5EBMB

Kcsa t75g mutant in the nonconductive state
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Fab Fragment Light Chain
publication title Individual Ion Binding Sites in the K(+) Channel Play Distinct Roles in C-type Inactivation and in Recovery from Inactivation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 49
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ebmB01
3MLWH 5I73B 5J1SC 1HOCA 5HVHB 1OSPL 1QBML 1C5BH 5E6YA 1DBBH 2G5BB 5F7FA 3I85A 1JYXA 4P2RA 4Y5VA 2LU4A 4IRJC 4PJ8C 4PB0H 1VPOH 2XQBL 1Q0YH 1N4XH 2VWEC 3KYNA 4APQD 8FABB 2EEAA 4H20L 5IKCB 4Z7WE 2KZ1B 1VB9A 1XGQB 3QH3B 1YYLL 3MPCA 2FEDC 1D5IL 4NNPL 4NP4L 3CLEL 2JCCF 1DEEB 2VXVL 1F58H 2J8HA 2CR6A 5DMJB 1RJYA 5IGXL 4F7EB 2BDNH 2EDHA 2R23A 5GHWL 5E99L 2HT2D 3E1F1 1FNFA 4R4FH 1CQKA 1GXEA 5IQ7H 2SEBA 5IG7A 2ICEA 1CGTA 5D7LE 1B6UA 2HLFD 3CDYA 2AJUH 5L0QC 5EU3A 3G6AB 3HE7D 1F8TH 4M9OA 3MNVB 3LKSA 1DVFC 5CKGA 4BZ2L 2PXYB 4U0RB 5KSAB 1R3JA 1D9KC 5JUEH 2YR3A 3QYCA 1KGCE 5FFLA 5DUPH 1KJ2L 3GJEB 1ZT4A 1H3TA 5D7SH 1AHWC 1IBGL 1I9JH 2XZQL 1FIGH 3H6JA 2YMXL 1I1YB 3EKCA 3WN5C 3OKDA 4FQ1L 3RWIB 4Q9CA 3UZVB 5E2JA 4Y19E 5BQ7A 4YXHL 5C9KA 4RNRA 4GRLB 5LBSH 1JRHL 3ESUF 4JY4B 4BSVB 1U8IB 4K55A 1IFHH 3VU2A 5F3BB 5F3HB 4NKDB 1IJ9A 1NAMH 5MI0B 3EOTL 4YHIB 5D7KD 4BQ9A 2E8ZA 5EO9A 3GSXB 4N0FA 4O4YH 4Y5YB 1CDCA 4KK5D 1ZVYA 1XF1A 1JTOA 3MRJB 2A6JA 1NEUA 4LU5H 4WO4B 3BP5A 3QQ4A 4K3GA 1JP5A 3K74B 3FTGB 5HGHA 2DMBA 4XH2A 2VITA 3MRDB 2HJKA 3D2UA 4IEFB 2VZ1A 5C2BL 1OCWL 3I50L 1X7QA 4RFNC 3BO8A 1OGTA 3SE4C 1YN7B 4KJYA 4JFFD 1ZANH 5F96L 3BPLB 2XG5A 1PG7X 1BREA 5JQ6L 3PWJA 1PLGH 2BNQB 3GSNL 4JFXB 1A6ZB 5C0ND 4GQ9H 1NEZB 4N0RA 1S9VA 3HMWL 4OLXH 5GRXG 4FQXB 5D1QD 4NFCA 3WLBB 4BZ1L 3FT4A 4WUUD 5KBNC 2ARJB 4X98B 2ZUXA 4HZLA 1IGCH 3KJ6H 3STLB 3MZGB 1U8KB 1DR9A 2AERT 3F12A 4RMQA 1ZOXA 4WHDA 1C5BL 1MCWW 1DBBL 1IC7H 4HS3B 2AV7B 3DIFA 1R5IB 4BQ8A 1F6LL 2GJ6A 3LKPA 4PB0L 4L3EE 2BRQA 3MFFB 1Q0YL 1N4XL 1U8HA 3TO2B 4ODUB 1X5FA 2FYYA 1IAIH 3K8KA 4PLJD 3D39B 3ZSTA 1I7TA 3Q6GL 1TQCC 1GC1H 2Q20A 1JFQH 3FQNA 3VCLB 3WE6B 3G6JE 2WQ8A 3DRQB 1BZ9A 3ALWA 1NUGA 1V8HA 3QXDA 4X6CB 3UJTL 1MNUH 4M7KH 5SWSB 1OAYH 5DT1L 2K1MA 3UTPE 4M1DL 2FO1A 1Y18B 4LLQA 5BRZE 4B7IA 3QRGH 3IXAA 4E41A 3CC5B 5CP3H 5JO5A 2NY4D 1HXMA 3MUY1 1INDL 2Q7YB 3MRIA 1CDYA 5E9DA 2X10A 4FFWC 3V5HB 1R5VB 2DWEA 3EO0B 1FG2B 1A6UH 2B1AH 2BNRD 4FQQB 3UMTA 3QO0A 5I9QB 4U3HA 2VQUA 1F8TL 4LHUG 1T83C 3VI4E 3GNML 5T5FL 1ORQA 3O6ML 4JFYA 2PNDA 3LDBC 3KWWA 4XVJH 5E00B 2RR3A 2C9AA 2VTFA 1RUQH 2DQCH 1J0IA 3FZUC 3MXVL 1OP5K 2X1OA 3LPGA 2V2XA 3LVEA 1I9JL 1NBVL 2FLBT 1QACA 2ZKHL 4IS6A 4N9GA 1BGXH 3T1FA 4HIHA 3O6FD 3P4MA 4CGTA 3BPOC 4HIEA 3WL9B 3LQAH 4O2CA 5MEPA 4LSSH 2HT3D 4KROD 5LBSL 5C09E 3HMXH 4PYGA 1QSFE 4QRUA 3RY5A 2VLKD 3GMPB 1OLLA 4CU7A 4Z7WA 5GS0D 5C0RH 3BN9C 1MHHB 1SEBB 5AYUL 3MLPA 3OAUL 3UCRA 4QHMA 4X4ZA 3RZCD 1EO8L 4QRRA 4LOUC 2ITDA 3EFDL 1I3UA 1DANT 2NY0B 5IBLD 1MREL 2KZWA 4RWYL 1IRAY 4PJXB 4ODXB 1ES0B 3HAEH 3MROB 5EO0A 4HFWA 5E8DH 2XOTA 4HS8H 4JFOB 4NN7B 1B4JH 1WFUA 3VWJC 5CP7A 4KRNA 4UBDC 1EV2E 3FB7A 3S88L 5E5MB 4NM4L 5C08B 1MRDH 5I8EB 2DYPA 2QADD 3OGCB 3D0LB 5D7LA 2EE9A 3D3VB 2WQRA 4MX7B 4RGMB 2VRAA 2W65B 1ZGLB 1PKQE 4YHPB 1GGIH 3H0TA 3N06B 1HWHB 1L6ZA 2AXFA 2YA0A 2X4NA 4TVPH 4YO0A 1T5WA 4HGMA 4WWID 3T0BA 4AMKH 1RY7B 4I8DA 4QKXB 5DJ2A 1UA6H 1IC7L 1OL0A 4YDVA 5CBAB 2IPUK 2ZUQB 2Y72A 4OQTH 4YE4H 1TPXB 4Y19A 4D2NA 2H9GA 3S98A 4HK0A 5GS1B 2QQLH 3V4UL 5BXFB 1U92B 4LFHG 4PJ7F 1MHEA 3WXWH 5LXGL 1BM3L 5HHOD 1CG9A 3VGAC 1GGUA 4Y4KC 1YNTB 4R3SA 4YHLH 2B5IC 3W11D 4JANB 3D69A 4D0BA 4JRXD 3U1SL 1CLYL 3UBXG 1QFWL 2AJXH 1WAAF 3D87B 1Z3GL 5I1AA 2GQHA 3BZEB 4P2OD 2HFGH 4EUPG 5INDA 1A7RH 3CFCL 4GW4A 1LMKA 3TIEA 1T66C 2EYSB 4YEFA 5TH2A 1JGUH 4YHMH 2NTSP 1G9ML 3W39A 4F9LC 4YDIL 4RMWA 1G0XA 2J5LB 2PYEE 3O3BA 1MUJA 5FYLL 4P99A 2YD5A 4WV1A 2FWOB 3LKOB 4M62L 1MWAH 3SDDA 5GGSY 4LLWA 2PUQT 4TSCH 1I7RB 2VL5A 4HPOH 4MSWB 3V6FA 1QRND 3CZFB 2D7PA 4X9BA 4U6TA 4LBEB 2WINB 5FGRA 1Q9KA 2DDQH 5FYJE 3AROA 4I0PA 3NBNA 1IAKA 1J1OH 4K3DH 1D6EB 3BOVA 2D03H 1CVRA 2DQCL 4PGZA 5D7IB 4I3RL 4J4PD 5IK3A 4J3XA 3HC4H 3VXQB 2CKBL 5I16A 3FFCD 5AD0A 1FCGA 4PTUA 3QUKB 2Q1EA 3CU1A 3SGKC 1F4WL 2JIXD 3EYSL 4M43L 1FDLH 2R56L 2EDEA 3KDMB 3ILQC 4PJGB 4LGSB 2Y36H 1F45A 5D6DC 4YQXH 4LLUB 2CXGA 2HJLA 4LSSL 2JJTC 5LJYH 4L3EA 3DX7A 3HR6A 3SKMB 4MZ2A 2YD9A 5GS2D 4L29B 4WHCA 4KTEH 1GGBL 5CILH 1TJGL 5FDWB 1FFPA 2AJ3B 4UNUA 1LWRA 3H9SE 2O5ZH 4WFHE 2V9TA 1V7NL 3G6JA 3N0PB 4K3JH 3AU1A 5E4EC 3LRSA 2NTFA 5IHLB 4JO2H 4WFGE 1E4WL 4OZHF 2D31B 5CAYB 2B7DT 2DI8A 1XGUA 5D8JH 3WS6A 4UV4H 2F58H 5BRZA 1AE6H 1I1CA 3BKYL 4KHXH 4DN3L 3O3EB 4FG6C 5AAMA 4NQVB 3NIDE 4Y0GA 2VLLA 5J1TC 4LARH 3TP4A 5TGBB 2F74B 4ONHA 1FNEB 4Q7DA 1MHCA 1QLEL 3UTZB 3P3YA 1AKJB 3BXNA 2AEWA 2E3VA 4G9FB 1GZQA 4KDVA 4N8VG 4RGOH 2B0SL 4EN3A 4ZSOE 4K94L 3T0EC 2IBBA 3A6BH 4TNVF 3MRBB 5IHZB 4IDJL 2XQYK 4XCFL 4F9PC 2P8PB 3CFBB 3RX8A 2WWMD 4XMLH 5FKAA 2ZUWA 4HKBB 5F1NB 2OTPA 4K7FA 3LZFL 2H32B 4TVPL 5EO1B 4AMKL 3CFDA 4OF8A 5B39A 4P48A 4NQEE 1KCUL 1MCDA 2PXYD 3FQRB 5KSAD 1XCTB 4HGWA 4HC1A 2D7MA 4OQTL 1HEZA 1JTPA 2PW2A 1NDMB 4YE4L 4O5LH 3MGOB 3BVNB 4ZAKA 3P73B 3S4SG 4PLKC 4PR5B 1F6AA 5C09A 1QSFA 2ADIB 1QO3A 4RFEB 3SDCA 2ICWJ 3JVGA 1RFDL 1UM4H 3MSPA 3C5SA 4UAOC 1DBJH 4GRLD 2X1QA 4ZFZA 5BZDB 3GM8A 4RX4A 1GSMA 1DBAH 4XXCA 3T3MF 5D4QA 5F7KC 3VG9C 1EFXA 5ILTL 1BZQK 2X9XA 5E8EB 1JGUL 3WXVH 4JFDE 2P47B 1EEUA 3MRQA 4OGXL 3JUYA 2OR7A 4Q58C 2ATPA 5EUOE 1XCQA 1MJ7L 2AW2A 1LK3H 3I3EA 4WO4D 2D2OA 4HPOL 4KJQD 5F88B 2HLAB 2W9LA 2FHFA 3O2DA 4CVUA 3S3PA 3V4PL 3H3PH 2AV1B 4AEHL 1MH5A 4NBYB 2R2HA 4XPAL 1QR1A 4OZ4B 5FYKU 4K3DL 4WU7B 4JFEE 4UOW0 1KIPB 1UCTA 4CAGA 5E24E 2RJMA 3I84A 1PKQA 1D5XA 4M6NH 3GMLA 2HAZA 1IGIH 3CSYA 2BNQD 4ZYKB 1K4DA 1EUTA 4JZNB 1IEHA 3KLAB 1KC5L 2GCYA 3H9HB 2V2TA 1CICB 1D5ZA 1NCAH 3R8QA 1BFOB 4NPYA 4FQXD 4AYFA 2DWDB 3KPMA 3D18B 1MCOH 3RVWD 4YNYB 2AJZB 4ETYA 5D96C 4JFQB 5J13C 4Y88A 5JA9A 1HIML 4MD4A 4M5ZL 5JR1H 3HZKA 3BT2H 1IC4H 3BP4B 4CW1B 3F65A 3MJ8B 4LSRH 2VDRL 5IMKB 2B2XL 4BELD 4R97C 4JFPB 3T0XA 4YX2H 4K3JL 1J12A 3G9AB 2XXMB 3IJSB 4P4KB 3D39D 2WIIA 4HX1A 3VRIA 1WZ1H 3EDFA 4HSQA 3QUYC 4MAYC 5LQBH 1WIOA 3TV3H 3B3IB 1G7JA 2E7LC 1NMAH 1HI6B 1NGZA 3MJ9H 3U7AA 5SWSD 1OF2B 2DJ4A 4FQHB 3BD5A 2PYEA 2XG4A 1J0HA 2XKNA 2LFGA 3LEYH 4UQ3A 4FQCH 3WHE1 4F33B 1WZMA 5CIPH 4RGOL 5JW5A 3WEXA 3JV4B 4L1DA 3ZTJH 3GIZH 2BNUA 3L9RA 1PQZB 4GAFB 4E0RB 4LAQH 1WZKA 3T2OA 3KPQA 2WP3O 4XCEA 3DV6A 4XCCL 3MBEA 5E1AB 4NKQB 3VG0L 1RIUH 3W0WE 2LAAA 1KJVB 4O5LL 3TBVB 1F00I 1WFNA 3UAJD 4PJAB 3RL2A 4O2FA 3V5DA 4CDHA 5IQ9B 5CUSH 1B0RB 4HGKC 2DKUA 1N3NB 2FIRT 1ZS8B 4L4TB 4CDGC 1KEGH 4RGNB 5ACZA 4XX1G 3ZYJA 2FBJL 1DBJL 2J8OA 2JCCE 3PV7A 4PLNC 2X1PA 3QCTL 5F9WB 3QIBC 1CF8L 1C5CL 3CVIL 3WIIH 3N1MC 3S34H 3SDAC 3BJLA 5GRYA 3T04D 1A22B 4RIRB 4KVCH 3QSKB 3ARDA 1G7IB 4N0YL 1M7DA 4WFFE 5HYSB 1KIQA 4JGMA 3RWCA 2VLMD 3CPLB 1RZFH 1LK3L 1T3FB 1U2HA 4O51B 2NY0D 1N2RB 2FATL 4FZ8L 3VXOA 5CZVL 3VGFA 4S1QL 1VFAB 2OQJA 4HV8A 3ECBB 2GSGB 4ZSOA 5J12B 4LCWB 4H25B 2ZCHH 1O7SA 2VLRB 1ZLSL 2VIRB 1FQ9C 5GJTH 5C08D 4DGIH 4F7MA 2IH1A 3QCVL 3ZKXC 1FFRA 1UWEH 1VEMA 1HHGB 3D3VD 4EIZC 3PDDA 3DVNA 3ARBA 3WBDA 5ANMB 1PGRB 4EXKA 4Z7UB 3OG6B 4NQEA 1MCOL 3HAEG 3ARXA 3RNQA 1OW0A 1OP9A 3V95A 4EI5B 1Z0NA 1TZGH 3V6OE 1X4XA 2VABA 3BT2L 3KLDA 3T4AA 1YEFL 1NQBA 2FR4B 5BJTA 4LCUB 1F4AA 3HZMB 4PRDB 5GGRY 4YX2L 3DNKA 3TPUB 5J6HB 4ZO9A 3BWUC 5F9DC 5DMYA 1ADQH 1H3PH 4I3SL 5FB8B 1WZ1L 3CJJA 2VDQH 4X4XA 1NMAL 2PYFB 5DJAA 1IGFL 1RVFH 2GTWB 4PTTB 4I5BA 1PG7H 4HCRA 4JFDA 1YMME 1G6RL 4Y5XB 3V0VA 1QSEB 1IGTB 1MFCH 3MGAA 4Y8DC 4FQCL 5EUOA 4W6WB 2W1NA 2Q3ZA 3L3OB 3MLYL 1PBYA 3VGEA 2FZ3A 3JTSA 3H7BA 3E6HB 2C5DC 2CR3A 3ULVE 3DUHA 4Z0BH 5GGVL 3KAAA 1PDKA 3VXSA 2C3XA 4LAQL 3UC0H 4JFEA 4AT6A 4JO4H 3OAZK 4NN5C 3T65A 4CRPA 3OAYK 4XZUA 2UUDH 4LVNB 1WIPA 4GH7B 3VXTA 1A7OL 5KJRH 5JXEA 4UNTA 4BFIB 3QUML 1X9QA 2X4PB 1E4XH 2LAGB 5KANG 1EVUA 1AXTL 3M45A 1L7IH 3RKDC 1KEGL 1Q9LA 3MODH 4NDMA 3REVA 3ZHKA 5EOQH 4XP6H 5GRZA 4R7NB 4QOKB 1CLOH 4WEBL 4DJMA 1F3JB 4TRPL 3L3JA 5IB4A 1CIUA 4KQ4L 1CT8A 2Y23A 3D6GA 1I1AA 4H1LA 5D1ZA 3WIIL 4BSWB 1TCMA 3T8XA 4S1DD 4JFHE 4TUJA 1BAFL 2DQIH 5DTFA 4J12A 3S36X 3VFTB 1G7QA 2DQFA 2MHAB 4AEFA 2Q86B 1E4KA 1XF2A 4XAWH 2D0FA 1TETH 1TNNA 4XNZC 3ZLQC 1KN2H 1RZFL 1WWBX 3L5IA 4FZEL 5GS0L 4CNIB 1NKOA 1H0DA 2VDKL 2Z31B 1ZLWH 4JREC 4JCMA 4EIGB 4X6EB 4L8SA 4PPTA 5E6IA 4LIQL 5HGDB 1S7XB 4LLVB 4DGIL 2ED8A 3RDTB 4BKLB 1AKJD 4G9FD 4BQ6A 3U30C 4EBQH 5F7HA 5C6TH 2GSIA 3HI5L 4AJ0A 1T7XA 4PG2A 1C7SA 4HUWB 5DEZA 1FNGB 1CZ8H 5J6GB 3W0WA 5CJ8A 2R29H 1YDPA 4WFED 4P49A 4YXKH 5DGRA 3TZVA 1CI5A 4HBCL 4XTRD 4Z7VB 32C2B 3QDME 5TDPA 2FHBA 2JCCA 1EDQA 5BO1H 5F6HJ 1HH9A 2ADGB 3DROA 3VFNB 1A7QH 1OAXL 4O58L 3RL1A 5I1JL 3PHQB 3KPNA 4N5EC 3G04A 5SWZE 1WBXB 4QHLB 5DWUH 1TCRB 3QZWB 1CGSH 3OTTA 4WY7L 3VXNA 1U8NB 1SM3H 1BWMA 3JWOH 5DJ8A 2RBLA 5HYFA 5J9PA 3DMMB 5K9KB 1P5VA 3CVHH 1CE6A 3GO1H 4NC1E 2OL3B 1BVZA 2BHUA 1MHPL 1UXWA 5B3NA 5DJZB 1CFSA 4POZC 2B4CH 3JZ7A 1ZHBA 1OWWA 4Z0BL 3WFCH 1MCQA 3OKMB 3LSOA 3E3QC 1KPUA 2HJFB 1Q9WB 2EYRA 5FA3B 1DUYA 3KPRB 3CX2A 3EJJX 3WDHA 4NKIL 4O2EA 1J87A 1R3KA 4JO1H 4LRIA 1OAKH 3LKRB 4PJHF 3VW3H 1KYOK 4K9EL 1QNZH 1U2CA 5INCB 2OK0L 5KJRL 2LU7A 3EGSA 5F1SA 1U8PA 5C07E 1NUDA 4OI7A 2RCSL 4PJ7E 4R7DA 4WVRA 4QF1B 4FTVB 3QI9C 1CICD 3SKNB 5EOQL 3V6OA 1MJ8L 1JPSL 3I75A 4PB9H 1CLOL 1WAAE 3HKFA 1QLRB 2OSLA 4B41A 2D0GA 2EE2A 4L4VE 1F11A 5JNYB 4MJ2A 2DQIL 4JEGB 5IEHA 1LK2A 35C8H 3CMGA 5DK2A 3IGAB 4XAWL 2NR6D 2BVUA 3GHBL 1KN2L 2Z92A 4G8EB 5MENB 1JPTH 5C0BB 3SEPA 3BISA 1YMMA 3T77B 4P4KD 5I66A 4KHTH 1I1RA 2P1YA 5IB2A 4HT1H 4FABH 3RTQA 1ZLUK 3C8KB 4G7VL 1P7QB 2CLRB 4ZFGH 4U1MA 1BIIA 1G7HB 2FJFA 4LEOB 5T1KD 5IM7B 5CJQH 3VMPA 5KZCB 1WT5A 1DSFH 3GSOA 1QBBA 2EECA 5HI5D 5C9JA 3TO4A 1D7FA 5L9DH 1B0GA 1RQ5A 4K7PH 1MFAH 2UWEB 4JPVL 4ZXBC 3ISWA 3K1DA 3HUJB 3O11A 1AFVL 3K4AA 4LHUA 3R06A 4IRJB 4OZIF 4PJ8B 1S7SA 1FVCA 1DQJB 4MA3A 1EAJA 2APBA 3FN3A 2XTLA 4HIIB 4Y2DA 3AC0A 1A47A 2Z8WC 5ESQA 4KI1A 1CL7I 1M7IB 3G6AA 3MA7A 5BW7A 1Q8MA 2A6KA 2ERJC 4M7ZC 5LAXA 1KBGH 4JG1H 1FL6B 1NFIB 1R6VA 2NYYC 1F97A 3UX9B 4OZHE 3IDXH 2QKIB 2CDGA 1ACYH 3ZTJG 4ZUUB 1A7QL 2Z93A 3F7VB 4P9HH 1TZHB 2C3VB 4LKCB 5DFWH 3DWTA 1NLDH 5F70A 5HDBF 1B6DA 3C5ZB 3SCMA 4P46A 1S78C 3QAZB 3GRWA 4GW5B 3GJEA 4CADB 3HNSL 3UO1H 2V17H 2Y6SD 4NKOB 4OFYD 3PXJA 4GRLA 1Q72H 1UZ8B 1B2WH 1NPUA 3IDMA 2CPCA 1KTLB 1AGCA 2B4CL 1ORSB 1VEOA 4GKOA 1D9KB 1QFWM 4OLWL 1IC5H 1BQLH 5DSCB 1R5WB 1JGLL 4TTGA 3SKJL 4L9LA 2AJSH 4UI2A 3MRJA 1JUFA 4JO1L 1K6QH 1OAKL 3GZKA 1ZSDB 5DQDL 4LCWD 4F57H 3BGFB 2VLRD 2GI7A 4KV5F 5ITBH 3PV6A 3KNBB 3GHEH 2DMKA 2C4XA 1EGJL 2APTA 5DK0A 1EGJA 2F19L 1EK3A 3IRZA 3B43A 1ZVHA 3GSVA 3QUXC 4UILL 4WV1C 1UQSB 3SDDC 1UCBH 3NZ8B 4GXUN 5F9JB 5I76B 2DD8L 3OKEB 2ZCKH 3QDMA 5F97E 4ETQA 1HQ4B 4L8DA 3LPFA 3T3ME 2APFA 4EI5D 4YAQB 1C1EL 1ZT1B 3KPSB 5J3HD 1J0JA 2IEPA 1A1MA 1M71A 5IB3A 5DVKA 4WJ5B 1TXKA 35C8L 4I0PC 1I3RB 1MLCB 4TSAH 1FO0L 4PGCB 1J05A 1FO0A 3LS5L 1H8NA 3MZTA 1F3DH 4IBLT 1ZAGA 4LSUH 3STLA 3MV7E 5SWZA 4HMEA 3ZE1F 3IFPB 4NQDE 5DRXB 4MQ7A 4C59B 2OTWA 4KZEL 3QFJA 1FRGL 3UBXA 4KHTL 4RFNB 4OGAD 1UH2A 2ZOKA 4TULH 5JPNB 4HT1L 1R5IA 3QG7H 4GRMA 1I9RH 4J3SA 1WEJH 3GSUA 3NN8B 2AK4B 5DRWA 4ZFGL 3QCUH 4QRPE 4G6MH 4W81A 5EOCL 3TWCH 1QSED 3K0WA 1UKSA 5DMGD 5EU5B 5LGJB 1U58A 4OD1H 2WV3A 3A6CH 5TF0A 3BE1H 4CVZA 3DRQA 4WENB 4K7PL 4KUCD 4X6DF 1U8MB 1DN0A 4LLMB 3QQ9C 4KU1A 2L7JA 5AYQA 4HMDA 2IH3A 1CD1A 1T1YB 2JKXA 2XACC 5IJKA 1NDGA 2NW3B 3FHQA 3HC0B 4S11A 1EHLL 5EUKB 4X4YA 3WS6C 5CWSA 1QPXA 2R2BB 1X5JA 1OPGH 2OJEB 2R1YB 1R5VA 3BD4A 4NNXA 4L8CB 2ZUYA 4PJ7A 5FIEA 1TQCB 3BESR 4WW2A 5HPMA 3T3PF 1WAAA 4WI3A 4EN3C 3IDXL 4NRZB 1L7TH 1RU9H 4ONGL 5FYKL 2FSEA 4L4VA 5I18H 3GI9H 4Y4FC 5EOTA 1FNAA 3G5VB 1RHHA 5BV7C 1NGXA 4QOKD 1FHGA 3D85A 4XX1E 1ZGLP 2FNBA 3RQ3A 3RWHA 1N7MH 3AY4A 2APWA 2PTTA 4NOBA 2OR8A 2V17L 4U1JA 4AH2A 2G60L 4NCC2 1T03L 5IHUL 2R9HD 3WIFA 4ZUTB 1B2WL 1OTSD 3G5XA 1NLBL 1YEIH 3E0GA 3REWA 3PF2A 2AXGA 4RISL 4ZQKB 4ZAKC 3LDBB 1IC5L 4DN4H 1BQLL 1W0VA 3TA3A 3QEQE 3SDCC 2MTPA 2FX8L 3JVGC 4NO3A 3UZEA 2Z31D 3HN3A 4O02H 5A16A 5IESH 4ZOEA 4N68A 3BGMB 1NGPH 2CO6B 3CX5J 4MQTB 1W8OA 4N8VA 4JQVA 4XP5L 1CD8A 4HS6A 1FBIL 1SBSH 4XAKD 5IR1B 1CWVA 3BRDA 5L7XL 1HWGB 3OKOA 2NNAA 3MACH 5B21A 3RDTD 3NFNA 4XBPB 3B2VL 5MP6L 4NQSB 4W70A 1VACB 1WFTA 5ESVB 1MJJB 3EOBB 4NWUL 1KN4H 3KXFD 3R1GL 4NFDA 1UCBL 2QLVB 3QDJE 2XTJE 1O7VA 4NJAH 1FFQA 2L0DA 2VXQL 4QRTB 5MERB 3GJFK 1M05A 1BJ1H 4IRSD 2XFXA 2UZIH 3S4SA 2N7AA 2IPTH 1MJUL 1P84J 3FO9B 2H32H 2IG2H 1KT2B 3HCVB 4GW1B 3KS0H 3FOMB 3MUHL 3F62A 4HUVB 3VWJB 3L6FA 4OUUB 1RIVL 2O61A 2ZG3A 1WISA 4BZYA 2AK1L 2ED7A 4XNQB 3O8XA 2X7LB 1INEL 2IQAB 3NZHL 3O0RL 4GAJH 3TT3H 5CCKH 3HS0B 3ZHLA 4KRPB 1KIRB 4DKFL 1FH5L 1H3VA 1NJ9B 1MPAL 1R24A 5D7JB 2BSTA 4HK3N 4P9ML 3DMMD 1KLGA 4NZRL 4GKSA 3P0VL 3L5WA 1EXUA 1ZA6A 3VRJB 5F6HI 3HA0A 2X70B 1XF4A 5KS9E 3IU4H 3VH8A 1MFEL 1J8KA 4ZNEA 2R1WA 1KPRB 2K9UA 4UIKH 3WFDL 3KPRD 1NAMA 3O2VL 1JGDB 5C0JB 1QFUL 2DKMA 2FWOA 2R1XB 3TBWB 5CZKA 4PY7B 3U7YH 4Y4KB 1BEYL 2V9RA 3HNVL 3QHTC 4GFTB 5JW3L 3P30H 5EC2B 2WINA 2E7MA 3NFPB 1Z2KA 4G8GE 2I25N 2R4RL 1MVFA 4ZG1A 1UH4A 5DVMA 3VFGH 3O4LB 1VERA 5EU6E 4FTVD 5I18L 3EOYG 3GI9L 4HIXH 4G43A 1YEGH 2A0LC 3I6LD 1FJ1A 5J06A 3U46A 4WTXA 2ZSVB 5IFHH 1GVIA 2NY6B 1QBAA 4MZ3A 5ICXB 3MV7A 4HUXB 4LASL 4NQDA 1ZE3C 2VISB 5HHVH 3MBEC 3ABZA 4QLRA 1KUMA 3TBSB 4Z5RA 1XGTB 2HLFC 3CLFH 1NGYA 1YEIL 3HE7C 3K2MC 4LSVL 4WNQB 5MEND 2QL1A 4QYOB 1I1FB 5IVXF 4QRPA 3UPRB 1R3IL 1LO0H 3H7LA 1Z9LA 4Z78B 2OMBA 2X42A 2P46B 5D2NE 3T4YB 1P7QD 5GGTL 3WFBL 1NGPL 5GGTA 1LDPL 2FHCA 4MB5A 1PX4A 3RWJB 5ICYA 5KZCD 1NEZG 3G08A 3V8OA 1F2XK 4RRPG 5EC1A 2BX5A 2NCMA 2A73B 3LKQA 4JG0H 3L7FB 3D48R 1JF1A 3WNLA 1IKFL 3SOBH 4M6ML 2AP2A 5JDSA 4OZFA 2G9HB 1UJTA 1S7TA 4JAMB 5DVLA 5E6ZA 1RZKH 3DX8A 3JTTA 1E27A 1KN4L 3DYMA 3CFJB 5EU7E 4IRJD 3WUZA 3S36H 4PJ8D 3PWPE 4YXLL 4LPYA 4L3CA 4PJ5B 3QUZA 1UGNA 1MY5A 1OB1B 2PO6A 4D0CB 3NACL 3MRGB 5E4EB 2W0FA 4EOWH 4ZPTA 4KK5C 2A1WL 1A6AA 3VFWB 2UZIL 2FEDD 3LN5B 5F1NA 3QNZA 4PGJA 4IM8A 2AEIT 4J1UA 1QYGH 3IB4A 1J0ZA 1S5HB 3UZQA 3V52H 4XPBL 4U6YB 3HLAB 4IDLA 3U0PB 3ARBC 1S7RA 4EQ2A 4GAJL 4R8WH 4XCYA 2EDKA 5CCKL 4EVNA 1JK8A 3C5ZD 2DL9A 5IMMA 1P2CB 3BVNA 4CVXA 3T0EB 5CINL 1FZJA 4GRWB 4L3AA 3U9UB 1OW0C 1JWSA 1YPZB 3MREA 4R96A 5CHNB 5EBLA 2DQUL 4PJBB 2YKLL 4WRLA 1B9ZA 3AM8A 1VSCA 4CBPA 3RWFB 3QEQA 3LCYA 2DTML 4E5XB 1HDMA 3LAFA 2VSDA 2FH8A 2NX5B 3V4VH 3M17A 1D9KD 3HMXA 3VD5A 3EFFB 1KTDA 2VXUH 2V7NA 2ZCLL 2FJGB 1A4JB 5H37H 1FZOB 4J8RB 4Q2ZB 1Q38A 1MEXL 4Z0XB 3V0WH 4JHBA 3FL7A 3WFHB 2A9MH 2F53B 2LABA 4MD5B 4XCNB 4JQXA 5GGRB 3P30L 4ELMB 5EBGA 1UYWL 2NPLX 3PL6B 1FCCA 3SE9H 1DBMH 5FA4B 3QDJA 3OX8B 3GUTB 3VFGL 1R3LA 2C26A 3MMEA 3VG9B 4QHUB 4JPKH 5CBEB 3TNMB 3BUYA 3N1PC 4DEPC 3TF7C 1RZJH 5IFHL 3KPOA 4JB9H 3HG1B 2F5BH 2VKWA 1KOAA 5AUMA 5EZJB 3AXLB 1FZKA 2R0KL 3JWNC 4JZNA 1JNJA 2PR4H 3OZ9H 2XY1A 3KPSD 3LN4B 1LO4L 3QDGD 2FGWL 1MVUA 3M8OL 3JUZA 4X80H 3STZB 5FO9B 4ERSH 3HI6H 5I1LA 3GMOB 2CDEA 2C7UA 2IAMA 1CK0L 1SJEA 2HKFH 5MEQA 5M7QA 1VENA 1E6OH 2NY2C 4DUVA 3DJ9A 1XIWA 2AJVH 4QWWD 4WCYH 2A83A 43C9B 1FL5A 1N5AB 4TNWF 4DUWA 4JFPA 1F4XL 2AK4D 3FCTA 1OAUH 1RV6X 5C0CA 3KYKH 1HHIB 2DJUA 5K59F 4PJHE 1RULH 5KS9A 1I1AC 3UYRH 1P1ZA 1TIUA 3UTSE 4NZUH 4JG0L 3VA2C 4WUUE 1K85A 2VQ1A 1K5NB 4XXDB 3AUVA 1HXYA 1RMFL 2W9EL 4XMKH 1G0DA 4KROC 3TJHC 1OGAB 4NO5B 3DXAB 1LD9B 4EDXA 4F15C 1MF2H 3VXUB 3AS1A 1TZIB 4R97B 4WWKB 3C87A 5GS0C 4PG9B 4PGDB 4G8GA 3OPZL 2BSED 4I0CC 2BY3A 2MSPA 1MCRA 2D7NA 4MAYB 1PQZA 3QUYB 4L8SC 3RAJL 5EU6A 1JHKH 1JPST 3QIUA 1MWAA 4JFZH 4OCXL 4U6HB 3A67H 4LVHB 2VN7A 4OCWH 2ZNXA 4LQFH 3QO1B 3Q3GB 3SPVB 5E1AA 3T2PA 4HFUH 3RPIA 4QNPF 3FOLA 1P4IL 5KSBB 2E9JA 4NKMA 4PG2C 1S7UB 1Y6NR 4G8FB 1KPVA 4OFPA 1CDGA 2GT9B 1TLKA 1QKZL 2ATKA 5IQ9A 2CIIB 4FFWD 1N3NA 2BXYA 2BCKB 3MV9E 4L4TA 4DZ8B 2KQNA 4C56B 5E8PA 4WI6A 2BNRE 4KI5F 5FDYA 4FMFA 1G1CA 5E2UH 2IPKA 4M4RA 1FNSH 1TJHH 3TZVC 1ZEAL 3O3UN 3NIGF 2EDBA 3V4VL 4CUCA 3IJYB 5IFJA 1YC7A 4P4RA 3K2UH 4OZIE 4AEIH 1PW3A 1G7IA 1Q1JH 2YEZB 3TGXA 2DLFL 1GHFL 5ESAA 3BKMH 3W2DH 1CGVA 5FUCE 5DC9B 3IDIB 2A9ML 3IDGB 1T3FA 1T22A 3F7PC 3L5XH 3S35X 5ERWA 4M1GH 1G9NH 1TDQA 4OZGF 3QIBB 1KB5H 4YIQA 3PWPA 3LIZL 3SDAB 4L8BB 4LCWA 2EEBA 4JPKL 4G7YH 5HDBE 3BN9D 1RZJL 2QQKH 3MNZB 2F5BL 4NZTH 4OFIA 2VC2L 1A6WH 5D2LF 1SJHA 4LOUD 1BF8A 4MA7H 5DVNA 5FO7A 3BZ4B 2BOCB 3NPSC 4RAVB 4P23A 4JM2A 1HSAB 3UYPA 1INQB 4NRYB 4YR6A 4F37F 3OMZA 2EXWC 4YK4C 4K9EC 3NFSH 3VWJD 2CK0L 5EBMB 1LNUA 4UBDD 3GJFB 1E6OL 1RUML 1MRFH 4IJ3C 2RGSA 2FR4A 1L4IA 4DKEL 4PJCF 3L7EA 4MMZC 4KRPD 1ZHKA 1YJDH 3FO1A 5D71H 5ALBL 3V6OC 5DD6B 3SHSA 5IUSA 2HA1A 4HXBL 5D7JD 3QG6B 4V1DE 1T04A 5HI4C 5FB8A 1JGEB 4LSTL 4KV5E 3KYOA 3UYRL 1TVHB 1D5MB 2VDNH 2VL4A 4F7TB 3ARRA 5F7DA 3QPQC 4AIZA 4XMPL 1DQML 3U4EA 1WFOA 2Q76B 4Y2OA 4OV5A 1WGOA 4PJFE 3ROOB 4PD4K 3L3HA 2KUTA 1WQVT 1MF2L 5HVHC 5CEYA 1IGYB 2VAAB 1K8DB 3KPPB 2MCPH 2OL3H 1CL7H 5GRVK 2P8LA 1HH6A 4ZUVA 2X4UA 5DJXA 3RTQC 1FFNA 5EPMB 1TQBB 5C0AE 4Y4KD 3MUGB 4G5ZL 1RUPH 1IEAA 1JHKL 3C9NB 3QJFA 5KW9H 3AMLA 1WT5C 3A67L 2BRRH 1EEYB 5EN2B 4S10A 3GK8H 5I1GL 3ZE1E 4UINH 3ULVC 4HWEH 5GGVY 3MRMA 4HFUL 4PRPE 3O4LD 1T66D 2VDML 4IHOA 4KFZC 1HOCB 1WV7T 1I3GH 2JJUA 3FONA 2ID5A 5DHVA 2JJVA 5LKNA 3S3JA 4P2RB 4Y5VB 3RVUC 5D72H 2NY6D 1SYVA 3KYNB 4M02A 4XWGH 4GLRH 1N0LA 4XI5C 2D4DA 7FABL 4Y2DC 1QRNE 1MAKA 2WWMC 1FNSL 4X6DE 4QTHA 1G7PB 3ET9F 2F8OA 1CGXA 3O3DA 4C4KT 1FZMA 1SEQH 4ZDHA 3C6SA 4PJHA 1Q1JL 2PXYC 5KSAC 4IOIB 1RJYB 3T0WA 5C0IA 1DJSA 4KZDH 2AABH 3UTSA 3FFCE 2R23B 3OG4B 1JF5A 3SCMC 5GGUB 5KSUA 3TH4T 4LDLB 1O5DT 2BHYA 3FHAA 1BD2E 4XRCA 5IG7B 2ICEB 1I75A 2OTUA 1P5UA 3T3PE 3U4BH 1JVKA 5EU3B 4J6RL 3C2SA 4GRLC 5F8QC 5AWNH 3MYZA 4G7YL 3LKSB 3MJ9A 5A2FA 1GOGA 3WIHA 1R3JB 3DVGA 3LOWA 1T7VA 4NZTL 1JHLH 4PJ5D 3PP3K 1AC6A 1CFNA 1A8JH 1V7MH 5ADPH 1ZT4B 3MJ6A 5CIPA 4J3TA 2HWZH 3RA7L 3PGCA 1FVEA 2WUBH 4UT9H 3RZWA 1YUHB 2CUMA 3OF6A 4MDJA 3OKDB 3B8SA 4WO4C 2PTVA 4KJQC 2HRLA 3QFDA 1BQHG 4YHZL 4ODSL 5BQ7B 3BIKA 4FG6D 3RJQB 3OGOE 4RNRB 4YDKH 1IAOA 1BZ7A 4OLEA 1T20A 4LAJH 5KTEL 3ILPA 4EDWH 4P0DA 4AL8H 5HHMB 3O6KL 4I4WA 2DI9A 1YN6A 5GIRA 5IT2H 3MV9A 3U30B 2V7HA 5HHXL 3BPLC 3T0ED 1BLNA 4PJ9A 3MQIA 2EDOA 4S0TD 2X05A 3J7HA 4NN6C 2MWCA 2ITCA 2V5TA 3FB8A 2ICWB 3N50A 2A6JB 3C8DA 1X6LA 1HSBB 1KCVL 4WGWB 4OZIA 3KR3L 5HHPA 1J8HE 3QQ4B 5KVDL 5D5MF 1YEJL 1U8NA 3TCXA 1PZUB 3GKWL 2VXTL 2NX5D 3ZL4H 5HGHB 1U3HB 2J88L 2NY5H 4XH2B 2VITB 4UUJA 2HJKB 1OT2A 3D2UB 2OL3L 3SDXA 3MA9H 3CSPA 1EAPA 4PREA 3BO8B 1OGTB 4OIIH 3MLVH 3V9FA 4U6XA 4XP9H 4KJYB 4PLKD 3PWNA 1EO5A 1QTYT 3PWJB 4NC1C 2Q87A 4P5TA 2F53D 1DE4B 3RWEA 1C5DA 4I18A 1KELL 5CEZL 3PL6D 3ZE2F 1OD9A 2KKQA 3KPLA 1S9VB 2W91A 4NFBA 2FO4A 3GK8L 3FT4B 1F4YL 2ZPKH 4HZLB 4HWZA 1NC2A 2YWYA 5AZEL 3F12B 4DOHB 4BA8A 4M03A 5H37G 5HYSG 3DIFB 5IJKC 5IW1A 2GJ6B 5FEBA 3LKPB 4XVSL 9CGTA 4KDTA 4ODVH 1A5FH 1U8HB 2CLZB 3EDDA 1NL0H 2WWKT 5IVNA 2FYYB 3EDEA 3IETB 1AJ7H 4DFHA 1JHTA 3ES6A 4XPHL 4CJ0A 1I7TB 3FQNB 2WM0A 1BZ9B 1EJOH 2ESVE 4WW2C 3QXDB 1XR9A 3Q48A 4WW1A 1FORL 5T1MA 1IMHC 4V1DA 1IGMH 3LEXA 5T3ZL 4JZJA 1K4CA 4R26L 1C08A 2AABL 4LLQB 4E41B 4KUCF 5MENA 1V3LA 5JO5B 3UAJC 3TH2T 3S37L 4DTGL 1NCTA 2JK5A 5C0BA 2E5EA 1HXMB 3MRIB 5E9DB 1IQWL 4PJFA 1G84A 2CUIA 2DWEB 5DD5L 1ADQA 2VLJE 5HVFB 3PP4L 1KG0A 5I15L 4XBEH 3DI2B 2DTSA 3FB6B 5HDQH 3PG2A 4FNLH 3T0VA 1OGAD 3DXAD 2YBRA 4F8TA 3VXUD 2VKXA 3CDCA 3QWRD 1N26A 5C0AA 1CR9H 4JFYB 3RJDA 2JLLA 5I6XC 5EB9A 5ISZE 3MV8E 1I8KA 3KWWB 1JHLL 4WWKD 2YS4A 3TA3C 5ADPL 3EYUL 3V7AG 3HUJA 2D7TH 2Y7QA 1MCPL 2V2XB 1G6VK 4BH8A 4PRPA 4WTZG 4NT6B 4MAYD 2IPUG 3QUYD 4LKXA 5I1IH 1FGNL 4JQVC 4IS6B 4N9GB 3T1FB 4HIHB 3QNYA 3P4MB 4HIEB 4YDKL 4KUZL 4O2CB 3MCG1 5MEPB 3ARZA 1MCNA 3HPJA 5IVXE 2EDLA 3KYMA 4NN7C 4QRUB 3U7WL 4AL8L 2MQ3A 2YD7A 1BBDH 5IT2L 1FL3A 4Z7WB 1ZGLM 4MNGE 3OJVC 3ZT5A 1I85C 4X6DA 3X3FH 4KVNL 3U9PH 4QHMB 1SQ2N 4ZO8A 1GRWA 2MQ0A 1EFQA 2QKIA 4RGMC 2CLVA 2C3VA 1XF5B 3MRCA 4C56D 2ITDB 4JKPL 5DR5H 3BGAA 3IAGC 2DQJL 4GMTH 4OKVA 2BVTA 2BZDA 4NHCL 4RMSA 5EO0B 3IKCB 4HFWB 4M6OL 1FPTH 1F42A 5KVFH 3ZL4L 1BIHA 3TFKD 4OBRA 5DEGA 5CP7B 3ARVA 2IMMA 3FB7B 4BYHA 1WTGT 1BD2A 4M7ZB 4P3CH 1AGFA 5D7LB 2FCBA 2WUCL 3T2NH 4FFZH 2IANE 2FX7H 4AENA 5DSCA 4XC3H 1DQDL 3H0TB 1OAZH 3UTTE 3QIBD 1U8JA 4XNXL 1Z5LA 4JR9L 4H5SA 2AXFB 2X4NB 3SDAD 4YO0B 1SHMA 1T5WB 4TQEH 2AI0H 3DVFA 1KCLA 3ZTNH 5F72S 2EO9A 1MFBL 2CSPA 5DJ2B 3KNBA 4YDVB 2NXZB 1I7ZA 4Z7VF 1KEMH 4Y19B 2H9GB 5L88H 4B7LA 1A5FL 5DVOA 4HK0B 5DUMH 4QXUL 2FEEI 1AJ7L 1MHEB 1QUNA 1NMBL 5CEXA 1CG9B 3NZ8A 3JWDL 4R3SB 4DQOH 5B38A 1WBYA 3D69B 3DSNA 4D0BB 4L9DA 4OIBA 3SDYL 2F5AL 1MIMH 5I1EL 5I1AB 2W07A 4O9HH 3EDJA 3INUH 4YHOL 5INDB 4GW4B 1MLCA 3TIEB 1RPQA 4Y7MA 3PIQA 2B1HL 5TH2B 2WBWB 5DRXA 3W39B 1J8HA 2OS7A 1TVBA 2GAZA 3O3BB 1MUJB 4ZNCD 1ZXQA 4WV1B 4OUOA 3WJLA 3SDDB 4LLWB 3P4OA 5I1KH 2VL5B 5HVGB 3V6FB 2ZSWB 1CD0A 5IJVB 4MLSA 5HDQL 4NYLA 4JDZA 1Q9KB 4BH7A 1L6XA 3S7GA 2I07A 5E8OA 1ODAA 1CU4L 2X89D 4I0PB 1IAKB 5L6YH 1KF9B 3GDBA 2ADJA 1NCBL 1PX3A 4QY8A 4CMHC 4U1SA 2A6IA 3P0YH 4JO3H 3CVHA 4UT7H 5T1DH 4PJEE 5I16B 5AD0B 4PTUB 1Z9SA 3RPKA 5JOEA 3NABL 3TCLA 3ZDZF 1P4BH 3L3DA 2FB4H 2H3NA 3QZWG 3F6LA 5EUKA 3RI5F 1KTRL 2VR5A 1NANI 4U4BA 2HJLB 1T7WA 1XH3A 2P24A 4L8CA 4L3EB 1GC1C 3DX7B 2F9BT 4JPWL 4ZFFA 2IGFH 1D3CA 4LQ1A 4IRZL 1FFPB 3L3GA 4XNYH 5FUZH 4P2RD 3U9PL 4F7PA 4D9QE 5K59E 3FO0L 3G6JB 1YNKL 2PO6C 2ESVA 3NPZB 3AU1B 3LRSB 2NTFB 5HHQB 5DD3H 4R4BA 5CZXC 5E03A 4F58L 1XGUB 5GSVB 1W72H 4U1NA 5BRZB 1NCCL 4XPTL 2R69L 4YGVA 3VXME 4YC2C 1AI1L 3O3AB 4J23A 5D6CA 4ZTPH 2BOBA 1YZZA 2VLLB 3DSFL 5DQJA 1YQVL 1HILB 4ONHB 2VLJA 2BMKA 1MHCB 4XTRC 3CX5K 5CSZA 3BXNB 1DCLA 5GIRB 3X11B 3K3QA 1GZQB 2YSSA 3KVQA 4EN3B 1J0KA 2MKLC 2FX7L 2EKSA 4I0KA 1BFVH 2E27L 2AKRA 5BV7B 3ARFA 1YEEH 1WVZA 3BHBA 3MUJA 1FAKT 5FKAB 3FQXA 1IL1B 3BGMA 1QFWI 4K7FB 3MV8A 4N9OB 4U1LA 5ISZA 3LB6C 4QRSA 1NKRA 4PV8A 2EE6A 4QNPE 1IE5A 3DYPA 3CFDB 4ZOAA 5B39B 3TPKA 5FGBA 1DTUA 1K8IA 4N0UE 4HGWB 1CVSC 4RBPK 1LP9E 4RFOH 5SX5H 1HEZB 2PW2B 1T2QL 4MJ6A 3UJJH 4JY5H 3HI1B 1HHKA 1J1XH 3K81A 1F6AB 5C09B 5IVXA 4U0QB 1QSFB 1QO3B 2NMSA 4KI5E 1HINL 3SDCB 4L1HA 2X4RA 3MRLA 4JQXC 4J7RA 4HJJH 2WZPD 3C5SB 1Z9OA 3CMOL 4MNGA 4A2LA 4ZFZB 2CJUL 1CS6A 2DF3A 5HHMD 5C7XH 3S35H 1EFXB 3SE3A 3VFVA 1OTTD 1YYMH 3KPTA 1P7KA 2ATPB 1J7VR 1LO5A 1R3HA 4MA8H 5JXAL 1XCQB 4Q0XH 4K3EL 4OF0A 5I1KL 1M1SA 3TEUA 4OZGE 4Z7NF 1QOKA 2XWBA 1MQKL 2HKHH 2R0ZH 1TJIL 4WFEE 1MH5B 2R2HB 1QR1B 4H88L 3D2UD 3O4OB 2IANA 2XWJA 4KKCC 1XIWC 1PKQB 5D2LE 2P43B 3EZ8A 4YGAB 1YNLH 4LRNL 3UTTA 3GMLB 3ALPA 3CSYB 1K4DB 1U95A 4NNYA 3DYOA 2GCYB 4N5ED 4YBLB 2V2TB 1IM3A 1D5ZB 4NPYB 2E9BA 3KPMB 1BVLA 4DFIA 1LO2H 1LEKA 3CCHA 2IGFL 4ODTH 1A1OA 3HZYA 4PJCE 4MD4B 1JMZA 3HZKB 2CKNA 4UOW1 3GMRA 4XNYL 2F15A 1QBLL 2GJ6D 5IP4A 4WU5A 4KH2A 3ZYOA 5C0EA 2M26A 4ZPVA 3B4NA 4ZS7L 4YDJA 4N8PA 25C8L 2H1PH 2MPAL 5JHLH 1P6FA 1NCUA 3PGFL 3IJHA 3VRIB 3DBXA 5HGGS 1HQRA 2RAMA 5F71A 1VESA 3QIUC 1G7JB 1VCAA 3T0DA 3MLXH 1DLHA 3BAEL 2WLYA 3D25A 2YD6A 1NGZB 2AEQL 3BZFA 4LDEB 2PYEB 12E8L 2XKNB 4JVPA 4UQ3B 4UT6H 5I75B 2FJHA 4E41D 1BBJB 1NGWA 2P5WE 5JW5B 1J5OL 5E9DD 5DA4A 5HHNA 3VDCA 3WEXB 2OR9L 3I6KA 1F02I 2AGJH 2BNUB 3L9RB 4RGNC 2J6EA 3UEZA 1DZBA 3WD5H 3KPQB 3WKMH 2O26U 4PJEA 5F9WC 4XCEB 5I8OL 3NTCH 4LLYA 3MBEB 2OP4H 4OIAA 2GW5A 1K9TA 1RJLA 1NSNH 2DQGL 3GSQA 4MA1B 1PY4A 1A7PH 1FAIL 3RL2B 4JY5L 4O2FB 3V5DB 3BN3B 3PJSA 2ENSA 1B90A 1M4KA 3CFJA 3ORJA 1YEDA 5TQ2H 3ARTA 4PJ5A 2YPLE 4HJJL 5ACZB 1OB1A 5T3XH 2VDOL 5EU7C 4OLYH 3VFWA 1PSKH 3UYOD 5J12C 4GKNA 3NAAL 2I26N 3GB7A 1YYML 3ARDB 3W9EA 4KRMB 4WI5A 3WSQH 1M7DB 5K9JH 3L3KA 3ME0A 1KIQB 3RWCB 2BVOA 4QRRD 3VXMA 4Q0XL 1MI5A 3VFRA 4LSQL 1BECA 3VD9A 4XPGH 4JM2C 3VXOB 4G6FD 4TYUA 5LWYL 2OQJB 2H2PC 4HV8B 5TQ0H 2CRIA 4ZSOB 1XR8A 4EI5C 5J3HC 3CK0H 1SVCP 2R0WL 4F7MB 2IH1B 4HQQL 4WDIA 3CXHK 2R2EB 5D7LD 5GGQL 5C3LD 2NYYD 5E2TH 3P9MA 4ALAH 3DVNB 4LK4A 3UJIL 3WHXA 5D70L 4GMSH 4ODHH 1CCZA 1S78D 2CIKA 4JDTH 4NQEB 4N0UA 1LP9A 1YECH 3RNQB 1LO2L 4YWGL 3SGEI 2F53A 1KGCD 4MD5A 3UXFA 3T4AB 2VABB 1LILA 5DMGC 2YD3A 2NXZD 5BJTB 1KULA 3Q1SL 2V6HA 3S96A 4ZD3L 3GUTA 5T33L 4PBWD 4Y19D 5DRZA 5JHDE 4MD0B 4OJFH 1E6JH 5I1DA 4HF5L 1C7TA 2OZ4H 4KTDH 3HG1A 5I8KL 4X4XB 5D5ME 1U8LA 5DJAB 4OT1H 4I5BB 4JFDB 3RIAF 5FHBL 4BSJA 3V0VB 5L2KE 3LEVL 4BQBA 2M1KA 3G6DL 4MXWH 1OTUC 5EUOB 2FRGP 3X13A 3FT3A 3TNNA 2W60A 3MNWA 2HH0H 2FZ3B 3JTSB 2HFFA 5ANME 3VXRE 2IFFH 3PWLA 4HPYL 3H7BB 2VUOA 4DEPB 3ZE2E 3SDDD 2AGJL 4YEEA 2C1OA 3VXSB 2YD4A 2YPVL 4JFEB 4LF3A 4AT6B 1E0OB 1UJ3A 3T65B 4V2BA 5EBWA 5D2LA 1A0QH 3MX0A 4JN1H 3NTCL 1CFQA 4K23H 4I0PD 3VFUB 3CD4A 4XZUB 5E1HB 4TPRH 3QEGH 3H8NA 4PP1D 3MGTA 5GSRA 3VXTB 1PZ5A 4OLZL 3CGTA 1OTSC 3IFNH 1KCRL 2CGRH 1HKLH 3QEHA 1Q9LB 3R4DA 4NDMB 4OAWA 3REVB 1ZTXH 4PGDA 4RA3A 2FLRT 4TUKH 1PEZA 2Z31C 43CAA 3EZJB 3L3JB 2MNUA 5IB4B 4L3ED 1CT8B 4W6YB 1I1AB 5D1ZB 5JOPD 4P59H 3T8XB 5AZ2H 1T80A 1IT9H 4TUJB 1NGQH 1DLFL 3OXSA 5DTFB 1G7QB 2DQFB 5ID0B 1XF3A 1GPOH 3QO1A 3WSQL 1K3IA 1XF2B 2DM7A 3QQ9D 3QA3A 4F15B 2VB5A 5IMOA 1OSPH 1QBMH 2GHWB 3RIFF 2GFBA 5SV4A 3KLSA 2EDJA 4OB5H 3UTPD 4DVBA 3I3DA 2A2QT 5BRZD 2XQBH 4YFEA 2HMIC 5JW4R 2P5WA 5FOBA 3HRPA 4H20H 4Q97A 4OQ1A 4U1IA 5E6IB 2FX9L 4NNPH 4NP4H 5EOCJ 3QIWA 3CLEH 4ENED 2FL5A 4EN3D 2XKSA 1S7QA 2GSIB 5LCVL 5HYEA 2BFVL 3HR5A 2VZVA 4KGLA 4PJ9C 1KNOA 5IVZA 5IGXH 15C8H 2YEZA 3I2CL 5IIEB 3DGGA 1H3XA 5A2JH 4LPXA 1CXHA 5GHWH 5E99H 1A9BA 3O9WA 2UVFA 3W0WB 4XBGA 5EDXA 3BD3A 4KQ3H 3NCMA 2O5XL 1KIUA 1E28A 2APXA 3TZVB 1DUZA 3MLRL 4U3XA 3CIQA 2YPLA 4N90E 5TDPB 3QPXL 2W0PA 1BQHA 1WC7A 2JCCB 4ZAKD 4TNVK 4ELKA 1NBZA 1OQXA 5C09D 1QSFD 1HH9B 2Z8VC 3SDCD 3OR6B 2OZ4L 4KTDL 1UEMA 4HWNA 3RL1B 4I18C 1GCFA 3AS2A 3KPNB 2X09A 3G04B 1FLTX 2RFXA 1KJ2H 3BRFA 2JJSA 3QNXB 3VXNB 1FYTE 5GZNC 1DL7L 1IBGH 4RX4D 5C71A 2HVJB 5HYQA 2XZQH 5DJ8B 2YMXH 3WDJA 1EFXD 5J9PB 4Q6IA 3ZSSA 1CE6B 2N1KA 1AXIB 3BP7A 4YXHH 4JHZA 5LVEA 3ZHDA 2X44D 1UXWB 2HH0L 4BFBD 4Z7OF 2ZZUT 5J11C 1JRHH 1ERNA 3KXFE 1ZHBB 3IDNB 3LSOB 1U0QA 4WIQA 1KPUB 5EIVA 3EOTH 1UZ6F 2EYRB 5I0ZA 1JGVH 3Q2CA 1DUYB 1T0MA 1JWMA 3V8CA 4E42A 3NPSB 4O2EB 4PGEA 1R3KB 3MCLL 3ZKMD 3LHPL 4ELMF 3QEGL 4Z7VE 1V5JA 4YK4B 3EGSB 1QQDA 1U8PB 2R8SL 3K4ZA 4IJ3B 2X89A 4R7DB 1JZ7A 4CU8A 4NM8L 5E5RB 5C2BH 1OCWH 3I50H 4D8PA 3U4AA 3TT1L 1RSFA 4HKJB 3I75B 4TUKL 5F96H 4PS4L 2WBKA 3B9VA 4IIQA 5JQ6H 1J10A 1SMAA 2OSLB 4HEME 5JHDA 3B2UC 4P59L 1F11B 1NUNB 1RJZA 4ZO6A 3W9DA 3WNMA 5DMIL 4U2YA 1A7NL 3HMWH 5IEHB 1CBVL 1LK2B 4BZ1H 3MRPA 5DK2B 5K33A 4X5XA 1QPPA 4WHTB 2Z35A 2HT4D 5D5MA 2Z92B 1F3DJ 1YMMB 3P77A 3Q5OA 2C4FT 1WSST 5I66B 1FE8H 5L2KA 4OB5L 5IB2B 3RTQB 4BM7A 1JZ5A 2DMCA 3NVQA 4F3FA 4TSBL 3THML 2LQRA 4M7JH 4XP1L 4U1MB 1BIIB 2EH8H 2FJFB 1TENA 5F7NC 2PYED 3VXRA 3NIFF 3QQ3A 3SO3C 3Q6GH 3GSOB 5C9JB 3TO4B 5BVPL 4KKLC 1G7PA 1OWRM 1B0GB 3UJTH 3ZDZE 1EVTC 4OCMC 2VOTA 2Q6WA 5DT1H 4OF7A 2A0LD 4U7MA 4M1DH 3O11B 4IOIA 1U8QA 4LHUB 15C8L 5FYJD 1X4ZA 3R06B 1DANU 1S7SB 1FVCB 3C5ZC 4G6KL 5IMLA 1A14L 4OSUL 3QAZC 5GGUA 4MA3B 3RY6A 1INDH 5F7WC 4KQ3L 2I60L 3MBED 4Y2DB 5EIQA 1QHPA 1AQDA 4PFEA 5EORL 5ESQB 1YC8A 5TFSH 1IEBA 1IQDA 1JPFB 3MA7B 3B9EA 2A6KB 5LAXB 3GNMH 4FMKA 1W0WA 5T5FH 4ONOA 4RQQB 3O6MH 4Q9RL 1J1PH 5E8NA 3ZT6A 2CDGB 1EBPA 2X1XR 2D7OA 2Z93B 4YBQC 2I24N 4X0KA 3SCMB 5KG9A 4P46B 4LPWA 3TJEL 3MXVH 2BP3A 2DICA 1BQUA 4YDLB 4WFHD 1BFTA 1NBVH 1YUHA 2ZKHH 4AZ8A 3BGFC 4WFGD 3ARDD 2NZ9D 3JV6A 1G1YA 3AMKA 4OF3A 1S9WA 3C6LB 3IDMB 5B22A 1AGCB 2HFEA 1E4XI 1HYSD 5CSGA 5GRUL 4Z76A 1CXEA 4C54A 2CD0A 1JGVL 5AYUH 3S3SA 2VWEE 5CD5D 3JWDC 3OAUH 4L9LB 1S3KL 3B5HA 1JUFB 1EO8H 2ICWA 4OF6A 1A6VL 5JMOC 3EFDH 1HSBA 1MREH 4RWYH 2A77L 2BHZA 3AREA 3D0VA 2D0HA 3PV6B 4JQIH 3MOBL 1SY6L 1SY6A 1NANH 5H2BA 3LS4L 4ESKA 1U3HA 5DK0B 5ECJE 3ARBD 5FKPA 2H6PA 3B5GA 5I30H 1L9NA 3GSVB 3S88H 3F7RA 2BVQA 4NM4H 1WITA 4QWWC 4NQED 3X3GL 2YD2A 4KPHL 4CJ1A 5IEKA 1T21A 5A1AA 4NN6B 2G2RA 1DE4A 3QDMB 4ETQB 4L8DB 1NFDF 2J8UE 4G6JL 1J0YA 3J8F7 1A1MB 1M71B 4DAGL 5IB3B 1BJ1J 2M2DA 1J05B 4HJGA 1FO0B 4ZUWA 5SWZB 2OJZL 4MQ7B 1M6OA 3KS0J 2OTWB 3QFJB 1VEPA 2DJSA 1FYTA 1FE8L 3UBXB 4Y1AE 1A02N 4Z7NE 2ZOKB 4GRMB 2X4OA 5C70A 4EUPB 4OCLC 1KXQE 3GSUB 4M7JL 4JFDD 2CLZA 5DRWB 4B5EA 2ICCA 2EH8L 3V4UH 3GMQA 3IETA 2VE6A 5LXGH 1BM3H 1OAQL 1NMCC 1U58B 3UDWA 4UV7L 5HPOA 3QQNA 1AC0A 2XKUA 4CVZB 3U1SH 1CLYH 1QFWH 2EKJA 1DN0B 1L0YA 2MMXA 1Z3GH 1JNLL 1I4FA 3PGDA 3CFCH 3RWGA 3E6FA 2IH3B 2WW8A 4Y89A 1CD1B 1C12A 1BOGA 2XI9A 1NDGB 3VXSD 4JFED 4V2CB 4JRYE 1G9MH 4PGBA 4NWTH 4YDIH 3MOAL 2GUOA 3BWAA 5DJ0A 4X4YB 2YA2A 5CWSB 4MB4A 5FYLH 3FRPG 3QDGE 1AD9A 4KWUA 4NNXB 4M62H 3FB5A 3ZT7A 4PJ7B 4OCYL 3FN0L 3OKKA 2E6QA 5TFSL 3OKNB 2X4QA 2YPKA 1X5XA 3FB6A 1VADA 4WW2B 5HPMB 5JXED 3VE0A 2JELL 2NY2D 1J1PL 1QD0A 3RVVC 5FGSA 1ZA3A 1AH1A 2DBLL 2FSEB 5IOPA 1NBYA 4L4VB 4D9RE 5EOTB 1RHHB 3ARFC 4I3RH 2DKSA 1NGXB 1PEWA 4R9HA 2CKBH 3D85B 3MLSL 3RWHB 1N6VA 3VJ6A 3OBAA 1I1AD 4NT6A 5D1ZD 1F4WH 3EYSH 4M43H 3I3BA 2R56H 2PTTB 4U1JB 4AH2B 5HXMA 1A3RL 5FGBC 2V5YA 4UTAH 3WIFB 2YRZA 3TJHD 1UC6A 3G5XB 3REWB 5HGBA 2AXGB 1GOHA 1AY1L 5I6XB 5L2JA 5TDNA 3RVXC 1AD0A 1QFOA 1GGBH 1TJGH 1W0VB 2E7HA 3IDYC 3TA3B 1A1NB 4QHNA 5E0QA 4ZFOA 4NO3B 5A16B 3U83A 1V7NH 1XF5A 5DJDA 4U31A 4N8VB 4X7FC 1E4WH 3B9KA 5E6ID 4HS6B 5J57B 5KN5A 5JA8B 1V3JA 4JQIL 5CJXA 1G7LA 3OKOB 2NNAB 3IKCA 3NFNB 3SE3C 2C3HA 2XRAL 4OLUL 3BKYH 5DHYA 4DN3H 5KVEL 4PJDF 2YXFA 4MNQE 3OB0K 5I30L 2DLTA 4GBXA 2ZOLA 4KRPC 1QLEH 3SGDI 3W0WD 2B0SH 4P9HC 4K94H 4XNMA 3L5JA 4PV9A 4GKZA 4WHYG 5CGTA 1M05B 5D7JC 4ZS6C 5BV7H 4IDJH 1N0XL 5DJYA 4XCFH 2XFXB 3S4SB 4OZHB 3ARQA 5A2IH 3TZVD 1I8MA 1Q0XL 3LZFH 4BUGA 4M61A 4KK9C 4HH8A 3GSWA 3L6FB 5F9OL 2O61B 3MUZ1 1KCUH 5JQHC 4LLAA 3O8XB 4F8QA 1T5XA 3FRUA 1H3GA 5HYJE 1R24B 4WFFD 1CXIA 2BSTB 2PW1A 4YUEL 5BOPA 2D3VA 5I0DA 2VDPL 1RFDH 4F80A 1KLGB 4GKSB 3L5WB 1EXUB 1ZA6B 2F8VA 2C1PA 4LCCA 1XF4B 2K7QA 3VH8B 3M1BA 2R4SL 1MCEA 1JZ3A 5ILTH 2R1WB 1LEGA 3L3IA 4OGXH 3FT2A 4NWTL 5ALCL 1NAMB 2NY6C 3MLZH 3FQTA 4XB8A 1SYSA 5FCUL 2CDFB 1MJ7H 1AGEA 1ONQA 4HG4K 1FLRL 4HWBA 2EXWD 2ZSWA 3HB3D 4JLRA 5IJVA 4IOFC 3V4PH 2ORBL 1CTNA 3HFMH 1S9KC 2XYCA 3QHFL 4AEHH 3DARA 4HD9A 4LVOC 4XPAH 3D9AH 4KAQL 4NC2B 2J8UA 4G43B 1A2YA 1FJ1B 3U46B 3VGHA 5HI4D 2EIBA 2WP3T 4EI6A 2AQ1A 1DVFA 1T1WA 3MV7B 2D7QA 3WJJC 1KC5H 4NQDB 4QO1A 5F89A 3QPQD 1KB9J 1T1XA 5GRVL 3ULUE 5JDJA 4Y1AA 4EEEA 4UTAL 4K7PX 4Z5RB 4LEXL 3NCYP 2YZ1A 2UY7A 1NGYB 5C0GA 1AHWA 4FXLA 5GRJL 1HIMH 2AJYL 1D5BA 1YMMD 1UG9A 4M5ZH 2NW2A 1A3LL 1AIFA 4QRPB 3WN5A 4CMHB 5HI3C 3RTQD 2VDRH 2B2XH 3N1FC 3O6LL 4XPFH 5ICYB 5HHQA 3G08B 3QHZL 5IWLA 2AS5M 5EC1B 5GSVA 3S97C 3ULVD 3TO4D 3LKQB 4NOFA 1JF1B 4Z77B 2Q3AA 4KDWA 4JRYA 1Y6KR 1JI1A 1CTOA 2GY5A 3SGEH 1OHQA 3O3AA 4OZFB 3RUGF 5JDSB 4I48A 1S7TB 1H8SA 2J7LA 4LHUD 3DX8B 3IYLW 3JTTB 1E27B 1HILA 4HLJA 3RVUD 1ZHNA 3X11A 4L3CB 3OKYA 3QUZB 4Z6AT 1JTTA 2PO6B 4OD3H 3GMNA 2W0FB 5GGSA 4U1KA 4XI5D 4D94A 4ZPTB 5BV7L 4Y2DD 1A6AB 4WI2A 1MFNA 3VFPA 1IL1A 3QNZB 4X7SL 4J1UB 5A43C 4HBQA 4YC2B 3BSZL 4XCCH 3L1OH 4MXVF 2CMRL 2HTKC 4HC1L 2DQTH 2ZUSA 3VG0H 5IB5A 1S7RB 4JFHD 4XCYB 3QULA 4EVNB 1JK8B 3SCMD 5CGYC 4P46D 2X4SA 5L8LB 4KMQA 4HIJA 5IMMB 3HI1A 3K80A 4CVXB 2BVPA 1FZJB 2VH5L 5KVGL 1JWSB 4K8RC 3MREB 4R96B 5EBLB 3EOAA 4M7LL 3PL6C 2Q8AL 2FBJH 4UDTA 3QCTH 3C6LD 3QEQB 4OD2A 1HDMB 1CF8H 2V5SA 1C5CH 3CVIH 1H8OA 2BSRA 2VR4A 8CGTA 2DIBA 3M17B 3WFZA 1ZT7A 1KTDB 1CDBA 3W5MA 4LCIL 2V7NB 3SJVE 4N0YH 2VZ3A 4XVTH 3MLZL 3C60A 4L4JA 4NUJA 1BVKA 1QFPA 4A2MA 5ADOL 3VI3F 7CGTA 1YMHA 4GAYA 2FATH 4MNQA 4NQCE 1ACZA 3O2DL 4FZ8H 4Y16A 4U2ZA 5CZVH 2HRPH 2IALA 2BSSA 3EO9H 3HFML 4S1QH 4PRNA 3WUWA 3QDJB 4PP2A 3OQ3B 1AGDA 2XTJB 4DGYL 3D9AL 3MLTA 1R3LB 3MMEB 1LVEA 2HVKA 3PDOB 1ZLSH 4JHAL 5K9QG 3BUYB 3QCVH 3KPOB 4UDUA 2XV6B 4OLVL 5AUMB 2XWTA 1FZKB 3QDMD 1UJ3C 1ND0A 5I17A 5F21B 3SQOL 4GJTB 5LGHL 1N5YL 1MVUB 2K3TA 5F6IC 4Z7OE 5DLML 4MNHA 5I1LB 1ZMYA 2CDEB 2C7UB 2IAMB 5SWZD 3MRNA 4YBHA 3IFLL 4U05A 3OSKA 1SJEB 5HJ3A 5MEQB 3QFJD 5HYJA 1YEFH 1XIWB 1XMWA 2RQ8A 1UZ6E 1WCBA 4M9PA 2A83B 1FL5B 4LCYA 1HNFA 3GMMA 4WWKC 4MVBD 3FCTB 5BS0E 4XPFL 5C0CB 4F2MA 3F7QA 4I3SH 2B8OT 4ELME 5KS9B 1P1ZB 2E9IA 2VQ1B 1IGFH 4LVHC 2Y25A 2DQEH 4Z7QF 2NY3C 1HXYB 3WV0A 3BKCH 1G6RH 4EDXB 5EWIH 1EH9A 1GGCL 3EUUA 3NGBB 4EZMA 3QXAA 2VDLL 4MCYA 4QXTA 3IS0X 1BBJA 3MLYH 1VFUA 4IMLA 4OD3L 3C08L 3OJDA 4YHKL 4G8GB 3QXTA 4BK4A 3S6CA 3TVMA 5FYJL 3HC3L 5GGVH 5EU6B 3QIUB 1MWAB 1RURH 2OCFD 2UUDK 1Y6MR 5TE6H 4GAGL 2VXSL 3TN0A 3L1OL 4QHKJ 4DVRL 3RWDA 1GJIA 3RPIB 3Q5YA 3TFKC 2DQTL 3CUPB 5FYKD 3FOLB 3H9ZA 4HUUA 4C58B 1L0QA 4L4VD 4NKMB 2FECL 1A7OH 1KPVB 3D85D 2ATKB 4HKXA 2KQMA 2WAHA 3QUMH 2F8XC 4GSDL 3VFMB 4OCRL 2WANA 3NIFE 2X40A 1AXTH 3MYJA 3F8UB 3QISA 6FABL 5E8PB 1YEKL 3VMNA 5I19L 4CN4A 5I8CA 4LP5A 2IPKB 4WEBH 4TRPH 2DIAA 3H9SA 4D9LL 3V6BR 1LO3L 1TMCB 4H1LH 4KQ4H 3DXAE 1P9MC 4MMXC 3WLWC 5IFJB 1BAFH 4P4RB 1GZPA 3TA3D 4XVTL 2VO5A 5T3XE 2WLZA 1X44A 5ESAB 5HSFA 1LE9A 2YK1L 4FFVD 4X7TA 3P0GB 1A4KA 4M8QA 2JJSC 1T22B 4FZEH 4PRHE 3EYFA 2Z91A 3DRTA 5CS7A 2ZWLT 5GS0H 5ERWB 1H3WM 4UB0L 5FK9B 5GJSL 2HRPL 5FO8A 2VDKH 3EO9L 4Q6IC 4W4NA 5CJOL 2DB8A 2VNCA 4YIQB 3PWPB 4DW2L 1W72A 4XP4L 1R0AL 4HAFA 2OM5A 4LIQH 1I8LA 2GJZA 5TDOA 1UH3A 2R2EA 3T1WA 4JM4L 4X7EC 1X5IA 5TE7L 3QWOA 5DGQA 2OX5A 3HI5H 5IBTL 3HNTH 1SJHB 5DD0H 1VA9A 2A74A 3GBNL 3RGVA 5IV2A 3H3KA 5FO7B 1A6PA 1KJMA 4NSKA 1U91A 5DDHA 4P23B 4JM2B 3CXDL 3GEWB 4W68A 4YR6B 1G9EA 1AXSA 3EJYC 1F2QA 3FQUA 3SBWC 5EA0L 5IROA 3RBGA 1RAMA 1PJ9A 1FVDA 1LNUB 5CGMA 2XZCL 4F7CB 3O8XD 2IFGA 5D6DA 1EPFA 3L7EB 4HBCH 1ZHKB 3O45A 3FO1B 4MD0A 2O5YL 1IKNA 2GKIA 1T04B 5AG8A 4IIQC 1TQBC 1CYGA 3KYOB 1OAXH 3E2HC 4O58H 5I1JH 1UXSA 3CH1A 4RAUA 4G9DA 4WI4A 4HCRL 5F7DB 3SJVA 2DQEL 3ZMRA 4AIZB 4WY7H 2I5YL 3BKCL 3U4EB 1KCSH 2PETA 4OV5B 5EWIL 1HN1A 3L3HB 3DHMA 5HVWA 3LKNA 5CEYB 2KBGA 3JXAA 1MHPH 2P8LB 4Y5VC 1HH6B 4ZUVB 5IF0A 2JB5L 2X4UB 5DJXB 4MWFA 1FFNB 1NFDE 3G5YA 1IEAB 3CFKA 3QJFB 5FV1L 1RURL 5TE6L 2VZTA 2J12B 3H42L 2MCG1 1FGVL 4NKIH 1JN6A 3MRMB 4A6YA 3VFUA 2EDQA 4M5YL 4IHOB 1MAML 3FONB 4C83A 5DHVB 5E08L 1TTFA 4I9WE 4K9EH 4MS8D 2OK0H 4PRIE 5DD1L 4FQ2H 1ZLVH 2RCSH 1SYVB 3MV7D 1RZ7H 3RY6C 4M00A 4NQDD 2NLJA 3ZO0A 3EYVB 2IADA 1MJ8H 1JPSH 4QRQA 5BOZG 3IAPA 4QTHB 1XZ0A 2EDWA 3O3DB 5BS0A 1RD6A 4QRPD 1FZMB 4ZDHB 4ISVA 3C6SB 4X9FA 4PJHB 5ID0A 5C0IB 4AM0B 3UTSB 2AVGA 3GHBH 4WUUB 2RIKA 5GS2H 1NCNA 4K07A 1X4YA 5KSUB 1U93A 3P2TA 3BJ91 4ORGA 1BP3B 2Z8SA 4XRCB 3GI8L 5E2WH 3RU8L 2OTUB 4G7VH 5IBUB 3K4DA 2NY7L 2J4WH 3CZJA 1DBKH 5DUBA 5DS8A 5E94A 4JPIB 3Q6FA 4Z8FL 3F7YA 2Q7NA 2P48B 4S0SD 4XHQA 3ULVH 3DVGB 3PNWA 5C8JA 1GAFL 3QUZD 1OTTC 4KGJA 1CFNB 2PO6D 3HNTL 5DD0L 4JPVH 1AP2A 5CIPB 5CZXD 3PGCB 1AFVH 4LGRB 1V05A 1FVEB 1MLBA 5IIEA 3MJ7A 4MDJB 4U1HA 2AXJA 3BPNC 3QWQB 1Q9OA 1AO7E 3QFDB 5FECA 3BIKB 4FXGB 4X8JA 4CMMA 4YPJA 1IAOB 1BZ7B 1T20B 3ILPB 1IM9A 1U3HC 3S5LG 5GXBB 2QHRL 4FFYL 4I4WB 1YN6B 4HUMB 5A3ID 3MV9B 3LH2L 2ZJSL 2OXHA 2V7HB 5I1CL 5TF1L 1BLNB 3IT8D 4PJ9B 4XB7A 4PJIF 3OR6A 4PBXA 2ITCB 3FB8B 2V2WA 4X5WA 2JJWA 1AQKL 1MFDL 3GRWH 3LB6D 3MFGB 5GPRA 4OZIB 3QNXA 5HHPB 3QEQD 4PJDE 5F93C 1KCSL 3HNSH 2JE8A 2HVJA 2R0LH 3C2AL 2P7TA 2EZ0C 4RCAA 1VGEH 5CJ5A 4UUJB 2PCPA 4C57C 1LHZA 2EEDA 4PRHA 4J3OC 2ZG1A 3SDXB 1EAPB 4PREB 2E7LA 4UU9A 4U6XB 2DM4A 3PWNB 4KRLB 2XA8L 3IDJA 4P5TB 1B88A 3IDNA 4OLWH 4TUOA 3RWEB 1C5DB 4I18B 4X6BA 2MQCA 1JGLH 3KPLB 5JORA 3SKJH 2FO4B 3VXPA 3QDJD 2XTJD 4HWZB 1NC2B 5DQDH 5CD3A 4MHHI 3RZCB 3DURA 1RZIA 5DK3A 5T5NF 3ROLA 5K93A 3TYGH 2JB6A 4FQ2L 5J11B 5IW1B 4U49A 2V5MA 2LV4A 1EGJH 2F19H 1RZ7L 1YJDC 2OI9C 3SQBA 2Z4QA 3QEUB 3V2AR 5F7UA 3QDAA 3PABA 4NRXA 4UILH 4HKJA 1S7WA 2IQ9L 1JHTB 3ES6B 2OLDA 3V6ZA 2DRUA 5TE4L 2DD8H 1DQLL 2IAMD 3ARGA 1XR9B 1C1EH 4WW1B 3R0MA 4WI8A 5FM5M 5T1MB 4V1DB 4KKCD 1XIWD 3LEXB 1EMTL 4JZJB 1CGYA 5EUOF 1K4CB 1FO0H 2P4AB 4NO2A 4P2QE 1C08B 4WHTA 3LS5H 2OBGA 1QSZA 4P2CG 1C16B 5EZIH 1AGBA 1HHHA 1AR2A 2JK5B 5C0CD 4KZEH 1FRGH 4QT5A 4PJFB 1IVLA 5E2WL 1QLFA 2GY7B 1KG0B 4POUB 3SGDH 2J4WL 3ZZ1A 1DBKL 5EOCH 1RIHL 2YBRB 5T5NG 4YPGA 5C0AB 3ULVL 4TNWK 3VDBA 4FS0A 1I9IL 3VD3A 5L8JB 1I8KB 5B3JF 2V9QA 2A9NL 4G8GD 1CLZH 1KSRA 5EZOH 2Y7QB 1VGKA 1X5HA 4BH8B 4PRPB 3HZVA 4LKXB 5EU6D 3VRLF 3QIUD 3B9KC 4KKAC 1EHLH 3MXWL 3QNYB 5CJXC 1PY9A 4LHQB 4NQXA 4PRIA 3HPJB 3KYMB 1UWXH 3EO1A 4NO0A 3SO3B 3WNNA 1FL3B 4NHUA 1JPFA 4LSPL 4GS7C 4R2GC 1QRNB 4GBXC 1OT1A 4X6DB 4RQQA 1VHPA 1N8ZA 3IFOB 4ONGH 1U41A 5FYKH 4HKZA 2IBGA 4L4TD 2CLVB 3MRCB 3IXTA 4RGND 5LGKA 3BPCA 4FHBD 2CRMA 4QHKI 3GRWL 2XICA 1RK1A 2VJXA 3RHWF 4OKVB 4JJ5A 1KYOJ 3RUGE 2R0LL 4FQIL 3FMGL 1VGEL 5DEGB 4JDVA 5JW4N 2G60H 4G8IA 1T03H 1WWAX 5IHUH 1P4LA 2NXZC 1BD2B 2BJML 3C6LA 3F58L 2G75B 3E8UH 1AGFB 1NLBH 2PF6A 4RISH 1EJ6A 2QV2A 4GLRI 3MRKA 4PY8J 4AENB 1FC2D 1EEZA 1JNHA 2FX8H 2EDRA 5E2VL 4H1LG 1U8JB 3PWPD 1Z5LB 3IF1A 4MXVE 4H5SB 3KHOA 4FXKA 4HH9A 4Y8AA 4XP5H 1EZVY 4LCCC 1FBIH 4H8WL 5L7XH 3BH9A 3TYGL 4KY1L 3GGWA 1I7ZB 3P4NA 2HG5A 1ZHLA 3B2VH 1AO7A 5MP6H 2N56A 4R0LA 4QRRE 4OTXH 3FO2A 5I1HH 3K8LA 4NWUH 3R1GH 5CEXB 2DM2A 4P23D 4JM2D 3IVKA 2YWZA 5GS3A 2VXQH 5B38B 1WBYB 2H2PD 3TESA 4XWOC 1MY7A 2XN9E 4YHNA 5FXCH 3KLHC 1UB6B 1WBZB 1JYVA 4M7LT 1I7UA 1MJUH 3PIQB 2NY5C 4PP1C 5EZIL 1D6VL 3VI3E 1J8HB 3IU3A 1RIVH 5ACMA 1FFOA 1TVBB 2GAZB 4PJDA 4E9LA 2AK1H 1FC1A 1JWUA 1INEH 3O0RH 3NZHH 4EUPA 4MCZA 3P4OB 4F37K 4DKFH 1FH5H 5A40E 1MPAH 2F54E 4NYLB 4JDZB 1VFBA 4BH7B 1KJ2A 2I07B 5E8OB 4P9MH 4NZRH 4KJWC 2ADJB 3P0VH 4QY8B 1XGRA 4U1SB 2W9DH 5DQ9A 2A6IB 3CVHB 4GG6F 3DETC 5CMAA 2EE3A 3RY4A 1MELA 3RP1A 2XA3A 1CFVH 1CLZL 5EZOL 5FAAA 1MFEH 2EH7L 3TCLB 1PYWA 1HHJA 4LP4A 3L3DB 2H3NB 4NGHL 3O81A 3T08A 5IWLC 3WFDH 2QBWA 3MRHA 5GRWA 1KFAL 3O2VH 1QFUH 1VDGA 4OCSH 1XH3B 2P24B 4LPVA 5C07A 1NMCB 1BEYH 4ZFFB 3HNVH 1OTUD 4HMCA 3BMWA 3OKNA 5JW3H 4RMTA 5EZLA 4CN6A 3L3GB 4GG8A 2N4IA 1U3YA 2R4RH 4ENEC 3S37X 1A6TA 3V5KA 4POYA 3OJ2C 3DTXA 1PD6A 1Y0LB 4F7PB 5DEFA 5FYLE 2ESVB 2APVA 4R4BB 3BMVA 4U6VH 2PN5A 4DKAA 4Z7QE 5FGCE 2QR0A 1HZHL 4P2QA 4U1NB 3VD7A 4HULB 1U42A 2YOCA 4YGVB 4LASH 5D6CB 5J8OA 3GSNA 2BVYA 2BOBB 4Q9QL 5GISL 2H8PA 3VGBA 5DQJB 3I02A 3ULVF 3UTSD 2VLJB 2BMKB 3E8UL 5CSZB 4LSVH 3MLWL 2YSSB 3BEVA 2VMFA 4NJ9H 2EKSB 1R3IH 2AKRB 1MSPA 1A1NA 2E8YA 3ARFB 3BHBB 3RVTC 3FQXB 5GGTH 3WFBH 5ISZB 3MV8B 4U1LB 1LDPH 2UYLA 4QRSB 1VPOL 5JOPE 1Q94A 4PV8B 4PRAA 3H3BC 4XXCC 4JZOA 1K8IB 3WKNA 3LPWA 4H0HB 1IKFH 2GJJA 4QXWA 4M6MH 4MJ6B 4OZFH 5EIIA 4OTXL 1BMGA 1HHKB 4XGZA 1F58L 3C60C 5I1HL 5JZ7C 5IVXB 3ZYZA 3IDYB 4IOSD 3OF6D 3U36B 2X4RB 3MRLB 4YXLH 2BDNL 4KKBC 1CDHA 2HMID 4Y16C 3DO3A 2R2CA 3NACH 3DUUB 4MNGB 5T1LA 2YXMA 4R4FL 4HHAA 2A1WH 5FUOH 3QI9A 1KJ3H 1S5IH 4OZHA 5IQ7L 2FEEL 3MV9D 3O4OC 3ZKMC 5CJBA 3RGHA 3DX9A 2AJUL 3VFVB 3F5WA 1P7KB 4PJ9D 4XPBH 3RUGA 4IMKA 3GIVB 1LO5B 1R3HB 2JF1A 4YBLC 5JUEL 5MHSE 4CU6A 5DJCA 1X5ZA 4TVPE 5EULV 2XWBB 5CINH 5DUPL 5DI8A 5D7SL 5I2IA 1FIGL 2DQUH 1RI8A 2IANB 2XWJB 3L95B 2W9DL 2YKLH 3AS0A 2IWGA 1B0WA 4P2YA 5B8CA 2DTMH 4K2UH 4X99A 1CFVL 1VFOA 3BIAX 2HT4C 3UTTB 4M93B 1EA9C 4P5TD 3BQUA 1U95B 2IJ0C 1IFHL 4NNYB 3BW9A 3MR9A 2ARJQ 4GUPA 4X8XA 4LPUA 4DZBA 2ZCLH 1IM3B 4HEPG 2J3SA 5CEZD 3HE6A 4RDQF 1NAML 1ZVSA 2QHLA 5GZND 2YN3A 1MEXH 4OCSL 4ZXBA 1BVLB 3MO1A 4O4YL 2EYTA 2CDFA 1NC2D 4PRBA 1LEKB 3CCHB 4P3WA 1A1OB 3HZYB 3PQYE 5C0DA 1UYWH 4LU5L 3GMRB 4HW6A 2P5EE 3IRPX 1EUUA 5I75C 4WU5B 3A0OA 4MJIE 1A7BA 5TJWK 5C0EB 4ZPVB 3P9LB 4YDJB 1JI2A 1KB9K 2XN9A 5C86A 1GYAA 3TVMC 3IJHB 4U6VL 1WWWX 3DBXB 1HQRB 5J0BA 1ZANL 1DLHB 2R0KH 3D25B 3G9VA 1ROWA 1DN2A 1PLGL 1LO4H 3BZFB 4ZMAT 2FGWH 3TN0C 3M8OH 4S1SH 4V1DD 3SKOA 3MCKA 4GQ9L 5T3ZD 5FF6A 4OLXL 4MA1C 2FJHB 3OHXA 4X6CF 1NGWB 4LVOB 1CK0H 4NJ9L 5C0BD 3ULUC 1IGCL 3KJ6L 2F54A 1GL4B 3DX6A 4RDQG 5HHNB 3I6KB 3MJGX 5JLZA 4GO6B 2WBJA 5ID1A 1F4XH 1F5WA 3B2UD 1KENH 5HY9A 4PJEB 5IB1A 4U3CA 4L5FH 4UOJA 4LLYB 5C0AD 1B3JA 1IAIL 3DV4A 1SJVA 1RJLB 4Z77A 3GSQB 1GC1L 1JFQL 3ARDC 2NZ9C 1RMFH 4WW2F 2W9EH 4XVUD 4Y4HA 1BX2A 2X41A 4KK6C 3OKLA 1MIEH 1MNUL 1FN4A 3PJSB 4M7KL 3FN9A 1OAYL 1HYSC 4PRPD 3TBYA 2C3GA 1YEDB 4NQUA 3CFEA 5SX4H 5DMKA 3QRGL 5CD5C 3OPZH 5CP3A 4FN0A 5FUOL 1IZKA 1KJ3L 4HLZG 1S5IL 3QUXA 4N0CC 5JIIA 3RAJH 2EDXA 4GKNB 4KKLD 4OCXH 5ICZA 4RA0C 1A6UL 1I8LC 2B1AL 3GB7B 3W9EB 1ZV5A 2YRLA 3HTLX 3G5ZA 3L3KB 3GSRA 5A2LH 2BVOB 3VXMB 1P4IH 3RGVC 5EH1A 1MI5B 3VFRB 2EIEA 4XVJL 4UQ2B 5C6WH 1RUQL 1QKZH 1EERB 2Z8RA 4TTDD 2CKBA 3GBMH 5IROC 3AVEA 1XR8B 1N6QH 4PJXF 1BGXL 1UM5H 1BD2D 3U2SA 5CSBA 1OP5H 1ZEAH 4WDIB 4K2UL 1KXVC 5DJ6A 3ALXA 3LQAL 5JW4M 3P9MB 3UTQA 3HMXL 3ULSB 1IKNC 3EJZC 4S2SA 4LNRB 4YBQD