4DAGL

Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
213
Chain Sequence
ELALIQPASVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQDSERPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Fusion glycoprotein F0
publication title Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site.
pubmed doi rcsb
source organism Human metapneumovirus
total genus 37
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagL01
3VG9B 1Z6JT 5CP7A 2W07A 1X5AA 3K4DA 5IEKB 4DN3L 1TVHB 2CMRL 2DQUH 1F6FB 3D18A 5GGSY 4A2MA 3CZFB 3VE0B 1CQKA 3F7VA 4LCYA 12E8L 2ERJB 4OZHA 4PJCE 3QG6B 3WHXA 3CDYA 5E0QA 2HFFA 2CLZB 4ODVL 4PGDB 1T1XB 4NUGH 4XHJC 4JZJC 4HKZA 4J8RB 4JN1L 5HYQB 1MREH 5FECB 2NNAA 5DSCB 5F71A 4OF3A 2EDDA 5DURB 3KPMA 1H3TA 4L3CB 2ADJA 4ZPTA 1YMMA 3QIBC 2VSCA 1U95B 3U36A 2JB5L 2HJKA 1VGEH 1FFQA 3GSQB 2VAAB 1K2DA 4XMLH 5DFWH 1FGVL 4BSWA 1OF2A 1YJDL 5DJZA 5JW4N 1V8HA 3SQOH 2Q6WB 1CE6B 1MAMH 1ORQB 4K7PH 1P4LA 3C6LC 3MJ7A 1X4YA 1RURH 4I3RL 1EEZA 1OTTD 1RK0A 1KELH 2H8PB 2ZG1A 1TTGA 4AEEA 4F33A 2V17H 5CILL 5HVGB 4ORZC 1SBBA 2EDLA 4NN7C 4PD4K 5F6HI 1EHNA 5E8EB 5DUBA 4CKVX 3RNKB 4DKFH 1S78C 5F6IC 2HG5A 2AEQH 5HHMD 2HH0H 4PJ8D 1ZHKB 2Q87A 3LQAL 5CJ8A 4ZDHB 4QWWC 3PP4H 2ARJA 2Q7YB 4KK6C 5D1QC 4M62L 3VXQA 1FDLL 1S7WB 1FG9C 2GFBB 4WTWA 5B39A 1A6AA 3RY5A 5DJDB 4PJIA 2P49B 3SDCA 4ZAKC 3RIAF 3LRHA 4KTDH 2XWJB 2DAVA 2YBRA 3BEVA 1WZMA 3WKMH 4JKPL 4HBQA 3HZYB 2DLTA 2NY2D 2FX8H 3P0GB 4XXDB 2DMCA 2VDKH 5AAWA 1NUFA 1IM9B 3BP5B 3P4MB 1WCBB 4JFZH 4PJXA 5BZDB 4FQLH 1TJGH 4NN5B 4U1HA 3MJ6A 4H1LA 4JRYB 3R8BB 4HJGA 4JHWL 1T5XB 2DIBA 3TV3H 1ZT7B 5CP3A 4BFBD 5C2BL 3ELAT 4PJ5B 4DZBA 3P4OB 2FBJH 2CGRL 1K8DA 2PYFB 4Q0XL 5IB1A 5I1KL 1NCWL 4LLUB 5J11B 4WO4B 1EO8L 3GSRA 4P99A 2D7PA 5DVLA 5KANG 2PTUA 1RUML 4K71C 4KJQD 5IBLC 4EVNA 3KLAB 3EYSH 1OPGL 4P2QE 3RPKA 1LEKA 2EE2A 1YQVH 1RZ8A 3RU8H 3NOIA 1B88A 1R3LB 1JRHI 2LTQB 4DOHE 2HFGH 5C71A 4KGLA 3VXPB 3ZL4H 3K46A 4NO0A 1MEXL 5F1OB 3WUWG 3ZDYF 3EUUA 2DM4A 3QXDA 3RWIA 1N64L 1HYRC 1YECH 1UM6H 5I1AB 1JRHL 5E24E 1KCKA 4HUWA 5FYJE 2YD4A 3T0AA 4HXBH 1H3WM 4LIQE 4JAMB 3GJFH 4WY7L 4NKQB 1MCBA 5ID1B 3HPLB 4K8RC 5J9PB 4AENA 1SEBA 3KAAA 1U2HA 4LVOC 2BHZA 1UKSA 2Z35A 3GJEB 1AIFB 1BZQK 2G75B 4YIQA 3I50H 3INUH 3P9MB 4JHAH 2BOBA 4PP1D 3SDDA 4NQDE 1N0LA 3MOQA 5DQJB 5D5ME 1BZ7B 1GOHA 3L95A 5E00A 4KKAD 4NO5A 3VXUE 1QYGL 1MCLA 3C8KA 4OB5L 2QLVB 2MKWA 1A7PL 5I75B 2CK0L 5EBMB 1MNUL 3CDCA 4RWYH 2YEZB 1JNNL 2HLAA 3EDFA 1OGTB 3V2AR 1IC5L 4YDJA 2FIRT 3QRGL 2PO6C 4KHTL 1UG9A 5FHAL 2DBJA 4BYHA 4P3CH 1VHPA 4NWUL 1G9EA 4JRXE 5TFSL 1FV1A 2LVEA 5A1AA 3RVTC 4WCYL 5ENWA 1MHPH 2PF6A 3V6OA 4PJGF 4DK6A 1I4FB 4BK4A 2V7NB 4L4TE 1HXMB 3HLAB 3B2UD 2MPAH 3CH1B 3MUGA 4CL7A 2ZOKB 4KI5E 1FPTH 4X8JA 4PGEB 3D6GA 1JWSB 1IGCL 4OF5A 5FO7B 2BSTB 3MJ8A 1Q72L 2EDBA 4Q2ZA 4XVTH 2IH1B 2VDMH 2DRUA 2NY6D 1UJ3A 1V7MH 3LRSB 5EU5A 4RBPH 3L7FA 4X5XB 3L7EB 4MSWB 1AR1D 2H3NA 3TZVD 4FQXD 4JPKH 4LRNL 3RHWF 4F7TA 4NWTH 1PEWA 2YC1A 1CLOL 3JV0A 5EUOE 3P73B 2YD8A 3VH8G 4GXVH 2FSEB 2GK0A 2D0GA 1FFNA 3BT2L 1L7TH 3IJHB 1PJ9A 2OL3H 3MV9E 3TN0A 1PDKA 2AJZB 3GRWA 4JDZB 5B8CC 5DC4B 1B0GA 5SWQA 4B50A 1RULL 5EOTA 2VXQH 5CINH 1LDPH 2C9AA 3S9DB 1IC7H 3KLDA 1YQ2A 1OTSD 1VEMA 2A6JA 3K8MA 5I8OL 2R1YB 1MFNA 3KPNB 1DE4B 2V2WB 3MRGA 3D85D 4X6FA 4C83B 5IGXL 4MD0A 5FF6B 3UBXA 2BVEA 2I5YL 4HCRL 1LP9F 2O61B 2CDEB 1HH6B 1IGMH 5A2IH 4Q6IB 2A6DB 3B2VH 4PJAE 3HUJA 4XCNB 1S9WB 5SWZB 4L29B 3CMOL 2FEDD 5EO1A 4JZJA 3RL2A 1AQKL 3BOVA 1PD6A 1GC1H 5C08D 1YEGL 4WHCA 4A6YH 1T3FB 5D6DA 1YUHB 5DDHA 1JNLL 3O3EB 1IMHC 4JG1L 3FRUA 3QR2A 3GSNL 3QIBA 3OMZA 4Z76A 1KJ2H 2Y06H 3HRPA 3GDBA 4TVPD 4HF5L 4OBSA 3T77B 1L4IA 2NQCA 2CUMA 2CR3A 2NXYC 1DQLL 3LD8C 3AAZA 4MA3B 4EI5D 4MA7L 4AQ1B 4TNVF 2EXYD 3FN0H 1J5OH 1ZA6B 2PUQT 1T7ZA 3C6LA 4Z9KB 4X6DE 3X3FH 3L5WB 2OXGA 1TZGL 1KN2L 3K81A 4LVHB 4XCCL 3S36H 2IMNA 4FXKB 2BFVL 1KENH 4F7CA 3KLHC 4BM7A 4LHJB 1RQ5A 4K9EH 5E94B 2X70A 4FABH 3MLYL 3QUXD 1MPAH 3LN5B 2FWOA 1E4KA 4NQXA 5ESAA 4PTUB 3I75A 1FORL 1T1YB 2L4OA 1G9NC 5KTEL 5IROA 4H0GA 3RWEB 5HYJB 4KTYA 4LEXL 1WEJH 5D1QA 4F8QA 1J0IA 2DWEB 3HC4L 5I73B 3JTTA 4HX1A 3S98A 4N8VG 2X4TB 2GJZB 5F7LB 4JN2A 1T0PB 1HQRB 4ZAKA 4GAYB 4MZ3A 3NTCH 4WDIA 2NY1D 5BS0A 3HMXL 1R5VB 4OD2A 5I2IA 3FQWB 4JFXB 4ODSL 2MHAA 4CW1A 5IEHB 3G6AA 1MI5D 1P84J 4E0RB 1FNSL 1KIRA 3DETD 2PYED 1XH3B 5DHXB 3ZHLA 2BVOB 5JOPE 4WU5A 1HN1A 1W0YT 4XVJH 4XPFH 1GJIA 5FV2A 1JPFA 2I26N 3MRDA 5ILTH 3SPVA 1QPXA 2H41A 3UTZA 3KPTA 5JDSA 3O4OC 3DROA 5I71C 4Q58C 1GGIL 5GS1C 4K94L 4P46C 1WTGT 5J8OA 4P3DA 4M7ZC 3I6GB 3BH9B 3CDFA 2BMKA 4RAVA 2XXCB 2NX5B 3QQ9C 1LE9A 5E2WL 5C0FA 4LSUH 3D3VE 3LKSA 4QHKJ 3T0EA 5DRNB 4I5BA 3VGEA 2V2XB 3MRRA 3LKPB 1XZ0B 5FCSH 3DUSB 1QHOA 3H3PH 4ZUUA 5ICZA 4PP2A 3M45A 3TYGH 1W72H 3U0TB 4NBZB 2DM7A 4RIRA 4AL8L 2VLRD 5HGDB 3IU4L 1H3GA 3GSVB 4QF1B 3QUYB 3ZE0F 3WBDA 4YUEH 5EO9B 1N5YL 2OMBA 3MA9L 1KPUA 2XWTA 5K9KB 1NMAL 5GPRA 3B6SA 5KSBA 1S7VA 2IPTL 1R5WA 4LSPL 2H2SC 4Z7VF 3O45A 2DYPD 4U2ZA 6FABH 4K07A 4X6CE 5ID0A 1FFPA 4OFVA 2F8VA 4MA8H 3HFMH 3PDOB 3UTPD 4O02H 4JKWA 5DHVB 5MP6L 5D7IF 3AVEA 4ZQKB 4ONFH 3UTSD 3QCUL 4TVPH 2VRAA 2PO6A 5EU6B 5KVEL 4KKNA 2I07A 4LIQL 4XRCA 3HNSH 5JR1H 3X13A 3CXHJ 5HHPB 1SMAA 2ATPB 5BO1H 3VXOB 3B9KA 3VWJC 4MAYD 3S97C 1IFHL 2E9JA 4MNHB 1TNMA 4B41A 5FB8A 5C0RL 1QRKA 2IQ9L 4PRAA 2KH2B 4UOW0 1O7VA 3H0TA 4PRHD 1X5IA 4UBDC 1N4XL 3WO3B 4HC1L 5DRWA 4J3UA 4ODUA 3DX9A 4N0UB 2FX7L 1EAPA 1T22A 3OKOA 3PDGA 4JFFE 5JZ7D 2QQKH 1YNLL 1NC2B 1UXSB 1AD9A 2VWEE 1Q9KB 4MJIB 1M7DB 4D9LL 4Y5VB 5C09E 2B2XH 3RQ3A 3KPSB 5B8CA 4OCYL 3HS0A 4XPBH 2R1XA 2C1OA 5DD1H 1WBXB 2XPGB 2N7AA 2Z93B 2QR0A 1S7TB 2PTVA 1Y6KR 1BOYA 3UPAA 1XF2B 1I85A 3ECBB 5KOMC 4I2XE 3P3YA 2P8MA 3LDBB 1M4KA 5TH2B 3BX7C 1F11A 1FIGL 1RZKC 1B0WA 1BM3L 2EXWD 4OZIB 1QEWA 3I6LD 3TC9A 3DNKA 3DECA 2WK2A 4YGVB 4EIZC 4MA1B 4UTBL 4LLQA 2IANB 1FHGA 3VFWB 4JY4B 4OIBA 5GJTH 4LQFH 3GSNB 4HUXB 5DYOB 4PRBA 4OZGE 1T0NB 3U7YH 4YDVB 3VGGA 2FZ3B 4CN6A 1CLZL 1G84A 4POUB 3SE3C 4XB7A 3UAJD 4GKNB 4ODBD 2QTEA 1U3HB 1WWCA 4LLAA 4GQ9H 1Z9OA 2QQNL 2IBZX 2R8SH 2BOCA 4M3JA 5E6YA 5GRVK 3T2NH 3ILQC 4PJCB 4YZFF 5MEOA 1JJUA 1NBQA 2EYRB 3GGWA 4X7EC 1G9ML 4U6VL 3BUYA 1WWAX 3QIUC 2XN9A 4OQTA 4JR9L 1GGCL 4YXKH 3NFPB 4M7LL 5HVHC 1EZVY 4Z7WA 2P7TB 4FFWC 4MNQA 3V6FA 1IQDA 1QFWH 3RA7L 4YK4C 1KBGL 1MFAH 4KK9C 1C8PA 3F7YA 5I6XB 1INEH 4LF3A 3AS3A 2H1PL 5D71H 5CKAA 4KHXH 1WICA 5TE6L 1NCBH 3OKEB 2J8UF 1KYOJ 4M6ML 1QFUL 4O2CA 4Z95H 1YEFH 2H32A 2EEBA 3MV8E 5I9QC 4IJ3C 1P7KA 2HT3D 4X8XA 5J0BA 4S11A 5FFLA 1YPZA 1I1FB 1N59A 3RUGA 3V6BR 3EFDL 1A7QL 1DBKL 2PXYA 3ARGB 4X5WA 3D5OF 1DBJL 3BW9A 1UCBH 3G9VA 1I9IH 4OLWH 4PJDF 4P59H 1CFVH 4DFHA 5IHZB 4XP9L 1G7IB 1P4BH 1T0MA 3T1FA 2NY4D 5GRVL 5C8JA 2ZCLH 5GS1A 3RAJH 1HOCB 3T3MF 3QXWA 4P46A 5TE4L 1OCWL 2EDYA 3ZKMD 3MZTA 3O6LH 2XTJC 4YDLC 4BKLA 2JB6B 1HNGA 4BFIB 1CGUA 1C08A 5E08L 3CUPA 3F58H 4S0TD 3FTGB 3U9UA 2VJXA 3JTSA 4MB5A 4AMKL 1DLHB 4ZS7H 4PY7A 2MOVA 3PGDA 3E6HB 3IRZA 3U7WH 2B5IB 4X4YA 5CZXD 1MCFA 3PWPE 3LAFA 3IJSB 2PW1B 3MCG1 5K59F 5LGHH 1JZ2A 1X5KA 4G42B 3HRZA 3OAUH 1UXWB 4HK0A 4P3WA 5EBGA 1FL6A 2DI7A 3SGKC 3MOAH 3GBNH 5L2KE 3K2UL 4OD1L 3RY6A 3WE6A 2F8OA 3UO1L 4D9QE 5ISZE 3C8HA 4ISVA 4LCWD 3OSKA 5TJWK 3S96A 1HQ4B 2ZPKH 1BQHA 1BJMA 2XG4A 2X7LA 3A0OA 3TBYB 3PXJA 4P2QB 4DQOH 3VXMA 4H8WL 4QXUH 4BZYA 1FN4B 5HI5C 1UA6L 2XZZA 2VB5A 3OKDB 4OFKA 2G2RB 3AM8A 4G5ZL 3J8F7 3TJEL 4DOHB 4CU8A 4KVNH 1DBBL 4XZUA 3IDGB 4S1RH 4ODTH 3WFDL 1M05B 5EOCL 5I19H 4HWZA 1C12B 3QIWD 2WUCH 1OVZA 4GKOA 1EERB 5J13B 5BXFB 3PNWB 3VWJA 1GXEA 4PJ5D 4QXTA 2AEPL 3U48A 1E4JA 1DLFL 2OR9H 5I1JL 2CLVB 1I7UB 2D03H 4GKSA 2NW2A 4POZD 1J0YA 2R2EB 3F7QA 1RUKL 4NQDB 5GGRY 2NR6D 3MV7D 3RWFB 4D0DA 25C8L 2P45B 5D5MB 1YDPB 4YH6A 2IJ0C 3GMRB 3IDNB 4J1UA 4UTAL 1HNFA 3AB0C 3OXRA 4U1KB 5FA4B 4X9HA 3BWAB 5FHBH 3O11A 4DWHA 3MLUH 3SDYL 3FQUB 3F8UB 3OZ9L 2PNDA 1DFBL 5JIKA 4IIQB 1YEHH 3CAFA 5I1DA 4DVBA 4JRXB 4ODWA 3BKCH 3VXSA 1BGXH 1S9VA 2Q1EA 3BMVA 5KN5A 4NJ9L 3S36X 3OGOE 2UZIL 4L4TB 1BBDH 4YPGB 1JPSL 2UWEF 3C60D 5JORA 4MXVE 2BSED 2HVJA 4BSVA 5IFAH 4NO3B 4CUCA 1T80A 5J12B 4XPHL 2XZCL 1FNHA 5T1MB 1A6TB 1ADQH 4HXAL 1JHLL 2BERA 1ZLVK 4UT7H 1ND0A 4IMLB 1OM3H 2W65B 3RWDA 2EC9U 1HK6A 3CCHA 4RZCA 3IXTA 5EUOB 3UC0L 3PHQA 1DEDA 4QRTB 4KPHL 3HE7D 2OXHA 5KSVA 4G9FD 3MV9B 4NP4L 5E9DD 3QDME 1OGAA 2F74A 1NGPH 3OKLA 3REVB 4ZXBD 5FGCE 3ARFC 1CICC 2VL4A 5ESVB 3TBSA 3KHOA 5HDOA 1A21A 2F5BH 3S34L 4AEFA 1CR9L 1FZKA 1YZZA 4WW2F 1V7NL 2CRMA 5J57B 5D6CB 1EVTC 2Z31B 3V4UH 1FC2D 1QFOA 4IRSC 4HIJA 2FH6A 2OYPA 4KWUA 4KMTH 1I9RH 4Y2DD 4PJAB 1HHGA 4O4YL 5CMAB 3H9YA 5EO0A 2WUBL 5IEKA 1BAFH 1YMMD 1TVHA 2BDNH 3OPZH 3EJZC 3QIUA 3N06B 3CZFA 4KKCC 3VE0A 3MXVH 2VTFA 1A3RH 2BSRB 2CO6B 2XKSA 3D9AH 4OI7A 2EYTB 1XIWB 1U6AH 4OJFL 4Z18A 2X44D 2CLZA 4PGDA 5F7EL 5KJRL 5H94B 5IIEB 5C0NC 1QLFA 5DJYB 5HYQA 4NFCA 3DTXB 5DSCA 2Y07L 1DZBA 4R2GD 3MA7B 4M02A 5JXAH 5EIVA 4L3CA 1K4DA 5AZEL 1NDMB 1JHKH 3OKNB 5F88B 3F12B 5DTFB 1QD0A 4EQ2A 4X9BA 3VXRE 4IEFB 1U36A 2CLRB 5CJQH 3WFEH 5IT2H 1E4XI 5GS0L 5CIPB 2ICCA 2MWCA 3PL6D 4X6DB 1MVFA 4GAGL 2GITA 3LS4L 4DJMA 1EIBA 1CE6A 2E6PA 5GRJL 1HYSD 1MCKA 1NC4D 3EIFA 1TQBB 4AM0B 4ZFGL 1MHCA 4JDTL 4MDIB 4ELMF 2AERT 5AWNH 3VD5A 1BECA 3WMSA 1QA9A 3GM8A 1DQDH 5ADOL 1MLCA 2GJJA 2H8PA 2E9WA 4OZFG 4V2CB 4P2OC 2AEIT 3S5LG 4OKVB 4BZ2L 4LGRB 3SDAB 4W4NA 3ZDYE 4MXQD 4LPTA 5E8EA 4O5LL 3CFKB 1ORSB 1P4IL 1MQKL 3NZ8B 3QWRA 3RNKA 4EQ3A 1U3JA 4C59B 1ZHKA 4NPYB 1U9KA 3LQMA 4JKKA 4F57H 3HG1D 1A3QA 1V3KA 3VGBA 4U6XA 4NO2B 2D3VA 2FLRT 2HJLB 4QXGH 1VGKA 4I9WE 2D2OA 4MB4A 5CKGA 5DJDA 4NZTH 1GPOH 5LQBH 4D0BB 5C0DA 3GKWL 2RR3A 5FGBC 5F6HJ 2XWJA 1HXYB 2R39A 1PLGH 3HZYA 4XXDA 1F02I 3BP5A 1NCCH 4JM4H 1WCBA 3EYFB 4FZEL 2VXUL 4Z6AT 3X14B 5E1AB 3P0VL 3K74B 2CDFB 2IPKB 3SGKA 3G08B 5EWIL 5TDPB 4KROB 3MYZA 1ZT7A 1TPXC 3C87A 1PZ5A 2NTSP 5SX5K 1MWAL 3AREB 3BDXA 3BFOA 3BDYH 3P4OA 4GRWH 1TVDA 2PYFA 3GI9L 2UYLA 4PB0H 2HRPL 4LLUA 4WWKC 4NO0D 3O2DA 1G1CA 1NLBH 3D3VB 1U8OB 1SY6H 3TIEB 1O0VA 1OP5H 4OCRH 5F89A 1JYNA 3SDXF 1VCAA 1CD0A 3KLAA 3OHXA 3WO4C 2ARWA 4JFEE 1HI6A 4UINL 4QRUA 3PP3H 1DCLA 1MCOH 2HFEA 3W11C 1JFQL 3Q6GL 1R3LA 1INQB 4CVZA 4XP1H 1BIIA 4LHQB 4PD4J 4IHOB 3HC3L 3N0PB 4JGJA 5J6HB 3FAWA 1HE7A 3L3HB 3SDDD 3OJVC 2GI7A 3M1BA 3RZCB 2QKIB 1RVFL 3V9FA 2DWDB 1CGSL 2A6IB 4X9IA 2FGZA 1MHHB 2J7LA 5J9PA 4XP5H 1S7XB 1UWGL 3RDTC 3O0RL 4L9LB 4PJFF 3LEXB 1OD9A 1AIFA 1GOFA 2VE6B 5HVFB 3GHBL 2NYYD 4X6CB 1DL7H 1I1AD 3FZUD 5E5MB 4ENEC 5JUEL 1X5GA 4DW2L 2LAGB 1JPGB 5IVXE 1LP9E 3OAYK 5HDBF 1LNUB 3KS0H 4XC1L 1J11A 3BP6A 5IESL 4LSTH 2DQJH 2E6JA 1MVUB 4JDVB 1MCNA 4N1CA 1CG9B 1WAAE 2EDFA 2X4QB 3M8OH 3VGAC 4YAQA 3Q6FB 1Q38A 3GI8H 2X10A 4HBCL 4JJ5B 3DLQR 1MAKA 3DUUB 1K6QL 4K7PY 4DN3H 2CMRH 3NCYP 3EOTL 3S3PA 3BE1L 1MFDL 2OSLA 1X5ZA 3AY4C 5DFVC 4I8DA 1LHZA 1I4FA 1OT1A 4O9HL 2Q86A 2V7NA 1IRAY 3HLAA 4S10A 3QEQA 3CH1A 3ROLB 4JN1H 1XF3A 3TFKD 4UAOB 4JFFB 5CD5D 3MOBH 1T2XA 3KPRA 1QFPA 2VSDA 2BSTA 4FFVC 3CVHA 5IG7A 1FE8L 3GMPB 4GW4B 3N1GC 2IH1A 4OGZA 4QOKA 1YY8A 3LRSA 5C09B 3PWUA 4S0SD 4NZUL 2JB5H 1SYSB 4XTRD 1F3RB 1U8NA 4GRLC 4RFNB 3ARFA 1QNZH 3C9NB 1CICA 3K2MC 3P73A 3MUY1 2FSEA 4Y4FB 3S37L 1RUAL 3IJHA 3MRKB 5DVNA 3HA0A 4UT9L 2AJZA 3SO5A 5B38B 1AJ7L 3IXAB 1AKJD 5ADPL 1JGDB 2DB8A 4I2XB 1X5LA 4I3RH 4K7FA 4XHJD 5D96C 4WHDA 5BV7B 2P24A 4LNRB 1A6UH 2R1YA 1GZQA 1DJSA 3ZMRA 4EZMA 3L3DA 1DE4A 2V2WA 3WFHB 1OARL 4OTXL 2OZ4H 3D0VB 4TUOB 3QIBD 3EW3B 5FF6A 2VH5L 1QR4A 3PV7A 5JHDD 1F5WA 4Q6IA 2A6DA 1P1ZB 4PRDB 4NZRL 2FX9L 1DUZB 3LQAH 3CFEB 2AS5M 1MFEL 3OGCA 4QHNB 4M62H 1FDLH 1FYTE 4MQTB 3T4YB 1YUHA 3EDDA 4OZGB 1U8IB 3OG6B 3O3EA 2FJHB 4WFED 4X7SL 3C6LD 1WVZA 4WNQA 5ESQA 5EUKA 2ID5A 4PLJC 4JKPH 2X4RB 3T77A 4LLMA 2VZ3A 3KYOA 4U31A 2DI9A 1ZHNB 4UQ2A 4HQQL 3VMOA 3VFUA 3MV11 5EA0L 4MA3A 4PJBF 4QRPA 5EOQH 1TCRA 1S78D 2AJ3B 3C5SB 2Q8BH 1E0OB 2GT9B 5FYJU 3C5ZB 3NPSC 3L5WA 4QWWD 4ZUSB 5C2BH 4KK6D 4XPAH 5D1QD 4Z7NE 2HJFB 5FK9B 2A2QT 4NC1E 4P2OA 2YSSB 5D2LE 4JZOA 3ULSB 4HPOL 4JFPB 4Q0XH 4YHKL 1AQDB 5I74B 1NCWH 4UDTB 1EO8H 1C7TA 2EEDA 1CFNB 4ZAKD 3LN5A 5JQ6L 1S5IL 4PTUA 1T1YA 1BLNB 4H26B 3BAEL 1OPGH 3RWEA 3P40A 3UJTL 5EZJB 4AY0A 3ZE0E 2DWEA 3MV8B 4QXWA 4ZUVB 5C70A 1UH3A 3B4NA 2GJZA 4ZFZB 5D1ZC 3DMMB 1IAIM 1PBYA 1JCKA 4GAYA 1D7FA 1HSAB 3VXNB 3E2HC 5FGBA 4EUPH 1N64H 2H6PB 2E7CA 5IVOA 3BZEA 1WZLA 3UJIH 1R5VA 5JPNB 4HKJB 2OK0L 4PV8B 4XB8A 1U8LB 3EO9L 4XPGL 4E0RA 2D0HA 3BPOC 3QHFL 1AD0B 1XH3A 5DD6B 2BSSA 2BVOA 1WISA 5IBLD 3CXDH 4I3SL 5HHOD 1KXVC 1DSFL 1F58L 4H88L 5IK3B 5CSGA 3ULUE 1MWAB 1YEEH 1T1WB 4RFOL 5E2UH 4JHBA 3VFTA 1WZ1H 1QYGH 3KPPB 5FYKE 4OB5H 1AC0A 4WWKA 5FAAA 1U8HB 4LQ1A 2CK0H 3F7PC 4R90H 5DHVH 3FT4B 4ZUWA 2AJVL 1JNNH 2ZKHH 4HJJL 5INDB 1IC5H 2D9QB 4S2SB 3IT8D 2NX5A 3QRGH 1MRCH 4K8RD 4G8IA 5C7XH 2B4CL 1J7VR 5FHAH 3TNNA 3C5JB 5HPOA 3PWPB 5TFSH 3SQBA 5DRNA 1RJLB 4NGHL 2V2XA 3IDYC 4BZ1L 3SHSA 4OFYA 3H9HB 5BZWA 1H8NA 4FTVB 4JFQA 3SOBL 3MMEB 3V0WH 1A7NH 1KPVB 1CT8B 5L2KB 4U49A 1A2YA 1IGCH 2P5WE 3U0TA 2HKFH 2A74A 2GQHA 3FOMB 4Y19E 2XFXB 1Q72H 5ISZB 3FO1B 4NQCD 3RDTA 4YR6B 3GSVA 4QF1A 3Q5YA 2EH7L 1DQJB 4XCYB 2IH3B 5EO9A 3AROA 5H2BA 3L3GB 1A7RL 1BIHA 1HHHA 1N6VA 3NA4A 5HXMA 3KXFA 1N6UA 1NEZB 2CDGA 1CLOH 4F7PB 3QI9C 4L8BB 4OIAA 3ROOB 5DJ8B 2PO6D 4XAKD 1XR8A 3BT2H 3KPLB 2VYRE 3NCEB 3D39E 3RVTD 5I1GH 4J12A 4RFEA 1RULH 2Y23A 4YHYB 3PDOA 4KXZH 5KVGH 3ZT7A 3RTQB 1QFWM 1PKOA 3R1GL 4N0RA 4TVSa 4ZQKA 5DK2A 5I8EB 3UDWC 3ZTJG 2Y5EA 1T66C 5BW7C 5IGXH 4FQQB 2I5YH 3AY4A 4U1NA 1I8MB 5HYSB 2ATPA 1A8JH 5AG8A 1CGTA 4JVUA 3VXOA 3O81A 4Z77A 4WTXA 5J06A 3CMOH 2VQUA 5KS9E 1B4JL 2A38A 4JLRB 3NCMA 4PJ9B 3HZMB 3ZE1F 1JNLH 4NDMB 4QHLB 4JG1H 4N0UA 5TQ2H 1CXFA 3LS5L 3GSNH 5GRUL 4P9MH 4PB9L 4RISL 5ANME 1CK0H 1UXSA 3CSGA 4NKMB 4GRLA 5F96L 1JTPA 1Q9KA 4MJIA 4IDLA 1JGVH 4LLVB 2E7MA 4R3SB 4LCUB 3BD4A 1C16A 1DQLH 4KJYB 4PRPD 4MA7H 1N5AB 2X40A 4XH2B 3T0WA 1WBXA 2DD8L 4QRRE 4TSBL 1KN2H 2Z93A 1F3DJ 2YKLH 4XCCH 1S7TA 3QEHB 1X4ZA 2C4FU 4HEPG 5FUZH 2J8UE 2B0SL 4O2FB 5ERWA 1E28B 4H5SB 3VXUD 4HEME 3ES6B 5TH2A 1KEGL 1WV7T 3DOSA 4OZIA 3RGVB 3I2CL 1RK1A 5KTEH 3QUZC 4LEXH 5T33L 1ZXQA 3QDMB 5FGCB 1FL3A 3MCLL 4Y5YC 2IANA 1RJYB 2NXYD 3P0YL 3DI2B 4PJDE 3QA3A 3RBSA 3VFPB 4IOIA 4WV1B 3VFWA 4JY4A 3UPRB 1N6QH 2ZUQC 4PRNB 1H3XA 5DLMH 5IQ9B 5DYOA 1MIMH 4RMQA 4DZ8B 1T0NA 4LU5L 4XXCC 3QJHA 4ZO6A 3HMXH 4PFEA 3KLHD 4FS0A 3EHBC 3MFGB 3MLVL 4APQB 4QKXB 1R3KB 2XN9D 3EOAB 2YPKB 4ODSH 5GGQL 4K8RH 5I66B 1FNSH 3UBXG 5DMKB 1NBZA 1KN4L 4GKNA 1U3HA 3VFSB 5CZVL 1WZKA 4PR5B 4J3TA 2DF3A 1DBAL 3WN5C 5IJKC 3O2VL 3MJGX 1I3UA 1RMFL 4PTTA 4PJCA 3L5IA 1NSNL 5BRZE 1FQ9C 2EYRA 1QSZA 4LARL 4G7VL 4GBXB 4LHUA 1GGIH 1Q94B 5F44A 3LHPH 2VQ1B 5HHXL 3LVEA 3LPFA 3PWVA 4JY5L 3U4BH 3NFPA 4X4ZA 2ZCKL 2P7TA 3U30C 2VLKE 1SJXA 4JFDA 2EEAA 2W59A 3AMKA 5E2WH 2PR4H 1XGYL 3ARYA 3V52L 3VXRB 2EO9A 4I18B 1EGJA 2ZUVA 3QISA 1ZVYA 4OLVH 1L6XA 5IR1B 1A5FL 3QSKB 3OKEA 4CMMA 1MCQA 2X4UB 4P5TB 2EC8A 3EO1B 2NY0C 5C0AE 3ARBC 1NGZB 2ADFH 5E5RB 3B43A 3GMLB 1OAXH 4I48B 4KFZC 4OV6F 1I1FA 1U93B 3DV6A 4AL8H 4RNRA 4P46D 3IU4H 3MLXL 2AJXL 2EKSA 2VDQL 1A6ZB 5FKPB 1N5YH 3MA9H 4ZUTB 2AQ2A 2RFXA 2D4DA 1NMAH 1PKQE 2IPTH 3QQ9D 4AJ0A 4LSPH 2YUWA 5IHLB 4KVCL 4JO1H 4QRSB 1GCFA 2DQIL 4DEPB 1HOCA 4MHHI 1TCMA 3TWCL 1DN0B 4KH2A 3QXAA 3OKMA 2JB6A 4PYGA 1G0DA 4LKXB 2APXA 3NABL 3QCUH 1OD7A 1FL5A 2MCPL 3JV6B 2BY2A 5GXBB 2J4WL 3DVFA 3RIFF 5KVEH 3G5XA 4LIQH 3HE6B 4ZNCD 5T3XD 1DLHA 5F9DC 4UQ3B 3E6HA 3LQZB 3IB4A 4IOSD 2H2SD 1YNKL 2FJGB 5C0RH 2IQ9H 5HYEA 3JWOC 2CQVA 2PW1A 1N4XH 2N1KA 4EIGB 1AHWB 1TTUA 3ULUL 3VXMD 4JG0L 1LVEA 4QTHA 1DR9A 1J0ZA 5A2LH 4OLXL 4JFYB 2W0PA 5FYKL 4TSCL 5BQ7B 1ZT4A 3BISA 1JZ4A 4V1DD 3D2UA 2FHCA 1EUTA 3QH3A 3QI9A 4YBLB 1F3DH 1OAZL 1BQSA 3FHAA 3WS3B 2QHRH 5DXWA 3MGOB 5HHME 3MLSL 1RUPL 4HPYL 1G7PB 4PJEE 4JFEB 4P2QA 4OCYH 2GJ6A 3VWJD 4JPIB 2FECI 1HZHL 2EIZB 2G2RA 3RVUC 4KRPD 1ZLSL 4UBDD 1IM3B 3IDGA 2VZTA 3UDWA 1QSEA 5D7JB 5BW7A 2FECL 1AI1H 4UILL 3WIHH 1Q0YL 35C8H 4NSKB 1XCQA 4U6TA 4U6YA 2HFTA 2CLVA 1I7UA 3SY0B 4P4KC 4U1LB 4K55A 3HN3A 2R2EA 5EOCJ 4R8WL 4NQDA 4HC1A 5IVXB 4L9LC 1LP9B 2GUOA 2YD6A 1YDPA 3GMRA 4HH8A 4U1JB 2C3GA 3VXSD 2YPLD 4NIKB 4OGAC 3CLFL 3GK8L 5CLTA 4EXKA 3TBWB 4U1KA 2ICWI 5FA4A 3MCKA 1MRFL 5IFJB 3BIKB 4WUUD 4J4PC 3P11L 4XNUL 4TULL 1SMOA 2DQDL 4HIEB 2IAMB 3O2WL 3MRMB 3FFCD 4MXWL 4U6HB 5EU4B 4JRXA 2D7OA 5C0EA 3DHMA 4F37F 4KAQH 1S5HB 4PS4H 4WW1A 5DMJB 1LO3L 3UX9B 3VFGH 1WQVT 4PJIF 2P5ED 5GGRB 5DRXB 1G9MH 4NUGL 2BY3A 4YPGA 1FNEB 3QHZH 5ITFB 5DA0B 2R23B 1OGAD 2VXVL 1D5IL 3H42H 2EIDA 2JTDA 4WI4A 5HHVL 1ZLUK 3FB7B 1IGIH 3KWWB 3RA7H 3QUZA 3TA3B 4IMLA 1P7QB 1KBGH 4ELME 1JGLL 2J12B 2DI8A 1U8KB 1NCNA 5HI4C 3DWTA 1GHFL 3V4VL 1O5DT 3U4EB 2V5MA 4NFDA 5EUOA 3PWNB 4HGMA 4G6FD 5TE6H 4QRTA 1BBJB 2JJTA 1FJ1B 1CDGA 3H8NA 3ILQD 3REVA 3ZDXE 5CIPH 1MCSA 1KULA 3BZFB 1MCHA 4CGTA 1KCVH 4ERSL 3V0VB 4XXCA 5HD8C 3CGTA 3TBTB 3WUWA 3QIUD 1DEEB 4FQJH 2I24N 5D6CA 5T3XH 4FFWD 2Z31A 1GGUA 2MKLC 1DBJH 3OG4B 2OS7A 2X9XA 2ADIA 3WN5A 5F72S 1KOAA 1NAKL 3NMEA 4KK9D 5AYUL 4L8SC 5JW3L 4PJAA 4EXPX 4DKFL 2HH0L 2AK4D 4D94A 1FYTB 4PLKC 1OCWH 3BMWA 3D0LB 4NKDB 4F9LC 1XIWA 2VLMD 4P0DA 2NXZC 1BQUA 2JJSA 1TJHL 4RGMB 2BY1A 1U3ZA 3VRJA 1SM3L 5DJYA 5E08H 1A1MA 3OJ2C 4ODHL 3HMWL 1NDMA 2OLDA 4N0CC 3OX8B 4AMKH 3MXWL 3F12A 1OT2A 5DTFA 1LO4H 1ITBB 2E8ZA 2F53A 3IFOB 2CLRA 1TJGL 4LSVH 2YR3A 2J6EH 4X6DA 1XGPB 1R3HB 3L9RB 5GGSA 1K3IA 3TV3L 2HP4A 4AM0A 5H37G 4MDIA 2XTJD 3QWRD 5D2LB 1OQOA 4CVUA 5DZNA 3K2UH 2EE9A 2EDRA 4GUPB 2W91A 4JREB 3C5ZC 3UO1H 1W0VA 5JMRA 4QY8A 3GMOA 4HKBB 1D5MB 3NGBB 4KUCD 4X83A 3ORJA 4OKVA 2I27N 1IGYA 1XAUA 4JVWA 3SDAA 4HUMB 3EYSL 4H8WH 3VH8A 4FHBD 3QNXB 3TESA 3CFKA 4U4BA 3STLA 3NZ8A 1BQLH 1X4XA 5DR5H 5FOBB 4G5ZH 3TJEH 1L0QA 1IJ9A 4O2EB 3AC0A 4W4OC 2HFGL 3ZL4L 4KZDH 3WFDH 1HWHB 4NO2A 4KDTC 4TVPE 5EOCH 4M1CC 3TT3L 2G5RA 2C7UA 4HUVA 1RZKH 4HXBL 1ZK9A 4HUUB 2XZAL 4Y2OA 4RBPK 1DLFH 1X6LA 4WU7A 5I1JH 4H20H 3G6JE 3MGTB 4XNZC 2APWA 5IB4B 3SO3B 4ZOEA 4OI9A 5FDWB 1NMCC 1A1OB 1RUKH 25C8H 3EYFA 3X14A 5HI5D 2VZVA 1R6VA 1QRND 4UTAH 2CDFA 1T7VA 2IPKA 1RJZA 3G08A 2XKNA 4V2BA 1ZWIB 2WINB 3K4AA 5TDPA 4CU7A 1QHPA 1X3DA 4N0YH 1D9KB 1RD6A 4HIXL 3AREA 4LCIL 1IEBB 2GY7B 1JWMA 3OB8A 1CDCA 3HR5A 2ED7A 5EZLB 2DTMH 3OZ9H 4Y4KC 1KG0B 2M8XA 1VADB 5DJXA 3D3VA 1G7QA 5E6IC 1Q9LA 4M00A 1WFUA 2XRAL 3MRLB 2FLBT 2G5BB 3NA9L 4I0CC 5A16B 2BXZA 3D1MC 1MHPL 5FGRA 1CDUA 3VD4A 1YEDB 2ZUYA 2RQ8A 2HTLC 3LCYA 1YNTB 2P5WB 5BMFH 1GYAA 1MSPA 5DI8B 1J0JA 2QSTA 4X7CC 2XZCH 4XPHH 4Y19B 5J6HA 5IB5B 3L3HA 1S7RB 5DJ2A 5ELIA 4HXAH 1JHLH 1MI5E 4ZYKB 5L8JB 2X1WL 3O3AA 4NNYA 1DP0A 4XVTL 1G7MA 1NEUA 2PYEE 4FFZL 1NAMA 4KRLB 4OCWL 4I0PB 1MHHA 3UC0H 5H8DA 3TYFB 5F1KC 1S7XA 4KPHH 2P44B 1E27B 5FUCC 4L9LA 4GXVL 1MF2L 5HDLA 3LEXA 4NP4H 1XF5A 1H5BB 3D39B 4N8VA 4X6CA 3U0WL 3B9DA 4N9GA 1UVQA 4NKIL 5GRZA 4HHAB 2ENYA 1L6ZA 3NCCB 1JPGA 1U8MA 5JW4M 3S34H 3WXVL 2VXQL 5CINL 1LNUA 3FQRB 4J4PA 1IC7L 3DRTB 4EOWH 1MVUA 4JDVA 3TIDB 1XR9B 1KLGA 5EFIB 5D7KD 4JRWA 3U1SH 2ICWB 3QEQD 4B7IA 5L2KD 1CIUA 3Q6FA 3V8CA 3KPRD 1G6RA 2JCCA 1Y18B 3DVNB 1QSFA 5D8JL 1IGML 1J12A 4O4YH 4CADB 3DUUA 4QOKD 4U1MB 5KS9B 3W5MA 3RKDC 5DJCB 1EFXB 3I84A 5LAXA 5ECJE 5TDNA 2WW8A 5ALBL 5TF1L 1W0WA 4LAQL 1BWMA 3VFRB 4OJFH 4JM2C 3ARFD 5E5UB 2AEWA 2VLRE 5CJOH 3LB6C 2B20A 4NCC1 3ROLA 1J8HA 1BJ8A 3OR6B 1Q9WB 4JFFA 5ANMB 3WD5L 4PJBE 1KJ2L 5B4MC 2ZOLA 2Y06L 2Y07H 4M6NL 4IS6A 3GMPA 4GG8B 3DO3A 5IF0A 4N0FB 5AZEH 3I3BA 5JMOC 4ONGL 2DLEA 5CBEB 4IRSD 2EECA 1RZFH 5FA3A 1LILA 1SYSA 2PTTA 3DIFB 1VERA 3QULA 1A9EB 2WBJB 3SCMC 1T89A 4Z7QE 3L3JA 5GS0H 3H9SD 4L8CA 1KNOA 4QGTA 1KB5L 4QRRB 4GAGH 3LS4H 5F8QC 3UTPE 3EJZD 2C3XA 4KKCD 3WS6C 3GSWA 1NUGA 1LO5A 3UTSE 4JDTH 5E4IA 5B38A 2J8UB 5FDYA 3S36L 4PBWD 2BCKA 5ADOH 1BFOB 5C0ND 4HFUL 5CEYA 4OFDA 4XNMA 4L8SA 4BZ2H 5GISH 4D8PB 3KDMA 4M7KL 4CAGA 3QQ4B 8CGTA 2VLJA 4FQ2L 5GGTL 3O3UN 3WFHA 5KW9L 3P77B 5SWSA 1FAIL 3QWOB 2QSQA 4PRHE 1P4IH 1MQKH 4F9LA 4U0QB 4L4VD 1P1ZA 4PJDB 1DUZA 4DN4L 5JXEC 3CFEA 2Y1VA 5K9QG 5F7NC 3JXAA 3QQ3A 3EDKA 3S35H 4G80B 3MJ9L 3NTCL 4QRPD 3CFIC 3IJYB 2FJHA 1RZIB 1S8DB 3GKWH 2RCSH 1JF5A 2VXSH 2LU3A 3MRNB 2ORBH 3O6FB 4P2OD 2GCYB 3LEVH 3R06B 1YN7A 3CSYB 2MTPA 3BYTA 4FZEH 2VXUH 3PABA 5BRZB 2QADB 3CZJA 3GHEH 2DQFB 3VWKB 3RGVD 3OV6A 5ILTL 3P0VH 2AJ3A 2D7MA 2QQQA 1IVLA 1PQZB 5DJAA 5EWIH 3C5ZA 2AI0L 5F70A 4Y16B 5DUPL 5FUOH 4P2RD 2G60H 1IGFL 1U91B 4KQ3H 4LVNC 4HV8A 2HJFA 4LRIA 3VFNA 1F90H 3I6LE 2VLKB 2YSSA 2ICEB 4G6AC 4JFPA 1AQDA 3BKML 5FM8A 2HRPH 2C1PA 4UDTA 4TRPL 2AP2A 1CFNA 3LKQA 3SKMA 4XX1G 5AUMB 1MHEB 1BLNA 3BPCB 2W92A 3RL1B 4UINH 1LEIB 1VPOH 2KDGA 4W4OA 4XNYL 5I16B 1OB1B 3MV8A 3OR7A 4CVXB 5GS3A 5C0AB 3Q6GH 4X6EB 3H3PL 2FEEL 1XFPA 5KAQF 1YEKH 3EJJX 1VFAB 3TYGL 1LK3H 1NCTA 2YRZA 3GMQB 4PV9A 1LE5A 3AS0A 5C0GB 1RVFH 1YMHB 2H6PA 3S88H 1CGSH 5T5NF 1PKQB 5JPNA 4HKJA 4PV8A 1U8LA 1UWGH 4JO2L 4WWKD 5EIQA 3O0RH 3VCLA 4G6ML 3GSUB 1AD0A 3KLSA 5A2FA 4KMLB 3E3QC 6FABL 3Q0HA 1CFTA 3P9WB 1JNJA 5JUEH 5IK3A 3W11D 5IUSA 4MA8L 1MWAA 1UYWL 4XC1H 4P23D 5SX5H 1IZKA 2WMPA 4CJ0A 5ACZA 3IVKB 4OFYD 1I9JL 1NFDE 3M17B 4ONFL 4YEEA 4TVPL 4RX4A 5D72L 1G7LB 1U8HA 3BRGC 2CUHA 5E6IA 3FT4A 1FO0L 3Q1SL 1F4HA 5D5MF 3JWDC 4HK3N 1ZANH 4S2SA 3SKOA 4I3GA 2GEEA 5BO1L 3C5JA 3EOTH 3RDTD 4YHLL 3PWPA 3BE1H 4YDIL 1QACA 1RJLA 4HIHB 4WEBL 2R2HA 3KXFD 5L2JB 1EHXA 4FTVA 4ENED 2FATL 5E4EC 1TQCB 1PAMA 1KPVA 1SVCP 1CT8A 1XEDA 2WIIA 3FHQA 1MCEA 4E41A 3IS1X 2QQKL 4UIMB 1FE8H 1T20B 1F4XH 2XFXA 3FO1A 5L0QB 4NFBA 4YR6A 5HHMB 4PJ8B 4XCYA 2IH3A 2L0DA 4PJEB 3SGJC 1YYLL 1KSRA 3HI5H 3PJSB 5EIIA 3PQYA 4JE4B 1EH9A 1IC4H 4YBLC 4RAUA 4XPBL 5DJ8A 5DMIL 3ROOA 3S37H 3HI1B 2EICA 3KPLA 3BXNA 2CRZA 5DFVD 3FCTA 4F9PA 4J3XA 3P4LA 3OAYH 1AJ7H 1WSST 5ADPH 3RPIB 4Z8FH 3FB6B 2NY2B 4GFTB 4MJ4A 4FFVD 4GG6E 5I8EA 1OARH 4OTXH 1KJVA 1X5JA 1JF6A 2XA8L 2XI9A 5DK0A 3RWGA 2ZSVB 4GRLD 4JM2A 4ETYA 1P5VA 4KTEL 4NZRH 5K33A 4UU9A 3K80A 2FX9H 4X98A 1MFEH 5EPMB 2ZUUA 5F9WC 3VG0H 4LQFL 2MCG1 1ITCA 1KJ2B 3HZMA 4QHLA 3TVMC 4X7SH 3ZE2F 4LCWE 1Z9MA 2IADB 3ARDC 4NKMA 4XWOC 3SCMA 1ZA3A 4LLVA 1N0XL 3GMNA 3IFPA 2V2TA 2EDQA 5CAYB 3DGGB 1PY9A 2A9MH 4HQQH 3S7GA 2R8SL 4LDEB 4F15C 3FRPA 3WS6A 3T2NL 3UJJL 2DJUA 5D93C 4L3AA 1CGWA 3HCVB 3QFDB 1QFWI 3LKOA 4UNUA 2DLGA 4YXKL 3QEHA 2XY1A 4QHMB 2DLHA 4HPOH 4YHKH 5J3HC 1EBAA 2HN7B 1KLFA 1KV3A 3ES6A 4ELMB 1MFAL 3PGFH 1S5IH 3MV7E 4PLJD 3MREB 5D71L 1QOKA 3CLEL 3GUTA 3BAEH 3BN9C 2AKRB 5JXEA 3UJTH 1CS6A 1IAKB 5FYKU 4GRMB 3QDMA 4L8DA 3MBXH 1YEFL 1BVKA 1BHGA 5I30H 3BJ91 1CWVA 4WV1A 4NN6B 3GB7B 4PRNA 4C4KT 3MNVA 2AV7A 1NH6A 4GAJL 5CWSB 3OJMB 4DZ8A 1CCZA 4F3FB 4AIZB 1R3KA 3EO9H 4OLWL 1I9IL 2YPKA 4XPGH 4P59L 2R69L 4QYOB 3U4AA 5I66A 1QKZL 3ESUF 3QHFH 4HIIB 1P9MC 2IGFL 4HWBL 5DMKA 3O4LD 4JFDD 4PR5A 4X6BA 3P4NB 5I0DA 1KCLA 3RAJL 4I3SH 4Y5XC 1DSFH 2HRLA 1V3LA 4TUJB 4RFOH 5IHUH 3DSFL 2NY6B 4XMKL 5D1ZD 3TZVB 3TPUB 4GRWE 1JYXA 4FQXB 3EYQC 3F58L 2VDPL 2AJVH 2DKSA 2F54D 1A4KA 1DDHB 4JPWH 5HGAB 1AGEA 4G9FE 1BX2B 4JGUA 4LSDA 5E9DE 2B4CH 4I18A 2DQEL 3U7WL 2BVQB 2C3HA 1I8IA 2WQRA 4K23H 4NGHH 5D2NE 1H3VA 4BZ1H 5IR1A 2C5DC 1A7OH 5LGHL 3I02B 3KYMB 3SOBH 1W72B 4OZHE 1P2CB 1UWEL 1CXLA 1Y0LA 4E5XB 2YRPA 3CC5B 3O8XC 3SKNA 2EZ0C 5LVEA 1AO7A 1KTRL 3D85B 3GMLA 1SBSL 3MOAL 2F58L 1U93A 4M1GH 1JBJA 1BMGA 3NFSL 4D2NA 2Q7NA 1A6ZA 3UCRA 3KNBB 5FKPA 5HHQB 3FQNB 1A7RH 1YMME 3N1FC 3W9DA 2PCPA 4EJ1C 5F1IB 5C08B 1Z2KA 1AXSB 4DQOL 1J1OH 1KCUH 3BPLB 3OKYA 4NRZB 1PYWB 4RWHA 3BEWA 4GLRH 3WV0A 1KF9B 5EC2B 4QRSA 4WTZG 4KVNL 2ZZUT 4LSQL 4C4KO 3WLWC 4G7YL 4S1RL 4ODTL 1RJCA 1A3LL 3DX7B 3QYCA 1FO0B 3R1GH 3VFOB 4Y1AD 3VI4E 3W9EA 5KG9B 1D5XB 2EDOA 2X89A 1BZ9B 2DM3A 4EI5B 1ROWA 1AP2A 3G6JB 3HE6A 1Q1JH 5D7LD 3D2UD 5ITBH 1O7SA 4NRXA 1QVOA 3PDDA 4UQ3A 5GSVB 2H2PC 2IFGA 3Q2CA 5K9QI 3QI9D 5CD3B 3GKZA 1B4JH 3GSOB 5BJTA 5FXCH 2YN5A 3BGFC 2X4NA 1AHWA 3QUXB 1HHKB 1U42A 2GJ6D 4NM8H 3LS5H 1ZS8A 5GRUH 4JFYA 4PJGA 4JANA 4KUZH 4PB9H 1X9QA 4RISH 5BQ7A 3X12B 3RRQA 3SGJA 3BGMA 4ELKB 4PJIE 1M71B 1B9ZA 3FJTA 1N2RB 1QSED 2F9BT 1T66D 7CGTA 2A73B 1DVFC 2OR8A 1RZJC 3MYJA 3VI3F 4JFEA 4G8FB 4M61B 2IWGA 3HG1E 2NY1B 1XCTB 4D0CA 2DD8H 1UGNA 4TSBH 4U3XA 1QR1B 2OTUB 1QTYT 1D5ZB 1FVDB 3CPLA 2Q76A 2V7HB 5J1TC 5IFAL 5I1IL 4CMHB 1MI5B 4M9OA 2B0SH 3S4SB 3IU3A 5FKAA 5HYFA 2PYEB 5D7JA 4UT7L 4OZFA 4B5EA 4WHTA 4NQEA 4MB3A 1KEGH 3S5LA 2YA2A 4NSKA 4PGZA 5E8DH 2K3TA 4OUOA 1JI1A 3CSPA 3LY6A 4MQXC 5E8PB 2X4SA 1LWRA 5EU7E 5ACLA 2V6HA 4GXUN 4U1SB 2ITCB 5EB9A 1EPFA 3MCLH 3S35X 4IBLT 1NGPL 5DGRA 4WIQA 4G6KH 1LP9A 4ZO7A 4NCDA 3W0WD 1A1NA 3BHBB 1JNHA 4U1JA 1A6VL 3QAZC 3ARDA 2BNRD 4YFLF 5IKCA 3BKJL 3ZYIA 3TBWA 4LU5H 3L3OB 3O3DA 3MLVH 2W9LA 5GGQH 3AMLA 4AEHL 5IFJA 3BIKA 2OCFD 2CXGA 3GSXB 4KMTL 4HIEA 4OBRA 1ES0B 1H9VA 4OT1L 2IAMA 5J1AB 1ZEAL 1KN4H 3MRMA 2XNAA 5CZVH 5T1LD 1IILE 3QUZD 4U6HA 1DBAH 4OZGF 3MBEC 2BDNL 3THML 1QLRB 3O2VH 4PG9B 1RMFH 3KPOB 4GW5A 1NSNH 3MXVL 1NFKA 4G7VH 2VLRB 4QCIA 5GGRA 5DRXA 3HAEH 4M8QB 2N4IA 3G6DL 5ITFA 2ICWJ 4MQ7B 4F7EA 1YEIL 3FT2B 4PJBB 4JY5H 1JHTB 5E99L 4XNQB 2ZCKH 3C6SB 3ZO0A 3FB7A 4M6AA 2V9RA 3KWWA 5C1MB 4XVUC 2DYPB 3V7AE 1P7QA 1T5WB 3SDCC 1XGYH 3V52H 3ET9F 1KFAL 3T3PE 5MI0B 2VDLL 2YD2A 3QEUB 5CJQL 3PWNA 1J88A 1A5FH 2WZPD 2H9GB 1CGXA 4OCXL 3KPQA 3UTSB 4KK8C 1UZ6F 5MHSD 3V6OE 1J86A 1TIUA 5AWNL 3O3BB 4OCMC 4HZLB 3TBTA 3W39B 1DQDL 2W1NA 3MLXH 2AJXH 3I6KA 5I76B 1T03L 4MAYB 3UZQA 1P9MA 3QUMA 5JIIA 4LLDA 1VKXB 1KJMB 4BFEA 5KSAC 1TDQA 4Y5XA 1OP5K 4PRHB 3DURB 3MRQB 4AQOA 1JYWA 4U0RC 4KVCH 3BZ4B 3PP3K 2DQIH 2OJZL 4LCCC 1A47A 1FYTA 4F57L 4PGBB 1WBYB 2F53D 4NKDA 3IDMA 3GO1L 1IEHA 2NY0D 4DAGL 3G5ZB 3ARBD 2EDKA 1RZ7H 4NZTL 1GPOL 1MCWW 2CIIB 3RY4A 3RWCA 5GRXG 5M95B 1G7JA 4RA3A 4UOJA 1PLGL 2GAZB 4C56A 3REWA 1NCCL 4JM4L 2ADGB 2PW2B 2YOCA 1A6PA 1C5DB 2BNQA 3RVVC 3MRPB 3IFOA 1S7UB 3O8XA 5EBWB 2PKDA 5K93A 3ZKQD 3T8XB 2DQGL 4OZ4A 5TPWH 4X99A 5C92A 1XGPA 3ZKXC 3ULUH 1ZTXL 3S8WA 3L9RA 5L9DH 3EYVB 2RBLA 4OLXH 5JW4Q 3HZVB 4HW6A 3MRIA 3BQUD 4HJ0C 4Q7DA 3UZVB 4HKBA 1OAZH 5C07A 2VR5A 5JHDE 4OM1H 1RV6X 2WWKT 3MLSH 1SY6L 1RUPH 4IM8A 4HPYH 5CS7A 5E8NA 3HHRB 2FNBA 1T1ZB 5B3NA 1U8QB 4WFEE 2D31A 3K3QA 3BO8B 4O2EA 3WYRA 1ZLSH 3QUKA 4Z7VA 5IV2B 4ETQB 1WBZA 2ESVA 1CGVA 3DI3B 1Q0YH 3L3KA 2AXFB 3O41B 3QCVH 2XQBL 3FB8B 5D7IA 1SJHB 3DGCR 5DC0A 4Z78A 5FDWA 1A1OA 1DL7L 2GSGB 4HS8H 1CXKA 5HYIA 2YZ8A 1MJ8L 2R2BB 4X0KB 3RVUD 4M93C 1CDJA 2VISA 1NFDB 4LSTL 2DQJL 4KMQA 3NCJH 1J9CT 3U2SA 1S9YB 15C8L 3M8OL 2O26U 4ZNEA 3P11H 4XNUH 1B6DA 4TULH 4EEEA 2DQDH 1DVFA 4MD5A 5EZLA 2I9TB 3ZHDA 2YUVA 3LKNA 2CKBA 3O2WH 1KG0A 4ZTPH 1OP3H 3MUZ1 2A9NH 4MXWH 2AJYH 3A67L 2X1PA 2G5BA 1UEYA 4P4KD 2WSKA 5A16A 1LO3H 1JF1A 2CK2A 4KGJA 4JPVH 2D7TH 5DZLA 2FCBA 1YNTA 4UDUB 2VXVH 1D5IH 4MJ2A 3MOBL 5DI8A 1I7RA 5TDOB 3TH4T 5JLZB 5D6DC 4OGAD 5HHVH 1PFCA 5IB5A 2OTWB 1S7RA 4MJ5B 1S7SB 4NCC2 3T2QA 2G9HB 4ZYKA 1X5YA 2WWKO 2NY4B 3IKKA 2EYSB 5KAQG 3EJYC 1JGLH 4J4PD 2KKQA 1FRGL 1GHFH 3N1QC 4MXVF 3V4VH 5HHOE 5EZOH 1QNZL 5ICXB 4MNGE 4MJ6B 4XNXH 2AAVA 5MERA 3W2DL 5E2VL 5IB2B 2BC4B 3V6ZA 5T5NG 3EOBB 1K9TA 4OSUL 4XWGH 3DXAA 3GFUA 4HHAA 5DHYB 5GRWA 4ERSH 2XACC 1R24B 1R0AH 4JZNB 1OOAA 1FSKC 4XP4L 4J3WA 2KQMA 2XZQL 4RGNC 4GG6B 1QBAA 1A6UL 3TIDA 4E42B 5I1HL 1XR9A 3SE4A 5EFIA 1FNGA 2WAHA 4X7TB 2ICWA 3MBEA 2OZ4L 1J8HD 1NAKH 2FD6L 5JO5B 2R9HC 3GMMB 5AYUH 5JW3H 4XBGB 2P8PA 1E4KC 3DVNA 3KJ4B 5HI4D 1KCSH 4CADA 1FG2B 3Q5OA 4N9OB 4WW2C 1TFHA 2J5LB 5IROC 4HSQA 4O51A 1TXKA 3PWLB 3MRHB 5CHNA 1MH5A 4M1DL 1BREA 1GC1C 5EU3B 4NQCE 1TJHH 3B3IB 3OWEA 4FZ8L 4LCWB 1SM3H 5HD8D 1ZLUH 3T65B 1WFOA 4J3OC 4ODHH 2AQ1A 4LP4A 4R7NB 3HMWH 2FIKA 5HGBB 3G04B 1FVCA 4XAKE 3MXWH 3O9WC 5CBEA 2A0LC 3V0AC 3UP1A 1DN2A 3X11B 1A9EA 4GS7C 1FZOA 3NCYS 3UTQB 3IKCB 4KV5E 5GGVL 2NTFB 5EOQL 4YHOH 2Q8BL 2VLJD 4UUJA 3JWOH 1H3PL 3HI6L 3QIWB 5SWSD 2IBGA 4PLKD 3DVIA 4XPAL 1D6EA 3LKRA 2J8UA 2NXZD 2XV6B 4R26H 3TO4D 5KSAA 2YUXA 1AGFB 3SBWC 2RB8A 2FO4A 4K9EC 1W8OA 4XT1C 3MV7B 2VABA 4D8PA 3QQ4A 4EBQL 4N0CD 3JUYA 3N1MC 4LCCA 3QWOA 2OI9B 4JQIH 4PJDA 5T1KA 4WUKL 3T0EC 3LPWA 4Y4HC 5I1EL 3QDJA 4RQQB 1ULVA 4Z0XA 3V5DB 1KT2B 3CFBB 2W9EL 3ZDZE 3U7AA 3U0PB 4BH7B 3TT3H 4HUNB 3DYOA 5GSRB 1L7IL 1S8DA 3UJIL 2VDNH 5ABDE 3WNMA 2XZAH 2IALB 2NY5L 2BHYA 5IOPB 4PRPE 4JO3H 1YEJH 1WFNA 3UTOA 4NM4L 5EBLB 5MEQB 1NAMH 1NGQL 1VFBB 4HMCA 3C60B 4YWGH 3CSYA 1K8IB 3EOYG 3CXDL 4R0LB 5BRZA 4LASL 5D9SB 3VWKA 3SJVA 2Q3ZA 1YEEL 2DL2A 4OGYH 5E2UL 1ETZB 1GZPB 1WZ1L 4GRWB 4HIXH 4G8GD 1KIPB 4LCIH 4LMQI 1U91A 2APVA 2VKWA 4OLYH 5EN2A 1HCVA 1ERNA 2DOCA 4R90L 5C9KA 4M1CD 2ICEA 3HE7B 2ZKHL 4OIIL 4G9FB 3HZKA 4XP6H 5E9DB 2GSIB 3BP7B 3DRQB 4ZXBB 1MRCL 5C7XL 1JL8A 2XRAH 5AUMA 1IGTB 5D2NB 4QNPF 3NA9H 4YHIB 3B9KC 3F7VB 4LCYB 5GZOC 5I16A 4J2XA 1OB1A 4OZHB 1L9MA 5IMMB 3WHXB 3V0WL 2HFFB 3NIFF 1A7NL 5CEZD 2Z92A 3PG2A 4OQ1A 4HKZB 1VFAA 4KI1A 1F2XK 2XN9E 2HKFL 3BIBX 3GMQA 1OTSC 4Y2DB 4BFGA 3KPMB 3GJFA 5IFHH 1IKNA 3F7RA 2ADJB 5C0GA 4FFZH 1YMMB 4MX7A 1PKQA 3U36B 4OCWH 2HJKB 4LOUC 4Y4KD 1CBVL 4ONHB 1K2DB 4BSWB 3GSUA 1MF2H 3C09B 1J18A 5E6ID 1MCRA 2KUTA 5DJZB 3FONB 4KXZI 2H26B 3U0WH 4NKIH 4OCLC 4PJHF 5I1GL 4R2GB 3WXVH 3QQNA 1K3ZA 3W82A 2HTLD 4FQPA 1ZT1A 3MJ7B 5KVGL 4NJAL 1EEZB 1YPZE 4GKZB 5JOFA 1I85C 1EDQA 4WFGD 3PL6B 5IVXF 4E41D 5D8JH 1NC4B 1TETL 3ZE2E 1NGWB 3V4PL 3EBAA 1QQDB 2HG5B 5ALBH 1WAAF 5TF1H 4LAQH 4I13B 4HIHA 2VN4A 2FJFA 4FQHB 3MRCA 3PQYD 4F2MA 5B39B 4X9FA 5TQ2L 3WD5H 3D25B 2K7PA 4M6NH 4P9ML 4PJIB 1CK0L 1T20A 2UWEA 4MD4B 4ONGH 1JGVL 3VMNA 3VW3L 4LFHD 2YBRB 3BEVB 4PJ8A 1ONQB 2CH8A 4LSSL 1NANH 3HG1B 5F7HA 3PJSA 5I1CH 5F9JA 5BOZG 2OL3A 4U1HB 1KB5H 3FFDA 4H1LB 3RKDD 2XY2A 1QBLH 5HGGS 3HI1A 4HJGB 2Y9RT 2YKLL 2B1AH 3LRGA 3QDGD 4JM2D 4U7MA 3MNWB 3LB6D 5FUZL 1X44A 1W8NA 3FB6A 4HFUH 5T3XE 4G9DB 1CFBA 3LOWA 5B4MD 4LLWA 43C9B 4M7KH 3VRIB 4FQ2H 5GGTH 4WW2A 1J1PL 5KW9H 2CXKA 4CBPA 3VGHA 1A14H 1FAIH 1FFOA 2RGSA 1RZGB 1NKRA 2ZSVA 3SCMD 2F19L 2Q20A 3VXME 4A6YA 3SEPA 4DN4H 4ZSOA 4OLEA 5D1XC 5EPMA 4HGWB 4V1DE 1N6QL 4EN3C 2WANA 3MJ9H 2UZXB 5DLML 4NO0B 1KJ2A 1MIML 1KXQE 4M7LT 3O9WA 1B2WH 4L5FH 3AU1B 2IADA 4K8RL 4HK3J 4RDQF 2COQA 2UVEA 3ZKND 1SEBB 5IBUB 2PXYC 4IRJC 3JWNC 4U1GC 1KGCD 5HJ3B 3DGGA 4DKEL 4YIQB 5CBAA 5CEZH 1CXEA 2NY3C 5H35B 3SDDB 5DD3L 4WENB 1N8ZB 3IDUA 4P9HC 2AI0H 3L95B 1C5BL 3LHPL 5DUPH 3SBWA 1IGFH 4NO5B 2GTZA 3P9LA 4WJ5B 1NLDL 4JGMA 3U4BL 3C8KB 1T2JA 1AGBB 3A6BH 3IFNH 1B0RB 3BKMH 1TZHA 2HN7A 1YYMH 2VDOL 2HLAB 4ELMA 4TRPH 1WCQA 3TPKA 3TF7C 4L3EA 1I1AB 5C0IB 2PR4L 4RAHA 3MREA 4Z7NF 4OLVL 1MLBB 3H6JA 4Y4HA 1F6AB 1IAKA 5D2LF 4XNYH 4GRMA 3WFZA 4GQPH 3VXSE 2YPLE 5MEPB 1OW0A 3VFMB 1YC7A 4MLIA 4X4XA 5K9JL 1DUYA 1MJ7L 5F1NA 3MUGB 4R97C 2ADFL 4EUPB 5B38G 1OAXL 2DKUA 4X8JB 2ICES 4WUUE 3GB7A 3MJ8B 3LZFH 2ED8A 3GZKA 3FFCE 4F3FA 1UJ3B 5EU5B 2VDRL 4G6AD 3RY6C 4AIZA 2ZNXA 1WF5A 3L7FB 5A2JH 4DUWA 3QCTL 4OCSL 4JO2H 5HSFA 4G6MH 1W2KT 3GIVB 3BPNB 2DQCL 3W81A 2P5EE 4NZJA 4QHUA 1FFNB 4JO1L 3B5GA 1OGAE 4TQEL 1B0GB 3WL9A 1OTUC 1UYWH 2ZUWA 3ZTNL 3CFDA 3AM8C 3JVGA 5LBSL 1D6VL 1I9JH 5HHNB 5ICYA 3TZVA 1I75A 5D72H 1H8OA 3TPUA 2A6JB 4FQXA 1X7QB 3B83A 1FO0H 5KVMC 3KVQA 3Q1SH 5DF0A 1AO7D 3MRGB 1DDHA 4X6FB 3ULUF 2LU4A 5HGAA 1MCWM 5I17A 2F5AL 2R4SL 4YHLH 3WSQL 1AKJB 1QSVA 4YDIH 1HCFX 3HNVL 4JZJB 1HHJA 4WEBH 1Y6MR 2CIKB 4KQ4L 2L7UA 3KYMA 1W72A 2FATH 3SDXA 4E5XA 1X5FA 3HC0B 4HS3B 3VI3E 3FRUB 3D85A 3QIBB 2AV1A 4MWFA 3UTTA 4LEOB 3JV4A 2WBKA 3CX2A 5JHDB 4L4JA 3KNBA 2QHRL 2E7LC 2AK4E 1I3GH 1YYLH 5F1IA 1U92A 5C08A 1VFUA 5DEFA 3KHQA 2NY7L 5DMIH 4L1HA 2X89D 2VLME 3AAZB 4NRZA 3OKKB 3IDJA 3RWHB 2X4PA 3C6LB 1AC6A 2XQYK 3GIZL 4OFPA 4Y8DC 4PJFA 1QBMH 5J6GA 4NNPH 1G6VK 1FZJB 4PBVC 4IRZL 2P8LB 4F7CB 4OQTL 1AI1L 3WIHL 3DPBA 35C8L 3LH2H 5KG9A 1BZ9A 4EI5A 1G9NL 2XA8H 4NQXB 3I75B 5F6IB 1ZE3C 3KYKL 3ZYJA 1U8JB 1JV5A 4KTEH 5D1QB 1NGXA 3FO0L 2Y6SC 3NN8A 2XTJE 1JMZA 1ED3B 3GSOA 1J05B 5DWUH 3HPJB 4F7MB 4P5KB 2D7QA 4JN2B 4YC2C 3RI5K 4I77H 3ABZA 4ZAKB 4WDIB 3CDGA 3NIGE 5C0BD 3J7HA 4I0KA 1KPRA 2JK5A 1CYGA 3QB7C 4OD2B 5DC9B 3WIFA 5I2IB 5KS9F 5DUMH 1M71A 3U9PL 5I18L 2DN7A 1N0XH 1XGRA 1BVLA 4LPCA 4R4BB 1N2RA 3FQTB 4TUKH 4ZG1A 4NQED 1BFSA 4WU5B 3UJJH 3DSNA 3FOLB 1F4WH 4G8FA 4KAQL 4PS4L 2JF1A 3VG9C 3VFGL 3SPVB 3AXLB 3UTZB 4P9HL 1J87A 5MENA 1XGQB 2OTUA 3QHZL 1FVDA 2WLYA 2ERJC 1ZV5A 3H42L 2AGJL 1ZVSB 3S4SA 4R96A 3TVMD 1IGIL 5C6WH 2BMKB 4RAVB 2DQTL 4K71B 1UZ6E 2P47B 5E56A 4FFYH 1FVEB 4G43B 3ARDD 5HHOB 1LE9B 4XWOD 4MNGB 5E8PA 3CLEH 1EAJA 3LKSB 1NEZG 4U1SA 5D1XA 2R0KL 4JFHD 1QRNE 4I5BB 4QGYA 5A40E 1OLLA 4EN3A 2OX5A 3MRRB 3QFJD 1KCVL 4HKXA 3AUVA 5ICZB 1MCDA 5GRYA 4FQJL 2P43B 4FMFA 2J88H 4RIRB 4GAJH 4Z7OE 2GHWB 1LK2B 4IRJA 3L3OA 5T3XL 3MZGB 5J3HD 2R69H 1KPUB 1EJ6A 1QKZH 2XWTB 4FQCH 4P5MB 3E6FB 3B6SB 2IGFH 1S7VB 4HWBH 1UADC 3WCYA 2HVKA 3ZSSA 5JPMB 1R5WB 5HYSG 1NDGA 3O45B 1OWWA 3BN9D 3WFBL 4H25B 4ZOCA 5DJ6A 4TSAL 2L7JA 2DIJA 3I9GL 3N1PC 1D5BA 3G5YB 3KPOA 1RU9L 5ID0B 1FFPB 4NQCB 2VLRA 3DSFH 3ISWA 1EHAA 5E7BA 2QBWA 4XMKH 1NUDA 4NHUB 4PJBA 5JOEA 4YHZL 3STBA 1CLCA 2VDPH 1WIPA 3C6SA 1CE1H 2PO6B 2AXGA 2I07B 4XRCB 3STZB 3X13B 1T5WA 1FAKT 1LO4L 2N7BA 2DQEH 8FABB 1JTOA 2JIXA 3FRPG 4LSVL 5IB3A 2J6EL 5FB8B 4HH9A 1MAJA 4GMTL 1R3IL 1HIMH 4XAWL 2EDWA 3UTSA 4DVRH 1DANU 1UWEH 4NN5C 4PRIA 5DRWB 4ODUB 5TGBA 1KIQA 1SBSH 5D7KE 3O3BA 2F58H 2VR4A 3QEQE 4H0IA 3W39A 3NFSH 3RVXC 3UZEA 2A77L 3KPRE 1AD9B 3EYQD 4PUBH 3VJ6A 4MAYA 1YN6B 3ZZ1A 1BPVA 2B7DT 5DD5H 4QOKE 4YQXL 1VKXA 5IMKA 1KJMA 2KQNA 2K9UA 1EV2E 1CFSB 5J11C 4WO4C 4UT6H 3DURA 5B8CB 2EDEA 1BQLL 2C1OB 5F7FA 5DR5L 4WFFD 3BZ4A 4OV5B 4LSQH 4C56D 2BJMH 3FT3A 4PGBA 4G7YH 1WBYA 4DGYH 4KZDL 4LPWA 2BNQD 1A3LH 1PZUB 3O8XD 4IDJH 3DO7A 3G5ZA 3QZWG 1F6LL 2LTQC 5I8CB 3EDEA 1RZKL 3TLRA 1F11B 4PRPB 2CIIA 4ZTOH 1QEWB 3H9SE 3RVWC 2N56A 4H20L 1U8PB 3QP3A 1WUNT 2GAZA 2ADGA 3IF1B 1C5DA 3MRPA 2XTLA 5DFTA 1S7UA 1UM4L 3VXUB 2RJMA 3A6CL 1A4JB 3WLWD 4N0YL 3EYVA 2OP4L 4NNXA 4LL9A 4PRBB 2JJVA 1BD2A 1KTLA 5DQ9B 2CSPA 2E7LA 2Z0BA 4HWEH 1CN4A 3DVGB 5DEGA 3ULVC 2DTML 1NJ9B 1LDSA 3K1KC 2XKUA 3R4DA 1N3NA 4NYLA 2NXYB 5HGHB 3LD8B 2ESVD 3LSOA 5I75C 3DX8A 4L4VE 1XGUB 3NACL 3TEUA 2R1WA 2H2PD 5MEOB 3GGWB 1T1ZA 1BF2A 4QRPE 4PGCA 5HI3C 1U8QA 2Y72A 1ZHLA 1Q8MA 3TCLA 4RMUA 2XN9B 5BMFL 5I1IH 1KB9K 4PJEF 1G7HA 3HB3C 1JGEB 1CVSC 1LEGB 3GBML 1IQDB 4XGZA 1IQWL 4MDJA 3QDAA 4WHYH 1C1EL 3W5NA 2AXFA 3CSBA 3F7YB 3CVIH 2HWZH 2LFGA 3FB8A 4LF3B 2FGWH 4Q9RL 1SJHA 1GRWA 3PGCA 1UH2A 4XCEB 1DVFD 4YNYB 3QO0B 2K1MA 4P2RE 2FO1A 3MNZA 4M03A 3KG5A 4I4WB 9CGTA 2IMMA 4X0KA 1A6VH 1YPZB 3BKJH 5K9OA 4EOWL 5C0CA 4R2GC 4YFLI 4LDOB 4AEHH 5BVPL 3U1SL 4X5WB 1I1YA 3BW9B 2I9TA 1MY7A 1EJOL 1HILA 4OT1H 1ZEAH 3KS0J 4MQXD 1T0MB 3K0WA 3OF6A 3BWUC 3THMH 3O4OB 5I71B 1IEAB 1OQXA 5DMGC 1KCRL 4P46B 3VGDA 4Q6IC 3QG6A 1UQSB 4UOW1 2CR6A 5CJOL 1T1XA 4M7ZB 1D3CA 3G6DH 1YEIH 1ADQA 4J8RA 2JELH 1VSCA 4OM0H 3CIQA 4HWUA 5FECA 5E99H 5JLZA 3DXAD 1C08B 3CUPB 2OJEB 2G9HA 4U3CA 3U9UB 2B1HL 2EYSA 2ILLA 5LKNA 1YA5A 1U95A 3JTSB 1KFAH 1RZFL 3GSQA 5CZKA 5AYQA 2VAAA 4PY7B 5TQ0L 1Z0NA 2FRGP 2VDLH 4MJ6A 4X4YB 5ETUB 4Q9CA 2UUDK 3BN3B 5IB2A 3MBED 1YJDC 2BC4A 4OCXH 2Q6WA 4Z7UF 3EOBA 2HTKC 1ORQA 2ZJSL 3TJHC 5DHYA 3HRZB 4HK0B 1E6JL 1OWRM 1M1SA 5JDJA 1FGNL 3EAKA 4LVHC 5AZ2L 3WE6B 1T03H 5D7SH 1H0DB 5GISL 3ZDXF 3LMJL 4ISVB 4XVUD 1RUQL 4X7TA 3DX6B 1BQHB 4M43L 3SDCD 5JO5A 3GMMA 3O2DL 3ALWA 1XF4B 5L6YL 4XBGA 4M9PA 3B8YA 3KXFE 3VXMB 5KZCD 4ONOA 1FG2A 3T09A 2SEBB 2OJZH 4ZDHA 4V1DB 3WIIL 4URTB 2Q7YA 4UV7H 2EO1A 1S7WA 3GO1H 2GFBA 4XZUB 2AW2A 4KK8D 3S35L 3UMTA 2EIEA 5I73C 3L3IB 3ZSTA 4DAGH 3B3IA 3JSSA 4LCWA 5F3BB 4KDWA 4HWZB 2WP3O 5D70L 2RCSL 1HDMB 2VXSL 2ORBL 4R7NA 3VWJB 1JZ7A 4QXTB 3LEVL 1IM9A 5KSAD 3P4MA 1FNLA 4GKSB 2NW2B 5LXGL 5BZDA 5TE7L 1AY1L 4KRPB 3GHEL 1OAUL 4D0DB 5D4QA 2DQGH 1VFMA 2ENSA 4JRYA 1ZTXH 1T5XA 1FLRL 43CAB 3OXRB 5FUOL 2G60L 4KQ3L 4QNPE 4PJ5A 5T1KD 1F90L 4AH2B 3TBVB 3MLTB 5DO2C 3QDJD 4NUJB 3O11B 4OF7A 4WO4A 3NIFE 2APBA 4H0HB 2C4XA 4DVBB 4L1DA 3VXSB 1KACB 2YPLB 1VPOL 2PETA 3F5WB 4U05A 3RVVD 1CIDA 1EEYB 2XG5A 1UT9A 5JORB 1H3UA 4LP5A 4WUUB 1YEKL 2HVJB 1LK3L 4QEGA 3VXPA 1F3JB 2YUZA 1L0XA 3U0PA 2QV2A 4BH7A 3SJVD 3FFCB 5KSUB 5I1AA 3T0DA 4PJHE 3S88L 1CVRA 3CVHL 4HJ0D 4JAMA 2IALA 5ID1A 2XQBH 3HPLA 1IKFL 4OLZH 3QUYC 2P5EB 3GJEA 3T4AB 2G75A 1VFBA 3QWQB 2CUIA 3P9MA 3MLRL 4MVBC 1OGAB 2F74B 1II4E 3OKLB 4LK4A 1KLUB 4R0LA 3QO1B 3FN9A 3ARZA 3HAEG 5DQJA 3TBSB 1BZ7A 1MJ8H 3FB5B 3NIDF 4OFIA 4N1EA 1GZPA 3BIAX 3G6JF 4U1IB 1J1XL 15C8H 4G6FB 5EBMA 2YEZA 3HE7A 4BUGA 1OGTA 4G9FA 4DGVL 4JCLA 4FXGB 1ZANL 3T08A 3DRQA 4ZXBA 2IG2H 3CJJA 1HHGB 2BNUB 5EDXA 2IBBA 3A67H 3S3JA 3IDXH 1IGTA 2VUOA 1YY9C 3IETB 4PREB 5EO0B 5D2NA 3FN3A 3LV3B 3QIUB 2NCMA 4YHIA 1RIUH 4NQTA 5IMMA 3MC0A 1CU4L 5HVHB 1HXMA 2ZOKA 3TH3T 4PGEA 1JWSA 1QLFB 5FO7A 4YK4B 3TN0D 1F4XL 4Y2DA 3BRFA 1CXHA 4S1SL 1K4DB 2AK4B 4X5XA 3O4LE 3L7EA 4MSWA 4QO1A 4JFDE 2JJWA 1FRGH 5T3ZD 3HI5L 1K4CB 4ONHA 1IC4L 3W2DH 5I9QB 5E2VH 5C6TH 4Y5VC 1WGOA 4IJ3B 3N85L 4Z5RB 2AXJA 3FONA 4OSUH 2GITB 2H26A 4JDZA 1NUNB 1QBBA 4H1LH 3MROB 1S9XB 1MHCB 4UZGA 2P46B 4Z8FL 4MHHG 2F54E 5CP3H 4XP4H 1QA9B 2XZQH 5IJVB 4JO4H 1MLCB 5F9OH 2QL1A 4GKZA 5I1HH 1EZVX 5JQHC 3KPNA 3LDBC 4C83A 2FD6H 1ZMYA 3PL6A 3EJYD 2IBZY 1SJVA 1V5JA 1KTDB 2O61A 5EG6C 2CDEA 4N5EC 1HH6A 2AJUL 2IPUG 1NC4A 1NGWA 4XCNA 1S9WA 5SWZA 2XTJB 4L29A 2VZOA 1QQDA 4YDLB 3OL2A 2X4OB 4M1DH 4MA1C 3VG0L 1I8KB 1T3FA 4XC3H 1SYVB 4U6XB 4FQHA 4FZ8H 5GZNC 4WGWB 1VGKB 1T7WA 3D25A 4N8CH 2ZNWA 4LDLB 5C0DB 4RGND 4P4RB 4MD4A 5CSZB 2V9QA 1ONQA 2YD1A 3ZTJH 1DBML 1UKTA 2A9ML 1KJ3L 1I3RB 2R9HD 3HG1A 5GGVH 1HSBB 2H45A 1U3HC 1H3PH 3HI6H 1ZA6A 1S7QB 4Y1AE 1PZ5B 4FXKA 3MNWA 2DDQH 4Z7QF 5E1HB 1VB9A 2VN7A 4G9DA 5E94A 2UYLB 5D7LE 2OZ4A 3PGFL 43C9A 3VRIA 4R4NC 4EBQH 3MV01 3O9WD 1PY4A 5BS0D 1FCGA 1QRNB 2A0LD 5F89B 4XBEH 5HYJA 3OHXB 4OAWB 1HI6B 1RZGA 3MBXL 4QRUB 5I6XC 1P5UA 4WUKH 1CDIA 4WTZA 2HFEB 2X4TA 2GJ6E 5I30L 2V5RA 3O6MH 3PE9A 4CVZB 5I1EH 1BIIB 3CMGA 4HGWA 1HQRA 5I1LB 2W9EH 4YPJA 4BUHA 4JEGB 3HNTL 3OTTA 1L7IH 2QJDA 3M1BB 5E03A 1QSEE 5EZIL 4AK1A 1GGTA 4OF8A 2NY5H 3AU1A 3FQWA 4JFXA 4YXLH 4IMKC 3U46B 5IEHA 3I85A 4NM4H 2I60H 3H9ZA 4GO6B 5DVOA 3ARGC 1NGQH 3UXFA 1ZKAA 5HJ3A 5IW3A 3VRLE 4L3ED 1EUUA 3AB0B 4LASH 5H35A 3T0ED 5IHUL 2XICA 3NAAL 1N8ZA 2DTSA 2VZSA 3GRWH 4Y4HD 3WUZA 3BP6B 4WJ5A 4K94C 1KXTB 1AGBA 3I6GA 3BH9A 3NH7H 1B0RA 4OIIH 2R2CA 2BRQA 4JPWL 4YAQB 5T3ZH 1TJIH 1I1AA 2B39A 3MQIA 5C0IA 1AE6L 2F8XC 2ZSWB 4BQ8A 4Q9BA 2J2ZA 1MLBA 3W0WE 4K23L 1AGCB 1JIBA 1F6AA 1WIOA 2OSLB 4LPUA 3LKPA 1XZ0A 3VD7A 1A7OL 5MEPA 2BNRE 3DUSA 4TPRL 3VFMA 2HT2C 2B5IC 2AJSL 1IARB 5F7KC 2Q86B 3QEQB 4EUPA 1SVZA 1XF3B 5CJBA 4KJWC 3KPRB 4M1GL 5KBNC 5IG7B 3CVHB 5HGDA 3K1DA 3R8QA 3QUYA 2Z8RA 4QOKB 1YY8B 3Q3GB 4GLRI 3PWUB 5K9KA 1CBVH 1U8NB 1CZ8H 4MGXA 3UROR 1J1OL 1KCUL 3ARFB 4M5YL 3GIVA 3SE8L 1CICB 4GSDL 4PJ7F 5IWLC 3ARQA 2V5TA 4YXHL 4WRLA 1JZ3A 3B9KD 5GZOD 1RY7B 4YFEA 3T2OA 1LO2L 2E7BA 4BQ6A 4NJAH 4K7FB 4IRSB 5DHVA 2P1YA 5DQDL 2NPLX 5HHNA 5HPMB 2E27L 1SEQH 2P24B 1GZQB 2R4RH 2ATKB 1X7QA 3H9SB 5EU6A 3L3DB 1Q1JL 5C3TA 5HHPA 1FYHB 3UTTD 5M7QA 1ZOXA 3PIQB 1TETH 5ITBL 4LOUD 5J13C 3V4PH 1Z5LB 3JZ7A 3TP4A 5MHSE 1NFDF 1AKJA 4MNHA 5FO9B 1YC8A 4DTGL 4XHQA 2WLZA 3OGCB 4FP8H 1IZJA 2CIKA 2KZWA 2O5XH 1Y6NR 1PSKH 2Q8AL 2YPVL 4NM8L 3HC0A 4HS3A 1PX3A 2JE8A 4KUZL 1NC2A 4LEOA 1BWWA 1Z3GL 4K3EL 2QSCH 4WNQB 4ZOAA 5EORH 5ESQB 5EUKB 5JHDA 3VW3H 4L4VB 1M7DA 1GL4B 1RSFA 4Y5VA 4LLMB 3KYOB 3F62A 4LSSH 2CO7B 4UQ2B 2GIYA 3KPSA 5DEZA 3VFUB 4P49A 2F53E 3IS0X 4IIQC 4QRPB 3OBAA 1TCRB 3OKKA 3RWHA 2XPGA 4K3DH 4G3YL 1ZGLM 1XF2A 32C2B 5IMLB 3ECBA 4BH8B 4P2OB 1FZJA 2P8LA 4KI5C 2M2DA 2QQLH 4JZOB 5FYLD 1QG3A 4J7RA 5J12C 5E8DL 4HCRA 1C5CL 1J1PH 2RHEA 5ALCL 3WHE0 4YGVA 2Z8SA 1RPQA 1EGJL 1U8JA 2F19H 1OAKL 4P2RB 1MUJB 4A2LA 4PIRF 1CXIA 4GG6F 4G6KL 2JJTC 1ED3A 2AABL 1J05A 2YA0A 1EA9C 5E6ZA 3HPJA 4F7MA 4P5KA 4HS6B 3GSNA 5FIEA 4HUXA 3QZWB 3EGSB 4YDVA 2FZ3A 5DZOA 4R4FH 3V5HB 5MEND 3BZEB 2ZCHL 2YA1A 4I1NB 1WITA 5E2TL 1HINH 2HT4C 4OF0A 1NBVL 2VIRB 2Z31C 2W0FB 1LQSR 4MNQD 2VZ1A 3FQTA 4R4BA 2X05A 1FNFA 4DKEH 2BSSB 3PV6B 3IRPX 4O58L 3FOLA 4OGXL 1TPXB 4XBPB 5DD3H 5B3JE 3AXLA 4EDXB 3EFFB 1C5BH 5D1XD 1XGQA 1G9MC 4HLJA 4WGVB 3VFTB 1NLDH 4EN3D 1XIWC 4AG4L 4WWKB 2D9CA 2JJSC 1ZVSA 4ZUWB 2VDOH 2QSVA 3AGVA 1FVEA 2MJWA 4G43A 3WO4B 3EO0B 3WJLC 5HHOA 4MNGA 4G8IB 2EDTA 3TNNB 2PXYD 4IRJD 3VDCA 1GVIA 4P23B 4JVPA 1UFUA 5I15L 3NZHL 1KTKE 5BZWB 4JFQB 3FO2B 1HH9B 2NY3D 3DUHA 5DT1L 5K9JH 1A22B 1MJ7H 3QT2A 3FQXB 1A2YB 4X7DC 3HMXA 4IMKA 2A74B 1TQBC 1GIGL 5SV4A 5F7DB 5DGQA 1LK2A 3RDTB 3ARGA 2VDRH 5T5FL 3MFFB 3QCTH 4P2CG 5T1DH 1NGYB 4OCSH 3IAPA 5H2BB 1HHHB 5IHZA 4P5MA 3E6FA 3KXFB 1G7IA 5JPMA 2CDGB 2DQCH 4ZFOL 1RHFA 2XYCA 5EULV 1XR8B 4ACPA 3SDAC 1VEOA 4H25A 4Z0BH 4TQEH 2CRIA 3G5YA 3U6RB 2KBGA 3ZTNH 4IOFC 2JIXD 4NQCA 4RFEB