5EBMB

Kcsa t75g mutant in the nonconductive state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmB01
3MRHB 3TFKC 3O2VH 2K9UA 2AEPH 3P9MA 3TV3H 3EJZC 1PX4A 3C08H 4NZTL 3PGCB 2EDKA 1E4KC 4JPKL 4W81A 4QRPE 4EVNB 2ITCB 4Z5RB 4M1CC 3HMWL 1IZJA 1RZGA 4KVNL 3QFDB 4L8BA 3TIDB 5TDNB 2BVPA 1CICB 2OJZL 1WZMA 4C58B 3ZDZF 3CZFA 1HHKB 1JGEA 2DLHA 1GGBH 5F9JA 1AQDB 4C56B 5JW5B 2IAMD 5GGUB 2XNAA 4U7SA 4XBGA 5F3HB 2DM7A 4OZHF 3VGDA 3WHE1 5DMGC 1S7RB 4I2XE 5DRZA 2XI9A 2J7LA 4ESKA 1Q9KA 3L3GB 1MFDL 3OKLB 2B7DT 2F58H 1RK0A 3MYZA 4C83A 4FFYL 3S6CA 1A7RL 1QR4A 2DL9A 2BVTA 4F7MA 4PY7A 2D9CA 3EYQD 4K9EH 4NQDA 2CRYA 2X4SA 1XF5A 5KVDL 3EDKA 4S1SL 3RVWC 5DDHB 2HG5A 3D3VD 3UP1A 5DRXB 4C4KO 2Y1VA 5J3HC 1F4XH 1IM3B 1ZK9A 1TNMA 2VZ3A 5I74B 3WDHA 2YUZA 3CD4A 3HZYA 4P9HL 3ZHDA 4HK0B 4NUJA 2Q8AH 2QQQA 5KN5B 3P73B 4YXHL 5DQJB 4G9FB 5E03A 4PJAE 5F96H 3VRJA 1EEZB 5DK2B 3TNNA 1HSBB 1JRHH 2JKXA 3RVTC 4TUOB 2DQGL 2MNUA 4N0CC 3BZDA 4KMLB 2LU7A 4HLZG 5FA4B 5GQBA 4LLUB 4FXKB 1EFXB 1CXEA 5BV7B 3IDJB 1SHMA 3LKPA 4OJFL 2ZJSL 1DBBH 1QPPA 4NC0B 1VFBA 3MV9D 3RPKA 4HXBL 4L3CA 5F7WC 3PQYE 4NFCA 4NHUA 3HAEG 4QRPB 1MCEA 5TE7H 2NZIA 4K9EC 5BW7A 1NL0H 4XPBH 3KS0H 4L9LB 1P4BL 4MCYA 4J4PA 1YMHA 3GM0A 2ZUQB 4YZFF 3K46A 1ONQA 4R90L 1I7RA 5ISZA 2G5BA 2WUBH 5HDQL 4QXTA 5GISH 3ULSA 2YUWA 5GRJH 4I2XB 4Y4KB 1XGUA 2ED9A 4TN9A 4HD9A 3MLUH 2QSTA 4R4FH 4MJ5A 3LN9A 3EDEA 4Y2DA 4JO1L 1R24A 5CUSH 3RWHA 1V7ML 3QPQC 4CMMA 5AEAA 5JOPD 1KJVB 4S1QL 5J1SC 1OLLA 1ZHBB 4POZD 5HDLA 1I8IA 3HB3D 5FK9B 2ADFL 2IALB 4EUPA 3RWCA 1A9BB 4HIHA 4UTBL 1C5BH 1DUZA 4LQFL 5E56A 3DX8A 2BJML 1U8HA 1EEQA 4KAQH 4E9LA 2UY7A 5ENWB 4JO4L 1RQ5A 5IIEA 2NPLX 1DTUA 4GW1A 4GW4A 2DF3A 3I50H 3CVIH 3VGHA 2BHUA 1AHWB 5HGDB 4H0IA 2OMNA 4PJAB 4S1DC 3EOTH 1WBYB 5FEBA 5JR1H 4ZOAA 2CXKA 1A3QA 4JM2C 1FVCA 5HHQB 5KSVA 4Q6IA 4F9PA 1B6UA 4KUZH 4O51A 4FP8L 3O41A 4WUKL 4QF1A 4TTGA 1YY9D 1CL7L 3CCHB 5DD3H 2CPCA 1ZLVH 3K4DA 1IAIH 4PJCA 4LOUC 3OKDB 3PQYB 4UDUB 1KTLA 4O2EB 1AD0A 3U0WH 3KPTA 2XKNA 3WIHA 1MREL 3TVMA 4QRUB 4P23D 2A9NL 1N8ZA 2A73B 4OIAA 1BOYA 3LN5A 1MELA 3DV6B 4HAFA 1DL7L 3MACH 2IG2L 1NC4A 1FZJA 4XP1L 4PTTA 5DWUH 3CSYA 3VRLF 4ZPVB 4P5MB 5ID0B 1HHIB 3QDAA 1WTGT 5BO1L 1X5HA 2EEAA 2VXSH 4MD5B 3BAEH 2NY7H 5JPNA 3O2WL 3JWDL 3DUSB 5I73C 5KTEH 4BQ9A 3K7UA 4S10A 4U1LB 4ODBD 2NY2B 3SJVA 4DW2L 5LBSL 1MJ7H 5E8PB 3UDWC 3GIVB 5DHVB 3UC0L 3KXFD 4JFYA 5JMRA 4WU7B 3RGVC 4FXLA 3M07A 4KJYB 4ZG1A 2NXYB 5EOQL 2YN5A 4YE4H 3LAFA 2NTFB 5CJXA 3RTQC 3VFUA 3CX2A 2UV3A 4PJIE 1CGWA 5T3XL 4AENA 3P77B 4KROB 2XY2A 1MCKA 3O81A 2MTPA 4ELKB 4YHZH 5F71A 4RMWA 2O93L 4HUVB 4G8FA 1LP9F 5CGTA 1WBZA 4YBHA 5KVEL 1WCBB 3WJJC 5E08L 2FBJL 1JZ7A 3IJSB 1KT2B 3PGCA 3KNBB 4NRYB 3S36L 1DE4A 3H9ZA 1DFBL 5GZNC 1MCWM 4G8GE 2ITCA 4EVNA 4J3WA 3STZB 3QFDA 5TDNA 1DBKH 1CICA 4Y19D 1QSEB 2ADGB 1M7IB 2D9QB 2E7MA 2EDDA 4LRIC 5FYJL 3DGGA 5KS9A 4EI6B 1HHKA 3FT4B 3VGFA 5BRZE 2D3VA 4CGTA 1WIOA 2RIKA 4H20L 4XBPB 5JW5A 3MX0A 5GGUA 4MLIA 2ZZUT 4H88H 2W0PA 2IQAA 3D25A 4LF3A 4U1MB 1LEKA 3L3GA 3OKLA 4GG6F 1VGKA 2VN7A 3ES6B 4WNQB 3FFCA 4TSAH 3D39D 4OLYL 3OBAA 2G2RB 3MLVH 2Y07H 5IHBA 3FQRB 3TYGL 4F33A 3BPCB 1JL8A 5MENE 4D0BB 1IC4H 1RU9L 1D9KD 4HFUL 5B3JF 3MREA 4UT6L 3QHZL 1JMXA 5FXCH 4MA3B 1CR9H 5ICXA 3U6RA 5DRXA 1A6WL 5FECA 5F21B 3E1F1 1KPVA 1A47A 2DICA 5GGTA 4RBPK 4MJID 3DMMC 4XCYA 5C0IB 4P3WA 3VD4A 5IMOB 4DN4L 3E8UL 4R7DB 5KN5A 3OB8A 4RGNE 1OSPL 5DQJA 4G9FA 5T1LA 2H8PA 1I85A 3DTXA 4KMQA 5ESVB 1EEZA 1KUMA 4PGDA 5DK2A 4TSBL 3UMTA 5E99H 1OAZL 3HMWH 1II4E 3QO1B 5F44A 2EH8L 4OZFH 3KPOB 4RWYL 4NSKB 4PJIB 1G7HB 3WIIL 5FA4A 2I9LB 2OJZH 3WUWB 4LLUA 3IDJA 1KELL 1MCPL 1U3HD 4ODXB 4CVUA 2HRLA 3OB0K 4UNTA 4OCLC 5T5NG 3SDXB 3O8XA 4LHUD 5GRYA 4PPTA 3TBYA 4DGYL 4GLRI 1EERB 1GGUA 5IHZB 4Q6YA 4QRPA 4G8GB 4Z7UE 1ACZA 1KPRB 3MGTB 4FFYH 5C70A 5GGTL 3NACL 4L9LA 1BFTA 2LE9A 1A3LL 2PETA 3B43A 5BRZB 1A7PL 5KVDH 4JGMA 3PNWB 3BDBA 1NCUA 2FZ3B 3CNKA 1W0VB 3TZVD 3PWVB 4Y4KA 5IW3A 3HI6H 1CXIA 1EX0A 4M4PA 2L0DA 4PJ9B 4O2CA 4YFEA 4YDKL 4XMLL 5EO0B 1P6FA 2RR3A 4MX7B 2W1NA 3VD9A 2E7BA 1KJVA 1IBGH 4OGAD 4YXHH 4UDTB 1MF2L 1WV7T 1ZHBA 3AS3A 3H6JA 5CD5C 5MENB 3QIUB 3L3IB 4OCMC 3IAGC 1BFOB 2IALA 1A9BA 4RMVA 1WWCA 2MQ3A 3VFSB 4OJFH 4UAOB 1AE6H 2ZJSH 3UTQA 1E4XI 3V6OA 4NPYB 4HXBH 3DVIA 1AHWA 1LILA 3FQNA 4RGNB 3G5VB 3KPPB 3VWJB 3TF7C 3ZHLA 1P4BH 5F1SA 5FO7A 1D6EA 2NY6D 2X44D 4K3JL 2FO4A 1AO7E 4R90H 5F88B 2VDPL 1XF3B 1BD2D 4ORGB 5DURB 4GKOA 5HDQH 2KQMA 3E6FA 2C5DC 4NQEE 4UQ2B 5J6HA 3OKDA 2HVJA 4HX1A 4UDUA 4O2EA 1RPQA 4OAWB 1KNOB 3BGFC 4G6FD 4H26B 3NABL 5FUCC 1J8HD 2O5ZH 4I48A 4Z7UB 4JO1H 1GOHA 1MJUL 2A73A 4HF5H 1V7MH 1AC0A 3DV6A 1QKZL 1TZHB 4S1QH 1Z6JT 2N56A 1UYWL 1W72B 4P5MA 1SEQL 4DUXA 4UTBH 4MD5A 3BZEA 1LNUB 2A74A 3OF6A 5HGGS 1VADB 2HT2C 5D93C 4RAVA 5DS8A 4HK3N 1N59B 2D7OA 3VI3F 5I1JL 1TITA 4U1LA 3RVXD 1CE6B 5BCAA 4QGTA 3RQ3A 5E8PA 5IM7B 1JUFB 2W9LA 2V7NA 4PRID 4OFVA 1U8MB 3ZE0F 4KJQD 4OFYA 4UV7L 1OCWL 4KJYA 3RL2A 3FOMB 4BZ1L 1AKJB 5HD8C 5T1DH 1VB9A 4LARL 3CSPA 4MAUL 4WUKH 3P77A 1CL7H 2ENYA 4EUPH 1MY5A 4QHMA 4X0KB 5KW9H 3GDBA 3IDYB 5DTFA 3D2UB 5J11B 4OB5H 1C12A 1WCBA 3KNBA 2IG2H 1I9IL 3STZA 1EH9A 5BW7C 4QGYA 1AO7B 2EDHA 2H9GA 3OJMB 2ADGA 3RBSA 1M7IA 4J4PC 2DYPA 1BIIB 2FGWL 4EI6A 1BQLL 2Z91B 3FT4A 1NEZG 1T7XA 4NQEB 5IMMB 3D85B 4DTGL 1GHFL 1FIGH 2WQ8A 3O2WH 2CIKA 3DROA 1QO3B 1NUGA 4ODTL 2FEDC 3C60A 4QLRA 4DW2H 2P8MB 4WNQA 1VEMA 4LLDA 4NT6A 2EKJA 2AKRA 3UYRL 2G2RA 2DTSA 1A1OB 4GT7A 1NGPL 5GGSA 5IF0B 1BZ9A 1U8IB 3BP7B 1B0GB 5EOQH 2D7TH 2BOBB 2YSSA 4D0BA 3WNKA 4FFWC 1G0DA 1Y0LB 5T3XH 2VLMD 2ADJB 3EFFB 4M9OA 3NBNA 4LCCA 3NAAL 2QL1A 2DBLL 4PGZA 2IEPA 5KVEH 4EXPX 3VWKB 5CEZE 2FBJH 5E08H 1YMMA 4OZGB 5CHNB 1H3PL 4DKFL 5CKAA 4ACPA 4QYOB 3KPOA 5HVHB 2CKNA 4PJIA 1RUKL 2I9LA 3WUWA 3TA3B 5FYJH 5MEPB 4CVZB 3JWDC 3T65A 4Q6IC 3X3FH 4H20H 2PCPB 2V9RA 2VLRD 3KPRA 4RFOH 4X5WB 3SGJA 1SJVA 1FL5A 2OM5A 1RZ7H 4G8GA 4OLYH 4Y4FA 4QRRA 1N5YH 5HYIA 2WWKT 1GAFL 3EO0B 3TO2B 4OSUH 1NCCH 2IH1A 1KCRL 4NO2A 4XCNB 5BRZA 4Y1AE 2KDGA 2YD7A 1RU9H 4HFUH 5GJTL 2B0SL 4NC1C 5FYLH 1S9VB 3I6LE 2FZ3A 3GSWB 3MBED 4UT6H 4I0CC 1J88A 4LRNL 3S4SA 3T04D 2V5SA 1UJ3C 1ZMYA 1TVDA 1MH5B 3MOAL 4P46C 4ELMA 4PJ9A 2EYSB 2HFEA 1T0NA 5F7EL 4NQCD 3ARDA 5F1IB 3E8UH 1OF2B 4UDTA 1OSPH 3HAEA 4G3YL 4HEME 4M48L 2Z8RA 4WO4C 5MENA 4XNUH 2N4IA 3L3IA 3TO4C 1OAZH 5K59E 1MVUA 4YQXL 2EH8H 2NTSP 4TYUA 4RWYH 2YR3A 3WIIH 2Z35B 5H8DA 3F5WB 4OM1L 4MXQC 1YDPA 4HIEA 1T0PB 1MCPH 3LDBC 5BOPA 1GGCH 4CADA 2NY4C 1A6UL 1QYGH 4NPYA 1CQYA 2V17H 2JIXB 1FNHA 4DGYH 2IBZX 3KLDA 3ZKXB 3L3JB 4XHJC 4MNHA 2X5PA 3BH9A 3VFTB 1HCVA 3NACH 3X12B 3SGDH 2XTLA 4OKVA 3QWRA 3NN8B 2OZ4A 2I07B 3B8SA 4OFPA 5DUBB 5LGJB 5E6ID 5F88A 1TFHA 3S98A 5F7UA 1I7ZB 1XF3A 2CQVA 4ORGA 3BUTA 4BQCA 1BBJB 5HHNB 3O6MH 3QA3B 3SEPA 3D69B 4UQ2A 1VA9A 4ZS7H 1OAUH 3CVHH 4OAWA 5CZKA 4P2QD 1H3VA 3MUHL 4H26A 4F9LA 1PDKA 3T4AB 2D4FA 4O58L 2YXFA 1JV5A 4YDKH 3NZHH 4U1NB 1T1XB 3T2QA 3R0MA 1RIHH 4KRMB 1DQTA 1RUML 4DKAA 1JNLL 3LPWA 1TZHA 3I75B 5JPMB 5CFHA 1FFRA 5HGBB 4ISVB 3NIFF 1W72A 1F42A 3IJHA 4Y1AB 4JFED 3RIFK 3MLWH 1HDMB 2OXHA 1F90L 3GMPB 1Q72H 4DEPB 1RUQH 4OI8A 4PJCF 1D5BB 4QNPE 3PABB 5GZOC 2EDYA 1LNUA 5ICZA 3HA0A 1VADA 5DQ9A 3U30C 2GAZB 1LVEA 2OSLB 3EKCA 3WEXB 5DEFB 5J6GA 2UWEE 5IM7A 1JUFA 3TH4T 4FFVC 2X42A 3T8XB 5L9DH 5T33L 5A2KH 1CCZA 3W0WD 3B9KB 4JFXB 5C0ND 1U8MA 5HDBE 5DK0A 4Z78A 4NO0B 1RZ8B 5C0BE 4I9WD 3DX7A 2VWEE 1I85C 3BQUD 4FNLH 4WTXA 4K3JH 5HY9B 1HQ4B 2VDPH 4U7MA 3L9RB 4P2OD 1UXSB 4PJ8B 1W72L 3C87A 5C0GA 3DHJA 4FQQB 1CT8A 1DN0A 3FB6A 4J6RH 3KPNB 4X0KA 5FYKL 4PLJC 5F9DC 4AH2A 3RBGA 4K7PY 4BUHA 3O8XC 3NABH 4YFLI 4XWGL 3K2MC 4Z77B 1MJUH 1F5WA 1A02N 1A1MA 2C4FU 1QKZH 1S8DA 1S9XA 1MWAB 1UYWH 4N9GB 1AO7A 1SEQH 2JCCE 3HC3L 3BDYL 5IMLB 1DDHA 1EO8L 2ICWI 3LS4H 1OAXH 4KTEL 3RY5A 5EIIA 4UILL 3D85A 5D5ME 1FFOA 1LEIB 2VDNH 1BX2A 2D4DA 2GKIA 2XTJC 1QO3A 3MUGB 2R0LL 5I1JH 1BAFL 4JPVL 4N8VG 2HWZH 5D7JD 5B21A 2YPKA 3ALXA 1A1OA 5KS9F 1RJYA 3BP7A 1B0GA 4ONFL 1ZT7B 3RU8L 1TZIB 4BZ1H 1ZGLP 5HYFA 1ZHNA 2BOBA 1B90A 5DEGA 3REVA 1N6VA 4LPVA 3MV7E 4PTUB 4MAUH 3EOAB 1Y0LA 4W6XB 1BGXL 3B4NA 3WIFA 4TPRL 1VDGA 2UWEB 4EI5A 2HLAB 5SX5K 1YN6B 4NM8L 4M7LL 1OTSD 3V6OC 2EH7L 5D7IE 3S37X 2JLLA 2XXCB 5I1EL 5C0BB 1I9IH 1MCWW 2JELL 4RSVA 4QYOA 4F15B 4WV1C 3UYPA 3O4LD 4XNZC 1BQHG 4YLQT 1Q9OB 1MLBA 4NCDA 3TA3A 5I30H 5MEPA 2FGWH 1BQLH 5IMKB 4DTGH 4N0UE 2PXYD 1IC5L 1ZA3B 1JIBA 2E27L 5IVZB 3SHSA 3VXMD 4X5WA 4QTHB 1PG7X 3MA7B 1KXTB 5EOCL 5EC2B 3TNMB 3UYRH 5I75C 1W0YT 2JCCB 4OLWH 1NGPH 1VERA 5LAXA 4GAJL 4R4BB 2WBJB 4XPAL 4D9QE 5J1AB 4X4XA 5D5MB 5KSBE 4JY4B 3TM6A 4HZAA 2BZDA 4X9FA 5AD0B 2NYYD 1S9VA 1MHEA 3GSWA 3C8KB 2EEDA 1FV1A 1WZ1L 1MSPA 2EYSA 1KIRA 3NAAH 4OQ1A 4L9DA 3AXLB 5JZ7D 1F97A 2DBLH 1GZQA 2G75A 1ES0B 3FFDB 5HI3C 4Y4HA 5F1IA 2QADD 3EYUL 3BRDA 5AYUL 4PJFE 1H3PH 3AM8C 4DKFH 1P7HL 3P4OB 5BOZG 1XF4B 4EEEA 5L2JB 5GGQH 3MV7B 5JLZB 3NPSB 4NQDD 3WNPA 1OPGL 4MXVF 4KVCL 4WEMB 2DKSA 3MNWB 1Q9LA 3QIBD 2OL3B 3GGWA 1X7QB 5D7IB 4UT9L 3IFLL 3L7FA 3VXSD 5KG9A 2ZCHL 1G6RB 3EOBB 3X12A 1S7VA 4PUBH 5JOFA 5E2VL 3PJSB 4ZPTB 1GAFH 1E6OL 1S9YB 3NN8A 4P4KB 3C9NB 5HHME 5IG7A 1DN2A 4IIQA 5FKPB 5DUBA 5LGJA 3ZSSA 3HZMA 3RAJH 3V5HB 2GUOA 4N0UB 1ZLUH 5GJTH 2B0SH 3F65A 4PJBB 5HHNA 5ELIA 4LMQE 5CINH 4U0QB 3QHFL 2EE6A 3D69A 3TCXA 4R96A 4QWWD 3MOAH 4YO0B 2H26B 1CXKA 1B0RB 4P48A 5F7EH 1A6TB 1O7VA 4PG2C 4CUCA 1T2QL 2BC4B 2GEEA 3I75A 1NSNL 4R97C 3S3JA 4XVSL 5L0QC 4KI5E 4JPWL 4M48H 1OAYH 3RIFF 5KSBB 2X9WA 2WIIA 3L3HA 4YQXH 5SV3A 4DGIL 5A2JH 3QDME 2JJUA 3GMMB 2D7MA 2LV4A 1D5BA 4OM1H 1JGDA 2F54B 3QT2A 4BFBD 1YA5A 2IH3A 4BFIB 3ZTJG 2GAZA 1MCQA 4OD1H 4JANA 3QG6B 1A6UH 3WEXA 4LVNC 1JGVL 3NMEA 3G6JE 4UIKL 3GJFB 3ZE2E 4HLZH 1KOAA 4RFNB 2J6EA 4GO6B 3N1QC 3WN5A 4PRNB 3DURB 2JK5B 1PKQE 2A6IA 3B9KA 4JFXA 4Y2DD 2EE3A 3RWIB 5J0BA 4AMKL 4NO0A 3Q6FA 3ETBF 1UACL 4QHNB 1P7QB 2WUCL 1WF5A 3CH1B 4R9HA 5I8EA 4M7JL 1UWEL 3TC9A 4M43H 4NKOA 5TDPA 5HY9A 1HQ4A 3K0WA 1MQ8A 3HAEH 1UXSA 3L9RA 4AIZB 3FB8B 4LEXL 3CSGA 4QO1A 1U36A 2QQNH 4FQQA 2VZOA 1T7ZA 3E3QE 4MDIB 3MUJA 3FZUC 1U58A 5LXGL 2R1WB 2AAVA 1LD9A 3UAJC 2MFNA 1RUMH 1JNLH 5HHMB 4Q9QL 1MCNA 4Y4FC 2J6EL 1M71B 4PJ5D 5F9OH 4F2MB 5FUZH 5K9OB 3I3BA 4NO3A 4YHLL 4XZUB 3CSBA 5JHDE 4XT1C 3H3PL 4L29A 1Z9LA 4NBZB 5I19L 5J89A 2GTZA 4KK8D 3MUGA 3BN3B 3MRRB 1CLOH 4JFZL 2IFFH 2ORBL 2BXYA 2G5RA 4KZDH 5T33H 3HFMH 4RMUA 3TVMD 2X6MA 3VW3L 3NCFB 5JW4R 3ARDC 2ATPB 3QDMB 2BSED 1TZIA 2BMKB 4FQ2H 4J3UA 1NC4D 4KKCC 3K1DA 4Y89A 5I71B 3SCMB 5KANG 1J1OL 1M05A 1NMCC 4Q9CA 3WO4B 1T7YA 3I9GL 3UTTD 5JA8B 1ORSA 4PTUA 2FCBA 5ECJE 3EOAA 5DD6B 1TVHB 5I17B 3MRPB 5EU6E 2O5XH 2UWEA 1PEWA 5FYKH 2HLAA 3EDFA 1IQDA 1YN6A 5GSRB 4G6JL 3CDCA 2SEBB 2WIMA 3GBNL 1PKQB 4XWGH 1CU4L 5C0BA 2HKHL 2XQBH 1C1EH 1VHPA 1CGUA 2OTUA 1Q9OA 3HC3H 5IQ9A 2FSEB 4JDVA 3SBWC 3S3SA 2HRPL 4KTEH 4MQXD 5IMKA 4FG6C 4JQVA 4UILH 1ACYL 1HWGB 2O61B 4DZBB 4ZQKB 3WKML 1JNNL 2PO6D 1LMKA 4QTHA 2R0LH 3ZL4L 3MA7A 4NBYB 4JPVH 4UU9A 2OLDA 3GM8A 5C6WH 4F9LC 4CMHB 4XTRC 1SJXA 1T1ZB 3P0GB 4JFOA 1JGLL 4PJIF 1XFPA 2JCCA 1K3ZA 3VMOA 3V7MA 2YD3A 4R4BA 4P5KA 2WBJA 3RU8H 2AEQL 3PL6B 3T09A 4OFKA 4EN3B 2P5EE 1U8OA 5JHDB 5D5MA 3MCKB 5AD0A 5DRNB 2BOCB 1CICD 3SKOA 3C8KA 5DR5L 2Q8BL 2BNUB 3HR5A 4C56D 3LCYA 4JLRA 4LCIL 1NANI 5HYJE 3SDAC 3WV0A 3AXLA 4M7LH 1T5XB 4H5SB 3ZDXE 1A0QL 2EH7H 1ES0A 2X1PA 2YWYA 3IU3A 4PGJA 4JJHA 4JZNB 3FFCD 4JHAL 1INQB 2MKWA 1C08B 3PV6B 3AVEA 4W4OA 1BOGA 3MR9A 1UH4A 4UINL 5L2JA 43CAB 3LSOB 5C9JA 4U6VL 4ELMF 5DYOB 4QRTB 1J11A 1IGMH 5MEOA 1IC5H 4KXZH 4N9OB 1KEGL 3DV4A 2FX9L 4G6ML 2BVQB 1CFTB 5TGBA 4UB0H 5B39G 1O0VA 3ARUA 3MODH 3TLRA 5CEYA 5EB9A 3QUML 1G6RA 3WKNA 4ZPTA 1S9YA 3C9NA 4GAJH 1NFIA 1NMBL 3LHPH 4G7VH 3KYAA 5DO2D 5D6DC 2AS5M 4G9FD 4XPAH 3BP6B 3V5HA 4OTXH 4N0UA 1KLFA 2DKUA 1QG3A 1NUDA 2AJSH 2JTDA 1KCVH 3DLQR 1LDPH 5GS1A 1ETZA 2NQCA 2X4UB 4FABH 1EFXD 5IWLA 1E6JL 1DEDA 6FABL 2CRZA 4XVUC 1VFMA 1EV2E 1IFHH 1WZ1H 1R5WB 4P5TC 1B0RA 1FYTE 2GSIB 1VFUA 1S7QB 2OR8A 2BC4A 4UI2A 1DQDH 1ZVHA 4FS0A 5AYUH 2P5EB 5JXED 4QRPD 4GMSH 1IAMA 4D9LH 2E9JA 5H2BB 1OLZA 5CIPH 5KSBA 4BA8A 1K2DB 2R0KL 4XCEB 3VFVB 5D72L 3U79A 1G6RL 1ZAGA 1OPGH 1TDQA 5EIVA 4HZLB 1A14L 2Z31B 1E28A 1S5IL 3H9HB 1QRNE 4Z7UF 2HA1A 2YS4A 5HYJB 2O5YL 4RGMB 2AK4E 5F7YC 3QG6A 3TN0C 4OBRA 2DMCA 3VD3A 1LK3L 3GJFA 4Y4KD 2VIRB 5EBWA 3SDDC 4LCYB 4UT9H 1MPAH 4EI5C 5C0DA 4PJFA 3O6KL 3OAYH 2JK5A 2ZCHH 3MFFB 5EG6C 4WW2A 1E4WH 1A2YB 4U1SA 5D1XA 3GSXB 3L3DA 4O5LL 5E2VH 1E6OH 4XC1L 1Q94B 4HT1L 5SWSA 5I1AB 3EFDH 2NNAB 1MCHA 1DVFA 4AIZA 4M6NL 4FHBD 3QHFH 5IB5B 4MDIA 2H32B 1PSKL 1FLRH 2VR4A 4XAWL 1I3RB 4B0MM 4MS8D 1U2CA 2WP3O 3RDTB 4PY8I 2BERA 2CLRB 3LRSA 4XVTL 3RGHA 4L1DA 3O9WC 5IVXE 1EHLL 2JJWA 2DQEH 2QBWA 1M71A 4ZFOA 4I3RL 5I16B 5E1AB 4HIIA 4WWKB 1EIBA 5A43C 3MLTB 5DFTA 1SJHB 4YAQB 2Z93B 2AP2A 4UIKH 5A16A 4BK5A 3L5WB 5ESAB 2V5MA 3PQYD 1E27B 2VQ1B 3OAZK 3QQ4B 2VDRH 1IRAY 4W4NA 2LQRA 2YD6A 3PHQB 5DHXB 3SOBL 1OD7A 2ESVE 4AMKH 2ATPA 1RJLB 3QDMA 3MRDB 1OM3H 1YZZA 2BMKA 4MAYC 5C08A 3QZWG 3V2AR 3JWOL 1UACH 1GC1L 4G9DB 5D1QB 2WUCH 1UFUA 4FRWA 1YYML 1QRNB 4MVBD 2YKLL 1XAUA 4LEXH 1FL6A 3N9GH 1NFDE 2AK4B 3IGAB 4ZFOL 1TVHA 4LKCA 3G6JA 5MI0B 1QBAA 1A4JA 3OF6D 4MJ6B 2DB8A 1CXLA 4FMKA 2SEBA 5CJOH 2ZSVB 1PKQA 4XB7A 5HJ3B 2BY0A 3LQAL 5TJWK 2NY2D 4U2ZA 1GZPB 2LAAA 1N0XL 3MRKA 3WCYA 4BKLB 5E24E 5EUKB 5D71L 5C8JA 2J6EH 3I6KB 4R7NB 5D1ZB 5F72S 4N1HB 2NXYD 4K55A 4IIQC 2ZNWA 4WHCA 4U31A 2YD8A 3RIAF 4MMXC 1Y6KR 3BP4B 2VDQL 4RQQB 2VE6B 3BWAB 4LHQB 4KROD 2QQKL 4JFZH 4M03A 5CJQL 4U0RC 2ORBH 1D7FA 5DVNA 2XA3A 2W60B 2FNBA 3CLEL 3AS1A 1T83C 5IVXB 1OTTC 1UM4H 4MZ3A 3VW3H 3T0DA 1T1ZA 4HHAB 3QIWC 3JWNC 5HHPA 1BPVA 3H2WA 4FQXB 4X4MA 1TPXC 2GJJA 2R2CA 3IB4A 3PWNA 4EN3A 3PL6A 3PP3H 5C0CE 3BIKB 4CJ1A 1WICA 5F6HJ 3BOVA 1C8PA 1J1OH 1CDYA 4K3DL 4XB8A 4M1GL 4NJAL 1I8LC 3DBXB 2EEBA 1QFHA 5T5FL 1VEOA 1P4IL 2Y6SD 2GCYB 1T22B 3HE6A 3Q6GL 1T5XA 3D18A 4H5SA 1A6PA 1CU4H 2G60L 2YEZA 3HZKA 4GRWE 3GKWL 3C60D 1I1AB 3WN5C 4JN2A 1C08A 1QFWI 1XF1A 3CU7A 4OGYL 4Z7WE 5DJCB 3NIDE 2VKWA 4LVHB 43CAA 1NFDB 1UCTA 1DBAL 2HRPH 5EU6A 3IJYA 2VNCA 4QRTA 3ARBC 4LLAA 1UB5A 1ACYH 1JHLH 3LKNB 1VACB 4PB9H 4S2SB 5IVNA 1JNNH 3MZTA 5ADPH 1CFTA 4OT1L 3ZL4H 5DJXB 2HKFH 4WFEE 1J5OL 3G9VA 4GXUN 1JNHB 5SWZE 5GS0L 4KHXL 1JGLH 2WSKA 5JW4M 3UTZB 2AEQH 1DBJL 2PUQT 2R9HC 3BP6A 3UROR 1KN2L 2B8OT 4U3CA 1NGXB 3FT2A 5DR5H 2F5BL 2B5IB 4LAQH 4LCIH 1MJ8L 2FJFB 3EGSA 1T03H 4LPWA 1UWXK 4JKMA 2K1MA 4HC1A 2Q7YA 5C07E 3RX5A 2P5EA 5C0CB 5EO9B 2NX5E 4G8GD 4NIKB 5CMAB 1A4KB 2P49B 1K2DA 4JHWH 3V6ZA 3VFVA 4LPXA 3BKJL 3RZCC 1R3JB 3EO1A 4U6VH 5BRZD 3U4AA 5LWYH 3FHAA 2VISB 5HYJA 2AVGA 4YUEL 4EDXB 1ZT1A 4MDJB 3PHOA 1KEGH 2FX9H 4G6MH 3BPOC 4JEGB 1FZMA 1LHZA 5JDJA 4LCYA 4LBEA 4GRWB 5MHSE 4ZXBC 3H7BA 3MLRL 5BJTB 5A1AA 1NKOA 1H3TA 4PJ9D 5T3ZH 3B6SA 3KJ4C 3MFFA 3QUMH 3V52H 4CU6A 4RMRA 3EYFB 4Z7WB 3DVNB 3O3DA 4OCSL 1BM3H 1R3IH 2NY3C 4NHCL 3SDCC 4X6BB 1C16A 4HC1L 5MEND 3QIUD 2NNAA 3OKKB 2P7TB 4QOKE 4D3CL 4P3CL 2X7LB 3GJFK 2W0FB 1E6JH 6FABH 2H32A 3OJVC 5DK3A 2FECI 1F45A 5K59F 1I3RA 2GK2A 3MJ9A 2XN9A 4YC2B 2CLRA 1IKNA 4S1RL 3LEVL 4RGND 3RL1B 4LPTA 3MFGB 2R0KH 5I0DA 2IAMB 4FTVA 5D72H 5E1AA 3HE7B 4GH7B 4WWKA 2I24N 3WNMA 4OI7A 5FF6B 1ADQL 5DURD 1FYTA 2FH8A 2O5YH 3BEWB 3K80A 1LK3H 5T1KB 3V5DA 3L5WA 1E27A 5C07B 3HR6A 5D2NE 3O6KH 3QQ4A 2NX5B 1PZ5A 1T80A 2QSCL 3VMPA 1XGTB 1BJMA 1P9MC 2LTQB 1G7LA 1RJLA 3LKSA 2JJSA 4O5LH 1F4HA 4ZO7A 5CP7A 3MJ9L 5HGAB 5IGXH 5E6YA 3LEXB 1FSKB 4HT1H 2ZWLT 5GGVY 5IOPB 1CN4A 2CD0A 4M6NH 1I7UA 2AK4A 3IGAA 3PXHA 3X13B 2AJZB 1S7SA 3OV6A 4Q7DA 2DLFL 1XMWA 1PSKH 2Y9RT 2X2YA 2ZSVA 3CFKB 3K4ZA 4MJ2A 1ZHKA 5I9QC 5INDB 1GZPA 4QNPF 3OZ9L 2AEIT 1ZTXL 2CKBL 4FQJL 4JAMB 4BKLA 1NC2B 4BSVB 4ZFFA 4AG4L 4JKPL 1C5CL 3I6KA 4R7NA 5D1ZA 4HGWB 3QXAA 4I3RH 2F19L 4QOKB 4Y5VB 1MHHB 4Y8AA 2UWEF 3MV9B 2EXYD 5TH2A 4BQBA 4TTDC 5FKAA 4BQ6A 3GSRB 4GW5A 4AYFA 5LCVL 5HDBF 1H5BA 3BP4A 2VUYA 5GS1C 2VE6A 3BWAA 1J1PL 4HV8B 3FN0L 3ZKMC 4NNYA 3ROOB 5IFAL 2CDFB 4NDMB 3ULUE 4IHOA 2LU4A 5IVXA 4WUUE 1RUPH 2WWMC 5GIRB 3SOBH 5DJAA 1QFPA 3O6FB 5ITBL 4E0RB 4PGEA 1ZWIB 2D31B 1GC1H 1G7QB 4CBPA 5B4MC 1YYMH 1AO7D 4XP4L 2YKLH 4KDWA 4Z7QE 5C1MB 3DBXA 1FN4B 1WCQA 4NQED 1V5JA 3D85D 4MD4B 2MHAB 4M7LT 2FEEI 1N7ML 1T22A 2O26U 2YD1A 4IRZH 5D2NB 2JCCF 5INCB 4YK4C 1KULA 2ESVA 3ULVH 3CPLA 3QI9B 2RGSA 5D5MF 4GJTB 4JRYE 4KU1A 1I1AA 4HIXL 5D71H 5IP4A 4WW2C 5D1XC 4LU5H 5I1DB 3D0VA 3DSFH 3S36X 1NFDA 3GMOB 4JZJC 3UTSE 2DJUA 3MRLA 2NY0B 2R4SH 3IFNL 5F9AC 1MHPL 1OW0A 3LKNA 1DVFC 5IB3B 3VMNA 4S2SA 3MRFB 1J18A 2VDQH 4LSPL 3QCTL 4WGVB 2XRAL 3B9AA 3L3KB 1XF2B 1H3UA 2QQKH 5CJQH 1TZGH 5GGRA 5DJXA 1QTYT 3MSPA 4PRDB 4MHHI 2W65B 1JNHA 2XZCL 3VWKD 1AP2A 1GC1C 3RWGA 4C57C 3CU1A 4N1EA 4GBXC 5HTSA 4TOYL 4N5EC 2ERJC 1HH6A 1KB5B 4L4TE 4V1DE 4E41E 3L95A 1JK8B 5D7IF 4M1GH 1NGXA 3TBSB 3TA3D 3MYJA 1LE9B 3CDYA 3UO1L 1AGEB 3ULVC 3WHXB 4Y0GA 1P4IH 4K7FB 2X4QA 4I0PA 4L8DB 4WUUB 3Q6GH 4LEOB 3RJQB 1URLA 2J88H 4GXVH 3V6BR 4F7EB 2NR6D 5B39A 2G60H 2P5WE 2X41A 5C0CA 5EO9A 4J3TA 2AJVL 1ORQB 2N7BA 4MJ4A 4GG8A 2BXZA 4FQLH 4LVOB 2YMXH 5IJKA 1DBAH 1JFQL 2VISA 1LO3L 1D5IL 3GJEB 1BBDL 4MDJA 4TVPL 3W5NA 3EDDA 3GSNB 4H1LB 1JTTA 2HJFB 4OT1H 4U6XB 4YBQC 5BQ7A 3MJ6A 4JRYB 5KSBF 2DMKA 2HFFB 1FRGL 2B1AL 3TJHC 4YHNB 1MUJB 4YIQA 4CAGA 4KHXH 3TESA 3EYFA 3QUZC 4Z7WA 3V6FB 4Y4HD 3ZT6A 2FD6H 4RMTA 1CXFA 1RV6X 3QXVA 1DBJH 2CUHA 4Z18A 1HHHB 1QBLH 3UTSB 3KLHC 5E2TL 4ERSH 5C0FB 3OKKA 2P7TA 4QHUA 5DD1L 2X7LA 5C92A 1FNFA 3O45A 4IRJC 4WI2A 2Q6WA 2LVEA 2F5BH 4PJFF 3VXRE 4WW2F 3G6AB 5HSFA 5DJDA 5SWZA 2JIXD 5CEZD 3MLYH 2H2SC 2F5AL 4J2XA 3RY6A 3FONB 3BEVB 4L4TB 2UZIH 5HXMA 3MRGA 4E41B 4P57A 5AUMB 1RY7B 3BKJH 2D7PA 4OLEA 2GJZB 1CK0L 1OB1B 4TQEL 1YEKH 5FF6A 4KKBD 2IJ0C 3UJJL 4YUEH 5K9JL 2LAGB 4F58L 3V0AC 3BJLA 3VG9B 1T5WA 2DDQL 4YEEA 5T1KA 1NGQL 4I13B 5C07A 3GBMH 2P5WB 3MLRH 3BZFB 3U9PH 1FH5L 2HT3D 4GRLB 4EIZC 3C6LC 2ZOKB 5L2KE 5HGAA 2YBRB 4NHCH 1WSST 3LEXA 4HC1H 4LASH 4Y1AD 3GHBL 3IFOA 3I6LD 4JO3H 1MCRA 4JG0H 1LEGB 2D7QA 1N6UA 4UOW0 2AJZA 4E42B 1U8LB 4KI5F 2VYRE 1R0AL 3DYOA 5SWQB 2I9TB 4R4ND 4PJGE 5INDA 3QEGL 4N0FB 4NWTL 4S1RH 3AAZB 3LEVH 4JAMA 4R8WL 4KZEL 3B9KD 1FNLA 1IE5A 2V2TB 4HGWA 4M02A 2ZCKL 4NO0D 3G6JF 4QOKA 5EPMA 3UTPE 3ZE2F 3QZWA 4LHUB 3HUJE 3WFBL 4WI6A 2C1OB 3UJIH 3K2UL 2P24B 4H0HB 3RWJB 4JGJA 1S7WB 1ADQH 5HGHA 4MZ2A 2H1PL 4PJ8D 5JW3H 1EZVX 1J0JA 4I77L 4MWFA 4YXLH 3OTTA 3VXRB 2Z92B 1OSZB 4HBQA 4HV8A 3IDIA 5EZJA 2CDFA 4UT7H 4PY8J 1XGYL 1CQKA 2DQDH 3MMEB 4KQ3H 2I5YH 2QSCH 5GIRA 3TIEB 5HYSG 1L6XA 3ZTJH 1GVIA 1N4XL 1DQLL 3O6FA 3QJHB 4E0RA 1OGTB 1LDSA 5IEHB 5IQ7L 4FA8A 4YGVB 5IK3B 4ZODA 4KUCF 2PW2B 4LPYA 1OD9A 2IBZY 4ALAL 4I3SH 1SVCP 3MXVL 3T1WA 4MD4A 2MHAA 3TT3H 1A6AA 3FB7A 4NZUL 5D2NA 5ACLA 1JVKA 5INCA 1DANT 2EZ0D 2VQTA 1FZKB 4FN0A 3OZ9H 1ZTXH 4WTZG 5J06A 5L2KB 2CKBH 3AC0A 1XR8B 5CWSB 1OARL 5AZ2L 4AG4H 1C5CH 3W9DB 3WNNA 4PV9B 1V3KA 2F19H 3ARFB 3GMOA 5CBEB 4PB0L 2J8UE 3QNYB 1CGSL 3PWPE 2FHCA 5CLTA 4PGCB 3BPLB 2RFXA 2FJHB 1OTUC 3L3KA 1J1PH 1TETH 4PJGB 1XF2A 3CK0L 2F74B 3NFPA 4PRDA 2CIIA 3TT1L 3SKMA 2EDRA 2W65A 3CUPB 5CAYB 1WGOA 1HYSD 5C0AA 4YDVB 1I1FB 1UH2A 2B39A 1BD2B 1IKNC 3BKML 2PTVA 4JRWA 5C0BD 2FX7L 1KB5A 5JUEH 2X4NB 4IMLB 4XP4H 3PXJA 1JK8A 3TBSA 1HZHL 3T3PE 5E2WH 3S5LG 2EYTB 1C5DA 1T20A 1WC7B 3DX9B 3QO0B 4XCFH 3S35L 2GYSA 1N7MH 1T7WA 2Q7NA 4L8DA 1QPXA 3WYRA 4F7EA 2VL5A 3T2NH 5JNYB 4BJLA 2DLGA 4M1DL 1HI6B 2BY2A 4NNXB 2NY1C 4QCIB 4HIXH 1P5UA 3UZEA 4U1GC 1NLBH 1ORQA 1MFNA 1U8KB 3JXAA 2BSTB 2WBJD 4XI5D 1HHJA 3CGTA 3CDGA 4BH8B 1CDBA 1MHPH 3GJEA 2WAHA 1FGNL 3AB0C 1CLYH 2OR9H 3GSNA 2XRAH 4H1LA 2MOVA 2HJFA 4U6XA 4ODSL 4KY1L 2MJWA 4NRXB 5H37G 4HUKB 4HIJB 3QQNA 5EZIL 2OXGA 2XZCH 1KACB 5AYQA 3S9DB 3V6FA 2X4RA 2HT4C 2XYCA 1HHHA 4FQ1H 5C0FA 2J8UB 4HCRA 5IB2B 4IRSA 3U0TB 3ZDXF 4JN1L 1ZEAL 3PWPB 3MV7D 2C3VB 4UTAL 2WK2A 2FRGP 2RHEA 5C6TL 2P4AB 3L5XH 3W39A 2QHRL 3G6AA 1H5BC 2D2OA 1LO0L 2HLFD 4F7PB 5FHBL 1CF8L 3GSNL 4WFHE 3FONA 3MCLL 3BEVA 3X3GH 1MFEH 2DI7A 4L4TA 2GI7A 4V1DA 4L3EE 5IB1A 5F9WC 4E41A 4GQ9L 4P4KD 4W68A 3G5YB 5AUMA 4Q0XH 2GJZA 2W9EL 3WLWC 5FGBA 3K8MA 1JFQH 5C0JB 1LO3H 4NM4L 1D5IH 3T0BA 1BBDH 1NPUA 1IGIL 4TVPH 4HCRL 1K5NA 3U9UB 3C2AL 1F3JA 2GITB 1QLEL 2WANA 4JB9H 5MP6L 2P5WA 3BZFA 4PRPE 4JCMA 1JCKA 4XPTL 4GFTB 5A2FA 1Q38A 2KH2B 5IJVB 2ZOKA 4N1CA 5L8KB 4D9QD 2YUXA 3LMJL 3MBXH 3MPCA 1T6WA 4R2GC 1YQ2A 3HG1E 5FM4A 5DD1H 1RFDH 4JHBA 2HTKD 4RGOL 5IKCB 5I76B 3QUXA 1U8LA 4E42A 1OW0C 3R8QA 2I9TA 5SWQA 4HFWA 5IHLB 1NKRA 1J0ZA 4U1HA 1JPSL 3DRQA 4N0FA 2F5AH 1KCUH 1SY6H 1RK1A 5AWNH 3U1SL 3EYOA 1KIPA 3OKOB 2ARJQ 4AL8L 5J13C 5GRUL 3INUL 2F53E 3DUHA 5DD5L 5EULV 2MQCA 4UAOC 4K7PH 3VFMB 4EDWH 1P7QD 2C1OA 2P24A 3RWJA 4G8EB 4TQEH 3V9FA 1S7WA 1B9ZA 2A83B 4LP4A 4WWID 3UJJH 3VXRA 3P2TA 5K9JH 2KZWA 4HMCA 1ZLWK 4IEFB 5DD0L 2R0WL 2DDQH 3PDGA 1CFNA 3VWJC 4U1IB 3MMEA 4JM2B 1MJJB 4I0PC 4ZD3L 4YHML 2FDBP 4POYA 3QJHA 1BZ7B 5IEHA 5HHMD 2BNQE 1DSFH 1DCLA 1YN7B 5IK3A 1B0WA 1ED3B 5DJYB 3MOBL 2PW2A 1U8QB 4EKXA 3Q5TA 4IS6B 3CMOL 4K3EL 3L1OL 3T3MF 4MB4A 1DJSA 5IJKC 2P8LB 4XP9L 5FGRA 3RRQA 2AEWA 5IVXF 1PD6A 3BYTA 1JNJA 4LVEA 1KN4L 1R0AH 1CZ8L 4PRPB 3BISA 4XNMB 32C2B 2KL6A 2PW1B 4EBQL 3FCTB 4NUGH 3OXRA 3QEQA 5L2KA 1T66C 4KI5D 4JDTH 1A1NB 4AQOA 2XFXA 3HG1B 3QDMD 3LN4B 2ZCKH 2HTLC 1GPOL 3ARFA 4U49A 2OTWA 5I73B 4ZOCA 5HPMB 3WFBH 3SCMD 3K2UH 3QNYA 4GSDL 4WFFE 4XNYL 1FO0H 2A6KB 4I77H 2CDGA 5EU3A 1YUHB 1IAOB 4UUJB 5MEQB 1MRDL 3RGVB 2F74A 1CVSC 1XGYH 4J3VA 1Z9SA 1NBVL 3CUPA 2JJTA 2Y7QA 4J8RB 4KKLD 2EXYC 4WEBL 2F53B 3QRGL 3RTQB 1HEZB 5CBAB 1NFDF 4YDVA 4PR5B 1DQLH 1I1FA 4IBLT 1BIHA 3HUJA 2FIRT 2X4NA 4IMLA 4ALAH 4L5FL 1OWRM 1G9EA 3NCEB 4KDVA 4ZUTA 3UJTL 3IDYC 2IF7A 3U7YL 3UZQA 1CG9B 3PDDA 1A7NL 1IGJB 1QQDB 5I1CL 1ND0B 1P84K 4JG1H 2G9HB 1WC7A 1S7XB 3BH8A 5BZWB 1KV3A 1E4KA 3D5OF 4KUCD 4NZUH 3U0PB 2VDLL 1WK0A 1F3DH 1N3NB 5JNYA 3ILQD 3ARSA 4G80B 5ACZA 3ARVA 1J87A 1HI6A 2BNQB 4NNXA 1HXMB 3AFLA 3HZVB 1KPUB 2KPNA 2WLYA 1EGJA 3LZFL 4F7TB 5DVOA 1BZQK 1JF1A 1OAKL 4HUWB 3ZE0E 3PL6D 4XMPL 4EN3D 3O2DA 5JHDD 2CLZA 1WUNT 4PB0H 1QUNA 4PJXA 1MCCA 2IADA 4CW1A 1TCRA 1EO7A 1INDL 2B20A 1VPOL 2E9WA 3W0WB 3F7VB 1HYRC 3CK0H 1T3FB 2JB5H 2AJ3B 4HIJA 5GS0D 1KJMB 2PNDA 3I2CL 1IARB 4APQA 2WLZA 5HHOE 5DEZA 3BKMH 5DMKB 1HKLH 1EHNA 5K9QG 4LQ1A 2J8UA 4HXAL 3JBG7 5DJZB 3PWPA 3QUKA 4ZS6D 4ODUA 4LLMB 2VERN 1HZHH 4GRWF 3VXTB 3DMMB 4Y5YA 3V4PL 5EU6D 5ALBH 3VXNA 3U2SB 1QA9A 2YA2A 4YR6B 2DOCA 1RZFL 4M5ZH 3S35H 3O2DL 4PRBB 1K8IB 5E95B 1SBSH 4Z7WF 2Y5TB 3NIDF 3D9AL 4M1DH 4RISL 5EZLA 4U6TA 3SKJL 1ZS8A 3WFCL 4L4VE 2F8VA 2Z0BA 3G5YA 3BI9X 5JQ6L 3NCCB 2AXFB 3BN9C 3LOWA 4NOBA 1FDLH 1Z5LB 5I8OL 4B7IA 1X5FA 4Y8DC 5CS7A 3OKEA 2P8PB 5FUCE 1SM3H 5CEZH 4F57L 4K3GA 5ERWB 2AEPL 4ZUWB 1YYLL 1GL4B 2D0FA 1RJZB 3AREC 5DA4A 3GMNB 1EMTL 5EZIH 3ARYA 2IPUG 1G7JA 2APXA 2XZAH 1ZOXA 1JZ5A 1H0DA 1ODAA 1V3JA 1NANH 5C0EB 1UEYA 2P5ED 4PYHA 1XCQB 3MLSH 1ZANH 4JDZB 3UPRA 1BVKB 4JN1H 1ZEAH 2R23B 4UTAH 4NQVB 3C09C 5DSCB 4OF8A 4PJEE 5I76A 2Z31D 1S78D 4G42A 2HP4A 4OUOA 4LLWA 5HYJD 4CDHA 2QHRH 2F58L 1HHGA 4OZFB 4JFPB 4DKEL 1LO0H 3R0NA 4WHYG 5HHOB 5KZCB 4XPFH 5FHBH 2QHLA 4RA3A 3RHWK 1MCIA 3DHMA 4JFFA 3U4EB 5D8JL 3VFMA 4GQ9H 3ZZ1A 5HVFB 2W9EH 5C09E 2NZ9D 1Q9WB 4G8EA 1N26A 1EBPA 2A83A 1PQZB 4NM4H 2W07A 1IGIH 2GJ6E 4HCRH 2VZSA 1TJHH 2V7HA 3C2AH 3P9MB 4N0RA 5MP6H 4U1IA 2Q8AL 4TUKH 4DQOL 5IBLC 4WU5B 2X10A 4L3EA 1RZGB 4L4VB 5E4EC 2ARJA 3RDTD 3G5XB 4L8BB 1IT9H 2FECL 3ESVF 1IGTA 3CZFB 1JGEB 1NDGB 5HHVH 3VDBA 1JYXA 1AGBB 4IS6A 3KPLA 2VDOL 3BGFB 3PV7A 1H8NA 5ISZE 4XBGB 2A77H 4ZAKA 5KSAC 1T1YA 4NC2B 2MSPA 2P8LA 4WWKD 5DRZB 3CLFL 2CUMA 1S5HA 3ELAT 1FYTD 2AERT 1CGXA 3QUYA 5FV2A 4PRPA 1RK0B 4XNMA 32C2A 5TE7L 4C83B 4JO2L 4XPBL 1EPFA 1JPSH 2PW1A 4F7MB 2CDEA 2VAAA 5JIIA 2EDFA 4DK3A 4NQDB 3OAZH 4HUUB 3U1SH 4AL8H 2X4SB 1A1NA 1MLCB 3Q2CA 3LN4A 3VGBA 4Q9BA 2QR0A 5D93B 5GISL 4AEIL 5D1QD 4PJEB 3LQZA 4UQ3A 5E7FA 3NIGE 2HMIC 4NZJA 5J4MA 1QRND 4IRSC 3FL7A 3UDWA 2A6KA 4OF6A 3VCLA 3G04B 2AK4D 4UUJA 4LDOB 5IB4A 5DD0H 5CUSL 3P3YA 1QEWB 4KKAC 4ZD3H 2R29H 4J8RA 4FMFA 1K6QH 3TYFA 3VRJB 5BS0E 3UBXA 1IC1A 4LFHD 1FAIH 3I85A 4GKNA 3F7PC 4TNWF 3L7EB 1MFBL 1KGCE 1R5VB 5C09B 3LKPB 3MOBH 3QULB 5D1ZD 4NGHH 4K3EH 2GJ6B 1VFBB 2W0LA 3TBTB 1CG9A 3LKRB 1QQDA 1IGJA 3WL9B 5C3TA 4LSTL 1QFUL 2G9HA 5AAWA 5IBTL 4ZSOE 1KN4H 1XZ0B 5I1KH 1RIVL 1N3NA 3MV11 4WHTB 1WFUA 1A21A 1UQSB 1NCWH 2WW8A 7CGTA 2BNQA 5JR1L 1X44A 3HI1A 4EBQH 1HXMA 2FATL 3HZVA 4LRIA 1CFVH 1ONQB 2E6QA 4FQXD 4D9RE 5T3XE 2DQFA 4NC1E 1GPOH 5ISZB 2G5BB 3T0WA 2FYYA 4QXTB 3QDGE 3ULSB 2X9YA 5DD3L 1IAIL 1HIML 5FOBA 1NAML 4XNYH 4MJ5B 4P49A 2DQIL 2XKSA 3B9VA 4BELD 1MRDH 4K94L 4PJ7A 3QUXC 3RWHB 3LRGA 5IBUB 4CMMB 3SJVE 3MACL 4JREC 4X5XB 3A6CL 3VFOB 1BWMA 1HILA 2BX5A 4Z7QF 2ESVD 3SKNB 4WEBH 1CLZL 5FYJE 1I8IB 2LVCA 1KCKA 4EUPB 4BK4A 5DMKA 3RWCB 4HIHB 1UKSA 1I1AD 5LKNA 5KVMC 1DUZB 2VXSL 4RRPA 1T1WB 2A1WH 2R4RH 5DJZA 1BREA 4L5FH 4LLMA 3UJTH 3LIZL 2P45B 4GW1B 4GW4B 5I1CH 4D0DA 4DGVL 1U91A 1MJ7L 2XKUA 2VDLH 5E5MA 3EHBC 3DRTA 2E7HA 2XWBA 3B2UD 2X70A 1GYAA 5JIPA 2PR4L 1FVEA 2APBA 2EIZA 3BX7C 4KK9C 1FVCB 3MO1B 4YE4L 1F4YL 5KSVB 5FYLE 3PIQB 4Q6IB 4NKIL 1OAKH 5E9DE 2AXFA 4XMPH 3TGXA 1Z5LA 1HINL 4ODVL 1A6ZA 2P8PA 4OD2B 4CL7A 1KTLB 1INDH 2VLLA 4ETYA 2XKNB 3GRWA 3DGCR 4ZUWA 3V0WH 3EJYD 2EXWC 1RJZA 1N8ZB 2AQ1A 1MEXL 4NKQB 3NCBB 1P5VA 1FZJB 3DO3A 4MA7L 3C5ZA 3I2CH 2IFGA 5DFVD 1TTUA 3LS5L 4RFEA 1CD1B 5KVFL 3DECA 3KPMA 4CNIA 5C0CD 3QDGB 5CSBA 3KR3H 1R3HA 5JPNB 3BD5A 4P46B 1BVKA 2BP3A 2R23A 4IOFC 4H88L 2BFVL 3CJJA 5D96C 5DSCA 1IGCL 3V4PH 4ZO6A 4KRPC 1QFWH 3SJVB 1NCDL 1AXTL 2EDXA 3GIZL 3O2DH 2CK2A 5CGYC 1EVTC 2R2EB 4LHUG 2EIBA 4JFYB 4OF5A 3GSOA 3D9AH 5HHOA 2NLJB 3E6HB 4WCYH 1NUFA 3GRWL 3RHWF 4R0LA 4RISH 3QQ9C 2Q20A 3U4EA 4ZMAT 3LDBB 3VFUB 3F62A 3WFCH 4WRLA 5JQ6H 3E0GA 3VGEA 2NY4B 1CR9L 4AENB 5BVPH 2AQ2A 2UUDH 3GSUA 1PQZA 4KK5C 3C2SA 5FM5O 1WBZB 4F57H 5D7LE 1ITBB 5HI4D 1JF6A 1YYLH 5DA0B 1DE4B 4U1KB 4WFED 1EMTH 2GY7B 4ZO9A 3O11B 4WU5A 5SWZD 5E99L 4L4VA 3G5XA 5E9DB 4CN4A 7FABL 5KS9B 3DGGB 4M3KB 3VDCA 1NDGA 2YN3A 2XQYK 1AGBA 3CX5K 3IRPX 4OQTH 1U2HA 3HE7D 4Y16C 2XTJE 3JSSA 2IQAB 3D25B 4LF3B 1LEKB 4MXVE 1VGKB 3FFCB 4WJ5B 1G7MA 1E0OB 5T1KD 4DKEH 5C07D 4F33B 4KDTC 1XR9A 3MROB 5I1IL 4HWNA 3S34L 2XPGB 4HUUA 2NX5D 1QNZH 4PP1C 4Z7NE 4X6CE 4APQC 1MLCA 5CZXD 4I5BB 5D8JH 3U83A 2EC9T 3MREB 1K4CA 3OKNB 3WUZA 3CFEB 4PJEA 5ICXB 3U6RB 3F7RA 3HI6L 5FECB 3H3KA 1KPVB 3DETC 3EBAA 5IR1A 3G04A 3IDNB 3MOQA 3V6OE 4Y5YC 4XCYB 1F3RB 3WS3A 2OX5A 4X6EA 5MHSD 1QEWA 5BMFL 3J8F7 5EBMB 1IBGL 4DQOH 4LNRB 3ZYIA 5TE4L 5T1LB 2H8PB 3DTXB 3MGOB 4PGDB 3BW9A 1RJCA 4XGZA 3TH3T 3VFPB 2DMBA 1OVZA 4QXWA 3P0YH 1NC2D 3L7EA 4LDLB 4M8QB 1R5VA 4U4BA 5C09A 3IU4H 3QULA 5CEXA 1AE6L 3UPAA 2Q76B 4PJGF 4QOKD 2VDOH 2GJ6A 3O8XB 4KK6C 3TBTA 2EDNA 4X5LA 3LKRA 5D7LB 3WL9A 3TBYB 3CLFH 1RMFH 4K8RD 4Y5XA 1XZ0A 1P6AB 1MY7A 3QEUA 4WHTA 4JO2H 2ZUTA 4XX1E 1UQSA 1ZLVK 3HUJF 4JFHE 2A6JB 1WWBX 4Z95H 3GEWB 3LPFA 3BIAX 1P84J 3T0EA 3B2VH 3O6FD 3HHRB 5HVGB 5HI5C 4AEIH 2XTJB 4AEHL 1R3KA 3S7GA 2DJSA 4YWGH 3RVUD 2O5ZL 1J1XH 4O2CB 4NCC2 1B88A 4PLKD 4OV6F 4HF5L 3ZDYE 4KTDH 1WIPA 2H41A 4X5XA 3VFOA 3V7AE 5E94B 3SKNA 3QI9D 4PJDE 4M5YH 5DJ2B 4ZO8A 2R69L 3KLAB 1MFBH 1T1WA 2M8XA 3QG7H 2BVOA 4L8CA 1YEEL 5ILTL 1NLDH 3GB7A 3UTQB 1BLNA 3OXSA 4WI8A 2NY0D 4LSTH 1QFUH 5BZDB 3IKCA 5IBTH 2D7NA 3FQNB 2KBGA 1CFSA 3ZKSD 1D5MB 1KYOJ 1DZBA 1RIVH 4AM0B 5BS0A 4WV1B 2P42B 4XNZB 5EWIH 4MB5A 5FO7B 2ICEA 2FATH 2J8UF 1D6EB 3BD3A 3MO1A 1GRWA 3W11C 4A6YL 5ANMA 4EJ1C 5T1DL 3PIQA 2YOCA 4M93C 2FO4B 3KPSE 3QPXH 4KJPD 4QRSA 3E6FB 4D2NA 1YEIL 3GUTA 5J6HB 1HIMH 4ZSOA 2HVJB 4HX1B 1NAMH 4OD2A 5JDSA 5KW9L 4OB5L 1G9ML 2DQIH 4ZAKC 1QFOA 3P4NA 4I48B 5I75B 4K94H 3EZJB 3ULUD 1XT5A 4CRPA 3A6CH 4WUUD 3QUYC 1CLZH 3QYCA 1CD1A 3FQXA 3T3PF 3I84A 2NW3B 3QDGA 1UZ8A 3LPGA 1UJ3A 3BZEB 1SYVA 1FIGL 3GSVA 43C9B 2A74B 2E3VA 4P46A 2RCSL 4WW1B 4RAVB 5DS8B 3LIZH 2EIEA 4DGVH 1XIWC 4KWUA 4X8JA 4M6OH 1AR1C 2QKIB 2V7NB 2R2EA 4WO4A 3D3VA 5DHYA 1FL3B 2XIDA 3TO4A 2NLJA 3E6HA 4AIXA 2PR4H 3ZSTA 1YMME 3RL2B 1QLFA 4JRYD 4Z76B 2BK8A 2XQYG 2J5LC 2D7TL 1F4YH 4HWBL 4BFEA 4NKIH 5F97E 4G6AC 4RX4A 3UTSD 6CGTA 1HINH 4ODVH 4QHMB 3BJ91 5DTFB 4K94C 1CBVL 1ITCA 1C12B 3KPRE 2UYLA 1EVUA 2DQUL 3PDOA 3RWFB 1MEXH 3BPNB 1OP5H 4U1KA 3BT2L 4RAUB 2DM4A 4PBWD 1U3YA 3O11A 4MA7H 4QRRE 3LS5H 3O4OC 2H9GB 5KVFH 3KPSB 5E9DA 2AI0L 2DYPB 3HMXL 3MJ7A 2DWDB 3X3FL 1IZKA 4OM0H 4L4TD 4V1DD 5H37H 1WZKA 2AABL 3KLSA 3VH8G 2ITDB 3QB7C 4E41D 2FH6A 3BSZL 2CIKB 2BFVH 3DROB 5GRVL 4RFOL 3ARGC 1IGCH 3QQ3A 1XCTA 4JM2F 2JJVA 5EUOA 3C60B 2KUTA 4ELME 1NCDH 1AXTH 4LLDB 3GIZH 4NT6B 4WJ5A 1RZ7L 5I2IB 2AKRB 1N5YL 5FDWB 2EDLA 4PBVC 5GGSB 1YY8A 4MGXA 1BZ9B 4OSUL 3GRWH 2P5WD 1NCCL 3MROA 5FGCE 2APVA 2EYRB 2XPGA 1AI1H 1OHQA 4HKZA 2YSSB 3MLXL 1JPFB 4I5BA 5FUOH 4GRLD 3ZKNC 1JWUB 5FYLL 5A3ID 1AJ7H 3OKNA 2UZXB 4ONHA 3CFEA 2FWOA 3FRPG 1MIML 1TQBC 1HSAB 4LCCB 3IDNA 5HVWA 1KJ2L 3UCRA 3LKQA 4HJ0D 4LSVL 1NDMB 2WBWB 4BH7A 4HJJH 1YQVL 3LRHA 5DI8B 1YMMB 5EBMA 3N50A 4LNRA 3K74B 3EIFA 3MGOA 4QKXB 4XNUL 1AD9B 2Y06H 1V7NL 5IVOA 3VFPA 3QCUL 1GOGA 1FNAA 2WQRA 3CVHA 2BRRL 5TDOB 7FABH 3H3BC 5I66A 4M8QA 1UVQB 4HS6B 3T65B 1EBAA 4ENED 4J23A 2Q76A 1GGCL 4O9HH 1I9RH 1QYGL 2V17L 5D7LA 3KPRB 3JV0A 3T1FB 1NGYA 3W82A 2VSCA 4QT5B 3H9YA 1KIQB 1T2JA 3PGFL 4QRQB 1FL5B 3VXRD 3I3DA 1AGDB 4Y4FB 4QRRB 2XA8L 4IM8A 1KEML 3VGAB 2A6JA 4J1UB 5I1IH 2IH1B 3S34H 2GK0A 4GAYA 3C5ZC 4KHTH 4NO2B 1HCFX 2NXZC 4YHYC 2UY6A 2YA0A 5FYKE 3FO9A 3FQTB 1LK2B 2EE2A 3O6ML 4IJ3C 1T4KB 3S4SB 4ZS7L 1OAUL 3ARPA 3CVHL 4HUXA 1RURL 1JWSB 4ELMB 3EAKA 5DJ8A 2HFEB 4J3OC 1T0NB 3BRGC 3NZHL 1RIHL 1G1YA 1CDGA 2ZG1A 2OK0H 3SKUD 4ONOA 3ARDB 3STBA 3ZMRA 5BMFH 4JY6A 5FGCB 5TE4H 3HAEB 3KDMA 4RIRA 4X6CA 5E94A 1NMCB 3U7AA 3MLWL 3RVVC 4XWOD 1MVUB 5DJ2A 2XV6B 3IXAB 3MC0A 2JE8A 4R0LC 1Q72L 2ADIA 5L2KD 1RUQL 2ZSWB 2BDNH 3KLAA 2CK0L 1ZSDA 2F15A 4NYLB 1ZGLB 1YDPB 4HIEB 2H2PD 5E70A 3W5MA 3RWDA 3VA2C 3ARFD 4CADB 4PJ7F 4B5EA 1O7SA 4G43B 5BZDA 4TRPL 4MNHB 1LO4H 1D5MA 5L9DL 3BH9B 4AM0A 4AEEA 1SQ2N 4DN3L 4WV1A 1QSZA 3N06B 4OKVB 4PJHE 1EJ6A 3BGMB 3PWJB 3L5IA 3LEYL 12E8H 2KKQA 4FNLL 3NTCH 3PHSA 4JZOA 3UTPD 3LD8C 3VXUE 2D0HA 5HHXL 4AEHH 1A5FL 4J6RL 1ROWA 1F4WL 1U95B 2EDWA 4QY8B 3R4DA 2J8OA 1JV5B 3TFKD 1F11A 4EZMA 4X83A 3EJZD 5B38G 3AU1A 4I18A 1P1ZB 4I1NB 4WI5A 3IJHB 3BP5B 4M1CD 3S37L 4W70A 4ZUUB 2NW3A 3LS4L 1OAXL 1LGVA 1EZVY 1O5DT 2R69H 2YWZA 4QHLA 4OI9A 4MA1C 1FORH 2ZG2A 43C9A 5ICZB 1YC7A 5DQ9B 1YEEH 1FVDA 2VDNL 5ILTH 4WW1A 1L0XA 3MV8E 1MOEA 3V95A 2CRIA 5DMGD 3QNXA 4WTWA 1EHAA 5J6GB 5F1KC 1D9KA 2HWZL 2QKIA 3AM8A 3TBVB 1FL3A 3MA9L 3ESUF 4PJDA 5DK0B 5CZVH 4Z78B 3C8DA 5J8OA 4Z76A 4Z7VE 2IQ9L 3DX7B 4A6YH 4WI3A 3NGBB 5IESL 3LB6C 3ZYJA 3WNLA 3RVWD 5C0GB 1S7UB 1CT8B 1DN0B 5DVKA 3FB6B 1SMAA 1U0QA 4X7FC 1YEIH 5J3HD 3PWPD 2V2WB 4AH2B 1G9MH 1S9WB 2XICA 4G7YL 3RWFA 3S3PA 1A1MB 4PJHB 4RAUA 1S9XB 1S8DB 3P4LA 4Y5XC 5IFHH 5GSVA 4P2CG 3KPSA 2YPLE 3RVTD 4N0CD 4XVJH 3GFUA 2A9ML 4O02L 1DDHB 3N85L 2J3SA 4UBDC 3VXUB 1PW3A 5I30L 1JYNA 2DWDA 1G7IB 2OQJA 2FGZA 3IVKA 5EIIB 2AV1B 4PLOB 1FFOB 2ITDA 1UADC 3T0EC 3N1MC 2DWEB 3AS2A 4P5TB 1BX2B 4M4RA 2RCSH 1FQ9C 2A2QT 4PG2A 2HH0L 3A6BL 2R56H 4WY7H 5DMIH 1LO5A 1WFTA 5DUPL 5I2IA 4MLSA 2YPKB 4YHOL 3TZVA 5FDWA 4OLWL 1RJYB 3KS0J 1ERNA 2EYRA 3CX5J 2UVEA 1JTPA 3DUUB 3WFHB 1ZHNB 1Q1JL 3KVQA 4HWBH 5DZOA 5DEGB 1A7OH 1JPFA 2MCPH 3REVB 1UA6L 1JWUA 2IANE 3RX7A 3D48R 2E9BA 3MV8B 1IGFL 5EOTA 1IQWL 3TN0B 3WIFB 1LE5B 4M6AA 1G9MC 3DWTA 3FB5A 4EI5B 4DUWA 3EW3B 2HJKA 1CS6A 1HSAA 2X1QA 3A6OA 1CBVH 2JB6A 1A7QL 1NDMA 3WXVH 2DQUH 3M8OH 3QPQD 3T4YB 5DI8A 4TUJA 3BT2H 4B50A 1J0KA 1B2WL 3SGEH 3T08A 2IPKB 2M26A 1AD9A 1OP3H 1YECL 3F58L 5DJ0B 5DZNA 5DF0A 1MLBB 1CXHA 5GGQL 4PJEF 1I3GH 2AI0H 3JV4B 5TDOA 3B5GA 3HMXH 1UVQA 4HS6A 5M94B 4LSRH 2AABH 5GGSY 3IT8D 4NN6C 4C4KT 3BSZH 3KYNB 3X11A 3T1FA 3VG0H 4QT5A 1OT1A 2OJEA 1KIQA 5CIPB 2VDKL 4QRQA 3HS0B 3O9WB 2AJYH 1AGDA 1EUUA 5LGKA 1JPGA 4S1DD 4PUBL 4HK3J 2YPLB 3GHEL 5LAXB 4J1UA 1TNNA 4WFHD 4JM2D 2IAMC 4K3HA 5ABDE 1PYWA 4OD3L 4NP4H 1J8HA 3MLXH 4X4XB 3RAJL 1GIGL 4L3ED 4KC3B 4PP2B 1MHEB 3FQTA 5CINL 1LK2A 4WHYH 1T4KA 1MIMH 3MRCB 4DFHA 4LOUD 1FV1B 1JWSA 4MQSB 1N2RA 1KIRB 1KJ2H 3EYQC 2DIBA 4R26H 4LSVH 1GZQB 1V3LA 1YQVH 5H35A 4DVBB 2G75B 3JTSB 2LTQC 2OBGA 4Y4HB 4KH2A 3SE3A 1OAYL 4PRPD 5E8EB 1U8NB 1V7NH 3O3AB 2VITB 3IXAA 2EC9U 1UZ6F 2IANB 3LKOA 1CYGA 3QCUH 4G5ZH 4JPIA 3SO3C 2BRRH 2ZSWA 1AQKH 4PRIA 4NYLA 1ZGLA 2EDJA 2I27N 1K85A 1Q9LB 3HG1D 4Z7OE 4OD1L 3FHQA 5D2LE 4PV8B 3GGWB 5D7SH 4G43A 3OX8B 2ZG3A 3L7FB 3PGFH 3JUZA 2YUVA 5KG9B 3BYYA 2XA8H 1HOCB 3RGVD 1S7VB 5JOFB 3VXOA 1KEMH 3B83A 3BGMA 3PWJA 5IG7B 5ICYB 3SBWA 1J7VR 3NIGF 4IIQB 3HZMB 2F53D 3RTQD 4M43L 2GUOB 4HMDA 4EQ3A 4KI1A 3QCVL 2QQNL 2Q86A 2R2BA 3O3UN 1BJ1J 2HFGH 4CN1A 1YPZE 4R96B 3VE0B 1U95A 4U0RB 1Q0YL 4QY8A 1IGYB 1RURH 2Q87A 4Y88A 1MFAL 2D03H 4K2UL 2J2ZA 3GI9L 4MNQE 1TPXB 3EDJA 3NH7H 5GZND 1P1ZA 3M17A 1VESA 4NRZA 3X14B 3BP5A 4NKDB 4YDIL 4AEFA 2WIIB 3L3HB 5F9OL 4ZUUA 2BNQD 5FUZL 1JGDB 2CK0H 2YRLA 3IETA 1CDIA 2IH3B 4N90E 5E7BA 5GXBB 4XXCA 3SDAA 5F1NB 4IMKC 1BP3B 3G6DH 4JANB 1CLOL 4OLUL 2IFFL 4POZC 2GFBB 3HB3C 4TRPH 4OLXH 4KZDL 1U3JA 1H8OA 3TBVA 3HFML 3WN5B 1QR1A 3LQMA 4UZGA 2A6IB 4DN3H 1TENA 5FHAL 5AZEH 3Q6FB 4FQ2L 3LEYH 3ZYZA 1MRFL 1TVBB 2CR3A 2Q3AA 5I8EB 1FCCA 5TDPB 4NKOB 2CGRL 3P11H 3LV3A 5E4IA 5D2LB 1S7UA 1EA9C 5HHXH 4BYHA 9CGTA 1A5FH 2O5XL 1EDQA 2EDOA 1WAAA 5F7NC 4WFFD 3RWEB 1F4WH 2XZZA 4J3XA 2V2WA 1U58B 2NCMA 2AV7B 1S9WA 3DMMD 1BEYH 1LD9B 4KGJA 4PJHA 2FHFA 5D6DA 3DI2B 4YFDB 2XQBL 2FBOJ 1C1EL 4DCQB 2VLRA 1YY9C 4XPHH 3S37H 3WFDL 1CTNA 3ZKQD 4NO3B 3VXUA 4NQSA 1G7IA 5F6HI 4TNVF 1YPZB 2AV1A 1CD8A 4P23C 4L29B 3HNSL 2DWEA 4P5TA 3SDYH 2WNGA 2GTZB 5F7FA 1VFAA 4TSCH 5EC1A 1P7KB 3VA6A 4MNQB 4X6FA 3X17A 5T3ZE 4OFIA 1CFQB 1EHXA 5D9SA 2K7QA 2DQHH 2AK1L 4M6ML 5E5UB 3MA9H 1PG7H 1QVOA 3R1GL 5KAQG 3WFHA 3GI8H 3DUUA 3RZCB 2IQ9H 4NQCA 4TVSa 1M05B 1YNKL 5IESH 2R39A 3U36B 3MV8A 1ORSB 2P43B 4QEGA 3TN0A 3BPOB 1LE5A 1BF8A 1NEZB 1P2CA 3VH8A 2BNRE 5E2UL 2V5YA 3SDDA 3HCVA 3U7WH 5CILH 3P4MB 1IQDB 5ID1A 3GO1L 4POUB 2CR6A 3KJ4B 1AY1L 2DN7A 2IC2A 4G7YH 3T4YA 4Z7VA 1UC6A 2IPKA 2NY3B 3SDCB 2ZUVA 5CD5D 2OTUB 4HKXB 5DJ0A 5HHOD 1UH3A 2J12B 3QXWA 4RNRB 5KZCD 5IQ9B 2A9MH 4O02H 3JV4A 3A67H 3N85H 4JDVB 4YBLC 4R3SB 1FNGA 3BKYL 4TULH 1IGML 4L8SA 3QJFB 1KLUB 4HKJA 4UV4H 3KYNA 1RAMA 5KBNC 5A2LH 1JHKL 3FRPA 4UB0L 2HH0H 3A6BH 5E6IA 2Z4QB 5CIPA 3MODL 3HS0A 3PGDA 2OP4H 4UU9B 3O9WA 4LIQH 5GS2D 5DUPH 4YHOH 4JFOB 1G1CA 4NKMA 2YPLA 4P5KB 4P2QA 3LHPL 4G7VL 3STLA 3PE9A 1U8OB 4I18C 4Q2ZA 1Q1JH 4GAFB 4OTXL 1UA6H 4L4VD 4Z9KB 1AR2A 4PP2A 4ZYKA 2AJSL 4ZUVA 1KCVL 1IGFH 1IQWH 1LDPL 5L6YL 4FABL 2MWCA 3SKOB 4ZNEA 3VJ6A 3MRCA 1QBML 3HR5B 3QUMB 1IFHL 4JLRB 4XXDB 5ACMA 1N64H 3P0VL 2ZUWA 1A7QH 3NOIA 3G5ZA 4IOSD 4NN5C 3RUGE 1S9KC 1LWRA 4DVBA 3JTSA 1DQDL 1JPTL 3BUYA 1R6VA 2VZVA 3IU3B 1D9KC 3KHOA 4MAYA 4GMSL 3KYOA 4D9LL 1B2WH 5E8EA 1U8NA 2YD2A 1YECH 3G08A 3O3AA 2VITA 3F58H 1BOGB 3MR9B 4ZTPL 2IANA 4KPHH 3NA9L 5CP3H 3VDAA 3L3OA 5C9JB 4BSJA 2DIJA 2BNRB 2KQNA 5SWSE 5MEOB 1V05A 1CFBA 3MCG1 4BZ2H 2HT2D 5B8CA 4PV8A 3SO5A 3DV4B 1I8KA 1TQCC 5TGBB 3OX8A 5I9QB 4Z7NF 1MPAL 4X6CF 2VDKH 5CEYB 1OT2A 3FO2B 3W9EB 4BM7A 1HOCA 4N68A 1FE8L 1E4WL 1X9QA 1U3HC 3S8WA 3GHEH 5ICYA 1NFIB 1RHHA 3HLAA 4HJGB 1U92B 4OD3H 5HD8D 2E7LA 4FOMA 4CU8A 3EFDL 1GIGH 1BVLA 5SV4A 3IXTA 2YPVH 2X05A 1I9JL 5GS1B 1ETZB 5C09D 3CFIC 3P40A 3VE0A 1IGYA 3ULVE 5E6ZA 1FLRL 4LKXA 3ZTNH 1T83A 2GJ6D 1NMAH 4NN7C 3QIWA 2R1XA 3P9LA 4D8PA 3BWUC 3X14A 2DQEL 1WFNA 3ZT7A 3TZVC 1KF9B 4NKDA 2NW2A 2DS4A 4ZOBA 4J4PD 4ZOEA 2EDQA 1M7DB 5C08E 1I8LA 1I7TB 5D7JA 4UNVA 1E28B 5AG9A 3IFPB 5F1NA 5ISZD 1NCBL 2Y5EA 4OGAC 4YK4B 1G0XA 4RDQF 3RUGB 2FEDD 5EBWB 2GFBA 5C0DB 4PJFB 2VDRL 3U4BL 3WXWH 2DLTA 2Y36L 3VD7A 4N0YH 3F8UB 4U05A 4U1SB 4WW2B 1WEJH 5D1XB 4NQTA 3L3DB 5FO8A 1OM3L 3FKUS 4JZJB 5TPWL 3QSKB 3QWOA 5GPRA 1TVBA 3V8OA 3ILPB 3ARBA 1NCTA 1OQXA 2ZOLB 4JE4B 5SWSB 4FFWD 2WINB 1DVFB 1PBYA 2VDML 3MGAA 3N9GL 5D2LA 4NJ9L 4RWHA 3QCVH 3ZDYF 1REIA 1MAJA 2Q1EA 5TQ2H 3RWEA 4QXGL 1Q0YH 2OMBA 25C8H 4PJDF 2AV7A 5CJOL 1MFAH 1KIUA 4K71C 1IAIM 2NY6C 4K2UH 5C2BL 8FABB 3GI9H 3S96B 4JR9L 3T0XA 3LRSB 1MAMH 4LLVB 4GBXB 1MQKH 3GMQB 4DCQA 5BS0D 3BVNB 3QXDB 2VXVH 4YDIH 4ZFOB 4OIBA 4X4ME 3I6GB 1WWAX 3CAFA 4HQQL 1KGCD 4HIIB 2F8XC 1YPZA 3ARZA 4O4YL 2CJUH 3T77A 1ZKAA 1IEHA 5DT1L 1B6DA 3LY6A 5KOMC 1M6OA 4Z6AT 5C7XH 2VLJE 3ME0A 4X99A 1P7KA 3NFSL 4OLUH 2A6DB 4MNQA 5A16B 2ZUXA 1CFQA 2BCKA 3EYVB 2YXMA 3TH2T 1X4YA 1DQJB 1UM4L 3REWA 5EU7C 4P2YA 5FHAH 2ZNXA 1AXSA 5C08B 1AIFB 3RZCA 4F37K 4CU7A 3SE3C 1MRFH 1FGVL 4U2YA 4KGLA 1BJ8A 4D9RD 5T3XD 3IKKA 3RVXC 2CGRH 3U36A 3Q3GB 1W8OA 1FL6B 1AGCA 3QDGD 4LKCB 3G6JB 1NEZA 3I02A 4YHIA 1A4JB 4KJQC 4ZXBA 4P46D 3P4MA 3KYKL 1T0MB 3WUWG 1K4DA 3F7YA 1N6QL 3W2DH 3PF2A 3QUZB 3ARRA 3MLPA 3SJVD 4N8VB 5LQBL 3MRKB 3QIBA 4WO4D 4GKSB 3SDCA 1AFVH 4HH8A 5C8JB 5FYJD 4X7SL 3TO4D 4GOSA 4HKXA 1JHTA 4RNRA 3WFDH 4X98A 2X9XA 3VXSA 3THMH 4R3SA 3OGOE 4IRJB 4MXQD 1A6VH 2ZKHL 3JV5A 1NAKL 1JHLL 3HNSH 3QJFA 1KLUA 3ZYOA 3QR2A 3RIAK 1M7XA 4PB9L 2NY4D 1F13A 3RA7L 4RX4D 5ADPL 2CSPA 2WWKO 2Z4QA 2HKFL 4XHJD 2AK1H 4M6MH 3O3EA 5HHPB 3S4SG 5BVJA 2DD8L 4LGRB 3PWNB 3FMGH 3R1GH 1HNFA 1KFAL 5EZOL 5FYLD 1JJUA 4WVRA 1YNKH 1BQHB 2MKLC 4EQ2A 4EXKA 5E9DD 2DTMH 2VLJB 4OF3A 5E1HB 2GTWA 1M1SA 1MNUL 1HH9A 3QUMA 4LAQL 5E2UH 4XXDA 4HS3B 4XXCC 3KJ6H 5AAMA 3HE6B 2LFGA 3OPZL 3GO1H 3D6GA 5KSUB 3D18B 2IBGA 3OR7B 1AY1H 1P9MA 1T03L 2R15A 2YEZB 3HZKB 4X80H 3C6LB 2I26N 2GY5A 2CMRH 2EO1A 4JN2B 3BDXA 4MNGE 4JHWL 3RNQA 2H6PA 4DZ8A 2DM2A 3FAWA 2QTEA 5CSZB 3OAYK 1FZOA 3BKYH 3IJYB 5CJBA 5EU6B 4EOWL 4ZFZA 2BNRA 3VI4E 5LWYL 1UB5B 5GZOD 4HS8L 5JORB 5CD3B 2BVUA 1JF5A 1JHKH 1PG7W 5F7DB 3UYOD 2YZ8A 4CJ0A 3HNVH 2MCG1 4FFVD 4Z0BL 5T3ZL 3FO2A 3V52L 3W9EA 4K23L 5HYQA 2XN9E 1DBML 4BSWB 1NBZA 5EORL 3DVGA 4HJGA 1U92A 1BM3L 5T1LD 1R3IL 5A2IH 2C3HA 5F7MC 5J12C 3SE4C 4FTVE 4NO5A 3FT2B 5L6YH 2QQLL 1QBMH 2APTA 1S7TA 4PJ5A 4PLJD 2C4FT 1IM9B 3O8XD 3P0VH 4GS7C 3FO1A 3EGSB 5D7LD 4E5XB 1DLHB 3SQBA 1JPTH 4M7ZC 2L7UA 2Q7YB 3MBEC 1QSEE 1IVLA 2OI9C 2AQ3A 4ZTPH 3V6ZB 3NA9H 3O6LH 4G8IA 1M7DA 4CKVX 1I7TA 1ZVSA 3EO1B 2C3WA 5DZLA 4Z8FL 1KTDA 3IFPA 1ZT1B 4LP5A 4M9PA 3PHOB 2XTJD 3RUGA 2C7UA 3QFJE 1FZMB 4LBEB 4U6HA 2QEJA 3H7BB 3UTTA 3AS0A 3B6SB 3F7QA 4MNGB 1J8KA 1FE8H 2WV3A 3HC4H 3BZ4A 3V79C 3O3DB 1Z2KA 4JZJA 3VFRB 2HN7A 5IGXL 2YD9A 5FIEA 3ILPA 1C16B 2ZOLA 2WINA 2VO5A 2OCFD 3IDMA 4XP6L 1I9JH 1SJEB 3EO9H 4WFGE 4L8SC 4HGKC 1WQVT 4JQIL 1OGAE 5JIKA 1RI8A 3WIHL 3M1BA 3CC5A 8FABA 1NH6A 4U1JA 3T3ME 5E6IC 2XN9B 4LNVA 3S96A 4LLVA 4GBXA 1E4XL 3GMQA 2YD5A 1SEBA 1BJ1H 4U6YA 2PO6A 2PTTA 3BVNA 3QXDA 3RKDD 1MI5E 3I6GA 2AXGB 4FTVB 1ZVYA 3BE1L 1WAAF 4J12A 3SDXE 3CFJB 2FO1A 3MRHA 5GRWA 4YDJB 3QAZC 3AY4C 1FYTB 1NCBH 3PP3K 1J0YA 1MCOL 2VABB 2F9BT 4PJHF 2A6DA 2CKBB 4YNYB 3V5DB 5J56B 4Z5RA 3EYVA 3TIDA 1DQJA 1RUPL 1PZ5B 2NY1B 3U4BH 2Y36H 2GW5A 4U1GB 4JFHD 1G7LB 1PY4A 3LKSB 5I15L 1AQDA 4C56A 1FNSH 4F37F 1AIFA 5CP7B 5TPWH 3ALWA 5F3HA 4M00A 4AT6B 1S7RA 3Q3GA 3MRIB 2VDMH 1I7UB 3AB0B 3K8KA 4NJ9H 4W6WB 1H3GA 3QFJB 4YHKH 2ZCLH 2LABA 1S7SB 5C0NC 3U46B 4QXGH 2XWTB 2CXGA 4IRZL 1T0MA 5B8CC 1ZXQA 4YHPB 2DLIA 3ULVL 3BQUC 5C2BH 3JZ7A 1ZHKB 3QUZA 5HI3D 1WIUA 4JR9H 4N8VA 4P2OC 5DDHA 1IC7L 4GKSA 4ZFFB 1JZ8A 3HNTH 2DI8A 4RMSA 2BVYA 4LU5L 3QXAB 4OFYD 1IM3A 3BXNB 3DSFL 3TJEL 4Y7MA 5FA3B 4HQQH 2ICWB 4IRJA 5TH2B 2E7LC 1SVZA 2R4SL 4O4YH 5FKAB 4TVPE 1OGAB 4GW5B 5DT1H 3ET9F 4NZTH 4FFZL 4HK0A 1D3CA 1H5BB 3P73A 4JPKH 3NFSH 4OUUB 4Z7VF 1TZGL 4NNYB 1HSBA 4KVNH 4TUOA 4IHOB 2X89A 4FXKA 1EFXA 1MI5B 5DJAB 3JVGC 1FPTL 5F9WB 4P3DB 4PGEB 1L6ZA 2XT1B 1FGVH 1U42A 3VFNB 1BQHA 2VL4A 1YNLL 3KPSD 5L7XL 4H0GA 1MFDH 2DYPD 2VLJA 4C59B 5D7JC 5JXEA 1BVZA 1A7RH 2L4OA 1A9EB 4HS3A 5GS2H 3KYKH 3CFBB 5KSUA 3OR7A 2J88L 4GXVL 2ESVB 3CPLB 1N6QH 3GBLA 2RAMA 3C6LA 1FFNB 3RX8A 3OKMB 5LQBH 4S1SH 4I2XA 4X7SH 4R2GB 1EJOL 4FQLL 3RKPA 3D0VB 3C6SB 5CSZA 5BV7L 2YMXL 1TTFA 1QACA 4XAKE 1OTSC 3MRLB 5T5NF 2ZKHH 1OAQL 1GCFA 1GJIA 1NAKH 4X6DE 3LH2L 4P9HH 3RP1A 5CD3A 5JORA 4OZ4B 3RA7H 5EH1A 5C2UB 5F7DA 1MCLA 5GGRB 5FK9A 2DQGH 4RBPH 1BHGA 3SPVB 5J13B 5D6CB 2OS7A 1AP2B 3RWGB 2DD8H 4BSWA 1EEUA 4LGSB 1WFOA 1YMMD 2FD6L 2PXYC 4OLVL 5ENWA 1QBLL 1KFAH 5EZOH 1JI2A 4ERSL 1HH6B 5HGDA 3L95B 1VEPA 2OR7A 3MYJB