4DAGL

Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
213
Chain Sequence
ELALIQPASVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQDSERPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site.
pubmed doi rcsb
source organism Human metapneumovirus
molecule tags Viral protein/immune system
molecule keywords Fusion glycoprotein F0
total genus 37
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagL01
1YNKH 4U1HB 3LQAL 3DXAB 4JPIB 4X80L 5EC2B 5SWSA 4IRJB 1NMAH 5FKPA 2EYSB 4M00A 2HFEA 1VFUA 3QJHA 1VENA 5DMKB 2XFXA 5EFIB 3NZ8B 1QSEA 4GG6E 3STBA 1FL3B 1BREA 3BP4B 3B5GA 1Q1JH 4XC1L 3V5KA 1OGTA 3I50H 2YUXA 3BD4A 4PREA 4ELMB 4BK5A 3BPCA 3HNVH 5ESQB 4LEXL 4ZOCA 1MVFA 4LF3B 4PS4L 5EPMA 1U8KA 3DX9A 2GJZA 3OGCA 5DURB 4HWBL 4J1UB 3P73A 1T1YB 4LLUA 3TM6A 4RISH 1QLEL 3QA3A 3QCVH 4E41A 2DQFB 4WUUE 4OCSH 2F74A 1OGAE 4XP5L 3K2UL 4Y4HC 1YEIL 3MACL 2DAVA 3E6FB 4MQXD 3TLRA 4NWTH 4G8FB 4KJWD 3STZA 3GBMH 4M7LL 1ND0A 1NBVL 3PF2A 3OHXA 5IR1B 5JW4M 4GXVH 5DHVH 2W0KA 5ESVB 4P5TB 3ZHLA 2Y5TB 4Y4FC 2IBGA 1W0VB 4ORZC 1OM3L 1M05A 3MRFB 3KPRA 1G7JA 3O3BB 4OFIA 4LCIH 2Z8SA 2X4TA 4PJ5E 2QHLA 1ZHNB 2ITDB 4XXDA 2XWTB 1H5BC 1ZHBA 4KK9D 1W72A 4OUOA 3O8XC 3RVXD 3MV8B 3TBTA 1IC7H 3ZDYF 1A6TB 2W60B 2DIAA 3F7VB 2J12B 2J5LB 1DLFH 1P4IH 3TWCL 1RULL 1XIWD 5JHLL 1IARB 1G84A 4M5ZH 4G8GE 3GSRA 3GSXA 4I8DA 3ARFC 5BO1H 5CD5D 4HXBL 1EX0A 4WDIA 5GGQH 4XCNA 4BZ1L 5KN5B 4WHYG 2UWEB 1MCOL 1N7ML 3LB6C 4QHMA 4RIRB 3QJFB 1U8MA 3ROLA 1IGJB 1CL7H 3F7YB 3P9LA 1G7QA 1CF8L 1UG9A 3LKSA 1LO3L 4M48H 4X6DB 4TUJB 5IHUH 1XGQB 3AREA 2GI7A 1GGCH 1MCOH 2EDKA 2Q3AA 1BEYH 4M3JA 1RZFL 2GFBB 3QAZC 5TDPA 3OJDA 5HYIA 3MNZA 3P0YL 4Y5XA 4ELME 3CSYB 3HMXA 4NNPL 2VKXA 4N8PA 1DSFH 5F6IB 4OLYL 4JKLA 3HZYA 3DNKA 1HK6A 1QSEE 1J05A 2AV7B 2CK0L 5I1JL 2J8HA 2H2PD 4JZOA 1QVOB 3SCMD 1ADQL 5CMAA 1ZMYA 1XF4B 2GK0B 2OL3B 5DJAB 2BXZA 4LCWA 2IANA 1MFEL 4PLJC 4M93C 2DLTA 4UQ3A 5CBEA 1XF3B 1WLHA 3ULUE 1R3IL 2HJKB 2EKSB 1PYWB 4HJJH 5I1HL 4NKDA 2AQ2A 3MRRA 1JTTA 5FUOL 1FFOA 3BXNA 3HC0A 1B6UA 1VA9A 5D5MA 5CD3B 4PLJD 3L7FA 1OPGH 4XRCB 2BSSB 1B88A 1JV5A 2CLZA 5C0IA 5EUKB 4LNVA 2W0LA 1MLCB 4Y2OA 4DJMA 4GW1B 3KLAA 1MCJA 4HT1L 4QHNA 4Y2DD 3MXVH 2AGJH 2IC2A 5JPMB 3DGCR 3MA7A 1OPGL 2VABA 3AMKA 4NKMA 1FNEA 3ALXA 4U6XA 4MD0A 2C7UB 5DQJB 5IW6A 1K4CA 4EUPG 1PQZA 4L3EB 4NC1C 4FN0A 1JJUA 5TE7H 3C08L 3X3GL 1V7ML 4K2UH 3S5LB 4P3DA 2WZPD 2WQ8A 3KPMB 1JPTH 4X9FA 4MAYA 3TZVD 3L5IA 3MV7E 1MJ7H 2XG5A 3KJ4B 4PJAA 3PGDB 2CDFB 3SDCA 4U3XA 1ZLVH 3ZHDA 2NW2A 5I15L 3MJ7B 1MPAL 3GBNH 1QA9A 4XBEL 3NFPA 4HKBA 4IOIB 4X4ZA 1BLNB 1HH9A 2D4FA 4AIXA 4ZG1A 5GRUL 2E6PA 2WWMC 2X05A 4ONGH 4NZTH 1ZAGA 4XPGH 1RSFA 4YHYB 5DFVC 4ODBD 1RZFH 1LO0H 2YMXH 3VXRE 4LHUD 4UINH 3LN4A 1LE9A 1TXKA 1YY8A 5T3ZE 5GRJL 4WENB 4PJHB 3MUHL 4MQ7A 2V9RA 5GRXG 1UKTA 1EV2E 1PKOA 4Q6IB 4UNTA 5IQ9A 5DJZA 2YPKA 4WW2B 1CZ8H 4L4VB 3NFSH 5I66B 5JOPD 4PJHE 4P5TA 5DO2C 3BZEA 1JGDB 3VXRD 3SKMB 3LIZH 4U6HB 2OL3H 1JK8B 4I3SH 4D8PB 3I02A 4PV8A 3VXSB 2CGRL 3QUMB 4NQSA 1T0NB 4LPXA 1KLFA 1CDCA 3L95A 4DKFL 4HQQL 1KCVL 2Y6SD 4U1JA 5C0NC 5FV1L 1ZKAA 1RIHL 1NGZA 3WIFB 2AJXH 3H42L 4DZ8B 1GZPB 4Z7UE 5ABDE 3U36A 4Z77B 1U8OB 1XGTA 1KTKE 5I8OL 1D3CA 2CGRH 1I1AC 3RWIA 3VA2C 3VDAA 1EEZB 1EO8L 1CXLA 3HR5B 3K7UA 7FABL 3PWJA 4WGWB 3CFCL 2K3TA 2FHBA 2DTML 3LEVH 2C3HA 3O45A 1T83C 4LOUD 1S7XA 1WIOA 3QIUD 4DK6A 4I0PB 1RZGB 3WFEL 4OF3A 1HHKB 1QRKA 4HZAA 2OR9L 3RBSA 1I9JL 4JZNB 3D9AL 2WIIB 2J8UE 1RZJC 4O00A 2MQCA 2YN5A 1VPOH 3AREB 3Q1SH 2H2SC 4DUXA 1Q0XL 4YPJA 1F02I 2GFBA 1AR1C 4MDJB 3RVTC 5F89B 1SJHB 1AGDB 2ZNXA 4KUCF 1FLRL 2I25N 4JM4L 4CKVX 3SDXA 4H88H 4NQDA 3IFPA 1ZWIB 2J8UA 3L9RB 1E6OH 4XC1H 3TPUB 1NGQL 2VKWA 3LV3B 4X4MA 1TVBB 1GPOH 4PUBL 5FAAA 2P7TA 1EBPA 3CH1B 5C71A 1WEJH 2BJMH 1A6PA 5EULV 4JZJB 1BZ9A 2OXHA 3O2WL 1V7MH 2E7CA 2K1MA 4Y16D 1HEZB 3FOMA 3TJHD 1U0QA 3MRQA 1MHEA 4NP4H 3ULSB 5FYKU 5E2WH 1B0RA 4OLZL 3GNMH 1CDBA 3C5SB 5C0GA 1NBZB 4ZUSB 1J12A 1S9WA 4JDTH 3MXVL 3OX8A 2EE9A 3QNYB 3IU3A 1A9EA 3Q3GB 2CLZB 5M94B 2IALA 1K8DB 2UUDH 5C0BB 2LU7A 5F97E 1A7BA 1A4JB 1IM9D 3OQ3B 4PGCB 2CUHA 3FFCE 3T0EE 1NCWL 1J86A 3QXDB 2BDNL 4KK5C 1MY7A 4PJFA 4PRIA 1U8QB 2VN4A 3WDJA 4YHMH 4HGKC 4XC3L 4F37F 5CFHA 3R8BB 1I75A 1NCAH 2EDWA 5K9KA 4PRDB 3KPMA 4OF0A 4I13B 4JO3H 3N85H 5SWZB 2PYFB 1FCCA 4PYHA 4LRNL 4H1LG 5ICXA 5K9QI 3WLWD 4GKZB 4YEEA 1NMBH 2JJSA 1UM5L 1YMMA 2GIYA 1MJ8L 3R4DA 5FGCB 5IJVB 3NGBB 1LDSA 4LDEB 1CLOH 2ICCA 4JHBA 1NKRA 1XIWA 2F8OA 4QXUL 2NXZD 1KACB 2V9QA 5HXMA 4RMSA 1KGCE 2YPLB 3N0PB 4JB9L 5A2IH 1MJ8H 4R4ND 5BW7A 3SE9H 5C08B 4J3XA 2D9CA 4OZIE 3BO8A 3HI6H 2UUDK 4MQ7B 4LL9A 4Y7MA 4CMMB 2ZUQB 4D94A 5DJDB 5B39B 1BVKA 1JYNA 3KNBA 4LU5L 4XI5D 1J0JA 3R06B 3MLUL 1VADB 3G5YB 1G0DA 1YDPB 3DMMD 4JAMA 3LIZL 5DEFB 3H3PL 4JPWH 4HUUA 3I84A 4I3SL 5EO0B 4WUUB 4PRNB 2P5WB 3GIZH 5GRZA 4IRZL 2OJZL 3ZKMD 1IGMH 3CK0H 1N2RB 4HKXB 4OQTA 3VXSD 5IROA 4F2MB 5FHAL 4G43A 1A7RH 3UTZA 2AV1A 5DMIH 4BKLA 2VDOH 3UZVB 5D5ME 3CPLB 4DZ8A 1KLUB 1FVEB 2JTDA 3GMLA 4G8IA 4FABL 1FFNA 4ISVA 2IADA 3QCUH 3KDMA 1G1YA 1UB5A 3MZGB 2R23B 3QUMH 4R7NA 4RWHA 3PQYA 1YNTB 1TMCB 3D3VB 2R4RL 2R29H 4ZUWA 4JFZH 2VN7A 5JR1L 4H5SA 4KK8C 3HZKA 2HKFL 3T04D 1T04A 3TBWB 1ONQA 5DVKA 4ZQKB 1IBGL 2F15A 1AI1L 4MNHA 1KJ2A 3HHRB 4WWKC 1UWXK 4JY6A 4KVNL 1YUHB 1T20A 2XQYK 5C0JA 4MJ5A 3UPAA 1AY1H 4MDJA 5F89A 1MHCB 3VRLF 4HWBA 3NABL 5C9KA 5EBMB 3DYOA 4PJBA 5KSVB 1PZ5B 2CPCA 2C5DC 3HNVL 4Z7VA 2EIZB 2ADFL 3MUGB 4MA3B 4KMQA 1NGWA 1OD9A 4M93B 2J8UB 1CXIA 3TPUA 5I73C 3U79A 3PIQA 4FOMA 4YNYB 1YECL 4CVZA 2V2XB 4KUCD 1MAML 2Q3ZA 4JO2L 4PGDA 5L8KB 1TJIH 2V17H 5F6HI 1VFMA 1DQDH 1DBKL 1A7PH 4RWYL 1DEEA 1FNSL 4OUUA 1I8IB 5BVJB 3FONA 2RCSL 1MHEB 3WHE0 3CSBA 3RP1A 5GPRA 1NKOA 5CGMA 3MA9L 4FQXB 1ZS8A 1FL6B 4BELD 3BW9A 4PG2A 3MYZA 3PL6D 3X3FL 4MCZA 4P2QB 2F58H 4JHAH 3GO1H 4C56E 3ULUF 4PRPA 1C5CL 4QNPF 1JRHL 3OX8B 2P5WE 1IFHH 3MBED 3EBAA 4CVUA 4YE4L 1O0VA 4PTTA 1T2XA 1E4KA 1O5DT 5F9WB 4R2GD 1X5KA 1RIUL 1LD9B 1PW3A 3RGVD 1IQDB 1XZ0B 3FAXA 3ZE1E 5DT1L 1DUYB 2OL3L 4F8QA 1B2WL 1C5DB 3S97C 1FDLL 1GHFH 1HZHH 3WS6C 3ZL4H 4GAJL 2ZNWA 1OSZB 1MVUA 2BHYA 3HRPA 5IFJB 3SCMB 1UXSA 3DVFA 1DBAL 3O3AB 4R9HA 2GSIB 5I1LB 3V52L 4OZHA 4IM8A 3O6ML 4Y4KC 5HHOD 1MRFL 2WBWB 3QO1B 4OLWH 4U6VH 4NJ9L 4S1SL 3QUKB 4LNRA 3MCLL 3W81A 5LXGL 3DO7B 1OAYH 1X4XA 3C60C 2ZZUT 1NUDA 3GMMA 5J06A 4PD4J 4HIHB 4X8JA 5C6WH 1NH6A 4OIAA 2L7JA 5DS8A 3WFDL 1S3KL 5D7IF 2I9TB 3C5ZB 1NGYB 2EYTB 2Y9RT 5MENE 4JQVC 4GKNB 3P4MA 2BFVL 3IGAA 1DBJH 3W0WD 3H7BB 1QFWH 2D03L 3UTSA 4YK4C 3MJGX 2PXYD 4K3GA 1VADA 2HLFC 3G5YA 1J1XL 1RZ7H 5F44A 1JUFB 1FBIL 1DP0A 4LLDB 1KTLA 1YY9D 2X4UB 4YAQB 1U41A 3ZKMC 1CXEA 4ZSOA 2XZCH 4ZYKA 3UZEA 1KJMA 4NCC2 2DLGA 2W0FB 3JV0A 2PW2A 1CGSH 3QDJA 4OCRH 3ZE0E 4Y1AE 1E4XL 3K0WA 4G9FB 1IAKB 4Y5YA 1WIPA 4MCYB 3KLHC 3HB3C 2A73B 2APFA 4G6MH 2HP4A 3LCYA 4UV7H 3T2NL 1HHGA 2HG5A 1GOHA 3IVKA 3T2QA 1L6ZA 2R23A 2YRZA 3P4OA 5I1HH 3KPNB 4M7LT 3UTPD 3RL1A 3OL2A 3DSFL 3C5JA 1UCTA 4HC1L 5LCVL 2J5LC 2EDOA 2QKIA 1S5HB 3S37L 4FQHB 3KG5A 3ULUC 4JDZB 3S7GA 4FNLL 4FQ1L 1UENA 1R5WA 1A14H 4JPKL 4DGVH 2FHFA 1I3VA 1OAKH 3UBXG 2NY3B 4MD4A 3RUGA 2E9IA 2B8OT 5F6IC 3GGWB 3UJIL 5CD5C 1FFPA 1T0PB 1C16B 4LLQA 1GSMA 4Z7NE 4JGMA 1FZMA 5DJ6A 1OCWH 4M02A 2VO5A 3FOLB 5EH1A 4YNYA 4CVZB 2ED7A 3KHQA 4N0CC 3EYOB 1OF2B 1OAXL 1AD0B 4JFDA 3OG6B 5E8PB 1WBXA 5T3ZD 3CDGA 3VWJC 1EHLH 5EO1B 1KN4H 5LQBL 4Y16A 3Q48A 5D1ZC 1LNUA 5A16B 2F54E 4W4OC 3O11A 1T4KB 6FABH 3WL9B 1I8MA 1SQ2N 4RA0C 1X7QB 2OSLA 3MLUH 3RZCD 5IFAL 1FG9C 4YXKL 4YHKL 3WDIA 4TVPH 2NY3C 3G6DH 3SGEI 3OJ2C 5I8EB 1EA9C 4LCCB 2QQLL 2ICWB 2XN9E 3ROOA 2DWDA 2VLRB 3RZCC 4MA7H 5CWSA 1WICA 5JTWA 1I9EA 1TQCB 1IQDA 1XZ0A 3BP7B 4EUPB 4JO1L 1G1CA 4JQVA 3U9PH 4HXAH 5GISL 4BUHA 1HINL 4QTIH 1OW0A 1Z0MA 4NNPH 4DQOH 3MBXH 4BSVB 3RDTC 1MVUB 3WYRA 3V52H 5J12B 4QHUA 5I1IH 1ORQA 3CD4A 2O61A 1FZJB 2YD8A 4OAWB 2NY1B 1ACYL 4CN6A 3K4DA 5I1AA 1ZT1B 3FRUA 4HS6B 2EXWD 3H3KA 2NXZB 3BESR 2H6PA 2F5AH 4HWNA 4I4WB 4R3SB 2A0LD 2VISB 1I85A 1HCVA 3L5XL 5GQBA 1JNJA 1Q0YL 3CH8A 4Y5VA 4LEOB 1XGPA 4HLZH 4ZD3H 2FGZA 2ZCHH 1NGYA 1UJ3B 1OD7A 1IRAY 3GSNA 5DSCA 5K9OB 4GRWH 5FUZL 3IGAB 3GHBL 4BH8A 5ADPL 5LGKA 3HPJB 1NJ9B 1HHJB 3MLSL 4LSQH 2AXFA 4U7MA 4NO5B 2ITCB 2E27L 4X0KA 2HFEB 5DXWA 2O5ZL 5IMMB 2Z31B 5KVMC 2AJSH 5T5NF 4ZS7H 5IHZA 1EHXA 4D0BB 1F4YH 1JHLL 1CLCA 2FGWH 4QOKB 5T1MB 1MAMH 4JO2H 3JVGA 3PDOB 1Q9OA 2R2EB 2NZ9D 4NQDD 4ODHH 4XNZB 1A7PL 4RWYH 1CLYH 1CT8B 4OGAC 4LLUB 1WCQA 4YC2C 5CSZA 3LPFA 2FX9H 3U7WH 1HXMA 2QADC 3P77A 3RWCB 4P0DA 3HNSL 4G7YH 4PJ7A 3ESVF 3OR6B 3NZ8A 1F90H 1MFAL 1FV1B 3I6LD 5CEZL 4Z5RA 4NQXA 3CCHB 1I7TA 1BBJB 1WGOA 1T7WA 1N6UA 3FFCD 3RJDA 5ESQA 5CJXA 3HNTL 3NTCL 4L9DA 5ID1B 1S5HA 4S11A 1U8KB 3DX9B 1UWXH 4P5TD 4M6AA 4ODTH 4K3EL 1MY5A 5ICYB 5BJTB 4U6YA 1IAOA 5I8CB 3JWDC 4YGAB 1JPGB 4YBLB 5E24E 3HI5L 3FTGA 3KWWA 3B2VL 2DL2A 4MD4B 3RUGB 3D6GA 4KV5F 2CRZA 3FMGH 4U7KA 3TBTB 1TVHB 5B8CA 3TNNA 4CNIA 3G5VB 3WLWC 2VL4A 3FQRA 4WHTB 4QRUB 4W4OA 3FOLA 4O4YH 3KPSA 2J7LA 3H8NA 3RTQC 4HG4J 5E94B 1IC4H 3HFMH 1ZVSA 4HQQH 4U49A 4HWZA 2OX5A 5KANG 2NYYC 4LPYA 5FYJL 5KSBE 1OGAD 12E8H 4OCRL 4W4NA 3C9NB 2Q7YB 3BSZL 3QFDA 3TH4T 4K7FB 2PYED 5L8LB 3INUH 1OL0A 4UIKH 4Z0XA 4O51A 3DX7B 1AR1D 3H3PH 4NDMA 1CDHA 1IGML 3F7VA 3PP4L 1ZLSL 1JWUA 4TSCH 2J8UF 3QDGE 2X4NB 1X7QA 2OSLB 3L3JA 3UTSD 1OAQH 3GZKA 3SE9L 2VLLB 1YYMH 4XCNB 1S7UA 2BCKB 4RIRA 1KIQA 5ITFB 3HZYB 1JPST 4GRWB 4R0LA 4HUVB 5D7LE 1A6ZB 3F7YA 4FQIH 1FZOB 1BOGB 1B4JL 1ES0A 4G5ZH 3AM8A 5ESAB 4AEFA 1S78C 2RIKA 3MV9D 3MRJA 4OQ1A 2B4CH 1BD2D 3QDJD 5ISZD 5IB1B 4OIIL 1MH5A 3N50A 1X5JA 3UJTL 2BK8A 2A6IB 1EIBA 3WIHH 4HUNB 3NIGE 2NY5L 4NKDB 4MJIB 3DX6A 1MREH 1P9MA 1KUMA 2DF3A 4Z7UA 3R8QA 5GRYA 3QO0B 5DZNA 5ERWA 4YDVB 2OTUA 4GG6B 1LQSR 4C58B 1EO5A 2FZ3B 4LVHB 1IT9H 4UOW1 4JZOB 5I76A 3BJLA 1ZA3A 2PTUA 4GW1A 4FA8A 3HZMB 4FS0A 5ID0A 5ACZA 1EHLL 4KJYB 5KBNC 4DVRH 1XF3A 4ODWA 4MD0B 2NTFA 4KVCH 1YEEL 3ZTJH 1RJZA 2QQKH 2W9EL 1K4CB 5D5MB 3BGMA 4UV4H 4J2XA 3C8KB 3L3DA 3WHXA 1EJ6A 4ZAKB 5IV2A 2AXFB 5E8DL 4HBQA 1BD2E 4MAYB 4NYLA 4RMQA 4ELKB 1ETZB 3FQXA 5HGAB 1MLCA 4CRPA 3SDCB 1CLZL 5GRVL 1GZQB 5DF0A 1VFOA 3RY6A 3V6ZA 2IAMB 4RZCA 4D0BA 3UPCA 4ZFZB 2X89A 4V2CB 3QWQB 2BY2A 4WI6A 2CDEA 5E8DH 3T77A 3TJHC 5A1AA 3HZVA 4HDIB 4N0CD 2BZDA 4DN4L 2F53E 4EXKA 1MCEA 3EYFB 4YWGH 5F7EL 5FA3A 1YECH 3ZLQC 3D18B 3EAKA 3UTQB 1AP2B 3RUGF 5MP6H 5LGJB 2PW1A 1TPXB 5ANME 1QD0A 1IGYB 3WFBL 1CFSA 4PV9A 5GGVL 1YEHH 3SE8L 3S98A 1S9VB 3K80A 1NUGA 3F5WA 3BGAA 1PDKA 1HH6B 1I7TB 2EZ0C 3ZKXC 3REVA 3K2MC 4DVBB 1DN2A 5JLZB 2JJSC 1OW0C 1ZSDA 2DQCH 3GRWL 3KS0H 2FJHB 2D3VA 3MRKA 3DMMA 1IGFH 3I6KA 2MCPH 1FIGH 3EZ8A 1SY6A 4IJ3C 3QG6A 4Z7WB 4KK5D 4G6AC 3LPWA 5DRWA 1NCCH 4YXLL 2FBJL 4NBXB 4PGEA 3O8XD 4NIKB 5I16B 2M2DA 4EI5C 4U1JB 1CYGA 4ETQB 2DWEA 4Q7DA 1A5FL 4JPVL 4RGNC 1NGZB 4P2CG 4FFVD 3WIFA 1RURL 1I1AD 5FYJH 1FP5A 4QRUA 1Z6JT 1J5OL 3OF6D 2X4RB 3SKMA 1A3QA 5C8JA 1I1AA 2BVOB 4LPTA 5LVEA 3JWDH 3SN6N 4U6HA 4X8XA 1EEQA 4LCWE 5IG7B 4PV8B 3VXSA 3CVHA 4RA3A 1A7NL 3VFOB 5FYLD 1G9EA 5DMKA 5EFIA 1OARL 4K8RD 1JBJA 5KSUA 2OI9B 4DW2L 3FRPG 2A2QT 4HZLB 1OGTB 2MHAA 3L7EA 1EDQA 4PJ9B 5F9WC 1XGTB 5EZOH 3ARSA 4MXVF 2HWZH 1RY7B 2VC2L 1SYSA 3QA3B 4N1EA 1KIQB 4OZGA 4R90H 1HQRB 2D7PA 1AGCB 2Q8BL 4R0LB 4HUVA 2P4AB 5D6CB 5BV7C 1AO7B 4NOBA 4JM2C 1HHKA 4GH7B 2C1PA 1D6VL 1MFCH 4XCCH 1F6AA 4G6KH 4PTUA 1VEOA 4GXUM 5GGVH 1MI5D 3GSOB 4ONGL 5HHQB 2VE6B 4ZOEA 5HHMD 4MVBC 4PJBE 4TSAH 4JFPB 4P9MH 5I9QB 3HE6C 2ZCKH 1JYXA 4UOW0 2AEPH 4J3TA 1J0KA 3KPRB 1TZGL 5D4QA 4ZUSA 1MAJA 3RTQB 3ZHKA 1NCBL 3MV8D 4CL7A 3SE3C 1J1OH 4QNPE 3TH3T 5J0BA 3CH1A 2W9DH 3UBXI 1HSBB 4PG9B 4R6UA 1PKQE 1FE8H 1QNZL 1OTSC 3QUYB 5I19H 4OZ4B 3PJSB 1MCIA 4PLOB 4JCMA 3G6AA 3VXNA 2WANA 3MGTA 2CJUL 3PABA 1NFDE 3O6FD 3N9GL 3PGFL 4PJIA 4FQQA 5FUCC 1KT2A 1M7IB 3CMOH 3FQUA 4XCEA 2W38A 3EO0A 3D87B 5BV7L 5E4EB 4APQC 5J1AB 2P8LB 3RNKB 2C4FU 1CGYA 3V0WL 1M7XA 5IBUG 5IMKA 4A6YB 3MV01 3D48R 5LGHH 4HJJL 4YK4B 4MWFB 2FR4B 4BJLA 2JB5H 3PGCB 1TCRA 1DCLA 1UYWL 4XP9H 4Y5XB 1AJ7L 2BY1A 3B43A 3MNWB 4YHIB 2VSDA 3CU1A 2FSEA 4OLYH 4LASH 4PJIF 4N1HB 4U1SB 1CD1B 3MRHB 3WIHL 3FB5B 5D7IE 2DM7A 3ESUF 1BFVH 3ISWA 5GJSL 4QTIL 1QVOA 2HMID 4C83B 4GKZA 4JGJA 5JORB 1JNNH 3QIUA 1YMMB 4NQVB 4NO0A 5F9JA 3REVB 1N3NA 1A1NA 1ZSDB 2BERA 1YYML 4HLZG 3BIKB 4MDIB 1CFQA 1FFOB 3BXNB 2H2PC 4ZOAA 1C12B 1GGCL 2P5WA 4WY7L 5F9DC 3V4UH 3W9DA 1V7NL 5JQHC 2BC4A 3JV6A 1T7VA 2ESVE 4HK0A 2APBA 2CKBH 1ACYH 1B3JA 4NHUB 1IGCH 3MTRA 1NDMA 4H0HB 4Y19D 3P30L 2GEEA 3MXWL 4MQTB 3VFRB 3PWLA 2B0SL 4FFVC 4BFEA 1KPVB 2NQCA 3O6KL 2VXSL 5I71C 1WFNA 1N7MH 4M1GL 2KBGA 5GS1C 1A1OB 1KPUB 2X4RA 4KTEH 3UO1L 3SJVE 4NZUH 5AZEL 3QEUA 1Z3GL 2F53D 2GSGB 2Y7QB 4GUPB 4Z7WF 3CVHB 5I19L 4GJTB 4WU5B 2A9MH 4DTGL 3CNKA 3VFOA 4KKAC 3VD5A 4L3CB 3U48A 2DJSA 2R0KH 1KOAA 2GAZB 1Q38A 4QRTA 5CINL 4MJ6A 5EU3A 1J1OL 3TV3H 2AJ3A 4KXZH 4FTVD 4HZLA 4QRRB 3VFWA 4YHOL 1C5BH 4PJ9A 4U1KA 5DJCB 3WUWA 1MHCA 3RZCB 2QHRH 3RVUC 3K81A 3P9MB 2DLHA 3CXDH 1PZ5A 3RY5A 1TITA 4K3EH 5F88B 1NCAL 5DYOA 4ZUWB 3VXSE 4HC1H 4NC0B 5LCVH 3LN4B 5D96C 1FNLA 1YY8B 2ZSVB 1I85C 2PO6B 3UMTA 3QQNA 3EDFA 3VXMB 1ONQB 1X5XA 4X4XA 4OZFA 4PGDB 2UVEA 1ZXQA 3QRFM 4RISL 1PEWA 4Q6IA 2GJ6A 4LMQI 2ZG3A 4L4VA 3QCTH 2QLVB 2VE6A 5I15H 1MFDL 5DD1L 2ADJB 3L5HA 5DHXB 3EW3B 5KSVA 15C8H 4Z7VB 4NHCL 1GRWA 1HHHA 3OB8A 1JK8A 4D8PA 5DUPH 4MA3A 1SM3L 4QGTA 5A2KH 3VWKA 4XP4H 3C6LB 3T0BA 2EDTA 1QSED 1X5FA 2DQJL 4Z7VE 4YHZH 5CZVL 4HWEL 3QUYC 2V2XA 3SDDD 3QUML 1ZVHA 1M6OB 4G80A 1RHHA 4S1QH 2XZCL 4PTTB 2NY0B 1L7TH 4Y8AA 1RK1B 4RGNB 2J88H 3MRIA 1H3VA 4HFUH 1U8JA 4P5TC 1DR9A 5ITBL 3EDKA 4I0CC 1G7HB 1YN7B 3JSSA 3NA4A 1KEGL 4WV1B 5C0CD 2WINA 3NACL 2YZ8A 5BZWA 5DUML 5ALBL 4PBWD 1EEZA 3MC0A 2BFVH 4AMKH 5JA9A 4HGWB 4HK3J 3GUTB 2H8PA 3X12A 3GJFK 4K3JH 4Y4KB 3LKOB 2DJUA 4HAFA 3S35X 4GG6F 2H32H 4FQQB 4KTEL 4WEUD 3JTSA 2OK0H 4I0PA 2L4OA 2DQTH 3EO0B 5D7IA 4JZNA 3DSNA 3BWAB 4IRJD 1D6EB 2EDNA 2B1HH 4EVNA 1A0QH 5J57B 5F9OH 2D2OA 1NGPH 4G9FD 4OGZA 2ARJB 1FYTA 2FR4A 2EC9U 3AFLA 4TSBH 3LAFA 1UVQA 2WUCH 5DS8B 5F3BB 3QEHA 5I1IL 2ICEB 4OZHE 1QBAA 4YHNA 2RFXA 4IRSC 5JNYB 2AJUL 4O2CA 1MWAL 1A5FH 4JPVH 1QYGL 5F9JB 4AQ1B 4JRYD 4POZC 5FGBA 3K3QA 5IK3A 1KTLB 3O3DB 2F8VA 4DKFH 3JUZA 4DGYL 3KHOA 4HUXA 4F7TA 2W0FA 3WN5A 2FX7H 4LGSB 1G6RH 5D1QA 1MJJA 4HKZB 3GMPB 4L3AA 5FGSA 3WBDA 1TIUA 4ZAKD 1K8DA 4KRPB 4FZ8L 4ZFOL 5D7JA 1J9CT 3OKEB 4U1HA 3EFDH 1VCAA 1IKNC 1NEZB 5J1TC 1KIPB 4LLDA 1DL7L 2X1PA 3QHZH 3QXDA 2VZ1A 4KDTA 3KPNA 3NMEA 2NXYB 4AMKL 4PJFB 4RMUA 1IQWL 1U8QA 3Q5YA 2ORBH 3H0TB 1OAXH 4OFKA 2PW2B 5AD0B 4BZ2L 4F9PC 2HRPH 4JDTL 1B0GA 3UC0L 2IBBA 1IZKA 1JWSB 4FFYH 2FD6L 3VG9C 1IT9L 4MCYA 2LU3A 2YXFA 1MIML 4YDKL 3LEYH 3UJIH 3OAUH 1IAMA 4P2OC 4YHZL 1CTNA 5E95B 2FLRT 4E41B 1KIRA 4N8CL 3QEQE 2F74B 3QXWA 4U1KB 1H3XA 1A6VL 3FO0L 3VGDA 4Z9KB 3RGVA 5BQ7B 3ULVH 4LSVL 4KDVA 2VL5A 3HRZA 4Q74A 1P7KB 3CSPA 2VIRA 1MSPA 1JN6B 3WD5H 3QCTL 8CGTA 3IDYB 2PO6A 5MERA 5A2JH 3CFKB 3MOAL 2AEQH 3MJ9H 4HK3N 3B9KD 4OZFB 4FQHA 2F9BT 1HYSC 1AKJD 4XXDB 2XWTA 3OKDB 4X6EA 5FK9B 4UQ2A 5D7LA 1FFPB 3JV4B 4Y88A 2BSTB 1UZ8A 2OMBA 1RZKC 3CC5A 3DVIA 3HPLA 4F57L 5IW3A 4AM0B 1I1FA 5HYQA 3GSRB 3SGKC 6CGTA 3TGXA 1YNKL 3PHQB 4G43B 3O3EA 4N8VB 1M6OA 2X4OB 5LBSL 5JXAL 2CMRH 2H9GA 3MLWH 4LCCA 2X7LB 4BKLB 3LS5L 1G9NH 3CPLA 3RWEB 5I1DB 1U8MB 5D8JL 2WINB 3ROLB 4ALAL 3QCUL 5GS2D 4UU9A 1RIHH 2XKNB 4GMTH 1X5HA 2RGSA 5T1KA 1EMTL 1FORH 4IS6B 3KYMA 1I8LA 4H1LB 4X9HA 3DV6A 3BZDA 4XVUC 5I8EA 3TJEH 1SJXA 2IAMC 4JY6B 4PRHD 2VLRA 3S88H 2WUBH 3GEWB 3KYOA 4HS6A 4YXLH 4YFDB 2NY1D 4PRHA 3TBYB 4XPFH 2GHWB 2IAMD 3MV7A 4LRIC 2X42A 3M1BB 3QRGL 4WY7H 1VFAA 2PTVA 4NSKB 2EIZA 4NQEB 3MUGA 4UINL 2VZTA 5IEHB 2FH6A 3WFHA 4RAUA 3VRLE 4E0RB 4WI8A 4PJDB 4MHHI 4XNUL 5CBAB 3UROR 4LVNC 3SQOH 4HUWB 1DBBL 3E1F1 4ZUUB 2MOVA 5FYLE 3FRUB 3C6SB 5LG1A 4L8SC 4S2SB 5DT1H 1ZS8B 4WW1A 1BP3B 3OV6A 5JW4Q 4MCZB 5IMMA 2ZUWA 1KEGH 4XWOD 2ATPA 1T6WA 3MA7B 4NKMB 4YE4H 4ZSOE 4Z18A 2O5XH 1MJJB 4HKZA 3GMPA 5JXED 3GSNB 5DSCB 4X99B 4FG6C 3PXHA 1BHGA 2UY7A 1FFQA 1PLGH 1KC5H 1LD9A 2FJGA 4GQPH 1P9MC 5D7JB 3IDJA 1CS6A 4L9LC 3S5LA 2JJVA 4HF5H 4N0UB 2EYRB 4NHCH 2QSVA 2RCSH 3EUUA 3NBNA 5BS0D 1YEIH 1QBML 3MACH 1KN2L 4WI5A 5HVHB 1HQ4A 4RQQB 4KQ3H 3RU8L 4Z5RB 2NW2B 3MJ7A 4MZ2A 3D3VE 3IU4L 3NACH 1BZQK 2YUVA 4HF5L 5TDNA 1CL7I 5ITBH 2HT4C 4FFWC 4PJFF 4QWWC 5CSZB 1U3ZA 2XQBL 4XHJD 5EOCJ 2IPUK 3P40A 2N56A 4PGZA 4OCWH 5EA0L 5IMLB 4JVWA 1UEMA 1HKFA 43C9A 1TVHA 5B8CB 5DC0A 1YEDA 3KYNB 3QDGA 5DUPL 4BYHA 2B2XH 3G5VA 4JKKA 3ME0A 2BXYA 1A3LH 4XHQA 1QFUH 3IS1X 5F21B 5CLWA 1S3KH 3RL2A 3CX5J 1T7ZA 3QXAA 1E27B 3QI9D 4JM2B 1CGUA 4OSUH 5E94A 5IBLC 1ZVSB 4FFYL 3H7BA 5BJTA 3VGGA 5I8CA 3BIBX 5ACMA 3ALPA 4JFDD 4Z76B 2BP3A 3EZJB 3HE7D 5GGTA 3P0VL 3KPSE 4GW4B 5DD6A 5GRWA 3C6LD 1Q0XH 4BQ9A 3E2HB 2CLVB 5HYQB 5KAQG 2EXYD 1F00I 4M7JL 1KCUL 1QHOA 25C8H 3KPSB 4GFTB 3SGJC 4D0DA 5K9JH 1A8JH 1XCQB 4L1HA 3MBEC 1WAAA 2VXUH 4HWZB 1S7UB 1QR4A 7FABH 2JCCF 4HFWB 3MCKA 2VMFA 4KUZH 4PJDE 1F3JB 3QQ9C 2XA8L 5E70A 3RWHA 1CIUA 4J3OC 3GJFH 4P4RA 3MRBB 1I1CA 4KZEH 1OCWL 4NZRH 2D7TH 2ZUQC 3DECA 4Z7QE 1SJHA 4H1LA 1G0YR 4OKVB 3VXQB 1DQQA 2Y5TA 2X9YA 3ZO0A 1ZTXL 2VLLA 4LSUH 3PUCA 4I18B 3RI5F 3AU1B 5LBSH 4C56D 5JXAH 3G5ZB 1WAAF 5EWIH 3DPBA 3IFPB 4JKMA 1UT9A 4OLEA 3ZYIA 3EIFA 1ZGLA 4JY4A 4P2OA 5HVHC 3IAQA 2C3GA 1ZA3B 1RUQH 4DKEL 5HYFA 1N6QL 3UTSE 4U1GC 5EOQL 1EZVX 4TTGA 5FM4A 3ECBA 4ENEC 4OFDA 4BFIA 3MZTA 4YGVA 5T3XH 4MYWB 1LO0L 2YMXL 3N1QC 3QJFA 2H45A 5L6YH 5HDQL 4K7PX 3QNYA 4G7YL 1P7QB 1ZT4B 3S35L 3O4OC 3P9LB 4P23A 3BWUC 1HXYB 3WD5L 4LSVH 3WJLA 1F6FB 4NYLB 1E4XH 4KU1A 2XPGA 3IF1A 1I1YA 4QY8A 3HZMA 4XTRD 2UWEF 5FDWB 4QTHA 4JGUA 2VR4A 3PWPA 4L4TB 4NOFA 5C6PB 5D5MF 3JWOC 4WV1C 5D7KE 2XKSA 4MAYC 1F4WH 5F1SA 1BFTA 1NLBL 1UCBH 1B9ZA 5C3TA 1N64H 4CVWA 2OQJB 3T2PA 2E7BA 5CP3A 2QEJA 2IGFH 1AHWC 1S8DA 2OTPA 2IH3B 5L2KA 2OR8A 4JRWA 1X5ZA 3T0EB 1S9VA 3VH8G 1ZA6B 2F53B 3FO9B 3FB7A 3T4AB 4FZEL 4WU7B 4XPBH 1ZLUK 4LKCA 4NFCA 2YUWA 3MPCA 4FP8H 4UB0L 3I6KB 1NCNA 2FL5B 3ARBA 4MGXA 4E42B 4RDQG 4UMGA 4IMKA 1U92B 3REWB 1H3TA 2D7OA 1JV5B 5E99H 3ULUL 1FAIL 5C08A 3ARYA 5C0IB 2AI0H 3MBEA 5SX4I 3SKOA 3V9FA 4G8EB 5KSAD 1QBBA 2VLME 2ZUXA 1GXEA 2A74A 4IRJC 4U3CA 2WUBL 1RUQL 4ZOBA 3TJEL 2C7UA 4PGJA 1KGCD 3NIFF 1JGVL 1A7NH 4L4VE 1D6VH 4XCCL 4OLUH 2XXCB 3LB6D 4BQ6A 1EMTH 3EJYC 5I1KL 3SJVD 2WUCL 4UBDD 1WTLA 4OF5A 1QA9B 5M95B 1Z9OA 4HKBB 4ODSH 1T03L 3EOAB 2VXUL 3ZT7A 3F7QA 1LO4H 4PR5A 4WHDA 5IVXB 2YKLH 1DBKH 4H5SB 3S8WA 1QLRB 1UXWA 2FIKA 3V6BR 1LMKA 3AROA 3JTTB 3TO2A 2C1PB 3G9VA 3V7AE 2CRMA 4F9LC 3D39D 4X4YA 5I66A 4WWID 3D0LA 3EDJA 5T3ZL 1A47A 1VGKA 4U6TA 2P43B 5J11B 5IIEB 1WCBA 2VAAB 2XY1A 5MP6L 4EOWH 2G2RB 4KQ4L 5FGBC 3SEPA 1SYSB 4NZTL 4PP1D 4XBEH 1JPGA 2NX5A 5CEZD 4NRYA 3LHPH 4MXWH 2FB4L 3SGDH 1TVDA 1AO7A 1WK0A 2CR3A 5FF6B 2WWKO 1U8HA 3ZDXE 3TNNB 3H9HB 4KJQC 2WP3T 5I30L 4PG9A 1U6AL 2NCMA 4JRXA 1IC5L 1LE5B 1CLZH 1QPPA 4K94C 3GRWH 4A2LA 4Z77A 2B5IC 2Z4QA 3DTXA 3LRGA 4KGJA 3KLSA 3N1FC 2D0GA 3S35H 1FL6A 2VITA 3NPSC 4O02L 3VXNB 2X6MA 2X9XA 3PABB 2FD6H 3K4ZA 4PRPB 2VDRH 5GIRB 1RZKH 3GSVB 1P7QA 4TULL 1RUMH 4HIEA 4UT7L 3NABH 4BQBA 4XCEB 1HXYA 3WMSA 1F97A 3OGOE 5HHVL 5IEKA 4HT1H 2R69L 4DKEH 4IMKC 3SO3B 4HCRA 3UTTE 5E9DD 1U2CA 5MEOB 1AR2A 4MS8D 5CEYA 1JZ6A 2A38A 1X5GA 1TQBC 1AKJB 1YC7A 1G6VK 4JPWL 5FHBL 4BA8A 5EOTB 1EO8H 3QUZC 1YQ2A 1CICC 3B8SA 2YBRB 1K4DA 3IXTB 5IFJA 3LV3A 3VI3F 1TVBA 4WI4A 3B4NA 1SY6H 3O3AA 5KS9E 4XB7A 4APQA 2D03H 4DGYH 5E6IB 4C83A 1IM3A 3T65A 5HDOA 4KKLC 3FOMB 2QQKL 5DMIL 2WK2A 5HYSA 3ZSTA 3T4AA 3TA3B 3ULSA 2XTJD 2UV3A 4WVRA 4MDIA 4P46A 1MEXH 4QRRE 3MXWH 2QADB 5ERWB 4WO4A 4OTXL 5D2LF 1U92A 3QFJD 4OGYH 2EYTA 4MX7B 1A1MA 3LPGA 3QR2A 4HCRH 3P4NB 5MEQA 4WO4C 3OKNB 4PJ5B 5ACZB 1A4JA 5EO9A 5HGBB 1KJ2H 5IB5A 1I3RA 5GJTH 5D1XD 3DROA 4XVSL 5DZOA 5BO1L 5F70A 3W9DB 4FP8L 4UB0H 3FN0H 1DQLH 4CMHC 3H3BC 1OWWA 3QDJB 4G8GD 3WKML 3OB0K 2QJDA 5IBTH 4HS3B 4KMTH 4L3CA 3U2SA 5CJBA 5ADOL 1KPVA 1TNMA 5HI5D 2R39A 3EHBC 1UM5H 3QG7L 4G42B 1PVHA 4QRTB 2IAMA 3MV7D 2C3VA 2IGFL 2GW5A 5C1MB 3WXVH 1XIWB 4P59L 5C09A 3IRPX 5KSBA 2XXMB 1T1WA 3BDBA 4F7EB 2DOCA 4O2FA 1CFSB 5HYJA 4PV9B 4UT9L 3JTTA 1QO3B 3RU8H 2ZUTA 3DJ9A 5EU3B 4LVOC 5E03A 3NIGF 1ED3B 2UY6A 4WUUD 4S0SD 1FE8L 5DEFA 3S34L 3D0LB 1JI1A 2R0LL 4MVBD 4ZO7A 4HUUB 5EO0A 1EAPA 1R3KA 1AO7E 3EKCA 3GGWA 4TULH 1N4XL 4GAYA 3MJ9L 4KRPC 5F88A 5C0AB 2XWJB 2J88L 3I9GH 1S7TA 2I60H 2E7HA 3B9VA 4TPRH 3VWKB 5FFLA 2APXA 1N2RA 4HMCA 4AEIL 4B0MM 3CVHH 2AEQL 1I8KA 1SJVA 2WNGA 5JO5B 1WZ1H 3LEXA 1KCRH 4AZ8A 5I0ZA 1H8NA 4MQXC 1AD9B 1WUNT 3L3IB 2LFGA 3WFEH 3KYKL 5FKAA 5E8PA 5H37G 1KLUA 3I3EA 4MSWB 1FVEA 2XZAL 5F72S 2BNRD 2Z4QB 3C2AL 1HSAB 2IADB 2X2YA 2XNAA 1LEIA 5C0CB 4HGWA 2NY0C 1F6LL 1KTDA 4GLRH 1P2CB 3MLSH 3LKOA 1WT5A 4TVSa 5H35A 3EYQD 4G6FB 3GSUB 1OSPL 3U1SH 1TJGL 5GIRA 3GSVA 4EI5A 2D7TL 5D7SH 1FVDA 3F65A 4OZIB 2UYLB 3GBLA 2IFFL 4LBEA 3VH8B 4K94H 5EU5B 1D6EA 1U8JB 3DYMA 5L7XH 3NIDF 3NN8B 2R1WB 1T5WA 5MEOA 3FFDB 4CUCA 4XH2A 1F4XL 4J3UA 5DUBB 1FFRA 3BKJH 2FRGP 2EH8H 4Y4KA 2W59A 1BAFL 1YMME 4LPCA 1HQRA 4FZ8H 5D96B 4LPVA 1BJ1J 5I1KH 4JN1H 4GKSB 1RD6A 4LHJB 2O61B 5D7IB 1F6AB 4P5KB 4LLWB 5AG8A 5BW7C 4KROC 1JF1A 3GSOA 2HN7A 4DEPC 2VXQL 5IBTL 1B90A 2C4FT 1TZHB 4U2YA 4OI8A 4HAGA 1NLDL 2HFGL 3TBSA 2VNCA 4OZGF 2IQAB 1JRHI 2MQ0A 4Y4FB 4YPGB 4KV5E 5L88H 3RTQA 3QBTB 4PJBF 4KMLB 4XMLH 4QXTB 5C0ND 4UUJA 2ZKHH 5I2IA 4HKJB 3KPOA 3NIFE 3CLFL 3QHTC 3C60A 1INDL 1A1MB 3BDYH 1F3RB 2VLKE 5D9SA 3QNXA 1F11A 3L5WB 5GS1A 2P8PB 4ETYA 3D2UA 3QQ3B 4K23L 2CDGB 5EBLA 2IH1A 2DQCL 3QCVL 1KIPA 1YYLL 4X0KB 2XKUA 2HJFA 3HAEG 5J89A 5I6XB 3ARQA 1IKFL 2BVUA 1P5VA 5FXCH 4LOUC 5DK2B 3B83A 5GGUA 3QUZB 1Q9KA 1OSZA 3N1GC 5DGRA 5I74B 2LQRA 3CMOL 3SCMA 2FNBA 3KXFB 4OLVH 1MIEH 1WVZA 4HS3A 4POYA 2BVTA 2P8LA 3DETC 3RNKA 4FZEH 4YHPB 2DBLL 4YWGL 2VZUA 2HFTA 4OFPA 1IFHL 1KBGH 1MRCL 3QUKA 3SDXE 5J13B 2WLYA 1N8ZB 5BRZA 1MQKH 3WFCL 4AIZA 2D9QB 3VD4A 4EJ1C 2ZUVA 3FHAA 3PWNB 3MNWA 1BJ1H 1R3IH 2LV4A 3UTTA 4PY8J 4NQXB 3CCHA 2I9TA 3ZYZA 3P11H 3E6HB 5HGGS 2VR9A 2PN5A 4V1DE 5FECA 4P9ML 4HWEH 2EEDA 2R69H 3VI4E 3W2DL 5DVMA 2ZSWB 3QIUB 4WFFE 4ONHB 4K3DH 1IAOB 1DBMH 1CFTB 4BFBD 1JWMA 4R26L 4XAWL 4FG6D 5E8EA 2IF7A 3UYRH 5EBGA 3WNPA 5FK9A 1N4XH 2AKRB 3FJTA 1H3PL 5D7LB 2HAZA 2VSCA 1DZBA 4P23C 2BSTA 3HPLB 1S7TB 1OTSD 4P2QE 4M1DL 2PO6C 3L3KA 1KYOJ 3HMWH 5E2TL 3SGKA 2X5PA 1BD2B 4PJCF 4XAWH 2V5SA 3JV5A 2EZ0D 1PSKH 3TF7C 1NC4B 4UT9H 4FNLH 5GZOD 4XVJL 3MOBH 3S96A 3ET9F 3C5ZC 3HCVB 3EDDA 3E3QE 4X6EB 2QHRL 3DLQR 4JRXD 1CFVH 1RUPH 3EGSA 4LSUL 1XGYL 1WJ3A 4UU9B 5CJXC 1MCFA 2XKNA 5KW9H 2GSGA 4GUPA 3HMXL 3C5ZD 3VWJA 1T22B 3U0WH 3SY0A 2BHUA 2X4NA 3C8HA 5DA4A 3FKUS 4O5LH 5J13C 3PL6A 5C08E 2H9GB 2DTSA 1WFTA 4L8BA 1U3HA 1NSNL 3ARWA 2GAZA 3HE6B 4DFHA 5B8CC 3VFTB 1BVLB 3VXRA 2AJ3B 3VCLB 3HC4L 4B41A 3FFDA 1DQLL 5HHME 1F3DJ 3BKJL 2IG2H 4KKAD 4OD3L 5ESAA 3RUGE 4OCMC 3HS0A 3QPQD 2A6DB 5GGRY 4GRLB 2F5AL 5T1KB 3ALWA 4RCAA 4PP2B 4ZO9A 4TRPH 3WS3B 1OY3B 2A6IA 3HG1A 4KPHH 1J1XH 4M6MH 4ZUVA 5JZ7C 4OB5L 4M4PA 1OP3H 3QO0A 2Q1EA 2X4PA 4XP6H 5EO1A 3VFVA 5FYJU 4Y16B 4DN3H 1YMHB 1D9KD 4JFED 4NN7B 3SJVA 4WFGE 1ZK9A 3CSGA 2JK5A 1MUJB 3RAJL 5ID0B 5F6HJ 2ATPB 4UUJB 2Y36L 1H15A 3MYJA 1HKLL 4F58L 3ARDB 2DQJH 5CZVH 5A3IC 1RU9H 5IVOA 1YJDH 1A6AA 1IM9A 3MRIB 3BP6A 3WNLA 1J8KA 3FHQA 4ODTL 4ZAKA 2E8ZA 1J0IA 4X7SH 3GO1L 2WBJB 1ADQA 4GOSA 3ZTJG 4JHZA 4MNGA 3X12B 3BKCL 5IWLC 3B9EA 1F90L 2LU4A 1V8HA 1WBYA 5KZCB 5HVGB 1FSKB 2DI9A 4N9GA 1BIIA 4TN9A 5E2UH 5ISZA 5IMOA 4RMVA 2ESVD 3TO4A 1CK0H 3Q0HA 2FJGB 3LDBB 3NA9L 4M6OH 4BSWA 1WBZB 5IVZA 2CIKB 5C0DA 5EU6A 4DVRL 2BOBA 2IBZY 5SWZE 3B5HA 3NCJL 2QTEA 4AIZB 1QSVA 3U1SL 1T6VN 3EO1B 3M8OH 1UVQB 2YC1A 3BAEH 5E2WL 1CVRA 5C09D 4RQQA 4RGMC 4Y5VB 4ORGA 2OZ4L 3BKYH 4BQCA 3V4PL 3D1MC 3O0RL 5IBLD 1FZKB 1K2DA 4G6JL 2BVQB 2EIEA 3V7MA 4MB5A 3AGVA 2XV6B 5GS0L 5JR1H 5DFVD 1HHJA 3L3OB 1CU4H 2VDQH 4XCYB 1CFTA 3FN0L 5CJOL 2ITCA 3D69A 3O3DA 3G5XA 3BKML 4J6RL 2B4CL 3KAAA 43C9B 3B3IB 3U7YL 5C0FA 1JNLL 4G8GB 4FXKB 4HUXB 5IB2A 2DYPB 3UCRA 2FH8A 1MLBA 4R4FH 4QOKA 2VXTL 3L3KB 4OCLC 5JDJA 2PCPB 1CGTA 1HOCB 5T1LB 5C8JB 4CN4A 3VW3L 4HIIA 2KH2B 4GAGH 9CGTA 1BOYA 2BNQE 3MLRH 2OP4H 1XCQA 5AWNL 3OKEA 4Y1AD 2Z9TA 4DKDC 3GJFB 5FYKL 4M6ML 2WW8A 2ZKHL 3OKOA 4UDTA 3NPSB 5GS0D 5DJ2A 3X17A 5L88L 1IEAA 1FV1A 2DBJA 4A6YL 1T22A 4RNRB 1JGEB 2DDQL 1KB5A 3DIFA 5JUEL 4Z8FH 1H3UA 4LLMB 2EDJA 1T7XA 3QFJB 4H8WC 3S3PA 3F7RA 3IAGC 1RJCA 1DDHB 3BZ4A 5IB4B 3VFTA 3VXRB 1XCTB 4HHAB 1M4KA 2XG4A 5CIPH 5DUMH 3V2AR 3IETA 2YD3A 2YZ1A 3FMGL 3RPIB 4P2RA 2FHCA 1OWRM 3RGVB 5BQ7A 1ZGLB 4P2OB 1XGRB 4POUB 4P4RB 1XGYH 5AAMA 2NY6B 2VL5B 4CNIB 4ERSH 1D5ZB 5FO8A 3BRFA 6FABL 3FQRB 5KG9B 1IEHA 1LK3H 3WS3A 5JQ6H 1I9IL 3UTOA 3VXQA 5IUSA 4EIGB 4M5YL 2VLMD 3THML 4D9LL 3GIVA 1EXUB 3PXJA 4FQCL 2ZUYA 4Y89A 2NY6C 4UQ2B 3GM8A 4JY4B 3EFFA 3IJYB 1AGEB 1I1YB 4QY8B 1CU4L 2VDQL 4OSUL 1VDGA 1U8IA 3LZFL 3O6LH 5DHVB 4QTHB 2GYSA 4OZ4A 4K3DL 3ECBB 3G6AB 3QWRA 3ARDA 2Z92B 3NCFB 4JEGB 2XZQH 2X7LA 1DBML 5DK3A 2WMPA 4L29A 3CXHJ 3PNWB 2H3NA 3KYKH 2Z91B 1P6AB 4JFQB 4JG0H 1FZOA 5DJXB 4ZTOH 3KS0J 2G60L 2J3SA 3BVNA 3T0EA 2F19L 3IF1B 5J11C 1P1ZB 2EDYA 4YH6A 5E0QA 3IDNB 5FHBH 4A6YA 4UOJA 3LEYL 4WW2C 4U1GB 3NGBC 1NL0L 1WBYB 5KVGH 3R0MA 3TVMD 1WFOA 4AQOA 3FB8A 5EU7E 3QWOB 3K1DA 1JZ5A 1HCFX 3ZE1F 2FL5A 5F1IA 2OTUB 3O2DH 4APQD 1LP9A 3RX8A 3MREA 3JXAA 1AHWA 5TQ2L 3H9ZA 1FLRH 1NFIA 4PJAE 4NM8H 3WV0A 5L8JB 3BT2H 3O41A 2VXSH 3L3HA 4GRLC 1BZ7A 3HUJE 5D70H 4DW2H 3DURA 1S7SB 5AZ2L 5TFSH 4KJYA 1YN6A 4XNYL 4JREB 4NO0B 4ORGB 3OSKA 2AXHA 3AY4C 4LFHD 3KR3L 3S4SB 1C7SA 1GGUA 1BQHG 4HUWA 4QF1A 4X6FB 3QDME 4YUEH 1WISA 2VB5A 3BHBA 2Q6WB 1HDMA 2XN9B 2NY5H 1VKXA 1H0DA 3WO4B 2R9HC 2AJUH 4JKPL 5FYKD 4UTAH 4HPYL 4I3GA 1RUAH 4G8EA 4XMLL 1JHKH 2JLLA 5MHSD 2DN7A 2GTWB 4NN6B 1TETL 1DQJB 4MJID 4RZCB 4QRSA 3OKLB 3LKQB 2F54B 4HUMB 1V05A 3SGEH 1P4BH 2YSSA 3PWUB 4PIRF 4I48B 3IFLH 3KXFE 5F7KC 1PJ9A 2DQHH 4W6XB 3O6MH 3UP1A 1CGWA 3B9DA 4GRWF 5DURD 1BBDL 1DBAH 4LLVA 1PGRB 5JDSA 3QQ9D 4XVUD 3PP4H 3TO2B 1QSEB 3VE0B 4YZFE 2ZOLB 1U58A 2VDKH 2R4SH 4OJFH 5JLZA 4U7SA 4ODSL 4WO4D 1T03H 1PX3A 4M9PA 3BPOC 5TQ0L 3P9MA 1MCDA 4MNQD 4J1UA 1KG0B 4PY8I 2QQLH 4MMXC 4PB0H 2D31B 4O4YL 1ZHKA 4LGRB 4X6DE 2D0FA 2ZSVA 5DRWB 4GMSL 1UWEL 1CFNB 4X4XB 1U8HB 5F7HA 3GI9H 2BSRB 4X98A 3FQWA 4H20L 3STZB 5FYKE 4OLXH 1QRNE 1OOAA 5FO8B 1A3LL 1NMCB 2A9NH 2ADJA 4NQUA 1ODAA 3EHBD 2ERJB 4JM2A 2NXYD 3GM0A 3B2VH 3M17B 5TF1H 3V6FA 3NCJH 2BNRA 5DJ8B 3MRFA 4X5WB 4U31A 1WZ1L 5HHVH 4XPTL 3MODH 3ARVA 3GIVB 4AEIH 2DQUH 7CGTA 2APVA 2ARWA 1W72B 4FQJL 1RHHB 3MV8A 4G80B 2DB8A 3CFEB 3AS2A 1QHPA 2BRRH 2JJTC 5KSUB 2X4QB 2N4IA 1T7YA 4MS8C 4OT1H 2CLVA 3LH2H 4WV1A 5BZWB 4OGAD 3VFMA 4OFYA 4FTVA 1GIGL 4RBPK 2HWZL 5KN5A 3ZZ1A 2VLJE 4HLJA 4MHHG 5EZOL 2QR0B 4Q6IC 5J56B 1CXFA 2HLAB 1AGCA 2CH8A 3FQTA 2YBRA 4UDUB 3AY4A 1U95A 5FA4A 1CGSL 4HIEB 4NRXA 5ETUA 1FL5A 5MENB 2R2HB 3VG0H 2AJVL 4LSTH 5DJYB 5BMFH 4KAQL 1X5IA 3MRBA 3D0VA 3E3QC 3T65B 3TV3L 3G6JE 3HE7A 4KKBD 1SBSH 2XTJC 4M4RA 2ARJQ 5IT2L 2PNDA 5D7LD 1VGEL 4N5ED 4L8CB 5HI4D 1B4JH 3FCTB 1D5XB 1FNAA 5F93C 3TIEA 1SHMA 1A7QL 1M71B 1AKJA 3GMRB 1T80A 1Y6KR 4Y1AA 3MNZB 1B4RA 1ZGLM 2V5MA 5EOTA 4M7KL 1CICA 2VDKL 3MGAA 1BQHB 3OPZH 4H26A 2ESVA 3TO4D 1K4DB 3IXTA 1F58H 1R3LA 3NVQA 4M8QA 4LAJH 5EN2A 3IKCB 4IIQC 4APQB 1DANU 2ZCHL 1QTYT 5HSFA 1IM3B 1RV6X 5D72L 5I1CH 1ORSA 3O6KH 4ZFOB 1DANT 2PYEE 4QHLB 4X7TA 4ODUA 5GJTL 4DCQB 1T21B 5F7WC 2N7AA 5TE4H 1PYWA 5IB5B 4YGVB 3MGTB 1JYVA 3BMWA 1FIGL 1CE1H 3ZT5A 3JUYA 3QIUC 5EORL 5AWNH 5E6YA 1H5BB 3IRZA 4HIJB 2AK4B 1DTUA 1GHFL 3ZL4L 1HDMB 2XN9A 5DD5H 3RI5K 4PJ8B 1H0DB 4WUKL 5IFHH 5CP3H 5J1AA 5E5RB 5EC1A 3TYGH 3P4NA 1N26A 5MEQB 1KEMH 1DSFL 3GKWH 4WNQB 5C07D 1OP5K 1DQJA 1T1ZA 4MWFA 4NO2B 4XAKD 3EJZC 3KPRD 5LXGH 3DVGB 5AUMB 2F54A 3U9PL 1MCQA 3PGCA 1AQKL 4XP9L 3KR3H 1KLGB 4QOKD 5SV4A 4I48A 1RVFL 1MWAA 4LCWD 4OFVA 2IAND 5JA8B 3ARUA 5DRZB 3EJZD 3G04A 1S78D 1CD1A 3BE1H 3MRHA 2EECA 3CXHK 2V2TB 1B0GB 2AI0L 4MD5A 4PLKC 4YHKH 1XF5B 3GJEA 3PGDA 5IFAH 1JWSA 2AJYL 1IKNA 2HT2D 3KLDA 1OAUH 5EU7C 3X3FH 3QDAA 4N5UA 1SYVA 4HX1A 4QYOA 5SX4H 5CEXA 3Q5OA 1QBMH 1LK2B 5HVFB 4XPBL 4ZNEA 1YZZA 1HHIB 1OQOA 4M3KB 3U7AA 1N5YL 1QNZH 2P49B 1U8NA 2EDXA 2FJFB 5FOBA 1J1PL 1RUML 1CFNA 1UM4L 3SKOB 1QO3A 2CLRB 3L3IA 5GS3A 4KJPD 4Y5YC 1JZ8A 4NBZB 4ZDHB 4B53A 2MSPA 3C2SA 1FJ1B 3D85B 3RX5A 4PJGF 2FECL 3MODL 1GCFA 2FWOA 3B9KA 1WIUA 2IEPA 1K8IB 2A6JA 4NP4L 3RKPA 2BJML 4KVNH 5CJ8A 4OV6F 2GQHA 2XWJA 2ZP0T 5C0BE 3LQAH 4NWTL 2D7QA 4JG1L 1OT1A 4XNZC 4M1CC 4NBYB 4EI5B 5LJYH 4ZD3L 5B39G 1YC8A 2O5YH 2UYLA 1AD9A 4X9BA 5TDOA 5DWUH 5FKAB 5DJ0B 2APWA 5J6HB 2J2ZA 2HA1A 5DDHB 3ULVC 4J23A 4F33A 4LEXH 4XXCC 1HSAA 2V5RA 3BEVA 3MRCA 4YEFA 5AG9A 1S5IL 5C0CA 4PR5B 1JMZA 1UKSA 5FB8B 1A7RL 1P2CA 1JZ7A 3O2VH 1T66C 1NCDH 3QIBA 4CVXB 4ELMF 1KB9K 1U95B 5FA4B 2Y1VA 5H2BA 2WBJD 3HLAA 1FL5B 1M7DA 5MENA 5I8KL 4LBEB 5DJYA 3K74B 2FEEL 4BH7A 4EN3B 4LARH 4NFDA 3VGAB 1EHAA 4JFFB 5I71B 3DHMA 1RHFA 4L8CA 4PRHB 1ZLWH 3TBYA 5BCAA 3N1PC 4FFZH 1OGAA 2DMCA 5IIEA 4AEHH 5DC4B 5BRZE 3ILQC 3SDXB 3Q6FB 1H8SA 4U0RC 1KSRA 3IB4A 3VDBA 1T83A 1ZWIA 1BQHA 2J4WH 3CUPA 4ONOA 5FCUL 4DWHA 3G6DL 4L8SB 5TGBB 4RGND 2P7TB 4QXUH 5EN2B 4NO3B 3LKRA 4JN1L 1PEZA 2DQEL 1Q9WB 2R4SL 3QDJE 2FIRT 4PJIE 1JGVH 1G7HA 4X6CF 3IFNL 3V8OA 2AK1L 4S2SA 4X7TB 3EDEA 1XGUB 5KANI 1B0RB 2GKIA 4PJ8C 3CZJA 5LQBH 5EORH 4LU5H 5DK2A 3LQAC 1LO3H 5E8NB 3UJJH 3VXMD 4WRLA 1EGJA 4HIJA 2AK4A 3JTSB 2VLKA 5T1DL 4PJ8A 4KKNA 3UYOD 2M8XA 5IEKB 4UAOB 4WWKA 4GRWE 3QNXB 1F11B 3L5WA 4WCYL 4R4NC 3WN5C 4C56A 5F7EH 5SX5H 1DVFA 5IVNA 1T1ZB 4OD2A 5K93A 4Z78A 1YPZE 1JPSL 4QRPA 5CHNB 3V0VA 3FQNA 1GC1H 1FLTX 4W70A 3VRIA 3SDDB 5HGDB 3GSQB 3I6GB 1EZVY 5D93B 3RZWA 3RVWC 5IW1A 3F7PC 4OLZH 1Q9LB 2DQGL 3BMVA 4ZTOL 3VG9B 2XTJB 3M8OL 5EUOF 4R7DB 3MLWL 4ONHA 1RIVH 1NGXB 5HYSB 1WAAE 3HUJB 5SWQB 2QSQA 1N5YH 4YZFF 4UV7L 4P46B 2DICA 3V7AG 2X70B 3BQUC 3EYVA 3QUXB 4Y4HD 1E6JH 4KKCC 1BQUA 4QO1A 4HS8H 1EUUA 1T5XB 4DFIA 1N0XL 2CIIA 1NEZG 5D1QB 2Q7NA 1U8NB 4K8RL 3RL2B 1MELA 1Q0YH 1I7UA 4R97B 1E4KC 2ADFH 4U33A 3VWKC 4NZDA 4KI5D 4U1LA 3QPXL 5EUOA 4L3EE 4PRPE 4TOYL 2P5EE 4GW5B 1CDIA 1L9MA 4DKAA 2MMXA 3D85A 1KENH 1A7OL 3QI9A 2G60H 2FX8H 2Z31D 1MI5B 1I3GL 2R8SH 2ZPKL 4PRNA 3DO3A 2VUOA 4NQDE 5AD0A 3TNMA 4TSAL 2ZUSA 3W39A 4X80H 1T1XA 1KB9J 3T8XB 5HJ3B 3CU7A 2EDHA 3RAJH 4DN3L 2AV1B 3OAUL 1KELL 1U3HB 4JRYB 2G75B 4G42A 1PX4A 5DJ0A 4X5LA 5J6HA 2C3VB 2NW3B 1CR9H 3UDWA 4LIQE 3A67H 4HFWA 4F33B 4UT6H 2HFGH 3MCKB 3LDBC 4Z7QF 5DHYB 3VXTA 1UB5B 1F3JA 1UM6H 3WS6A 3QNZB 1GOFA 3D3VA 5INCB 3HS0B 1XH3B 2VIRB 2HVJA 4Y2DB 3QIBB 4TUOA 2NLJB 1CVSC 1KB5H 2R0WL 4K8RC 3GIZL 1BIHA 4MNHB 3OJMB 4HMEA 4FQPA 1BVLA 1CZ8L 1TCMA 1ZV5A 3BSZH 3NFNB 4HMDA 2J1KA 2QBWA 4WGVB 1KJVA 3OKDA 4AENB 3AREC 1G6RL 4IOFC 3U82B 3SJVB 3DOSA 4B5EA 1WWAX 2ZJSH 3TYFB 3IFLL 1OTTC 4LCIL 3V5KB 1YQVL 4L8SA 5TGBA 1I3UA 1V3KA 3LKRB 1PZUB 3HKFA 1IAIM 3BP6B 4LDLB 1G6RA 1G9NL 1CGXA 3LN5A 1RZJL 2UWEE 3F6IA 4NNXA 3PQYD 1ZT4A 2P44B 2XNAB 1MOEA 1LEIB 1MJ7L 5KSAB 1FQ9C 1KCSH 5E2TH 3E6FA 4FXGB 3VFPA 5E6IC 5FO9B 2XIDA 5DMGD 2FX8L 1A6WH 3DV6B 2ZPKH 1F13A 3F8UB 5T33L 1T2QH 4DZBA 4EN3C 3QQ4A 3KYOB 4UILL 2VLRE 1J10A 1DVFB 2X4TB 5CZXD 5F8RC 1ZHNA 2ITDA 5FYLH 1FIEA 4UNVA 1S8DB 4RFOL 1ZHBB 5E7BA 3FQNB 4K8RH 3OTTA 1P7HL 5TF1L 4U05A 3VRIB 5IEHA 4KZDL 3WFHB 2L7UA 4RAUB 3MRLA 3FB7B 4GQ9H 4Y0GA 3GSQA 1JPTL 1LEKB 1UXSB 3TN0D 5SX5K 2O5ZH 3MQIA 1JHLH 3AS1A 1PY4A 4ZUUA 2WWMD 2CIKA 4AT6A 5KOVC 3MJ9A 2DRUA 4Y16C 5GZND 5IHLB 5TE6H 4Z0BL 1INEL 5E9DA 4U1MB 3MLZH 4Y4FA 4YPGA 3RVVC 3B3IA 5C0FB 3KPQA 3ARPA 5JIKA 4TUJA 3T0WA 3U83A 1IQWH 3LKPB 1F4HA 1NANI 1ZGLP 3AB0B 5DRXB 5HDBE 3WKMH 2BVQA 4NT6B 4GKNA 4Q9RL 5DRNB 5J7CC 1OLZA 5D9SB 4CAGA 2CO6B 1H3GA 4XCYA 3RX7A 4IIQB 4N1CA 5HD8C 2KQMA 3AXLA 4U0QB 4ZPTB 4OLWL 4UDTB 1FGVH 2HYMA 1N6QH 4S1DD 2GCYA 3KXFD 5GGUB 2V7NA 4Q2ZA 3BP4A 4Z7NF 2DYPA 2Y6SC 4L5FL 2ICES 1CL7L 5B3JE 4ELMA 3K46A 2CR6A 1FGNH 4HBCL 4YHOH 3PP3H 2PCPA 4LAQH 2EXWC 3QFJA 1BFVL 3VMNA 3CZFB 3TCLA 4NC1E 3P73B 4HW6A 1DDHA 4NNYB 3V5HB 3SDYL 5D1XC 2DM4A 1N59A 1IGIL 4XWGL 5J3HC 2CRYA 5DJ2B 3MOQA 5GGTH 3MJ8A 3VDCA 1JF6A 4OGXH 4MA7L 2QSTA 3RWJB 4X4YB 3RVUD 3T0AA 1UJTA 3V0WH 4JE4B 4TUOB 2DDQH 1EERB 1GL4B 5JHDE 3VGHA 4B7LA 3I6LE 1E27A 4U6XB 2F5BH 2JB6A 4PJ7E 5IBUB 3D39A 2ZSWA 5HPOA 1T89A 4XBPA 3IFOB 1FRGH 4XVTL 1R5WB 3RVWD 2DQTL 3VXUE 4Z76A 1KJVB 1PG7L 3F62A 2BNUA 3NFSL 4NQEE 3VI4F 4KROD 2CJUH 2MCPL 3SE4C 1C16A 4LLQB 2E9WA 4PLNC 3O81A 5HHOE 1OTTD 3U0TA 1QLEH 5FM8A 2HT3D 2W07A 1WWWX 3DTXB 2FEDC 3JVGC 3NFPB 4IOIA 2EE3A 2IPKB 2AVGA 2RB8A 3U4AA 3WJLC 2AABL 1AD0A 4PJ9D 3QUYD 3CJJA 3BKMH 1WBXB 5DQDH 2XTJE 2Y07H 3CDFA 5HYSG 5KJRL 1CFVL 1RUPL 3WJJC 1LE9B 3W2DH 4K71B 1OAKL 4XCFL 3TH2T 3WL9A 3WNMA 4AG4L 1IBGH 4YC2B 1P1ZA 4ZPVB 5D1XB 2COQA 4XP5H 4OKVA 5DQDL 4EI6B 4Y4HA 3QPXH 3HMWL 1NGQH 1BM3H 2Z92A 3FB8B 3RWGA 3HE6A 2OZ4A 4OZFG 4BK4A 1D5IH 1FPTH 5E5UB 5L6YL 2A77L 4Z95L 4WWKD 2H3NB 1J1PH 4FQLH 2UZIL 4FFWD 4UV4L 4YIQB 1TNNA 2FX9L 3SE3A 4QCIA 4GG8A 4LIQH 2GJ6D 2W9EH 1CLYL 3Q1SL 4GRLA 1DL7H 3QHZL 4EIZC 1Y6NR 2EO1A 2JIXA 4ZTPH 3ARBC 2BX5A 3A0OA 4LCWB 2IANB 1NFDB 2WM0A 3OB0H 1QEWB 4UQ3B 4WTZG 1EFXB 1I7RB 3B6SA 4OM0H 4QXGH 2O5XL 4DUVA 4NJAL 2F5BL 1U8PB 4NQTA 4F8TA 5BZDB 2X4PB 3LRSB 3UXFA 2BSSA 4AT6B 2FX7L 2CSPA 2A9ML 4GBXB 4WFHD 1L7IH 3IKKA 3L1OH 1X6LA 1R24B 3PWPE 4I4WA 3JWOH 3U9UA 4JY5H 2BVPB 4M7ZB 5BVPH 2GTZB 4CMHB 2DMBA 1CI5A 4GO6B 1FNEB 4GSDL 3WDHA 3PWPB 4F58H 4L4TA 5I1EL 4JRYE 1BJ8A 1UJ3A 5DRXA 4OLVL 2DI8A 1F45A 3DMMC 2Q76A 4FQXC 4QF1B 1HI6A 2IPUG 2PXYB 3ZE0F 4YDLC 2F54D 3MLTA 3RBGA 4KKLD 1NJ9A 3TYGL 2OQJA 2HKHH 2HT2C 3VXOB 4NQDB 2F8XC 3WSQH 1CLOL 3QB7C 3L9RA 1IGTB 5C0AD 2IH3A 5L2KB 1U3YA 5HHXH 1A6UH 1F8TL 3MRGB 2Z31A 1AFVH 3W5NA 2DLIA 3F58H 4EBQH 1NGPL 5IVXE 1HEZA 4Q0XL 4WU7A 5EUOE 4MA1C 3E0GA 2E8YA 4LKCB 2B1AH 3SE8H 2W92A 1S7WA 4LVHC 1S7RA 2CRIA 3I2CH 1J0ZA 4L9LB 1CT8A 5DMGC 1S9WB 5C70A 3DARA 4HH8A 3IU3B 5CSBA 4I5BB 5GJSH 2OBGA 2O26U 1RUKL 2BSRA 3VE0A 3FQWB 5EU4A 1K5NA 1IC7L 3BI9X 5D1QD 3U4BH 4RBPH 3RWJA 1DLFL 3O0RH 4PGCA 1ED3A 1T3FB 4PJDF 3RHWK 4L4VD 5TF0A 2PUQT 4E5XB 2CKBB 1QG3A 3V6FB 5M7QA 3H9SA 4F9LA 2IPTH 5EOCL 3TVMA 1VGEH 4OZGE 4EN3D 4JKWA 4NJAH 3O9WA 2YEZA 3BP5B 4CU7A 3WXWH 3QUMA 1XT5A 4PRAB 2DL9A 3RJQB 3L95B 2VDPL 4XMKL 3WNKA 4XNXH 4X98B 3CFEA 4G8GA 5IB2B 2ZCLL 1JMXA 1U8LA 1YEJL 4XPAH 1G7LA 1JGLL 3D5OF 3K1KC 3U36B 3ZYJA 1E6OL 2VDMH 3VXUD 1HOCA 2NZ9C 4PJ9C 5KVGL 3TEUA 4FTVB 3M17A 2BNRB 3MRDB 4LLYB 3WUZA 1EFXD 5H35B 3DUHA 4I3RH 1U3JA 1S7XB 5DFTA 1UA6L 4Z6AT 5CZKA 4AG4H 3BO8B 1IEAB 1FO0H 2Y06H 3S37H 1ADQH 3ZT6A 3ILQD 3GB7A 4S0TD 2G5BA 1MCPL 1YDPA 1QFPA 1M71A 5C07E 2X09A 1SEBB 2JCCE 4E41E 5EZIH 4LCYB 3NH7H 3TC9A 4X7FC 3NOIA 2ORBL 3EOYG 3FT3A 4KH2A 5KAQF 5DD3H 3TZVC 4HKXA 3RPIA 1MHPH 2HRPL 4GKSA 2R2HA 5ADOH 4GG8B 1BFSA 3S34H 4XNUH 1GGTA 4GRMA 3D0VB 3MRJB 4J4PA 1JF1B 2HN7B 2YK1L 5KG9A 2CXGA 1NFDA 2I5YH 4IDLA 3EFDL 1I7RA 3B6SB 2DQDH 1TENA 3QULA 5CKGA 4YFLF 3DX6B 4J4PC 3ULVD 4KTDH 5B22A 1EXUA 2QQQA 4QXTA 1AFVL 1U3HD 5I2IB 1TPXC 4XI5C 3C60B 1IC4L 1UB6B 2I9LA 1T04B 1U93A 5ICZA 2EC8A 5I76B 3VW3H 3IJYA 4GBXD 3TWCH 5HI5C 1VSCA 1U8IB 3GKZA 5DHVA 4IRSA 2GTZA 3D2UB 3QQ3A 4P2RD 2P5WD 4MJ5B 5CEYB 2VZOA 4LSSH 2IFGA 3WSQL 1RURH 5CAYB 2V7HA 1P69B 1MEXL 3W0WA 4OV5B 4X7EC 3SDYH 1MWAB 4Q9BA 3PNWA 5DRZA 4PRIE 3BRGC 5E00A 4LSDA 3TP4A 5K9KB 5IGXL 5D2NE 2CMRL 3SHSA 4LSRH 5EC1B 3AVEA 4TUKH 3TT1H 1RAMA 2NR6C 3T0XA 1Q72L 1SYVB 3HC3H 5IJVA 1CG9B 3ULUH 5DVOA 1N8ZA 4XT1C 5JXEC 3RDTD 3QP3A 1NBYB 2EIDA 2EH8L 5B3JF 1XF2A 4OTXH 2R1YB 5F1IB 4DOHE 4HULB 3EYFA 2NY4B 2YPLA 2HVKA 3G04B 5C92A 3PHOB 4Y19E 1URLA 1QPXA 4MX7A 1S5IH 4I1NB 1RZ8B 3O41B 3TVMC 3L3HB 5GGSB 3ZMRA 4PJXA 4CADA 4K94L 4ZDHA 3ILPA 3OXSA 4PJAF 4PB9H 1FPTL 1E6JL 3F12A 1NUNB 4FQLL 5E8EB 4PRID 1Y18B 4V1DA 3UBXB 1QRND 4X4ME 3DMMB 1D5IL 4E5XA 4X6FA 5FUOH 4QWWD 2VH5L 3R0NA 4AL8H 5HBBA 5KZCD 4J3SA 1ZANH 4CW1A 4MJ4A 1EJOL 2YEZB 3MA9H 4H8WL 1OAZL 3OZ9H 5KSBF 1BX2B 4PGEB 5I16A 2AEPL 4YBHA 1R3JB 4NUJA 3RNQB 5E4IA 1NCBH 4ETQA 2DWEB 2XACC 2CD0A 4HWUA 4KVCL 3S96B 2DKMA 1G7LB 3BJ91 4RFOH 4URTB 3GMLB 2YR3A 4CU6A 5FEBA 4LNRB 1HE7A 5EU6D 1UA6H 2BVOA 1MHHB 5EZLB 3A6BL 2BVEA 1KXVC 4I3RL 4R8WL 1RJLA 5E5MB 5EOQH 1AXTH 4G6KL 3VWJB 4KJWC 3G08B 4F7EA 2HMIC 3D3VD 5JOFA 3PL6B 4D3CH 3HNSH 3BGFC 1G7PB 3TBWA 1S7VB 3IDUA 3P0GB 4C59B 1ROWA 3ZSSA 3BDYL 4WHYH 4PJ7F 4JFFA 2ZCLH 3JWNC 4M62L 2HKHL 5JQ6L 4EZMA 3T3PF 4XMPL 1YEFH 4NCC1 1UC6A 3CVIH 2CUMA 3SPVB 2IG2L 1NFDF 4KK9C 3SKNA 1RMFH 4JO1H 1KG0A 3Q6FA 4LCYA 4JCLA 2D31A 3FN3A 4ZYKB 4YXHL 1PY9A 5GS0C 4ZFGL 1A9BA 1XIWC 3HUJF 3QXUA 1A4KA 1ZT7A 5E2VH 3JWOL 4OGXL 4FMKA 4BH7B 1F2XK 4ZMAT 1Q9WA 4PTUB 2GJZB 3OGCB 4OB5H 3DI2B 1DEEB 1EEUA 3KJ4C 4LHUG 3S36X 2JIXD 1L9NA 2DD8H 2YWZA 4YXHH 1MI5E 1HHGB 4JHWL 2EEAA 1GC1C 5D8JH 1OGAB 1D5MB 2YD2A 4M7JH 4X5WA 1NCCL 3T3ME 4EXPX 1QFHA 1QOKA 1V7NH 1D9KA 4JFEA 4UIKL 4XVJH 3GK8H 1FVDB 5ESVA 4XPHL 2I9LB 4JLRA 1JGUH 3L6FB 2X4QA 5E7FA 1EK3A 1K3ZA 2ICWI 3O4LA 2R1WA 4JANB 3GMNB 4K3JL 3BPNB 2X1QA 1A02N 5F9AC 2H41A 4R4FL 3EYUH 4ZO6A 3RVTD 1Z5LA 2K7PA 1A21A 2RAMA 3UYRL 4JN2B 1A6TA 2W60A 3MMEA 2QR0A 5H94A 2PETA 1W72H 5L0QC 4NRZA 5ALCL 4MAYD 5E00B 5JMRA 5DWUL 4FQ2L 1FZMB 4JJ5B 2DIBA 5DJ6B 2BNRE 5H8DA 3S6CA 5ISZB 4Z0BH 4BM7A 2YOCA 3DVNA 2EE6A 4YLQT 5EG6C 4EKXA 3RVVD 4TYUA 1CG9A 3P2TA 4K71C 5C0DB 1SY6L 2XICA 3CDGB 5AZ2H 1TZHA 3GFUA 5FOJA 3GSNL 3TBSB 3G6JF 3SBWA 4YHIA 3EYVB 5TE7L 4GQ9L 4P23D 1NC2D 5BV7B 1RI8A 3LRHA 3KPOB 1MFAH 1TTUA 4OCXH 1DQDL 3FT4B 2R0ZH 3UTTD 4D9QE 5IQ7L 3W9EB 5HDBF 4RGOH 4Q58C 4XPAL 4U1LB 5JORA 3AAZB 2NY7L 4P3CL 4BFGA 3L3OA 1ZOXA 5IWLA 1P5UA 2EDEA 5CWSB 1RIVL 5E2UL 1FNGB 1NAML 2W9DL 4DGIL 4C57C 1CFQB 3X13B 1L0YA 1JFQL 2X70A 5D2LE 4ODVL 2EDRA 2MQ3A 2GK0A 5L2KD 4JDVB 3BN3B 3T2OA 2ZOKA 2DYPD 2BY3A 1I7UB 5EIVA 1IVLA 4HV8B 5D71H 2GUOA 4LPUA 3QH3A 4YHPA 1REIA 1INDH 4ZS6D 3MRRB 3U4EA 3MLVL 4WNQA 2NX5E 4GW5A 2QSCL 3MO1B 5BRZB 5J8OA 3QZWA 4M43L 5DHYA 4MB3A 4GBXC 3C09B 5I18H 3OAYK 2LTQB 3QNZA 1WZLA 2VZSA 3RIFK 1GOGA 4U6VL 2OJEA 4QHNB 4N8VG 3C5JB 4AIOA 5MEPA 3RFZC 4ZO8A 1DLHA 5FECB 1KXTB 3GJEB 3VXME 3NZHL 5LWYH 4X7DC 5C7XH 5CKAA 3F58L 4EBQL 4WFED 5MI0C 1OAQL 4CBPA 4P57A 5EIIA 1XCTA 1ZE3C 5IHUL 3OXRA 4IRZH 5J4MA 1VEMA 2KQNA 2IQ9L 3MRNA 1XH3A 3NIDE 2YRLA 1DQMH 1CN4A 4Y19A 5IHZB 1FBIH 2CUIA 4KY1H 4XX1G 1TTGA 5T1MA 4MA1B 5EBWA 3BN9C 3MLYH 1J5OH 2CLRA 3HI6L 5D7SL 3SOBH 5KSAC 2GJ6B 1KCVH 3VXUB 1OSPH 4JFYA 5DQ9A 2DLFH 3KJ6L 4P48A 3PDGA 1OM3H 1S9XA 4PJ7B 1YEFL 1EH9A 4PBVC 4ONFH 3QXVA 4N0YH 4FXGA 2RBLA 3VFPB 2CQVA 4N90E 5D1QC 3V6OC 4HG4K 1CD8A 4P5MA 5IQ9B 4YUEL 2WIMA 3LD8B 4X7CC 2VWEE 4XBGA 3K8MA 1RK1A 3MRPB 2Y72A 1MCNA 1YY9C 2IBZX 4EUPA 2VZVA 3WFBH 2D4DA 1F2QA 3RIAK 2BRRL 2OS7A 3GUTA 1QUNA 5EZJA 5FB8A 3KPLB 4FMFA 5I18L 3I50L 3U7WL 3DGGA 4BSVA 2VQUA 1J0YA 5EB9A 3HLAB 1M7DB 1L0QA 1TJHL 3A6CH 4D9RD 3S9DB 2VWEC 4EN3A 5IESH 2AJZB 4XXCA 1ZT1A 4F7PB 1MIMH 3T0EC 1TZGH 4YDKH 5JIPA 3MJ6A 3NCMA 5H37H 3MREB 1INEH 1EUTA 4F80A 2FGWL 1W8OA 2H6PB 1QFWI 1RZGA 1BVZA 1UM4H 3Q5TA 1MCCA 4JO4L 5DD0H 2AQ3A 4WFGD 2VH5H 5KS9F 4OZIF 5CGYD 5T3ZH 4KDWA 3BD3A 2V5TA 2R0KL 3MROB 4NO3A 3GI9L 3S4SA 2ICWJ 4LHUB 5IKCB 3W9EA 1FVCA 3AS3A 1GAFH 1MRDH 1CGVA 1TJIL 3ZDXF 3ZKXB 5ENWB 2FDBP 1MIEL 1ZVYA 5TPWH 5KVEH 1BOGA 4LPWA 2EO9A 2P5ED 3X13A 5K33A 3DRQA 5L9DH 5E8NA 2GTWA 4NQCA 4TVPE 4Q2ZB 4JZJA 1FYTD 2VTFA 2HFFB 4UIMB 1MH5B 4N9GB 1BIIB 1RZ7L 2ILLA 2BNQA 4GKOA 4UTBH 4I77H 5IVXF 2W91A 3TT1L 4U0RB 1CBVH 3BE1L 1RVFH 2MFNA 4HCRL 5HHMB 1I9JH 3W11D 2BY0A 2AP2A 3ARRA 5HHXL 3EOTL 3CAFA 3CZFA 3X14B 3B5TA 1WBZA 5IVZB 5F7MC 3MO1A 2MPAH 3P77B 3RWCA 2AK1H 3A6OA 2P45B 3DUSB 4KK6D 3U6RB 4NKIL 1BPVA 3C60D 3I3BA 4Z7VF 3QYCA 3WFDH 1R0AH 1G9MC 1U58B 2VRAA 4YJZL 4FQIL 3ARGD 1FZKA 1K2DB 3MGOA 2KL6A 4TSBL 4H25B 4RX4A 1J18A 1YQVH 2V5YA 3D39B 1Q94A 2VLJD 4D9RE 3IFOA 4U6YB 4PGBA 5EIIB 4YQXL 4PRIB 3JZ7A 4GT7A 1MCRA 3C8KA 3C87A 3FTGB 5FYJD 3MV9B 3ARED 1O7VA 2IQ9H 1KPRB 2OK0L 1SEQL 1H9VA 3GSWB 3MJ8B 4KHTH 4L4TD 2PYFA 2HT3C 5ICXB 3U0TB 2FEDD 1P7KA 2P1YA 2PR4L 3BUTA 5L2JA 1MLBB 1CDUA 4HIXL 5D2LA 3OPZL 1QQDA 3SBWC 5JOPE 2B5IB 2DKUA 3H9SD 3DBXA 1HIML 3LQMA 2V2WA 4RFNB 3NZHH 3ZDZF 1WITA 1N6VA 2WAHA 3MLZL 4O5LL 1RFDH 1FC1A 1E4WL 2Q7YA 3C9NA 3LS4L 3GHEL 1UM6L 3PQYE 2ADGB 1TFHA 1SBSL 4YHLH 1OB1A 3TESA 3WE6B 4AM0A 4M03A 4DOHB 2OXGA 3F5WB 1L0XA 3MOBL 2A6KB 4ZUTA 2X4OA 2IPKA 4JPKH 4FHBD 5DD1H 4JRYA 2QV2A 2G75A 4IHOA 4FQ1H 3RWEA 1UH2A 3ZKQD 5TJWK 1A6ZA 2Y07L 4MJ2A 2NY6D 4P2RB 5ETUB 5C07B 1AXTL 4H0IA 3D25B 3UC0H 3UTZB 3V79C 2NXZC 4IS6A 4MB4A 2HRLA 5BS0B 1DEDA 3RY4A 2AGJL 4U1IB 4N68A 3DXAD 3ARTA 4J7RA 4ISVB 1I7ZA 2SEBB 2EKJA 4R90L 2PYEA 2AJZA 5BS0E