3C6SB

Crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
209
Chain Sequence
EVKVEESGGGLVQPGGSMKISCVVSGLTFSNYWMSWVRQSPEKGLEWVAEIRLKSDNYATYYAESVKGKFTISRDDSKSRLYLQMNNLRTEDTGIYYCFLPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 209
sequence length 215
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sB01
4POYA 1H3WM 2WQRA 1CGUA 5D6DA 3VXSD 3D3VD 4EI6A 3G6DH 3DECA 2I5YL 2GFBA 5J89A 1RK1A 1P7QA 2EZ0C 3JUZA 3NA4A 4PD4K 4XX1G 5DJ6A 4EQ3A 2E6PA 3LH2L 4JFOB 2OI9B 1MCCA 1LP9F 3DV4A 3UTQA 4I3RH 5CLTA 1LNUB 2E7BA 2Z35B 3ARDB 1Y18A 4JPIA 2YKLH 4TSCH 2BY3A 1I8KA 3C6SA 3RVVD 3PJSB 4PPTA 5FGCB 1YN7B 5J8OA 3MLVL 1X5LA 2ZOLA 4J8RA 5B38B 4HKZB 3TNMB 3H7LA 3ARRA 3ZE1E 3U46B 1J0IA 3JWOH 2Z4QA 3VGHA 3DJ9A 3GO1H 1IZJA 2PO6A 4ONGL 5I1KL 3VFSA 4ONFH 4ZUTA 1NPUA 5C08A 3MRIA 2ORBH 1QRNA 2AS5M 1I7RB 5I71B 3BKYH 4LSVL 1AO7E 1P4BL 4LHUG 5DLML 5EIIB 4P5MB 3TO4A 4Z7VB 1TTUA 3NTCL 1DSFH 4F33B 3DUUB 5DUPL 5C9KA 1CFQA 4H26A 3UROR 3RTQD 5I1IH 1T20B 2CDEB 3PWUA 1U36A 4X6DE 5GGRA 4MD0A 3ALWA 1IM9B 4PYGA 1YN6B 2ENYA 1HSBA 1W72B 1MI5B 2IANB 1OP3H 1Z3GH 4OI9A 1G9MH 2CR3A 1OSPL 3SOBH 4JHBA 3RVVC 5CWSA 3CZFA 1ZS8B 3FL7A 3GSRA 5D1XD 5DJ2A 1V7ML 3C2AH 1A6TA 3VFWA 1JI1A 1TFHA 2NXYB 2B1HH 2EDBA 1KPRB 1H5BB 1HQRA 2VO5A 1J05A 3N85H 1F4XL 4JDVA 5IMKA 3NZHH 1S7QB 4A6YA 4HT1H 2R4SL 1TPXC 5D5MF 2B7DT 5CZVL 3GB7B 4QKXB 3C5SB 1NBZB 2BVUA 3IJSA 5E1HB 3T2NH 1H3PL 5HY9B 1FZKB 3TYFA 3GMPA 2MFNA 2WBKA 5C7XL 1TVBA 3WV0A 3BGFB 5EO9B 5A16B 3AY4A 4ZTPH 2VJXA 4LCCA 1EBAA 3CFDB 2WV3A 3QDHA 3EFDH 2XZQL 5F72S 5EU4B 3NVQA 3R4DA 3MCKA 1V05A 5I73C 1J5OL 2XZCH 4LAQH 1P2CB 3EJJX 2F8XC 3WHXA 3RTQC 4ZPVA 5F7FA 5IMMA 4Y19D 4LSSL 2P8PA 5FM5O 2X05A 4Q97A 1F5WA 2VXTH 2LAGB 4PJAF 4D9RE 3QHFL 5IM7A 2ZJSL 4LKCA 1HE7A 3GMNB 5ESAB 4TUJB 5JPMA 2R2HA 1FAKT 4BQCA 1MAJA 1A9EA 1T1YB 3P77A 3SQOH 4XC1L 1XGRA 3HRZA 4QRTA 4BM7A 1NGWA 5SWQA 1GRWA 3RWEB 4QTHB 3F7VA 2O5XH 1ORQB 2E27L 3QAZC 2MWCA 4PJFE 1LO5A 4YJZL 4TSAL 5ALBH 4G8IA 4ETQA 4WIQA 1QLRB 5FV1L 3KGRA 1J0ZA 4I3SH 2ZUUA 5HI5D 1VSCA 4D0BA 2VXSH 1Q1JL 3P9LB 1MCBA 1MHCA 1NDGA 2OM5A 3GMLA 4P57B 2DM2A 5L6YL 5DT1L 4FQ1L 4NCC1 1EHLL 5K93A 4ZFZB 3LS5H 1RIUH 2P45B 4ZDHB 3MMEA 3TBSA 2V5TA 3HMWL 5GJTL 5ESVB 4NM8L 2FLBT 2VIRA 2P7TB 3ALPA 4X6CE 2F58H 1VADA 3W9EA 3QG7H 3PHQB 3MV11 3RIAF 4QT5B 4ERSH 1WZKA 4Y7MA 1AXTH 2OMNA 5KVDL 1SEQH 3U1SL 1UWXK 2OL3A 1A7OH 3CCHB 3STBA 3VWJB 4DVBA 3F58L 5DHVB 1BIIA 3D3VA 1QBMH 5C0CD 4GXVH 2WQ8A 5E24E 3CSYA 2YSSB 2EXYC 4HH9B 1E4XI 3RL1B 1M7IB 1IAKA 4NC1C 5BVJB 2WK2A 2HFGH 2D7NA 1R3JB 2WIMA 1TETH 3JWDL 1QQDA 2NXZB 1S7XA 1MJ7H 4ZD3H 1F3RB 4NQSA 5HVFB 5LKNA 4NDMA 4Y5YA 5F9JB 2IPTL 1U8MB 4PJAB 3QQ3A 5HI5C 2P5WD 1CE1H 3BIBX 3FO0L 4MMZC 1OAXH 2Q3AA 3D9AH 4B0MM 4AEHL 5ENWA 2XPGA 1T2QL 3KAAA 1G7MA 5TPWL 4DGIH 2GY7B 3Q5TA 2ICEA 4BYHA 3SKMB 4JLRA 3Q0HA 2CLRA 4KKLC 4PJCE 3GK8H 4H88H 2HH0L 2X7LB 2LVCA 1OP5H 4DQOH 3BO8B 5L2KD 4MJ6A 1OF2B 4OF0A 4KKBC 4NO2A 4KI5F 4ELKA 2Z31B 2QQLH 5B38G 3OX8A 3T4AB 5CCKH 1KBGL 3ETBF 4CN6A 5HYJD 5J1AA 3MJGX 4JHWH 1TDQA 1WIPA 1IKFH 3VXRB 1RZGB 5F96H 4TNWF 3RTQA 4TNWK 4FXKA 2RQ8A 1FYTE 4OCSL 5GSVA 5GRJL 3O0RL 2CKBH 5J6GA 3O3BA 4GH7B 5F6HI 1D5MA 1T04B 5D1XA 3U4EA 1X4YA 4WY7H 5TQ0L 4L8CA 1S7TB 1GGCL 1JFQH 3OKMB 1KN2L 4MCYA 1T1ZB 2JB6A 3U30B 1TLKA 5DJ0B 4YAQA 4FZEL 3T77B 1ZHNB 5JIIA 1AIFA 1U9KA 4RAVB 1N3NA 4P59H 4PJ5B 3MCG1 1GZQA 5D72L 4NNPL 3U0WL 4BQ6A 3GI9H 1JTPA 2FWOA 1N6VA 4QXGH 1WAAF 5IWLC 1CD0A 2R0KL 4WFGE 5SWSE 2Y23A 1CFNA 3W5NA 3REVB 1X6NA 2OXHA 3EOTH 1YZZA 4N5EC 2Q7YA 3BISA 4M48H 2ESVD 5L2KB 3I3EA 2R1XA 3VGFA 5F3BA 1LEKA 5JIPA 5CBEB 2NY3B 1QSED 4Y19A 1G7JA 4OKDA 5I9QB 4XMPH 3MNZA 2D7QA 1L7TL 3O9WB 3QWRD 2FHCA 4UT9L 3O3DA 3ARBD 2GITA 2XT1B 1A7NL 1W0VA 4LSTH 4RA0C 3UC0H 4UZGA 4F58L 3AB0B 2V7HB 3L1OH 3VFRB 1JF6A 3DVFA 5K9JH 1JGLL 4LDOB 4I2XA 4LCIH 5EG6C 4U1JA 5E1AA 3RUGF 4DTGH 2VLLA 4N0FB 4KGLA 5D7LD 3ARQA 3VH8B 1RULH 3TEUA 2RGSA 1L0XA 4PRPD 1JGEA 2X4PA 5E7FA 3TH3T 4IMKC 4CN4A 3GSNA 4U7KA 4P3DA 2BVYA 1T83C 4OZHB 1UACH 1AR1D 1D5BB 3GM8A 2MHAA 1WBYB 4C58B 2I9TA 5KS9E 5DA0B 3ZTNH 2XZAH 3MLXH 5DQJA 3F8UB 5EZIH 3TBYB 5FUCE 4IRSD 5E6IB 4O5LL 1EEQA 4YDVB 4WHTB 2W0FA 3PWVA 3GIVA 2DF3A 4F57L 1DDHB 3LN4A 1AGCA 3HLAB 4QRPE 3QCVH 5HYIA 1FRGL 4LARL 3DLQR 4ZAKD 1F90H 1KTLB 4GKSA 1YQVH 4IOSD 1IC5H 3KR3L 3ARBC 1RZKH 2DLFL 2DQHH 4KMTL 3FT4B 4RDQF 1FC1A 2VSDA 5C0CA 2HN7B 5C92A 3WKNA 3CC5B 3O4LE 4KRMB 5K9OB 5E08H 3CD4A 3JZ7A 2FEEI 3QUYD 1RJZA 1JPFA 3N1GC 3QWOB 3DXAE 3QFDB 5I8EA 1HOCB 3SGEI 3MRRB 4WEBL 3OZ9H 35C8H 4X7SH 3JTTB 2XN9D 5E4EB 1MCEA 4QY8B 4G8EA 3V6OC 2GHWB 4NQED 4NYLA 4AJ0A 2LU7A 1BFOA 2P5WA 4D9LL 3O2DL 4IHOA 3RBGA 4WI9A 1AR1C 1N7MH 3H7BB 4CU7A 4MD5B 4MXVF 3S7GA 2CRIA 4M03A 2E6JA 4JVPA 4OAWA 5MP6H 3TH2T 1BAFL 3DBXB 4IRSC 3HI1A 1P7HL 2VDQH 3IDYB 4NO3B 1A4KB 4WFFE 2BP3A 3GMRA 5D71L 5BZWA 4X0KB 2MQCA 1T66D 3V6FA 4MNQB 2CO6B 2J4WH 4ZAKC 1JRHI 4G9DB 2VYRE 5HYQB 3SGDI 1DUYA 1NGYB 1I9IL 3TYGL 1DLFH 1O0VA 2H26A 4BA8A 3HPLB 1RHHA 2HWZH 5HYJA 2X6MA 3QZWA 4PRDA 3OJMB 1SYVA 3QUYC 4JHZA 3C5ZD 3GSUB 1EEYB 1U91A 5TFSL 1CLOH 1QKZH 4HZLA 5C3LD 3JWNC 1RSFA 3V4VL 2IGFH 3I6LD 4CMHC 5KBNC 5GS1C 1YMME 4IIQB 2HA1A 4ZFGH 2CIKA 5DJ8A 1F00I 3BPLC 4UTBL 5DD0L 2PKDA 2AJ3A 2NY0D 4YGVA 3FTGB 5ISZE 3PABB 1MJUH 1K5NB 2X41A 2UUDH 4YO0B 4PGZA 2J8OA 4XPFH 2XKNA 4IDJH 1EGJH 1KPVA 2YWZA 5HGDA 3C6LC 5JHLL 4IMKA 1T66C 1T83A 3IETB 3T1WA 4NT6A 2H41A 2B20A 1M71B 1D5ZA 1SJXA 3ZT7A 3BEWB 3I6KA 4GQ9L 4JO3H 1EZVY 1X5YA 2CXKA 2ESVA 2F53E 3WIIH 1ZVSB 4UMGA 3CFJB 3K4ZA 1QSEA 3DX6A 3TT3L 2BOBB 3C5ZC 5CGYD 4MA3B 1DFBH 3L3OA 2EIZA 4HFUL 4GW1B 5D70H 2XA8H 3ARGB 2FCBA 8CGTA 4CADA 3QWRA 5HPMA 4QRQB 5I1JH 5I1LB 4GRLD 4R8WH 1NAML 2DQIL 4NSKB 1RZ7L 3UZQA 4JRYB 5DI8A 1AGDB 2X4RA 3G5YB 3ARBA 5CEYA 4YFDB 3F12A 5D2NC 5IFJB 2D7MA 5C0DB 1A7PL 3IU4L 1KEMH 4M6MH 5EO0B 2YEZB 3QIBB 3PL6D 1CICC 2FX8H 5I0DA 2C3HA 5FOJA 2R15A 1UM6L 1I75A 1A4JA 1F6LL 3M1BA 3AREC 2VLMD 2VDOL 3IFOA 1JGDB 3G6AA 3U36B 2BSED 1GH7A 1MCOH 1KJMA 5BRZB 1CDUA 1MWAA 2IAMD 4PRPA 1M6OB 3REWB 1R3KA 5AZ2L 1V5JA 2EDDA 5IVZB 4ODUA 2HVJA 4OLXH 1DR9A 1EJOH 1YEIL 2KZWA 4WFHD 3GJEB 3CFCH 2F5AH 3GSWB 3MBXH 4PLOB 2KZ1B 2OJZH 4X6FA 1LD9A 1RIVL 5E8OB 3S5LA 1JNLH 4IRSA 3QNZA 4H0GA 5T3XL 4EVNB 2NPLX 1AI1H 1NCBH 2P48B 2XG4A 3RVTC 5IIEA 1KB5A 1W8NA 2C26A 3D69B 4JJ5B 1MCRA 3QO1A 4ZAKA 3F7RA 1YYML 3OPZH 3U2SB 3BT2L 4XCYA 3BN9D 3ISWA 5LAXA 1WWBX 3IKKA 1N6QL 2FX7H 5IOPB 2SEBB 1JPSH 4HS3B 4GMSL 2IPUG 3HFML 3V5DA 1XR9B 1JZ2A 5JOPE 3PL6C 3HMXL 5DMJB 1JGUH 5E4IA 1CF8L 5ADPL 4U49A 3QUYA 1VACA 5FGSA 3FB5B 4GRLB 1ZT7B 1U2HA 1QA9A 2DJSA 2UWEA 4Z77B 5I8CB 4RQQB 4O2EB 2CDFB 1FJ1A 1K8IA 4XNYH 3U83A 3ZE2F 2XN9A 4LLWA 3PWPD 5E2VH 5LBSL 3WLBA 4NQEA 4NN6B 3V4UL 1JE6A 5FO8B 2W59A 2PCPB 15C8H 5TE7L 5HHQB 1HHJB 5GS1A 4DN4H 3E6HB 4LVNC 5E2UL 3TO2B 2VITB 5DQ9B 4PJBF 2VKXA 4JGMA 2J3SA 4NKIL 4XZUA 43CAB 1EHNA 4PB0H 4RMUA 4NZRH 1ADQL 4PJXB 3FQXA 3D2UD 4GG8A 1U6AH 5B39B 3ULVH 4F3FB 1MCKA 1Q0XH 4Y88A 1WWWX 3DURA 3VXME 3C6LA 3DRQB 4PP2B 5AAWA 4P5TB 1XR8A 2Z93B 1S8DA 3RWIB 5MI0C 1C5DB 3C60B 2ADIA 3VFGL 1LE9B 5DVOA 1K3IA 1CDHA 3SE3C 4RGND 4FZ8L 3CVIL 4HQQH 2BRRL 2OCFD 2VN4A 1A3LH 3FFCE 5IBTH 3VWKD 1LK3L 3KHQA 4LHJB 4Q9QL 1FGNL 1HILB 2G2RB 2ZG2A 4OCWL 3VFPB 3C5ZA 1LO2H 4LP5A 3B6SA 4KQ4L 2FATH 3HE6C 1MCWW 4QHLA 2VDLH 2X70A 3CMOH 1I1RA 1YNTA 4MAUH 2JELL 3S8WA 4U1KA 4I9WD 1J11A 1HHGA 3DMMC 2RR3A 1PG7X 3T2PA 4L3ED 3MNVB 5GRYA 2A77H 1OGAB 4OM1L 1OAYL 3HPJB 3IFNH 4BSVB 2P8MB 4K9EH 1DL7H 4OD3H 4RMTA 3QXTA 4E5XA 3U4BL 3OKKA 4WUUB 1EUUA 1TXKA 3QDGD 2HG5A 4NNXA 1QO3A 2WAHA 1DTUA 3WSQL 3GMOB 1FCCA 1XCQB 4NJAL 2H3NB 4WHCA 1MF2L 1FORL 3MXWH 5JORB 4FP8L 2N4IA 4LSRL 1YJDC 5E03A 5IV2B 5GGVL 1JI2A 1V7NH 3CLFL 5FM4A 5IMLB 2BNUB 2R2BA 4RGNC 4Z7NF 3T4YB 1I9EA 1T1WB 2ZUWA 4GBXB 1MPAL 2J8UE 3MBED 3VGGA 4G80A 1NLDL 4P2CG 4AQ1B 3DX7B 3U0TA 43C9A 1GXEA 4H1LB 1RV6X 2ADFH 3Q6GL 4JY4A 5IG7B 3V8CA 1FNHA 2O5ZL 1MRDL 1KPUA 2PN5A 1MREH 4MQ7A 4U1MB 2D3VA 3S37X 2HFTA 4X7TB 2R0WH 3MJ9A 3MLUL 3INUH 3VWKB 2BNRE 4KZDL 2CQVA 3ABZA 4LPXA 3X12B 4PGCB 2DQCL 5FUZL 4JFEE 5F6IB 4JZJB 4Q9RL 3M8OL 5GQBA 4B5EA 1ES0B 5C6WH 4P4KC 4HPOL 4OZGE 5MHSE 2A9MH 1ZA6B 5GGTL 2R1YB 4KK8C 1IZKA 2X4SB 3PL6A 3NN8A 2LU4A 1E27A 1F4YL 3FB7B 3U0PA 1MLBB 3I9GH 3BVNB 1RUAL 3F65A 4LNRA 5FA4A 4HBCH 1BVKB 5CUSH 1MFDL 1KJ2A 3BKJH 2IAMA 5DC4B 3AGVA 3WFHA 3RIFF 1WF5A 3THMH 3RIFK 3WD5L 1J1OH 3KG5A 1CZ8L 2X4QA 2FR4B 3LDBC 1BECA 5J9PB 4OCXH 3MRFA 3QUXD 3BDYL 1U8KB 4Q6YA 3MBEC 2C1PA 1UZ8B 4UINL 3B9KD 3L3DB 4NZTH 3IJYA 4YZFE 1QRKA 3Q5YA 1AFVL 3M45A 1KT2A 3JV0A 4MXWL 4K55A 5F7EL 3BQUB 4EDXA 2XV6B 3RZCB 1UXSB 5C8JA 1CK0H 1MCIA 3GDBA 3LQZA 5EBLB 3SE3A 4WENB 4PY7B 3FMGL 3B5TA 3QHZH 5JQ6L 2DLEA 5IMOA 1CR9L 1SBSH 3CVHB 2BVTA 5IKCA 1MHEB 4NRYA 5ICZB 1AO7B 4FNLL 4KVNH 2FX9L 5HHPA 1KIQA 3BXNA 4OIAA 5EUKB 3GRWA 2CLZB 3ULVC 4P23C 1CQYA 4N0UE 4C83A 4HH8A 4AMKH 1NBYB 4MWFB 3BOVA 4NQXA 2EH7L 4X6DB 4G6MH 5FO9A 3VA6A 3O41B 3RVWC 4ZPTB 2ZUQC 5FGBC 3BAEH 3MA9L 4BQBA 5GS2D 3QUMB 3OHXA 3KDMB 3MV7D 1IGTB 3GSOA 2UV3A 3B9KC 3DIFA 3TM6A 4PV8B 2ATPB 3D2UA 4YBQD 1W72H 1JV5B 3SGJC 5I74B 4LQFH 1HWGB 4LIQL 2IJ0C 3S6CA 1WWAX 3D39E 4X5XA 3VGAB 2D4FA 4WFED 1P4IL 1M4KA 2BNQE 5I30L 1CLZL 3VD5A 2OR9H 2OTUB 2LTQC 4MA7L 3BUTA 2DQTH 3PWNA 3S88H 3F5WB 2NY2B 5LGJA 1XCTA 3SQBA 5L9DL 2H32B 1BQLL 2R2EA 3RP1A 5L2JA 4QCIB 2AV1B 1AY1H 5EFIA 4M7KH 3HAEB 4R7NB 3WDHA 3BZ4B 2VUOA 1U95A 2I26N 3EKCA 4JZNA 1I3GL 4HUVA 4LVOC 2BHZA 5I1HH 1G6RL 1MQKH 4P2OC 2EXWD 4M62L 1NAKH 4L3EA 2VQ1B 3QDME 3NAAL 4DN3H 4LPTA 4GXUM 1CG9A 3HKFA 4R26L 2YD4A 3TP4A 1I7ZB 4EDWH 4ELMF 5E2TH 3L9RB 5AD0B 3QDGA 3K2MC 3KPPA 1WBXB 5H35B 2E7CA 3P30H 1TZGL 4PTUB 3MGOA 5FYJU 4N1HB 1FL6A 4I48A 1VKXB 1ONQB 3DUSB 5JNYA 3RWCB 1FGVH 3UBXI 4PS4L 2WIIA 4XNZC 3WNLA 4KUZL 1JWUA 2WNGA 4JY5H 1EO8L 2L0DA 4PJFB 1TZHB 4XB7A 2DTSA 4PLJC 1L9NA 1RUMH 4HMEA 3KLHC 1QBAA 4KJYB 1L7IL 3G9AB 4GFTB 4ZS7L 2ED7A 3HC4L 4ODHH 4U7MA 3G6JA 3MBEA 1UA6H 4FG6D 2NLJA 3MRCA 4AIZA 1UVQA 3FB6B 2H45A 4TVPD 4BFIB 4LPUA 1NKOA 4WNQA 3U6RB 4JKWA 3ARPA 1WIUA 4CL7A 2IBGA 4MSWA 4BQ8A 1QYGH 3OBAA 1IAIH 1A0QL 1NUGA 3QPQD 5D7JB 5FUOH 4KDTA 3CXHJ 2EXWC 4X6CB 5JMOC 3DI2B 4KAQH 5F7UA 3R1GL 4XH2B 2VQTA 4WW1B 1SY6L 1OAKL 1G9NC 3PGFH 4HX1A 4HUKB 3PHOA 1RAMA 1H0DA 3CUPB 5EC2B 1Z0MA 3ARDC 1U8QB 3P4NB 1PZ5A 3QJHA 1IQWL 3PGDB 2DQDL 2VNCA 4ZYKA 3U9PL 4S0TD 4MD4B 3QXDA 2VH5L 4GUPA 4XPHH 4LQ1A 3WE6B 4Z7OF 1S7SA 4U6HB 5DJZB 4RFNB 2ICES 4UNVA 3O6ML 5DHVH 5EUOF 3IDMA 4LGRB 3E6FB 3OXSA 5FGBA 2HRLA 2OQJA 3SDDD 3QUXA 1NANH 5E56A 3H3PH 3CAFA 1OP9A 1NC4B 4GRWF 3MLPA 2OJEB 3GSQB 3B9KA 3ZDZE 5F1SA 1CGYA 2B0SL 2UVEA 3EGSB 2AQ3A 3SGJA 3PDGA 4B50A 3IDGA 5C0AD 4IEFB 3VFVB 1DBMH 2EECA 4PJDA 1K4CA 4FQCL 2Y7QB 1IC7L 3VRIB 4A6YL 2XXCB 4PJCB 2DQGL 4GMTH 3UBXA 4ETYA 2IMMA 2QL1A 5HPOA 1QFUL 4F8QA 3HUJE 4XBGA 5CJOH 3SDYH 4JFZH 1A14H 4NKDA 3DGGA 3NMEA 3QUKA 3WO3B 2NW3A 4RCAA 1DQLH 3ULUH 3GSVA 4OGAC 4P3WA 4ORGA 3TWCH 3F7PC 1DBBH 2A73A 2UZIH 2GUOA 3H0TB 4K2UH 1NEUA 5E8EB 4LCWE 2AXFB 4EN3B 4M93B 3VFUB 3G08A 4NRXB 1YPZE 4O9HH 5C2BH 1MIEH 4Z18A 4WV1A 5F7KC 5ANME 1CFTB 2ZUYA 2DWDB 2DKSA 3GSXB 3RAJH 1SHMA 1BP3B 1TENA 2PETA 1OAZH 4K8RH 4XP6L 1FYTB 1J0KA 1BGXL 2W9LA 4K07A 5IGXH 3EO9L 1HNFA 3HNVH 5H8DA 4M00A 2VB5A 1Y0LB 2QSCH 1T5XB 3PUCA 4C55A 3DRTA 5KVEL 3MV7A 2EDTA 1VFBA 2PXYD 2YUZA 3K7UA 1BM3L 2EIDA 3NABL 4UT6L 3GI8L 2HP4A 5FO7A 4BZYA 3LQAH 4K23H 4JKPH 4K3GA 5TF1H 2PW2B 3E2HB 3K80A 2AK1H 1DEEB 4HV8B 2BCKB 32C2B 1HWHB 4R3SA 5T5NG 4AEEA 2R1WA 4Y5VC 4HWEL 1T21A 2VLRE 1VA9A 5SWSB 1EUTA 4GLRH 1YDPA 3VJ6A 4F2MA 4XPAH 4I5BB 3C09B 3S35H 2EDEA 3DARA 4YE4H 4YHKH 4YHLH 1MRCL 4JKLA 2IPKB 4Y4KC 2FNBA 5IB2B 3BPNB 4OF8A 5K9KA 4DVRH 2EICA 5EBMB 4CW1A 1T7ZA 4NRZA 1S5HB 2XI9A 4R97C 3CXDL 3MRJB 3V7AE 3PG2A 2NY7H 4Z76B 3FONB 1CGXA 3T8XB 1ITCA 4TRPH 3P4MB 4RSVA 1AGFA 3BDXA 4CVZA 2EDOA 3ROOB 2IMNA 2EKSA 3UJJL 3BGMB 3T0BA 5IW6A 1LNUA 3MUZ1 1WFOA 3OV6A 2PXYC 2YMXL 1U92A 1WTLA 2OL3L 3HAEG 3L7EB 1Z9SA 3LKOA 4FTVD 1WC7A 4Z7WF 3VFOB 1AE6L 4R96A 4OI8A 3MV9E 2NY4B 3TNMA 1FNGB 1KN4L 4HULB 2VR5A 4G8FA 2VLJD 5T3ZH 1LDPH 5DD6B 2A83B 4NHCL 5FHAH 2A6JB 1I1YA 2APXA 4YHIB 3EOYG 4HC1A 4Y8AA 5F9OH 1OARL 2ED9A 4JM4H 1LQSR 1RJLA 4MDIB 4WFFD 2JCCE 5DRWB 1SQ2N 4K3JL 4FQXD 5E5MB 1YECL 1I9RL 4P2RD 4ODSL 5KS9B 5C0BD 4MJ5A 3LKNA 4BKLA 5JLZB 3LCYA 1IBGL 1F97A 2CUMA 2B2XL 4U7SA 3LMJH 5HJ3B 5EBGA 2ADJA 5SV4A 4OZFA 4HIXL 4QHNB 2HT3C 2XTJC 3NCYS 3ILQC 2AVGA 3RNQB 4QRPB 2X4NB 4XNUL 1G7LA 1JVKA 2OTWB 1T20A 3E0GA 5I1DB 4QRSB 8FABB 4HWBA 1A6WH 2AJUH 2Y6SD 2NXZC 4M6AA 5EIQA 5IHUH 4WO4D 1MHPL 2W9DL 3O4LB 3WIHA 4X98B 4ODWA 1DN2A 4UV7H 2IQ9H 5IEHA 1BFVH 2D03H 3DXAB 5F1KC 2EDLA 2Q3ZA 2KL6A 3QIWD 1AXIB 5DS8B 5E0QA 5TH2B 4UIMB 3OAYK 3BPCA 1A21A 5GHWL 3SDDA 4KDVA 4MCZB 3ULUC 4FFVC 1YNLH 2D9QB 5CEZL 3HNSL 4U1IA 1Q9OA 1FAIH 5GZOD 2FIKA 4HKJB 3NIDF 4D9QD 3MYJA 4PLNC 4WJ5A 4P9HC 4DKDC 4QF1B 3SKJH 1LP9A 4HXAL 3QEQA 2VDML 2CDGB 4JN1H 4ZUVA 1HINL 4IRJB 5C0AA 2QKIB 3OB0K 4LVHB 1EA9C 1RURL 4JB9L 5MEPB 5A16A 3U7YL 4ZUSB 3QULB 4HKXB 1U8HB 4G9FE 5JW4N 4W4OC 4LCYB 3VG0H 5EU4A 1E4JA 1KYOJ 1PBYA 1A3RH 4FQXB 4L3CA 3T0DA 4RMWA 4Y5VA 4YNYA 1YNKH 3TVMC 3FRUB 3U9UA 4O02L 3MODH 4S1DD 3C8HA 2GTZB 4JO1H 5D1ZC 3LQAC 2VZSA 3LS4H 3VRLF 3O2VH 4Y4KA 4QRRA 4WO4C 3HZMB 3G6DL 5DD1H 5HTSA 1U8IB 4WHYG 3MNWB 2H6PB 5HHOD 1L4IA 4AG4H 3BP6B 5F71A 3HB3D 3NPZB 1JF5A 4G5ZH 2G75A 1ZK9A 4I3RL 1FO0A 4NKOB 3U30C 4PJEE 2YKLL 3FFDA 1FNEB 4PRNB 2E7LC 4WI7A 5EU6E 3KYMB 2OBGA 2PXYA 4HF5L 4QYOB 4H5SB 2V7NB 4IDLA 1S78D 4OZFG 1YMMB 2COQA 2Q8AH 1LEGA 3CU7A 3FQUB 2VAAA 3CDCA 1FNFA 2X9XA 4KKAC 5ISZB 1LMKA 4P57A 5CP3A 5KSAD 5JW5A 1V3KA 1T5WA 5EU7E 2ORBL 1NGQL 1REIA 2W65A 3SE4C 3V9FA 2NY3C 4XVTH 4N8VB 1AKJB 3WS6C 5D5MA 4F7EB 1KELH 5I9QC 1KENH 5D2LF 3FOMB 3LEVH 4KMQA 5D8JL 1M1SA 3O9WC 1HH6B 1X5ZA 2F53B 4RNRA 1DSFL 2UZXB 3MLYL 1IC1A 3HR5B 4H25B 3SE9L 3MFGB 3L3JB 1ZA3B 2AGJH 5EH1A 4KI5C 3AB0C 3FQRA 3VU2A 4UTAH 1SJEB 3H9SE 2BXYA 3VXTB 1WQVT 1VEOA 3WDIA 3EZ8A 3GGWB 1K6QL 3U48A 3LOWA 5FYKH 3L3KB 1CFVH 5EC1B 1UZ6F 3SOBL 1FQ9C 1IGIH 3OKLB 3S34H 3LEXA 3LPFA 2EE9A 4LEXH 3ZKND 5JDSB 3I85A 5IK3B 1S78C 1HDMA 2B1HL 1TIUA 2R8SH 4PJAA 1Y6NR 2AJSL 4FTVA 4FS0A 2K1MA 4FQQB 3RI5K 1NCCH 5GGUA 3SKNA 2IBBA 3MOAH 1XGPA 4EIZC 3MRQB 3S37H 2BVQB 4MNGA 5A2KH 5J12B 4Q2ZB 1UXWB 4X5WA 1R5IA 2VLJA 3AMLA 5CGTA 5BOPA 3AM8C 4PRIE 4TYUA 2ZCKH 3T2NL 3SKMA 2MPAH 2YRZA 4JFPB 4TUOA 4PREA 4JANA 1ZHLB 5I19H 2PTTB 4YK4B 4ZTPL 4J3TA 3GMQA 4YUEH 2DLTA 4P2RA 5KSAB 5C0BA 3DPBA 1ODAA 3EFDL 4NM4H 1BBJA 3MJ8A 4Q6IB 5CJXC 4WDIB 2UY6A 2XZCL 4OLYL 4W4OA 3BP7A 1AQKH 1NCUA 1N64H 4YBLC 1FSKC 4DK6A 3B3IB 3NIFF 2APTA 5J7CC 4X8JA 1MFEL 2I27N 3IU3B 3TVMA 5FYJE 1KLUA 4JFXA 1T0PB 5DC0A 3LKQA 3MZGB 5E9DE 5D1ZA 4OV5B 1JZ4A 2VN7A 4HD9A 4WO4A 3O3AA 2BSTA 3VMNA 2C3VA 3W0WE 3IDIA 3FO9B 5CD3A 4HFWB 3DYMA 1TQBB 1Q9WA 4DKEL 3QXUA 4U1GC 1KTDB 3LD8B 4GW5B 4L9DA 3BH9B 4CVWA 1S9VB 3CFKB 5ALBL 2VR9A 3EYQD 2YPLE 3SKOB 1UADC 5CP7B 4HHAB 4I3SL 1OD9A 1JUFA 1NBQA 4X9IA 2DB8A 3D1MC 4OZ4B 5MEOA 1FVEB 1KCSH 1SEBA 2E7LA 3IAGC 3IDYC 1U3HD 1VESA 2VERN 2VXSL 2VAJA 2LVEA 1QSFE 1KF9B 3SO5A 1XGYH 5EZJB 4KKCD 4LSPH 4LPVA 2AJYL 3OR6B 4JFHE 3ARYA 3MA7B 2X44D 3FN9A 1KIRB 3L95A 1RIUL 5ITBH 4XGZA 3RX5A 4M7LH 4HKBA 4M5ZH 2DQEL 4UDUB 2C3WA 3R8QA 1T4KA 3TH4T 2A1WH 3VXMB 1IGCH 3UYOD 2F58L 2FJHA 3H9ZA 2GTWB 1KB9J 1NFDE 1AXTL 4ZFOB 3JV5A 1U93A 2Q87A 5B3JE 4R4FH 4HMDA 3FFCB 4KK9D 2I9LB 4J3XA 1JWMB 2NX5A 4LDLB 3ET9F 5HHOA 3TZVB 2QSVA 3ILPA 5TDOB 4NOFA 4RISH 2XWBA 2HFGL 2Z0BA 4OT1H 4DUWA 5JIKA 1TETL 3W2DL 4IIQC 3D0LA 4AEFA 3EYQC 1MJ7L 4ZD3L 4KHXL 4Y2DB 4YBHA 3TJEL 5CIPB 3NH7H 4GAYA 1I1AB 3GJFK 4K7FB 1Z0NA 1M7XA 2E9JA 3HZVA 1U3HC 3DROA 4KI1A 4DZBA 1OAXL 3D9AL 3S4SB 4PJIE 4KKCC 2W91A 2D31B 1ZVHA 1JPTH 1N4XH 4DGIL 1HNGA 5DD5L 5KSBA 4QRUB 5T1LD 3MREA 1ZAGA 5E7BA 3ZDYF 1VENA 3ARUA 4EBQH 3QUZD 5FFLA 3NZ8B 3QG6B 4H88L 3W9DB 3AM8A 4DQOL 1P7KB 3GUTB 3VXOA 3RKDD 2E8YA 4KJWD 2YK1H 3FRPG 4C4KO 1P84J 1DUZA 1F6FB 3B9EA 1SMOA 1G7HB 1UCBH 1MLCA 2QQLL 5IBUB 4F9LA 3L5HA 2J8UB 3T2OA 1JGVH 5HHMD 3FT2A 5CCKL 3Q1SH 1UJ3A 3I2CL 4LSUH 3MYZA 4GAGH 2PYEA 2H2SD 1E4WL 4HZAA 5DMGD 1KCUH 2JLLA 3P9MA 1GOGA 1EV2E 3LPGA 3L5XH 1PQZA 3I3BA 3QISA 5CD5C 1S7UA 1H15A 1XF3A 3BIKA 3CDGB 3NIGE 5BZDB 3WLWD 1FL5B 2BNRB 4J4PD 4N8VG 3QFDA 4OUUA 3QI9D 1XGTA 3UXFA 1RUKH 4YHYB 3MRPA 4H1LH 4I13B 4JFEB 1UM4H 1CFSB 4NQCD 3DVNA 2YN3A 2LU3A 4N68A 4OZGB 3EOAB 1JFQL 5JXAL 4HW6A 1EH9A 5GZND 4UAOC 4KXZH 3V8OA 3HNTH 5F7YC 3TA3D 4WW2A 4YR6B 5JZ7D 2XKSA 1JNHA 5T1KD 5F1OB 1OT2A 2V2WB 4P59L 2AEQL 4I0PD 1N5AA 2XQBL 3O6LH 4QHMB 3GI9L 4F8TA 4QXGL 5EOTB 3QCTH 3RUGA 4M43H 5T1LB 3OKOB 4JFFE 5LJYH 3QUZB 4ZS6D 4LSQH 5IP4A 4D0DA 3T1FB 4AH2B 3EOTL 1BX2B 2R69H 2KUTA 5D7SL 4EUPB 5MEQB 4R7DA 5HI4D 4AM0B 2B1AH 1DLHB 1AQDA 2Q76B 1RMFH 1DE4A 4XMPL 2OR7A 3SDXF 2HKHH 4M7ZB 2WINB 3EHBD 3WLWC 1A7RL 4J4PC 5HYSG 2DWEB 3CNKA 2P46B 5IFAL 2WBWB 4LSTL 2XWJB 1AD9B 4LU5L 5DDHB 2H2PC 3L1OL 4NN6C 5GZNC 4L9LB 3NFNA 2PYFB 3SHSA 5HGAA 4JDZB 3TA3C 4N8CH 4ZOEA 4X99A 4F7TB 1WV7T 4LCIL 2EE3A 4LFHG 2AJXL 3CVHH 4N0UB 5F44A 1VFAB 2AV7B 5DHYA 7FABH 2VDRH 1P9MC 1RK0B 2GJZB 1RULL 1I8IB 3BESR 3RNKA 2LFGA 3NPSB 3DHJA 1CGTA 4GKNB 1BQHG 5CAYB 1U3HA 4LPWA 4DZ8B 1ACYH 5JOFB 5A40E 4HSQA 2YC1A 4ZS6C 2W07A 3CIQA 1NSNH 4XCNA 1ZWIB 3C60C 3ZTNL 3IETA 3MLXL 5C08E 5BV7C 5IHLB 2DM7A 1QRNE 3JTSB 3FO2B 4RWYL 1PEWA 4OZIF 2HLAA 2QQKL 3TLRA 3WXWH 5J57B 1UM5L 5KSVA 3D39B 3QUMH 1O7VA 4FABL 1JZ3A 3MGTA 2BNQB 3RDTB 3RY4A 3T65B 2A0LD 1I8MA 2NY1D 1YQVL 5DEZA 2BY1A 1MVFA 1IC5L 6FABH 5JW4R 2DQHL 1JHTA 4N8PA 2C4XA 1X9QA 4LLYA 3C5JA 3OKNB 4JR9L 5E08L 1G84A 4FQIH 3SDCD 3IXAA 1J8HD 2H32H 3OZ9L 1BD2D 4JRWA 1QG3A 3C8DA 4YXLL 3LKRA 3HAEH 4GKOA 1G0YR 4LMQI 3MJ9L 1N2RB 3OMZA 4FXLA 3QDMB 4KJPC 4BFGA 4X4YB 1N7ML 2Q8BH 2X09A 1MHHB 3BZEA 2CO7B 1F6AB 1OP3K 2DMKA 4P2QB 3C9NB 5FF6A 2Q1EA 1JYXA 1XZ0B 3QDJD 5MP6L 1F3JB 4RFEB 5FYLE 2MQ0A 4GBXC 3EOBA 5EU5A 3V2AR 3U7WL 2JIXA 4QNPE 5E8OA 1INQB 1CGWA 4KKNA 4NN7B 2AXGB 4EVNA 2A0LC 2J4WL 2NY1C 2NY6B 2X4TB 4ZFFA 5EORH 5A2IH 3D69A 3VRJA 4V1DA 1R5WB 5K33A 2RFXB 1AXSA 3KPNB 1DLFL 3GBNL 4XB8A 5ID1B 1X5IA 3KS0H 3H42H 3AS0A 2VISA 3S97C 4HBQA 4JZJC 3CSPA 5F8QC 5IB5B 2OP4H 3O6FB 3TV3L 3FQTA 3QWQB 4L8BB 1XIWB 1CLOL 4W81A 3ZE0F 1F11A 3KLAB 3FB5A 5BXFB 4J4PA 3QI9A 1R24A 5GS0C 5TGBB 2IGFL 3UYRH 3A6BH 4NQCA 5KAQG 5IBUG 4NNYA 1K4DA 4FFZH 3C8KB 4BH8B 3TA3A 1L6XA 4LLMA 1I1CA 4PGJA 2EE6A 3V0VB 1NLBH 5T1KA 1P6AB 5IQ7H 4B41A 2VITA 1MJUL 3EFFB 4X7DC 5TDPB 4XPGH 1P9MA 4I0PA 2XFXA 5HDQH 1NCWH 3TIEB 4XPFL 4IDJL 1Q0YL 1EGJL 4CRPA 3WJJC 1BEYH 4F3FA 1ZVYA 1JN6A 4KWUA 1G7IB 1CDBA 4YX2H 4Z0XB 5DR5H 1HHHB 1P4LA 4JY6A 1PY4A 5JPNB 4PGEB 1C5DA 3C60A 3LRSA 3EJYD 3OGOE 4ODTH 3WIIL 4MS8C 2Q20A 2OSLB 5BOZG 3QIUB 2DL2A 4FXGB 4BSJA 4G6AD 2GAZB 3FQWB 4GS7B 1DFBL 4HXBH 4LEOA 5I15H 2MKLC 2R2CA 4UILH 3N9GH 2XA8L 4OD2A 3VXSE 5F6HJ 3D3VE 4RRPA 4OB5H 5JA9A 5I1JL 3CX2A 3HUJB 4R8WL 4BK4A 1ZLUH 2HRPH 4OGXH 5C0RH 3H8NA 4WHYH 3WEXB 4Z78B 1U8PB 1D9KB 4RFOL 2CRMA 5DO2D 1I3RB 1KEML 1AHWB 1UEMA 3UJIL 4LCWB 2BVEA 3FOLA 4K7PL 3RL2B 1Z5LB 3DUHA 4MQXD 1YPZB 5DMIH 2A74B 5DVLA 5IR1B 3TPKA 1RJYB 3CXHK 1J9CT 4F7CA 5ANMB 4QXTB 1DQML 1SJHB 2HJLB 2GK0B 5I16A 1AP2A 5INDB 5F8RC 5JORA 4LBEB 3RPKA 2VUYA 1MFAH 1ZHKA 3QNYA 3AMKA 5SX5H 1EJOL 2FH8A 3WDJA 3VGAC 4JFDD 1EZVX 5KANG 3EYSL 2EC9U 4E42A 3EJYC 4PV9B 1OTUD 3E3QC 3X3FH 2NY2C 2W60B 1T7YA 1JNLL 1N8ZA 2EDHA 5K9QI 4JFQB 4Y16D 1NGPH 1UKSA 1ND0B 4PJBA 1IEAA 1NUDA 2C1OB 4GRMB 4J3WA 4U1HA 4LOUD 2XNAA 2NY5H 3OPZL 1XF5B 1OP5K 3MJ7B 5T5FH 2WBJD 3P4LA 4KK5D 2FX7L 5KN5B 5EOCL 4MMXC 4KTYA 2VLRB 1JPSL 5IESH 1OGTB 5C2UB 1NDMA 5DO2C 4G7YH 5LG1A 1JK8B 4WUKH 4C4KT 5DZLA 1OB1B 2V2TB 2YD2A 4MA8L 1JGUL 3SDCA 3WL9A 5MEND 4NQTA 1T0NA 4YHPB 1OSZB 3ZKXB 4PGDA 1J8HA 3X14B 1BD2A 3STLB 4X6BB 1MFNA 3NBNA 3PP4H 3WJLC 2YOCA 2YA2A 1NFIB 2ZUTA 3HI5L 1E6JH 4JAMB 1BVKA 3UTTD 3V6BR 3WFCL 5DEFA 1MAMH 4DN4L 4XC3H 1QR1A 4HJGB 1I7UB 3QR2A 4HEME 2EC9T 4GSDH 3QDJA 1TCRB 5BJTA 3VG9B 1URLA 4L8DB 3R06B 3ULVL 3UTOA 3LSOB 3H2WA 1ZTXL 1Q0XL 3V6ZB 3WUWB 1AC0A 3MV9B 2P8LA 3DYPA 4X4ZA 1EPFA 4W4NA 2HT4D 4G3YH 5LQBL 2Y5EA 3EYOB 2WBJC 3HS0B 3QEGL 5ALCL 4Y19E 5D7JC 1WCBA 1A3LL 2IALA 2JCCB 3I6GB 3DVGB 3DX8A 3LIZL 3LV3A 4PY7A 4LGPB 4OF6A 3QNXA 3CDYA 4EI5D 1NH6A 4OLWH 1L0QA 5CSZB 1FZOA 2NTFA 5C86A 1SYSA 1LO2L 1MNUH 1U3JA 1D6EB 2FATL 4OQTH 4CNIA 5JR1L 5FCSH 4PJGA 3WKMH 1NEZB 4MAUL 5D1QD 4IMLB 3QXVA 2X10A 3UTZB 4J3VA 4RIRA 4IOIA 1LE5B 4M1GH 4I2XE 1QSZA 2EH8H 1WZLA 4NC1E 5CMAB 4PIRF 3W39B 3HA0A 1DL7L 4KJQD 2HFEA 3L6FA 5T3XD 3OKYA 2VDPH 3QQNA 1IGFH 3K4AA 3TBVA 3KPRA 2WUCL 5AUMB 5KVMC 3ESUF 3NFSL 5MERA 4UB0H 3LN5A 1UT9A 2ICWI 1FV1A 2ZKHH 3LHPH 1DQJB 3MXWL 3VI4F 2VLKD 5DURB 4NHUB 3RGVD 1ZANL 1T80A 4NWTH 4B53A 2HT4C 5ABDE 4JM2F 4MZ2A 1IM3B 5F1IB 1IC4L 1LO4L 2JTDA 3CLEL 4UU9B 1T1XA 3B4NA 1OQXA 5LWYL 4K3DH 4IS6A 3MRGA 5LGHH 4HWUA 1TJIH 5D7KD 3SKUD 4K3EH 5F7DA 1S3KH 1B0RA 3RWJB 5BS0A 3CFEB 3MRHB 4S2SA 2ADFL 3PF2A 1KG0A 4F15C 5F1NA 1IFHH 4AEIH 1R0AH 2Q7NA 4G8GD 1X5JA 1MREL 3MLWH 3O2DA 4G9FB 4JCMA 2R0WL 4EN3C 5C0CE 1RZFL 3V0WL 3INUL 1FN4B 5GJSL 1OTSC 1K2DB 3RPIA 4G6KH 1DQDH 3PIQB 5AEAA 1HI6B 2VZTA 3ECBA 1Q72H 4X9BA 4L4TD 2AKRB 2R56H 1FLRL 1MY7A 5E8PA 3QRGL 5E5UB 3QXAB 1OLLA 4YHZH 2VE6A 4WI3A 1AGBA 3ZMRA 2Q6WB 4HS6B 3AS1A 3PQYB 2P5WE 3NGBC 3TBTB 2NYYD 3WJLA 3OGCB 4OM0L 1EXUB 3D85D 2W0LA 3RGVC 3THML 2NY5C 3RWCA 4MAYB 2AQ1A 1KCRL 3E8UH 4PJEB 3E2HC 4CU6A 3S3SA 4JFDA 3KLSA 3VDCA 4OGYL 1BLNB 1Y6MR 3SGKC 3T2QA 5EU6B 1G9NL 5AYUH 5K9QG 2V17H 4UBDC 4Y4HB 4X7CC 3BSZL 4L8SC 4NZTL 1QBLH 1A7QL 4Y16A 1FFOA 4KROB 4PP1C 1TVHA 2VC2H 4G42B 4HIIB 2ICWA 3C09C 5C07D 1U8JA 1CK0L 1GPOH 1U58A 5HYJE 5EZLA 4QHUA 2WBJA 5ICXB 5IVXF 1TZIA 1FVCB 3WFDH 1SBSL 1MFCH 2XG5A 4JN2B 3KYKH 4PJHF 4KVNL 1U8NB 2DTMH 3ZTJG 3TBWB 1UB5B 5MENA 1RVFH 2NW2A 4TVPL 4MJID 1GL4B 4O2FA 5CSBA 5GISH 4PR5A 1CLYH 4OLZH 1KYOK 5D4QA 2NYYC 1OL0A 1DN0A 1C08A 3PDDA 4D0CA 3H9SB 1SVZA 1FCGA 1FG2A 3UTTA 3BAEL 1ZT4A 3P0VL 2NY4C 1PKQA 1CDJA 5IB3B 5I17A 2YPLD 1I7TB 1KTRL 4HWBL 5DK2A 5IJKC 2EDYA 5I8KH 3U82B 5EPMB 1H3TA 4LQFL 1NAMA 3MXVH 3WO4C 1QFWH 5FA3A 4H8WH 4ELMA 3V7AG 2ZG1A 2QQNH 4E41D 3OKDA 4LPYA 2ESVE 4PRIB 2ITCA 3O8XB 2UUDK 5IROC 4JFHD 4MXQD 2DQTL 2J6EH 3IF1B 5B3NA 1QSEE 4M61A 3V5KB 1KULA 3LEYL 3EO0A 1WFNA 1F58H 2V5YA 3DTXB 4Z95L 3P3YA 1XF2B 5DEGB 4CGTA 1FFPB 4EI5A 4TULH 1AY1L 5AZEH 4GQPH 4M7KL 5IW1A 5HBBA 1HH9A 5DUMH 4ZXBB 3BWUC 4HPYH 5DK3A 2BC4B 5EOQH 1I85C 1M05B 3HZKB 3ZYIA 3WHE1 4KUCF 3WUWG 3FHAA 2VXVH 5D1QA 1U8OB 4RBPH 4YHNA 5C71A 1RZIB 1MH5B 5JDJA 2FGWH 1F4HA 1MQKL 4DFHA 4UQ2B 3ARFD 1NAKL 1AR2A 1X7QA 2B8OT 4DN3L 3KYNA 3X11A 4U0RB 4XP4L 2YUWA 5FDYA 5D7LE 3VXNB 3UX9B 2BVPB 4EDWL 4PRHD 5E2TL 1IL1B 3UPRA 1V3LA 5E9DB 1PDKA 1HHIA 3K8LA 4XWGH 3IVKB 1KNOA 4PRPE 1UC6A 3P30L 4WTWA 1ETZA 2FBJH 3W0WB 1QHPA 4LNVA 5FKPB 5D9SA 1FGVL 2VLKA 2YN5A 3DYOA 4IBLT 3A6CL 4XP5H 1NEZG 3RGVA 1NMBL 4JY5L 1QR4A 3FQNA 1YY9C 4AT6A 1LO0H 5IB1B 1RUML 5T1DH 4JKKA 3BP4B 4MXQC 1GJIA 2GT9B 5EN2A 1FO0L 1DVFD 4PUBH 3HMXA 4O4YH 4ODHL 5DJAB 5F7WC 3AXLA 1UA6L 1U41A 3OJDA 4OF3A 1T03H 4L8SA 1QSFB 5EUOA 3EYVA 4S10A 4ZTOH 3O11B 1SM3H 3B5GA 3DO7B 2AP2A 4MHHI 4BH7A 1X4ZA 2AJVH 1OPGH 1D7FA 2VQUA 4G8GA 1F4WH 4YFLF 4YEEA 5H94B 1IAIL 4V2CB 3SN6N 3P11H 3K4DA 1MVUA 3ARFC 2DYPD 1HSAA 3BEVB 4KAQL 5DJXA 5B8CA 2Y72A 2UWEE 4KV5E 1ZGLM 3LRGA 1NFDB 4XRCB 4L4TA 1A6ZB 1ADQA 1AGEA 4Y1AD 2XN9E 2FYYA 1WT5C 2JK5B 4NQEE 5T1MB 2H1PH 4JRXB 2PTUA 5DF0A 3ROOA 4APQD 5D6CB 2HJKB 3PWJB 5FHBL 3D85A 4HIHB 2J8HA 3RWHB 3LH2H 3QQ4A 2A6IB 3IGAB 3L3GB 4HWNA 4LRIC 3NOIA 4J7RA 4U6XB 5DJYA 1MJ8H 3MRBB 4O2CA 4KH2A 4NQDD 3L3IB 3H3PL 3EW3B 3MLVH 3BDBA 2BERA 2BSSA 5BO1H 4NZUH 4HLZG 2E9BA 2CRYA 4OD1H 5IJKA 3NCMA 3Q6FA 5I18L 4PJIB 4HWZB 3G5ZB 4ZUUA 1RU9H 4NBXB 2XXMB 5I1KH 3G5VB 5CIPH 1L9MA 1UJTA 1OM3H 1DBML 1EAPB 3VXPB 1J0HA 5E5MA 1DVFB 5C07A 4HUWB 1BZ7A 1OAQH 4P46D 3ULVF 5A43C 1KCKA 4J1UB 5IROA 3OXRA 2X1OA 2X1QA 2BMKA 3SDYL 4JFZL 1A14L 4E0RA 3MRKB 3P40A 4X7FC 3ULUL 1D5XA 2W0PA 3TWCL 4IM8A 1DBBL 3FO1B 3TT1L 2FD6L 5CLWA 3O45B 4P9HL 4U6YB 3LKPB 4JG1H 3NTCH 4MJIA 5C2BL 4O9HL 4LLDA 4APQC 1EEZA 4R4ND 3I6LE 2DYPB 5DUPH 4RZCA 4JGJA 4RWHA 2G9HA 5I1CH 1MCDA 1UG9A 4YPJA 3ARSA 4Y4FD 2DAVA 2J88H 4N0CD 1KB9K 1OAZL 4LF3B 4J3SA 5IGXL 3HE7B 1OSPH 3MROB 3OB8A 5ACZA 5J12C 2QSCL 4P4RA 2Z91B 1V7MH 5C0FB 4H20L 1CVRA 2ZOKB 1PYWA 1F4XH 4KU1A 1ZHBB 3LQAL 1T89C 4HAGA 1A6AB 1GZPA 5EZOL 2R4SH 5TF1L 2OLDA 3MOBH 4I4WB 3B43A 4NC0B 3MACL 4WI8A 4YK4C 1NMAL 4E41A 3MFFA 4LLUA 3DHMA 4GG6F 1D6VH 5KOMC 5IJVA 1KGCD 3QA3B 4Q6IC 5GGTA 2QADD 4Z7WA 4D3CH 3FCTB 1AD0B 3PNWB 5C0IB 4JFFB 1MCPH 4XPAL 3RWDB 1ORSB 2XZQH 3I75B 1VGEL 3OAUH 5DSCB 3ULSB 4YHLL 4ACPA 4M8QB 5HI3D 4P99A 4IOFC 4HIJA 4DVRL 1FPTH 2H8PB 5DK0A 4KGJA 2GTZA 1QPPA 2IH3A 4MA1B 4Y4FC 4MDJA 2YZ8A 4N0CC 1E6OH 1XGQB 3NA9L 1P84K 3ARFA 4K94H 2NY7L 1WTGT 1PLGH 1TQBC 4TRPL 2A6KA 4EI6B 1FFNA 3QHFH 4FFWD 4EUPH 2GSIA 2ICCA 2ZJSH 2GFBB 5JW3H 4MNHA 1FZJA 4BUHA 4PRHA 1RK1B 1P7QB 2VABA 2EO1A 4Y8DC 4N90D 2ZG3A 3CJJA 5DJ6B 5DMKB 1WT5A 3HC0A 3VW3H 3KPMA 3DV4B 3UTQB 1XGUA 1Y18B 5IBLD 3SDAD 2E27H 3MRLA 4JPIB 4WFHE 4CN1A 1CWVA 2DM3A 2WUBL 1I8KB 2V7NA 5F9WB 3C6SB 4H0IA 4TSAH 4LRIA 1HHKA 3FQUA 2MQ3A 5T3ZL 2ZOLB 4J8RB 3S36X 1JZ8A 3UO1L 1M7DA 4QO1A 2QADC 5EU3A 2L4OA 4U31A 2Z4QB 5JIHA 2PO6B 2G5BA 4WI4A 4TSBH 5I1AA 3VFSB 5IQ9A 2I60H 1HIMH 1GC1C 4RMRA 4ZUTB 3TIDA 1S9KC 3T08A 5HI3C 5C08B 3KWWA 3MRIB 2JJTA 1F42A 2PW1A 1QRNB 3LMJL 3SCMC 4BSWA 3HMWH 1JZ7A 1O5DT 1DBJL 5GJTH 3PV6A 3P2TA 5J13B 5E94A 2OZ4A 4KRPB 4YXKH 2MMXA 4XMKL 5M94B 3TO4B 2P43B 3IFLH 3ALXA 1ZA3A 4YGAB 5JUEL 3TZVC 4NCDA 5KVDH 1INEL 4N9GA 5DUBA 4N1CA 4TUKH 4Y1AA 2AJUL 3PWUB 4Y2DC 4APQA 4YDJA 5CHNA 4MD0B 3UMTA 5IHUL 4OSUH 4Z5RA 1HSBB 5IBLC 1BIHA 4UV7L 2P42B 2IQ9L 2VZ1A 3ZL4H 2D03L 2N7AA 1BPVA 3JWDH 5CWSB 4ZQKA 5DJ2B 2KPNA 5CJQL 5E6YA 1A6TB 3OAZH 4ONHA 3VFWB 3STZA 5J11B 1HQRB 1YNLL 4NQDA 1J05B 5LCVL 4JDVB 5IMKB 4LL9A 1FAIL 4A6YB 4QWWD 5HSFA 3FO0H 3KPLA 4HCRH 4Z7VF 5IFHL 4AEHH 4AIXA 3SKJL 3VFNB 2ZNXA 4JN1L 3IJSB 3EO1A 4RGNE 1GHFH 5ACMA 4I0KA 3TYFB 1G6RA 2PTTA 3GMPB 1TVBB 3S98A 2BHYA 4FQLH 4P46A 1KXVC 4W70A 3VG0L 4G7VH 5ESQA 2NQCA 2ED8A 4LCCB 3MPCA 1YNKL 4JZOA 5I1GL 3MCKB 3B3IA 4GO6B 3MODL 2XWTA 3RU8L 4XNXH 3WHXB 4JO1L 4I9WE 2YUVA 4ZPVB 5IMMB 2AXHA 3LS4L 1NUFA 3BWAA 4L3EE 3C87A 5CINH 4YHYC 1A47A 2YRPA 4Y4FA 1IAIM 3KHOA 4YPGA 3TCLA 1B2WL 4TPRH 5IM7B 4LKCB 4OCSH 5D2LA 3QDGE 4G5ZL 5GRJH 5JPMB 2R2HB 2VZUA 4KK6C 1A9EB 3P77B 1XGRB 3HRZB 4QRTB 1NGWB 1JMXA 3HZYA 4LK4A 4LPCA 5SWQB 2MCPH 2NNAA 2G60L 3BH9A 4QWWC 3F7VB 1U2CA 2WZPD 1GGCH 2Z8WC 4ZOBA 1LO5B 2W92A 4JEGB 1XEDA 2YPVL 4ETQB 1K8DA 1I1FA 3I50H 2BY2A 4JREC 3G6JE 2ARJA 4D0BB 3O4OC 5CGMA 4K94C 3FB8A 1KJVA 1MHCB 1SY6A 3OR6A 1XF4B 1PG7L 3GMLB 3RJDA 4YHOL 1UYWL 2R0KH 4KRNA 5DRNA 2IADA 1A1NA 4XVTL 1XFPA 4UV4L 2N56A 3CFIC 5EA0H 4YWGL 4YDKH 3MMEB 1CXIA 3TBSB 1KENL 2BK8A 4CMMA 3VFTA 3LEVL 2GTWA 1JL8A 2R4RH 3VDBA 2HVKA 5GXBB 3HG1A 4ZUWA 1VADB 3SCMA 3W9EB 3VDAA 2AGJL 5FB8A 1N59A 4NPYA 4JVUA 2OL3B 2QHLA 4XNQA 5CEZD 4UTAL 3VXSB 1BIIB 3D3VB 4R2GD 4DUVA 4UT9H 3CSYB 1RQ5A 3D6GA 1CFVL 1ZLVH 3MZTA 2M26A 4F58H 3S34L 1IAKB 3T3MF 4LEXL 1X5GA 4M6OL 3DETC 1S7VA 3NPSC 2R8SL 1QQDB 1JGLH 1S7XB 4NQSB 3SDAA 3F7YA 4NDMB 4Y5YB 2E9IA 1J88A 3MOAL 4X83A 1A8JH 3QQ3B 3S4SA 4YHMH 4PGBA 5HXMA 5ENWB 2XPGB 3D25A 1G7MB 1CU4H 1EFXA 2MPAL 1CD9B 2EDRA 3W9DA 2QEJA 4PJDE 2ICEB 1TPXB 4JLRB 1ED3A 2CLRB 4O58L 4Z7QF 4YUEL 2YR3A 1KC5L 2F8OA 4NM4L 2QR0A 3RDTC 3X13A 1NL0H 4MJ6B 4O5LH 3KPQA 4NO2B 1Z9MA 4HG4J 1A3QA 1QTYT 4ELKB 1AQKL 2O93L 3BW9A 1N64L 3WN5A 3MRNA 3KPSD 2VL5A 2BFVL 4MVBD 3OX8B 3ZTJH 3SPVA 4LARH 4R2GC 4K71C 1NJ9A 5ETUA 5I73B 3AVEA 3KR3H 4WU7A 2DLFH 5J1AB 5A3IC 3BHBA 3EJZC 3RTQB 4FXKB 3MRMA 3ULUF 3CH8A 4G6JL 2EXYD 1MQ8A 2YZ1A 3G5XA 3P73A 5GSVB 5J6GB 3O3BB 4L1DA 4PBXA 3ZZ1A 3GBMH 1D5MB 4WEBH 3T3PF 1N0XL 5D1XB 2HMIC 3U4EB 1RFDL 3MV7E 4L8CB 1FG9C 3D5OF 1S5IL 1QBBA 4MCYB 4X6EA 4AL8L 2JB6B 1CQKA 1KCSL 4HS8H 1T22A 3BUYA 1NCAH 3OL2A 3QAZB 4YAQB 2V5RA 4WFEE 3KYOA 4PB9L 3LAFA 1AIFB 1N3NB 2ATKA 1XGYL 4OLVL 3OG6B 3IJHA 2FWOB 4DKFL 3GJFA 1YYLL 4KKLD 4HK0A 3CGTA 1GYAA 1KXQE 5ITBL 3T1FA 5FDWA 4M7LL 4M5ZL 3O3EA 1CFNB 2X1WL 2A1WL 4MVBC 1IGCL 2EKJA 3EDKA 2DI7A 1CE6A 1BJMA 2IFFH 4KKBD 4PTTA 2FL5A 2Q7YB 3RIAK 4AM0A 3BZFA 2JB5H 5F3BB 1LEKB 4XVSL 5ERWA 5J56B 4OFVA 1I9IH 1XIWC 1CL7I 3TYGH 1PJ9A 4Y19B 3JWOC 3X3GL 1G7JB 2Y1VA 1OCWH 1EJ6A 5DGQA 1MEXH 3K2UH 5BQ7A 3WCYA 5BV7L 5F93C 4XP1H 3BRDA 2Z92A 3TJHD 2DMBA 4RISL 5DDHA 1CD1A 2GITB 1W0VB 1UH2A 4DWHA 3V4VH 2ID5A 4RX4D 2OR8A 3PDOB 4AENA 2BX5A 4Q0XL 2E8ZA 3NH7L 4DGYH 1BF8A 4I2XB 5GSRA 5C9JA 1DQTA 4U1JB 5E1AB 4LLVA 3VGDA 2QHRL 2VLLB 1A1MA 1YQ2A 4N9OB 2BOCA 5CZXD 2ZSWA 4P9ML 5DD0H 1N5YH 1JGEB 4OCYL 2B5IC 3GSNB 4P3DB 4EBQL 1HEZA 2CIIA 1G7PA 3V52L 4TVPE 4FQPA 1S9XA 5INCA 1EHAA 5JHLH 1S9WA 1G9MC 2I9TB 1NC2D 1ZE3C 5E2WH 4TTDC 2YK1L 5DQJB 1OWRM 3TN0C 3TESA 4JG0H 5BVPL 4ENED 4N5ED 1EMTL 3FAWA 4GT7A 3RDTA 2W0FB 3PWVB 3JV4A 3GIVB 3TT3H 3LN4B 1AGCB 4GAGL 4L29A 4GKSB 1D9KC 3TJHC 4HFUH 1KEGL 3L5XL 2EYRA 2YD7A 4JGUA 4OZHF 5C0CB 4XNMA 1MOEA 5I66A 5DWUL 1HYSC 1RUKL 5FIEA 5F7MC 2IPUK 1RUQH 3ARXA 4S1SL 2F74A 4G43A 1RJZB 1JPFB 4M1CD 1WJ3A 5I8EB 5DJDA 2OK0H 3SDXA 5CZXC 1UM6H 3VXUD 3HNTL 2AK4D 5EBWA 4G8EB 4C54A 4NYLB 3VXQA 1BFOB 2P5WB 4IHOB 4P2QA 5DGRA 3BE1L 5E00A 1UEYA 4XPTL 3KXFD 1LP9E 5HGGS 2MCG1 3QEQE 4HLZH 5C0AE 3FN0L 4OAWB 4X7EC 4UT7H 4M43L 5GS0L 1B6UA 1RZ8A 4URTB 3MJ6A 5I1EH 4ENEC 3HI1B 4KPHH 2EYTA 4P3CH 4LSQL 2R69L 3GMRB 3ZT5A 2CMRL 5BZWB 4R6UA 1N0LA 3V6FB 5SX4H 4XP9H 4JVWA 2VTFA 2B1AL 3KPSA 1CBVH 1RMFL 4CVXA 1DUYB 5TF0A 5DQDH 4KY1L 4QRRE 2HKHL 2H26B 3HR6A 2E6QA 1RHHB 1FVDA 5HYJB 3ZKXC 3QZWB 4PRDB 1FZMA 3OQ3B 4DEPC 4OZIA 5D7IE 4M1CC 1QLFA 1QFPA 1U91B 2F9BT 4HZLB 4N8CL 2BSRA 3TC9A 2C7UA 3VGEA 3SO3B 3MLZL 3GIZH 5DXWA 5F89A 4U3CA 5LBSH 3RWFB 2HFFA 3S96A 3H3BC 5FK9A 6CGTA 5TDPA 2CIKB 5DJ8B 5E8NA 2JJSC 4V2BA 4AYFA 2D7TH 2AJ3B 4YGVB 5E2UH 3FZUD 1WICA 1DP0A 4NGHL 1KIPA 5I75C 2XKNB 5KSUA 5C0NC 1KPVB 5HGDB 4M7JH 1MUJA 4M4PA 1K85A 4NT6B 5D5ME 5IUSA 1D5ZB 1NGXA 3WXWL 4JO2H 3EYFA 3I6KB 1FYHB 3QUML 3ZKQD 5GGSA 2IH1A 2ESVB 5SWZD 1CN4A 4FZ8H 3C08H 5DRXA 3TN0A 2UWEF 1FLTX 1QSEB 2GSGB 3DX6B 1EO7A 6FABL 9CGTA 3GHBL 4ISVA 1LK3H 1VDGA 2VKWA 2XTJE 3L3OB 4Q9QH 3N1QC 1VGKA 2EIZB 3MLTA 1F02I 4CADB 2DMCA 1ZT1A 5HPMB 3WEXA 4KQ4H 2EO9A 1TNNA 4FQIL 1D9KA 5DI8B 2X4RB 4UIKL 5J3HD 3ARBB 2H9GA 5CEYB 3F6IA 1L6ZA 2JELH 4RX4A 4N0YL 4PJAE 4FTVE 3VD7A 4OM1H 1OAYH 4RAUA 3QEUA 1A4JB 3M1BB 3EYUH 4MNGE 3IFOB 3FZUC 3G6AB 5D7LB 4Z7UA 3MR9A 2VLJE 5INDA 1KJMB 3RX7A 3BP5A 3MV8D 1MWAB 4PRPB 3S3PA 1R3KB 1FORH 4D2NA 1FHGA 2RCSH 4ODUB 4FP8H 5FYJH 2HVJB 3TPUA 4M1DH 3ZDXE 3C6LD 4P2RE 5C0BE 1NC2A 3HI6L 5IWLA 3BJLA 2QJDA 3ES6A 3QJFA 4X6FB 1LD9B 2ARJQ 3S5LB 4IRSB 1MPAH 1F8TL 3QNZB 5EORL 2GJ6D 3T0EC 1MFBH 5I0ZA 5C0JA 5IIEB 5DD3L 2DQUL 1KB5B 1QNZL 3MJ7A 2ZWLT 3UJTH 3QO1B 1E28A 5GRZA 4JM2D 2EE2A 4ZAKB 3Q6GH 1LK2A 1EEUA 4WCYH 4XCCH 5J3HC 3T0AA 4XCYB 1YMHA 5LAXB 1CFBA 2OP4L 2X4UA 1B6DA 3MLUH 3S36H 3V5DB 3CH1A 4KZDH 4MLSA 1IGMH 4ZOAA 3N1FC 1F3DH 1UWGH 3W11C 3M8OH 3QUYB 1VACB 5M95B 1QA9B 2DQFA 4HPOH 3A6BL 2UWEB 2UY7A 1FJ1B 1K8IB 1CICD 4FFZL 1JBJA 1F4YH 3VXUA 3S35X 1T3FA 2XN9B 2AK4A 4LLWB 1JNNH 3WLBB 3ARED 4NQEB 4RGMB 4D9QE 1NLBL 1MFDH 4HJGA 4CMHB 1H8SA 3IXTA 3MRDA 2BJMH 1WBZA 3ROLA 1TCRA 5IEKA 3KXFA 1NMCC 3WNNA 3CPLA 5HDQL 5GS1B 5FKAA 4C56D 1XH3A 1CZ8H 2HTLC 4L5FL 4KROC 5H2BB 4YX2L 1JJUA 3FQXB 4GG8B 1BBDL 5DR5L 3QO0A 3B2UD 3DURB 1BMGA 3SBWC 2DI9A 3C6LB 4P49A 3UAJD 2GK2A 3RVXC 5EU7C 1XR8B 1S8DB 4JM2C 4JPWL 4MXWH 5F7EH 4HXBL 4XBPA 3RVTD 2ZSVA 5I15L 5C0EA 3OWEA 4NQVA 4PJ9D 3N9GL 3IB4A 4F7PA 1DQQB 4OB5L 4LSDA 4K3HA 4OIIH 2XA3A 2NX5E 5DTFA 4OGXL 3Q3GA 5HHOE 4KI5E 5C0RL 3C5ZB 3B6SB 3H9HB 5L0QC 2MTPA 3N50A 4QHLB 1HKFA 2X70B 4PJXF 4H0HB 1YNTB 2DLGA 3HRPA 4U1KB 1J18A 1HHGB 3GNML 5DMIL 2OTPA 1LEIA 3FT3A 4GW4A 3V6OA 1T0MA 2EH7H 3T0VA 4E5XB 3CMGA 2GIYA 3OKKB 3HC3L 4NKMB 2DOCA 5AG9A 2HG5B 1RZKC 3QZWG 5KSBE 4NNXB 2NY0B 1MFAL 2GYSA 4X4MA 4LCUA 3B2UC 2Z8VC 1A9BA 3O8XC 1VHPA 4NZDA 3UAJC 4HDIA 5DYOA 3X3FL 4L3AA 1H3XA 3B9DA 4XCEA 2R2BB 2FBOJ 1MJJA 5IB4A 3UTSD 1NGPL 2CKBA 4DGVH 1P4IH 4PJ9C 2DDQH 4MGXA 2R23A 1YUHA 5SWZA 2A38A 2AABH 4G80B 4MA7H 2AW2A 4ZXBC 2NY5L 1SJVA 2PYEE 2CRZA 43C9B 5C09D 1BQLH 5T5FL 4GOSA 2AJZA 3T0EA 4QEGA 5JHDA 4JY4B 5IESL 2A6DA 1KPUB 4R4BA 4D8PB 1SVCP 3IS1X 4MQ7B 3EAKA 5E70A 1HI6A 2CR6A 3QB7C 3HE6D 2FJGA 5HDBF 4OKVA 3D18A 1TJHH 4I18C 1MCQA 3QXAA 4PJ7A 4LRNL 2YBRA 3DMMD 1JIBA 2JJUA 3PL6B 3PQYA 4NWUL 3NN8B 1JP5A 2XICA 4YQXH 1E27B 3IDJA 3DOSA 1KCLA 2C3XA 3U0PB 5LXGH 5IT2L 1BVLA 2A9NH 4FQ2L 3MUGA 4LNRB 3QDAA 2WWKO 3CFBA 5FA4B 2O5YH 1MAML 4KUCD 1U8LA 5IHZA 1KJ2B 3MV8A 1JPGA 2YD1A 2GEEA 1DBKH 2IAMB 3BJ91 5C6TL 5DFVC 1TZGH 3WFHB 2Y5TA 4NCC2 2LAAA 5A2FA 3G04A 1IMHC 3RUGE 2E5EA 2X4QB 4KUZH 1MCLA 3MRFB 2EDKA 1EO8H 4LVNB 2C1PB 5IHBA 1GGIL 4PG9A 4FN0A 4CAGA 4ZS7H 3IJYB 1J87A 5L88H 3HC4H 2GJ6A 4JFYA 1KT2B 5JTWA 5ITFA 1A02N 4EDXB 4I0CC 5C8JB 5MI0B 2YPKA 3DSFL 4JM2A 4OF5A 1J0JA 4JN2A 5TDNA 1S9YA 1U8NA 4OQTL 5IMOB 1A0QH 5IKCB 2Q86A 4NRYB 1BREA 1A2YA 3SY0A 5HHXL 5HHPB 1KIQB 1Q9KA 3BXNB 3R1GH 5D2NA 3S5LG 3WFEH 1MCNA 1EHXA 4P4KD 3KNBA 4PRBA 4S1QH 1IRAY 2VWEE 4KK8D 4KVCH 4X4XA 1P1ZA 4C83B 1CICA 4YC2B 3ZE1F 3PWPB 2JF1A 4XBEL 3AREA 4NQXB 4ZSOA 2DQDH 5FO9B 3KPOA 4UB0L 2VH5H 2IQAA 3G6JF 4P5KA 3IFPA 4C56A 5JA8B 5B4MC 3LKSB 3WS3A 3OHXB 1A6VL 4NWTL 3GSOB 2AEIT 4XXDA 2EDWA 3DIFB 3MUHL 4YXHH 5E6ZA 3D2UB 1NGZA 1RHFA 3LZFH 4PFEA 5JW4M 3H6JA 2F54D 1RUPL 2G5RA 2ZUVA 5GGQL 4MXVE 2DD8L 4K3DL 2FLRT 4X5XB 5LGHL 1TJIL 1INDL 4J6RL 3GMMA 2RBLA 4RGNB 2W1NA 1Q9LA 4FQCH 4LKXA 2X4OA 1IC7H 3PWNB 4YDLB 4WTZA 4X6DF 1R3HA 4A6YH 4PJ9A 5LGJB 1FNSH 1XCTB 2DQGH 3C2SA 1R0AL 2XYCA 2DBLL 2J5LB 3MLWL 4KTDL 2R2EB 5T5NF 3V7MA 3UYPA 1FDLH 1GGBL 1H8OA 1PSKH 5EFIB 2P5EA 3JUYA 1FL3A 1QLEL 5HDLA 3MLSH 1A6PA 4NO0D 1U95B 1DBAH 5FYLH 5F3HA 4JZNB 1IKNC 4HUVB 2FJFA 4O51B 2R56L 1QEWA 4HUMB 3JBG7 3KYAA 5FCUH 4DCQA 3VFMA 4P23D 3PGCA 3ULVD 5I8OL 5IVXA 4L3EB 2R9HC 4I18A 5HYFA 4WWKD 4ODVL 3JV6A 4UOW0 1CG9B 5KVGL 4R0LC 4PJHA 4M5YL 3VI3E 4YDIH 1BGXH 1YEFH 3RVWD 3QDGB 1HKLH 2R0LH 1CTOA 3BX7C 3E8UL 1PX3A 3MGOB 4P2YA 1FL6B 4I48B 4PJDF 4XAWL 5JNYB 1NBVH 1EO5A 3QFJD 4JQXC 4F37F 4F37K 2WIIB 1BM3H 1JWUB 4UT6H 4ZO7A 3RWGA 5GIRB 1QBLL 2P24B 1OAUH 3LDBB 2HLFC 3UTSA 5J0BA 1UWEL 2VC2L 4HUUA 3LN9A 4V1DE 3G6JB 5HHME 3MBEB 2GY5A 2NLJB 3MRCB 4AIZB 1UVQB 3M07A 3MO1A 1A1OA 4HIEA 2MOVA 2GCYA 4PRAA 5C09A 4WNQB 1C16A 4YIQA 5L8KB 4HWEH 3S9DB 4YFLI 1CT8A 4QOKD 3EDEA 1LILA 3KYKL 4MSWB 5FV2A 1VFOA 2DTML 4L4JA 4Q7DA 1KV3A 1YY8A 2IG2L 1MRCH 3L7FA 2FHFA 2ITDA 4KQ3H 4TOYH 2RAMA 3HE6A 1RVFL 1IAOA 1GGYA 5GISL 1CLYL 1EGJA 4PJFF 4WWKC 5IF0A 4NQCE 1F2XK 5HHNA 5KTEL 5KZCD 3Q48A 4HX1B 3DMMA 3PHOB 4P2OD 4JRXA 2HAZA 3LB6D 3AU1A 1H0DB 4PJ8D 2OZ4L 3LRHA 2XKUA 3QJHB 1PZ5B 4N1EA 4BFEA 4XCFL 1CXFA 4ZYKB 1MCSA 5DZNA 1IEBA 3UJJH 3QXDB 3IKCA 4GUPB 4G6FD 5JO5A 1OD7A 2OL3H 1S7SB 1A7BA 4ODXA 2NMSA 5H37G 4Y5XC 2X9WA 3IDMB 3OXSB 5I8KL 4JDTL 2Y07H 4LMQE 2OQJB 3I02A 3QUXB 1UB6A 3DV6A 1G7QA 4X6CF 1KN4H 4F7MA 4PLJD 4HWZA 1ZLSL 3KLHD 2FZ3A 3B9KB 1TQCB 4IJ3C 1W0WA 4K9EC 1R3IH 2RB8A 2J6EL 3IDGB 4NUJA 1J8KA 4I77H 4OLUL 3IDUA 3U7AA 1JHLH 4RAHA 1R5VA 4PJDB 1K4CB 1YEHH 3P0YH 4BZ1L 2R0ZL 2VDNH 4ODSH 2AEPH 3UBXB 3TO4C 4TULL 2FO4A 4XBGB 12E8H 2B2XH 3OKEA 4HPYL 4NKDB 1W8OA 3DGGB 4U1NA 5EULV 2EIEA 1FBIL 2X89D 3GSVB 2AI0L 4ORGB 1YEJH 3FN3A 3J8F7 2A73B 1HXMA 2GUOB 3LB6C 1H3GA 1GOFA 1AC6A 4W6WB 1C5CH 4PJ8C 1JF1A 2ERJC 3G08B 4P4KA 2FO1A 2V2XA 5I2IA 4WV1B 5CEXA 3N1PC 1IKNA 2K3TA 4QTIH 3ZYZA 2ZCLH 4LVOB 2ADGB 1ZLUK 5KG9A 5KZCB 3ARDD 1MY5A 2W9DH 1IQDA 4KRLB 3QEHA 2FBJL 4LHUA 4UQ3A 3QH3A 4PJCF 5HVHB 3PWLA 4GKZA 2QSTA 4R0LA 5C6PB 1WK0A 4XP5L 3ZE2E 2O61A 3DRTB 1A6AA 3MV7B 1S7WA 1VFBB 1LO0L 3QYCA 5JMRA 3HNSH 1I9JL 5T1DL 5FO7B 5K59E 2F54A 4MLIA 3D0VA 4PUBL 4DAGL 4JQXA 4O4YL 2CJUL 2YS4A 1KLGA 4PJBE 4L4VA 2VDMH 5CS7A 4LCCC 1YEDA 2D7OA 1T03L 5SX5K 2DI8A 4JB9H 1SM3L 1VFMA 5FOBA 4DKAA 4XVUC 4R3SB 4HJ0D 4HAFA 5T33L 2BVOA 3VE0A 2AJVL 2R1WB 3RVUD 1OPGL 1T21B 1F4WL 5I76A 1U0QA 1E4XH 3VJ6B 1YDPB 4F2MB 3FHQA 4QXUH 1IT9L 4NO0A 4OGAD 1Q38A 5K9KB 1J8HE 4U1LA 2OI9C 1BD2E 5ID0A 1YC7A 4CW1B 1IM9D 5BMFL 4NRZB 1MI5D 4P23A 2IAND 4HG4K 2H1PL 2ICWJ 4QGTA 1BOGA 4WWKA 4MX7A 1GC1L 5KVFL 3LQMA 1AGFB 4M4RA 4CVZB 5DMKA 4ZFOL 2DJUA 2NXYD 5C0GA 4R90H 2CLVA 2EEAA 2EKSB 5IW6B 3QDJE 1CVSC 1JWSA 4HJJH 1KLFA 1U92B 2LABA 1ZGLA 1B0GA 5HGBA 25C8H 3LKOB 1MJ8L 3IDNA 1WC7B 3QFJA 4HF5H 3O81A 1N26A 1VPOL 4R96B 1QVOA 1KCVL 5BO1L 4NZUL 3QEQD 4Y5XA 1QZ1A 4OD1L 4G8FB 2WWKT 1LHZA 1HXYA 5I71C 1I1YB 1RU9L 4X80L 2R29H 5DRZA 4HJ0C 3GHEH 1J1XL 1OM3L 3RVUC 5DFTA 3T0XA 2B4CH 2Y25A 2ZZUT 1RJLB 5J6HA 5FECA 2XRAL 2FSEB 4HMCA 1OAQL 1B88A 1NGQH 1A6UH 1CTNA 1YEEL 2EDXA 4MJ5B 4Z7NE 3LKNB 4QOKA 4S1RL 4BKLB 5D7IF 5HD8D 4BZ2H 3GSNH 5TE6H 5HVWA 1UQSA 3O3UN 4PJGE 1WISA 4GG6A 1I8LC 2ADJB 4OZFB 1Q94A 5D8JH 4XAKD 3CK0H 4Y4KD 4QRRD 4JG1L 3MLYH 2Y9RT 3SE9H 4LLAA 5I1CL 4KZEL 1G7LB 2NXYC 2HYMA 4P2OA 1JYNA 1H5BC 2J88L 2QLVB 4LDEB 4PJ8A 3B83A 1K6QH 1U3YA 4Y5YC 5GGVY 3KPRE 3OR7A 1RPQA 4LVEA 2D7PA 1BWWA 4ODWB 4QHKI 5KS9F 3SJVA 5IEHB 1U42A 5KJRH 2AJSH 2EYSA 3BPCB 4AK1A 2E7HA 3BGFC 3SDDB 4U1IB 1Q9OB 2D9CA 3MOBL 4XT1C 3VFNA 2FIKB 3MLRH 3MYJB 5IVNA 4WJ5B 5JQHC 4PY8J 3E3QE 1D6VL 5FAAA 1LP9B 4NFDA 5DJCA 4UDTA 3QEQB 1NCDH 2BXZA 4ZUVB 1ZSDA 4L1HA 5C0AB 5BS0E 4CJ1A 4D3CL 5HD8C 3NCFB 1LO3H 1OWWA 4HUXA 1MCPL 3NFPA 5HGHA 5ICYA 5CILH 3ZHLA 3OAUL 3VCLA 3BH8A 1JYWA 4L3CB 3M17A 4Z8FH 4OLYH 2D2OA 4Y5VB 2X89A 1RJCA 3VWJD 4YNYB 3WXVL 1FPTL 4J3OC 3DGCR 2HT3D 3U9UB 2XTJD 3ILQD 1ZLWH 1E6OL 1MFEH 4K94L 4GAFB 1PLGL 1K9TA 4Y4KB 4QRRB 5DVKA 2IC2A 1KXTB 4JFOA 5JW3L 3MCLL 5D1XC 2NXZD 2Z35A 3ARDA 4R97B 5D7IB 3UBXG 3VW3L 1EX0A 2G75B 3MQIA 4IRZL 3PJSA 1FO0B 1FH5L 2VL4A 4DKEH 1YN7A 2GQHA 3KLDA 4RGOL 5B38A 4JFDE 3FFDB 4KC3B 4HKZA 5ILTL 3U46A 3ZDXF 2PXYB 4Y89A 4M6NL 1AJ7H 3ULUD 4FFVD 2Z9TA 4ZNEA 1LEGB 3IYLW 2VAAB 2IEPA 4NP4L 3IDXL 3ORJA 3V4PH 1XF4A 3K0WA 4TSBL 1I7RA 3FKUS 5JW5B 2AJYH 2I60L 3QPXH 1HIML 2Z31D 1T5WB 5EIIA 4P5MA 1QFWM 2W65B 3VWJC 4Q58C 4K8RD 4NIKB 4Z7VA 2DQEH 5D5MB 1VERA 4F33A 2NZIA 3DUUA 4YXKL 4OFIA 5MENE 3SGEH 3IFLL 3VXRD 3WNKA 3TVMD 4JHAL 5E99H 1QOKA 2CDEA 4RNRB 1IM9A 1B3JA 1YN6A 1I8LA 4TUKL 1W72A 1MI5A 3V0AC 5D1ZD 2VZVA 3VXSA 2IANA 4TNVF 2XTJB 3FQRB 4OFDA 4TNVK 1IAII 3P0GB 4HUNB 1ZS8A 4O00A 4OSUL 3UTTE 1KFAH 3NCJH 4OJFL 2B4CC 3H3KA 1KPRA 1H5BA 1J1PH 1PKQE 3ZL4L 3A67H 3W2DH 1S7QA 3LEXB 4KHXH 2P44B 3KPTA 4EEEA 1WZ1L 3TJEH 1HDMB 1S7RB 4FTVB 3GB7A 3C5SA 5GGUB 1NBZA 3SKNB 3JXAA 4PJ5D 1XGPB 2CK0H 4HCRL 4ELME 1A64A 2DQJL 4MNGB 5HY9A 1FZKA 1JRHH 4XPBH 4X5WB 1R5IB 2VLJB 4NN5B 5DD5H 3L3HB 5EO9A 3SGDH 2Z31C 4KKAD 1GHFL 2DIJA 3PP3H 1CL7L 4HGWB 3BPOB 3CFDA 4TUOB 4K8RC 4PREB 4JANB 1NANI 1Z6JT 1KACB 4FQLL 5E8DH 4G7VL 3GMQB 4P2RB 1C1EH 1P2CA 5C0BB 2NY3D 1MWAH 3QCUL 1BBJB 3MJ8B 3BP7B 1CXKA 4ZNCD 3O9WD 4XNXL 3I2CH 3WNMA 3WIFB 4X8JB 1G0DA 5GRVK 2NX5D 1E4WH 3GMNA 5ESAA 1F3DJ 4TUJA 5CINL 2OS7A 4KI5D 3TVMB 1KLUB 3EBAA 1T1YA 5T3ZD 4TPRL 4JFXB 3RWEA 5T3XE 4QTHA 3LKQB 5D1ZB 1ORQA 1KB5H 2W9EH 5I6XB 4WO4B 4OLEA 3O3AB 4TSCL 2BSTB 5KSBF 2C3VB 3IDIB 2MCPL 4RBPK 5CD3B 1Q9WB 2VLKE 1JZ5A 2MSPA 1QLRA 3NACH 5JXAH 3QIWB 1GAFH 3JWOL 3GO1L 3P9LA 3R0MA 3ZSTA 1JUFB 3I50L 4ZO6A 5MEOB 2CPCA 1SEBB 2AEQH 4Z7OE 4ONFL 2XQBH 5D7KE 4ZFZA 5EUOE 4ZDHA 3B5HA 5E6ID 4DUXA 3BKYL 5ESVA 2FIRT 2P7TA 2QBWA 4KDWA 4G8GE 1VFUA 3L95B 5EA0L 4GRWE 4YDKL 4XGZB 3PHQA 4HKBB 2CUHA 4QT5A 1T4KB 3ME0A 5D7SH 2R4RL 3CCHA 4NJ9H 3OSKA 2GJJA 2XQYK 3QP3A 3VWJA 2PYED 2FJHB 5DHVA 4XWOD 4L4TE 5I1IL 2APBA 2YSSA 1U93B 2K7QA 4HH9A 4EKXA 3V95A 4CVUA 4EZMA 4GLRI 4P48A 3RL1A 1M7IA 5BVJA 4WW2F 1A7RH 1R3JA 1Z3GL 1G9ML 5GGRY 2NX5B 3SO3C 5IFAH 5HHOB 3ILPB 3C2AL 4LU5H 3B2VH 2XWBB 5F9JA 1U8MA 3PDOA 3N85L 3D0LB 3NZHL 4HT1L 2AJXH 4KHTH 1ZGLP 4GAYB 4LASH 1H3VA 4YHML 3HZVB 4WRLA 3DROB 3RRQA 4DZBB 1HK6A 4JO4H 1IAMA 5E6IC 1CU4L 5HYSB 2X7LA 1KUMA 5KSBB 3BO8A 4OI7A 3MREB 5C07E 1OF2A 4MNQD 1CXLA 2Z31A 2OXGA 3VXOB 3VD4A 1NL0L 4LAQL 4RWYH 1BQSA 4XWOC 3T4AA 2QQKH 5KW9H 1DUZB 1UM5H 4FABH 4FHBD 1WEJH 1MLCB 2VXTL 5CBAB 4OFKA 3VXRA 1UGNA 1RZGA 3FT2B 4MJIE 1BQHB 1UJ3B 4JKMA 2OMBA 2PYEB 2DKUA 5LVEA 3P9MB 5E4EC 4YBLB 1FSKB 3SQOL 4JR9H 1PQZB 1T04A 1FIEA 1S7UB 1H15B 1XF3B 3ZHKA 3BIKB 1RIHH 2O5XL 1S7TA 4OUUB 3OKMA 1Q8MA 1XGTB 4WGVB 3GBML 1RZJH 3MRPB 3AUVA 1T1ZA 1QSVA 1WUNT 5DJ0A 3DVNB 4YXLH 2VRAA 1KOAA 3T77A 1ZHNA 3MJ9H 5H37H 3MGAA 4RAVA 5KAQF 4PJ5A 4WW2B