MNQB 1HQ4A 5GS1A 4Y0GA 3HE6A 5SWSD 2X4PB 3ZDXE 4Q2ZB 5K9QG 4LAQL 1A7QH 1WBXB 4BFIB 2VXTH 1MNUL 1BD2D 4WFED 1IAKA 1UXWA 1H8NA 4M62H 1MCFA 2YKLL 3B9VA 3U9UB 1QYGH 5IROA 2DM3A 4J3XA 2VC2L 1U3ZA 5EBGA 2CLVB 3QCUL 5E2VL 2F53D 3HRZB 5I75B 1AE6L 1XGRA 4Y19A 2F54B 1IAIL 1DZBA 4M3JA 4RAVA 4R96A 5I1HL 1AY1L 5D5MB 3PGDB 5IWLC 3TGXA 2RCSL 1PSKL 3UTTD 1MUJB 2MQCA 3ARED 5GRUL 5DEZA 4GS7C 5A43C 5F9WC 3IFNL 3QUZD 4NHCL 4BH8B 2PR4H 1U2CA 3P4NA 3I2CL 3WFHA 3BDYL 1EJOH 3OXSB 4GRWB 3FRUB 5FYLL 2W9DH 4D0BB 1GL4B 1SEQL 2KKQA 5AYUH 4E41A 1B0GB 1U9KA 4LCWE 3X12A 4GG6B 4LVNC 5EOTB 4ZPVA 1G7IA 2UZYB 1S7XB 1TZHB 2XXMB 1PZ5B 4YHIB 4JM2C 3O2WH 4NO0B 1A7NL 3RWDA 5LGKA 5HYJB 5B21A 3FOLB 1PVHA 2H32A 4YHYB 4LSPL 2UUDH 4PS4L 4OQ1A 2GITB 1QRNA 5C71A 2J8HA 4P2RB 3HLAB 5FYJH 4K9EH 5BS0E 4KXZI 4WNQA 4HK3N 5D1XA 5K9JH 2G9HB 3BO8B 5DEFB 5DUBB 4X98A 4JY4A 4MCYA 1G6RH 2RR3A 3QIBC 1ONQA 3RI5K 3BUTA 4KQ3L 4I0KA 1DQLH 3MOBH 5E03A 4XC1H 3F12B 4HEPG 1T20A 1XEDA 2ZOKB 1F6FB 4GXVL 3GMPB 1XGPA 4QNPF 2NY2D 5D72H 2FX7L 1U8NA 3U79A 4EVNB 5IFJA 1JGUH 4OIBA 4NM4H 3IJHA 3ARFD 1OAQL 5GGTA 2E8YA 3DTXB 4G80A 4ZUTA 4Z7WE 1I1FB 3CNKA 4OKDA 4M3KB 3WJJC 1EX0A 2IFGA 2P49B 4MD4B 4L8SA 1G9NH 2WNGA 5FOBB 2BK8A 4G6AD 4LSRL 4DKEH 3MUGB 3S4SB 4YHPA 3TIEB 1ZHNB 2ADFH 2EE6A 4U6XB 5DD0H 4GH7B 4OB5H 3STLB 4LEXH 2KL6A 5I74C 2F8VA 3DYOA 3S36L 1EHLL 4LP4A 4XX1E 2WIIA 5EB9A 2PKDA 1I7ZB 4TPRL 5J12C 1VGKA 3QUXA 4X7DC 4HS3A 4O02H 4PRHB 5TGBA 1R0AL 3HCVB 2EIDA 4QCIB 1E6OH 3IJSA 2ZUXA 3OKYA 4NPYA 2BCKB 5TF1L 1U3HC 4WHTA 5A16A 4MJIB 4LHUA 1T89A 4MA3B 4OGXH 1A64A 3EDKA 2DLHA 3QRFM 3P0GB 3KDMA 5DGRA 3LN5A 2V7HB 2VXQH 1WCBA 1G7JB 3O0RL 2Z31C 3PV6B 3QEGL 4HXAH 3EO9H 4O4YH 3MSPA 4P2OC 4WCYH 5EU5B 4NO5B 4YXKL 1EFQA 2Y5EA 1UWXK 4ODBD 5C0FB 4DFHA 3O3BB 2YA0A 2Q6WA 1T3FA 2A83A 5E9DE 4AY0A 3I3BA 3HMXH 2EKJA 2ZKHH 3MGTA 5MEPB 4UDTB 3T65A 1QA9B 3SO3B 4ESKA 2LABA 2IFFL 8FABA 2ERJC 4G8GB 1MFNA 3B9KD 3NA9L 3ARBB 5KSAD 4NKMB 4NZDA 3FOMA 3TZVD 1MFEH 3ULSB 1MCNA 3BW9B 4PD4J 3C8DA 4LLUA 1XR9A 5F1IA 5MEQA 5DMIH 5EUOE 1CG9A 2WQ8A 1IC4H 1WGOA 1FHGA 3O6LH 1JUFB 1OLLA 1R5VB 3PWVA 3ULUL 1WFNA 1JGEB 4BSVB 3UPCA 4CADA 2P46B 2VISA 4QYOB 2X4TB 1K4DA 5GGUA 2P44B 3IVKA 4GBXC 3LMJL 1DE4B 2YBRB 4ODTL 4AG4H 3CX5J 2XZQH 1L7TL 1I3VA 1NUFA 3MO1B 2XACC 1NBVH 4UTBH 1P7QA 3HPJB 1W2KT 5DF0A 1ITCA 1F3DJ 1U92A 5ACLA 3GSNH 3X11A 5E1AB 1FGNH 3QIWB 3NH7H 3RWGA 3FO2B 3HR5A 1CDCA 4LSSL 4PY7A 1LEIB 1Z5LB 1NGWB 2VL4A 4RGND 3LQZA 4NCC2 2EYSB 2IPTL 2FD6H 2PN5A 2OK0L 1MLCB 3RDTC 1ZGLA 1AKJB 1JYNA 1A3LL 4Y2OA 2CUIA 3T4YB 1VHPA 4Y16B 1Q94A 1EEYA 4Q9RL 2NY7L 4FFVC 5AZEH 4HS8L 4NQDD 3RY5A 2W9EH 2WQRA 3D18B 1HEZB 3QUMA 4N0UB 4CGTA 5ISZD 1NC4A 1U58A 1QFWH 3KR3L 5AZ2H 3IDIB 3KLAB 4PY8I 1ZKAA 2BJMH 2DIJA 1KCRL 3TH4T 3ZKNC 1BGXL 2P8MB 5ERWA 1RJZA 2FJHB 2C1OA 1QACA 2HAZA 1CTNA 3CDYA 1IJ9A 1D5MB 1FG9C 1RAMA 3W5MA 2R0ZL 2I9TA 3C5JB 1D5IH 5ANME 1BFOA 1OSZA 4Y2DA 2ICWJ 1VGEL 5A1AA 2YD5A 2VKXA 4XPBH 1A14L 2DN7A 1IQDA 3MRQA 4LIQL 2Q7YB 3EDJA 4P3CH 4MA1C 3RWCB 3OXRB 2DD8H 4P46C 3QIUA 4IRSB 1IT9L 3F58H 3C5ZD 3BP7B 1PYWB 4U31A 2XY2A 1OAUL 3QDME 1X7QB 1QZ1A 2CDFA 1PKOA 1JI1A 5IQ7L 3PDOB 3WHXB 1DBBL 4KJPD 4C56D 2ZSWB 4K2UL 2AJZA 4KDWA 2VDQH 2VZSA 5DURD 4XNQA 2CJUH 2I5YL 3LSOA 1FLRH 1S7SB 5DRZA 4HXBL 4YEFA 3SDXE 4OM0L 4MLIA 4Y88A 4AM0B 4JZNB 1XF5B 2DTSA 2RB8A 4PYGA 1JPST 1S3KH 2XTLA 2IEPA 2IGFH 2JJTA 2X9XA 3DECA 5ENWB 1CIUA 4OAWA 4ONFL 4U4BA 2F8OA 3HNVH 4HJJH 1S5IH 4WO4B 2Z92A 4CU7A 3MBEB 1U8OA 2C4FT 2K7PA 3LDBB 3DV4B 4NOBA 5ALCL 5CS7A 4M7LL 5JMRA 1II4E 3BEVA 4PRIA 5DZLA 3NZHL 4MS8C 1HQ4B 2ATPB 2ZUQB 3HE6B 5GS1B 3QBTB 5HI3C 3RUGE 1EHXA 25C8L 1UM4H 4HZAA 1IAKB 1UXWB 3HTLX 1TQBC 5E2TL 1LE5A 1A7OL 5I30H 2LE9A 4WU7A 4HEME 3BRFA 3PJSA 4TQEL 4G8IA 3MOAL 1XGRB 4Y19B 4F15B 3PQYD 1JL8A 2VLJE 4R96B 1A5FH 4RAVB 3L5XL 3LQAH 1CVSC 2YPKA 3RL2A 1N5YL 3UXFA 3FZUD 3KPSA 1X5LA 3BESR 3P4NB 3WFHB 3QUYC 2HJKA 4MJ6A 1NCWL 4JZJA 4KAQL 1TETH 3E6FA 3RVXD 3AC0A 4E41B 3OPZH 4OZIA 5FO8A 5T3ZL 4PYHA 4ZPVB 1G7IB 1B6DA 4WJ5A 2E9IA 4N90D 4KROD 3RWDB 3T0EA 2H32B 1XCQA 4J23A 4XVUD 1NL0H 2Z8SA 1QRNB 3O2VH 1VPOL 2HVJA 4WNQB 1N7MH 1J18A 3LS5L 5D1XB 3VRLF 4XX1G 3VI4F 1VA9A 2OQJA 4CBPA 5IIEA 4J3VA 3L3KA 4X98B 1SMOA 5B22A 1T7XA 4JY4B 3BPLB 4MCYB 3V5KA 1FIGH 1Y6NR 3MGOA 1ONQB 3BT2L 4P3WA 2AJVL 4PJ8D 3AS1A 4K55A 1U8PA 4LRIA 3L7FA 2IADA 1T20B 5KVGL 1J1OL 1XGPB 5CBEA 1J0HA 1U8NB 5DS8A 1FZOA 2YUXA 5IFJB 3PWLA 2ARJA 3IJHB 4P4RA 4FQJL 1A6PA 2HTLC 2IQAA 1BFVH 4IRZH 4G80B 3ZT7A 1BJ1H 4MX7A 4ZUTB 5HHPA 5FCUH 2FDBP 4PB0L 4W6XB 3OJ2C 4XMPH 3HC4L 3QCVH 4L8SB 4YBLB 5LGHH 4TULL 4F7MA 3SJVA 1AGEA 1EEZA 2GFBA 1N0XH 3L5HA 3MUZ1 4YHPB 3KPRA 1OAXL 2XRAH 1UKQA 4PJDA 4TRPH 3MCLH 4R90H 1J8HA 1N0LA 2AK4E 4PJIF 4JQIL 2J8OA 2WIIB 2ADJB 3QHTC 4MAYA 5E5RB 3I9GH 5CGTA 5F9OL 5I18L 4HHAA 2JKXA 1VGKB 3QUXB 1EMTH 1MVFA 2CXKA 1U8HA 3C8HA 4HS3B 5TGBB 1NGZA 1NH6A 4U6YA 2P5EE 2Z35B 5HHVL 3IJSB 1R6VA 4NPYB 3SEPA 2WBJD 2YMXL 4WHTB 4YE4L 3WCYA 5A16B 1KCUL 4LHUB 4JDZA 4QWWD 4HIEA 2NY1C 1S8DA 4HWBH 4E0RA 4WEMB 5D70H 1KC5L 3KDMB 4P2YA 3LN5B 1WCBB 3T3PF 1DQDL 4TVSa 1LEKA 5EU6E 1I9RH 4E9LA 5D2LF 4NBXB 5F7HA 5I1GH 1E6JL 4DWHA 4B5EA 3WV0A 2XY1A 4TSAH 3JWDC 5JXEC 4YQXH 3ARDA 4JFDE 4KQ4L 2Q6WB 1T3FB 2A83B 1IC1A 4ZFFA 2P45B 2J12B 3HC3H 4KMTH 1T22A 3AS2A 3MGTB 1WFOA 3T65B 3GSVA 3VH8G 5C6WH 2Y72A 2DIAA 3H9SA 8FABB 1CXKA 3FOMB 1XF1A 4KMLB 1N6UA 3MV11 1U8JA 1CF8L 4XAKE 5JMOC 4LLUB 1XR9B 5F1IB 3VXRD 5MEQB 5FGBC 1CG9B 4MMXC 3TNNA 3LH2H 1NBQA 4L4TE 3PWVB 1GZQA 2UZIH 4JO1L 2A74A 3IFLL 4CADB 4AMKH 2VISB 3V7AE 1UCBH 2FIKA 2BNUA 2OL3H 4JLRA 4BSWA 1K4DB 5GGUB 2H26B 3IVKB 4KKBC 1F4HA 4L8BA 2GK2A 1ED3A 1I8LC 1QSED 3LPWA 3MOQA 2VDRH 4L29A 4UUJA 2C3HA 2CUHA 4XCFL 4Y89A 3VWJC 5GGVY 2EIEA 2P8PA 2X42A 2X44D 1P7QB 1U92B 1G1CA 5MEOA 3GNML 3X11B 4PJDF 1KYOJ 3RQ3A 3KJ6L 1JF6A 1B2WL 2EEAA 5BV7L 1EO8H 1HHHA 3RWGB 1KJ3L 2NY3C 2VYRE 4NN6B 3HR5B 4HBCL 5KOMC 4PY7B 4V1DD 4PLJC 2I60H 5E6ZA 3LQZB 1ZLVK 5E95B 3ZDYF 3FJTA 4MHHI 4UT7H 5CUSL 3BHBA 5F1NA 1I1RA 2FX9L 1RUQL 1ZGLB 4JG0L 1XIWC 5FV1L 3Q3GA 2HFGH 4NQVA 1XGUA 1ZA6A 1Q94B 4NN7B 2Y06L 1QFWI 1S78D 2YUVA 1VFAA 4X6DA 1EEYB 1LGVA 5I8CA 2ID5A 4MB5A 4KKNA 4LU5H 5BO1L 1HXYA 3H42L 4JJHA 1T0NA 3QUMB 5DMYA 1QNZH 4L4VA 1NC4B 1X3DA 1U58B 3ULUF 4LPTA 5JOPD 3LIZH 4NQCA 4KY1H 3T1FA 5IMMA 4JR9L 4K3HA 1H15A 1YECL 3REVA 3ARZA 4Z7OF 3MLSH 3NIFF 2UVFA 5ERWB 1RJZB 2C1OB 2DLGA 1GC1C 1OAZL 3ZE2E 2WV3A 3JV5A 3FHQA 2CK2A 3TT1L 4X6CE 5BMFL 3WD5H 3GBLA 2XNAA 1EJ6A 5IMOA 2I9TB 1TITA 4FQXC 2R29L 5IEHA 2AJSH 3BQUC 3NACH 4LARL 5EZJA 4RMSA 1BFOB 1OSZB 4Y2DB 3FFCE 4OI7A 1HHKA 1YEEL 3WUWA 3V79C 4NBZB 1IQDB 3MRQB 3SE9L 1S7QA 4OIAA 1FZKA 5MERA 5GRYA 1NFDA 4OBSA 5I75C 4IDJH 2ICWA 3QIUB 2ZUVA 1RIUL 5F44A 2HT2D 5ITBH 1YYMH 1FYTE 4LNVA 4CVWA 2BHZA 1SM3L 3V0AC 1CGVA 3VXSA 2HA1A 3J7HA 5M95B 1DN2A 2QKIA 4Z7UE 3UEZA 5I15H 2AJZB 4XNQB 3NIGF 1IC7H 2WBKA 4JFFA 3LSOB 43C9A 1TMCB 3O8XA 4PJ9D 5DRZB 2AQ1A 3QUKA 3GI8L 5CEZL 4LSUL 2BSRA 1P7HL 1P4IL 1OD7A 2VXVL 1CYGA 3MV8D 4OAWB 4WI6A 1F58H 3WLWC 5F71A 4I3SL 5DT1L 4R26L 1U8OB 2X6MA 2R56L 5F9JA 1J1XH 5IB1A 3WSQL 3BEVB 1BFTA 4PRIB 3L7EA 2DQCH 5FXCH 3MC0A 3PWJA 4Z7QF 4PG9A 2GY5A 4HMDA 1WEJL 3WFDH 1KTLA 5DHVA 3GB7A 4ZFOA 1FDLH 3G6JA 4IRJA 4FHBD 4L3ED 1LE5B 1IILE 3E2HB 2IPKA 2EDHA 4AH2A 4WU7B 3IF1A 3PJSB 2NQCA 4G8IB 4NP4H 3I6LD 4YWGL 1F11A 4RNRA 2OZ4H 1IEHA 1W72L 3C6LA 3GJFH 4FFYH 2F5BH 2YPKB 3RL2B 2VZVA 4JPKL 4WEBL 1OGAD 3KPSB 1T5WA 1T7YA 5IFAH 4G8FA 4WUUD 3ULVH 1KUMA 3ULVE 3GBMH 4P59H 3IDXH 2HJKB 5SX4H 4MJ6B 4JZJB 3E6FB 4RFOL 4OZIB 1JGVH 5FO8B 4WJ5B 4XBPA 3OJVC 2NR6C 3ZE0F 4RMUA 4GUPA 1DBJH 1Z3GH 4TTGA 3P40A 4P2QA 3QXDA 5CJXA 3OX8A 3T0EB 2MCPL 3UJTH 5I73B 5FKPA 1XCQB 5EBLA 3P2TA 4ZUVA 3S35H 2OR7A 2HVJB 5EN2A 2MHAB 3DSNA 1YN6A 1Z2KA 4NFBA 2OQJB 5EIIA 5IIEB 3FONA 3L3KB 4G6JH 1WWWX 4OLYL 3V5KB 5FYKD 3MGOB 5B39A 1T1ZA 2FATL 3KPOA 1DANT 3L7FB 4QXTA 4DTGL 2IADB 3NTCL 2JJSC 2D03L 1PG7L 3ARUA 4HUMB 4ODHL 5GRJH 1H3XA 2B8OT 3R1GH 5CBEB 3W82A 5EC1A 1MFAH 5DS8B 1YMMA 4P3DA 1FZOB 1HHGA 3PWLB 3TWCL 4I5BA 2ARJB 3OAYH 4LASL 4P4RB 4R4FH 1JYWA 2IQAB 4IJ3C 1L0QA 4MX7B 2YSSA 1JHLL 5HHPB 3X3FH 4KI5C 4NKOA 1YJDL 3HE7D 4F7MB 4UIKH 3SJVB 5GRVK 1AGEB 1EEZB 1M7DA 3SO3C 1OP5H 2GFBB 4GKNA 3ZHLA 5HHMB 1MI5A 1UACL 5JA9A 1AXTH 3KPRB 3V4VL 3ZDZE 4G7YH 2YPVH 3ARBC 2B7DT 4ALAL 2COQA 4PJDB 2DMBA 1XMWA 1J8HB 2WK2A 1LO0H 4EUPG 3VGFA 3D3VE 4WFGD 4MAYB 3OG6B 1J0IA 1S7UA 4HHAB 4QHUA 2UWEE 1WITA 4YHMH 1U8HB 2FJFA 4JM2D 1J05A 3S96B 3P3YA 4JY6A 4DEPC 3MXWH 1NGZB 3T09A 4NZRH 4U6YB 2EE9A 2O5XL 2AXGA 3TJHC 2PW1A 3VXMA 1NGPH 2R2HA 2RGSA 2AJYL 2C3XA 1F4WL 2E7MA 4JDZB 4HIEB 3CMOH 4APQC 5MHSD 1S8DB 4E0RB 3S9DB 4PY8J 5GXBB 2P8LA 2P43B 4KK9C 2RAMA 1NAML 4K7PH 3BAEL 4D9LH 5L2KD 1LEKB 1EZVY 1SY6A 2XKUA 4XNMA 1V3JA 3JWOC 4ODWA 5HGAA 3QI9A 4I9WE 4HWUA 2IQ9H 1KCVH 4MXVE 3WIHL 2MFNA 2A9NH 4LKXA 3W11D 3ARDB 1ZS8A 3KYMA 4OCRL 1ROWA 4X9BA 4ZFFB 3NMEA 4LPUA 3U0PA 1T22B 3HB3C 1CFVH 1GGUA 1DVFA 1MOEA 4QOKA 3GSVB 1D6VH 4Y16C 4H20H 4G6FD 4DKDC 2PETA 2F5AL 3H9SB 1C5BL 1URLA 4LSQH 1U8JB 3QNYA 1RZGA 1AHWC 1TDQA 3STZA 4R2GC 3VWKA 5FUOH 1U8KA 4Z7VE 3SQOH 3TNNB 5AUMA 1GZQB 4UV7L 4RRPG 4YHKL 1B6UA 4HPOL 2FIKB 4BSWB 4JLRB 5ITFA 3LKRA 3TNMA 2EDFA 4NO2A 4L8BB 1ED3B 4HIJA 4UUJB 4L29B 4EEEA 3PQYE 4URTB 2P8PB 4OSUL 2QHRL 3OKMA 3TO4A 5MEOB 2BNRD 5JW4N 3UTPE 2VDLH 2Z31D 2FBOJ 2JIXA 3O2DL 1HHHB 2BOCA 1ZV5A 3OKKA 5IHUH 2ZOLA 4DUWA 1ZT7A 2DBLH 5GSVA 4YFEA 3SKOA 1KB9J 1E4KC 1F4XH 1N64L 3VXUE 1CDBA 2Y5TA 3BHBB 2VDNL 4OD3H 5F1NB 3CLFH 2AJUL 3Q3GB 2ARWA 3MA9H 2DJUA 1QG3A 4NQVB 1XGUB 1A1NA 1QPXA 1ZA6B 1TJGH 4ODVL 1VFAB 4X6DB 4EDXA 4P4KD 5I8CB 3BPNB 1HXYB 1T0NB 4QTHA 1I3GL 4KDTA 1JMZA 4DVRH 2E7LC 4L4VB 3MLWH 4NQCB 1GZPA 3T1FB 5IMMB 4LRNL 1GHFL 1H15B 3V6ZA 3REVB 1P5UA 3I50H 5DJ8A 4WO4C 4HG4K 3MBEC 5CILL 3CZJA 1OP9A 3LDBC 4R6UA 4GQPH 5DZNA 3PL6A 1A7QL 1T1WA 3CH8A 5J56B 5KANG 1D5BA 2VXTL 2XZCH 4GBXD 1G84A 4LDEB 2XNAB 5GS1C 3HE6C 5I8KH 4M62L 5IMOB 2CPCA 2VH5H 3C60A 1QYGL 5IEHB 1LWRA 1JI2A 5EZJB 2XN9A 1HHKB 1K3IA 3MRRA 4K3EH 3WUWB 4ERSH 3GFUA 1HK6A 3GMNA 2DLTA 2N7BA 4EKXA 1S7QB 1FZKB 5MERB 2BNQD 2CSPA 1NFDB 5E1HB 2ICWB 3H0TA 5AG8A 3SO5A 4Y5XA 4TTDD 2WANA 1JTOA 2DM7A 3RL1A 4S1SH 2PR4L 3VXSB 4X7SH 3MYZA 1EJOL 1EDQA 1MRDH 4G9FE 1VDGA 3K4AA 3TIDA 2WWKO 5C0AA 2QKIB 2W9DL 1A7PH 3VFTA 1KXQE 4HGKC 3VFRA 4CW1A 5AYUL 2DLFH 4PRBA 4TVPD 4JFFB 4HMCA 43C9B 3O8XB 2QSCH 2EXYC 4FFVD 5L2JA 3C09B 5ACMA 1K8DA 3O2WL 4Y4KB 4M6NH 1KNOA 2BSRB 2PCPA 2XKNA 5FYJL 3ZKND 4K9EL 2PXYA 5K9JL 3BEWA 5F9JB 4PUBH 5CGYC 2VQ1A 5IB1B 2H2PC 2E5EA 2M2DA 1WWAX 1A6TA 1O7SA 3L7EB 3G04A 2FH8A 3PWJB 1G6RL 5D1XC 4NQED 2J7LA 4PG9B 1VKXA 2Q3ZA 1DQLL 3MOBL 3TEUA 4XC1L 1KTLB 1INDH 3BPLC 5DHVB 3GB7B 4ZFOB 1WJ3A 3VG0H 1RZFH 4PJEA 3G6JB 4MA8H 4IRJB 1KULA 5D72L 5FGRA 4DZBA 2IPKB 4AH2B 1JGUL 3BDBA 4U0QB 4NM4L 3U1SH 3SDYH 3IF1B 4KHXH 2QL1A 3VFOA 4DJMA 4FQCH 5KZCD 1NCNA 1F11B 4RNRB 3C6LB 1G9NL 4HBQA 2FH6A 3EOTH 4WI2A 4DKEL 2DM4A 5SX4I 1KF9B 5DTFA 3UTQA 1T5WB 2ADFL 4L8SC 4YBLC 1U93A 4G8FB 5DD0L 5C0CA 3VI3E 4OB5L 2Y1VA 4JCMA 4LEXL 4HULB 1QKZH 5BXFA 4PJHF 5BZWA 3IDYC 4O02L 4WUKH 1HCVA 1E6OL 2XIDA 4OF7A 4XBPB 1D3CA 3QUXC 4GUPB 4KI5E 5CSZA 5HVHB 1JNHA 5CIPA 2YN3A 4P2QB 5EULV 2XWTA 3QXDB 4P5MA 3RPKA 3OX8B 5FKPB 1BZ9A 3UBXI 4OGXL 4HH9A 2F74A 2BVOA 5EBLB 4BZYA 2M26A 2XI9A 4ZUVB 5F93C 1DQTA 1R3KA 4V1DE 1EO5A 5EN2B 1FVDA 2VXQL 1YN6B 3SGJA 1A21A 5D93C 5HI3D 4HXAL 5EIIB 3EO9L 3FONB 4O4YL 4WCYL 4OQTA 3OMZA 4M61A 4P9HH 4CN4A 3JSSA 5B39B 3DMMA 2MTPA 4N9GA 4HWEH 5IJKA 1KJ2H 4YEEA 5FM5M 1T1ZB 4QXTB 3KPOB 5K59F 1AR1C 1CL7H 4MQ7A 3DGGA 2VLKD 4FXGA 1AXIB 3P11H 3HMXL 2ZKHL 5EC1B 1D9KA 4J3SA 1YMMB 4P3DB 1HHGB 4I5BB 1QLFA 5DJAB 1F45A 1DP0A 4RFNB 5KSVA 4N8PA 4N0YH 5DJ0A 2YSSB 5CP3H 5F1SA 3ZTJG 4MSWA 4X4YA 4NKOB 5J0BA 4N5UA 4ZTPH 1MFEL 1M7DB 2NX5A 4GKNB 1MI5B 5DMIL 3ZYOA 1WZMA 1IC4L 2FZ3A 3O6LL 4D9RD 4F7TA 3BIKA 3WIHA 4I13B 1N6VA 4UAOB 1S7UB 4QHUB 1QR4A 3MZTA 1B4JH 5IBUB 2FJFB 4IMKA 3NFSH 5IK3A 1J05B 4JY6B 4AG4L 4HS6A 3ZL4H 4PFEA 1OPGH 4GG8A 2XZQL 2AXGB 4D8PA 2PW1B 3VXMB 4U1KA 3K8MA 3PG2A 1NBVL 2R2HB 4UTBL 4WFFD 4S1DC 5I19H 3J8F7 3QWQB 3GSNL 3WIFA 1GXEA 2B4CC 2CKBH 2P8LB 3IRZA 4Y8AA 3NH7L 5GHWH 1TVHA 2DB8A 1J11A 4YPJA 3FFDA 4NJAH 2J8UF 5JDJA 4OLXH 2YPLA 4XNMB 2FD6L 4ODWB 2VDKH 5HGAB 1F97A 3QI9B 5SWZA 4ZO9A 2UUDK 4KK5C 1PAMA 2QJDA 3FO0H 4BSJA 4W4NA 4QRRD 5IVXA 4LKXB 1HOCA 1ZS8B 5HYQA 2DKMA 3Q6FA 3KYMB 4K23H 5DHYA 2Z8VC 3U0PB 1ZLUH 1NMCC 5AZEL 5C0BA 2EYTA 1CN4A 1DVFB 5DJYA 4N5ED 5HHQA 4QOKB 4J3WA 2W9EL 1BQSA 3QEUA 4NN7C 4MB3A 2EIZA 2FL5A 2ORBH 1E27A 1I7TA 5KSBA 2Z4QB 1QFWL 1IFHH 4W81A 5AZ2L 3BFOA 1JN6A 3LKQA 2BJML 2ZUYA 5EIVA 2UV3A 1RZ7H 4KJQC 4LLAA 3QNYB 1RZGB 1FC1A 3K3QA 4L3AA 3STZB 2FGZA 3VWKB 1CDYA 4YR6A 5AUMB 1C7TA 4H8WC 2JCCE 3QEQE 1A7BA 1N26A 4C83A 1BJMA 3G5YA 5ITFB 3LKRB 3TNMB 1D5IL 4NO2B 4LSVH 1LMKA 4HIJB 3S3JA 4R3SA 1EH9A 2VUOA 3KGRA 3Q5OA 1S7RA 4QXUH 3ESUF 4XPBL 3SDAB 3FQTB 4P3CL 5CEYA 3NPSB 2Q86A 3CJJA 5C1MB 2DD8L 3LEYH 5FYKU 1OGAE 3TO4B 3F58L 5B8CA 5DR5H 3F6IA 3O4LE 1T6WA 2JIXB 4QEGA 6FABH 1NFKA 2BOCB 3OKKB 3VFPA 3S8WA 2XZAH 2ZOLB 1ZT7B 5GSVB 3SKOB 3PWUA 1NUGA 4DW2H 5JXED 3H3PH 2VDQL 2Y5TB 4GAYA 2X2YA 2CJUL 5E8NA 1OAYH 3QO0A 2E3VA 1WZKA 4DGIH 4DK6A 1EHNA 4Y1AE 3BKYH 1WZ1L 1A1NB 4PJGE 3RNQA 1YEKH 3F5WA 2XKSA 3CU7A 2ZCLH 4EDXB 1CWVA 1S3KL 4XMLH 2XQYK 2IGFL 3KHOA 4QTHB 4OV5A 1YPZE 4LLQB 3RVUC 3HNVL 2X1PA 1GZPB 1KEMH 1S5IL 1T83A 4HJJL 1UH4A 2JJTC 4G6MH 1JZ3A 3V6ZB 5T5NG 1Q0XH 4P23A 5DJ8B 3IDGA 3EHBC 3VRJA 4AK1A 4X8JA 4PRDA 5IVXF 3K74B 4LCWA 5H2BA 1ZLWH 3PL6B 1T1WB 2VQUA 5KS9E 1D5BB 1DQQA 3EZ8A 4KKBD 1UM4L 4DGVH 3UAJC 3C60B 4KRLB 3TLRA 5I30L 3B9EA 4OCNC 3UTSD 5KSBF 2XN9B 3MRRB 3S5LA 4GRMA 4BJLA 4KVCH 3GMNB 4JPIA 3E2HC 4U6HA 5CHNA 5ABDE 5BS0A 1A5FL 2QR0A 3LQAL 3H0TB 1A9EA 2NY3D 4Y5XB 4PLJD 3RVTD 1ZT1A 1F6LL 3RL1B 1G6RA 2EXWC 5GZNC 4Y5YC 3WNLA 2QADB 1T04A 3TIDB 1U91A 1TETL 5C0AB 3WKNA 3VFRB 3VFTB 4CW1B 1BJ1J 5HSFA 3OPZL 4RGOH 5F7YC 4PRBB 1KCLA 3KXFE 3P77A 4JZJC 3B4NA 3CLEH 3RVVD 1E4XH 1RHHA 4PJ7E 4WU5A 2GW5A 5L2JB 1K8DB 2K9UA 4YC2B 1KNOB 3ZDXF 2PCPB 1NL0L 3O2VL 2XKNB 3N1GC 3RHWK 1IGIH 3T0EC 4C59B 1N7ML 3MUY1 5IHZA 3BZDA 2PXYB 3BEWB 3MRNA 2VQ1B 4H5SA 4XNYH 4X7FC 5FFLA 1A6TB 3A6CH 3FCTA 1FNLA 3G04B 4TNWF 2VAJA 4L9LA 1FIGL 4MNQD 5FHBH 1QQDA 2IH3A 1VKXB 1G7PA 3FHAA 4WTZA 1SBSH 1UH2A 5TF0A 2MKLC 4PJEB 5TFSH 3WN5A 4LRIC 1FNAA 2WUBH 3HZYA 4DZBB 4XXDA 3QEHA 4MJ4A 4LK4A 4Z7NE 1WIUA 3VFOB 1BFVL 4IRZL 1F6AA 2F54D 5TDNA 3HA0A 5FCUL 3Q2CA 2FYYA 1MF2H 1HQRA 2VDPH 4XMPL 4ZODA 3HG1E 3QCVL 4OZHA 5LGHL 1N0XL 3D48R 1TNNA 5DTFB 3UTQB 4EI5A 5C0CB 1U93B 2XRAL 4TRPL 3MCLL 4R90L 4R4NC 4Q9QH 4JHWL 3BGAA 1FCCA 3I9GL 5BXFB 5E9DA 5BZWB 2OYPA 4UBDD 2VR5A 4QRSA 5LGJA 1EMTL 1U8IA 1A4JA 3HMXA 1FSKB 3F7YA 2ZUTA 4L5FH 4MAYC 2WWMD 1P4BH 5CSZB 5LXGH 4XXCA 4ONHA 1JNHB 5CIPB 1TVBA 2XWTB 4NO0D 4P5MB 5HYJD 3WLWD 3LPGA 4JPWH 1BZ9B 1RY7B 4HWBL 4HH9B 3MJ9H 2F74B 2BVOB 1U3YA 4WVRA 1X5KA 4IMLA 5EUOA 5JZ7D 3DSFH 5D70L 4P2RD 1R3KB 2D2OA 4HK0A 1FVDB 4M8VA 1MJ8H 1YNLH 3VE0B 1I9RL 3ECBA 1NJ9A 1CL7I 1CE6A 1OAKH 5D1QA 4M61B 3RZCA 4MD0A 4OZ4A 1I4FA 5I1GL 3DMMB 4N9GB 4Z7WF 1VERA 3ULUC 4RMRA 4TSAL 5ECJE 4YQXL 4MQ7B 3DGGB 1A1OA 4FXGB 4WW2F 2F58H 1F90H 3HC3L 4KMTL 1D9KB 2ZG1A 4L4JA 1KB5H 4FFWC 1QLFB 3GSNA 5KSVB 3F7QA 5DJ0B 5DUMH 2C7UA 4MSWB 4X4YB 4WHCA 4YAQA 1CD1A 2VL5A 2E7CA 2NX5B 3ELAT 9CGTA 3BN9C 3P73A 2LAGB 3A6BH 3DUSA 2ED7A 3BP5A 3LH2L 4BUGA 2FZ3B 1FRGH 4MAUH 4OLEA 2UZIL 3JUYA 4F7TB 1JTTA 3AM8A 1MHCB 2VWEE 4AMKL 5I1AA 1UCBL 2OL3L 5J6GA 1OARH 4PRHD 5IK3B 4WI4A 4HS6B 2VDRL 4GG8B 1UENA 4D8PB 3FQUA 4U1KB 5DC4B 5HD8C 1GGCH 4CMHB 3PDDA 5ADPH 4MJID 2RIKA 3C6SA 1FL6A 3WIFB 3ZHDA 3WO3B 4FQLH 1FO0H 1EO8L 1EZVX 2HRLA 1WTLA 1TVHB 3FFDB 4FNLH 4MNGE 2I60L 4J3OC 5GPRA 5DLMH 2YPLB 4M7ZB 4Z18A 5T3XD 1QFUH 4UT7L 5C92A 2BY1A 3PF2A 5ANMA 1CICC 5SWZB 3ZSTA 5HYSA 3LVEA 4Q6YA 5IVXB 2HFGL 4LCUA 5I1DA 1HOCB 4GAGH 4RMQA 5HYQB 3Q6FB 2D4DA 5DHYB 3K8LA 2VIRA 3DRTA 4MJ5A 1RVFH 3CC5A 4PJ5D 5C0BB 2EYTB 5DJYB 2BERA 4LU5L 5IB3A 5HHQB 3QEUB 4I3RH 3QDMA 1YMHA 2EIZB 1QNZL 2FL5B 1E27B 1I7TB 3LIZL 5KSBB 5HGHA 2L7JA 3BPNC 4H0HB 5KG9A 4G8GD 4KY1L 3ARBD 1GYAA 3S3PA 2AS5M 1JN6B 3LKQB 5T1KA 3MLSL 2IBBA 3VFUA 4U3XA 3CFCH 5I1JH 4BQ8A 3N9GH 4YR6B 5GJSH 4FQ1H 3CGTA 2H9GA 3SDXA 3WD5L 4C83B 5IBLC 2ESVE 3R06A 3G5YB 2AJSL 5IWLA 1F02I 1M05A 2NLJA 4QTIH 3NACL 4NRYA 1YEFH 4R3SB 2W65A 3BISA 3B3IA 1S7RB 5C08E 4LPYA 2WW8A 4CDHA 3RA7H 4ZO7A 2V9TA 5CEYB 2Q86B 4IDJL 3RWFA 2OX5A 5B8CB 1L7IH 1TCMA 3M45A 1DBAH 2YRPA 3QIWD 5ITBL 1YYML 3FN0H 3AS0A 3MCG1 5FOJA 1IM9A 3P4OA 3CSPA 5BZDA 3VFPB 2H8PB 3AB0B 3RUGA 2APVA 3QDHA 4MLSA 1NCBH 4HKJA 3RNKA 3IT8D 5FYLE 2H41A 2A6KA 3PWUB 2AGJH 1YNKH 2EDLA 3N1PC 4NSKA 3MLYH 5I15L 1AJ7H 4GAYB 1TNMA 3MLVH 1IC7L 5E8NB 4R0LC 3QO0B 1AKJD 1F00I 4FQPA 3F62A 4AYFA 5LWYH 2VLJA 3RNQB 5IFHH 5E8PA 1CGTA 1IRAY 3F5WB 3O8XC 3C09C 5HYFA 3VGGA 1DL7H 3QIBA 1MELA 4OV5B 3CSBA 4YO0A 1F58L 4XVJH 1J1XL 4P23B 4ZUWA 2VO5A 4EJ1C 3IDGB 4KPHH 2DQCL 3VRJB 4X8JB 4JRYD 4PRDB 2FO1A 4LCWB 5H2BB 1CS6A 2OP4H 2GSGA 5GZOC 3WFDL 1DQQB 1FDLL 1RPQA 1JRHH 2A1WH 3ILPA 1JF5A 3WFEH 4FXKA 3V5DA 3JV0A 3WIIH 2BVUA 3TVMA 3S5LB 3HS0A 3G5VA 4NP4L 4GRMB 2DKSA 4N1HB 5HVFB 4JPIB 2OZ4L 4U6HB 5CHNB 5BS0B 4FFYL 1TTGA 1MJUH 2F5BL 3DO7A 4ZNEA 2QR0B 1TZGH 5E2JA 1A9EB 3KPMA 4IRSD 1T6VN 4XZUA 2EE2A 1HINH 3S6CA 3C6LC 4OI9A 4NC2B 1ZT1B 4Q0XH 5IFAL 5EUKA 2MJWA 3RP1A 1G6RB 1Q9KA 4N0RA 4PGBA 3GBML 5EO9A 4P59L 1QHPA 5JA8B 1NDGA 3IDXL 4NYLA 1E4XI 1MPAH 1U3HA 1T04B 1OSPH 4JZOA 1U91B 2NXZC 4RBPK 2NY5H 4MQSB 5HHXH 4PJXE 2WZPD 4MJ2A 4GMTH 4OLVH 3TPKA 1JNNH 1JGVL 3P77B 3GSWA 4LHUG 3RGVA 3ARVA 4WU5B 4Z7WB 4R97B 1DBJL 1Z3GL 3S37H 3SDCC 4U05A 4XPFH 4HJGA 4NN5C 3UJTL 15C8H 4P2OA 2D0HA 5C3TA 3SJVE 2XWJA 4YJZL 1YQVL 1AC6A 4JM2F 3S35L 4BQ9A 5BVPH 4K3JH 4WO4D 2DQUH 4RQQA 1INQA 5IHZB 3MBED 2AK4A 4HLZH 2VKWA 3MRNB 5ESVA 3GZKA 4H5SB 1J5OH 3KPQA 5F7FA 4G6JL 3FCTB 4F9LA 4L9LB 5D7SH 3HE6D 1QQDB 4UOW1 2IH3B 1G7PB 3ZKXB 3SDDA 4OI8A 2P5EA 4OFYA 3HZMA 4CVUA 3TT3H 5GRJL 3R1GL 3TBWA 2PYEE 1GIGH 1H0DA 3WN5B 3TA3A 1MFAL 3HZYB 4XXDB 1EA9C 3QEHB 3Q1SH 4HGWA 4R4FL 3KWWA 3NZ8A 4HWBA 2P4AB 4Y19D 1F6AB 5TDNB 3X3FL 1QR1A 2FYYB 4OZHB 4UIKL 4RFNC 5B38A 5C07E 5EU6A 4X5WA 3SE4C 1F2QA 1AXTL 5HGDA 4UNUA 4G7YL 4EI5B 2YPVL 2AQ3A 3VG9B 4F37K 4IM8A 3GJEA 2EDJA 1LO0L 2BSSA 2BC4A 3C2AH 4JFDA 1M7IA 2E6PA 5E9DB 2EXYD 4QRSB 5LGJB 4E41D 1U8IB 2BY0A 2OMBA 4BQ6A 1A4JB 4YHML 1YY8A 3MXWL 3F7YB 4NZRL 4UAOC 3CXDH 1F5WA 4ONHB 1NGPL 3GMQA 1TVBB 3BKJH 1WIOA 3AXLA 4WHYH 4JO4H 3CZFA 3CMOL 3CPLA 2IANE 4GW5A 5SV3A 4WI9A 1KIUA 1QRND 4IMLB 5EUOB 1IL1A 2H6PA 3RDTA 1BD2A 4HK0B 4L4TA 4K7PL 4D9LL 3GBNH 2A0LC 2DIBA 3GGWA 4KRMB 5D1XD 4XRCA 3TYGH 3ECBB 1NJ9B 4LLYA 1CE6B 5I9QC 4POZC 5D1QB 3DOSA 3RZCB 4MD0B 4OZ4B 4PTTA 4QRPE 1I4FB 3VA2C 2IQ9L 1KCVL 1JPSH 5EZOH 1LQSR 3SKMA 1TTFA 4OKVB 4JHAH 1MIEH 1A1OB 3RY4A 2ZP0T 3AMLA 2F8XC 4JRXE 3Q5YA 1CLCA 3UTTA 3V52H 1CFVL 3QQ3A 1MIMH 3PP3H 3DETC 3GSNB 3QAZB 1D6VL 1D5ZA 4H20L 5FO9A 3B83A 2C7UB 2CH8A 5HI5D 1A2YA 1DVFC 4LSQL 1GOGA 2VLRE 1CD1B 4YAQB 1MCRA 2VL5B 5CSBA 5BV7C 5LBSH 3NCBB 3P73B 3DUSB 1QOKA 2XT1B 5FUOL 3BP5B 3SQOL 1KELH 3SBWA 2HH0H 5I1AB 4P46A 5J6GB 3QUXD 1OP3H 2W1NA 4QRUA 1XF2A 2IMNA 4LIQE 5CD3A 3RWIA 1Y6MR 1GGTA 3FQUB 1HILA 1GGYA 5DD3H 4LHUD 3C6SB 1NSNH 4QHKJ 1JZ8A 1FL6B 3EOAA 4W6WB 4PJFE 2VDLL 12E8H 2HTKC 3NPSC 1UA6H 3KYNA 4ODSH 2Z8WC 3TO4C 3MFGB 1OTTC 1T03H 5IHUL 3DV6A 2DBLL 2BY2A 4KUZH 1N6QH 4X6CA 2Q20A 5F9DC 1F4XL 4ZQKA 3ARFA 3MLUH 5ANMB 2EDQA 4OD3L 3CLFL 3FFCA 5HYSB 3ARXA 4LCUB 3PXJA 5I1DB 2J6EH 3MA9L 4NZTH 3VFSA 3FN9A 3LKNA 1PG7W 2VIRB 3O3EA 1TJGL 3DRTB 4MJ5B 5IOPA 3CC5B 3T0VA 3KLHC 5EC2A 5IB3B 1LVEA 1NFDE 4XVTH 5FKAA 2VDOH 1FYTA 1YMHB 3QDMB 1JZ2A 4DVRL 3MLWL 5HGHB 5KG9B 2L0DA 5EOQH 4KDTC 2CDGA 5T1KB 3I50L 4ORGA 3UMTA 4Z7UA 3T4AA 3K8KA 5EOCJ 3VFUB 4NNXA 5GGRY 2IBZY 5AD0A 3QRGH 4GOSA 4BK4A 3Q6GH 3QDJE 1EHAA 2XZCL 2H9GB 3SDXB 1YEJH 3WBDA 5I8KL 3D87B 3BVNA 3D5OF 2VH5L 2O5ZH 3R06B 1M05B 2NLJB 1OP5K 3EYUH 4NRYB 4S1DD 5HHOE 1OT1A 2W65B 1F3JA 4K3EL 4ERSL 3B3IB 5C2BH 3C60C 3P9LA 3KPNA 3QUYA 1P7QD 4O2CA 2W0PA 2HRPH 3RWFB 5JTWA 3ARTA 4PP1C 3G5XA 1IM9B 3P4OB 5JW5A 4KDVA 4S1SL 1CD8A 4GKOA 5BZDB 3RUGB 2WP3T 4Y5XC 1AH1A 4H0IA 2ZZUT 4X7SL 4HKJB 4Z6AT 3RNKB 2NZ9D 1MRDL 2A6KB 3BPOC 4KC3B 3SOBH 5GGQH 2CUMA 4NSKB 1A7PL 2DRUA 2DLFL 2QADC 4P48A 5GGVH 1CFSA 2QSCL 4CMMA 4Z95H 1DLFH 4PB9H 3RKDD 2VLJB 1EIBA 2OZ4A 1KT2A 2C4XA 3GJFA 5E8PB 4M6NL 1OY3B 2WM0A 1MCBA 1NLDH 3QIBB 5JR1H 4YO0B 3MV7E 4X6CF 4YC2C 1NC4D 4I1NB 4I2XE 1MWAA 2DDQH 3GUTA 1P69B 4PUBL 3IDNA 2VLMD 2IAMA 1F8TL 3SGDH 1BP3B 4ZUWB 3VDCA 1JRHI 1IAIM 4N8VA 3U4BH 2P47B 5GS0H 2MNUA 1DEDA 4PJAE 5F6IC 5DD5H 1INDL 3VG0L 2A6IA 1RZFL 3I85A 1WISA 3ILPB 4MA8L 1HHIA 4FG6D 4FXKB 3V5DB 1JPTH 4LL9A 4JREC 3U1SL 4Y2DD 3SDYL 4PGEA 4KHXL 3TVMB 3HS0B 3G5VB 2N7AA 4J12A 4FQCL 3UX9B 2FHFA 2JLLA 2JB5H 4LPWA 4Z7UF 1DDHA 1U3JA 3EOTL 3QIUD 3KPMB 4XZUB 1GGBH 5FV2A 5IMLA 3UBXA 3BKCH 4MA7H 5EUKB 1RD6A 4KKAC 4LCCA 1Q9KB 4PGBB 4JEGB 5EO9B 1NDGB 4JKWA 5HDBF 4NYLB 1JZ4A 1QKZL 1U3HB 1ETZA 3B9AA 4JZOB 4ELMF 2EC8A 4C55A 2NMSA 4U33A 2D7TH 4ZAKA 4WUKL 2DQTH 1TJHH 4WFHE 5HPMA 3GSWB 2D0FA 4OF3A 3RGVB 5FECA 4EI6A 3GM0A 4CVXA 1FSKC 1BF2A 4HJGB 2FLRT 4P2OB 1P4LA 2H2SD 3B6SA 3HKFA 1YJDC 2EDWA 4HIXH 3EHBD 4RQQB 1INQB 2FBJH 2LVEA 2AK4B 2V9QA 5ESVB 3MRCA 4JKLA 3D3VA 3KPQB 4F3FA 4PRID 1T66C 5IESH 4I18A 3TV3H 2UWEA 5ID0A 4P9HL 3RTQC 2J3SA 3SGJC 4HWEL 1KJ2L 1HNFA 4UILH 3SDDB 2P5EB 1BEYH 2WBWB 4KJWD 2BVTA 3MUJA 2LFGA 1CL7L 4TNVK 3HZMB 4WTWA 4XHJC 4K3DH 5IJKC 3V7MA 3TBWB 3BRDA 1H0DB 3P11L 1B90A 3TA3B 3RVWC 4I8DA 4PJCE 3ULVF 3KWWB 3NZ8B 3AGVA 4N0YL 1TVDA 2JELH 5FGBA 3CDFA 1P6FA 5CAYB 1D9KC 1QR1B 5E6ID 1ES0A 3MZGB 4ZTPL 3CCHA 5B38B 2CXGA 5EU6B 1G7QA 4X5WB 5KN5A 5TQ2H 1FNGA 4QRTA 5HGDB 3VXTA 3KPSD 4NWTH 4JCLA 4XPAH 1KN2H 4X5XA 3GJEB 3G6AA 2BSSB 2BC4B 3BD5A 4JFDB 5GQBA 1B4JL 5J9PA 3VD4A 1VEPA 3NFSL 1YY8B 1UT9A 4KK6C 1KLGA 3ZL4L 1OPGL 3QQ9D 1Z9SA 3VDBA 4ZUSA 3GMQB 4IMKC 5MP6H 5I19L 3AXLB 3GHEH 4U6TA 2Y6SC 2Y25A 2AK1H 1JTPA 1X4XA 3CZFB 3T0ED 3CPLB 3INUH 4GQ9H 4QXWA 5J7CC 4GW5B 2EDRA 4CMHC 1J87A 2CKBL 3A6OA 5GHWL 4Z7VA 1IL1B 2H6PB 3RDTB 1BD2B 3IS1X 4L4TB 3BRGC 1XIWA 4HUNB 4NJAL 3WS3A 3GGWB 2V6HA 4XRCB 4OLXL 4LLYB 4YZFE 2XQBH 2VDKL 1EAPA 4PTTB 4G9DA 2HLFD 3D6GA 1T21A 3RZWA 3FO0L 1RU9H 3SKMB 1FBIH 3PQYA 4M7ZC 2SEBB 2LAAA 3GSXA 4K71B 2WLYA 4K23L 5D7KE 3ZDZF 3UTTB 4YGVA 3QQ3B 3PWPE 5A2LH 5FCSH 1D5ZB 5FO9B 1RIHH 2ORBL 4OZFH 4LLMA 2HLAA 2P7TA 1A2YB 3RJQB 1IFHL 1JYXA 1WT5A 2MSPA 4FQXA 3MR9A 1RZ7L 3BQUA 1Z9LA 2J2ZA 3KPRD 4R4ND 4R7NA 3VXUA 4ZFGH 5IB2A 5BMFH 3B9DA 4BQCA 1J8HD 1ZLSH 4HKZA 2XG4A 2DOCA 4YDIH 1EO7A 4MAYD 5IVZA 5CEXA 3WUWG 3MRBA 4P46B 2FWOA 5ESQA 3WFCH 4BUHA 4QRUB 1XF2B 4LSVL 3SE9H 3V4UH 4U2ZA 4HCRA 5CD3B 2CRIA 3RWIB 1BBJA 1YUHA 1BX2A 4QXUL 4D3CH 1QBLH 3OG4B 2YUWA 4YDVA 1Z9OA 4XWOC 1L9NA 4ZS6C 1HILB 3LEYL 5BRZE 4S0SD 1GVIA 1DANU 3DX6A 1WAAF 3MPCA 3EOAB 3T0DA 5DR5L 1GH7A 3KYNB 1YEHH 1SVCP 2B1HH 6FABL 2GQHA 2N1KA 5B8CC 2XZAL 3DV6B 4G6KH 4X6CB 4M48L 3ULUD 2D9CA 5I71B 1LDSA 5DRXA 4ZQKB 5E4IA 4DW2L 3AB0C 3ARFB 3H3PL 3MRPA 5CP7A 5B4MC 3FFCB 5CEZE 1OAYL 1SQ2N 4AL8H 1DEEA 4JJ5A 1A6AA 4DGIL 3ARDD 5E24E 3VFSB 3NPZB 3BKYL 3LKNB 2G75A 3O3EB 1CXLA 1RV6X 1YEKL 4GW1A 5E94A 5IOPB 2ZCLL 2AW2A 4Z7VF 1MHPH 5HY9A 4XMLL 4HKXA 5EC2B 1UB5A 5ALBH 5FKAB 5GSRA 1FYTB 3IKCA 3T08A 4YK4C 1KEML 1MCKA 3H9SD 4XP1H 4YDKH 4G5ZH 4G6ML 4G9FA 2CDGB 2D7MA 2YD2A 3F6LA 1TQBB 4ORGB 4Z7UB 3T4AB 4HPYH 3MXVH 3NN8A 4NNXB 5AD0B 5KSUA 2WSKA 1CXIA 4OGZA 3UYPA 1XCTA 1JZ7A 4P23C 3QDGE 1J0ZA 3EJZC 2OSLA 1CD0A 4DGVL 3BVNB 1IEBA 2WLZA 2VE6A 1RJLA 3D39E 5HD8D 1AO7E 1DR9A 2GEEA 5GGSY 1F3JB 1U8QB 4OZGF 3P9LB 3KPNB 4KVCL 5JHDE 3UP1A 3QUYB 5ICZA 4O2CB 1QUNA 1SVZA 4MQXC 2LU7A 1FE8H 1JFQH 4KTDH 3G5XB 4K9EC 4HW6A 2XTJE 3VU2A 4C58B 5JW5B 5I1KH 2I25N 1KJMA 1UH3A 4CRPA 1CLYH 2APXA 3BMWA 1KGCE 1F4YH 1ORSA 4WW1A 2UZXB 3MLRH 5DVOA 4RGOL 1UZ6F 5BW7C 3CLEL 1CFSB 1E4XL 4YHOH 3IFOB 5KVMC 2YD6A 4CMMB 2A6DA 2H32H 1KCSH 4M7JH 4Y5VA 3CFJA 1T7ZA 1KT2B 1JWSA 3GJFB 4GRWF 4OJFH 4R97C 3SGDI 4J7RA 4DOHE 4GG6F 3RBSA 2W92A 4LOUC 4L4VD 4NCDA 1IGIL 1G9NC 4NQCD 1MWAB 3GUTB 4U6VH 3IDNB 5B39G 4XNYL 2IAMB 3QPXL 2R2EA 3A6CL 4N8VB 1ZLUK 3IXAA 5FHBL 5IBLD 2XG5A 1SBSL 3HI1B 4HUKB 4B0MM 1A3RH 3N85H 1T7VA 1IGYA 4M9PA 4L9LC 2A6IB 2FEEI 5TFSL 5GGTH 2EH7H 1HHIB 2WUBL 4PGEB 2HT4C 4F33A 1NMAH 4YBQD 4F2MA 3WN5C 1IGMH 5T5NF 4V1DA 3OGOE 1J0JA 4H1LH 3UTZA 1MF2L 4F57H 2VDPL 1DDHB 35C8H 5F7NC 1RZKH 1ZHBA 5H37G 1VSCA 4LVHC 5IMLB 1M7XA 5C3LD 3UBXB 1BAFH 3TM6A 1JBJA 5F6HJ 3ARSA 4WWID 4LCCB 4CN1A 4G7VH 3VXSD 1KJ2A 2NCMA 1VFUA 5DO2C 4EI5C 1ETZB 4B7IA 3VG9C 5DHXB 3PGFH 1NDMA 2VZ1A 1ND0A 3O3DA 3M07A 2NY1B 4APQA 4ZAKB 2M8XA 4L5FL 2YD3A 5F7WC 3EAKA 5HPMB 3O8XD 2HMIC 3EJYC 1P4BL 5LXGL 3OB0H 5FECB 5ACZA 3QXAB 4GFTB 1BIIA 5CP3A 4EI6B 4CVXB 4Y4KD 3GM8A 4TSCH 3L3HA 4JPWL 4XXCC 4MCZA 5J57B 5A2FA 1P4LB 3MJ9L 2FECI 3B6SB 3EJJX 3DSFL 4W68A 3FT3B 1MJ8L 1AXSA 1YNLL 2YD8A 4LBEA 1N3NA 3ARGA 1UFUA 3MRCB 3D3VB 4KTEH 3L3IA 1X5HA 1HKLH 4F3FB 1OAKL 1WLHA 1LO3H 5GZOD 4I18B 2UWEB 5ID0B 1G6VK 1G7MA 3TYFA 3QFJE 1UZ8A 5D1QC 3RZCC 4CN6A 3EDEA 2F58L 1F90L 1X5AA 4IRJD 4HC1H 3VI3F 2G2RA 2V17H 1KB5L 4KH2A 1AHWA 1AI1H 3N1QC 2PYFA 5DUML 3V6OE 5D6DA 1ZLWK 2UY6A 2YUZA 3C6LD 3VFWA 4F8QA 1ES0B 3CCHB 1G7QB 5KN5B 1WZLA 4ZO6A 4K07A 2E6QA 1TZIA 2ICEA 1FNGB 4QRTB 3VXTB 3A6BL 1Y0LA 4KI5F 1HI6A 1FRGL 4OGYH 4MAUL 3VWJB 4X5XB 4OF6A 3G6AB 2VRAA 1HIMH 3HRPA 3T2NH 3R8BB 5J9PB 3SGKC 1OARL 3KG5A 4JFHE 4JQXC 1KLGB 1M6OA 3AM8C 4ZO8A 2LVCA 1FAIH 3WXVH 4ZUSB 2OJZH 1GGCL 3T3MF 4FQIH 3IETA 1LO4H 4HUUA 5ADPL 1QSFE 3O2DH 5JQ6H 1RUMH 2MMXA 4Z8FH 5D96B 2YD9A 4FQLL 1CT8A 1FO0L 3IAQA 4Z7VB 5DMJB 1BZQK 1XIWB 4FNLL 3WS3B 2JCCA 3BWAA 3QEQA 1L0YA 5KVDH 4GT7A 1QFUL 1EAPB 1XGYH 4G9DB 1T21B 4YIQA 4O5LH 3PQYB 2X40A 3GSXB 4AQ1B 4GAGL 4XCCH 3AU1A 2YZ8A 4EDWH 2CRZA 3HR6A 3W0WE 5JPNA 1RVFL 1OGAA 4YGVB 1YMMD 2PO6A 1Q9WA 1CVRA 5TH2A 4I3RL 3O4LA 3WL9A 3RU8H 4LLMB 2HLAB 2P7TB 5F8RC 1PX4A 5DJ6A 3FB8A 5L8JB 4ETQA 3IDJA 5H94A 4D9QD 3G5ZA 3V8OA 4FQXB 3MR9B 4R7NB 1CE1H 3BQUB 3VXUB 2AJXH 4PR5A 5IB2B 1U42A 5SV4A 3CFCL 1AGCA 5I1JL 3N9GL 4OGAC 3DGCR 5GJSL 5DWUH 2I24N 4FQ1L 4HKZB 1CCZA 1VFMA 4Y1AA 2VXSH 5IG7A 5IVZB 5CEXB 3MRBB 2FWOB 4PJGA 3K46A 3RWHA 5ESQB 4QTIL 5DVNA 1YEFL 2DTMH 3AMKA 4C54A 4HWZA 4HZLA 1BBJB 1YUHB 1BX2B 5F7LB 3VXMD 1OHQA 1YPZA 1KG0A 1SJXA 3EGSA 4YDVB 3RA7L 1QPPA 3S35X 3DX6B 4J4PD 2R4SH 1L7IL 1G9MH 1DBAL 5CD5D 4I0PD 2VZ3A 2A0LD 3FN0L 4DUVA 1G7HA 1G0XA 1NCBL 2E9JA 5KS9A 3VRLE 5H8DA 1NGXB 2AGJL 1YNKL 1KPRB 5DRXB 1G0DA 3MLYL 3NCYS 1AJ7L 3MRPB 2I07A 3QI9D 5CP7B 3I84A 3OSKA 4N68A 3DPBA 2GJ6E 3MLVL 3BSZH 4OFDA 1DEEB 5D8JH 4JJ5B 4WV1A 5HPOA 1A6AB 2HT3C 4JAMA 4YDJB 3DETD 5LWYL 2G75B 4ZDHB 3VD7A 5IFHL 3G6DH 1L6XA 4GW1B 5E94B 1DN0A 5GS3A 4DK3A 4IBLT 4U7SA 5HY9B 3DXAD 1DVFD 4HKXB 5FYJE 1DL7L 1UB5B 4QOKD 3TN0A 2FIRT 4KTYA 2JCCF 5GSRB