2WWMC

Crystal structure of the titin m10-obscurin like 1 ig complex in space group p1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
GSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into M-Band Assembly and Mechanics from the Titin-Obscurin-Like-1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/structural protein
molecule keywords OBSCURIN-LIKE PROTEIN 1
total genus 16
structure length 98
sequence length 98
chains with identical sequence O
ec nomenclature
pdb deposition date 2009-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07679 I-set Immunoglobulin I-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2wwmC00
4OV5B 3RY5A 4WTXA 1U93A 5FYJH 4IMLA 1P2CA 2BJMH 4L9LB 2XG4A 2QSTA 4E41A 3GJFK 2JJSA 4FA8A 2FJFA 1BEYL 3ULSA 1KIPB 1J1XL 1BFOB 2J5LB 1HINL 1MVFA 5EB9A 3BO8B 4HWZA 1NL0L 4OD3H 2ZG2A 4OZGF 3VXTB 4MAYC 3WIIL 4Z7WE 3V52H 3U9UA 1F4YH 1TVBA 5DJDA 5GZND 3UZVB 3QCTL 1SJEA 1UENA 3DSNA 5C0EB 2ZUQB 3Q6GH 2YZ8A 1FLRH 1DN2A 4ENEC 4TRPH 1WBXA 5F7DA 5FCUL 1ONQB 1WAAE 3ARZA 1SEBB 2D0GA 2LTQB 2JJUA 2BY1A 4L9LC 1D9KA 3PWPB 4E5XA 1I1FA 2B20A 2SEBA 4HJ0D 1BD2E 2EE9A 4NM4H 5L8LB 3NGBC 2IAMA 1HE7A 3DI3B 3GNML 3TJHD 3UTPE 1F90L 2Y9RT 1CFQB 3NA9L 2C1OB 3AS0A 3QHZL 4L3EB 4IRZH 4JREB 4HKXB 5CLWA 2HH0L 4MAYD 1B4RA 3WS3A 5IROA 4XWOC 4NQCA 2VITB 1IGJA 4GQ9H 5GZNC 5JLZA 5E8NB 3QXAB 4PGEB 3WHXA 3ZDYF 1S7TA 2Q8AH 1HIMH 1VFUA 3QDJD 1AO7B 2A38A 3PV7A 1Y18A 5GRJH 4NYLB 5DMJB 1HCVA 3CC5B 3TNMA 1XF4A 1L9NA 1IAMA 5E2VH 1HHGA 1IARB 4PP2B 4WFGD 1KULA 1R5VB 4QXTA 1U8HB 5L88H 4NKDA 1NCCH 1OAYH 2R2HA 1NUNB 3MRMA 5DR5H 3DX8A 4ODTL 4XPFH 1MFBH 1X5LA 1BVZA 1V7NL 1WC7B 3CK0H 3EJJX 4RQQA 3SY0A 3O3EB 3V5KB 4X80L 4LOUD 4YHOH 1CBVH 1BF8A 1UB6B 2FX8L 3EJYD 3OXSA 1FBIH 5BZWA 1FRGL 1OB1B 2RR3A 3OAZK 3UJJH 1A1MA 3QUXD 1RHHA 5GJTH 3GO1H 1CD8A 32C2A 2BVPB 4OZIE 5F9OH 5CEYA 2E6PA 2BY2A 2NY6D 3PGDB 3P77B 4RAVB 5CD5C 2GJJA 4NN6C 1T04B 5MERA 1WZ1L 3DO7B 3HC4H 5TGBB 5J56B 5EBMA 3IVKA 1KTDB 4QRRD 5GRZA 3PV6B 5K59F 2DLIA 4YNYA 3OF6D 2XN9E 4Y5XA 1NC2D 3VXSD 1N2RA 5MI0B 1FIEA 4Z0XB 2OTPA 1NLBH 2FGZA 1J1PL 3NCCB 5KSAA 4WI9A 3ZT5A 4BKLB 1Q94B 1R3LA 1MUJA 1XIWB 1X4XA 1HI6A 4MCZB 3GRWH 2A1WH 4JFFE 2H3NA 3HCVA 5IBTH 1OAZH 1PYWB 3I75A 3JV6A 4RAUA 1CLCA 5EORH 1K4DA 4HLJA 3U0WL 4GW4A 1EXUA 4Z95L 4PGCA 1JNJA 4HUWA 4PB0H 2A6JA 1J1PH 4X6EA 3O45A 2WZPD 4K94L 4S1SH 2CK0L 3GGWB 5I1DA 1SJXA 4Y4HB 1LO3L 1A7OH 4Y4KD 3PWVA 1DTUA 1QFWL 4ZFOL 4J1UB 1BOGB 3BISA 2DLEA 5F97E 1CD9B 4Q58C 5I15L 5HI4D 3ILQD 4AEIL 1J9CT 2MQ0A 5AZ2H 1NFDA 1WWWX 1Z9MA 4CNIB 1G7MA 1TJGL 3L5JA 5HYEA 5IQ9A 4N90D 4P3CH 1CS6A 2VWEE 3U0TA 5IMKA 1VKXB 2VC2H 5D6DC 2AK1L 2LQRA 4MJ6B 1QLRB 2YBRA 4P23D 2EZ0D 1CYGA 4KGJA 3GIZL 3NFNB 4JZJA 1LNUB 1KB5H 1QBLH 3HNTH 2HKFL 1TCRA 3OJMB 1M7IA 2F53E 2OMBA 5D5MA 5DJ8A 2X42A 1A9EA 3NZ8B 4FQLL 3KXFA 2P48B 5CCKL 2NXYB 1FCCA 1KCUH 1R3HA 2X4TB 2FJGA 2Q8BL 1MCLA 1IGIL 4W4OA 4XPGL 3ZE0F 4A2LA 3MNZB 4PJ9A 4UV7H 2EYSB 4M1DH 1OGTA 1CDUA 2R39A 2DIAA 3C5SA 2YN5A 1GJIA 1RZJH 2Z8SA 4UOW0 4U1HB 4ERSH 5E94A 1JHTB 5JW4N 2ICES 3MBED 1IT9L 4KK5C 4OCXL 4AEFA 2HJLA 3O6KL 1AD0A 2E7CA 3BWUC 4PJ7F 5F8RC 4MD4A 3UTSB 1FL6A 4ORGB 4YGAB 1JVKA 3O2VH 4ELKB 4R4FH 2DTML 3HG1A 2RB8A 4H25B 1ACZA 5GRUH 3DWTA 4YX2L 2AEIT 4JN1H 2QQLL 4XNYL 5I1EH 3VFSB 43CAA 4NRXB 5T33L 4YDVB 2OL3B 1D5BB 3ISWA 5T1LB 5F88B 2EXWC 5IF0A 1VACA 2RBLA 3FRUB 4KMTL 4WTWA 4F9PC 5D93B 2E7LC 4G8GB 3NZHH 4UBDD 5M95B 4NNXB 1NCDL 4K3DH 5J3HC 1A3RL 4G42B 4P4KC 3VXNA 2J8OA 1JYXA 4NJ9H 4HHAA 1TXKA 3CUPB 3GMMA 4F33B 3TPKA 1IAII 4LLQB 4X7TA 2I9LB 3O3AB 4GG8A 3GHBL 3KNBB 4RRPA 5I8OL 3L9RB 2I26N 1T3FA 5KZCD 4YZFE 4N90E 3C5ZC 1PEWA 4I9WD 5C0IB 1Z3GH 1Q9WA 3JTTA 4OD3L 2NR6D 3G6JF 2D4FA 1I8KA 5ICXB 2P44B 5JORB 4QOKB 3SGKC 3QFJE 3V4UH 3BWAA 4I3GA 3TBTB 3UO1H 3JBG7 5A2JH 1QUNA 1FFPB 2BVQA 4H1LH 1TTFA 2YPLB 4JG0L 5D7JB 1JK8A 3VXRB 2XPGA 3RX8A 2J8UA 1KPUB 4ETQB 5E2WL 4JFFA 2QSCH 1CQKA 3IB4A 4KQ3L 4LKCB 3VXOA 2VO5A 3LKPA 4Z6AT 3VXMD 4QCIB 4LSTL 2MHAA 3V0WH 2ZG1A 1VERA 1RIVH 3D6GA 4OLWL 5DFTA 1ZLUH 1Q9LB 1TDQA 3BDYH 2E9WA 3EDKA 1XF5A 4FFYH 1F11A 3E1F1 1DEEA 4JRXA 1H3VA 1BJ1J 4HXBH 5SX4H 5IBLD 4CN1A 5T5FH 1G0YR 2CJUH 2ENYA 1CN4A 1QSEE 4WFGE 4F58L 5BJTA 2VLKA 4UQ3A 5D2LB 3TP4A 1FGVL 4O9HL 2UUDH 1S3KL 1YECL 3C08L 5JIKA 4BSWB 5IESL 2GY7B 1T2JA 3E6FB 4XHJD 4K7PX 4YHZL 1KJVB 1UYWH 1K4CB 4XNYH 1OSPL 4ZPTA 4UIKL 2W59A 4WDIB 3ETBF 4RDQF 3ZDZE 1FV1B 1UXWA 4NWUL 3GMNB 5H2BA 3O9WB 1LP9F 3JTSB 2IPTL 2HKHH 3D3VA 3H9YA 3JWOC 4RMSA 1FORH 3KYNB 3BMVA 4K71C 1YYLH 5D71H 3PWJA 1SBSH 3ET9F 4DW2H 5EO9A 3QIWC 5HGDB 2IF7A 2G9HA 4GAJL 1CE1L 1OCWL 4WRLA 2YK1H 4ALAH 1R0AL 5DA4A 4P2OA 3QG7H 3FB6A 4QLRA 1OAQH 3T09A 5JIPA 1IM9B 3L5XL 1V3JA 1D6EA 4XZUB 5T3XE 4Z0BH 1RIHH 3D18B 3Q3GA 4ODSL 4WY7L 3CDGB 1WWCA 2DQHH 1IEBB 3EFFA 3GMPB 4X6BA 1RJCA 1XCTA 5IROC 2HG5A 3KPRB 4U1LB 1KEML 2BSRA 1N64L 2W0LA 4KWUA 2FX8H 5D1XA 1CXEA 2DIJA 3HN3A 2NY7H 4H5SA 5DRXB 3CSYB 3L1OL 2X44D 3SCMB 5C9JB 3EO9H 3UPAA 1MWAA 1ZT4A 3KPLB 1ZANH 2PCPA 4FG6C 4I48A 5HHQB 1TZGL 5CSZA 5FUZH 5DHXB 2NY5L 4NRYB 2EYTB 4JKMA 4NQUA 1FL5B 1MVUB 3L3IB 4O2CA 5JHLL 5DUBB 4IOSD 5T5NG 2PR4H 3QIUD 4QYOA 2ARJA 3FQRB 2AABH 3RWIA 3RGVA 3A6CL 4PJHA 4R2GC 5JW4Q 3H9ZA 3P4OB 2H32B 4M6OL 4U2YA 2YD5A 3MXVH 1EAJA 3C5JA 4YLQT 3O11A 1XF3A 3RNKB 1ZSDB 4FZ8H 3MCG1 4TVPL 4CKVX 1G1YA 5EU7C 3DECA 1DL7L 2YR3A 4PRIB 2VLLB 5IM7A 3UJIL 3KAAA 2Z91A 4AIXA 2Q1EA 1A7RL 2N7AA 4NUGH 4GAJH 3H0TB 1HK6A 5FYLL 1T20B 2O26U 5FA3A 1RJZA 2VUYA 4ZOCA 3GZKA 5LKNA 3JVGC 5F7YC 1QO3B 4K7PL 4OM0L 1NUFA 1U6AH 4POZC 3BZDA 2WMPA 4WWID 3WIIH 4OAWB 3D0LA 1N8ZB 1F4YL 3UBXG 3WFBH 1LP9A 1BFVL 5KSVB 1H8SA 2A9ML 1MIEH 4ERSL 3BP5A 5F9WB 2CO7B 1KCSH 3REVB 5AYUL 5C71A 1FE8H 1CU4L 3TBYB 1A2YB 3T2OA 5I74B 3OSKA 4KI5E 5H35B 4QF1B 2YXMA 1ZT7A 3KPRD 4P4KA 3WXVL 3FB5B 3KJ4B 1I1AC 3MRHB 5BQ7B 4NUJB 3BH9B 3N85L 1QTYT 1U8KB 4FQLH 1IEAA 3BP7B 3K4ZA 4N0YH 4PJFB 2GI7A 2ITDA 3VG0L 4YHML 4CW1B 4XCCL 4OLWH 4F2MB 1WFNA 5L2KB 1Q0XL 4LLYB 1P6FA 3EAKA 4TVSa 5D6DA 3H7BA 3T8XB 1F4WH 4JFQA 2H6PA 2BNQD 2CDFA 3MRQA 2Q8AL 4HCRA 2Z31D 3D5OF 4J3OC 4GMSL 2P5WE 1YPZF 1HYRC 4G6FB 5IJVA 1NCNA 1BP3B 3O0RH 4OZGA 2Q20A 4BSVA 5F1NA 4NQXB 4KI5D 4XC3H 4MA3B 3VWJD 3C5ZD 2NY3D 1S9XB 3MRKA 4Y2DD 1QPXA 1A9BB 1S9VA 1U8QA 1F3RB 4PJGA 3FT2A 4HIHA 2CK0H 5C0JA 5DT1H 2PYEA 2PUQT 1IGMH 2WK2A 3IAQA 3IDIB 1M6OA 5FYKL 5EOTB 4F80A 2AKRB 4YIQB 3B9AA 5E4EB 2ZSVB 4WI4A 5EO0B 1S7QA 5F3HA 5TQ2H 4P99A 5IBUG 5FYKE 1NFDE 3EO0B 2VL5A 4N0CC 3ARDA 1TTGA 3BSZH 3X11A 3B9EA 3OHXA 4ZFZB 1Z6JT 2EDDA 4HDIB 2IC2A 4EN3A 4EI5A 5BRZB 5F96L 1UJ3C 1E4WH 4MHHI 4J3WA 1RUPL 3HE6D 2DQDH 2W0FB 3QEGH 1GZQA 4NC2B 4LF3A 1EAPB 4G3YL 2FCBA 3NMEA 2GTWA 5F7MC 3BUYB 1MLCA 3VWJA 2E7LA 4FQJH 2V7NB 2DB8A 5DGQA 1HDMB 3HR5A 1TQBC 2HVJA 3VXUA 3SDDB 2YPLD 1U0QA 5D2LF 3DX6B 3T2PA 4GG6B 4QOKD 3OWEA 3QIWA 3QQ3B 5DTFB 1JWSB 3DI2B 2X89A 3H9SB 3FB7A 3F58L 4JEGB 1JTOA 2EXYC 4N0FB 5DC0A 1QQDA 2H2SC 4OCMC 3HE6C 4GMTH 4M5YH 4GXVL 4OZHA 5FV1L 3S96A 5I8KL 1QFPA 3QFJD 2A74B 1RU9L 1E27B 2NY2D 4HK3N 5C2BH 1P4BH 3VFRB 1AGEA 3OKDB 4FFVC 4BUHA 4AT6A 4D8PA 1AJ7H 2H8PA 4KKBC 3MYZA 1P7KA 3MCKB 1OL0A 4R4BB 1P9MA 3IGAA 4HCRL 5D7IE 3QUXA 5MP6L 3EOAB 3ROOA 5B39B 4I3RL 1XR9B 2A6DA 4FXLA 2HLAA 2QKIB 4C4KT 4YJZL 2DD8H 1NGQL 2AXGB 2WWMD 4ZUVA 4M7ZC 3SDAC 3NH7H 3MRRB 2A6IB 4BM7A 1W2KT 3FMGL 4PJ7E 5F1SA 3ARTA 4JFHE 5BVJB 4Q97A 1C5DA 4U6VH 3H8NA 1FPTH 5IHLB 2AJYL 3DVGA 1DR9A 5CP3H 3C6LA 5DQJB 3IDNB 2DWDA 3LD8B 3T1FB 4PGZA 5LCVL 3UTSD 4Z7NF 4UT9H 3MZTA 1X5JA 4X4XA 2W9EL 4XP6H 1U8PA 3X3FH 3CIQA 2BDNL 5DJYB 2P24B 1T1XA 3SE8H 1WF5A 5B3NA 3P4MA 1CZ8H 3MFFA 3FMGH 4JHWL 3I9GL 1RY7B 4BH7B 4HS8H 5K93A 3SE4A 1NGZA 3IETA 1UB5A 3FFCD 4ZOBA 1EZVY 4G7VL 3FHAA 3BEVB 4BFBD 1FGNL 4HH9B 1OWRM 3V52L 4PJXF 2YD9A 5IT2L 4P5TA 3U7WL 1A0QL 3RL2B 1I7UA 4S1RL 1NMBL 3K8MA 5FECB 4JVWA 4FZEL 4JREC 2GEEA 4N5UA 2BHZA 3I50L 1BJ1H 1ZV5A 1HCFX 1T89A 3I84A 3LKSB 3SKOB 4PREB 5LGJB 4HPOL 1HHJA 1T21B 2C4FU 5FOBA 2ATPB 1BAFL 1CG9A 4JFOA 1JNNH 2A2QT 3NFSH 4I3SH 3BE1L 4Y4KB 4KDVA 4TULH 4DKFH 5C6TL 1ZHLA 4Y4HD 2XACC 4FQXB 5I1JH 1HILA 4P48A 1NGWB 5E8DH 3MLZL 1FZKA 2YPKA 3VFUA 1QLFB 3GIVA 1KELL 1EPFA 1KENL 5D1XC 3EDFA 1FORL 3IJYB 5HHVH 3CFCL 3EYFA 1Z5LA 2H2PD 4XGZB 3LPWA 4NNYA 4JANA 1PJ9A 2PYEE 4OZFG 1CF8H 1KXQE 5I16A 4FP8H 5KOVC 5HVHC 1DVFC 3QDMB 5J11B 1CK0L 3H3PL 2DYPB 3LV3B 2A83A 4ZDHB 5JXEC 5KSUA 2OJEA 4LRNL 2O5YH 4U1MB 4WTZA 1KCVL 3WUWG 5HGBA 1UM5L 3TPUB 5J6GB 5D1QD 2E9JA 5I1HL 5DO2D 4WFHE 5FKPA 1MJ8L 1DBMH 5FA4B 3U4BL 4EIGB 3RZWA 4XMPH 3VU2A 3PNWB 3TFKC 3C8KA 2W1NA 1ETZA 1LK2B 3EYUL 4QRRB 2GYSA 3SGKA 3HLAB 5T1DL 5A2FA 4MSWA 4XMKH 1P4LA 3I3DA 2ZPKL 1VDGA 4G8EB 4RBPK 1EERB 2O5YL 4IMLB 1CLOH 3S3JA 1ZLSL 3R1GL 2NY6B 1J11A 1C1EL 3MRIB 3DUUA 4OUUA 3QJFB 4X8JB 1CTOA 3HC0B 1KN4H 1SYVB 1ZANL 4DCQA 3NIDF 4DJMA 3A6OA 3K8KA 4HUUB 3WE6B 2V2WA 5INDA 3T0DA 3V8CA 3RVWD 1N4XH 2EIZA 5JOPD 3UO1L 2KBGA 4OV6F 1MCOH 3DMMD 4X98B 1HSAB 1JPTL 1F4WL 2Y36L 2BNUA 4N8CL 1SJEB 5I6XC 1HH9B 3WHE0 1M05B 2QTEA 3ZL4L 4PRPD 4TSCH 5EZOL 4Y1AE 2V9QA 1KJ2L 3KVQA 4AIZA 1WBXB 3N85H 4YBHA 5GGSA 5L8KB 2M26A 3SPVA 2DLFH 4HKJA 3PWPA 1EEQA 1KC5H 4PJBB 2VXSL 2VH5L 1HQ4A 5I2IA 2I60H 2JB5L 3HFMH 1DN0A 1AO7D 4XNMA 4HXBL 1JTPA 3QXVA 5DZOA 2VZTA 4G7YH 2HWZL 3MUY1 3MJ9A 4PPTA 1KIRB 3C2AH 3PP4L 3QULA 4X4MA 3FJTA 4G6KL 4PBWD 5IB1A 2UVEA 1IGJB 5GRVK 5JLZB 2P43B 4JZOA 4WEBH 4RX4A 1VFAB 3KPOA 4NBXB 5IJKC 4K9EL 1MJ7L 3CXHJ 2VXTL 3DRTB 4ZUTB 2KL6A 4LASH 4K9EC 1BFTA 1MCSA 3G9AB 3KLHC 3NIFE 2YD4A 3KJ6H 3WIHA 4XNXH 1YMME 3DX9A 1MHPL 4P4RA 2JJSC 1OAYL 3TH2T 2R2EB 3VD4A 3QWOB 3PWLA 2GJ6E 3OQ3B 4KGLA 5HYSG 3UTTB 2W9DH 3HZVB 4ISVB 1TENA 5JOPE 1B0RB 2DQIH 4YEEA 4PBXA 5C0AA 2B4CH 4LASL 1RJYA 1C7SA 1S7XA 4KMQA 1DQQB 3N1PC 1I1YA 5GJSH 4G8IA 5CGYD 3RKDD 3IDMA 1KN4L 3OGCA 1E28A 3MV8A 4Z76A 4KTDL 1WWBX 4LSQH 12E8L 4LPCA 3W9DA 4UTAH 2CO6B 2BX5A 2OX5A 5B3JF 3IVKB 2A9NH 1ZHKB 1GYAA 3KYKL 5DQDH 4PGBB 1OHQA 2HVKB 5ADOH 3G5XB 5GRVL 4YNYB 1N2RB 2ORBH 1JPFB 3PGFH 1GGUA 3TFKD 2UYLA 4JY6A 2YMXH 1AQDB 1V05A 3QZWA 4MJIE 3KYMA 3MSPA 4HT1H 5K9JL 5EBWB 3MLVL 5I8KH 3K46A 2JIXB 3Q1SL 5A2LH 3D25A 3HZYA 1GH7A 3PABA 2PW2A 4JRWA 2YRZA 2C26A 4WHTB 3OR7B 4X6FA 1WCQA 3OKNB 1YNKH 5B4MD 3CVIL 3FO0L 4YPJA 1FNSL 5E24E 1U92A 1DBAH 3HZMB 3OXRA 1TVHB 4PGCB 3S4SG 5HHMD 1IQWH 4H26B 3K74B 3ZE0E 3GBNH 1DSFL 4MNQB 5AYUH 4OCWH 4W6WB 5D7JC 5J0BA 2NW3A 4WCYH 1YNKL 2UZXB 4WGVB 3UPCA 1WWAX 2AVGA 2ARJQ 1GZPA 3TZVA 2ZOKA 4M4RA 3F7YB 4NKMA 1XF2B 1IC5L 1VKXA 4JKWA 4LU5H 2NY1C 1JWMB 4UUJA 4GLRH 5FFLA 1NCAL 4QKXB 1NUGA 2YBRB 2RAMA 1C08A 3IJSA 3RJQB 3WSQH 2XN9D 3VGBA 3C8DA 3TBWA 1BIHA 5INCB 5HPMA 3E3QE 2G60H 5CGTA 3LAFA 4QNPE 2DTSA 2NPLX 1CD1B 2YD1A 2Z4QB 3R0MA 5DJ0A 3ZTNL 4OJFH 3X12B 5FUOL 1P7HL 2O61A 1CLOL 2J8UE 5CKGA 2I5YL 4S10A 2AS5M 4QHNA 5TE7H 3CX5K 1FNGA 3V0VB 1CDJA 1G7HB 1HOCA 4WI8A 4WWKC 4K3JH 4XNUL 4U1HA 3SDCB 4MQXC 43C9A 5LAXB 3QAZB 1NJ9A 4M3KB 1ZVHA 1KENH 3QFJA 1DDHB 1RQ5A 1LD9B 5C0FB 4KI5F 5IBTL 1R3JB 3S8WA 5C0CA 5L0QB 5D5MF 1AGFA 2CDGB 2Z0BA 1AD0B 1BQHG 4JZJC 3O6KH 4HAFA 3BHBB 2AABL 1FL6B 1KFAH 4G9DA 4HG4J 4WW2B 5BXFA 2X7LA 2J6EH 3NCBB 1MFDL 4U1KA 1QP1A 3DRQA 4HPOH 5EPMB 4AYFA 3I6LD 4PJCB 4MA8L 3VFSA 3KPQB 4LLWA 3REWB 3QH3B 1QFWH 4YAQA 2P8LB 4ZXBD 5D7KE 2XKNB 4OFVA 5CZKA 1K9TA 2NX5B 2I27N 3VD3A 1UCTA 3ZKMC 1T66C 1VGKA 3I6KB 4P9HL 5HI3D 3VXNB 4DVRL 3IS0X 3Q5TA 1A7NH 4ZFGL 4XPBL 4P9HC 1R5WA 2IADA 3V6OC 2NLJA 3QDGB 1WFUA 4ZAKA 2NY1B 3WV0A 2ZUYA 1F2QA 1I9IH 3B2VH 4NDMA 1VSCA 1X7QB 2NXYC 4PJIE 5IFAH 2QL1A 3ARDD 3N9GL 4XB8A 4DKEH 4MJ5B 4WY7H 1BECA 4C56A 2OBGA 4MWFB 4YWGH 1RUAL 5E5RB 4HF5H 1J0ZA 2E8YA 1J05A 4F9PA 3CH1B 3Q5YA 4X99A 5EOCH 3DROB 3QO0A 2VZVA 5A16B 1G84A 1HHHB 1PY9A 4ELME 1X4ZA 5I66B 1JK8B 3VXRA 1CDYA 1NGPL 3MRFB 1HXYA 3QEQE 5I1KL 1DVFA 2AJXH 3DV6A 2CR6A 3O2DH 2V2TA 4N8CH 3V4PL 1RZKH 3VFMB 5L0QC 3ARSA 4GAGH 1JZ5A 4XPTL 3BGMA 1NBZB 2OQJB 8FABA 2MHAB 1G7LB 3RX7A 4A6YL 3WLBB 1Q9LA 2NNAB 3O4LA 5CEXA 4G5ZL 1T5WB 3QRFM 1F97A 1F11B 1X4YA 3P0YL 4XVTH 1LE9A 1NGYB 2VKWA 3VXSE 3QWQB 4EN3D 2GT9A 1QR1A 4N8VA 5C0AE 3ZTJH 3TT1H 1ZK9A 3F7VB 35C8L 4U33A 1DZBA 5BO1L 4JQIL 3NGBB 2XFXB 4KPHL 5JR1L 4HLZH 4U1JB 2XOTA 2AJSL 4N5EC 1T5XA 3FT3A 1OAUH 2CUIA 1QBAA 4GW5B 4RISL 2Y06H 1JNLH 1BIIA 1ACYH 3TO2B 1CI5A 5L2KE 2BRQA 3TCLB 1A7OL 2CLZB 3DX7B 4XCFL 3A67H 3MCLL 1S5IL 4UU9A 5DZLA 4PY7A 3QISA 3U4AA 1IGML 4LPXA 4YUEL 4MAUL 4NWTH 3WFHB 1YEFH 5DK0B 3GSNH 4PYGA 4XTRC 4G7VH 4M6NL 1MNUH 3BPCA 2IQ9L 3UP1A 1CD0A 1EHLH 4JN2B 4OIIH 3DUSB 5D2NB 4HS6A 4U6XB 1O5DT 3VRLF 1N6QH 2YOCA 3VE0B 1HXMA 5ACZB 1NAMA 3BVNA 1JFQL 2MCPH 3MLPA 1IQWL 5FKAB 3V7AG 3CDFA 5JXED 4AMKH 3ZT7A 3OX8A 5C08B 1BFVH 1NUDA 4JQXC 5C09D 4PJIB 2XZCH 5GS2H 3EFFB 2ESVA 1G0DA 3GMPA 3QEUB 4R26L 1BAFH 2BC4B 2X4NB 2XRAL 4P0DA 3HRZB 1YUHA 2X2YA 4Z7QF 4MNHA 1KNOB 5F9JA 3QCTH 4I1NB 3TBSA 2IANE 3IU3A 2X4RB 3NFPA 3WO4B 1E6OH 1BM3L 5C0AD 4RFEA 1CDGA 1MWAB 2A73A 3QIBA 4UTBL 3B9KC 1FZMB 2N7BA 3SDXB 2ITCA 2NZIA 4LCCC 4TNVF 4KQ4L 4YHYB 1FGNH 3HAEB 2NW2A 4QXUL 4M1CD 1PKQE 1U8OB 3ILQC 4PJXE 3U2SB 3MV8D 4HZAA 3RHWK 3EYOB 3FOMB 4R97C 4Y8AA 2BNRD 3DTXA 5JHDD 2JB5H 1QSFE 2V5YA 5GGTH 1U3HA 4WUUD 1PKQB 2K7PA 2J8HA 3LIZL 2ARJB 3OKLA 3RWIB 4K2UH 4JPVL 5IFJA 3TIEA 3MRLB 4JO1H 1DBML 4AQ1B 2H1PH 5CP7A 5DT1L 3OKYA 4MLIA 1IKFH 3C5JB 5DI8A 3K7UA 4ETYA 4Q9CA 4Q9RL 4EDWH 2R69L 5EA0L 5KVFL 3OR6A 3S97C 4TVPH 1DQJB 4XPGH 1BD2B 1VCAA 1KOAA 4QTHA 4XPFL 1G6RH 3OB0H 3UTTE 1NGQH 2BVYA 3MLWH 3MLXH 3NH7L 3CZFA 5DMYA 2GJ6B 5DC4B 4BQ8A 4WHYG 3FRPA 3NIGE 4JVUA 2W9DL 4J3XA 1DANT 3G08A 5DDHB 5DD0H 1D5XA 4JDVA 1BPVA 1QKZL 3BJLA 1N8ZA 1KTKE 2Y36H 3D3VD 4JHAL 1FL3A 3PHOA 5FUCC 3RRQA 1I75A 1J18A 5HPOA 4M7LT 3TBYA 2CLRA 4N8VG 2KH2B 3TN0A 2C3VB 1NMBH 5GS1A 3F58H 4P9MH 2VZ1A 3L3OB 1LEIB 3S9DB 4PJ8D 4PJCF 4I0PB 4RNRA 1BM3H 4WO4C 4KMTH 1U8KA 4J3TA 5EOQH 4D2NA 2VZ3A 3KWWA 1FYTB 2ITDB 1CFTB 2HP4A 4X7FC 3QXTA 4G8FA 1SJVA 1T1WB 3C2AL 5I19H 4PFEA 3RWDB 4BZYA 2R1YA 4XPTH 4AM0B 4CAGA 4U31A 1HHIB 3LPGA 1A5FL 3HE7D 5E03A 2ZZUT 4QTIH 4RZCA 4U1SA 1TVDA 1S7WB 4G6JL 5EC2A 2VXQH 5AUMB 1T6VN 3FCTB 5BS0A 1MCFA 5IJVB 4NO3A 2CKBB 2ADGA 4P49A 4KK9D 2MMXA 3PWPE 2YA0A 1FJ1B 1A4KA 2OSLB 4X7EC 4MA3A 3U7YH 1A1OB 4QWWC 2NY6C 3HPJA 1CE1H 4NT6B 5ESVA 1YA5A 2P8PA 3WO3B 4XNQB 2WAHA 2P5WD 5FYJU 1QYGL 4U1NB 3FOLA 5HYSA 3ULVH 4MVBC 5HBBA 4Z7WB 1KPVB 2MTPA 4JFDB 2AKRA 1NLDL 4NC1E 4YIQA 2X4SB 2R1XA 1S7QB 4W68A 4LNVA 2IPKA 3EO0A 4MAUH 4NWTL 3MV9A 3HI5H 4TSAL 4BFEA 1PAMA 2IEPA 2Y4SA 4HUNB 2BCKB 2D31B 5CJQL 2OL3H 5EO1B 3RUGF 1QSED 4IMKC 3ARGD 3VI4E 1P4IH 4JRXD 3QDHA 4HS8L 5HHNA 2CJUL 2DOCA 2BNRA 4KMLB 1GZQB 4RMWA 1J1OL 4HGKC 3GMRB 1QHOA 2GTWB 2HTKD 3E2HC 5ADOL 5MEOB 2Z92B 1F58H 3MRBB 5LWYL 2G2RB 5J57B 3BUTA 4IIQC 1RZFL 3SKNA 3LDBB 4YHMH 5C07B 3F5WA 5I1CH 3A6BH 3EYVA 4GRMA 4GBXB 4M1CC 4S0SD 5EC1B 4TUJA 4Y4KC 1I7RB 4I18C 2VQTA 1LEKA 3BX7C 3FFCA 1N7ML 3PQYD 1VEMA 3FB7B 4DGYH 4N0FA 2L7JA 3IXTA 1J8HB 3RPIA 3TO4B 4X4ZA 1ZHNB 4PLKD 4OZHB 4UQ2B 3S96B 3VMNA 1F4XH 3QHZH 4KPHH 5JR1H 2A74A 5E9DD 5HDBF 1D5MB 1FG9C 2F54B 4HMDA 5DYOB 1BLNA 4KFZC 2Y7QB 3P3YA 4OCYL 2Q76B 3VWKA 3T2NH 3QHFH 5I1JL 4ONHB 3P0YH 1IC1A 3MODH 5IB4B 3P4NB 2CKBH 3UTQB 2WWKO 3C6LD 4IOIA 1PX4A 5GS0H 1UA6H 3QG6A 3BKYL 1D5ZA 1H3UA 1MAKA 4WFFD 5KJRL 4YE4L 3KPMA 3VFNA 5FO7A 5KAQG 2HLAB 4WEBL 3TV3L 4M1GL 1DUZB 1JNHB 5E2UH 5E08L 2QV2A 3MLTA 4LRNH 4RRPG 5HGGS 3TO4C 1I9IL 1BBJB 4PJ5A 2LU7A 1BZ9B 3QIBC 1JE6A 4QRPB 3C60B 3HG1D 4HFUH 3UPRB 1UACL 3GSUA 1CBVL 3V0AC 3AMLA 4X6CB 5ANMA 5GPRA 5J9PA 2GUOB 2YC1A 4IS6B 3B3IA 3QXDA 1MOEA 1U8MA 1AP2B 5IUSA 4NQSB 2Q6WA 3MFFB 1O7SA 3ULUF 3GKWH 5GGRB 4JB9H 3T4AA 4CADA 2EDEA 3KR3H 1SYSB 4OLZH 3UBXA 3L3GA 4PJ9D 3SJVB 3P73A 4KQ3H 1MEXH 1I8MB 4GRWB 2ZOLB 1XCQB 3DNKA 1E4KA 3L5HA 2BNRE 3BI9X 4OZFH 4BQCA 2IG2H 2Q8BH 2BSTB 2FIKA 2XWBB 4O51A 2JK5A 2PW1B 3WBDA 3MGAA 3O6FA 5BV7L 4JO4H 3RUGA 1KCRL 4PJ7A 5GIRA 1KCKA 4OI7A 1CDIA 4MZ3A 2HT2D 4XWOD 5DK2A 5I1AA 1X5FA 2GTZB 1KB9J 2PYED 3HUJE 1FH5H 5AAWA 4E0RB 1ND0A 2H1PL 3LN9A 2HJKA 2LE9A 4XC3L 5IVXF 3O3UN 1OSZB 4F7TA 1ZT1B 1CFSA 4K2UL 1GC1C 2XTJC 3U0WH 2L7UA 1ACYL 3MMEB 4Y5VB 3ROLB 1JNLL 3BPNC 3CFDA 5JO5A 5HDQH 3P11L 4FQXA 3VG9B 4YBLC 4OCNC 2KUTA 3W5MA 1FZKB 2YPKB 3VFUB 4OM1L 3NN8A 3V5DA 2J12B 5HHOB 1RK1B 2BNQA 1A8JH 1OWWA 4LBEA 1ZE3C 3CAFA 1Z5LB 2YK1L 1M71B 1U41A 4YFLI 5E4IA 2XWJB 3RWCB 2OTWA 4BJLA 3ILPA 4HGMA 1QEWB 2EICA 5CMAA 5CZVH 5D7LB 5H37G 4JDZA 1FFRA 2PF6A 4NO2A 2BOBA 2HFEB 5FUCE 1KIQA 5LVEA 2DI8A 3GI9H 3E8UH 4Y5VC 2AXHA 2OK0L 3SE4C 5CJOH 5GJTL 1YQ2A 1QBLL 3GSRA 3QUZD 2VABB 3WIHH 4J8RA 1FVEA 3AU1A 2HRPL 4U6YB 1ETZB 3SOBH 1LVEA 1BQHB 4YC2B 4DQOH 2PNDA 1NAKL 3PG2A 1AGDB 2X1XR 2GQHA 4RGMB 2I9TB 3MRCB 4HKBA 3AXLA 4OF5A 1AKJD 4HV8B 1LO4H 4MA7H 3QNZA 3K4AA 2FH8A 3MUGB 3FQXB 5DJ6B 3MXWH 3BDYL 5IQ7L 1V3LA 1RV6X 2HRPH 4O02H 1KCSL 1F3DH 3L3JA 4O2EB 5DQDL 2P46B 3V0WL 4P5KA 3U4EA 4M61B 5AG8A 4PJBE 2X4UB 4PJGE 1M05A 4LAQH 1H3GA 4G9FE 1S9YB 4ZQKB 3PQYA 4YGVB 3A6CH 3QQ9C 5J6HB 2XIDA 4ZPVB 4LK4A 4UIMA 3SKJH 4HKJB 3DMMC 4WW1A 5GGRY 5JW4R 1LMKA 5IVZA 1J12A 4HQQH 4L8CB 1FVCA 5BVPL 2HT4C 4WFED 4HUXA 3QI9B 2NTFB 2JTDA 1RZIB 2MPAL 5LGHH 3UYPA 3AGVA 4ZFOB 5DWUL 1X5HA 3BKCL 2DLTA 4L4VA 1QSFA 4UT6L 5ADPL 1AD9A 2C4FT 4X9GA 4Y4FD 4YO0A 3HUJA 5C0GA 2RIKA 3BKMH 1WICA 4XP4H 3FQNB 3SKUD 1FN4A 2X4QB 3OPZH 2WP3T 3DHJA 2YPLE 4PJ5D 3T0AA 5JQ6L 2ZP0T 4GRLD 3MC0A 4HIEB 1NCWH 1EEZB 3MJ8B 4HS3B 3L95A 1YYMH 3LMJL 5C2BL 2IANA 1LO0H 4MCYA 4ODSH 5J3HD 4HW6A 1N6UA 5FGBA 5E9DE 3TBVA 5IHUL 2EYRA 2CLVB 1AIFA 3ES6B 4JFPB 3HZVA 4OCXH 1QSEA 3ULUD 5F3BA 3U83A 3BZFB 3BIKA 5J1TC 4QEGA 5DJZB 4OGYL 3EUUA 3VG0H 4E41B 4R90L 1ZEAH 2FJFB 3OGCB 4ZSOA 1QLEL 3HE7A 5FDYA 3BO8A 5A2KH 3WO4C 3HI1B 1TZGH 3VXTA 4JLRA 1FNHA 3T0EB 3WFZA 2FX9H 4DTGL 2R8SH 4AK1A 2O5XH 2VISB 3IU4H 3SGJA 3D39E 4FNLH 3OKMA 2D0HA 4HJ0C 4MX7B 4LSSH 5HGHA 2ZJSL 1AXIB 5EBWA 3WFEL 5TE4H 3WUWA 3ULUC 1HSBB 1RHFA 3UJTL 1S78D 5JDSB 2DL2A 2PW2B 3FT4B 1FZOA 1D9KB 4KI1A 2SEBB 5FM8A 4EBQL 2VLKD 4X6FB 4GRWE 4JCLA 3SEPA 3WIFB 1BJMA 1WBZA 3FQTA 1BQLL 3WS3B 5DUPH 3Q48A 5IB3A 4Z7UF 1IMHC 4PB0L 5CJQH 2PTTB 1B2WH 4GUPA 1BZ7B 3RWHB 3IFNL 1Y18B 1YEJL 2BZDA 4LSRL 1T7YA 1A02N 2NX5E 1BREA 1D6VL 4LLUB 3IDGB 5CHNA 4GH7B 2B4CL 3O6MH 2ATKA 3QFDB 4Y19B 3NABL 3GJEA 3B2UD 1K6QL 3MRMB 4PD4K 4XVJH 4KZEL 3VXRE 1B0WA 4Y16C 1C08B 3BE1H 2XRAH 3H9HB 2Q87A 5ITFA 4JAMA 2DKMA 1U8IA 3ARFB 3V5KA 5HPMB 4JFEB 5BZWB 4RAHA 3BPLC 3PL6B 3OJDA 2FZ3B 1KJMA 1P84J 3BP6A 3RU8L 4F58H 3GB7B 2R0KH 4XXCC 1JGEB 2KQNA 4DZBA 3WFCH 1OTUD 4KDTA 1RZ8B 3UTSE 4M48H 4OIAA 1MAMH 4LVOB 3WKML 1G7JB 1OAXL 1KSRA 2BVPA 4QXUH 5ETUB 1WZMA 3GSOB 1T04A 3H3BC 1K85A 4F37F 3FQUB 2BERA 1R3JA 4Y16B 3GKZA 2GSIB 1OSPH 4JY4B 3TNNA 7CGTA 2FSEA 3AY4A 4KRPD 3KLDA 2CDGA 1QYGH 2YKLH 4YHOL 1H3WM 4G9DB 2G75A 1T22B 1Z9SA 1NEZB 3DO3A 3BPOC 4LCWD 4GG6E 2WIIB 5EIQA 4ZUSB 4PJCA 2ESVE 4FQCL 3FHQA 4QHKI 4LVOC 2VLJB 1MUJB 4PLOB 3EFDH 2MPAH 1SJHB 3DURB 4YAQB 5HTSA 2XKNA 5C0BA 3VXPB 4S11A 1KXVC 5SWSB 3P9MB 3MLXL 2QLVB 3B43A 3CFKA 1A3LL 4N0RA 3MUHL 3TLRA 3O45B 2P4AB 5HYIA 4Q2ZA 4BK4A 4ZG1A 1NAMH 4GW1A 1RUQL 3EGSA 1D7FA 4ZO6A 1GIGL 5I1LA 2DBLL 1TPXC 2YRPA 4F9LC 5AEAA 4YXLL 1KPRA 2HMIC 4WUUE 3GNMH 1DLFL 2AJZB 3FZUD 1K2DB 1G7IB 5EU7E 5AAMA 4EZMA 1ZLVH 1H5BC 2D7NA 2ICWJ 3ZMRA 1U42A 1RMFH 3BQUA 2HYMA 5IQ9B 3N1FC 5F7EH 3U46B 2HLFD 1T1ZB 3G5VB 5FUZL 3IXAA 4W4NA 3QA3B 3WL9B 3WS6C 1OPGH 5EN2A 4PGDA 3EOBA 4Z8FL 1PLGL 1I1AD 4UAOB 8CGTA 2AI0L 5JHDA 5I73B 3OKKA 4GMTL 5FGCB 4EDXA 4XVUC 4XVSL 2X9XA 3GUTB 1WEJH 2CKBL 4LFHD 8FABB 1R3HB 2ADFL 2X4TA 3S36L 5EBLB 1S7UB 3BOVA 2HMID 1II4E 5LG1A 5FB8B 1X5GA 3O4LD 5DJCA 5ESQA 2HJFB 1JUFA 5EU6D 1ADQH 2VDNH 2BOCB 1SVCP 4JE4B 2E6JA 3DUHA 1FO0H 5F89A 1HHKA 1YNTB 4MJID 4MD0A 1AQKH 3E3QC 4M8QB 4ZYKA 2HA1A 1IAOA 4V1DD 3L7FB 1PSKL 3LY6A 3WNLA 5I73C 4GW5A 4XBEL 4L4VE 1CT8B 1IAIH 4KUZL 5L7XH 4XVUD 4PJXB 3LOWA 2FBJL 4H25A 1A47A 3UAJD 4JB9L 4PY7B 4LVNC 3E6HB 3QUKB 1JPGA 1I85A 5CFHA 1RZJL 4DKEL 1KG0B 2HN7A 1IVLA 5DK0A 3KPSA 2F58L 5CJOL 4DK3A 2H26A 2FATH 1P5UA 2ZCKL 2IFFH 3DLQR 3S88L 4ONFH 1AKJA 1MJUH 3O3DA 2AGJH 3HAEG 4NNXA 3MA9H 1VFBA 3LMJH 5JW3L 5EIIB 5ACZA 1OP5H 1OGAD 1NAMB 4ZAKD 3PJSA 4F33A 2AXFA 4UTAL 3BKML 5DMGC 3L3KA 5E6IA 1MELA 2X89D 3S6CA 4XCEB 1J87A 4A6YA 5HXMA 1Q8MA 3SN6N 1H3PH 2FATL 4YBQC 5DEFA 4ZUUB 3QDME 3TC9A 4GLRI 2ESVB 3LRSA 4I8DA 4AZ8A 5IMMA 4NN6B 4N8PA 5MEND 2Y23A 3D0VB 5HYJD 5CD3A 3RZCB 4HIJB 4Y1AB 4G8GE 3LSOA 2Q86B 3T65B 1MRCL 4WI6A 2WANA 4OF3A 5MI0C 1XZ0A 1JYNA 4RFEB 1ZGLB 4KROB 4A2MA 2DJUA 3L5WB 2I07A 3QDAA 2ITCB 4JY5H 1EO7A 4MDIB 3MV7D 3O0RL 3LPFA 4PJDA 2CSPA 3QNYB 3ZHKA 3EYOA 3FOMA 1OF2B 3ZE2F 3GRWL 5J12B 1MCPH 4E41E 4AJ0A 4ZMAT 1WVZA 4YUEH 4ZFFA 2OR9H 4P2RD 1YPZE 2PO6D 4GAFB 5TDPA 3TYFA 3ZYOA 2IAMD 3OKLB 2CMRH 3RQ3A 3OF6A 5D1ZB 2NZ9C 3TV3H 1CXHA 1KTLB 4MB4A 2VR5A 4FQCH 1NCDH 4K3DL 1KJVA 3O8XC 3I02B 2DWEB 5I9QB 4LHJB 4NJ9L 5DI8B 4G43B 4NQCD 4WDIA 5IIEA 3C9NB 5BV7B 5I30L 1L9MA 2EDBA 2VWEC 5GISH 4RMVA 4JVPA 4NSKA 2R0LH 3VD7A 4FS0A 1NFDF 4PRHB 2V5MA 5SWQB 4F7MA 5HGDA 4TSCL 2FJHA 2A0LD 3AY4C 2BMKA 2IMMA 4WFFE 5DSCA 3MACL 3I2CL 4RGOL 1NDMA 3ARXA 3UYOD 1ZMYA 1F45A 1GGCH 3EYQC 1D5XB 4JDVB 4M48L 1IEHA 1I3GL 5FHBH 3BDXA 4CDGC 5E6ID 4P46A 4EEEA 4U3XA 1D6EB 3QUYB 4GKNB 3W9EB 3N06B 3D9AL 3RL1A 3A6BL 4QY8B 2VLME 3FB8B 4NQDA 3CDGA 5EUOE 1D9KC 2Y07L 1Q0YH 5ERWA 4LCCA 4XAKD 5EZLB 1QBBA 2HAZA 2HG5B 3KPRA 4P4KD 4P5MA 5D72H 4YR6A 4D0BB 5MEPA 5T1KB 2C3VA 4KAQL 5GS1B 4LVHC 3TA3B 1ORQA 5DD3L 1OD9A 4NCDA 1TPXB 2NXZB 1LEGB 1I9RH 5I75B 3BN9D 5HD8D 5FDWB 5HHXL 2C3GA 1QPPA 3VMPA 1G9NL 4KUCF 3CSYA 1EFXA 1QRNB 2VXTH 3LCYA 4UB0H 2OP4L 2YKLL 3QUMH 1WAAF 1MQKH 1MH5B 3WN5C 5C3TA 1A6VL 3S5LG 1YEEL 2OI9B 5F44A 5HHQA 1IAKA 1L6ZA 2AAVA 4AM0A 5CSZB 3MOBL 3FO9B 3NA4A 3VI4F 4KTYA 1RVFH 4RZCB 4WI5A 1MVUA 1JIBA 4LGPB 4Z7UA 5JMOC 5CSGA 3BQUC 5H94A 2CKBA 5AZ2L 2APXA 2VTFA 3GSWB 1I9RL 5C0DA 3FKUS 2VDQH 4ZS6D 3TN0C 4O5LL 2P5EE 2EH8H 4LSDA 3LQZB 5ELIA 4K7PY 1R3KA 2NXZC 5BMFH 1R3IL 1H3TA 3HMXH 3FZUC 2QSQA 1IFHH 2Y6SC 4XNQA 2NQCA 1JGUL 5FF6B 3VH8A 1YMMA 4MNQE 1R24B 3JWDH 1MFNA 4Y89A 4KUZH 1UGNA 3FOLB 4LHUD 5HYSB 2DQJH 1EHAA 2FWOA 2R0WH 2J3SA 3JUZA 4MXQC 1QFWM 3LVEA 1NSNH 3NVQA 4OI9A 4NRZA 4J3VA 3ULVL 3RVVD 2W38A 5IK3A 3H7LA 4L8DB 2IPKB 3G5YB 3EO1B 5K9OB 3W11C 1BVKA 2VLLA 4P2QD 5IM7B 1WFOA 4F15C 3CDCA 1BGXL 2V6HA 4DEPC 3PGCA 5JA9A 2FX7H 5KG9B 4KTEH 4P5TC 5HHNB 1T20A 2C1PA 4MVBD 1RJZB 3X3GH 1YEDB 1U8NA 1XH3B 1VENA 4YHKL 1M7DA 1J7VR 5C3LD 4BELD 2XY1A 3QSKB 1A0QH 2DAVA 4IRSB 1B6UA 3D0LB 3RDTD 3SE3A 3TA3D 4HF5L 1EZVX 3CMOL 4NO0B 4WU5A 5T1KD 2VSDA 5D7SL 2BNQE 4X6CF 4KVNH 5I19L 3O9WC 1FYHB 2P5WA 4ODWA 4NQED 3UJIH 1I7TA 2O5ZH 3QUYD 1CFNA 1T83C 4DEPB 2OMNA 4KJYB 4LAJH 4QF1A 5JHLH 1KJ2A 3HMWL 1ZHNA 3BH9A 4UQ2A 3RBSA 5A1AA 5B4MC 4PY8J 4O9HH 2EH7L 5ISZD 4JJ5B 3G04B 1D5MA 1CF8L 2BP3A 2VN7A 4F2MA 2Y7QA 3UROR 4JO3H 3LH2H 4PRHD 1W8NA 5D1QC 5D70L 3PP3H 4K9EH 3TGXA 1WIUA 5IB2A 3V8OA 2QBWA 5DJDB 4NN7C 2UWEE 5DEGB 3RJDA 5KS9B 3G5ZA 4ZNEA 5FO7B 3DYPA 3IFPA 5MHSE 1HIML 4NHCH 5F1NB 2ZJSH 1JNHA 2RFXB 1JV5B 5GRJL 1SEBA 5FHAL 3UC0H 1A9BA 1S9VB 3DXAE 1ERNA 3BIAX 2XI9A 4WHYH 3U1SH 3DXAB 1YJDL 3FL7A 3E2HB 4QRPA 2IAMB 4FOMA 1FFNA 1WGOA 4P2RB 1LDPL 1YYML 3VJ6A 4ZTPH 1WITA 1TZHB 4OIIL 3FRPG 1YQVL 3OJ2C 3R1GH 4P3DA 1BF2A 3X11B 3QXDB 2F53D 3QAZC 5HHPB 4XP4L 4KKCC 4CUCA 5LJYH 2M2DA 3WSQL 1UXSA 1KGCD 1G6RA 2W0FA 2C9AA 3CC5A 3TNMB 1QACA 3GI8L 4I18A 4WUKH 2D2OA 3L3GB 1ADQA 2DDQH 1SVZA 3P0VH 2EC9U 5ISZA 1GGTA 5D7SH 5GS0D 2XQYK 4WNQA 3RZCD 2DQFB 4JGMA 4LNRA 3WDHA 2PYFA 3IF1B 1RIUH 5F7FA 1JGDB 2JK5B 3C08H 1GHFL 3WFDH 4FXGB 3FN3A 2ESVD 1BX2A 4RQQB 1T0PB 4AH2A 4RMTA 3SDDA 4LSUH 5GIRB 5K9KA 4NQEA 1MHHA 1E6OL 1V8HA 4FZEH 5FCSH 3GI8H 2JJTA 5D71L 3IFOB 5L6YH 4WO4D 3STLA 5F7WC 1SMOA 2WM0A 1EGJA 1RHHB 4U05A 1I7ZB 2AERT 3BKJH 1CFSB 3MOBH 5IHZA 1ZWIB 3P77A 4P46C 3S5LA 3VFRA 1A6VH 1RURL 1UWGH 1WTLA 1RUKL 3HPLB 3SGEI 4X5LA 1NEZG 2ADIB 1EEYA 1FC2D 5HHVL 1CZ8L 4EUPH 1MJUL 1FNLA 3PL6C 2NY0D 3KPRE 2WV3A 5IW1B 2MCPL 4RA0C 3KYAA 1E0OB 2UWEA 1Q94A 1R3LB 4GXVH 1MRDH 4JDZB 4P5TD 2BSSB 1RURH 1XIWA 2DQCH 2VOTA 4R7NA 1N0XL 4UINH 1JPTH 2H3NB 1IGFH 2EKSB 1I3GH 4MXVF 4X5XB 4K3EL 4GS7C 2UVFA 3FO1B 1ZLWH 2P8MA 1TNMA 5IOPA 5JW4M 4LLDA 5GJSL 4HUWB 5KTEH 4XNUH 1CDBA 2AJSH 1FE8L 4I2XA 2W60B 1Z9OA 5I1DB 3L5IA 3P4MB 4WIQA 5FO9A 3GHEH 4WGWB 4I5BA 3ZKXC 4DAGH 3S98A 5F7UA 3BJ91 1NGZB 5KSAC 3AS2A 2ICWA 3IETB 1UKTA 2XTJB 1JNNL 1P69B 2OTUA 5C70A 4CNIA 4X9BA 1A6TB 1EFXD 2CUMA 1JPSL 3L3JB 4OT1H 4YDJB 4HKZA 5C0NC 4KZDL 1FLRL 3NFNA 4TTDD 1OPGL 2Y25A 1EEUA 2FBJH 4APQC 5GRWA 1TCRB 2YD3A 5KAQF 1YPZA 2HFTA 3NCYP 1VEOA 2NTSP 1OP5K 2XT1B 1Q1JL 4LIQH 4P9HH 4PG2A 4MXQD 4GSDH 1J5OL 3MLUH 4RIRB 3U9PH 5F70A 3ZYIA 1T21A 4QRQA 3TJHC 4PJDE 3G6AB 4YPGB 1OGTB 1AE6H 1CG9B 1WAAA 3C5SB 3C87A 5SWSD 3V2AR 4HJJH 3BXNA 4PJGF 1F8TH 4PRHE 5TE6H 3F12A 1PFCA 3HNTL 5LGHL 1AGCA 5DXWA 4XBPB 1IC5H 2VLJD 4TYUA 1DVFD 4XCNB 2ZUUA 1JYWA 2VDML 3M1BB 2YUXA 3SCMC 4CMMB 4LLVB 4XBEH 2EIDA 3S34L 1MCWM 3QEQD 2VIRA 3LKOB 3ABZA 1GAFL 3LZFH 4OCSL 3SDYL 1JGVL 4L4TA 3QDMA 3RVXD 2IFGA 4M1DL 2DYPA 3LV3A 1QR4A 4NZRH 4KKBD 4U1MA 1Q9KA 5T1LA 3GK8L 4NNPL 4LGRB 5C08E 3TPUA 1EEZA 3MJ8A 1N7MH 2JLLA 3CX2A 5B8CA 5EZIH 4JY5L 4OGAC 3QPQD 2KZWA 4U0RB 2HFGH 3EZ8A 3V6OE 4NQVA 1M4KA 5JPNA 3QCVL 3EJYC 1LK2A 1CIUA 3LB6D 5AG9A 4DOHB 5FK9B 3CUPA 5FGCE 3C5ZA 5J11C 4IDLA 4WW2C 3QXWA 4EI5D 5C0RH 2I9LA 1RD6A 5DQ9B 1V7ML 2DN7A 5KW9L 1F13A 3L9RA 3PL6D 1ZHBB 2AEPL 1QRNE 2CD0A 4LPWA 4NCC1 4I77H 5I15H 3ARFD 3U6RA 1OTTC 3KPSD 2Z31A 3CMOH 4PRAA 3MRDB 1G7PA 3T4YB 2FIRT 4OLVH 3FQWA 1A4JB 3QI9C 4HUUA 4QOKA 5J4MA 5I1IH 1TLKA 2VXVH 1XEDA 4Y19D 2CQVA 3W0WE 2VISA 1QFWI 5T3ZE 3VXUD 1WQVT 3GRWA 2F54E 5F6IC 4H8WH 5DVOA 2IH3A 1LO2L 5E5UB 1HH9A 3ZO0A 3PWNA 3WNMA 1DP0A 1ES0A 1IBGL 4XRCB 3Q6FB 3GEWB 2R23A 4X0KA 4Q6IA 3VXOB 3SPVB 3LKPB 3FT4A 4LU5L 5EU6A 3I2CH 4RGOH 2CK2A 4KH2A 2F74B 3TYGH 3UXFA 1UFUA 3S35H 1HQ4B 2BFVL 5I2IB 4D94A 2VXVL 1I3RB 5FO8B 1DN0B 5E2TH 1T7XA 5JNYB 2B2XL 3R0NA 4LMQI 3WIFA 2DQDL 2IGFL 5HDLA 4HK3J 5JOFA 2GK0B 2CUHA 2EC8A 2VLKB 4UQ3B 5D2LA 3C60C 5ICYB 4MXWL 1CXFA 3QYCA 2R1WA 3K2UH 3VDAA 2MSPA 2HTLC 1DBJH 1AI1H 1F4HA 2Q3AA 3UYRL 1Y6MR 1CICC 4PR5A 1EGJH 1W0WA 4MD5B 5E8PB 5FM5O 1ZVSA 2BVEA 3IDGA 3FONA 1S7SB 4KTDH 1L7IH 2VXUH 2YEZB 2UY7A 5DMGD 3S37L 3F62A 2ATKB 3QFDA 1TZIB 2CIKA 1A7PH 1MQKL 2E27H 3T0ED 3V6FA 1U58A 5I1CL 4C55A 3B8YA 1NGXB 1KEMH 3RNQA 1WBYA 3G6JB 4TUOB 2VQ1B 4L29B 1JBJA 2E7BA 15C8L 1INEL 1FO0A 4TUKL 1LDSA 1I9JL 1U8IB 2B5IB 3ARFA 1RZKC 4X8XA 3VCLB 3R06B 3UYRH 3W5NA 2IALB 4R7DA 5LBSL 4F57H 1NMCC 2YMXL 4LCIH 4P2OB 1DLHA 4X9HA 4ZS7H 3JSSA 2F9BT 4GJTB 3IDJB 5BO1H 1RJYB 1RZ8A 1MCEA 3SGJC 2E6QA 1A7BA 1S7XB 1CICB 4XZUA 4PUBH 1DQQA 4FN0A 4LFHG 1I1YB 1YEKL 5D2LE 1CVSC 3IDMB 1XGYL 2AK4D 1A21A 3QQ4B 3B83A 4Z76B 4X6BB 3KJ6L 2X4OB 2K3TA 1G9EA 1FVDB 4PLJC 2FGWH 4PTUA 3TVMC 4Y16A 5I71B 3EJZD 4J12A 2AQ1A 5K9QG 5F8QC 3B9KB 4QRUB 5D1XB 1EUTA 3VFOB 5C9KA 5T3ZL 1IKNA 3WD5L 4XCYB 1MHEB 3HRPA 2G75B 2UYLB 3BD5A 4XAWL 5ALBH 1NEZA 3B9KD 3PP4H 3W39A 3HNSL 3KYMB 5D7IF 4JM4H 4Y4FB 4ZUSA 2J5LC 4YXHH 3OV6A 3P30L 5HYQA 1AH1A 2VLJA 5EOCL 1A22B 5EH1A 3ZDYE 1SM3L 3OR7A 1WCBB 1C12B 2V7HB 2X41A 5CILL 4Z7OF 5IVOA 3DGGA 4C83A 5T3XL 4APQB 5CUSH 4ONFL 4H0GA 3HB3C 3QO1A 1GRWA 3Q6GL 1S8DB 4DUXA 1KLGB 2FLRT 5SWSA 2QADC 4M6MH 3P9MA 4GRWH 1J0JA 5EZOH 2C3XA 3DPBA 3RGVB 2IH1B 4OGAD 1JPST 4H26A 2WWMC 1IFHL 1UWEH 3EGSB 5I1LB 2BK8A 3P30H 1DQTA 1N0LA 1S7RB 3MLYH 5HVGB 5GGQH 3V6ZA 1KPRB 2OI9C 4OB5H 3WDIA 2IBGA 3RNKA 3BZEB 1HYSD 4HGWA 3F7QA 5DD1L 4FQ2L 4M62L 3GSNB 3B5GA 4Y5YC 4G9FA 3TWCH 1C1EH 5IW6B 1MAML 5ESAB 3WKMH 2EH7H 3STZB 4K3EH 1RFDL 3GK8H 1FNSH 1G9MC 2ID5A 1T1ZA 2FO1A 2VZUA 5IMOB 1WV7T 4HPYL 1BFSA 3VDBA 3GJFB 1U36A 1MRCH 5F7HA 3EOBB 1MFEH 5BS0D 1IL1A 5T1MB 1OCWH 1A14L 3M17B 4L4TE 4MDJA 4ONGH 3UTZB 3NFSL 4I3SL 3BN9C 4XP1H 1U91B 5HD8C 3IDYC 4I4WA 5JPMA 3HA0A 3CLFL 2B1AH 3ZL4H 4UT6H 5ADPH 4UB0L 5MP6H 4LVEA 2UY6A 4QHKJ 2VNCA 4Z77B 1TETH 1U95B 3BSZL 4QHLB 2NY5C 4HX1A 5KSVA 2GAZB 2OCFD 5KVEH 5E99L 5ECJE 5EUOB 1U3ZA 3PHSA 4OZFA 3V0VA 1RPQA 1G7HA 5IBLC 2C3HA 5ACMA 5C7XL 3HTLX 43C9B 4PJ8A 3QUZB 2Q7YB 2BOCA 4EDWL 1DCLA 2XWTA 4YHZH 1HHKB 1YNTA 2AV1A 1CK0H 1Y6NR 2VDOH 5C0CB 1H9VA 3BW9B 5T3ZH 3WD5H 4MGXA 5GGVL 3QUML 3MQIA 3L7FA 5GHWL 4WW2A 3EYUH 2IPTH 4DGIL 2X7LB 3CVHL 3L3HA 2CRZA 5L2KA 4XMPL 3JWOH 3KPQA 4LL9A 5CSBA 2DQJL 1JPGB 4FQJL 4K7FA 4R90H 1KG0A 2P8LA 3F7PC 3KPSB 3U36A 4Y0GA 4TNWK 1A64A 2R0LL 4WCYL 3DETC 2VZSA 3O6LH 4U1IA 4HMEA 1I1RA 1X44A 5TFSH 1YY9C 3B9VA 4BZ2L 4NQXA 3UX9B 1OLLA 2FRGP 2FX9L 4DTGH 2R8SL 2IADB 4OLUH 1XGPA 3MJ6A 4NZUL 3C09C 3O3BB 4JM2B 3CSGA 2PYEB 2X40A 4R0LA 3MV7E 2APTA 3FFDA 4MJ5A 4N0UA 1JRHI 3IDIA 3JVGA 3OZ9L 2GCYA 4ZUUA 2VLRE 3OGOE 3P9WB 5HGAA 1PW3A 5HI5C 4E42A 3HZKB 3HE7C 2VL5B 5KSBB 4PJEB 1J05B 3IJHB 3WJJA 4NKOA 1GGIH 2ARWA 3DROA 3VG9C 4DVRH 4X7SH 3QEQB 4LGSB 5DK3A 4ZTOL 2E3VA 3T04D 5I66A 3HB3D 2E5EA 4ZO9A 1OAUL 4LP4A 3LQMA 5E00B 2OYPA 5IVXA 1DVFB 1Z2KA 3HNVH 5E1HB 5HVFB 1W72B 2EDKA 4UT9L 3QNXA 1XR8A 4Q7DA 4Z78A 1UWXH 2XZAH 1FNEA 1XGTB 1MLCB 4XP6L 3U30B 3VA6A 1KFAL 4NBYB 4Y88A 4BK5A 1NCCL 2V7NA 3O41A 2EDRA 3QIUC 4L8SA 5C6WH 1LE9B 3D2UB 1MFAH 4ZFFB 4JPKH 4XC1L 2GT9B 3VFVA 3DX6A 2XNAB 1X5XA 2FGWL 2EDXA 2X05A 3QIWB 5CZXC 3F7VA 3CZJA 4H8WL 4K23L 3ARGC 4CGTA 3H9SA 4C57C 2VLMD 1A3LH 2QADD 5DFVC 2AV7B 3CGTA 5JW3H 3UCRA 3MBEA 1OTUC 4JRYB 1FNAA 2CLZA 1AGEB 1YDPB 4OZ4A 1KB9K 3L3DA 4HWBL 4B5EA 3LDBC 4AEHH 4UV7L 3IGAB 3JWNC 5C0CE 3R4DA 1I4FB 3KXFD 1IQDB 4ODUA 4PRHA 3L1OH 4POUB 5B39A 3EO9L 2FJHB 1G7QA 3P4LA 4LPYA 4NQDD 3MROA 3MRNA 5DS8B 5I8EA 4LSVH 3TO4D 1J8HD 5JIIA 4HFWB 3BD4A 5BVJA 4P46B 2YD7A 4CN6A 1QFHA 1IGCH 3OX8B 5IEKB 3CFBA 2A1WL 5I1EL 4G7YL 1FDLH 1SY6A 1F4XL 1JF1B 2DWDB 3V9FA 3PHQB 5DVMA 5K9QI 3LKRA 4NKQB 1T66D 2QQNH 1DQLH 1K8IB 2ED9A 2Z35B 2BC4A 2X4NA 4P5MB 3HRZA 3PE9A 1L0YA 5F9JB 2XKSA 5E6IC 1LEGA 4YDIH 3NFPB 1DBKH 3L7EB 1RUPH 1L7TL 1J0HA 3JV5A 1UB5B 4PB9L 2JB6B 4BFIB 2A73B 3QIBB 4AEIH 2MCG1 3ARGB 4OCWL 1INDH 5E70A 1NCBL 2V2XA 4G6MH 5EU4B 5IMLB 2FECI 1DQLL 2K7QA 1A7RH 4NUGL 1B4JH 3O8XA 2VLRD 2VDPH 4KV5F 4UZGA 5TDOB 5D6CB 1I7UB 2VDOL 4M9OA 1TQCB 5GGVH 1AC6A 2VE6B 4Z7VB 4HIIA 4KK6D 3RP1A 1T80A 1U3YA 3LQZA 1UZ6F 3W0WA 3MX0A 3QUXC 4EKXA 5I8CB 3UBXI 1UWXK 1RSFA 4P2YA 1KT2B 3OPZL 4QOKE 4XX1E 1KACB 5SWSE 4M7KL 2R2CA 2EIEA 1YMMB 1QZ1A 2AI0H 3VFWA 3F6IA 2W65B 3AC0A 4F9LA 5D7IA 3QUZC 5I1HH 2VKXA 3G9VA 4N0CD 2VERN 3OR6B 1P1ZB 5F72S 1ULVA 4N68A 1A6PA 3IJYA 1KJ3L 5DMIL 5CIPA 1N5YL 3PGCB 4XPAH 5FUOH 1JZ7A 3U48A 4Z95H 4JANB 2WBJC 4C56D 5DURB 2EDNA 2C5DC 1WFTA 4TSBL 4EIZC 3SDYH 3QP3A 1NFKA 5TDNA 4ZDHA 5DDHA 2A83B 4TNWF 2IQAA 4DOHE 5FYJD 3LN4A 1YN6B 4UOJA 3CFIC 5JXAL 3VRIB 4NO0A 4WU5B 4J3SA 2J6EL 4YBLB 5IG7A 4D0CB 4NWUH 4V1DE 1ZEAL 2CH8A 1FL3B 1UM6L 2Z31C 5E7FA 1JN6B 5JW5B 3K2MC 1NMAL 3F8UB 3IAPA 3HS0B 5FCUH 3AMKA 4ODWB 5B21A 4FFZL 3V7MA 1I7TB 1XGRB 3DHMA 3RWEA 3FTGB 2CLRB 5DZNA 5F1OB 1DBBL 1CLYL 1RZGB 4PG9B 3I3EA 3K1DA 3D39B 2EDHA 4PRDA 4X7SL 2DM2A 3U7AA 1KV3A 4MQTB 1T1YA 4O5LH 1MCKA 4YHIB 2ZSWA 1V5JA 1SMAA 4JKKA 4PGJA 3U9PL 4OUOA 4JM4L 4LDOB 1T1WA 2RCSH 4X8JA 1GVIA 4HJGA 4JZNB 4V1DA 1PQZB 4IRJB 2R1YB 3IFLH 4OKVA 4YXHL 2MKLC 1U2CA 5GS2D 3QUYC 4KDWA 4Y5YB 1HSAA 1S7WA 4G6KH 2BNUB 3FCTA 4HIXH 1FBIL 3QJHA 1NBVL 4HXAL 4XX1G 4CVZB 1A4KB 2OSLA 5E8OA 5D2NC 1EIBA 2PN5A 4F8TA 2MQ3A 5GGSB 4JM2F 3RA7H 3CFEA 2QEJA 5DD6A 1EV2E 2WBKA 2VAAA 1CGXA 4KJPC 4PRNB 1ZA6A 1J0KA 5JIHA 1KLFA 2CPCA 1RUML 3JXAA 5CBAB 2N4IA 2WBJB 4RWYL 5KSBF 2J2ZA 4QRSB 1YEHL 3PDGA 4YHKH 3LEYH 5D9SA 2J88H 1RZJC 1MHPH 4NO0D 3LN5B 2R1XB 5E0QA 4U6HA 4ZS7L 5KTEL 1NCUA 3SBWC 5F6HI 1FQ9C 3GO1L 3GSVB 5EO1A 5CCKH 3MBXL 4LCUA 5B39G 1K5NA 4K3JL 5C92A 2R56L 3KLAB 1XMWA 4NPYB 4ZUWA 4IDJL 1GOGA 4HUVA 1T03L 3BPLB 4ZUTA 4P2QB 4FNLL 3GMRA 5BZDB 2PXYB 4P2QE 1L7IL 3EYSL 4R3SB 2DQFA 3IU4L 3DX9B 2X9YA 4P4RB 5L2JB 4FTVD 3S4SA 4LHUB 4GMSH 4O58L 3F5WB 3MGTA 3PWLB 1B0GA 1JHKH 4D9LL 4OSUH 3IAGC 4AH2B 3MYJA 4GBXA 4EBQH 4XH2B 4TUJB 1B3JA 1DQML 1MHHB 4WW2F 5E2VL 4CVWA 5CJXC 5IEHB 1YY8A 3STLB 4OV5A 4OQTH 3C6SA 3SE3C 4J6RL 3PQYE 4FHBD 1FSKB 1L7TH 2BVOA 2QSCL 4X5WA 2JJWA 3ULSB 2PXYD 2YPVH 3S5LB 25C8H 4ODBD 4TN9A 1CU4H 5EZJB 1H0DA 3RHWF 3VGAC 3ME0A 3HMXA 5JUEL 5IB4A 1H15A 5EA0H 1N59A 2HVKA 5DD1H 3G5XA 3QG6B 1D5ZB 4OGZA 5JQ6H 2G5BA 1LE5B 4Z7VE 1U93B 2DI7A 2Y72A 4PJFF 1S5HB 5F96H 2IBZY 1W0YT 2NXZD 3BAEL 4JY6B 4QRTA 3CXHK 3QZWB 4X4YB 3DIFA 5F7DB 1ITCA 5IBUB 3ZYJA 3D1MC 5D93C 4XVJL 4HWZB 5CBEA 2WBJD 1VHPA 3IKCA 1BZ9A 4PY8I 2HTLD 4TOYL 4OD2A 2EKSA 4CBPA 1TVBB 4HMCA 5F6HJ 1OARH 4LSPH 3T0EC 3HZMA 3OXRB 2V5TA 4RX4D 5EUKB 5IOPB 2FD6L 2GUOA 3CU1A 1RVFL 3MRPA 4QGYA 2PETA 4D9RE 5FO9B 1AO7A 2D4DA 2ICEA 1OT1A 5GGRA 3T4AB 2QQLH 5I0ZA 5B38G 2DMCA 4IRJD 2YA2A 1FYTE 3QCUL 2XTJE 4GS7B 5HI4C 4U4BA 2C1OA 3K1KC 1SY6H 1NCBH 5AZEH 4JDTH 3JWDC 3LS4L 4HKXA 4LVHB 1U8HA 3TA3C 5EU5B 3OAYH 2AJ3B 4I3RH 3RIAF 3JWDL 2FIKB 2DD8L 3V7AE 4BYHA 4NQCB 2VITA 5E8NA 3WHXB 3BZ4A 3D39D 3GSXB 4XCFH 4JG1L 3SY0B 1QG3A 1XT5A 3OG4B 5IVXE 1KB5A 1HKFA 2XY2A 4U7KA 2EZ0C 2AJYH 1G6RL 1OTSC 2DRUA 4WJ5B 1P7QB 4OFIA 3SKMA 1BVLB 4LDEB 4EI6A 5F93C 4G80A 3CSBA 2NY1D 1ZT1A 3MV9E 1C5BL 3L6FA 4QHNB 32C2B 3T3ME 3DX8B 3PGDA 1MIEL 1IZJA 2ADJB 1E4XL 4KK8D 2VDPL 3VWJC 1DDHA 5DURD 1UB6A 1WIPA 4KJWC 1KTDA 2EDJA 5MEQB 1AXSA 5H37H 4MQSB 1A7NL 4XBPA 4Q74A 2F58H 1DANU 4Y5XB 3IDYB 4XBGB 3U0PA 5BXFB 2EDWA 2VIRB 3H6JA 2OTWB 4GKSB 4Y1AD 1J86A 4YC2C 5BS0E 1WSST 5MERB 3VFPA 4TQEL 3T2NL 2EC9T 1Q9KB 2BOBB 2HFEA 4KJQC 5EBMB 1YMMD 4XXCA 4FZ8L 2GY5A 3LEVL 3ZKNC 3O2WH 3PV6A 1I1CA 4AG4H 3H3KA 1E6JL 4KVCL 4NQVB 5JPNB 4U6YA 3TT3H 5IGXL 1BQHA 1T7VA 3EDEA 2FEEI 4R4FL 5FK9A 4FTVA 3N1MC 2YS4A 4WUUA 2VDKH 5B22A 4ZAKB 1U8JB 3TVMB 5KSBE 4JPKL 3O2DL 4NDMB 1EA9C 1WK0A 4XC1H 3ARPA 4Y4HA 5C6TH 4DKFL 2JCCB 1H5BB 4PJHF 1F3JA 5FEBA 2OXGA 3AFLA 4G6AC 1K4DB 4WV1A 2PO6C 2W9EH 5H8DA 4L5FL 3FQWB 2F8OA 1A4JA 4P23A 1QSFD 2WUCL 4PJFE 2UZIL 4I0KA 2XICA 3QO0B 2WUBH 4P5KB 5C6PB 1HHHA 3U1SL 2EDFA 4ZTOH 1LNUA 4JQIH 4K94H 2X4UA 2IH3B 1HXYB 2NY2C 2LVEA 4OLZL 2OS7A 1UH2A 3M8OH 4XRCA 3BGMB 3K4DA 5J1AA 1OQXA 4ZPVA 1G7MB 1URLA 1JGLH 1S5IH 1TJHH 5EU6B 4H1LB 3RTQD 3HI5L 2F74A 3G6DH 4S0TD 5HHMB 3U0TB 1DE4B 1RUQH 2EYSA 4P46D 3QWRD 2Z8WC 3O4LB 3SGEH 2VYRE 2CIIA 4PJAA 4JG0H 3BGFC 4JZJB 4YHLL 3DBXB 1UT9A 2HLFC 2PKDA 5DUMH 5JOFB 5DJ8B 2J88L 2GK0A 1Y6KR 4HK0B 3I6GB 3WFCL 4DK6A 4UNVA 3NZ8A 2NY3C 4RGNC 3KXFB 3AS3A 4L4VB 1AD9B 3UTSA 4LEOA 1S7VA 1BIIB 5GGQL 4PR5B 3UZQA 1MPAH 2GK2A 2RJMA 3DX7A 4Q6IC 3TJEH 5HDQL 1PEZA 3KYOA 1MWAH 4S1DC 2R4SH 1IC4H 4ELMF 5FYKH 1OAZL 2ED8A 1W72L 5D8JL 2VQ1A 4L29A 3D3VE 3DUSA 5D2NA 5TE7L 2A77H 3QIWD 3EOYG 4IJ3C 1FO0B 5SWZE 5E8EB 1YMHA 1T2QL 2EYRB 3HC3H 1HXMB 3R06A 4ZFGH 2ERJC 1UYWL 4Y2DC 3BVNB 1KXTB 4JFPA 4K8RD 4LSVL 2DTMH 2WSKA 1GGYA 2BSED 4R96A 5F3BB 1CE6A 5ACLA 1U8LB 5GGUB 5I1GH 1MWAL 5DJZA 4LP5A 5C08A 1T3FB 3UTTD 5E99H 3WXWH 4FABL 1G9MH 1I8LC 4O2FB 1FAKT 2P1YA 3MJGX 4RA3A 4ZS6C 3LS5H 3SOBL 2UUDK 3CPLB 4JRXE 1YUHB 3TBTA 2CXGA 4PV8B 4KKLD 5F71A 2EDLA 3TBSB 1ZKAA 3B9KA 4QRUA 4X7TB 3FAWA 1DQMH 1M1SA 3OKMB 3DSFH 3RIAK 5IFHL 4XCYA 1NC2A 4YDLC 1QA9B 3RWFA 4AMKL 1ZLUK 2YUWA 1B9ZA 1CGSH 3H42H 3SDXA 4Y4FA 4YDKH 4HC1A 3RA7L 2QQKH 3ESUF 1Q9WB 5JDSA 1YJDH 5BW7A 4QCIA 2X5PA 4NFDA 1YJDC 3RVUC 1T0MA 2PTUA 4Y19E 1C12A 3W0WD 1MFAL 1WT5A 5B38A 4FTVE 5JQHC 3KHQA 2DQUL 4HSQA 1XF5B 5FV2A 2BVQB 2D3VA 5DRNB 1WBZB 3RZCC 1OGAA 1Z0MA 2XPGB 3KR3L 4ODHH 2P42B 3O4OB 5BJTB 5AYQA 3IDUA 5IFJB 3GBMH 1H3PL 4M6ML 4Y7MA 3MREB 4BSWA 4RMQA 3EHBC 4R8WL 5IWLA 5MHSD 2YD6A 2XN9A 4ZXBA 2VQUA 4S1SL 2R2BB 5E95B 1A6ZB 3P9LB 2OM5A 3CVHB 2J6EA 5IB5B 4G9FB 2B7DT 5ESAA 3DMMB 3GJEB 2FL5B 3N1QC 3O81A 2VXQL 5DJXA 5MENA 1U3HC 4TRPL 1BQLH 4AQOA 5C0CD 1FZJA 2DMKA 5EO9B 3E6FA 1IL1B 4KVCH 1K4CA 3VGHA 4JFEA 3Q2CA 4I4WB 5JPMB 3OBAA 2B1HL 3FB6B 4F7PA 3MTRA 3GB7A 5GS0L 1YEJH 4LSRH 3JTSA 4JFZH 5IJKA 2NYYD 3BYYA 3D18A 3Q3GB 5EUOA 4LQ1A 3PHOB 4LSSL 1LDPH 5GS1C 5IP4A 3I3BA 4BQ9A 1N6VA 5EG6C 3F6LA 2NY4B 2BSRB 5HYJE 4JY4A 3MRJA 5JUEH 3IS1X 3L3OA 2BJML 1MCDA 4RNRB 2DYPD 2HFFA 3QDMD 1MCRA 1F6FB 1IC7L 4BZ1H 1EBPA 4KRMB 1T22A 3SCMA 1FYTA 1NMCB 2FECL 3GSNL 4G8FB 5E2WH 5D5ME 4MNGB 5F1KC 4MNGE 3DVIA 4OBRA 3LKNA 2FBOJ 2FHFA 1MFBL 3DURA 1SJHA 4FQHB 2EYTA 1Q9OA 1FL5A 2O5XL 5KANI 4FQ2H 3V5HB 2ORBL 1K3IA 2ADGB 4FQXD 1ZVYA 5T5FL 4FXKB 3RGVD 4NQEE 2WINA 5DRXA 1VB9A 2JCCF 3IT8D 3K0WA 1LO0L 1NBQA 1ZS8A 1Q0YL 3MGOA 4R4NC 3KPLA 4OF8A 5D72L 3V79C 2H41A 4I48B 1Q0XH 1LK3L 4APQD 4CU8A 1OP3K 4QGTA 2H32A 3B6SB 1HKLH 3ZT6A 2D9CA 1N5AB 4GRWF 4Z7WA 3VH8G 5K59E 5DUBA 1SY6L 5AZEL 3SE9H 3D69B 3B9DA 4GRLB 3HZKA 4LAQL 4PD4J 3C8HA 5KSBA 3BQUB 5EUOF 4F7CA 1KBGH 3AVEA 3IJHA 4KY1L 1MF2L 3FQRA 2BCKA 2D31A 3BQUD 1INQA 4OF7A 4N9GB 4NO5A 5BCAA 3P4OA 1UZ6E 1AFVL 9CGTA 3OKKB 4I13B 2MQCA 3HUJF 1QO3A 5I74C 1ZA3A 4EDXB 3N50A 5HI5D 1CWVA 4M43L 4YFDB 1XR8B 4Z78B 4TVPE 2AK4B 1XGTA 4PJBF 4HWNA 3LS5L 4NP4H 2GITB 4J3UA 4NGHL 4PRIA 4GAYA 1C8PA 4FFZH 1ZTXH 3MODL 4L8SB 4P2OD 2HJFA 1A2YA 1CGWA 3WJJC 4LLMB 1UQSA 4DAGL 2H2SD 1J8HA 2QQQA 5HY9A 1AC0A 2C4XA 4NUJA 5SWZA 3B5TA 5CEZD 2FX7L 2F8XC 4RDQG 4JRYA 4AL8H 2F54A 1BGXH 4FFVD 1CGSL 1EK3A 4LLYA 4MB5A 1J0YA 3E6HA 4ONHA 3U79A 3QUKA 4IIQA 1KB5L 2CDFB 3MRQB 4FQQB 4GOSA 3VXQA 4XMLL 4QXGL 5DHVH 4UINL 5FOJA 2NY4D 2R0ZL 4MQ7A 1ZT7B 4OFKA 1IQDA 4Z7VF 1AKJB 3O3DB 2OP4H 3VFNB 4PS4L 4BSVB 1MFDH 1G7QB 3BESR 4JDTL 4EQ2A 4P57B 1AI1L 4AENA 1JJUA 4CW1A 4WEUD 2D0FA 3PJSB 5E5MB 4QNPF 1G6VK 2XTLA 3L3KB 4PJGB 3RBGA 4BH8B 4YQXL 3H7BB 3T8XA 3CLEL 4FMKA 1F00I 4A6YB 3KXFE 4HEPG 5IEKA 3HNSH 2ZUXA 3GSUB 2RHEA 4RMUA 4URTB 1YZZA 4YHPB 3K80A 2YC1B 5C7XH 4HG4K 3VXUE 2HRLA 2UV3A 3BDBA 3OHXB 1AP2A 3BKJL 5GXBB 4G9FD 1U8QB 4PJ5E 2XQBH 3FT2B 2B0SL 3UDWC 1ORSA 1XZ0B 3MLZH 5KBNC 2JB6A 1ZGLA 1EAPA 2I07B 5HHOD 3ARGA 5BRZD 1MIML 3INUL 2FYYB 4KKAD 2XWBA 1F8TL 5EU3A 3HR5B 1HINH 2HVJB 4EI5B 1XFPA 4V2CB 3GMQB 3D87B 3BT2L 3NTCL 4RFOH 2N56A 3TYFB 3MACH 5IR1B 3W0WB 3QQ3A 3MJ9H 5DFWH 2OR8A 1KT2A 5IGXH 2B4CC 2FEDC 1KTLA 4F7TB 1Z3GL 2AJXL 4Y2DB 5CGYC 3VWJB 4AG4L 3NCMA 4R26H 2WW8A 5DRWA 3ROLA 2W65A 3I02A 4MA1B 5D7IB 3SDXF 4HULB 3CFDB 1WUNT 5IQ7H 4JFXA 4R9HA 2H8PB 4D9RD 1BJ8A 3TF7C 1RK1A 3NTCH 1RULL 4MMZC 2BNQB 4O4YL 3T0BA 4GG6A 3BKYH 3VXME 1ED3B 5F7EL 1QQDB 3Q5OA 5L2KD 2KZ1B 3ILPB 4C58B 2I24N 1QEWA 5CMAB 1KYOJ 4XXDA 4D8PB 5L88L 2IQAB 1F42A 4NO2B 5KN5A 1YEFL 5DJAB 1UADC 2J4WH 4U3HA 3VRIA 2EE3A 5IV2B 4GKNA 4XI5C 3W9EA 2ICWI 1KBGL 3ALPA 2JCCE 1IE5A 2VABA 4OZIB 3C60D 1SQ2N 4J8RB 3HG1E 4QRPD 3VGGA 5DMKB 1OAKL 1CDHA 5ERWB 3K8LA 3SE8L 1BWMA 4ZO7A 1XGRA 4YR6B 1FAIH 4D0BA 5FYKU 1J8HE 3MLUL 5FAAA 1IKFL 3P2TA 2A6IA 1ORQB 1Z9LA 3QT2A 2MJWA 3VRJA 5E56A 1CQYA 3QHFL 3AXLB 3ZKQD 5BRZE 3SKJL 4F7EB 1EFXB 1QRNA 2CGRH 5ENWB 4GFTB 3C6LB 2X4PB 2X70B 3IDNA 4U6VL 1MH5A 3FQXA 5DJ6A 3C2SA 2APFA 1KUMA 4HUKB 4YBQD 2P7TA 5GRXG 4L4VD 4QO1A 4JR9L 3SQOL 1U8PB 3FO9A 3RWGB 2F54D 1T1XB 2GW5A 4M61A 4WHDA 5E9DB 15C8H 3OKOB 4LEXL 1I8IA 3GSWA 3WUZA 5FECA 4BH7A 3P40A 1N0XH 4MJ2A 4U6TA 4NJAH 3BAEH 3PQYB 4YGVA 3RAJH 3VGDA 3BFOA 3T1WA 3RTQB 4J7RA 1ZA6B 1UEMA 4GBXD 3ARBC 5FOBB 2GIYA 2VAJA 1DBJL 3FO2B 5C07D 4JFOB 4P5TB 4L8CA 5A43C 2FWOB 2D03L 1P4BL 1BBDL 1CGVA 3O6LL 1X5KA 4NRZB 3THMH 1MEXL 3TZVC 1R5IB 3LB6C 4PS4H 3EO1A 2AEQL 4ZFOA 3MO1B 5ISZE 1NBYA 4OKDA 1QSFB 4LCWE 2R9HC 4LCUB 2IBBA 4PREA 3EYFB 1M7XA 3KLAA 1QBMH 3WYRA 4ZUWB 3Q1SH 1CGUA 1U8NB 1FO0L 1XH3A 3FQNA 4D0DA 5ICZB 2NY5H 3OAYK 2APBA 2IMNA 5F7KC 4POYA 4LPVA 2D03H 1P53A 2PXYA 4LCIL 1EO8L 4U0RC 3TVMD 2QR0B 1QLFA 3GIVB 4NOBA 1UM4L 3S4SB 4M6NH 5KVFH 4WO4B 1I8LA 3PNWA 2J1KA 1QNZL 4WWKA 1YEEH 2P5WB 5GS3A 4XH2A 5E2UL 3T0WA 2H9GB 2ZPKH 4FFWC 4M6OH 3MOQA 3IDXL 1GIGH 3DETD 4MSWB 2R9HD 1IM9D 5TH2B 5IEHA 4KJYA 4G8EA 4ODXB 5KSUB 2OJEB 1REIA 4NBZB 4D9QD 4DGIH 5DVKA 5J6GA 2B0SH 4Z0BL 3PIQA 2MKWA 2OJZL 2Z9TA 3DUUB 4OUUB 1YEIH 3HE7B 4DCQB 3HKFA 3C8KB 5F6IB 4QRRA 4PTTA 5JZ7D 4G5ZH 4NHUA 1F90H 6CGTA 4HPYH 4YXLH 4BQ6A 2ZUVA 4X98A 1P4LB 1FYTD 4OF6A 4NM4L 2D9QB 3DVNA 4NZRL 3G5ZB 1S5HA 1PKOA 4QRTB 4OLEA 5I17B 3DIFB 3MRIA 3WUWB 2ZKHL 1XGUA 4H88L 3HC0A 1LILA 1P7QD 2V2WB 1UWEL 5E1AA 5INDB 3DXAD 2FR4A 5J1SC 5FYKD 4TULL 3HHRB 2YUVA 3FQTB 5LXGH 3WXVH 1FGVH 4PRIE 1TZHA 3GM0A 3LIZH 4LHUG 4HZLA 1MCHA 4G6JH 4P3DB 3S3SA 3MV01 1RULH 4O58H 4JZOB 1D5IL 3VXMB 4GUPB 1A3RH 2EE6A 2GJ6D 4PJBA 1OGAE 4LLUA 3FO0H 2OR9L 4UILL 4XNMB 1T4KB 1A6UH 2VDRL 4J6RH 1PG7L 5D7JD 4YXKH 5ISZB 5BOPA 5IHBA 3BPNB 4Y19A 1KIRA 2RCSL 2B5IC 3GBLA 4PJEE 2PYFB 1TNNA 3PWUB 4L1DA 3H9HA 3M07A 4S2SB 1ZTXL 1VFAA 1NPUA 5CILH 1NC4A 4RGNE 2WQRA 1KB5B 4MYWB 4NQEB 5T3XH 3PL6A 3NBNA 4ISVA 2CGRL 5B3JE 1KJ3H 1B0RA 5DMIH 3IFOA 3DOSA 3QDJE 4XPAL 1BVLA 5K33A 4EI6B 2BXZA 2OJZH 2FDBP 1I7ZA 3UMTA 2BRRH 3L6FB 3RDTB 4IRSD 3RKPA 1AHWA 1E28B 1GGBL 3MV8B 1FIGL 2DF3A 4GBXC 5DHVB 1RIVL 4KHXH 4FMFA 1GGCL 3UTTA 5MEQA 3FFCE 1N4XL 4ZD3L 2DS4A 5C0AB 1NFIA 2VL4A 4OZHF 1N64H 3AREC 3ZTNH 1B90A 3U0PB 4L9LA 1VA9A