3C6SB

Crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
209
Chain Sequence
EVKVEESGGGLVQPGGSMKISCVVSGLTFSNYWMSWVRQSPEKGLEWVAEIRLKSDNYATYYAESVKGKFTISRDDSKSRLYLQMNNLRTEDTGIYYCFLPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 49
structure length 209
sequence length 215
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sB01
2DLGA 5E2UH 4RNRA 4XCNA 3BO8B 4JFYB 1T6VN 4OB5H 3MLXL 4FTVA 5E24E 1J8KA 3UTZB 1E4WH 1B9ZA 1F3DH 1U95A 1NGWA 4LL9A 1J1XH 3ZDYF 3ARDB 4LVEA 3RWEB 4A2MA 2YN3A 4ZS7H 2YRZA 3HN3A 1SJVA 4OZIF 5IT2H 3MRIB 1QRNE 2GJ6E 1BQSA 3L7EB 1IZJA 3AXLB 4OBSA 5HYJE 3V7AG 3M8OH 1RJLB 1G9NL 1SBBA 1QSFD 4KVNL 3ZKSD 2W07A 3B3IB 5J1AA 1X5IA 4EJ1C 2XIDA 5DQDL 2H3NA 4GRWB 4L9DA 5JIHA 4PJCF 5EORH 1FFRA 1WIOA 4BSVA 2EE6A 3QUKB 1X5ZA 4LSPH 4AIZB 2AQ2A 3L5XH 4HXBL 4XXDB 1ZWIA 2OR9L 5FYKL 3QCTL 5DYOA 3ARGC 2MCG1 4GQ9H 1TZGH 3QPXH 3LD8C 4RNRB 4XCNB 4QRUA 4YXLH 4WNQA 5DC4B 1AC0A 4FTVB 2AXFB 1KT2A 4QRPD 4OFVA 3WXVH 1NGWB 1AH1A 3ZT5A 3DARA 2XQBL 1N2RA 4RRPG 2A6DA 4PB9H 1ZTXL 3MOBH 1DSFL 1I8KA 5ICYA 5I1HH 2XTJD 2XTJC 4LVOB 5E1AA 3MO1A 3V4UH 3EGSA 3RIFK 5KSBF 3ZT6A 3QDJE 4Z0BL 4TSAH 1CF8L 4NP4L 1MFAL 4YXHH 3QR2A 4ZODA 4RGOH 3RVXD 4PG2A 5J1AB 2XZCL 1FGNH 5EBLA 3RVXC 2H3NB 2Y06H 5I15H 2CRYA 3EYUL 3SGKA 4BSVB 3MJ7A 3WDJA 4I1NB 3IXTB 5I1IL 3WN5A 5IHUL 3TVMD 1ADQH 2KQNA 1ZWIB 2NZ9C 3EOAA 4Y16A 3TVMC 1OT2A 4Z77A 3BH9A 2ZUQB 5DYOB 4R0LC 1CDYA 1G6VK 3NIGE 5IEKA 1QP1A 3EJYD 5DJ2B 2B1HL 1DLFL 3SDYH 3EJYC 3O2DA 2EDQA 5FA3A 5DRWA 5IMMA 1N2RB 2EO9A 3LKQA 1F45A 2A6DB 3S9DB 1I8KB 5ICYB 2PYED 4FG6D 4JPIA 4LSSH 5D2NA 4FG6C 3MRJA 4P3CL 4Z7NE 1KEML 5DUPL 3CC5A 5E1AB 1LDPH 3MO1B 3VRIA 3EGSB 5CMAA 5GGTA 1JGLH 2HKFL 1PX3A 2MSPA 2R9HD 3C6LD 1MFEL 2R9HC 1EUUA 4OGYL 2P42B 3C6LC 2VXVL 1OSZA 1GVIA 5C09E 2VXSH 2K7PA 5EBLB 4BK4A 1QBML 4Q7DA 2HLAA 1F58L 4WFGE 1BFTA 2JE8A 1T80A 3MJ7B 1NCNA 5F88A 4M7LH 3WN5B 1P1ZA 3EOAB 4Y16B 3MLZH 5C0ND 2VDKH 4MJ4A 4ORZC 4K23L 3INUH 5D7LB 4Z77B 5C0NC 3GMLA 3BH9B 1UJ3C 1NFDF 2FYYA 5EOTA 4E41E 2X7LB 3HI1A 4KTDL 5BOPA 3CMGA 3VE0A 5IEKB 5ALBL 1FNFA 1ETZA 3FN3A 3QIUA 1ED3A 1G7IA 5IMMB 5FA3B 5DRWB 3LSOA 1F3RB 5E2TL 4XAKE 3LKQB 1BQHA 2IGFH 4MX7A 2RJMA 1YEKL 3BGFB 4Y5XC 4DVRL 2APVA 3DUSA 3MRRA 1I1AD 2GJJA 5D2NB 4IOFD 3MRJB 1EO8H 3CC5B 1XF4A 3VRIB 5INDA 1I1AC 1KENH 1T7ZA 5CMAB 4IOFC 4Y8DC 2VXQL 4K94H 3VFTB 3CJJA 1UKQA 1OSZB 4M7LT 4AM0A 5AG9A 5IWLC 5DMKB 2HLAB 5DZOA 1XFPA 4LRNH 2XY2A 3ILPA 3QFDA 5F88B 2J88H 5DK2B 3BYTA 1P1ZB 1ADQA 1MCPL 1JHKH 5D5MA 4PJEE 4OJFH 5BW7C 1UWGH 2FYYB 5EOTB 1HIMH 3HI1B 3VE0B 5DHXB 2EXWD 2MQ3A 3WXWL 3U30B 3QIUB 1ED3B 1G7IB 4KJWD 2EXWC 4FQCH 3OKEB 1PX4A 3LSOB 4LQFH 5CSZA 2R4RL 1BQHB 2IC2A 1NCBH 4MX7B 5IESL 4HGMA 3OAZH 3VG0L 3DUSB 3MRRB 3BD5A 1P6AB 1G9EA 1XF4B 3WUWA 3MCLL 5INDB 4UT6L 2WQ8A 3RZCD 1FO0H 1F4YH 1NCDH 3FO1A 3CU7A 4XPBL 3RZCC 4XB7A 1MQKH 3I85A 3VXNA 1BF8A 5F7HA 3CFBA 2OJZL 4NHCL 4WV1A 2GITA 2E7LA 4AM0B 1F4XL 3BKCL 5GIRA 1RZ7H 5TQ2H 4LGPB 1T5WA 4TTDD 4UT7H 3TCXA 5K9OA 3ILPB 4Z7UF 3QFDB 2Q7YA 1YPZE 4OCNC 4TTDC 4P3DB 5D5MB 3QCVL 5CEZL 1S3KH 5I6XB 5EUOF 1U6AL 3KPSE 3TESA 3BYYA 1TQBB 1TETL 3U7YH 3BP6A 1KTDB 1RAMA 1A7NL 4NOBA 1MOEA 4OCWL 9CGTA 2AXGA 3PIQB 3QCUH 2ZUVA 1OB1A 2FX7H 5CSZB 1QHPA 4PV8A 3EJJX 4MSWA 3DO3A 3MV9B 1H8SA 2I9LA 4OFPA 1EHAA 2JJVA 2Z8VC 3BIAX 1BWMA 1ZGLP 1WLHA 2C1PA 3S37X 3TH3T 5KS9B 4MQSB 3WUWB 4ELME 5JOEA 5LJYH 2NR6D 4PRNA 1HXYA 2ORBL 2IG2L 2NR6C 3FO1B 2AEWA 2EH8H 5KTEL 4M1DH 3TF7C 5T3XH 4FXGA 3VXNB 5DWUH 5ID0A 3CFBB 4WV1B 2GITB 5GIRB 4Z6AT 4KMTH 4HK3J 1J12A 1T5WB 4OZHA 5K9OB 2X4PA 1MCCA 5DGRA 3LKNA 3U4EA 2Q7YB 3RVVD 5KSVA 4M43H 1MF2H 3B9VA 3JTTA 4MJIB 4XH2A 1QR1A 2OMBA 2AEPL 3HFML 4PJ8A 3BP6B 4ZFOB 2ZPKH 4XMKH 3OG6B 1G0YR 2ZCHH 3SE4C 4WTZG 2DS4A 1Q0YH 4H1LG 5J6HA 5T1KD 1OB1B 1IC1A 2ESVD 3UO1L 4D3CH 4PV8B 4OFYA 1NAMH 4MSWB 5TE6L 3PV6A 3VFUA 2I9LB 1ORSB 1Z9OA 4WEMB 4D0DA 2JB6A 1WZMA 4XCCH 5ESAA 3O0RL 3HNVL 2C1PB 4U1SA 2IEPA 3MLXH 2HKHL 4JFDA 4PRNB 1HXYB 4MWFA 4GSDL 2J5LC 4OIIL 3QXWA 1SEBA 4OIBA 4FXGB 3NCBB 4U1IA 1EMTL 2CMRL 5ID0B 2B1AH 4OCXL 5C0BD 3P3YA 4Y4FD 4RMQA 4Y4FC 2PF6A 3N1QC 5FM5M 4OZHB 5I71B 5SWZB 3LKNB 1D9KA 1HZHL 2CDEA 1RV6X 5I8CA 4QHUA 4PB0L 4KVNH 1JPSH 4PJAE 4N0FB 3IDYC 3JTTB 4XH2B 3T0ED 3VD5A 1QR1B 3WS6A 1T2XA 5DQDH 3L5JA 1P9MA 4PJ8B 3T0EC 4YHKL 3B2VL 3PDGA 5TFSL 5J6HB 3V7AE 2NXZB 1WWAX 3P9WB 3VFUB 3PV6B 3O8XD 5FYKH 3QCTH 1S7VB 1ZEAL 3O8XC 4D0DB 1CFSB 3MLSH 2JB6B 3LCYA 5ESAB 5JHLL 1QBBA 4U1SB 3ULUE 4ODXA 5HYFA 2Z35A 4JFDB 4MWFB 2DM4A 2AK4E 4X4MA 4GAFB 2XQBH 3LPWA 1BVZA 1P7QA 3HNSL 3IRZA 3NGBC 1SEBB 4O02L 1EEQA 3HI6L 1ZTXH 1DSFH 5J12C 1SEQL 2R2HA 3E8UL 3T77A 4KHTH 2VNCA 1JPST 1FAIL 2BVYA 5F8RC 1D9KB 4XWGH 4Z0BH 2CDEB 4KWUA 2WMPA 3RWGA 5I8CB 4QHUB 1CF8H 4NP4H 1MFAH 3TN0D 1BLNA 3DX8A 4RISL 3SEPA 3TWCH 4KKLD 3PP3H 3TN0C 1GGTA 4UDUA 4HS8L 4KKLC 5MEOB 5BVJA 2OLDA 3SGDI 3EYUH 2C3XA 4IDJH 4W6XB 5I1IH 5E9DD 4EN3D 3MFFA 1MFDH 1UZ6E 4RGMB 5CEYA 1NAMA 4EN3C 1PGRB 4QWWD 4CRPA 1NBZA 3V79C 4HFWA 1HQ4A 2EDKA 4LCYA 4QWWC 3RWJA 5EO9A 5C71A 3WO4C 3F7RA 4V2BA 1SQ2N 4MJ6B 4LKCA 3U46B 1F13A 4ODXB 1W72L 2Z35B 5C07A 5A16A 4YBQD 2B1HH 4NM8H 1P84J 5GRJH 2WIMA 1P7QB 1CGTA 3LEXA 4DKAA 1P7KA 4UU9B 4PR5A 1JYVA 4P9MH 4CN6A 4I18B 4D0CA 4HV8A 4XNYH 4TSBL 3RTQD 4LLVA 4M9OA 2R2HB 5L6YH 5FYLE 3D48R 3T77B 3RTQC 1A47A 1HSAA 1TZIB 2F54B 2LU7A 4U6XA 5DUPH 2L0DA 1DN0A 2HKFH 3FT3A 1OF2A 3RWGB 5F7UA 1MFEH 5DFTA 5L2KD 4OGYH 4XNQA 4XBGA 3H2WA 4PRIE 1BLNB 2VXVH 3DX8B 5CGYD 2FEEI 1QBMH 4UDUB 5CGYC 5HHNA 4DAGL 4QNPE 4X0KA 1F58H 5BVJB 4I48A 2DQDH 12E8L 2EEAA 2BOBA 3FQTA 4JRYD 1T83C 3MFFB 2JTDA 4UB0H 5CEYB 1NAMB 1NBZB 4K23H 5DJAA 3QUYD 5HYEA 4HFWB 1HQ4B 3P4LA 4LCYB 5D8JH 5FK9A 3RWJB 2CUHA 3QUYC 5IB3A 1NQBA 4HG4K 1HINH 4LKCB 2FECL 5ALBH 3GKZA 5C07B 1F3JA 4L8SA 5A16B 4Y88A 5I0ZA 1HKLL 3LEXB 5E2TH 4NWTL 1P7KB 5CJOL 2UVEA 3OJVC 4PR5B 4C56A 4D0CB 4HV8B 5JA8B 4LLVB 4NC1E 5KW9L 4DVRH 5L9DL 1RJYA 2AV1A 1JTPA 5FYJE 1HSAB 1LO3L 4EOWL 4JM2D 4U6XB 2Q8AH 4RWYH 2Q8BL 2VXQH 1DN0B 2ICCA 4JM2C 3FT3B 1OF2B 4XPTL 4NZUH 1OP9A 3QDME 2DQGH 4XNQB 1IC4H 4XBGB 4IIQA 2Q76B 2OBGA 2H45A 5HHNB 1A0QL 4F7MA 2XOTA 4X0KB 1BJ1J 4RMVA 1CU4H 4XCEB 2OTWA 1JZ7A 3G9VA 3BE1H 4P2RB 2BOBB 3FQTB 2NTFB 1MCPH 5FGCB 3WSQH 4S1SL 3U9PH 3I6LE 2VWEE 3OQ3B 5JQHC 5HYJD 3UJIH 5DJAB 4MDJA 3VRJB 4LSTH 3UP1A 5FK9B 5AUMA 3O9WA 3VD3A 4WIQA 4YHML 4X6EA 5IB3B 4OCYH 1F3JB 3VFGH 4L8SB 1KLUA 4OM0H 2W0KA 2E7BA 5CKAA 1NH6A 4ENED 4B50A 1OAYH 1TDQA 1NBYA 1G6RH 3DMMD 4C56B 4ENEC 3PQYE 1HN1A 3RNQA 1TVDA 1CD9B 3DMMC 5C0RL 1RJYB 2AV1B 3JVGC 1FVCA 2EIBA 1EFQA 2Z9TA 1PZUB 4PJCA 4PJ9A 3TO2A 4UT6H 4W68A 4XNZC 3SGDH 1WV7T 1A6ZA 2BY1A 2WSKA 2N56A 4XPBH 5JHDD 1PSKL 4HPOL 4IIQB 4Z7QF 2AK1L 5IFJA 1K5NA 2PN5A 2OJZH 4NHCH 3ZDYE 2XZQL 1I8IA 1F4XH 3BKCH 3GK8L 4F7MB 5IJKA 3OJ2C 1T7VA 3VXUD 4K3JL 3DVNA 2Y36H 1T89A 4OTXH 5MI0B 8FABA 4HS6A 3QCVH 5GS3A 1U6AH 4MDJB 1Z9SA 5AUMB 3O9WB 1TETH 5DD5L 1X5XA 1MSPA 4U6TA 3S36L 2A2QT 2B2XL 2UZIL 2CKBL 3SDCA 3UYOD 5KANG 1FZJA 1K8DA 3UZEA 3D3VD 3S35X 1Q9WA 3I3BA 1KLUB 4NJ9L 3AM8A 5KSBA 3U7AA 4CMMA 1HDMA 1ITCA 3N50A 3TBVA 1PG7W 1I8LC 1NBYB 5J13C 2DOCA 1T0MA 3I6GA 1FVCB 4HS3A 4HUVA 4FABL 4PJCB 4PJ9B 3TO2B 2MQ0A 2ORBH 4ZOBA 1A6ZB 2IG2H 1NMAL 3UDWA 4U6VL 1RK1A 4YFDB 5HXMA 2YKLL 3VH8A 1G7JB 2WBKA 3P77A 3VCLA 4JR9L 1I8MA 3E0GA 3IJYA 1K5NB 1NEZA 3ROLA 3OAZK 1I8IB 3RY6C 4ALAL 3K4DA 3B5HA 1A9EA 1UT9A 3DVNB 4NKDA 4IS6A 5BRZE 4FQXD 4XTRD 1DEEA 3ZMRA 1E0OB 4FQXC 2A0LD 4XTRC 2X70B 4G9FE 4HS6B 8FABB 4HIJA 4NCDA 4ZO7A 2A0LC 4MHHG 3LKOA 4GJTB 3SGKC 4X7FC 1AXTL 5DA4A 5HD8C 1Z6JT 3LQAC 3SDCB 5C09D 5JXED 5C6TL 1K8DB 4PRBA 5EH1A 3MNVA 3R8QA 1RMFH 1WFNA 1Q9WB 1QSEE 4XBEL 1IQWL 5JXEC 1JF1A 4OT1L 3MUHL 4WGVB 5KSBB 4CMMB 1HDMB 5TE6H 3ESUF 3TBVB 4KK9D 3G5XA 2H1PH 4PJIF 3QZWA 1T0MB 3I6GB 4J4PD 4HS3B 4U1HA 4N90E 4HUVB 3NIDF 1QFWL 4J4PC 5B3JF 2DI8A 4GSDH 3LV3A 5EULV 4PRAA 1RK1B 1CICD 3VH8B 3P77B 3VCLB 2FBJL 1EMTH 1TTFA 1I8MB 3IJYB 1CICC 1NEZB 1NANI 3ROLB 4OCXH 3QWRA 1IGYB 1NFDA 1A9EB 2ITDB 3FHQA 5C0CA 4NKDB 4IS6B 4LDOB 4HW6A 1BPVA 1DEEB 1I1RA 4WI8A 4N8VG 1HZHH 4PBWD 4GUPA 4HIJB 3LKOB 5FUZL 4KTEH 3GHBL 5JMOC 2NY4B 4I9WE 3BJ91 2DQTH 4YHKH 4PRBB 4HUMB 3MNVB 5TFSH 1JF1B 1QKZL 4NOFA 4ZAKA 3IDGA 4X6FB 4NRZA 5KAQG 4I77L 3QXUA 1BD2A 4XP1L 1F4HA 4GFTB 3G5XB 4YPGA 3TBTA 3QZWB 5JHLH 4U1HB 4X6CF 4I0PD 4KK6D 4NZDA 4I0PC 5D1XD 3LV3B 4KK6C 4PRAB 5D1XC 3HI6H 3U9UA 1U8MA 3LMJH 2ADGA 4HSQA 4PBVC 1NMBH 3KJ6L 4ODUA 2G75A 4FQHA 1PKQE 2EDLA 4P0DA 3BPLB 5C0CB 1FAIH 2OL3L 4ZNEE 1IEAA 4M3KB 1XGPA 3QQ3A 4GUPB 4KMQA 2QBWA 1OM3H 1MHPL 3KYKH 4OSUH 4Q58C 4DN4L 3S6CA 2WBJA 5ESVA 1JTTA 3IDXH 3CK0L 2CO6B 2X1QA 2MTPA 2R0WL 4MA8H 4H8WL 2VJXA 3QNYA 1XCTA 1P4IL 2EXYD 1I9RH 4C4KT 4RMWA 2EXYC 4ZAKB 1MCNA 3IDGB 4NRZB 3X13A 3U6RA 2DYPD 3DNKA 4QGYA 1BD2B 4YPGB 2JLLA 5F21B 3TBTB 3KPSD 3TIEA 4LOUD 1W72H 1KGCE 7CGTA 5HBBA 3ZYZA 1KIQA 1KIPA 4LOUC 4Z7UA 5T5FL 3K81A 4MQTB 1H3PL 2KH2B 5DK0A 3U9UB 5ITBH 3EW3B 2ADGB 4FQPA 4ODUB 4TSBH 5CJQL 4FQHB 1P4BL 4R97C 5IVXA 1KV3A 1KIRA 1DQQA 1KG0A 4HWUA 1IEAB 4ODTL 4AZ8A 1XGPB 3QQ3B 5B38G 1TLKA 1NUGA 3BKYL 2R8SL 1E4KC 1J0YA 2WBJB 5ESVB 2HRPL 5HDBF 2XWJA 2OS7A 3QNYB 4LARL 4AK1A 1XCTB 4WFHD 1JZ5A 2MQCA 3O4OC 3STZA 5DQJA 1XH3A 3X13B 3U6RB 3TT3H 5JMRA 3MJGX 5B3NA 1CDIA 3TBSA 3ULUL 2IANE 1FYTE 3DXAD 5EPMB 3TIEB 1B2WH 1OPGL 1G7HA 1BP3B 1KIQB 1AGFA 1KIPB 4Z7UB 3V8OA 1B0WA 4QKXB 1HKLH 4X6BB 1PQZA 5CJOH 3RDTD 3MUY1 2H6PB 3MNWA 1JZ2A 4GMSH 1MAMH 3DYMA 3GEWB 3RDTC 3QXVA 4OIAA 5KW9H 4NN6B 3L3DA 5IVXB 1FRGL 3E6FA 4U3XA 1KIRB 1DQQB 1KG0B 2WANA 2Q8BH 1ZGLB 5IBTL 1H5BB 3NTCH 1QD0A 3FQUA 1INEL 3QP3A 1PEZA 4MNGE 5F1IA 2BNUA 4XC1L 4PFEA 4CNIA 5D7SL 4NGHL 3F5WA 4L8BA 2XWJB 1U3ZA 1A22B 1A7QL 3T2QA 5GS1A 3RFZC 3UTOA 4GG8A 3WHXA 3STZB 2O61B 5DQJB 1XH3B 5D1QD 1V8HA 5E8NA 5D1QC 1MH5A 4U31A 3OKYA 4MAUH 2OXHA 3TBSB 1I4FA 3MRKA 2FL5A 5C0IA 3T0BA 1W72A 1JGDA 2DLFL 3HG1E 4I13B 3SDAA 4ZNCD 1EJOL 1D5MB 4P2QA 3V6BR 4L9LA 1PQZB 3HC0A 3MNWB 1LHZA 1JCKA 5C0RH 1CE1L 1QRNA 2GJ6A 3E6FB 5E2VL 1F8TH 3STLA 3OZ9L 4JHWH 1RURL 5C6WH 1UWEL 3F7VA 3UTPD 4R9HA 3FQUB 3D9AL 2J8HA 4WI4A 1T03H 3PGFL 4YGVA 1ONQA 2AK4D 5F1IB 1H8OA 1N59A 4HPOH 4F3FA 2AK1H 2BNUB 4ORGA 1AD0A 4HF5L 4CNIB 3F5WB 4YXKL 5HVHB 4L8BB 2CRZA 4TUJA 5JNYA 3GSVA 4K3JH 1OAKH 4PYHA 5GXBB 5GS1B 1UCTA 4GG8B 3WHXB 3QUZA 3H9SE 3WKNA 3VDAA 3O41A 4OUUA 3STBA 3O2WL 2A83A 2PYFA 5E8NB 1MH5B 1LQSR 4HKJA 4LSRL 1I4FB 3MRKB 3S36H 4YHOH 3OXSA 2B2XH 4U3HA 1BBJA 2UZIH 4M5ZL 5C0IB 1IC5L 1HHHB 1W72B 1JGDB 3UYRL 3SDAB 3K46A 3BEVA 2KKQA 3MV8A 4P2QB 4L9LB 3HC0B 2EDBA 4I2XA 5FGBA 2YS4A 5EOCJ 3UJTH 5DD3L 5CGTA 3HAEH 1QRNB 2GJ6B 3STLB 4JZJB 5AWNL 4FABH 1A02N 3U7WL 2MMXA 4Q0XL 3F7VB 4AQ1B 1A6VL 2M2DA 1U8JA 4U6VH 1WZ1H 5HYIA 1MFBH 4YGVB 1MQ8A 1ONQB 5FHBL 1N59B 4JR9H 4NZTL 4F3FB 3D5OF 4ORGB 1IL1B 1AD0B 3CX2A 4ALAH 5D7IF 1WC7A 4CN1A 3GO1L 4TUJB 3UTSD 3GSVB 5JNYB 4P2CG 5EN2A 3FN0L 2HWZL 5FFLA 2W92A 3O3BA 2BVQA 4IRJD 5FYLD 1UEYA 3QUZB 3TGXA 1AR2A 3K80A 5JQ6H 4IRJC 3O3DB 1ZLUH 3O41B 4OUUB 3M1BA 2X4NA 3LEVL 3GKWL 2A83B 2PYFB 3EYOA 4HKJB 4L4TD 3OXSB 4PRID 1A7PL 1BBJB 1FNGA 4RMSA 1KB9K 5C6TH 1A6WH 4XBEH 1RZGA 3WIFA 4JPKL 4OT1H 2YC1A 3BEVB 2GTWA 2VLME 4HFUL 1MNUL 4V1DE 4I2XB 1KLFA 5IVZA 2VMFA 3BWAA 2VB5A 4JE4B 4OLXL 3EOTL 4PS4H 1VEPA 2BNQA 3GSRA 2BY0A 1QFWH 4KJYA 4K07A 3QDJB 5FKPA 1L0QA 4XPAH 5GGRA 1U8JB 3HTLX 4IMKC 3NACH 1RJZA 4ONGL 4RZCA 1WC7B 5MEQA 2XV6B 3ZE0E 1FLRH 5ACZA 5EN2B 4AENA 1G9NC 5EC1A 2ICWA 3O3BB 1AKJD 4BJLA 5FYJD 3A67L 1OT1A 1IC7L 3M1BB 3QG6A 2X4NB 3BXNA 4P4KD 5FUZH 3M17A 5CJXA 3EYOB 2QSTA 4E41A 3GHBH 4QF1A 4P4KC 5EU6D 1YMHB 3QDMD 3VMOA 1OGTA 5BS0A 3MYJB 1FNGB 2CKBA 2VDRL 1EEUA 1RZGB 1EDQA 3WIFB 1PJ9A 1F4AA 1QKZH 3PWPA 4MDIB 2YC1B 4OV6F 1MHHA 2X6MA 2GTWB 5ADPH 1TPXB 1DUYA 3NAAL 4UV4L 3FT4A 4Z18A 3BP5A 3BWAB 1D5XA 4I77H 4XP1H 3I6LD 2BNQB 4Z5RA 1FVEA 3GSRB 4NQCE 2VWEC 4KJYB 5FKPB 2NW2A 3UBXI 3P4MB 2IMMA 2GW5A 3U0WH 5E7FA 4NKMA 5C09B 3WJJA 4O2CA 1RJZB 4RZCB 5E00A 3QXDB 5MEQB 1FFNA 1IGML 1N0LA 3JUYA 3FAXA 5ACZB 4AENB 43CAA 3PQYD 3MLPA 2K7QA 3KYAA 3S5LA 5EC1B 2ICWB 2OL3H 4Z78A 2DTSA 5FCSH 4JG1L 1KPUA 3QG6B 4KY1L 5LAXA 3BXNB 4FQJL 3U0PA 3M17B 4OI8A 4E41B 4QF1B 4DN4H 4JM4H 5KVEL 1OGTB 1KN2L 1Q9OA 5BS0B 4XXCA 2CKBB 1YECH 1GGYA 1UKSA 5KVMC 4H8WH 1TTGA 1T22A 3X12A 3PWPB 1MHHB 4I4WB 3BQUA 4KKAD 1DUYB 2X44D 1IJ9A 3FT4B 4KKAC 1D5XB 3PGCA 2QSQA 3KLAA 4Z5RB 5JIKA 5FO8A 1FVEB 1OAXH 4AMKL 2FGWL 2NXYB 3MV11 4FXKA 1XCQA 2NW2B 4HX1A 5T5FH 1H3PH 3EDFA 2DQEH 4NKMB 4RFNB 4Y2DA 1TQCB 3S8WA 5J1SC 5E00B 1MY5A 4XNMA 1QA9B 1I1FA 5CJQH 1FFNB 4FHBD 2WUCL 5CZXD 1P4BH 4WO4D 1MCQA 43CAB 5CZXC 2Y9RT 4WO4C 3S5LB 3C5ZA 4Z78B 4TRPL 1MCKA 4ODTH 4LAQL 1KPUB 1ZAGA 4WI7A 1SVZA 5LAXB 2DL9A 3U0PB 4M03A 2R8SH 3FO0L 3RX5A 2CH8A 2HRPH 2XPGA 1EHXA 1Q9OB 1NKRA 5IQ7H 1EPFA 5E4EB 4NQVA 1T22B 3X12B 3BQUB 4BA8A 3CXDL 3JV4A 5BRZD 1MJJA 2C4XA 3PGCB 2NPLX 3KLAB 1BMGA 1HHIA 2ATPA 5D7KE 5FO8B 3RWCA 2CPCA 3ULUH 1AP2A 4ELMA 4X9HA 4FFYL 1OPGH 1Q1JH 3MNZA 4FXKB 1S7UA 1XCQB 5HHXH 3R06A 5DT1L 2LVEA 4HX1B 2BP3A 4LNVA 1RSFA 2NX5D 4JHZA 3AS2A 3FB8A 4P23A 1F02I 1PLGL 1TIUA 1RFDL 4Y2DB 2F5BH 4XNMB 1I1FB 1W8OA 2X4UA 3KS0H 1HXMA 5C8JA 4S2SA 4LVHC 4Z7VE 3T09A 1TJGH 4PJDE 3U79A 2FBOJ 2DYPB 2OL3A 5IBTH 4Q97A 5FEBA 5DD6A 4HG4J 4Y5YA 5AYUL 4J23A 4XX1G 5L7XL 4ZUUA 2FJHA 1UGNA 1J8HD 4NGHH 5D7SH 2XPGB 2FRGP 3VXME 3O6LL 3LB6D 4NQVB 3V6OE 1JWUA 2P5EE 1LGVA 2Z0BA 3LB6C 5D6DC 3TC9A 3ZO0A 4GBXD 4WI9A 3JV4B 4KROB 1T7XA 2VXUH 3TBWA 1MJJB 1I85C 3B8YA 4DW2H 4GBXC 3NVQA 1W2KT 1AXIB 1NMCC 1BOYA 2HFTA 3S97C 3GGWA 1HHIB 2ATPB 4HJJL 3RWCB 1AP2B 2FD6L 2QQNL 4ELMB 4CJ0A 3MNZB 4I9WD 1S7UB 2JELH 1FNEA 2BY3A 2DKSA 3LN9A 3R06B 4NRYB 4ELKB 4L8CB 3FB8B 4P23B 3H7BA 2W9LA 3IDIA 2GJZA 5FYLH 2X4UB 1HXMB 5C8JB 4S2SB 5E2VH 2XZZA 5BJTA 3OZ9H 1RURH 5TE4H 4YAQA 4UTAL 2OL3B 3VMNA 2UUDH 5DD6B 3NIDE 3KR3H 4PJAA 3BWUC 3PGFH 1C16A 1JYXA 1RD6A 4JFED 4ZUUB 2FJHB 3QQ4A 4G80A 4J3OC 3JXAA 4K71B 3TLRA 2O93L 4XP4H 4F58H 4X6CA 1JWUB 3OHXA 5I76B 1URLA 3EIFA 3TBWB 3G6JF 4F7PB 4GAYA 3GGWB 4LSRH 4JDVA 4TOYL 1RU9L 3RGHA 2J2ZA 1IM9A 4M5ZH 1IC5H 2P48B 1JIBA 4GAJH 4AG4H 3HC3L 1IM3A 1FNEB 1P7HL 3ZKQD 4Q74A 2F53D 3H7BB 2GJZB 2VZOA 2DM2A 1A3RL 4N5ED 5F1KC 2F8OA 4N5EC 5BJTB 5AWNH 1HK6A 3LPGA 4YAQB 4ZUTB 3PNWA 4QHLA 2EH7L 4JDTL 3ETBF 4RRPA 1WISA 4LRIA 4PJAB 2MOVA 3G04A 3V5KB 3ZDXF 1C16B 5FHBH 4NZTH 1I1YA 1JP5A 4G8FA 2ZKHL 4J8RB 3QQ4B 4G80B 3DV6A 3KJ4C 3GO1H 4CMHB 1M7XA 1OTTD 4RFOL 4X6CB 2HWZH 4HK3N 3OHXB 1OTTC 4YQXH 1PZ5A 1YEFL 3BH8A 3GKWH 1IAOA 5KOMC 4GAYB 4XC3L 1G1CA 5B22A 3FQRA 4JDVB 4YDJA 1A7PH 1IM9B 1DQLH 4E5XB 2ILLA 2R56L 4OFDA 3SHSA 1DQTA 1IM3B 4JPKH 3WHE1 4G8EA 1EEYA 2I9TA 2M8XA 3N1PC 2OMNA 4JZOB 4OCSL 3M45A 1UA6H 4OLXH 5I8KL 2FIKA 3GMOA 5JDSA 4EZMA 4AY0A 3PNWB 4QHLB 1FYTD 4JPWL 1IQDB 2M1KA 2C5DC 2FIRT 3PG2A 4U0RB 3G04B 4M6NL 1I1YB 4ONGH 3RWFA 3ESVF 3DV6B 4OV5A 1GGBL 3WLBA 1I7UA 2WINA 1H8NA 4ZS6D 4DWHA 1BVKA 4ZS6C 3SY0A 2MPAH 4KKCD 1PZ5B 4PJHF 4P4RB 4KKCC 3BH8B 3RWHA 1IAOB 4PJFF 4JANA 3TH4T 4FS0A 2ADJA 3KDMA 3VFPA 5D93B 3FQRB 5IVNA 4YDJB 3WFBL 5HHQA 4YO0A 3W9DA 1XF5A 1SHMA 3DVGA 5IHBA 2NY5C 2NYYD 4G8EB 3IJHA 1EEYB 4C57C 3FCTA 1MIML 1ZLUK 3QO0A 2NYYC 1OLZA 2I9TB 4UV4H 1ACYL 1E6JH 1IGIH 4M6OL 2RCSH 5L88L 5BOZG 3LRSA 2FIKB 1FPTL 3GMOB 1JF6A 3GHEL 4J6RL 5JDSB 3GNMH 4XB8A 1M71A 5CINL 4TVPE 4XHJC 4ZDHA 15C8H 3JWNC 2PETA 1MAJA 1OW0C 2Z92A 1RULL 1RZKC 3KVQA 3BZFA 3D39A 4JO1H 5E1HB 5I66A 3RWFB 2V2XA 5BV7L 5GISL 1IGMH 1N64H 3H3KA 3T2NL 4OV5B 3VD7A 3WLBB 2VYRE 1SJHA 1DE4A 1I7UB 2WINB 4NQDA 5KBNC 1NC4D 1BVKB 3SY0B 1J9CT 4MAYD 5AG8A 2DBJA 4M3JA 3O4LD 4WW1A 3B5TA 3FZUD 4MAYC 4FQJH 2R1YA 4JANB 3FZUC 2ADJB 3KDMB 3VFPB 4LPXA 5IHZA 5KVEH 5BZDA 2H9GA 4TN9A 5HHQB 4WY7L 4YO0B 2V9TA 1XF5B 3V6ZA 3W9DB 3QI9D 3DVGB 4L29A 2YUWA 5EZOL 3QI9C 3IJHB 4FFZL 1UWXH 3QO0B 2BSSA 3RL2A 3JBG7 4L1HA 3H9SD 5DJXB 3LRSB 3ULVF 3O6KL 4NQEE 1VSCA 1M71B 4K7PX 4S1DD 4ZDHB 4J12A 3AY4A 3H42L 3OGCA 1A4JA 3NFSH 1JGEA 2Z31A 2HAZA 4MQ7A 3BKJL 3EFDL 4S1DC 3KPNA 5DA0B 5L8JB 2Z92B 1ULVA 3QDMB 3WFDH 2D7NA 1RK0A 3ARYA 1E6OH 3D39B 2VDQL 3FAWA 4IHOA 1EZVX 5I66B 1D5IH 2V2XB 3W0WE 4U1KB 1NGXA 2WUCH 5CFHA 2AI0H 5GGVH 1SJHB 2VZTA 3MXWH 1MCBA 2EDDA 4NQDB 3BSZL 4TRPH 3KPMB 4M1GL 4OCRL 4UV7H 3BT2H 4LHJB 4WW1B 3CLFL 3OMZA 2R1YB 1ZLSH 1NGQL 3MCKA 3FJTA 5IIEA 5IHZB 5F7KC 5BZDB 2H9GB 5I1AA 5D4QA 1UC6A 1EK3A 2Z4QA 2LQRA 4R26L 3JUZA 3RGVB 3V6ZB 4L29B 3MA9H 1JMXA 5FAAA 5K59F 3QDHA 4P9HC 1PG7L 3CXDH 1FSKC 4F8TA 3RL2B 2DWDA 3TFKD 3ZE1E 1PVHA 3QDAA 3TFKC 3MV8D 4CDGC 1CFVL 2AEQH 4XP9H 3B9KD 4G8GE 3OGCB 4QCIA 2Z31B 1JGEB 3B9KC 4MQ7B 5DT1H 5DURD 4ZSOE 1VFMA 2YWYA 3ARED 4P59L 4UTBL 1RK0B 3WDIA 2IFGA 4IHOB 1PLGH 1FFOA 1RFDH 3AREC 1NGXB 5CEXA 5ELIA 4V1DD 2XA8L 4Q2ZA 2OSLB 4JO3L 2QHRL 4G9FA 3T65B 1L6ZA 2OI9B 4MS8D 5GHWL 5GGUA 5L7XH 4MS8C 2OZ4H 3MCKB 5IIEB 1NUDA 1UFUA 5I1AB 4LPWA 2Z4QB 4EVNA 1QSEA 4DUWA 1LO0L 1Y18A 2VXTH 1U8OA 3EUUA 1I1CA 4XVJL 1H3WM 3VXSE 2BVUA 1UB5A 2EDNA 4BQBA 3O11A 2DWDB 1A7OH 1TITA 3N1FC 1MCEA 4EIZC 1RZJC 4P5TD 5E6YA 4WTZA 4QCIB 4P5TC 4LSUL 3RL1B 1RIUH 1U3HB 2AAVA 4MNHA 4QRRA 4JDZA 1FFOB 2A9NL 4KRLB 3CLEL 3WD5L 5J1TC 3CSPA 4MNQA 4AEHH 5C3LD 5CEXB 5K9JL 1BZ7A 4FFWD 4Q2ZB 5BO1L 4FFWC 4ODSL 4HUNB 4G9FB 2YBRA 3AAZA 3IGAA 3RIFF 3R0NA 2DQHL 5GGUB 3MX0A 2GIYA 3D2UA 4Y19E 1CBVH 4NBXB 3ZHDA 4EVNB 1QSEB 4JQVA 2UZXB 1IAII 3MR9A 5I1EL 1Y18B 3QFJD 4I3RL 4W4NA 1U8OB 4H88L 4YEFA 3M07A 1MFNA 3EO9L 5CJXC 1UB5B 5DVOA 4HGKC 2IBZY 4NN7C 1H0DA 4DQOL 5CP7A 1YDPA 1RU9H 1FC2D 1U8QA 3HC3H 4HD9A 3ET9F 4I3GA 4P3WA 2VR5A 3K0WA 3U4BH 4KI5F 1CK0L 1SYSB 3ZSTA 4BM7A 4MNHB 4QRRB 1MREL 5HGDA 4JY4A 1W8NA 3U2SA 2HT4D 3BGMA 4MNQB 5GRYA 1BZ7B 1J7VR 1MCHA 1CFQA 1MEXL 1RUPL 2HT4C 4OD3L 3OKLB 1ZMYA 4O58H 3VRLF 2FJGA 4JHAL 4OZGF 2LTQB 3JWOL 4HIXL 2VSDA 1AHWA 1TJHH 5J9PA 2EH7H 4JDTH 3RJDA 2F15A 2YBRB 5EG6C 3AAZB 3IGAB 2AVGA 5DTFA 2FDBP 3D2UB 3OX8A 2ZKHH 3SJVE 4JFFE 4GG6E 1UCBH 2E6PA 1JRHI 3NCYP 1DVFD 3MR9B 4RWHA 1DVFC 2UUDK 4KQ4L 5HGAA 3WJLC 3BIKA 2BDNL 4NO2A 1DR9A 3PL6D 1CLCA 1QBLL 4YFEA 5CZVH 1YEFH 4NO3A 3Q1SL 5C2BL 3LIZL 5C7XL 3DLQR 1H0DB 1RZKH 5SWQB 3DVFA 5A2IH 1YDPB 4QTHA 4RCAA 1U8QB 1EERB 5LGHL 3VFRA 4S0SD 3P11H 5KZCB 3FO2A 4YBLC 1R3HB 5K33A 5CP3H 4LK4A 2E9JA 4OCSH 2HFFA 5FUCE 5HGDB 2XKUA 4JY4B 4TSCH 3U2SB 5I8KH 3BGMB 2AJSL 3OL2A 5J56B 1JYNA 1F6LL 1LDSA 1WBYA 1CFQB 2F58H 4KQ3L 5IR1B 2FJGB 1AHWB 5D7KD 4YWGH 5FV1L 1OGAE 5E5UB 1ZKAA 3HUJF 1KB9J 3FFDA 5DTFB 4M6NH 1DBAH 3OX8B 4M48L 3C5ZD 3V52H 5FUOL 3MBED 3C5ZC 1IGTA 2DLIA 4P46A 1EFXD 4G7VL 2FHBA 3MBEC 5SWSE 5HGAB 3BIKB 4NO2B 4QXUL 4Y0GA 4CVUA 2B5IB 2EYTA 4NO3B 4HEPG 4DCQA 4NWUH 4WUUE 2IANA 3NIFF 5DS8B 4UIMA 4QTHB 1UKTA 1DEDA 3OPZH 2EDHA 1JPFA 3JV6A 3QUML 2WIIA 5HHVH 4PJXF 4HHAA 3S88H 3QWQB 4Q6IA 1ORQA 2CK0L 3GIZL 1JZ3A 3VXMD 1MIMH 3PHOA 3FO2B 2P5ED 1MI5E 4M6OH 3V6OC 2HFFB 3U83A 1CFNA 1FH5H 5F89A 1FL6A 2LU3A 3GHEH 1WBYB 4J6RH 3MXVH 1FE8L 4X5WA 3EDKA 2BSTA 2XG5A 5B39G 5CINH 2BVPA 2MCPL 2ARJQ 2EIZA 3P0VL 4GOSA 3S34L 5D2LF 4JPVL 3FFDB 4KUCF 5C0AA 5EZJA 4JCMA 1SYVA 5GISH 5I16A 5D96B 3T2NH 1IGTB 2X89D 1JPTL 5B8CC 3C6SA 4WHTA 5ANME 5T1LA 1U3YA 4Y5YC 3WNKA 5C92A 1MLBA 3KYNA 2YD3A 1NGPL 4MMZC 1Z5LB 1YYML 2EYTB 4FMKA 3VGHA 4DCQB 2D7TL 4H0HB 3IU4L 2IANB 4BQ9A 3L3OB 4UIMB 1BJ1H 1ZT7A 4NUJA 4KI1A 1PAMA 2CQVA 4JVUA 3QQNA 3DJ9A 4F9LC 5DRZA 4WY7H 3JV6B 3HG1A 2VE6A 2EYSA 5ITFA 2WIIB 5HDOA 3QRGH 1CD8A 4HHAB 4RX4A 4Q6IB 1ORQB 5HYQB 5IEHA 3GI9L 4FFZH 2E27H 4K2UL 3PHOB 2NY2B 3VFWA 1FG9C 1RPQA 4P2OD 2Y6SD 1CFNB 1NDGA 5MEPA 5AAMA 5F89B 4P2OC 3ZKND 1FL6B 4JFHD 1CDHA 3O6KH 2HYMA 2Y6SC 4GRWF 1JRHH 4X5WB 3ZKNC 3EKCA 2BSTB 2I24N 2RGSA 2PUQT 4URTB 4KKNA 2BVPB 3H42H 3BKJH 2EIZB 3EFDH 1OP5H 1IAKA 2M26A 1GZQA 5IJVA 5TE7H 3OSKA 5FCUL 5C0AB 3WEXA 5EZJB 3G6JA 4X7SL 4M7KH 1CCZA 1WVZA 5I16B 4O9HL 3LH2L 1R5WA 3C6SB 1GZPA 4WHTB 5T1LB 3G9AB 1RZJH 1KJ2L 1MLBB 2ZOKA 4M1GH 3KYNB 2Q86A 2R4SL 1CTOA 1RQ5A 2VLRE 2X4SA 5I1KL 4LF3A 3F7QA 1ZT7B 4NUJB 4WHDA 4R26H 4ONHA 3SE8H 4OD1H 4DUXA 5DRZB 3HG1B 2VE6B 5ITFB 4BQ8A 4W4OC 4PLKD 5D71L 3P40A 2MNUA 1UM5L 4PLKC 2YPLA 3VFWB 3V6FA 4NKOA 3MC0A 3PJSA 3BPNB 3NBNA 5MEPB 1OWWA 1NDGB 5I73C 4XPGH 2DB8A 3TA3D 3C5JA 2BNRA 4JB9H 3TA3C 2BZDA 4MLSA 1L4IA 4XPHH 1UWXK 1IAKB 5I8OL 2IPUG 4UTBH 3CX5J 2NY3B 1AD9A 4PBXA 1GZQB 3V9FA 5IJVB 2JCCA 3WEXB 1FNHA 1WAAE 4D8PB 1WIUA 5CJ5A 1MWAL 3G6JB 2EDTA 5J6GA 2DKMA 1RHFA 3THML 3MJ9L 1R5WB 5F72S 4JO3H 1GZPB 2C3VA 2UWEE 5CILH 3LDBC 2ZOKB 1G9MC 5T5NG 1C1EL 2Q86B 5M95B 2X4SB 3FOMB 1KEGH 4EI6A 3OBAA 2W91A 4BYHA 4LF3B 3DURA 4FQQA 3Q5YA 2Y7QA 2N1KA 4ONHB 4U1LA 4FNLH 2EKJA 2VIRA 3QAZC 1IT9H 1YY9D 1Y6KR 2YPLB 3QNXA 2D0HA 4NKOB 4U49A 1YY9C 2HJLA 3PJSB 4MB5A 3N9GH 5H8DA 2XTJE 1KYOK 5I74B 3C5JB 2DQFA 2BNRB 4HXAH 3VXPA 4PP1D 1FFPA 3OF6A 2X9WA 2AGJL 4PP1C 2R2BB 5TDNA 4HUXB 1AD9B 2BHYA 2JCCB 2A9NH 2VZ1A 4HMDA 2WNGA 3CLEH 3L3HA 5EWIL 5J6GB 1T3FA 4PJFA 5K9JH 3VGEA 1UJTA 3IT8D 4JKWA 5HHMB 2VDLL 1JNLH 5BO1H 4ODSH 4N1CA 2P5WE 1T2QL 2IAMA 1V3JA 4LSVL 4TVPD 5CLTA 1NCAH 3BN9D 1YJDL 2IMNA 3RUGE 3SBWC 2EDJA 2R0ZL 4EI6B 1ZGLM 2FLBT 3BN9C 3DUUA 3ARTA 1HH9A 5DFWH 3DURB 1WGOA 4FQQB 2Y7QB 4PG9A 5ACLA 4UIKH 4LVNC 4ODHH 3VU2A 3PUCA 4U1LB 5HGBA 3H6JA 4P57A 4H88H 2VIRB 4N8VA 5F7EL 2YHGA 3D25A 3QNXB 5E4IA 2RR3A 1C5CL 3CVIL 5C08E 3VGAC 4TNWK 4NQCA 4J3VA 2X41A 2DQFB 4PRPD 2X4RB 2PO6D 3B43A 2X4OA 1SMAA 1F2QA 5KSAD 3VXPB 4O00A 1FFPB 4G6FB 2PO6C 3MGOA 5F8QC 5KSAC 4NO0A 4ESKA 1CK0H 5IFAH 3MLVL 4YJZL 2YR3A 2NY0B 3QXTA 4JREC 3L3HB 1T3FB 2HH0L 3V4VH 4WU5A 1MCOL 1MEXH 3FQXA 3MLUL 3HE7D 1MCWW 3K7UA 4JHAH 2R29L 3SE3A 3GJFH 4HIXH 3HE7C 2DJSA 1NC2A 5D1ZD 5ESQA 2IAMB 1B3JA 1L6XA 4LNRA 4U1NA 5D1ZC 4Q9RL 3SO3B 2FWOB 2IALA 2YZ1A 3OTTA 4JRWA 3DUUB 2WM0A 1HH9B 2BFVH 4F15C 2I60L 4X5XA 5HVGB 1BM3H 4PG9B 3ALWA 4C55A 4GRLA 4EKXA 5HGBB 3VXOA 4P57B 4HBQA 4KQ4H 1LEIA 4N8VB 1X4XA 2VLKD 3D25B 2FLRT 5E0QA 1BFOA 4L8DA 3LIZH 4M61A 4C4KO 3RX7A 4KGJA 4NQCB 4QY8B 4MD5A 2X4OB 3CFDB 4LGSB 5LGHH 3UTTA 3MRBA 3SKUD 3MGOB 1LE9A 4NO0B 3CH1A 2ZJSH 5HYSG 2W60A 3QEGH 1SMOA 2HJFA 1E4WL 5D5MF 3IF1A 3L6FA 4OZ4A 1J1XL 1QHOA 3HMXL 4NUGL 2FH8A 4WGWB 3AUVA 3QWOA 4AH2A 4KUZH 3NZHL 3TEUA 3FQXB 3MLWH 3V2AR 2DJUA 3LOWA 3OB8A 1NC2B 4K9EC 5ESQB 1CGUA 1ES0A 5HJ3A 5IT2L 4LNRB 4G8GD 4KK8D 1GPOH 4M6MH 2IALB 4NQUA 4KK8C 4M48H 2ZUWA 5CWSB 3NA9L 2FO1A 4X5XB 1NKOA 2J8UE 4GRLB 3C09C 3J7HA 1INDL 2VLJA 1YMMD 3VXOB 5KS9F 1NSNL 4KDTA 1LEIB 1XF2A 4LIQE 1AFVH 1IGFH 1IILE 3QH3A 1BFOB 1A6AA 4LHUD 5B38A 3I75A 4L8DB 4K8RD 3L5XL 4G6ML 3SCMD 4M61B 4K8RC 3SCMC 1WZKA 2QADB 4MD5B 5FB8A 1EH9A 3UTTB 3B5GA 5A43C 3MRBB 4WI3A 1TZGL 4HEME 3GIZH 2FGZA 3CH1B 3VJ6A 4YXLL 2P8MA 2W60B 3MA7A 3IU3A 2HJFB 1KCLA 4WWKD 4NQXA 3IF1B 3WXVL 3PE9A 4JN1L 4OZ4B 3MV7E 3DO7B 4WWKC 2XKSA 3VXSD 2G9HA 4AH2B 3PL6B 1FE8H 4F33A 3GJFA 1KTLB 2MCPH 1RIHH 5HJ3B 3VXRA 1ES0B 3P0VH 1GC1C 4JPVH 4LCWA 2EKSA 3L9RA 3L7FA 3VI3F 4TSAL 5IW6A 2H8PA 4M5YH 4YXHL 5JW4Q 4HLZH 2I07A 2UZYB 5FA4A 3VFNA 1FGNL 2VLJB 3GJEA 2DF3A 3MRPA 3PWJB 4FFVD 1XF2B 3QIBA 5I15L 4MXVF 1TMCB 1NGPH 3QH3B 3N0PB 2VQTA 4FFVC 1QZ1A 4M9PA 4MA1C 1A6AB 1YYMH 5E95B 4R96A 2Z8RA 3TZVB 5FIEA 4JFZH 3F58L 1EHNA 2Y25A 3G5YB 4ERSH 1N6UA 5FB8B 4X9IA 2R1WA 4Y19D 3QISA 5C0EA 4OZHF 3E2HB 3VJ6B 3GI9H 2P8MB 5J7CC 3WFHA 5A3IC 3MTRA 3MA7B 2KZWA 2HMID 3IU3B 5EUKA 6CGTA 2I27N 1OSPL 4NQXB 4XP5L 3IDNA 3SDYL 2HMIC 2VDPH 2SEBA 2G9HB 1KULA 2WW8A 2X4QA 2GY7B 4F33B 1MRCH 2YRLA 3D69A 4PJBE 2HN7A 3GJFB 4LSSL 4OCLC 1MLCA 2APWA 2IQAA 2J3SA 4JN2A 5IBUG 4LCWB 4PJ5D 1LO5A 2EKSB 3L9RB 3KPRE 5IW6B 2H8PB 4YNYA 3VD4A 4O9HH 4M93B 1F4WL 2I07B 5FA4B 3VFNB 2E8YA 4GS7C 5HPOA 4QOKE 1NCUA 3GJEB 4RAVA 3MRPB 4XGZA 1KJ2H 3QIBB 2A1WL 3CFKA 4X6DE 4MZ3A 2QJDA 3QIWA 4R96B 2CRMA 3B83A 4TULH 3AB0C 1LO2H 2VDKL 3IETB 2FX9L 4J3SA 1I7ZA 2L4OA 3INUL 4RIRA 1KPRB 3CDCA 3SJVD 1JNNL 5SV4A 2R1WB 3QUMA 2KDGA 4ZFOL 2YD4A 3HAEG 4OZGA 4WW2F 1WITA 3WCYA 5C0EB 5F6HI 3WFHB 4OLEA 1UM5H 1VESA 5EUKB 4ZTPL 1GGCH 3IDNB 1ERNA 1KPVA 2SEBB 2ZG1A 5LVEA 2IGFL 3KXFE 2X4QB 4TVPH 4APQB 4WCYL 3D69B 3CDYA 5FDWA 2HN7B 1VGEL 1I3RA 4HAFA 1FP5A 1MLCB 3GMNA 2IQAB 2OP4H 4JN2B 1KENL 5K9KA 1EEZA 5KVGL 3OGOE 4K94L 3ARPA 1LO5B 3AMLA 5E8PA 5EOCH 2Z91A 3T0EE 2XQYK 1TNMA 1MWAH 3OKMA 2W9EL 2VZUA 1LNUA 3U4AA 2XN9E 3MJ9H 3H9HA 1NPUA 3DROA 2ZUYA 4RAVB 4XGZB 3EFFA 5BQ7A 1OP5K 1XZ0B 5E8DL 3NPZB 1Q0XH 5DMIL 2J88L 3QIWB 1OGAD 32C2A 3QDGE 1R3KA 4ETYA 4I5BA 1I7ZB 3IJSA 4RIRB 1UWGL 2VL5A 2R0LL 4YEEA 1FQ9C 3QUMB 1HIML 2IJ0C 4OZGB 2BY2A 2LE9A 4JG0H 3HUJA 4L3EE 3AVEA 1KPVB 1NCBL 5EFIA 1HI6A 4WUUD 1I3RB 2JJUA 1ROWA 3K4AA 4LLQB 2AGJH 3GMNB 5DVMA 4MXQD 4X7CC 5K9KB 1EEZB 5MP6H 4DOHB 5A2KH 5E8PB 1J1OH 4MXQC 1FO0L 1M4KA 1F4YL 2Z91B 5LQBH 1QFWM 4NO5A 3D85D 4Q6YA 3OKMB 4ZXBD 3QG7H 3V7MA 1RUKH 4B5EA 5EWIH 3VG9B 2OXGA 4ZXBC 2NY6B 4LAJH 4X5LA 3H9HB 3MBXL 3DROB 4HIEA 1KJ2A 1T2QH 2Y23A 4PJXA 5BQ7B 4Y5VC 4HQQL 4R3SA 4CKVX 4LSVH 1O7SA 3VWKD 1OQXA 4P46D 4ETQA 3IFOA 4YC2B 5HHOA 4H0GA 4OLYH 3VWKC 32C2B 4P46C 1IKNC 1R3KB 1S7QA 4N8PA 5CJ8A 4KRNA 4I5BB 5D9SA 1LK3L 1KOAA 2VL5B 3U7YL 4LLUA 4N0YL 4RSVA 4KXZH 3S3PA 4BFEA 7FABL 4J3WA 2A6IA 1C5CH 3QCUL 3CVIH 4P99A 1UQSA 1T1YA 2C4FU 1II4E 4YK4C 1QFUL 5EFIB 2R2EA 1LP9E 1HI6B 3QEQE 1F6AA 1YZZA 5GGVY 2FB4L 1WWWX 3MLVH 4WI5A 4KV5F 3FFCA 5LGKA 3IKKA 5L2KE 4PY7A 4Y1AD 4NO5B 4F37K 2EEBA 5GSRA 1MWAA 3I02A 4M7ZC 3F8UB 2HH0H 2EO1A 4M1DL 4MCZB 4U1JA 3TO4D 3MJ9A 5DWUL 5T33H 2AW2A 3BDXA 2R29H 4K8RH 2AJYH 4MGXA 5F6IC 4IEFB 4JRYE 4HIEB 1KJ2B 4JRXA 1SM3L 4PJXB 4R3SB 1M05B 1VDGA 4Q9RH 4ETQB 3IFOB 4YDLC 1AXSA 3BD4A 3VGBA 3ZTJG 1V3KA 1S7QB 3BPOB 2I60H 1VFUA 5D9SB 2XZAH 3ROOA 2O5ZH 1F97A 4PJ7E 4F2MA 3E3QE 3BRGC 4LLUB 1JHLH 2ZPKL 2YUXA 4Y4HA 2A6IB 4XMKL 4KHXH 3ZE2F 2E7HA 4PRHA 4HC1L 4UDTA 5JPNA 1KELH 1UQSB 1T1YB 3OJDA 4JGMA 3ALPA 2VLRD 3TYFA 1XGQA 5F9OH 5TDPA 3VWJB 4EIGB 5E6IA 1F6AB 4XCCL 4QRTA 1FDLL 1PG7X 5HGHA 2AXFA 3L5WA 3FFCB 3WIIL 4PY7B 2WV3A 3W0WA 4FQLL 4KMLB 3HMXH 4NUGH 5GSRB 1MWAB 3I02B 3LZFL 5DHYA 4U1JB 3NZHH 4POZD 2B1AL 4N5UA 1U3JA 2GQHA 3DRTA 1IBGL 4POZC 4A2LA 3LKPA 5EU5B 1ZV5A 4JRXB 4YZFF 3ZKXB 1T6WA 1M6OA 4XZUA 1AXSB 1IEHA 3NA9H 1XGUA 1JPSL 3ROOB 3C8KA 5A1AA 4F2MB 1INDH 3GJFK 3T3PF 1WCQA 3PDDA 1NSNH 4Y4HB 4GLRH 3AMKA 1GHFH 5DDHB 4JEGB 4PRHB 4UDTB 5JPNB 3IXTA 4FTVE 5E2WH 4G6MH 3OJDB 1KF9B 4NQEB 1NAKH 3TYFB 3CMOH 1XGQB 3CNKA 3ARGD 2H32A 5TDPB 4R2GB 4U1GB 2J8OA 5E6IB 3MLSL 4AEIH 4XPFH 4QRTB 4ZSOA 3U0TB 5HGHB 2HVJA 2AS5M 4K55A 5DEFA 5IROA 3L5WB 5JHDE 2CGRH 5DJ2A 2VQ1A 3W0WB 4JN1H 3WE6B 4IBLT 5DHYB 4Z7WF 1R3LA 2JKXA 1MVUA 1PFCA 3VXUE 2X40A 3DRTB 4HWEL 1MVFA 3QB7C 3LKPB 4Q9QH 1TCRB 2G60L 3DOSA 4KHTL 1MRFL 4EI5D 5BV7C 4OUOA 4XWGL 3X17A 1M6OB 4EI5C 4XZUB 4OLWH 4PUBH 4I8DA 5J4MA 3UBXG 1XGUB 5HY9A 3BPCB 5D6CA 3C8KB 3QUXD 3TWCL 1H9VA 3MUJA 3D3VE 1KCSL 3I50L 3QUXC 4UMGA 2FJFA 2W59A 4F9PC 3UAJC 4IDJL 2QL1A 1SJXA 3G6DL 2NZ9D 1BFSA 1XIWD 2P5WD 1I7RB 5EZLA 2BC4A 1KUMA 2QV2A 1MFDL 1XIWC 3F58H 4OGAD 2H32B 3BN3B 5D7LA 5MEND 1CIDA 4OGAC 2X7LA 5GS2D 4ZSOB 4XVTH 5I75B 3BFOA 2HVJB 5DEFB 4YIQA 4NM8L 2VQ1B 1AO7A 1OSPH 1ZSDA 4XP5H 1CTNA 5GRJL 3GBLA 3HMXA 2JJTA 3BMWA 3RHWK 1R3LB 5DJ6A 1MVUB 4P9ML 5DJDA 1DP0A 1YYLL 2PXYD 4XNYL 5C08D 5L6YL 3LVEA 1FZOA 2PXYC 4Y8AA 3C9NA 2D7QA 5DUMH 1UM6L 1X5GA 3VFTA 3L1OL 5B4MD 1DDHA 3MRGA 2BSED 3CFCH 3Q3GA 4PD4J 5B4MC 5HY9B 5JW4R 3QT2A 1F4WH 5D6CB 5DXWA 2FJFB 5DMKA 5A2LH 2UV3A 5ISZA 2A1WH 2NLJA 1U93A 3K3QA 3O6ML 2JJSA 2DQDL 4XRCA 1XAUA 1RUAL 4UINH 5DK2A 4HBCL 3X3FL 5EZLB 1L0YA 2BC4B 4UB0L 3FQWB 1E28A 2FX9H 1R0AL 1LEKA 5F96L 4CU7A 3FN9A 5D8JL 2NY7H 1JNNH 1NL0H 4PGDA 5GPRA 4FZEL 1HINL 3SDDB 3OKKA 4YIQB 2R69H 5D2NE 3C60A 4PTTA 1AO7B 4ZTPH 5DZLA 1ZSDB 5J11C 3OKEA 5DGQA 4DZ8B 5DJ6B 5DJDB 4WCYH 2KL6A 5D7JD 2QSCL 1VGEH 1FZOB 3MLRH 5D7JC 3C9NB 3PXHA 2Q8AL 4BUGA 4RWYL 1VEOA 3GSOB 5KVGH 2R2CA 4JFFA 4LEOB 1BREA 1DDHB 3MRGB 2W9EH 3DX7B 3LPFA 4NZUL 2EDOA 4YHYB 3Q3GB 2DQGL 1IC4L 3VI4E 2PNDA 1ZT4A 3MUGA 1WCBA 2VZSA 1QACA 3W9EA 4LCCA 5ISZB 2NLJB 1U93B 5E8DH 1CU4L 5E8EA 3EYSH 4XRCB 5DMIH 3ULVD 4M02A 3BE1L 4P3DA 4MJ5B 2WQRA 3ULVC 3WSQL 3OG4B 3U9PL 4KRPB 3DBXA 1E28B 4BZ2H 3ARFA 3UJIL 4FQ1H 1VFOA 5DR5H 1LEKB 4LSTL 2R0LH 5L0QC 1QSVA 3DX9A 2UYLA 1KTDA 3EZ8A 4WHYH 4PGDB 4OCYL 3OKKB 1CR9H 3VFGL 1BVLA 4MHHI 3PIQA 2YXMA 3LN4A 3C60B 4PTTB 4OM0L 4NT6A 2F19L 1YEDA 3NCFB 3UX9B 4QYOA 3MV9A 1A6TA 1OAYL 1OQOA 3HE6D 4I3SL 1G6RL 1HE7A 4ZOAA 3HE6C 2ENYA 3P9MA 3TCLA 4D94A 5T5NF 1X5JA 5KS9A 4NBYB 1QEWA 4JFFB 1OTUD 4U3CA 1WT5A 4ODBD 2D9CA 1MCIA 1OTUC 3FMGL 3O6FA 5LBSH 4NJAH 1BQLL 5SWSA 3MV7D 1ZT4B 3MUGB 4L4VA 1WCBB 3EZJB 3MBXH 3W9EB 4LCCB 1KYOJ 5LG1A 2GSIA 1K85A 4HQQH 1Y6NR 5E8EB 2Y36L 3JWDC 4LLMA 3KWWA 1RZ8A 5IKCA 4OTXL 2ERJC 3G5ZA 4MXWH 3DBXB 3ARFB 1LK3H 4MJIA 4GW4A 3DX9B 3ZDZE 4N0YH 1OOAA 2UYLB 5IVXF 3SGEI 4ZFOA 7FABH 4G9DA 1MI5A 2FHFA 1BVLB 4RBPH 3LN4B 3DRQA 3E6HA 4NT6B 2CIIA 3ARSA 1YEDB 1KTKE 4QYOB 3NFPA 1UH3A 1A6TB 5I1LA 1ORSA 1AQKL 1QFUH 4NZRL 3V5HA 2YSSA 4BSJA 2KBGA 4JJ5A 3P9MB 3TCLB 1OGAB 4NBZB 2FB4H 2FEEL 3CAFA 5IOPA 25C8H 3ARUA 4M4RA 3RY5A 4DK6A 4FMFA 4AQOA 1QEWB 1FG2B 5CD5D 4CW1A 2BMKA 3VXRD 3O6FB 3JWOC 1L0XA 4KGLA 5CD5C 1V7NL 5SWSB 5EB9A 5ANMA 4BK5A 3R1GH 3KLHD 4L4VB 5CIPH 4WFHE 3KLHC 2GSIB 2DIJA 1SM3H 1EAPB 3OR6A 3SDXF 4LLMB 3KWWB 5SWZA 1WEJH 1RZ8B 5IKCB 4M93C 4OI9A 1OAQL 2ARJA 3G5ZB 1VPOL 3NH7H 4HWZA 4N0FA 3DXAE 1OARH 3KPRD 4GW4B 4G7YH 3ECBA 3ARBD 4G9DB 1MI5B 1CGYA 1RMFL 3ARBC 2X10A 4HC1H 4QOKD 5JW4N 3DRQB 3E6HB 3C87A 1DJSA 2CIIB 3ZL4H 4YDIL 1I9JH 4X4XB 3IFLH 4OAWA 3NFPB 5I1LB 4HKBA 3MRMA 3V5HB 2YSSB 4HUUA 1S7VA 4F57H 1CFSA 4JJ5B 4JFQA 2H1PL 1MUJA 1DQDL 1FDLH 3Q5OA 5IOPB 4QTIH 5T3ZE 5EU7E 4LDEB 2J4WH 3WIIH 2Y07L 2VAJA 1FO0A 4FQLH 4CW1B 2BMKB 4JM2F 3LZFH 1HYRC 3B9EA 4IJ3C 5ANMB 3KAAA 1IBGH 2X1WL 4WFEE 1JWSA 4OD2A 2E9WA 2NY1D 3KXFD 5ALCH 3OR6B 1J0ZA 4WW2A 4XNUH 2NY1C 4NN5C 5IFHL 4RGNB 3DI3B 2BXYA 4XI5D 3ME0A 3S37L 1AY1H 2ARJB 3LHPL 4XI5C 4HWZB 4DEPB 3ZHKA 4IRSD 4KI5D 4KTEL 2C1OA 4UAOC 2XN9D 3ECBB 3K2MC 2JIXD 4IRSC 3BZDA 4KI5C 5MEOA 2DQTL 2AJ3A 2OTUA 1CD1A 3TO4B 4WHCA 4ISVA 1CXHA 4Y4KD 1A64A 2AKRA 4JFDE 4Y4KC 5D72H 4OAWB 1KJMA 3NPSC 4HKBB 3MRMB 4JFXA 4HUUB 3QDGD 4OCMC 4JFQB 1MUJB 4FQ2L 3UTPE 3BW9A 4MJ6A 5EIVA 1QSFA 3MODL 3U46A 5DMYA 1N3NA 5I18L 1FO0B 1YN6A 3CSYA 4L3AA 2BJML 4UU9A 5I9QC 3LMJL 4F7TA 4L3ED 4I18A 5DVNA 1NMBL 4ODWB 4QEGA 4HWEH 2V17L 1JWSB 4OD2B 3T0WA 1BX2B 2G60H 1UZ8B 3BESR 1TZIA 2F54A 1DL7L 4WW2B 3SGEH 2VLRB 1MRFH 1AI1H 4HPYL 2AJXL 1FL3A 1BFVL 5DI8A 3DIFA 3GSQA 3HRPA 1OM3L 1YY8B 2DQJL 3KYKL 4QRPA 4OSUL 5F3BA 2C1OB 2DL2A 1KCSH 2EECA 3I50H 2WWMD 3IDXL 2AJ3B 2OTUB 1BIIA 3EO0A 2BHZA 2WWMC 3Q2CA 1CD1B 3UJJH 1EVUA 4ISVB 4MA8L 4HC1A 5FGSA 1F5WA 3G6DH 2AKRB 1I9RL 5MERA 3QJHA 1KJMB 4X4ME 3HZKA 2OJEA 4JFXB 4X99A 5E56A 2EE3A 2A77L 3BW9B 1QSFB 1A3LH 4YHZH 1P4LA 4ZQKA 2A6KA 1N3NB 1FZMA 1CGVA 3PHSA 4JFPA 1YN6B 3WKMH 2DQUH 3CSYB 4YX2H 4NNXA 5L8KB 5ITBL 3UTSE 4F7TB 2FATH 4G8IB 4TUOA 1YYLH 5GJSH 3NIGF 3TVMA 4WDIA 4BZYA 2CUIA 3QEQD 1UM6H 3ARGB 1ZLVH 1IRAY 4R0LA 1FL3B 3L1OH 1J05A 3LD8B 4LKXA 5DI8B 4KAQH 3DIFB 3GSQB 3HMWH 4L4TE 4DGIH 4Z7OE 2B4CC 4QRPB 2Q76A 4Z7NF 5F3BB 5FHAH 2FO4A 4NQSB 3PF2A 3VGFA 3PABA 4LIQH 1T1XA 1BIIB 3EO0B 5E94A 3O6MH 4XCEA 4N8CL 1VEMA 1RUAH 3QEHA 2PYEA 4P2RA 5C07E 4HBCH 2XTJB 2NTFA 5MERB 3X3FH 3L5HA 1XF1A 3QJHB 2XYCA 1CL7I 3HZKB 1NDMA 3FL7A 4A6YH 3VD9A 1R0AH 2OJEB 3TT3L 2HA1A 3DHMA 5F96H 2CK2A 3VRJA 4X99B 4CGTA 2DLHA 5KJRH 1U8NA 4X7DC 3RPKA 4FZEH 3C6LA 1B2WL 1MJUH 4ZQKB 1P4LB 2A6KB 1UG9A 1FZMB 5F9WC 1CXKA 1RUQL 3E3QC 4JFPB 2EDXA 1UXSA 2EZ0D 1OAZL 4WEUD 1LO4H 4NNXB 2X2YA 2EZ0C 4KU1A 4FP8L 5D70L 4TUOB 3CDGA 4GMSL 1MAML 1I3GH 3T4AA 3TVMB 2QSCH 4WDIB 2P5WB 3HHRB 3K8MA 3MGAA 4DKDC 3ARDD 3P0YL 1AGBA 2VOTA 1UJ3A 3ARDC 3CVHH 1KXQE 3RUGB 3S98A 4YDKH 4R0LB 3FT2A 1J05B 1CLZH 3NTCL 3QHTC 4LKXB 5EU6E 1DANT 4EUPH 4AT6A 1T0PB 5M94B 4E0RA 3RPIB 2FO4B 5F9JA 3PABB 1T1XB 4LQ1A 5KN5A 2K1MA 1NCWL 3IFNH 5E94B 1MCJA 4CU8A 1U42A 4Y5XA 1X5AA 3QEHB 2PYEB 1E4XI 3W82A 1I1AA 1N4XL 3HNTL 1NDMB 3RKPA 5FOJA 4HWBH 1M7DA 3T1WA 4NPYA 1U8NB 4MAUL 4C56E 4WVRA 2C4FT 3C6LB 4YUEH 4Y89A 43C9B 4X4YA 5TH2A 4YFLI 1K2DA 5A40E 1FN4A 1UXSB 2BCKA 1T7YA 2F19H 4G43A 4PJEF 2GTZA 4ZTOH 1N6VA 2F5AL 4I3SH 4FTVD 3CDGB 3O81A 3T4AB 3T3ME 4L5FL 4PJGE 1X6NA 5BW7A 1MIEL 1F8TL 1AGBB 1UJ3B 4JHWL 1H3UA 3FT2B 3LQAL 2CLZA 1UYWH 1T03L 2VKXA 3FMGH 1G7JA 4AT6B 1BQLH 2J8UA 4E0RB 1CS6A 4LVOC 2OQJA 5GS0D 3OV6A 5F9JB 2APXA 5KN5B 4PLJD 5GS0C 1PDKA 1OAKL 4PLJC 2DTML 4Y5XB 2Y5TA 1JZ4A 4OZIE 4R4ND 4XMPH 2X70A 1I1AB 4R4NC 1LE5A 1M7DB 4Z7WA 5F7YC 1JNHA 4NPYB 2L7JA 3RZCA 4YHOL 1BGXL 1YPZF 1DQMH 1GH7A 4X4YB 5TH2B 2H2SD 5GGTL 1K2DB 1C7TA 1JN6B 1FN4B 4PJCE 2BCKB 4G43B 2H2SC 2BHUA 2GTZB 2PKDA 2ZUQC 5CJBA 1AQKH 4O2FA 4NZRH 3UJTL 2DKUA 5IB2A 3EHBD 2YRPA 4F80A 3HKFA 3EHBC 1ITBB 1MJ7L 2CLZB 1WZ1L 3AU1A 1MFBL 3A6BH 5HDLA 2J8UB 4U05A 1V7NH 2ZP0T 1CL7H 2OQJB 5B39A 1CFBA 2EDYA 4ELMF 1IGYA 1L7TL 2FR4A 4OFIA 2ITDA 4X8JB 1QNZL 5F9DC 2Y5TB 4WEBL 3V0WL 1OAQH 4PG2C 5JQ6L 3CH8A 1VPOH 5KSBE 1LE5B 4Z7WB 2XQYG 1JNHB 2QLVB 4YHPA 5HD8D 3RZCB 2D7OA 5J57B 3WN5C 4NRXA 2DD8H 4Y16D 3GMQA 3PV7A 1A6WL 3TM6A 2NX5E 4MQXD 2YEZB 4Y16C 5D7LD 3N1MC 3MPCA 4MQXC 1NUFA 3CUPA 4YDIH 4HULB 2X1XR 4X6FA 2J1KA 2ZNWA 1JF5A 4O2FB 1G6RA 3VGGA 1CT8A 2IFFH 4PS4L 1DQDH 3GSXA 1JGUL 4NNPL 4DGVH 5IB2B 2EDFA 3CVHB 4MVBD 4RBPK 2E7CA 2Y07H 4MMXC 1Z2KA 4HMCA 2P24A 4O5LL 4XPAL 4MVBC 3BEWA 3FB6A 5HSFA 3BGFC 3AU1B 1J8HE 5J8OA 3NACL 3SE4A 3H7LA 4WUKH 5DZNA 1CE6A 1Z9MA 5D2NC 5B39B 5JXAL 2BRRL 5T1KA 4ZFZA 3O2VH 2ESVA 4ZUVA 2FR4B 1FLRL 5F1OB 4CL7A 5IFHH 2X09A 4W81A 3W81A 3S37H 1NGYA 3QHFH 1N6QL 3T1FA 3LHPH 3S4SG 3P0GB 4B53A 4X9GA 4LEXH 2R39A 4YHPB 1V3LA 3U1SH 3AS1A 4NRXB 4OM1L 1WJ3A 3GMQB 3N85H 1FNLA 2XT1B 4CUCA 5JW3H 4PJAF 5C0BA 5ADPL 3CUPB 1U8IA 1JTOA 1G6RB 4DUVA 4J1UA 1CT8B 2R0KL 3QIUD 2MJWA 5FYJU 4TQEL 4FQ2H 3GSXB 3QIUC 3U30C 5ACMA 3MODH 3NCEB 5HTSA 1NFDE 3EYFA 3T0EA 1YEIH 5I18H 2P24B 3BEWB 3FB6B 4JFEE 3U0WL 2BJMH 3CPLA 2MKWA 1CE6B 2FNBA 5IVOA 5CEZE 1RI8A 3ULUF 5T1KB 2V17H 4ZFZB 4ZUVB 1QVOA 2ESVB 3HPJA 2V7NA 1CXEA 2R15A 1DL7H 3O8XA 1NFIB 4HPYH 2AJXH 5I1CL 1BFVH 4YBHA 1NGYB 4KFZC 3T1FB 4OQTL 2J5LB 1Q8MA 4R90L 1S8DA 5KOVC 2DQJH 5SX5H 4JM4L 1YECL 4PP2A 2F53E 5I6XC 5C0BB 4NNYA 4Y4FB 1TQBC 1U8IB 3IRPX 4ZOCA 3C2AL 1C5BH 2PR4L 2YA1A 3DHJA 5K9QI 4J1UB 5HDQL 5FO7B 1MCDA 5ENWA 1OAXL 2A77H 5EPMA 1U2HA 3IDYB 3MV9D 3WIHL 3TN0A 3EYFB 3T0EB 1UZ6F 2MKLC 2DQEL 2O26U 3QBTB 4X6BA 5IW3A 3CPLB 2H6PA 5ADOL 2YK1H 5E9DA 5F7WC 1UENA 4EN3A 1QVOB 3HPJB 2V7NB 5LCVH 3O8XB 4X7EC 2E6JA 4Q9BA 1ZGLA 1H5BA 5IV2A 3B9DA 3S96A 4WV1C 2JB5H 2E7LC 2DLEA 1HH6A 1S8DB 2Y1VA 1EO5A 1J86A 3NGBB 1P53A 5IQ7L 5CS7A 4PP2B 4OZFG 5J12B 2ZOLA 4LSQH 4N8CH 2A38A 4NNYB 3RTQA 5FKAA 4OQ1A 2O61A 4YGAB 4GRMA 4OLZH 4Z7UE 3T0XA 1LP9A 4QNPF 3A6OA 1E27A 5ENWB 1QLEH 5EUOE 1NANH 3RP1A 5TPWH 5L2KA 1Q1JL 4QHKI 2VDNL 3TN0B 3SDXA 5HHXL 1RUQH 1OAZH 5GS0H 1D5MA 2NQCA 4FP8H 5D70H 4NFBA 4TUKL 2F5BL 5GRVL 1T83A 5E9DB 4JRYA 4EN3B 1A1NA 1Q38A 2ADFL 3HC4L 3P0YH 3SGJA 1TJGL 5JIPA 2EEDA 1S9KC 1KCVL 3BMVA 3QUYA 3MLYH 3WO4B 5IV2B 2DLTA 1QQDA 3VDCA 5T3ZD 5KSUA 3S96B 1QBAA 3D6GA 3PWUA 3WDHA 5EU7C 4PJ7A 4B41A 1HH6B 1MCSA 5SWZD 4WTWA 5I71C 1NCWH 2Z93A 2ZOLB 3CD4A 4WFED 1ZLVK 2QQQA 2CDFA 2XRAL 1A7RL 1WTGT 3RTQB 5FKAB 4PJ8D 2IWGA 4KRMB 1K3ZA 2VXUL 3DSNA 3HNTH 1N4XH 3MRQA 4GRMB 5JLZB 4PJ8C 4DW2L 1LP9B 4JM2A 1KIUA 5EIQA 5C9KA 1E27B 3PWNA 3RA7L 3QEUA 2NXZD 2IH1A 1JJUA 4OFYD 3GMMA 4UOW1 1T04A 3K8LA 5L2KB 2NXZC 1HHHA 3G6AA 3SDXB 2JELL 4ZYKA 1DQJB 4B7IA 2F5AH 4G6KL 3T0DA 1ZK9A 1QLFA 3KPLA 1CQKA 4JFDD 4FA8A 3V0VA 1R6VA 5FYLL 4L5FH 1JUFA 1A14H 4JRYB 1A1NB 1T1WA 5HYSA 1MIEH 4XBPA 4JZJA 3KPOB 5HYJA 5TE4L 3O4LE 3QUYB 3LEYL 5JOPE 3LQAH 1QQDB 3WFCL 2ZG3A 1IZKA 5KSUB 1IE5A 2XICA 3KR3L 1B6UA 3PWUB 3P73B 3MQIA 4PJ7B 4R4BA 1JHTA 1IL1A 1D9KD 3QNZA 4AIXA 4OF3A 2YWZA 1D9KC 3HPLA 2Z93B 2DRUA 3CDFA 4XP4L 4BZ1H 4F58L 2DTMH 1ZHLA 3TV3L 3DMMA 2CDFB 3JVGA 4POUB 3O2DH 3O3DA 4LBEA 3WS6C 3MRQB 1P9MC 1DBJL 4JM2B 4P2QE 5IM7A 3BHBA 4DKEH 3PWNB 4F8QA 1EO7A 3QEUB 2IH1B 1BGXH 4TPRL 2B20A 1BZQK 3GMMB 1T04B 5JHDA 3GM8A 4GAJL 3WFEH 4AG4L 3G6AB 4RGMC 5GGTH 2CXGA 4ZYKB 4TVSa 3VXUA 3BIBX 2ED9A 1QLFB 3KPLB 3WFZA 3V0VB 4RA3A 1PYWA 1JUFB 5FYJL 1NBVL 4N9GA 1P7QD 4HLZG 1T1WB 5E03A 5HYSB 4XBPB 5HYJB 3ULSA 2GK2A 3RI5K 2B39A 5T3XD 1XR8B 1OCWH 3QDJA 4RMUA 2R23A 4ZUWA 5IQ9A 1MJ7H 5AAWA 3FO9A 5M7QA 4I18C 3LS4H 4ZO9A 1AIFA 1IVLA 2F54D 4R4BB 3D3VA 1JHTB 2C3HA 3QNZB 3UC0H 4RQQA 1HWGB 1L7TH 1PKOA 5KVDL 2FHCA 3HPLB 1I8LA 1QNZH 3S7GA 5CCKH 3Q6FA 1ZHLB 3DMMB 4WEBH 4TYUA 3V0WH 4YQXL 5FM8A 1U95B 2Z8SA 3QQ9D 2KPNA 4LBEB 1HSBA 4XNZB 4IM8A 3MV8E 3QQ9C 5IM7B 3BHBB 5EU3A 2GHWB 5IGXH 4I2XE 3G5VA 1YMHA 1JZ8A 4XAWL 3MYJA 1DQLL 5JHDB 3RY6A 3S3SA 3W5NA 4MDIA 4OF5A 3VXUB 2N4IA 5C07D 4UBDD 1UA6L 3L3GA 4FQXA 1PYWB 5LWYH 4UBDC 5AZEH 4N9GB 4RDQG 3LKRA 1JGUH 4NNPH 4PGEA 4CU6A 3ULSB 5F93C 1KSRA 1RVFL 1YEJL 1BF2A 2R23B 3P4MA 4O5LH 4ZUWB 5IQ9B 1XT5A 3FO9B 4K3DL 2ZUUA 3P4NA 3S35H 1FIGH 1AIFB 1IKFL 2MWCA 3FQNA 5C09A 5JXEA 5ILTH 3D3VB 3GBNL 3QA3A 2NW3A 4MA7H 3QXDA 1HCFX 5JXAH 2BRRH 1DBBL 4RQQB 1RZFH 5IHLB 2WK2A 1O0VA 5CGMA 5J13B 4QRUB 4WNQB 2D4DA 3Q6FB 1KT2B 5HPMA 5DJYA 3ARQA 5C2UB 2MPAL 1VB9A 1N6QH 4J4PA 1HSBB 4GXUN 5EU3B 2YMXH 3MJ6A 3G5VB 4P2RD 4OM1H 3EJZD 2IPUK 1CICA 2BNQE 2F8VA 4Z76A 5FYKD 1BAFH 1P5VA 3EJZC 4I4WA 4D2NA 5C0GA 2QHLA 3B9AA 1E6JL 1IGIL 2RCSL 3DSFL 2R0KH 3L3GB 4FQXB 4TQEH 3HAEA 4L8SC 5I1GH 3GNML 3LKRB 4PGEB 3OAUH 5C86A 1DBKH 15C8L 5H2BA 4C56D 1CDGA 1KBGL 1HCVA 4GKNA 1U8HA 2J12B 5E70A 3P4NB 2VH5H 4PREA 4JO1L 3FQNB 2D03H 5F6HJ 3QA3B 2NW3B 4XNXH 5FF6A 3EDEA 1QA9A 1B90A 3QFJE 1N64L 1EBPA 1TJIH 5IBUB 5BS0E 4CADA 5GGSY 2GKIA 5HPMB 5DJYB 4HZAA 5I1CH 4IIQC 3F12A 1YEEH 2VDOL 4S11A 3PWPE 4PJEA 1VADA 2G5RA 3MOAH 4I0PA 4OQTH 4R90H 1T0NA 4S1QL 5D1XA 3K1DA 1AC6A 4JPIB 1FYHB 1I9EA 1CICB 4Z76B 5MI0C 3O9WD 3ZTJH 5C0GB 4UI2A 3O9WC 4LPCA 1FIEA 3C2AH 4DK3A 2PR4H 4TNWF 5DO2D 5HDQH 1UACH 3HAEB 5T3ZH 5DO2C 2ZZUT 2Q1EA 1MJ8L 3NABL 4XMLL 3TJEH 3WIHH 5H2BB 3NFSL 2CDGA 5I8EA 4GKNB 4HWNA 1U8HB 4XVUD 3WFDL 2VISA 4DKFL 4PREB 1E6OL 2ZCKL 4XVUC 4PJ9D 5ADOH 1D5IL 5FF6B 4PGBA 2DM3A 3GMLB 4YPJA 2YXFA 4PJ9C 4HMEA 3RIAK 5GQBA 4X80L 2AI0L 5GGVL 3MXWL 1YPZA 2CSPA 4CADB 2DYPA 3H3PL 1ETZB 1P2CA 4HKXA 2ZNXA 4LPUA 4UV7L 3BT2L 3EYQD 3F12B 3ZKMD 3MOQA 1A1OA 3KPSA 4PJEB 5I19H 1VADB 4I0PB 4KJWC 4QXGH 3ZKMC 3EYQC 4MA3A 2DJ4A 5IJKC 1ZLSL 4P49A 4NFDA 1T0NB 3BDBA 4UILL 1HHJA 5D1XB 1MAKA 2VZVA 5L8LB 4Z7QE 1T89C 3CX5K 4FOMA 2P8PA 3MA9L 2VR4A 4S1RH 2YD7A 3VXQA 1CN4A 1XF3A 2DICA 3CXHK 2A9MH 3KHQA 2EE2A 3SDCD 1BZ9A 3SDCC 3SE9L 3U48A 4XT1C 5SX5K 3NOIA 1EAJA 2AEQL 4XP9L 1E4KA 1G7LA 3AM8C 4LHUG 2VDNH 2CDGB 5I8EB 4NRYA 4ZPVA 2VISB 4ELKA 3HZMA 4L8CA 4JKLA 4TUKH 1GYAA 4WI2A 1D6VH 4PGBB 1BECA 1J1PL 4HUWA 2ADFH 3HC4H 3UDWC 1JBJA 3RVUD 1KCVH 1YPZB 2YOCA 4DN3H 1P2CB 4HKXB 3RVUC 4Z95L 5E2JA 1P69B 4PGCA 1R5VA 1A1OB 3KPSB 1IARB 3DXAA 4HDIA 4OQTA 2YA2A 4MA3B 2OZ4L 1CGWA 5CD3A 1HHJB 3RVWD 5DD0L 1JFQL 4ONFL 1Q72L 3RVWC 2P8PB 4POYA 3RDTA 2AJVL 3VXQB 2VXTL 4DTGH 5I76A 5EBGA 4R97B 2XRAH 1A7RH 5TGBA 1XF3B 2NY4D 5JORA 1ZT1A 2QKIA 3FKUS 2NY4C 5BXFA 3NN8A 4F7PA 1BZ9B 1A7OL 3BZ4A 5HI4D 5AEAA 2XY1A 5DRXA 3RA7H 4MB3A 5HI4C 3ARVA 5IK3A 1G7LB 3WIHA 3MRFA 4D9LL 1RIUL 3JV5A 4ZPVB 1YQVL 4I0CC 3GSNL 3HZMB 2RHEA 4EDWH 5AZ2L 3RVVC 4G6KH 3PWVA 3X11A 3O4OB 4AEHL 4HUWB 3P30H 5D1QA 1QPXA 1U8LA 2AXGB 4ZO6A 4ZUTA 5E08L 3LEYH 4PJIE 3CSGA 3QWRD 3WFCH 4TNVK 4PGCB 1R5VB 1A5FH 5B3JE 3DXAB 4HDIB 3V5KA 5DD1H 5C0CD 4U4BA 3BPLC 4J8RA 5CD3B 1CBVL 2W0PA 1YA5A 3RQ3A 5JA9A 5CEZD 1QFOA 3RDTB 2Q3AA 3TV3H 1T21A 2EC9U 4PIRF 4FQIL 5TGBB 5JORB 1GXEA 1ZT1B 1G0XA 1RHHA 2QKIB 4JFHE 1DBJH 5BXFB 3NCCB 3NN8B 1GGIL 3BZ4B 3K8KA 5DRXB 1CXLA 1R24A 5IK3B 1BOGA 4TPRH 4ZAKD 4E5XA 3KLDA 2AK4A 3MRFB 4ZAKC 2X4PB 1BD2D 3U4BL 1HYSD 4OF8A 1JV5A 3U4EB 2HFGL 1U91A 2BSRA 5KSVB 4GXVL 1HYSC 1G9NH 4JZOA 3PWVB 3X11B 3WHE0 4W6WB 5FYJH 1NBVH 1KACB 4O58L 5D1QB 1W0VA 1U8LB 5IUSA 2E9BA 1TJHL 1A6PA 4QXTA 1JL8A 3B4NA 1IQDA 2IBZX 2UY7A 3ELAT 4X6CE 4BELD 4HXBH 5IW1A 2NY5L 2OR9H 3CCHA 3UZQA 3VGDA 4JFOA 1UCBL 3UMTA 2AXJA 2XTLA 5KVDH 2ITCA 1T21B 3DECA 2WBJD 5FM5O 2JCCF 1RHHB 4JO4L 3UBXA 4U6HA 5CZVL 2WBJC 4P4RA 5C0DA 4U1IB 1RZKL 1R24B 1U8KA 4XAWH 1BOGB 3FB7A 2AK4B 4DVBA 4QO1A 1JV5B 1U91B 2BSRB 3P11L 5H37G 3UTSA 1RY7B 4B0MM 3IB4A 4TSCL 4IRJA 2XZCH 3UROR 3QO1A 2L7UA 2F58L 4PV9A 1TTUA 1NGZA 1HNGA 1W0VB 1RVFH 1YEJH 4YWGL 4XCYA 4QXTB 1S9YA 5IHUH 1X5HA 4K3DH 4L4TA 5IW1B 4PRIA 1IKFH 3CCHB 1DBAL 3GBNH 3PDOA 3CSBA 4NN6C 4JFOB 3KYOA 3V52L 1C08A 1DBBH 1H5BC 1A7BA 2CR3A 4J3UA 4H26A 1YNKL 2ITCB 2EYRA 2G2RA 3HRZA 1Y0LA 1DLFH 2Y4SA 4YBQC 3UBXB 4U6HB 2OM5A 5C0DB 4U7SA