4DAGL

Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
213
Chain Sequence
b'ELALIQPASVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQDSERPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGGTTLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion glycoprotein F0
publication title Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site.
pubmed doi rcsb
source organism Human metapneumovirus
molecule tags Viral protein/immune system
total genus 37
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagL01
3ZHKA 2JJSC 2DDQH 3V5HA 3O11B 2NY7L 1N2RB 5H2BB 4PJDE 1P6AB 2C3WA 1OHQA 1JGLL 2PYEA 3EFFB 3FQNA 4DFIA 5FCSH 1J0ZA 2ADIB 4XCFL 2ZSVB 3AY4C 1CG9B 2DM3A 3G04B 3GSOB 4P4KC 3QH3B 4JM2F 2VDOL 2VZSA 4M5ZL 2D0FA 3MV9A 4Z0BH 1FIGL 2VMFA 3G6DH 1R3JA 2JE8A 5CMAA 4PBXA 1MUJB 5CSZA 2BY1A 2BRRL 3M1BA 4V2BA 4HXAL 1QQDA 3HPLB 4F58L 2IBGA 2WBJA 4RGNE 4PJIF 5BVPH 2O5XL 2QQNL 4EDXA 3GBNH 3E0GA 4TTGA 2YC1A 4UNVA 1DLHB 4W6YB 3MODL 3QEHB 5HJ3A 4NRYA 2NR6C 3RGVA 1MI5B 2G5BA 3RUGA 5MEQA 5C71A 3QWQB 4YDLB 5BZDB 1VEOA 3DX9B 3LVEA 5DR5H 1II4E 1AKJB 3GSNA 3PWNB 4K8RC 4L8BB 1PG7H 2YPLA 3MRHA 3IFOA 4OLYL 3FB8A 3TZVC 1DQML 1T66C 4UB0L 4NFDA 1KULA 2IWGA 2B8OT 2CK0H 4KI5D 1BZ7B 3F65A 3VWJC 1FNFA 4JM2A 4LF3B 3ZDZE 3RU8H 4FQLL 1N6QH 4FXKA 4HS6B 2XYCA 4FTVE 2OTPA 4HWBL 4PG2C 2UYLB 2FJGB 5IJVB 4MNHA 5I1KH 2ARJQ 3MACH 1CLOL 4PG9A 3O41A 2Q6WB 5FCUL 4NCC1 3RWJB 4P2RB 2P5EA 3GNML 2R29H 4P5MA 1RSFA 2A6IA 2Z4QB 4PJFB 1WZ1H 1LK2B 4OSUH 2YEZB 4XCYB 5DQDL 5ERWA 5T5NF 4IIQC 3FO0H 1PG7W 1DL7L 5IW1A 1A9BA 4ZPVA 2UZIH 1UJTA 2J8UF 2FR4B 1Z9MA 5IIEA 4L1HA 3P40A 5CEZL 1G9NH 3GMNA 1QEWA 3JZ7A 2MCG1 1YEHL 4NN6B 1J05A 5MENB 1TJHL 3QIUC 2H3NA 5GZNC 4LLDA 4PGEA 1REIA 4WFFD 1OTSD 5GS2D 2FX9H 5T3ZE 3GRWL 2UWEB 3Q6GH 5T1LD 1OTUD 3NIDF 2VZVA 4PJBF 1IILE 4TQEL 1MAKA 1P53A 4GO6B 2R1WB 2ZOLA 4HBCL 2GK2A 4AL8L 2VB5A 3QG7H 4QT5A 4H88H 5CWSB 5D7KE 4NDMA 4NQDE 5HGDB 2W0PA 3DUUA 4XCCL 4XNQA 3VXNA 1MFBH 5F72S 1HWHB 4IS6B 5JMRA 3LPWA 5ABDE 1HEZB 4OCRH 2ESVE 4XXDA 2FATH 3OJ2C 1L7IL 5AAWA 1TITA 1MNUH 1Q0YL 2J8UA 4G9FD 9CGTA 3HE6A 3O9WA 1R3KB 1PVHA 2MHAA 3HMXA 1FLTX 2C7UA 4HZLA 4YK4C 2R2BA 4X6FB 3D3VB 3MMEA 4WI4A 3STLA 3JWOH 1KYOK 2AJVL 3MGAA 2HTLC 1OAXH 2WANA 3BW9A 2QSCH 1PZ5A 2Z93A 1G9ML 4ODSH 3V5KB 3HI6L 2ZUUA 2CUMA 5FUCE 1WVZA 2ZCHL 3IFLL 1NC4D 1IM9D 4OV5A 2DJ4A 1DANT 3UCRA 3D39D 4FFZL 1G6RL 1S7SB 4AH2B 5D70L 4GG6F 4A6YB 3DVNA 4G6AC 3O0RL 5CSGA 1J5OL 5EWIL 3NIFE 1H9VA 5E7FA 4EVNA 4PJAB 3KYMB 2Y25A 3QXDB 4JN2A 4XX1G 3T1FB 4ODTL 2NY0D 1R5IB 3P11H 5KZCB 3EOBA 3VG9C 2YD7A 2CGRH 1R5WB 1DQLL 1RVFH 3CFCL 1NEZA 1AR1D 1FORH 1H3WM 1NSNH 4RMSA 2O61A 1MAJA 1JZ8A 1TZHB 4FQIH 1OSPH 3LB6C 1D6EB 3IFPA 3RNKB 1MCSA 5F71A 3LKSB 3V7MA 4GAGL 4JFDA 1FYTD 1VGKA 5BRZA 3EYSL 3MLRH 3I3EA 3TVMB 5F7YC 1WWBX 4XWOD 3SKMB 1JZ4A 5IJKC 2APFA 2VXUH 5HHXL 3D2UB 4Y2DC 3B9KD 1GJIA 1S7QB 4H26B 4A6YH 1XR8A 3A0OA 3QDHA 2JB6B 4HIHB 3WJLC 2AXJA 3ZKSD 5K93A 1U93A 2NY4D 1VFOA 3K4AA 4EQ3A 3PGFL 1CD1A 4XHJC 3R1GH 3S36X 3TIEB 3E8UL 4X6BA 5B39A 5IW6A 4XNZB 3SJVB 1MWAL 2HVKB 3JVGC 3BHBB 1HZHH 1XR9B 3FONB 1CDCA 4PJ8C 4HJJH 5F9JA 3S37X 5L6YL 1F2XK 1X5GA 4YDJB 4C56B 3UO1L 4M5YH 1SHMA 4I13B 5GGSB 4YHOH 2J5LB 3BZ4A 4AM0A 3TO4A 1QUNA 5JOPE 1ZS8A 5MEPB 4D9LH 3HG1A 1IAIM 3MLSL 4JPWL 1SVCP 1AXSA 4R4FH 3W0WA 5DF0A 2FSEB 2DD8L 3VXUD 4Q2ZB 5JQHC 5C9JB 3E6HB 4MZ2A 5ICYB 2IQ9H 3RIAK 3UYPA 3G5VB 4FMFA 4JFEB 3LKOA 3UAJD 4F9PA 4ZD3L 1IQWH 4QOKA 1TDQA 1V7NH 3L5XH 2E7BA 3CDFA 4JFHD 3V0VB 1XF1A 1J1PH 4KJWC 3ARXA 4PJCF 3BP5B 4JFYA 3FAWA 3RDTD 4CN6A 3QEQD 1X6NA 2YPKB 5HHPA 1J0KA 4QHMB 1XGRA 5IW3A 4HEME 1ORQB 2MQCA 1A1NA 1GGIH 1G1CA 2VWEE 1I1AB 2VH5H 2NLJA 3DX6A 2BNRA 3O6FA 3G9AB 4X9HA 4XVTH 2GJ6B 4LBEB 3SCMA 2LU4A 3D1MC 4DZBB 1UB5B 3CMGA 5F6IC 3QISA 2DRUA 4KZDL 3SY0B 4F57L 1EO5A 1U8QB 3LKPB 3V4VL 3SOBH 4WHYH 3QJFB 4X7SL 1AO7D 3G6DL 3GIZL 4WW1B 4OLXL 4W6WB 1CFSB 5I73C 2FJFA 3BP6B 4N0FA 4CAGA 2EIEA 1U36A 4PJCA 4PRHD 3EKCA 4ZAKC 5FYKH 5BVPL 3LDBC 3MCLL 4P9ML 1G1YA 3F7YB 3FOMA 5IBLD 3IKCA 1MI5E 4ONHA 5F3BA 3IDJB 3OKEB 4WFHE 1JZ2A 2FHBA 2OJZH 4U6HB 1OGAA 2XA3A 3PDOB 2CUIA 1QA9B 1AXIB 3NPSB 1HQRB 3ZKXC 1RAMA 2FX8H 4OLUH 3LEXA 4UBDD 4H1LG 5D1ZB 4Y5VB 1BJ8A 5F9OL 4CU7A 3TIDA 1OVZA 2V5SA 3CXDH 2K7QA 1AHWB 2X42A 1OTTD 4G5ZL 3CNKA 1UT9A 3CFIC 4HPYL 4JFFB 3UXFA 1DBAL 4K23H 3T0EB 4Z7VA 2IH1B 1J7VR 43CAA 5C0AD 4OZHB 3LPFA 5D5MA 3UZEA 5ACZA 1A6TA 4GW5A 3O2DA 1KIPB 2NX5B 3W5NA 4PJFE 4BELD 5E8PA 3X11A 2R1YA 5CP3A 2X7LB 3PABA 3UYRH 4UAOC 1EEZB 1X4ZA 3GM0A 4PV8A 4Y4FD 43C9B 2DLFH 2BVTA 5E5RB 2GSGA 4BYHA 4EBQH 4H0HB 5BOPA 5IMKB 3F7RA 3WLBB 1IEAB 5CD5C 1OW0C 4HC1A 4PB9L 3BN9D 5BW7C 1A6ZA 4KU1A 5MENE 4WI2A 4TSBH 5CJ5A 4N1EA 3QO1B 4KUZH 1DUYA 1YEGH 2UWEE 4Q9BA 4S2SA 4O2EA 1C5CL 4IMKC 5GGQH 5IHLB 4Q6IC 4RDQF 2XXCB 4P4KD 1RZGA 1VB9A 5HVGB 3ZKNC 5EB9A 3EDDA 1J11A 3U0WH 5HPMA 5LQBL 3QG7L 4G42A 4GXVH 1DUZB 2EYSA 5IG7A 2VQTA 3QUZA 1MSPA 2CDGA 1IGYB 1E0OB 5KW9L 1NGXA 3VGGA 3OKNB 2ZSWA 1KT2B 5D2LB 5CJOH 2EDRA 1GC1L 5CP7A 1UWGL 5C3TA 3DPBA 3RIFF 1VFMA 3X12B 5I1AA 3GIVA 4E5XB 5FA4B 4RAUA 2NR6D 1F4XH 4JG0H 3PQYA 4YAQB 3VGAC 1AQKH 3RGHA 4RFEA 5LAXA 4W4OC 4O58L 2WBKA 3HC4L 4K8RD 5CEXB 2L7UA 3U9UA 4N9GA 3TZVD 3GMMA 3QIBD 1TJIL 2VIRB 5ESVA 3VWJD 2Z8VC 5I16B 4HK0A 3MREA 3GJFK 4JPIA 1AIFA 1BVZA 3NCFB 4MQ7B 4DN4L 1I9IH 3H7BA 2XWJB 1EEQA 1UM4L 3ULVH 4PJAE 3MLVL 4YEFA 3WS3A 4PLNC 2LAGB 3C60C 3SDYL 3UTZA 3OAUL 4BFBD 3SBWA 4RGMB 5C08D 1RVFL 3UDWA 2JB5L 1FAIL 3MXVL 2YBRA 5HHOA 3WKNA 3FZUD 4ZUSB 4KMTH 3NFSH 2HH0H 4PGJA 2XN9D 4LDEB 3QP3A 4JO3L 3RQ3A 2AK4A 3VXPB 3WN5B 2V2TB 1FH5L 5BO1L 1YY9D 4MD4B 5T1LB 1CT8B 1YYML 2D03L 4YHLL 4LSDA 1UM5L 4PJGB 3CX5J 3QEUB 4CNIB 3QIUD 1NLDH 4TNWK 2H45A 5BMFL 1IGML 4N5EC 4Y4KC 3V0WL 2D7TL 4E41A 3H9HA 4U7MA 3S7GA 4F7CA 5FOBB 1A21A 2PO6A 5I17A 2XV6B 4NRZB 2KBGA 3PNWA 1LO5A 5E2WH 4APQC 4KH2A 4MQXD 5FGBC 1H0DB 2BNQA 5A16A 1X4XA 2C1OB 1WC7A 4U31A 1FVDA 5TE7L 3FB6B 5F93C 3ECBA 4TOYH 3R1GL 4GFTB 3MBEA 2QHLA 4L29A 3FO1A 3SJVE 4N8PA 3HNTH 1RUMH 3MRQB 1JF1A 4LVNC 5HI5C 4LCIH 3X17A 2X4PA 4FS0A 5DHVA 3BX7C 4C56E 4QNPF 3QUXC 2J6EA 4M5YL 4LHUA 2G60L 4R7DB 4L4TA 4EEEA 4NZJA 1CU4H 1M7IB 5LJYH 4MS8C 2E8YA 1IM9B 4QRQB 1T83C 2HTLD 4L8SC 3MTRA 5DQ9A 4Z7WB 3VH8A 3CDGA 1C08A 4WW2C 3HI5H 1YQVH 3MJGX 5D6DC 3QUMB 1F4HA 4QHUA 2EXYC 4OLWH 3OXSA 5EOQH 5EU3B 2NYYC 4JFEE 4M6NH 3WIHL 2DIBA 1FNAA 1GGCH 1OSZB 3FFDB 3TBTB 1NEUA 2DWEB 4G6AD 4ZFFA 3U48A 5I8OH 1J1PL 3MRKA 1BD2A 3PP3K 3BKML 3O6LH 3VXQB 4NYLA 4FABH 2YRLA 1LDPH 1GGIL 4K71B 5TDPA 1FYTB 2GJ6E 4QHLB 1UVQB 4Z5RB 1YPZE 2NXYC 1MCCA 4DZ8B 3UTTA 3LB6D 2BDNL 2JLLA 2F74A 1ZHBB 1F90H 3W39A 3U9PH 5DRWB 4YBHA 4Y4HC 3WS6C 3B9KB 3LMJL 4PJDF 1FJ1B 1V7ML 4EI5B 1P5VA 5JHLH 2VXQH 2J88H 3EFDL 5DK3A 3IB4A 2NY4B 3QUMH 3QWOA 5SX5K 4JKPH 3C6LC 3B9AA 1A7RH 4Q9CA 4Y2DD 5F7FA 5C07A 3EO9L 1A7OL 2Z8WC 3QHFH 4X9GA 3TBWA 4NO0D 3VMOA 1BM3L 5FYKL 5JUEH 2YN5A 1K5NA 5HYIA 3LD8C 5DJ6A 5I1JH 4JN1H 2OJZL 3L9RA 1XCQA 4K7FA 2XTLA 5KSBB 3UP1A 3VFGL 4FZEL 3UC0L 1IAOA 4PJ8D 4R26L 1GOFA 2RHEA 2WK2A 3PWJA 1A1MB 2ZUXA 4ODHH 4OLUL 1MVUA 4X4XA 1FZKB 4K3JH 4JKMA 1YYLL 1W0VA 4CVXA 5L9DL 2FJHA 2VABA 2FBJH 4PJDA 3MRPA 4JFFE 3T0EE 1DVFC 3OQ3B 2G2RB 4OZHE 4JFOA 3NBNA 1XT5A 1CXHA 3OAZK 5DHYB 4HULB 1PSKH 5HDQH 3QEQB 4AY0A 5IR1A 3OGCB 4U1KA 1KEML 3NH7H 3ROLA 3ZMRA 3BZEA 1KLGB 1NGZB 4PPTA 3U36A 5HI4C 4KJWD 4JFPB 1ZSDA 32C2A 1I7ZB 4Y8AA 1PYWB 5C6PB 3D25A 5DEFA 4UQ3A 1EJOH 3W11C 2CO6B 2K9UA 4HIEB 4DW2H 4QTIH 2CD0A 1DR9A 3C87A 1P69B 3KVQA 2Z8SA 3KYOB 3TO2B 2W0FB 4TSBL 3LRGA 4NKQB 1AO7B 1MCBA 2R69H 4AZ8A 5ITFA 4KQ3L 1F3DH 3RWHA 4I77H 3QIWD 1RZKL 2FGZA 2BOCB 1TQCC 4JY5H 4RISH 3MQIA 4X99B 4M7KH 5C0GB 3ULVE 1CLCA 1WBXA 1IAII 1WITA 1F6AA 4PRHB 3U0WL 1F6LL 4GMTL 1CLZL 4CBPA 4FTVA 4DVRH 4I18A 2Q86B 2IPTL 3TA3C 2LTQC 5I0ZA 1MHHB 5D2LE 4J3UA 2AQ1A 1ZWIB 2EC9U 4RNRB 1KELL 1PGRB 2V2WA 4JQVC 2OL3H 3CZFA 1ADQA 2CDEA 1MRFH 3N85H 1YEKL 1MHPH 1X5KA 4KI5E 4LSQH 2A73A 5TH2B 5J06A 5DD0H 4WUUD 1CLYL 1MCPL 5SV4A 5JOFA 3EOAA 1JTTA 2B1AH 1FYHB 3GI8L 1KJ2L 4JZNB 4O2FA 3NABL 4OF7A 3VJ6B 1BJ1H 5D7SH 1BBJA 3FT3B 3BDBA 4XVUC 4JKKA 5HVHC 2YA2A 5C7XL 1NBVH 3CUPA 1FO0B 4P3CL 3WO4C 5C0AB 5IEKB 4JB9H 3KYNA 2Q8BH 2UZYB 4Z8FL 3B5GA 5JDSB 2HLFC 2XNAA 3SKNB 2V9RA 1YN6B 3IJYB 5HSFA 2IFFL 1OP5H 4ZDHB 3LQZB 5E4IA 1OPGH 1HH6A 2IJ0C 4GKNA 4Y4FB 3K1KC 1VADA 4GXUN 3TH3T 3NGBB 3TBYA 2I9TA 2VDMH 1G7QA 4G8IB 3V7AG 2H8PB 4ZUUB 4LPCA 3WFCL 3BO8B 3NIFF 1P9MC 4YQXH 4NQDA 4TNVK 5EU4A 1YEIH 3RI5F 2EDHA 2X2YA 2ESVA 4MA7H 2IPKA 4C55A 4LRIC 2DI9A 4NFBA 4EUPG 2OP4H 4RWHA 4LP5A 2JELL 4PJGE 4P4KB 2HMIC 3P0YH 4O4YL 1AXTL 4DVBB 4JZOA 4G80B 1FO0H 3SDDC 1A7QH 2BK8A 3LEYH 3QFDB 4LSVL 3MNZA 3U79A 3U4AA 1EHLH 4PGZA 1DBMH 1SJXA 2DTML 3BE1H 1CDHA 3HN3A 1T80A 4UIMB 3ZKND 2IMNA 1JHTB 3QRGH 3KPQB 2FB4H 4AEIH 2OR7A 5HPOA 1T21A 3WXVH 3S4SA 4E9LA 2CKNA 4M4RA 2PN5A 1MCIA 1R5VA 1UZ8B 3I6KB 4LCCB 4U6YA 5FKAB 1U8LA 5FK9B 1F42A 3EYVA 1F4YH 1RJYA 4WNQB 1KCUH 5CGYC 5INCB 1MWAA 1N6UA 2LQRA 3V8OA 2EZ0C 5LCVH 2YD4A 2JIXD 1NBZB 5ESAA 3T0XA 2LVEA 5D7JB 1RI8A 3QIBB 3HAEG 3H42H 3EJJX 1HHIA 1W0WA 2BJML 3HRPA 4QHKI 4Z7WE 1NMCC 3IETA 5GSVA 1NCUA 4WHCA 3RTQD 1LEKA 2QQKL 3VFMB 4PJ5B 1CIUA 3HI5L 3SE4C 4YHYB 2DYPA 1FFRA 4M6NL 3WJJC 1IGCL 3D0VA 1GGCL 4NWTH 5KJRL 5HHQB 4XP4H 1MJ7L 4NCDA 5C08B 1T5WB 2X1PA 5C92A 2J1KA 2NMSA 2D7NA 1IT9L 1N0LA 4TUKL 3O6LL 1AQDA 4IIQB 3H9YA 4H5SB 5CGMA 5J8OA 1GGYA 1H3PL 4FABL 3DRTB 3VG0L 1NLBL 4G8EA 3TYGL 5K33A 4C83A 1YDPA 3KPSB 2NW3B 4N8VA 4NHCH 5JORA 4YHNA 5CHNA 1PKQB 4PV9A 3GKWH 3K1DA 5JO5B 4ZS7H 5J1AA 5AAMA 5FXCH 3DYPA 1SY6H 2OI9B 1JK8B 4JKWA 5I1IL 1KFAH 1BIHA 3HMWH 3ELAT 1UC6A 1QOKA 3QFJD 4WWKA 4MJ6B 4P49A 3DBXB 3JV4A 4NC1C 4PTTB 1KIRA 3FQRB 5CJXA 3ETBF 3KPPA 4NO3A 5IF0A 3B8YA 5IB1A 4N5ED 4Y4KD 3QNZB 3EYOB 5CCKL 2H9GB 4G43A 2IQAB 1OB1B 1LO3L 4APQD 3PIQB 2UUDK 3QHFL 5DLMH 3O3DB 3ULSB 2R0LH 3P4LA 4UI2A 2Q8AH 5IHBA 4X7EC 5KSBE 2F54B 4OCMC 4O2CB 3OJDA 4LCWD 2ZOKA 3QEGL 3SKJH 4F7TB 4YK4B 3JWDL 5E1HB 1LNUA 4XNXL 3W5MA 1YECH 2DL2A 3CFEA 3QUXD 5I76B 4ENEC 3C5ZD 2HKHL 1HSBA 1FG2A 5DJCA 3P4NB 4JFQB 1QLRB 1V05A 3O11A 4MS8D 4P5TC 1CD0A 1D5XA 3OF6A 2D31B 3EFFA 1BHGA 4XPBH 2QSVA 4ERSH 2ADIA 4JFHE 2ZSVA 3WIIH 1CG9A 3G04A 4PRBB 3GSOA 3P77B 3Q1SL 3QH3A 1FL3B 2QQLL 4NQCD 5DJXB 3QEQE 2NYYD 1PSKL 1KPRA 4OFDA 2RCSL 1MUJA 3UTPD 1CTNA 1M7DA 1NGYB 3VXSD 3ROOB 1VKXB 15C8H 3HPLA 3I2CH 4JRXD 2IH3B 5GS0C 1J10A 5TF1L 1K2DB 3BIKA 3NPZB 1JGDB 1T0NB 4PJFF 1KXTB 3GSWA 1DLHA 1UA6H 2ED7A 3QEHA 3GJEB 1P6FA 1MI5A 4LPUA 4XT1C 1AO7E 3LHPL 5IOPB 5E2UL 2OS7A 1LO2L 3DX9A 3PWNA 1AKJA 1TJGH 1RZJL 4L8BA 1MLCB 2W92A 4NKIL 5E70A 1MCFA 2V5TA 1KC5L 1RUAL 4S11A 3WFEH 4M7KL 4Y4HD 3CAFA 3KXFD 3TN0C 4PRHE 4LF3A 4NO0B 1ZLUH 4HS6A 3K81A 2DQJH 4MSWB 5C9KA 5I8CB 1N0XL 3BDYH 1A6UH 2ARJB 3AGVA 2UYLA 2FJGA 5IJVA 1QSFD 2I26N 2ICWA 1AGEB 2VDRH 5GRYA 2EKJA 4JANB 1QRKA 2Q6WA 4CMHB 2AJUH 1WT5A 4Q9QL 2EE6A 1XGPA 1BVKB 4MCYB 2CK2A 1FHGA 1NGQH 4PJ8B 2Z4QA 4PJFA 1LK2A 2YEZA 4KTEH 4Q7DA 2AV7B 1T0MB 1WAAE 5ENWB 3U7WH 4ZO6A 2QSQA 2EH8H 2HP4A 2B1AL 2FR4A 3PHQB 3NFNB 4KROC 4F2MB 3IGAB 5CJQL 5AUMB 5E56A 2YRPA 3B5HA 3CZJA 1CGXA 5C0AE 5D7LB 1Q8MA 3K8KA 2AQ2A 5MENA 5K9OB 5B8CA 4WHTB 3DMMD 2UWEA 1DVFD 1AY1L 1AH1A 5I19H 2MPAL 2CRZA 1UACL 4JPVH 2EEDA 4OD3H 1AGBB 4ZUWB 5IHZB 1OGTB 2R1WA 3SGEH 1K85A 4I0CC 1T6VN 4ORGB 5CWSA 3O3BB 4AEFA 4HLZH 5HGDA 1ZT7B 4G6ML 2PR4L 5HI4D 4IS6A 1YEIL 2EECA 1HEZA 1VA9A 4J3SA 3IYLW 4MA7L 3DECA 5HHMD 3WLWC 2H1PH 4KAQL 5T1KD 1UKSA 3OAYK 5EZOL 3CLFL 3W11D 3IT8D 3CU7A 5F6IB 3O8XB 3C09C 5D2NC 4HG4K 2OP4L 1R3KA 2XTJB 3QIWB 4X6FA 4XNMB 3OB0K 2XI9A 4MXVE 1A7NH 4Q0XL 5TGBA 4I3RH 3VI4E 2XZZA 4RAHA 4G3YL 4RMWA 3N9GH 2ICEB 5JIPA 1A7QL 4U6XB 3G6AA 1NCCL 3VDCA 3SGDI 4K7PY 5I73B 5HGGS 1X5JA 2C1PB 4IOSD 4AH2A 4A6YA 3LCYA 4PJHB 1E4XH 3VGEA 4B50A 4L4VD 3HFMH 4R0LC 1T4KB 1ZK9A 4PJAA 3GM8A 3KYMA 4GAYA 3QXDA 2BCKB 4X80H 4NZRL 3T1FA 1R5IA 2EDJA 3MO1B 2X4OB 4WUUB 2NTSP 5BV7L 4LL9A 1R5WA 4C59B 4FQ2H 4FQ1L 4PR5A 3DYMA 3ZKXB 1CQYA 1TZHA 1JI2A 1D6EA 4Z7OE 1B9ZA 3RWFB 3RNKA 4TSAH 4PJ5E 1KB9J 3AFLA 3LKSA 5KVGL 5CKGA 3T2PA 3G6JF 4JDTH 4XCNB 4XVUD 4PS4H 3LN4A 5T33L 1D5MB 4NP4L 4POUB 1NBQA 3MA9H 2N7AA 3W2DH 3P0GB 4LHJB 1MCOH 5KVEH 3TVMA 1LE5B 5C08E 2HLFD 4AYFA 1YNTB 4K7PX 1IMHC 3SKMA 4M7JH 1MF2H 2P5WB 4GRMB 5HGAB 3D2UA 5EUKB 1S7QA 4H26A 4UAOB 3T0BA 4LSTL 2JB6A 2Q3AA 4HIHA 3MLPA 4GJTB 3KPSE 1GHFL 3TIEA 1EVTC 4K3EL 1PKQE 1A7PL 4JJHA 4NHCL 1K8IB 4KY1H 3SJVA 3BHBA 1SY6L 3HE7D 1XR9A 3FONA 4JZJC 4K8RL 1ZA3B 4YDJA 3QXAA 4C56A 3RA7H 5E9DD 4AEHH 1LO4H 5KS9F 1MREH 4N5UA 2Z31D 5GGSA 4NBXB 4WCYL 5L8JB 5K9KB 1YPZF 2XKNB 1EERB 1TCRB 4Q6IB 2HMID 4XP6H 5MEPA 2FHCA 1X5HA 3EJZC 4CMMB 3C2SA 1SEQH 2ITCB 2FSEA 3I02B 4Q2ZA 3SDDD 5FYLD 1NKRA 2ZG2A 4NM8L 3U1SL 5IK3B 5C9JA 3E6HA 5ICYA 1KPVB 3QDMB 5I9QC 5DLML 2AEIT 5F9WC 5GJTH 3G5VA 4ODVL 2OTUB 4JFEA 4QXTB 4ELKB 3OL2A 2F54E 3N1FC 3V0VA 4BK5A 4HT1H 3MLYH 1ZV5A 3BP5A 3RKPA 1JI1A 2KQNA 2YRZA 2YPKA 5JZ7C 5IFAH 5J56B 2F9BT 1KSRA 4QHMA 4NCC2 1R0AL 4FQQB 1ORQA 1RQ5A 3RTQB 4AIZB 4ODBD 1T1ZB 5DC9B 1S7XB 3G5XB 1JNNH 4PTUB 2GJ6A 1LD9A 2R8SH 4LBEA 4IRJD 4P59H 1YPZA 4DZBA 1UB5A 1MPAL 3VDAA 2D7OA 3A67L 3SY0A 3MA7A 5IUSA 3OJVC 4LAQL 1U8QA 2Q7YA 3LKPA 4QXWA 3QJFA 4HK3J 3MR9B 2AJSH 2PXYC 4WW1A 2IPUK 3C9NB 5CD3A 3V4PH 1CFSA 1J8KA 4L9LB 1BIIB 5L0QB 3NAAH 4JQIL 1OAQH 1ZGLB 5I15L 2BY3A 5D96B 3BKCL 3BP6A 3MFFB 4I8DA 1DFBL 3WEXB 3ZKMC 5DT1H 4DWHA 3PGDB 5C09E 4PBWD 5J57B 4QF1B 5EC2B 1M7XA 1NC2D 5L7XH 3QFJB 3IDJA 3OKEA 2FEEI 1RPQA 3IDYB 3FCTB 3WXWH 5DMKB 1X5YA 3D9AL 3PDOA 4G9DB 4MX7A 1BQLH 5GQBA 4NZUL 4XPGL 1QA9A 4K9EC 4OCNC 1RMFL 4Y4KB 1HQRA 2NY3D 4XMKH 5FO7B 3CH8A 5FHAH 3E3QC 4ISVA 5ITBH 3CJJA 4Z7UB 4APQB 5D1ZA 4Y5VA 3RZCC 5J11B 1CVSC 4YFDB 1F8TH 1MFCL 2NQCA 2WNGA 3BDYL 1A6UL 1AHWA 1XF3B 4AEEA 1CE1H 4QGTA 4JFFA 3KGRA 3T0EA 4IDLA 2IH1A 2D3VA 5TPWL 4OZHA 3ULVF 4J6RH 1UWEH 2YA1A 3DSNA 4LCWB 4RZCB 4GW4B 1KIPA 1RUKH 4A2LA 2APVA 4JM4L 4PB0H 4LLMB 4QEGA 2D0GA 2X7LA 4FNLL 4DEPB 1YMHB 3C5ZB 4ONFL 5BVJB 1EEZA 2O5ZL 3OWEA 3ORJA 1CFNB 4KTDH 3U7WL 43C9A 5GISH 4XBPB 2Z91A 5IMKA 5FGCB 2MJWA 1IEAA 4MMXC 2Y36H 3C2AL 1Q9WA 4NPYB 1VFUA 5FHBH 2WINB 4ENED 1BFVL 1MCKA 5D7LE 1BOYA 2VYRE 2A83B 3WNMA 1JYXA 2QJDA 1OP9A 3SEPA 4MJ5A 3QI9C 2VKXA 4ZNCD 4P5TD 3QO1A 4NQCB 1ZA6B 4QCIB 3S3PA 4DKDC 2CUHA 3H9SB 1E28B 2VDLL 4HGMA 4XPHL 3VXMD 5K9JL 35C8H 3VXSB 1MFDH 4UUJB 4PJ7B 4G8GD 4JRXB 4PJEB 1QBLH 1BWMA 2WQRA 1JNJA 4Y5YC 5IVOA 4Q58C 3BZFB 4LSSH 3PWUB 3UBXB 2FH6A 1BGXL 4ZFOL 1BQUA 2VR5A 3GFUA 5MI0C 1YMMD 1RIHH 1DUZA 3B83A 4W70A 1ZTXL 4OF5A 1T2QL 4KK6D 3BSZL 1IGYA 3RPKA 4N0CD 4LSUH 3HPJA 5GS0D 2ZJSL 2ARWA 1KT2A 5D2LA 1V3JA 3QHZH 1JV5B 1FQ9C 2XTJE 3X12A 4E5XA 5FKPB 1EGJH 1IRAY 2DIAA 2W59A 4IRZL 5FA4A 1U8JB 3RWDA 3CPLB 5E8DH 1IAMA 5ILTL 2KUTA 5F6HI 4MXQD 3QBTB 4I3RL 4ZTPH 4HS8H 5CEXA 3LIZH 5IB3B 1NH6A 5L2KD 3PWLB 2HRLA 4MLSA 2VKWA 1QSFB 2VIRA 2EDLA 5LGHH 1X44A 2B5IC 2XT1B 5I16A 5DWUH 4PJHE 5DD3L 4UILL 2VR4A 4CVZB 4MQ7A 4R7NB 2XWJA 1QLFB 1F4WL 5FM5O 2FD6H 5LGKA 1FRGL 4NM4H 1D5IL 1FSKC 4G7VL 5DFVC 4XB7A 3WNKA 1T7VA 3HC3L 3WD5L 1Q0XH 1QSED 2NZ9C 12E8H 5ETUB 2IGFL 1MAMH 4ZUSA 1A47A 1D6VL 3REVB 3WL9B 2LU3A 1OAKH 2OSLB 2X89D 4OLVH 2XG5A 1PBYA 3ZSSA 5BCAA 4KROD 1HHGB 4GSDH 4MJID 3VXPA 3WN5A 3DMMB 1QBML 1CYGA 2V2TA 2EDNA 1P2CB 3DGCR 5AZEL 1DVFB 4KRPD 1CT8A 4MD4A 1FFNB 5SX4H 3RIFK 4PJGA 2R4RH 3QEUA 4CNIA 3MA9L 3HS0B 4HPOL 3RVXC 3DWTA 4LCUB 5JPMB 5FOBA 2P5WE 2FEDC 3DV6B 4NRZA 3CLEH 3G08B 4U2ZA 4U7SA 4UT7H 1H0DA 1SYVA 4OFYA 1C5BL 1N6VA 4X7FC 1CXFA 3FB6A 4DGIH 1S9WB 1MFEL 3FN3A 4NJ9L 3V4UH 1RZ7H 1RULH 1U8HB 2ATPA 5T1KB 1J0YA 3AXLA 3MRQA 4PP1C 4ZXBA 5DUBB 1V3LA 3SE9H 1BAFH 1HQ4B 4PGCB 4L3ED 3KLHD 3VXOB 3GGWA 3WLWD 4LFHD 5TDNB 4NNYB 4MB4A 2AXGB 1M7IA 1M6OA 4RFNB 3S5LG 5A2KH 1IM9A 4QRQA 2XQBL 3V52L 1CBVH 2P48B 3C08L 4Z7WA 5M94B 1DE4A 3TCLB 2DQGH 1WFTA 3V0AC 4ZQKB 3NACH 2R4SH 3QAZC 4U0RC 4MQTB 3QDME 1MOEA 3QUMA 4L4VB 4BQCA 3LS4H 5EU3A 3FN9A 4U1HB 4XXCA 4N9OB 4NC2B 1OSZA 3QCTH 5A43C 3MRLB 3WDJA 2P1YA 1EBPA 3FFDA 4FRWA 3TBTA 4U6TA 3AM8C 3ARBC 4NRXB 5EU5B 2P49B 2F8OA 5DJ8A 5FYKU 2DAVA 4GXUM 4G6JH 3B9VA 2FX7L 3VXQA 4NZTL 5CZVH 2ERJB 3VE0B 1TZGL 4I0PC 1I9JL 3GO1H 3HNVL 2DQTL 4XC3L 3UTOA 1JHLL 4QHLA 2F19H 1UVQA 5HVHB 4Z5RA 1J1OH 1ZKAA 4DZ8A 1XMWA 1MCEA 3VFUB 4AENB 1ZHBA 2DLEA 4MD5B 5DRWA 5E2VH 4UTAL 3FQUB 3M17B 3H3PH 2A38A 3B9KA 1YEFL 1A3LL 3GHBH 4YHKL 4JFZL 4EI5A 4NT6B 5B38B 1JRHL 4DKEH 4LASH 2CRYA 4EJ1C 4X6EA 4PLJC 2YK1L 1K6QL 3DHJA 1CXEA 3HE7B 2NCMA 3TESA 1PDKA 3QFJE 5TQ2L 5F1IB 5HHNB 3BUYB 1E6JL 4HMDA 1WISA 2XWBB 5E9DB 5HGBB 3WXWL 5IT2H 2Z31B 3MZTA 5KSBA 5DD5H 2YZ8A 4QHKJ 3BRDA 4F7EB 2NW2B 1A1MA 1U8PB 2IBBA 3SDDB 4EDWL 4J4PC 4UOW0 1IAKB 4Z7UE 4JQXC 1FZKA 5F3HB 4HXBH 1UJ3C 4S10A 1F8TL 2W9DH 3EJZD 3JTTB 2G2RA 4HIIB 5FIEA 1K9TA 3KPTA 3SKUD 4DN3H 3SE8L 4CVWA 1ZT4B 4LPXA 3QEQA 1S7TB 5DVOA 3OGCA 4PB0L 1LEIA 2ENSA 1NGZA 4I0KA 3BT2L 2VDKH 3T2OA 1J87A 1XZ0A 3RNQB 3TT1L 3GB7B 1GAFH 4BFIB 2X70B 1X5AA 3L1OH 4JFPA 4KTDL 2OL3A 4OZFB 5EU6E 5FGCE 2IADB 1I7ZA 2J8HA 3MUGB 1PYWA 4IRJB 1NMCB 4HIEA 5SWZD 5HYSG 5D1QA 2Q76B 5EPMB 4LLYB 1JWMB 3KYOA 3TO2A 2W0FA 4QTHB 4NQCE 3LRSB 4WY7H 4G7YH 4P57B 1AO7A 4QRRB 5F7WC 1EA9C 3H9SE 3UTPE 1NCBL 4BH8B 1GZQB 3UPCA 2BOCA 5KOMC 3QCVH 4PJ7E 1MFDL 1VEMA 4JRXE 4PJEE 5C6WH 4X99A 3VI3F 4MYWB 4LSSL 4PRHA 1QFHA 2PXYD 2B2XH 1F00I 4XVSL 2NY1B 5EZIL 1NC2B 5F1KC 3FT4B 4XP9L 1TETL 4LSUL 1MHHA 1FFQA 5KANG 1TZIB 1I1YB 3ZKMD 2EKSB 4JO2H 1ZWIA 4D3CH 2M8XA 3S35L 4CN1A 4WEBH 5GS3A 4OZFH 1T03H 5IBTH 2NY3B 2DIJA 2Y5TA 2FYYB 4Y1AD 1P4IH 3MOAH 3BKJL 5JXAL 1WAAA 5I1CH 1N5YL 3SN6N 4JZNA 1QYGH 1TNMA 3PL6C 7FABL 3VJ6A 4KUCD 4OZGF 1NAMB 3CK0H 3QQ3B 5ESQB 3S34L 5E24E 1QSFE 1QD0A 2XG4A 4MXVF 1FO0A 5IEKA 1CFVH 5C0AA 1U6AL 3IXAB 3IXTB 3RVUC 2ZCLH 4Q9RH 2YWZA 3VRIB 1RURL 3BD3A 3SKNA 3DGGB 1YN6A 3IJYA 4RAVB 2VR9A 2YUZA 4ZDHA 5IHUL 4QXUH 3NA9H 1LWRA 4FXGB 1J18A 1JWUB 3KYKL 5H94A 2W07A 4IRSC 4XH2B 1P5UA 4G8IA 4BKLB 4KWUA 2H8PA 1FBIL 4TPRH 4ZUUA 3BO8A 1RZIB 1MCWM 3HUJB 4OLVL 2JJSA 3LQAC 2R0KL 1DQDL 1HSAB 4FQXA 3GHEH 3PV6A 4GSDL 4MNGE 5FGRA 8FABB 4M48L 3VXMB 5D6CB 2X05A 4G8GB 4HH8A 1NAMH 3QI9D 1EHNA 4O02L 4DVBA 4Z7OF 1ROWA 2ZPKH 1F02I 3NTCH 4C58B 3OPZL 3WIFB 1P4BH 4G80A 3H6JA 2ZKHH 4M7ZB 1VFBB 2DKSA 1S5HB 4D94A 3CFJB 3T65B 3FB5B 1N26A 4UIMA 3DIFB 1JHTA 1Q9OB 3BGFC 3KPQA 1T89C 4LHQB 3U30C 3JV0A 4YHML 5GJSH 1KPUB 5HI3C 4FQJH 1RIVH 1NDGB 1JHKL 4JGJA 5EOCH 3EHBD 2C4FU 1UZ8A 3I6KA 2O5YL 3IJSB 1BAFL 4J23A 5LWYH 4LCCA 4EN3B 5FKAA 5FGSA 4YXHL 5E1AB 5INCA 4KK5C 1WFNA 3R06B 2D4DA 4KKLC 1SY6A 3VWKB 1UM6L 4U1SB 1NBZA 1IC7L 5M95B 5L2KB 5T3XH 5D7JA 2VL5B 3QIBA 4JHZA 4LVHC 2G5RA 2HT3C 4R96A 1WFOA 3RI5K 3MLXH 2H26B 1XIWD 2PUQT 2W91A 4PJ5A 3TF7C 4YUEL 1BBDH 2H6PB 3JTSB 1FNHA 2IBZY 3IF1B 4YHIB 2Y06H 1IZJA 2HLAB 5D7IF 1FZMB 2GTZB 5HHQA 1L6ZA 5EH1A 3U0TA 5C08A 1T5WA 1NFDF 3SGKA 4PGDB 4GQ9H 1QSEB 5GS0H 4F9LC 4DCQB 1HIML 2X1OA 4KMQA 3H8NA 2IALB 4DTGL 4H5SA 5GGTH 4OM0H 2P8MB 1QRND 2HT2C 3DRTA 5DA4A 4WEMB 3LY6A 3GO1L 2NZ9D 3KPSA 2NW3A 4YBQC 1PKQA 4YHZH 3UTSD 5JO5A 4PJXB 4KRPB 4TUOA 3V6OC 1WBZB 1FLRL 1J1OL 1JK8A 2WWKO 4JO1H 1HKLH 4MXWH 1S7WB 2A6KB 1LE9B 5EBLB 4XPAL 4MJ6A 1ZLUK 1J0HA 3DBXA 1UKQA 3GEWB 3H3PL 4PTTA 3FQRA 2XZQH 3MJ9L 5EA0H 1CTOA 2YXMA 3ZT5A 5DUPH 1YA5A 3QULB 5DJ0B 4L3CB 3RVXD 1UFUA 3KS0H 3QNZA 4HKBB 3BMWA 2IBZX 3EYOA 2H9GA 3MV11 3SKOB 3MXWL 2FEDD 2IQAA 2A9MH 3BIAX 2BOBA 2HWZH 1OB1A 3P9WB 3PIQA 2RAMA 5GRUL 3O3DA 3WV0A 4L8CB 4L3EB 2AEPH 4Y2OA 5E9DE 5TFSL 4GUPB 3MBXH 2F54A 4PP1D 3MNWA 1FCCA 4NWUL 4O2CA 2CDFA 1DQQA 4F7TA 5DD5L 3I3DA 1RU9H 2GK0B 4KGJA 1PD6A 4WIQA 5I76A 5GGUB 4P9HC 1AJ7L 4OGYH 2P47B 3P4NA 4JFQA 1QLRA 4MNQD 5FYJL 3KNBB 3MJ8B 4KKBD 4XP5L 1CF8H 2D31A 5ALBH 4OQTL 1GOHA 4ELMF 5DMYA 1DSFL 1WTGT 2VSCA 3EYQC 4PRBA 2MKWA 1FL3A 4R0LB 5A2LH 3ZTNL 5DJXA 4X7TB 2J8OA 1MRCL 4RMUA 4UTBH 3T2NH 3PDGA 1NGYA 2WBJC 5F7LB 1FNLA 5GGRY 3ARBD 6FABH 2CLZB 3T0AA 2IH3A 2B4CC 1SJVA 5HBBA 1K2DA 4P23C 4RRPA 1JGDA 1T0NA 4U2YA 5HDOA 2QADB 3M45A 3NIGE 4MDIA 5DC4B 3RGVC 3FTGA 5C09A 4JEGB 3VD5A 1UGNA 3GJEA 3IDMA 2JJWA 3INUL 4K3GA 1INEH 3GSXB 5EUOF 3ARQA 2XOTA 1SMOA 4QRRE 5TE6L 3KWWB 4LGPB 5IOPA 1KB5A 5IGXL 1OWWA 5FYLL 1UQSB 3EDJA 3MUJA 1KN2H 5CBAB 3OKMB 1N8ZB 4JM2C 1MCJA 4RGOL 4OGAC 1PEWA 1CFQB 4NO0A 4OCWH 5EZLB 4BZ2L 1QKZH 4MSWA 1DBJL 4UIKL 2ARJA 3ZE1F 2VC2L 2XICA 1AGEA 1ZVYA 4PLJD 4WTZA 4JANA 3TPKA 3JVGA 3DNKA 4UT9L 1BVKA 4MCYA 4OGXH 4PJ8A 4X6CB 1RFDL 1T03L 4M43H 4UV4H 3RWEA 3IU4L 1T0MA 3RVTC 3ULUE 1FV1B 3ARRA 4WV1B 5ENWA 4CDGC 1B0RB 1N3NA 1QYGL 1RUQL 3PHQA 3O45A 3NFNA 4AIXA 4F2MA 3KPLB 4ZYKB 2RQ8A 3IGAA 1S7VA 4L9DA 2X4TA 1IZKA 4GKZB 2VDQL 4J4PD 4U1NB 5D7LA 5ICZB 1CFVL 3SDCD 2NY2C 4ZO8A 2FRGP 3VA6A 3LEVL 5F9WB 2DBLL 2BP3A 2ZCKH 2WLZA 4HG4J 4OCSL 5ADOL 1N64H 4YZFF 1AGBA 4ZUWA 5IHZA 1OGTA 2NY5H 2MQ0A 4FMKA 3MOBH 2CLVB 2GI7A 4XPFL 4ORGA 1EMTL 3H3KA 3GBLA 2VXSH 4Z78B 3NN8A 1DBBH 5SWZB 4MDJB 1ZT7A 4XBGB 5T1MB 2ZWLT 2MWCA 3HUJE 2FO1A 5JIKA 3WUWB 3S35X 4NUJB 3L6FB 5T3XE 2M1KA 4Z18A 3ZL4H 2VITB 3HE6C 3O9WC 3UZVB 4CKVX 3VXME 4OF0A 3EDFA 3O8XA 1GXEA 3QIWA 3THMH 4XNMA 4POZC 1RJLA 4X5WB 1CQKA 3RY4A 1JYNA 1SBSH 4G6KH 3T09A 2ICEA 3HZMB 3IKKA 2ZKHL 4U6XA 5E2TL 3UJIH 4QYOA 3NCJH 4LEOB 5DSCB 5I18H 3B6SA 4HFWA 2P8PB 1IQDB 5JXEA 1WFUA 2XY1A 2C1PA 2W60B 4PJHA 2WIIB 5EOCL 3VRJB 2VSDA 3T4YB 5JHDE 1T4KA 4HLJA 5J1SC 1H8NA 2DQDL 2BCKA 2VZ3A 3RAJL 3FB7A 3MO1A 1CGYA 2X4OA 5H35B 5IQ7H 3MCG1 1LHZA 2APTA 5L2KE 4QRTB 3DRQB 5KAQG 5FM8A 2EXWC 2B20A 2FECL 3QR2A 4U0QB 5D72H 3PWPD 3MLWH 1F3RB 4P2QD 4QXGH 2R15A 3EUUA 3GK8L 3RWFA 1E4WH 4YXLH 4U3HA 1B3JA 4YDIH 1C8PA 1U3HB 2BVOB 4XCNA 5AYUL 2W65B 4U1IB 1D5MA 2XPGB 4TN9A 1HNFA 2JK5B 1YNTA 1ZXQA 1R6VA 1QSEE 2V7NB 1OP3K 2R23B 2QKIB 5GS0L 4HS3B 2P5WA 4GRMA 5HGAA 4JR9H 5EUKA 1JGUL 1DTUA 4GAJH 2I5YL 4XNUL 1YEEH 4DGVL 2XQYG 2AI0H 2HJLB 4HQQH 4N68A 4IRSD 4RQQB 4Y0GA 1GIGH 2AJXL 1DANU 4R3SB 1K8IA 4X0KB 4N0UB 2CO7B 3AB0B 2VXTL 1ND0B 3GI9L 5F6HJ 3ZDXE 5B3NA 1HKLL 5GRWA 2ADJB 2NXZD 1AFVL 4P46B 4MCZB 2GW5A 2DQCL 5AD0A 4JHBA 1PJ9A 3TO4C 1F45A 3P2TA 5K9KA 2V9TA 2XKNA 1TCRA 4Q6IA 1HOCA 4YHPB 5T5NG 3NCBB 4IJ3C 4RMTA 5DUPL 1A9EB 3ET9F 2ITCA 3IDGB 1FG9C 5IVZA 3I02A 4QRSB 5MI0B 1DZBA 4BSJA 1NMBH 1KPVA 1UG9A 2F5AL 3QDMA 1EAPB 3BJ91 4L3EE 4F9PC 2ICWI 2OTUA 5D8JL 4QXTA 4YE4H 4OCYH 1FL5B 1PAMA 4ELKA 1U92B 1NCWH 4YNYB 3SHSA 4HCRH 3V9FA 3BAEL 1TPXB 4YO0B 3GJFB 5LXGH 1RZFL 2MMXA 4Z77B 1CK0H 2DI7A 3EO1B 4MWFB 5HDLA 4Z76A 4FQQA 4KK5D 5ID1B 4OKDA 2XACC 4KKLD 4CU6A 3RTQA 4AIZA 1XGUB 2GTWB 1T1ZA 1XIWB 3O6FC 4KQ4H 5CINH 3S36H 3B43A 3G5XA 4L8DB 3SCMC 4PTUA 1KG0A 5KSVB 3JWNC 4MQSB 5ALBL 4FP8L 1MH5A 1ZLSH 1GRWA 2HT3D 4RSVA 1MVFA 1I7RA 1NEZG 1INDL 1Y0LB 3CVHL 2DQIH 2WV3A 3DUSB 3V6FA 1OD9A 1QNZH 3MR9A 5K9QG 3LH2L 3F58H 1JTOA 3C9NA 1MEXH 1FDLL 3DVFA 1QRNB 5F7KC 1VGEH 4L9LA 2P8LB 4O00A 1BIIA 4WI3A 1EV2E 2KH2B 1ZGLA 4DKFL 1GZPB 3UTSB 3WEXA 5TE4H 4LARH 4HWEL 3D87B 3S88H 2ZUYA 4M3JA 2HT2D 5F96H 5EC2A 4FQCL 3GJFH 5FECB 1I3RB 1ETZB 4YFEA 3FCTA 3K2UH 4YBQD 5DMKA 3CVIH 3B2VH 5B22A 2CJUL 3JV6B 3ZZ1A 3GSUB 3BH9B 2PTTA 5FO7A 1BMGA 4NQXB 2CKBB 3N1QC 4Z7UA 5IBUB 1QFOA 1DEEB 4I3SH 5I1HH 1QKZL 1FFPB 3SDAB 5CGTA 2C3XA 4MA3B 4PJ7F 3JUYA 4RA3A 1MIMH 4ZTOH 3OKOB 5DS8B 4RZCA 5IM7B 4X6CE 5HYQA 5FO8B 2ORBL 4LLMA 1RY7B 1E6OH 2EYRB 3FRPA 2HA1A 3IS1X 1HHKB 1YMHA 4KVCH 3C5ZA 4KC3B 4BZYA 4M6OH 2MFNA 5BVJA 3I6GB 1EGJA 4MNQB 4XBPA 3WNOA 5EU6A 1P7QD 3MRMA 5DJYB 1S5IL 1JZ3A 1WICA 5JA9A 4NPYA 5E8OB 1ODAA 2WINA 4P5KB 1MCRA 5CBEB 2AGJH 1RJCA 5IKCB 2X1WL 2X4UB 5CIPB 1BF8A 2PYED 4LEXH 4NQCA 1ZA6A 4QCIA 1N7ML 1IAIH 3H9SA 2CKBH 1E28A 2D9CA 2K1MA 3PP4H 4PJ9D 3EYQD 1HILB 4UUJA 1W72A 1NQBA 4JRXA 4PJ7A 3MV9D 4PJEA 3RHWF 2DS4A 2J12B 3BZFA 3I6LD 1KENL 3PWUA 3UBXA 4I9WD 1F3JB 2BXYA 3QUZC 3TPUB 1G7HB 5SWZE 1FFOB 5JW5A 1I8MB 2Y7QB 4Y19B 3AAZB 2VDOH 3BP7B 1JYWA 4M5ZH 1FIGH 2Z92A 1HHJA 2CMRH 4P23D 1BF2A 1TTGA 1H5BB 2BRRH 2Y07L 4WVRA 3ZHDA 3ZL4L 4HXAH 1JV5A 4F58H 4YXKH 5CEYB 5FKPA 1BQSA 1U8JA 1ED3B 3CPLA 2QQNH 2NZIA 1H3XA 1IGIL 3ZTJH 5JW4N 3PP3H 4G6KL 2XA8L 1T22A 5CIPH 4ZUTB 1KCLA 5JW3L 1QSFA 4JM2D 4JE4B 1FZOB 4LOUC 4OGAD 1RUPL 2W1NA 3TT3L 1S8DB 5LG1A 3VRLE 4OLYH 1DQMH 1TVHB 4M6ML 4UB0H 4R7NA 5MP6H 4Y16B 4HD9A 1QLFA 4ETQA 5KVFH 2GSIB 4FQLH 1VENA 3MRBB 4HWBH 1EPFA 3UDWC 3L3DB 5BZWA 3GMRB 1HH9B 5ETUA 1CLOH 3MRIB 2D0HA 2A9NL 4MAYB 5SX5H 3DXAD 3REVA 3WL9A 4OUOA 5FCUH 2OSLA 1CDGA 1UCTA 3SDCB 2BSSB 3HNSH 1XGTB 4KZEL 1Y6NR 3GNMH 4OZ4B 4P3WA 5GS1A 5DQDH 3DO7B 1KEGL 4OBSA 1HHGA 4YXLL 3DMMA 3ME0A 4MNGA 1CD8A 1ZLWK 1W0YT 1BJMA 1DVFA 5C70A 3QXTA 5I6XC 3QG6B 5C0CD 1JE6A 4ZO7A 3PHSA 4KTYA 2PO6C 5CEZH 4DK3A 4LCUA 5JPMA 3DYOA 5B3JE 3DV6A 2A74B 2EDKA 1YEHH 3G08A 3Q2CA 3SPVB 1JPFB 1NAKH 1YEEL 3O2WL 1IKNA 5C2BL 3MBEC 1S9WA 3GRWH 1G6RB 3DX7A 4LU5L 3RX7A 1U8HA 2Q20A 2WP3T 2E9BA 5DTFA 5BJTB 1U3JA 3VGDA 5DUBA 2ADGA 4HBCH 3QQ9C 2ATKB 1HQ4A 2VDNL 2VLKD 4PGCA 4AL8H 5KVMC 4K9EL 1CGWA 3VW3L 3VXOA 3OAZH 1L4IA 3HE6D 3O9WD 4HDIB 4LLVB 3QT2A 1QPXA 2YD5A 4NSKB 2DBJA 5TDNA 4NNYA 1IL1A 4S1SL 4WU5B 2AXGA 3L3GB 1L7IH 2IG2L 2BX5A 2Z9TA 4F15B 1Q0YH 1ZEAL 4POZD 1GPOH 1PQZB 2E9JA 2VLJD 2OJEB 1A22B 3TCLA 4ZQKA 1EX0A 4H8WC 3FHQA 5I75C 2R1XB 2XRAH 1T5XB 2AJVH 5BOZG 5D1XB 4U1HA 1KGCD 2IEPA 1G9MH 5DJZB 3K46A 2R9HC 3MRLA 3HI6H 5SWSB 5HHVL 2AKRA 2ZCHH 1YC8A 4NRXA 3IFLH 5EU5A 2YMXH 1A6WL 4FFZH 1G6RH 3K4ZA 5D70H 4WTWA 5DK0A 3PWPB 5HDBE 4S1QL 3VE0A 3LPGA 3BRFA 3BVNB 4P2QB 2Y9RT 1J5OH 1G7PA 4YPJA 1JPST 5EWIH 1FGNL 4NKMB 4OZIF 4UU9A 4NNPL 2EXWD 4P48A 3L3KB 4X9IA 3QUYB 4PLOB 1IKFL 1O7VA 4QO1A 3VFPB 2AABL 3CFCH 3PV7A 2F8XC 4AENA 3S37L 4MD5A 3HI1B 4GKSB 5BRZD 2GIYA 3OG4B 5CFHA 3FQUA 3M17A 1OQXA 2NPLX 3P30L 1BJ1J 3VU2A 4NT6A 2CR6A 3VFRB 5B38A 1QRNE 4R2GC 3EGSB 4RMQA 4Q6YA 5JIIA 4QGYA 2L4OA 3UTSE 3LV3B 2PF6A 4X8JB 4X5XA 3Q48A 1U91B 2NNAA 1G9EA 4NJAH 3HE7A 4PY8I 5EULV 4UV7L 4OAWB 1QFPA 3O6KL 3OZ9L 2NXZB 1QBBA 5HHXH 5F1IA 3BUYA 2XWBA 5E9DA 5HGBA 2Z31A 3QDJD 3MCKB 1O0VA 5A40E 3E8UH 4F7EA 2NW2A 4QWWC 3KJ6L 4E0RA 3FFCA 4XTRC 1U8PA 3SDDA 1IAKA 2I07B 5F3HA 3HG1D 5L6YH 5A3IC 4I3SL 3W0WD 4K2UL 3UO1H 3QZWB 3RWGB 3S96A 3JTTA 5HGHA 4PRPB 2BMKB 4HIIA 4LHUG 3BJLA 1K3ZA 4JG1L 4JPWH 3MLSH 4LIQL 4AJ0A 1HYSC 1ZT4A 5JR1L 4QOKD 1S7TA 2DD8H 2HFGL 2HFTA 3VMNA 1SJEB 2OXHA 3V5DA 3VH8G 2DN7A 3OKYA 3RNQA 4HJGB 3LQAH 3GB7A 1D7FA 4PBVC 4RGNC 4JHWH 4BFIA 2X70A 4OZFA 2OXGA 1D9KC 3VCLB 4DUXA 3MUGA 4IRJA 4LVHB 2EE2A 3LN9A 4ODWB 5H37G 4KJQC 1X6LA 2Q76A 5EPMA 3OHXB 4LLYA 1BQHB 2CIKB 2BNRD 2YOCA 3O6FD 3ULUF 1GVIA 3RBSA 2VXVL 4QTHA 3S6CA 3LRSA 3D69B 4P57A 1P1ZA 4QRRA 1F5WA 3VFSB 4URTB 1E4KA 3NA4A 3RUGF 3WJJA 2CKBL 4BH8A 5JQ6L 1GZQA 1T1XB 3PP4L 4FFWC 4OCLC 2ZUSA 2D7PA 1R3LB 4D0CB 3LS5L 3TWCL 1Z5LB 3DHMA 4KZDH 4I18C 4GRWB 5CUSL 4F57H 4NQVB 3OJMB 4Y19E 5E6IA 3FRUB 3V4VH 3UJJH 1T1YA 3FT4A 1KCVL 4X7SH 5F8QC 3TYFB 3O6ML 3MGTB 4KHXL 1TZIA 1MCLA 2CMRL 3GIZH 5KAQF 1I1YA 5GRZA 2EKSA 2X1QA 4I4WB 4OLXH 4HAFA 1BFOA 3X3GL 4WI5A 5L88L 4YXKL 4ALAH 4LSPL 2FDBP 2FYYA 1FNEB 3BKYL 4M1GH 4MA1C 4LQFL 2N1KA 1ORSB 3MCLH 4P9MH 4MB3A 2Y23A 5DZOA 5CEZE 1G0XA 1KCSL 1NAMA 3QQ3A 5ESQA 4LLQB 3AVEA 4GRLD 1HE7A 3IXTA 4ZOBA 3FO9B 2X44D 3KLSA 1GH7A 3VRIA 3QPQC 3LAFA 4RAVA 4LPYA 1I9EA 3SQOL 4Q97A 5MP6L 1CVRA 1OWRM 5BS0B 5EOTB 1W8OA 4OQ1A 3RL2B 5KVFL 5KN5B 3K0WA 4FXGA 1LP9B 5F9OH 2H2SC 4H20L 3ARPA 3OMZA 1G7LB 4P2CG 5FA3B 1JWUA 2AW2A 2Z0BA 4G5ZH 4KK9C 3H3BC 3IAGC 4HPYH 4XH2A 1P7QB 1DBAH 4BKLA 3FQWB 4M9PA 1RZIA 1URLA 3TBSB 4HEPG 3TEUA 3HUJA 1EFXA 2B0SL 4B41A 3HNSL 2PYEB 2UUDH 4OTXL 1JFQL 2BVYA 5JDJA 1ZT1B 5JPNA 4MVBD 4KPHL 3F5WB 8FABA 3VXMA 5MHSD 5TQ0L 3W82A 5D6CA 4PJ9B 1C16A 4XZUB 4UT6L 3SGDH 1JN6B 2O93L 1R3JB 5CMAB 4PB9H 1WTLA 3WIFA 5C3LD 2EDWA 3CH1A 1Y18B 1CICB 5FUCC 3PDDA 1VFBA 3VFNB 4GBXA 1S5HA 5IMMB 3CFJA 2KPNA 2H2PC 3FB5A 1NAKL 4JPKL 4XVJL 4HMEA 1Q9OA 3BPLC 4P23B 2AJZA 5CLTA 4I2XB 1C5CH 4LRNL 1KPUA 5HY9B 1NDGA 5GGTA 1B0GB 4OFIA 3I75B 2DLHA 2OZ4L 3QXWA 5F1SA 4ZFGL 1L0QA 3IJSA 5EBGA 2ZNXA 5JHDA 5MEQB 4EN3A 5DYOB 4O5LL 5LQBH 5E1AA 3EJYD 1TLKA 3R06A 5T5FL 3VWKA 3VD3A 1TQBB 5I1LB 5KW9H 3ARGB 1NUGA 4LLAA 5L2KA 5FB8B 4AT6B 2BSED 4XMLL 3RX5A 2C4XA 2VL5A 5F70A 2VDPH 3D85A 1GC1H 5E00B 1GPOL 1UWGH 3CMOL 1NUDA 3HLAA 3L3IB 3HZYB 5D9SB 2H26A 2EICA 2H6PA 3GMQB 2XRAL 3JTSA 1P7HL 4U3XA 1HDMB 3IF1A 4YHIA 1I85A 1YY8B 4O58H 4U6VL 5ACMA 2HLAA 1MJUL 3HC4H 1FPTL 1FZMA 4S0SD 3W9EB 4P3DB 1HXYB 4PJIB 5SWSE 2GTZA 1QHOA 4NN5B 5C0IB 4BQ9A 2NY6D 4PGDA 5ERWB 1TJIH 1FE8L 1QSEA 2B4CH 1ZGLP 2YMXL 1KN4L 8CGTA 2GITB 4K55A 3C8DA 2IALA 3DXAB 3PWPE 2P8MA 2X89A 4P2QE 5IIEB 4DN4H 3VFVB 1UM4H 3MLVH 5J12C 3SDYH 3E6FA 3F62A 3OAUH 1J05B 1WBZA 2H3NB 3ZE2E 4LLDB 2AK4D 2ICES 1S7WA 2A6KA 4WWKC 5C0CB 1LE9A 2VNCA 2JB5H 1FAIH 2WBWB 3MXVH 5EBLA 3EYFB 4XC1H 3BISA 2RFXB 3ABZA 1NL0H 5CJXC 3AMLA 4WO4D 4JO3H 3EAKA 1UZ6F 4KI1A 5CILL 4MGXA 2PO6D 3ZT6A 2FECI 3QULA 5DJ0A 4L3CA 1FH5H 4HKBA 5BO1H 1YYMH 2D03H 3SKOA 3DUUB 2V7HB 2Q3ZA 4YHLH 3O3UN 2BNQD 1UM5H 2OK0H 4DQOL 2BERA 4X9FA 5BMFH 1IGMH 1IGTB 3V0WH 1JBJA 2D7TH 4Y5XA 4NJAL 4JRYE 2VLKB 5E7BA 4L3EA 3JSSA 3QWRD 4JDZB 4HW6A 1I3UA 3MV8B 4MJ4A 3C6SB 2FHFA 4GUPA 3AC0A 3DETD 2R2BB 1UENA 1AP2B 3STLB 5TE7H 5I1GL 3QQ9D 2IAMA 1PZ5B 1INQB 2MNUA 2Z93B 1VEPA 2GK0A 3ZO0A 2GFBB 1I3GL 2VLJB 4LHUD 2EH7L 5GGUA 3S4SG 4L4TD 4MHHG 2VWEC 4ZFZA 3ZE0F 3FN0L 1WLHA 5IMOB 5EBWB 5CZXC 2HRPL 4ACPA 4NBZB 4PJBB 2VZUA 4PY7B 2AJ3B 3KNBA 4JFXA 4KDWA 3MJ8A 2DMBA 4LCYB 4PRPE 1YJDC 2G60H 4L3AA 1GGTA 4C4KO 2GHWB 1J0IA 4AQOA 3Q6FB 3OAYH 3MROB 4NN7B 4JN2B 4DUWA 2YPVL 3L7EA 4KDTA 4X7TA 1EUTA 1F11B 3OB0H 1GGBL 2XFXB 1BD2D 2CLZA 1IGFL 4F8TA 3LQAL 1HKFA 5A2JH 4JHWL 3K8MA 2GJZB 3WIHH 3IDIA 4P2OC 2R0ZL 1E4JA 1I75A 2E7MA 1AI1L 1G9NC 3BKMH 2GAZA 5DMGD 4AIOA 5BRZB 3TM6A 3GSXA 3DOSA 4DUVA 3KWWA 3KPMA 4GG6B 2P24B 4N8VG 1JF5A 2VO5A 3BQUD 2YSSB 3MV7D 2BDNH 1CFQA 1P7KB 3PJSB 1J8HD 4J3WA 1Q72L 4OLZH 5B39B 3UJJL 2HFFB 2XIDA 3LMJH 1U2HA 1V7MH 3LKQB 3HZKB 4HBQA 4V2CB 1WT5C 4OJFL 2AJYL 3EFDH 4NQED 5F9JB 3QDJB 4TTDC 4Z7VF 25C8L 4JY4B 5AG8A 4X6CA 5D5MF 1MCNA 4ALAL 1WZMA 3EO9H 1A7OH 1BM3H 4M1GL 4WV1A 2C3GA 1B0RA 3BMVA 4B7IA 3JWOC 4HK3N 4IJ3B 3KPLA 4QWWD 1J9CT 3UPRB 4YC2B 4NN6C 3VFGH 5ICZA 4U1NA 3VGHA 4FZEH 3UC0H 5B8CC 3BEWB 4GG8B 4R26H 1GGUA 1ACZA 3LZFL 2J4WL 4QKXB 3U7AA 5A3ID 3VGBA 5IB4B 4QOKB 2C26A 5HD8C 2BVQB 5BS0E 1LP9E 3BDXA 1YYLH 4P4RB 5L9DH 4XI5C 1HYSD 2CLVA 2WUCL 4Z78A 1HHHB 1CDUA 3U83A 3QQ4B 2UY7A 3X3FL 3RJDA 5SWZA 4MDJA 2NLJB 4I5BB 5T1MA 4P2RE 3WUWA 4RGND 4NUJA 3L6FA 4M3KB 5F8RC 1D9KD 1KEMH 1U0QA 4QLRA 1QFWL 4UOJA 4KJQD 1HCVA 1T6WA 3G5YA 1ZANL 4X5WA 3I6LE 3WE6A 5C0FA 4I9WE 4FN0A 3ARZA 4ZS6C 3HZMA 1KJ2B 4HWZB 2EO1A 4TUJB 4FFWD 1A6VL 3I9GL 5DSCA 3RY5A 4LEOA 2GYSA 4YFLF 4KQ3H 3CIQA 4PJCB 1IQDA 1KJMA 3BH8B 4I2XE 4IMLB 2QR0A 5HYJD 1RZKH 1YNLL 4CJ1A 2W60A 3FOMB 1S3KH 2WIIA 3JUZA 3VRJA 1OCWH 4YX2L 3KDMB 2DMKA 4RMVA 2FCBA 4HHAB 1IC1A 1W2KT 5HXMA 4GMTH 4JAMB 1CLZH 3IFNL 4P9HL 5H35A 3L3JB 2IPTH 4MAUL 4ODXA 3WDIA 4QRTA 1EO7A 3DRQA 3E2HB 1JCKA 1AR2A 5DGQA 2VDPL 4GRLB 4BFGA 1KELH 3QNYB 5TJWK 1U3ZA 3SO3B 4M02A 1L9NA 2ZZUT 1YEKH 4Z7QE 3D3VE 1Z9OA 2R2HB 1U3HA 2BVOA 43CAB 2VLME 2W65A 1CLYH 1MCPH 1A6TB 5FUOH 4GW5B 3GI8H 1KJ2H 1A0QL 4PJIE 3NABH 3QPQD 4U1LB 3NMEA 5MEOA 5E6YA 2E7HA 2V7NA 1R3IL 1T66D 2R23A 1U9KA 2QKIA 2B4CL 5I8EA 5C7XH 4HS3A 4P3CH 1F2QA 2HJFA 3DXAE 3B9EA 2H2SD 4Z8FH 4HCRA 2HJLA 2IFFH 3I84A 3DTXB 4RWYL 4XNZC 4RQQA 5D7KD 4NQDD 4J8RB 2BC4A 5IWLC 2FH8A 2CPCA 1ND0A 2ESVD 2KDGA 5DJDB 5C0CE 3O4OC 1IEHA 2X4RB 3S8WA 3WFCH 1IARB 4P46A 4XC1L 4MCZA 1QFUL 1JPGA 4OCXL 3G9VA 3TV3L 1NL0L 3TGXA 5JW4M 4ZUVB 2VE6B 4R8WL 4YHPA 4S0TD 4I48B 1TIUA 1CL7L 4R97C 1QTYT 3IDGA 1J12A 5IG7B 4QRSA 2JELH 1ACYL 2OK0L 1C7SA 1MJJB 2DQEL 2GQHA 5GZND 4O4YH 1AXTH 2H2PD 1EAPA 4LVOB 2VLKE 1FGVL 1NMAL 2VLLB 1FIEA 3MV8E 4LSVH 5I1AB 3GIVB 2DTMH 1U92A 4TNWF 3WSQH 4YNYA 4FZ8L 3NCCB 4YO0A 3GJFA 5F21B 4RFEB 5J6GB 4MWFA 2VLJE 5FDWB 4G9FB 2GKIA 5AG9A 2CRMA 3CFBA 1XGUA 2GTWA 3LKRB 4EOWL 1XIWA 1HN1A 2DICA 3NIDE 2BY0A 2CRIA 3NFPA 5EIVA 4L8DA 2OQJB 4PJBE 4M1DL 2CH8A 1EEYB 4U1GB 1KGCE 5F97E 5KSVA 2X5PA 4HIJA 4JPIB 2XZAL 2DYPD 2NY6B 3BGMB 5IB2B 1NC4B 1Y0LA 5GS2H 2BJMH 3D39B 3DUSA 3T1WA 4RIRB 4W4NA 5DD1L 2QQKH 2FZ3B 1QRNA 1QO3B 2P8LA 2YBRB 3QHTC 1UCBL 1GZPA 2FEEL 3UTSA 1IGCH 2NY0B 1K3IA 5KJRH 2D7MA 5FYKE 1MJ7H 2AK4B 3HMXL 4UINL 4BSWA 1JZ5A 1IT9H 3RVVC 5FECA 1I3RA 1ETZA 4TUKH 4PIRF 4BZ1L 5EO1B 1K4CA 1I7TB 3JV6A 4WO4B 5I6XB 1H3PH 3VG0H 1NLBH 5F7NC 3NPSC 3TYGH 4WWKD 4GG6E 2PO6B 5GSRB 1OY3B 3BH9A 1KCRL 5D1ZC 4Y5VC 2BNQB 3OKKB 2CKBA 1QBAA 5I1IH 1AHWC 4KHTL 1FFPA 2RJMA 4OLZL 3SDAA 3FO1B 5INDB 1QVOA 1JF1B 3WMSA 3QDJE 2X4PB 5DS8A 1OAYL 5ANMB 1DLFL 5DHVB 5IM7A 5CCKH 1CDIA 1MHEB 5FO8A 3FQXB 4WHYG 2EYRA 1LO3H 1HHKA 4GMSL 2W38A 1JGEB 4KRMB 3I6GA 1ONQB 4XHJD 2D9QB 5DJYA 5E8OA 3BWUC 4M62L 5CBEA 4DAGL 1RD6A 5J13C 2ZG1A 1UB6A 3QEGH 2W9EL 2YD1A 3HCVB 1ZE3C 5CZXD 5IKCA 3JWDH 2X4UA 5CIPA 3OF6D 4XNXH 1QFWM 3RRQA 2FLBT 5DD6B 2CR3A 3M07A 1B2WL 3RZWA 4TYUA 2HKHH 3VXUB 1BFTA 5D4QA 1JPSH 2EDEA 1HILA 3ULVC 1I4FB 3BEVB 1KIQB 2JJTA 2UZXB 3U46B 1F3JA 4TRPH 3G5ZB 3QNXB 3Q1SH 4OFPA 4HWBA 4RCAA 2Y7QA 5DHVH 4Y19A 2QQLH 3AAZA 2JJUA 3U4BL 3ZDZF 3BP7A 5IFHL 5TDPB 1OM3H 2NX5E 4LKXB 4Z7NE 3RDTB 4ODUA 2RCSH 5GIRB 4P2OD 5J0BA 1H5BA 1IVLA 2E6QA 3OV6A 5CEYA 4U7KA 5TF1H 4OUUB 1Z3GL 1ED3A 1NBYA 1LILA 3BQUB 3MV7B 1AKJD 1NFIB 3QWOB 1J8HB 2A77H 2X9WA 2J7LA 2JF1A 4PLKC 4JHAL 3LHPH 5E2UH 3TBWB 1LO2H 1FZOA 1H3VA 4O9HL 4KKCC 5C0RL 1RZJH 4NUGL 4NQEB 1S8DA 4NKIH 4EXPX 1KC5H 1TVHA 3P4MB 1RUAH 1S3KL 4Y16A 1OCWL 4JKLA 4XCEA 1CZ8H 3GRWA 2GSIA 4NOBA 4RGMC 4LMQE 2RGSA 3RVWC 2AV1A 4LLWB 3LKNB 3MRBA 1C12B 1IAOB 1N0XH 4Z95L 4TTDD 3D0LB 3L3DA 3RHWK 2F5BL 3WO3B 3GMRA 1HH9A 4F37K 3HRZB 3MRIA 4MAYA 4NNXB 1X5IA 4M93B 4ZAKD 1VACB 2DM4A 1LK3H 4Q9QH 3SDCA 4JQXA 2BSSA 1KJ3L 1XGTA 4PJDB 5JLZB 3WN5C 1NCDH 1D3CA 4OZ4A 1KNOB 4JREC 4PRAB 3DO7A 1OTUC 4HKXB 1E27B 3MNVB 1MHCB 3KLAB 3BPNB 1WZLA 3RPIB 1J86A 3QG6A 5I71B 5FUOL 1SBBA 3QDAA 3KPRD 1DDHB 5GGVL 5CJQH 3ZKQD 2OTWA 1EEUA 5C0DB 4CADB 3BZEB 3D18A 3KR3L 5HD8D 1JPFA 4XI5D 1NFKA 4RGNB 2A0LC 1D9KB 1G6RA 3B8SA 2X10A 1AY1H 2MPAH 1UACH 3N06B 1I3VA 4ZXBC 2I9LB 5BJTA 1DQJB 2OYPA 1EIBA 2ATKA 3O4LD 4KVNL 4GKOA 5JOEA 3QCUH 4G6MH 2PR4H 4HDIA 5BV7B 4NSKA 4MA8L 3WFBL 4WU5A 4WFFE 5CD5D 3A6CL 4KAQH 1F6AB 5EZOH 5F89B 3CLFH 1PQZA 2OJEA 3ZYIA 2V5RA 5HYJB 4ZS6D 3O2DL 4X5LA 3ZT7A 2R1XA 3O3AB 1T5XA 4Q0XH 5KANI 5D1XA 3PHOA 2SEBB 4G3YH 2YWYA 4NQSB 5DJZA 3NVQA 2VQ1B 4CGTA 5SWSA 1NCCH 1S7RB 4K7PL 3WSQL 5JNYB 5E8EA 3BOVA 3PGCA 1UXSB 1WWCA 4HC1L 2BY2A 5DMIH 3NCEB 1I8LA 5JOFB 3EOAB 3PWPA 3ARYA 3BVNA 4G9FE 4P2QA 4K71C 1OOAA 5IEHB 4H0IA 4GQPH 4NKMA 2UVEA 1R24A 3L3KA 3NZHL 4NZRH 3QUYA 3KYNB 3AREC 2OR9H 5BV7H 4WGWB 2BRQA 1JWSB 1H3TA 3VFPA 1MQKH 4IOIB 5DFWH 3GBML 4FQ1H 4JLRB 1Q9LB 4TVPL 4XWGH 3TZVB 3HI1A 3B9KC 1HH6B 3D39E 1L7TL 1FAKT 4EI5C 3VWJB 4M61B 1NGPL 3VFRA 2I9TB 5KVGH 3KAAA 2ZNWA 4F7MB 4NQDB 3LV3A 5T33H 1CN4A 4NP4H 5DUML 4X8JA 1U91A 4OIIL 1PLGL 4WRLA 2VAAA 3MPCA 4V1DD 5EC1B 4JRYA 4OAWA 3GSQB 4PYGA 1XGYL 3SJVD 3C60D 4LSTH 2XN9B 3BI9X 2Q1EA 2ZUTA 5LVEA 1FNGA 3MCKA 1JUFB 1GHFH 4C56D 1TTUA 4K3EH 3KLDA 1A7PH 1FYTE 4WUKL 1AGCB 1WQVT 1WJ3A 1DEDA 4YBLC 3WHE0 4J3XA 4K8RH 2I07A 4XNYH 5IESL 3QIUB 4BSVA 4RX4A 3U4EB 4LSRL 2AXFB 3UAJC 3QZWA 3RWGA 3WHXB 4PRPA 2BMKA 4WCYH 4LKCB 1C7TA 1QLEL 3HC0B 2WQ8A 3CC5B 5ANME 4U6YB 1RJYB 1SJEA 2XKSA 4LGSB 1BEYH 4NM8H 3U1SH 4OI7A 4P99A 2CXKA 4HJGA 4ODVH 3VCLA 5EOCJ 5D1QC 5EZJB 4ODWA 3MRDB 1G6VK 3OHXA 1BQHA 4GOSA 2CIKA 2DTSA 5HI5D 1CE6B 2DYPB 2GJ6D 3FOLB 1T1WB 2A6JB 1A3RL 4OGZA 3D69A 1KLFA 1R0AH 4M7LL 4XRCA 3QRFM 1DCLA 3VFSA 3VXUE 1JPSL 1T1XA 5CJ8A 1ZHLB 4YWGL 5L2JB 4YDKH 5H2BA 1N2RA 2Z8RA 4D0CA 4L5FL 2A6DB 3AROA 4F9LA 1G7JB 5IMLB 4G6FD 1MPAH 2V6HA 1Z5LA 1WV7T 3A67H 3PWVB 4TRPL 4L1DA 4NQVA 4IDJH 4C83B 1LP9F 4LAQH 3FRUA 2EXYD 2VN7A 5CHNB 4AMKL 1OM3L 4L4JA 5FUZL 3TYFA 5J1AB 1T7ZA 2J6EL 3RWIB 3TC9A 2FGWL 3EOTL 3VG9B 4ESKA 1LO0H 5I1DB 3TFKC 4NHUB 4WWKB 4JQIH 5I15H 3BKCH 4FG6C 1DFBH 1A2YB 4PUBL 1FNEA 4LPTA 1CR9L 3MV7E 1ORSA 5IF0B 3WFDH 1J8HE 2X41A 2A77L 4H8WL 2BVUA 3D9AH 5BZDA 3MJ6A 4BQBA 2NXYD 4NZUH 4XPGH 3FO9A 4NQEE 2MCPL 1RMFH 1C5DB 2YUWA 4WGVB 3V79C 4RFOL 4F3FB 5FEBA 1BZ7A 1CZ8L 4W68A 1O7SA 4Y2DB 5EOTA 5BS0A 5KN5A 1LP9A 2DB8A 3TBVB 3KS0J 1MFCH 2UWEF 1G7LA 3NGBC 1LNUB 3B5TA 5AYQA 5FA3A 2XZCL 5DK2B 4XAWL 3DARA 3DLQR 2VL4A 1P7QA 3C6LD 4ZFOB 2MKLC 4H1LB 1TVDA 3FQWA 3W9DB 5TPWH 1SEBB 1T20B 3M8OL 1T7XA 1V8HA 3O2VL 3TBSA 4UZGA 5DJCB 2VOTA 1MFAL 1LK3L 3RWJA 4P2RA 1D5XB 4FQXC 3HR5B 4JM4H 1WK0A 1NCDL 2DM2A 4XCYA 4JO4L 1Q94B 4FNLH 3IAQA 1ZT1A 4ONFH 4U33A 2O5ZH 3F5WA 3AS0A 5E08L 2YD8A 2LVCA 4PJ9A 4XZUA 4NGHH 4YIQB 5DDHB 3BXNB 1JN6A 1KPRB 1RHFA 3ARDC 3C2AH 4KDVA 5BXFB 5GGVY 1BFVH 3DURB 5FM5M 1M7DB 1KBGL 4Z7QF 1UEMA 1Y18A 5KOVC 4OM1L 1CICA 3WKML 1BECA 3VFNA 3GDBA 5IMMA 2J3SA 3ULVD 4PRNB 3BIKB 4QRPD 1FP5A 2YN3A 4P23A 2LAAA 2VDLH 4P2OB 3O3EB 1EVUA 4XPHH 3GSWB 4I2XA 5K9JH 4K94C 1CXIA 4XBEH 3CD4A 5HY9A 2ILLA 1B0GA 5ALCL 3I75A 2B39A 1MCHA 4LCCC 2OMNA 2E5EA 3LN5B 4Q74A 2XQYK 3TH4T 5DYOA 1BGXH 1KYOJ 4H1LH 2E7LC 1NCAL 3MYZA 1ZTXH 4PJAF 5C0JB 1T2QH 3QCUL 3BSZH 5I1LA 3ARGA 5D7JC 3KPOB 4FFVC 2LFGA 3HZVB 3QIBC 5FB8A 4AT6A 2E3VA 2ZJSH 1IM3B 1XAUA 3RWCB 2VRAA 3SE3A 1YJDH 5E00A 1WIUA 5KTEL 5HYJE 4J1UB 3L3IA 4YHYC 3HZYA 5F7MC 5L8LB 5D9SA 4IRZH 4GAFB 2ICWB 3D3VA 4PLKD 4WI6A 5ILTH 3GMQA 3EBAA 4GLRI 1HDMA 1IC5L 1QFWI 3IDNB 1YY8A 1Z0NA 4KKCD 3W9EA 1XGPB 1HXYA 4P3DA 4PJIA 3V5KA 3SGKC 5JMOC 2ED9A 3QPXH 5E99L 4TSCH 3MRCB 5C0IA 3FZUC 3WFHB 5AWNL 5AEAA 2GITA 5DMIL 1S7SA 4F8QA 3DXAA 4XPTL 3RVWD 5DD3H 4ZAKB 2I60L 4UILH 3LDBB 4HF5L 3GMPB 3MYJB 3VFVA 5I2IB 1F4WH 3TA3D 3OB8A 1FRGH 1YY9C 1PKOA 1D5IH 4PGBB 2OI9C 4G7VH 1CGVA 4ZOAA 1WBYB 3DV4B 2OR9L 1JGVL 5B8CB 3HC3H 3WD5H 5C0CA 1MQKL 3KPRB 4Z0XB 1IEBB 2W0LA 2IGFH 2HFEB 3EYFA 4XWGL 4XX1E 1D6VH 2ADFL 2N4IA 2RFXA 1S9KC 4MQXC 3LRHA 1IFHL 2YR3A 1QBMH 1XH3B 4S1DC 5AZEH 4C4KT 1YN7B 3UTQB 2V7HA 5I30H 4OFYD 3IRZA 3UJTH 1MRDL 1IGTA 4HPOH 2M26A 5FYJD 3STZB 3O4LB 1ADQL 1UYWL 2A0LD 2VLKA 3CCHB 4JDZA 3WIHA 4CRPA 3B3IB 3MV8A 3LQMA 4X4YB 5F7EH 5GHWL 3C6SA 4ZXBD 2XN9E 6CGTA 4N90D 1AP2A 2Q7NA 1C5BH 2VZOA 1QR4A 2FBOJ 5DO2C 1MFEH 4NJ9H 5TGBB 2AEQL 1INQA 1Z9SA 4POYA 3RX8A 3U82B 1F13A 2GFBA 2VLJA 2VISB 4XP1L 3G6AB 2VAJA 3IDXL 2HVKA 5IMOA 4CDHA 5EBWA 1WSST 3OTTA 2BHZA 4XNYL 4PJBA 3UMTA 4PY7A 5T3ZL 2AJ3A 2AS5M 3MGOB 4LCYA 2F15A 3Q6FA 3MROA 1DBKL 4GAYB 4F33B 2XQBH 3V52H 1LMKA 3C08H 5IROC 1F11A 1QZ1A 5DJ2B 2XFXA 1BEYL 1MCWW 3MUHL 4PR5B 2V17H 1BZ9B 1JNLL 1CL7I 2GJZA 2BSTB 1IC4H 4OI9A 1XF5B 4OF3A 2JIXB 4GW1B 3EYUL 5D71H 2FX7H 4NZTH 1OAZH 1JYVA 2B1HL 3LN4B 4LLUB 3VGAB 5CGYD 1TZGH 1VSCA 4TULH 1I9JH 3ARED 2EZ0D 1OAUL 3HNVH 4MD0B 1FNSH 2DQTH 3ES6B 1I1AA 4XC3H 1EDQA 5TDOB 4GG6A 2P24A 1JHLH 4YDKL 2PTVA 2IC2A 2YSSA 4EI5D 3L95B 1P7KA 3PJSA 1KB9K 4V1DB 4IDJL 4UTAH 2BFVH 2HFFA 1A3LH 1YEFH 4NQTA 3MFGB 4CMHC 3LKQA 3HZKA 3C60B 4YHKH 3MRNB 4JFZH 1YEDB 1I9RL 1AE6H 1JRHH 3QDJA 1Y6KR 4OZHF 3O4OB 1LO0L 4JY4A 3QXAB 1I7UB 2VN4A 3QUKB 4MJ2A 5LBSL 2V2XB 2YK1H 1QPPA 1K6QH 5GGRB 4Z7NF 1OP3H 3G6JB 5C6TL 5ADPL 3WHE1 5DFTA 3WFDL 3F7YA 1M71B 5TQ2H 1TFHA 1E6JH 4FQHB 3DO3A 1Z9LA 2B7DT 4R97B 4U6HA 3UPRA 3F12B 5EO9B 4PP2B 2Y6SC 2BHYA 3BEWA 4GG8A 3HA0A 4JJ5B 1OT2A 4M03A 2AK1H 5IB4A 4EDWH 2BVQA 4EI6B 3ARVA 5C8JB 3MRRB 4XMPH 3EOYG 2EIZB 4P4RA 3KPNB 5DRNB 1HHHA 3QQ4A 1PW3A 2ID5A 3BUTA 4I5BA 2DDQL 3SE8H 4LVNB 5KS9B 3QQNA 1LD9B 2NX5A 3BIBX 5KG9B 1YPZB 3L5WB 3QUXB 3O8XC 5D1QD 3BT2H 2XTJC 3QIWC 3MA7B 3TT1H 2EE3A 5D2LF 3L3OB 2Q7YB 4NGHL 3FAXA 3WLBA 2EYTB 4Z0BL 4RRPG 4G6FB 4L8SB 1Z2KA 5K9QI 1I8KB 4OFKA 5CD3B 5JTWA 2YS4A 1KJ2A 4HWZA 4KI5F 4WW2B 5J4MA 4OF6A 4TUJA 1WGOA 4K07A 5JXEC 3OG6B 1IJ9A 4F80A 1A5FH 3BH8A 1NCBH 3GBNL 4IMLA 4XBEL 1L6XA 3KDMA 4HUUB 4HHAA 2C3HA 4HH9B 4MX7B 2WUBH 4HX1B 4JAMA 4N0YH 2EIDA 3BPOC 4XVSH 1WIPA 5DR5L 5EZIH 3L3JA 1PG7L 4YGAB 3TFKD 4XP9H 2YZ1A 1TETH 2K3TA 4FG6D 4ISVB 3OKNA 2CK0L 2R56H 3RL1B 4GH7B 3F6LA 1YUHB 2XXMB 4WTZG 3RU8L 2NXYB 4GRLA 1N6QL 1YJDL 2X4NB 4ZPTB 3S35H 4HLZG 1T7WA 3QNYA 5I1KL 2R2HA 4YAQA 2HYMA 3BKJH 4Y4HB 3MACL 5JXAH 3KXFB 5DMJB 1A64A 1N5YH 3AS3A 1QR1B 5IVXB 7FABH 3S34H 3GMOB 4U1LA 5DEGB 2R29L 1KTDB 3QPXL 4PJGF 4TSCL 1WZ1L 4OSUL 1TVBB 5EFIB 4C54A 5FDYA 4J2XA 3C6LB 4MZ3A 3FO0L 3BRGC 5DC0A 1U6AH 3TN0D 2UZIL 2GY7B 2Z91B 1RURH 5F1OB 1M4KA 1WCQA 3ARWA 3DTXA 4PRID 4CL7A 1Q9WB 3LD8B 1G9NL 5IHUH 4EQ2A 4J8RA 1WCBB 1MFNA 1MJ8H 3CGTA 4WUUE 5J13B 5FV2A 4MJ5B 5DJDA 3KYKH 4FQXD 3R8QA 3KPRE 2X4RA 2FX9L 1XEDA 1FBIH 1XF2B 3Q6GL 4R4BB 3GSRB 1G7MB 2BSRB 4ZUVA 2VE6A 2R0KH 1DQDH 1MIEH 4NO5B 4QRPB 5KSAC 3ARDD 4I48A 4YH6A 1H15B 3IU3B 3P4OB 4H88L 4M48H 5T1LA 3L3HB 5I30L 1F58H 1MFBL 1MJJA 4Z7WF 3HPJB 4OCRL 4O02H 3UJTL 2FATL 3O4LE 4I1NB 3OPZH 2VLLA 1MNUL 4EUPB 2WZPD 2PW2B 4HUVB 1Q9KB