1G43A

Crystal structure of a family iiia cbd from clostridium cellulolyticum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
160
Chain Sequence
b'AGTGVVSVQFNNGSSPASSNSIYARFKVTNTSGSPINLADLKLRYYYTQDADKPLTFWCDHAGYMSGSNYIDATSKVTGSFKAVSPAVTNADHYLEVALNSDAGSLPAGGSIEIQTRFARNDWSNFDQSNDWSYTAAGSYMDWQKISAFVGGTLAYGSTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCAFFOLDING PROTEIN
publication title Structure of a family IIIa scaffoldin CBD from the cellulosome of Clostridium cellulolyticum at 2.2 A resolution.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Structural protein
total genus 36
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 1g43A00
4B96A 4B97A 2XBTA 4B9PA 2WNXA 2L8AA 3ZU8A 4B9CA 3TF4A 1G43A 4TF4A 2YLKA 2WO4A 1TF4A 3ZQXA 2XFGB 1K72A 1KFGA 3ZUCA 4C8XA 1GA2A 4B9FA 1NBCA 4JO5A 2WOBA 1JS4A 3ZQWA 1G87A
chains in the Genus database with same CATH superfamily
5C0RL 4V2CB 4WGKA 4J2QA 1ZA6A 1WCBA 5KBDA 2AK4A 5E00A 1KXVA 4O9HH 4DWHA 4ZW6A 1BXAA 4M03A 5D70H 2EE3A 2YBRB 3DOHA 3VI4E 1K85A 1U8PA 4BH8A 1HYSC 3UCQA 2L0DA 1MFEL 2EXSA 2DDQL 4Y19A 5DA0B 3DWTA 3LNHA 5C0AA 5KZCD 4KQ4H 1AACA 5HVGB 2ADJB 4I3GA 4WJ5A 3ZYJA 1M6UA 5DJAB 1ND0B 5ERWA 3DYOA 3V7AG 2G2PA 4NZFA 5IFHL 1FL5B 4F33B 1JHLL 5TD4A 2X3CA 4S2SA 5E5LA 5D93B 1A4KA 2Z8RA 2DOCA 2E47A 1BZ9B 4YHNB 1M2OA 5K9KA 4PRDB 32C2A 2GVYA 4NUQA 3CSGA 2D0HA 4GLRH 2I5YL 5GS3A 3TU6A 4U6HB 1HZLA 1AHWB 3F05A 5I71B 2DTML 4QTHB 3G6JB 1MCEA 3FHQA 4K94C 1LGVA 4FABL 4G2AA 5E5MA 4QYOA 3WJJC 3FC8A 4RGNB 1VADB 3ROLB 3MQIA 2FJHB 4IDJL 4RLDA 1NFIB 3DVIA 2AANA 3O2DL 4K94H 4FG6C 5FYJU 1DR9A 4JVWA 43CAA 1HOEA 1CE1L 1D9KC 3K6SA 4ELMA 1QRNE 1ORSB 5ICXA 3MRHA 4FQQB 3FYIB 1BFVL 4GMSL 4NZUH 1S9YA 5FW6A 3BUDA 1G7JB 4MNGA 4UM8A 1NM9A 3ISRA 1K6QL 2MCPL 3FU6A 4XNMB 3UZQB 3HNSH 1X5JA 4JHWL 2KPWA 3N1QC 1JGDA 1AD9B 3IGKA 3DIVA 4NGHH 4N6RA 3T4YA 5FCUL 3Q5OA 1AP2A 2AZUA 4B0MM 4HIXH 4D0BA 3I2CH 2A83A 4DCQA 4U7KA 4LCCC 3ZKMD 3D08A 1J0YA 2Q7YA 3QWOB 4UTBA 2HSIA 2P5ED 3V5HB 1BF5A 1K5WA 3MJ9A 3B7TA 4G6KH 1LXMA 5FYJD 1B3JA 4NN5C 1UA7A 3BZEB 3LV3A 3MOAL 4P4KA 2C4XA 3ETBJ 3KDMA 3II2A 4OV5A 1A6WL 2A6IB 4DKFH 2OR7A 3OLIA 2YLKA 3UEQA 1AMXA 4LF3A 1WIPA 1HEJC 4R6UA 1KXHA 2EDHA 4I48A 1BBJB 2Z4QA 1GA2A 1VFAA 2PXYB 1RU9L 2YPVH 3QA3B 1MLCA 4LCWE 4P5TC 4TKWA 4A55A 4FADA 2X6VA 4L3FA 5D72L 2RGSA 3OMZA 1ZPLA 3JTTB 2VB5A 1G87A 1WWAX 2CKBB 2IFGA 2BIPA 3BO8A 3MX0A 5HBBA 5EUOE 3N06B 4P9MH 4P4RB 3ES6A 2D73A 4U7SA 1NC4D 3JTBA 1TFHA 1UJ3A 3LX9A 1VZIA 4JUSA 3L3OC 5ICUA 1WP6A 2N0KA 5FF6B 3K6IA 3OKMA 4RCAA 1P4BL 4FF9A 4HXBH 3H0TA 2OP4L 2E7MA 4TUJB 2LGNA 4A7TA 1PZ3A 1RPUA 4L9DA 2BXYA 1N0LA 5D7LB 5GGUA 2Q6WA 5HHMB 2C3WA 1ZS2A 2BNUA 2DKSA 3H2WA 4KOBA 4UOZA 1NCIA 3OR6B 1XZWA 2NTSP 3RVTC 5K69A 2WOYA 3SQOH 1F11A 2V7HA 4FQCH 5C09A 3C5JA 4JQIL 7PCYA 4MRBA 1QQDA 3WO4B 4Q9QL 1IQDB 1AI1H 3S37H 2R0LL 2FWLB 1W6WA 4Y2OA 3S8WA 5H8DA 4G11A 4X6EB 2JQMA 3I6LD 4JPKL 5F97E 3B5GA 5IHBA 1AQ8A 1FZJB 4FXGC 5IOPA 3HRZC 2EDMA 2XVKA 5LVEA 4XBPB 3BXNA 2XSKA 5DZNA 3WUWA 1VACB 4Y9EA 1NICA 2F74B 2V8MA 4XVSH 1KBPA 3OKKA 4GRWF 1T0MA 2H3XC 4O02A 4CJ0A 5KVDH 5CF3A 3NZSA 1JP5A 3WE6A 4C54A 5LNDA 1R9FA 1EH9A 3QQ3A 3GUTA 3GMMB 1H3PL 5FUCC 1B4JL 3AU0A 4GG6F 2ESVA 4NQCB 5TQ2H 1J8SA 2FECL 3VXQB 1NA8A 1MAML 4XWOC 4X6CA 3CUPB 2GIMA 2R1WA 4J27A 1JPST 2EH7L 4P57A 1VIWA 1LO2L 3MRNB 5D6CB 1SVZA 3UP6A 5HDBB 3HHMA 3L81A 1JF5A 5DFAA 3DTXB 2J8HA 2VABA 4NO2A 2NY0B 4NEHB 1UKSA 3UJTL 2W9DL 1YECL 2QEJA 4HZLA 1V5JA 1K4CB 1TMCB 2AEPL 3P9LA 4RDQG 4WFFE 5KYWB 2CKNA 2VKWA 3LQAC 2ENSA 2VLLA 1UZ6F 3U6XS 5J0BA 5IVNA 5GZNC 3FO1B 1AXTL 1XH2A 2F7IA 2VDQH 5C08B 3RL1A 4MNQA 1LNUB 3T1WA 4CGUB 4I0PA 3GMPA 4HS8H 2NUTA 5E24E 1G9NL 3LQAH 1UB5A 4FMFA 3IMUA 3V6FA 4PGCA 5DJ0B 5ID0A 2BNQE 4DTGL 1BD2E 2HT4D 5FYLD 4POYA 4APQD 5GS1A 5JQ6H 1X9UA 1IV8A 3IFNH 5H94B 1NBZB 1MI5E 1OQXA 5K93A 4HV8A 1FFQA 3PABA 3L5HA 1NEZA 4AWJC 4HWZB 3HKZA 4M4RB 2ENYA 1CTNA 4NO5A 5C07B 3SE4A 3H9SD 1M9SA 1NCBH 3WFHA 4F9PC 3KJ4C 4D9RE 5ELIA 3ZVVA 1OD9A 5C86A 15C8L 4YHLL 3E9TA 4JM2B 5FGRA 4ZQTA 1SLUA 2VL5B 1A1MA 1KPRA 1WBZB 2E0PA 5KVFE 3LXAA 4HU8A 3BFQG 3NSYA 2NY2B 4KRPB 3H7BA 1FGVL 3JV0A 4HUMB 5I5RA 5GRUL 2A77H 1HL8A 1V3JA 1FIGL 3VM5A 4FFZH 2AV7B 3BVNA 3TWCH 4BRVA 4J4PA 2K1MA 3E6FB 3N55A 3DGGB 5IB5A 3D2UD 4AK2A 3EOAA 3N40F 5A6IA 1QSFE 1ICTA 1YAIA 4Y1AB 1K8DA 2WQSA 3K2MC 4KDVA 4B53A 4OZIB 2WQXA 1XXDC 5DJZB 1NM4A 1PZDA 3DRTB 4LAQL 4JJ5A 3OKLB 1FPTL 1FVCA 1MY5A 1OCWL 2Z34A 5F7AA 3WLBA 1E7VA 4DW2L 1HSAB 4FNRA 4KJPD 4KXBA 3AAZB 3Q9PA 1RFDL 2RFXA 2ZUUA 3OVUB 4BQ8A 4NHCL 4BQCA 1LDSA 2BH0A 4PRHD 1CFNA 2DQHH 2Y2TA 3U4EB 5KBPA 1B9ZA 4N2IA 4PJ7A 4AE1A 5IKCB 3US1A 1G9ML 2F54A 3S2CA 4N2EA 3DOIA 4DPAX 5I18L 4RA3A 1HHIB 4P5MB 1IAOA 5KSBA 5SX4H 5E6IA 4UANA 2HJLA 4QRPE 1TNMA 4AIZA 4GSQA 1U9KA 4N0CD 3ULUE 1DFBL 4MX7B 3ESOA 5D93C 2HXAA 4OJCA 4Y4KA 4ZW8A 3QXAB 3GBNL 2KLSA 4YXLL 4GT7A 1AVAA 1XF3A 4WF7A 1TTGA 1FF5A 1F45A 3HEIB 5MERB 4IKJA 2O6CA 2CHXA 3TBWA 5I71C 4U1JA 4EF3A 5GPRA 3MLTB 1OAZL 2ZOWA 3GYRA 2EADA 3QCVH 5HGBB 3UO1L 5KBKA 4RGNC 3GLAA 2R4RL 2H6PB 4G6FB 1CU4L 4LESA 1MVUA 5GSRA 3S36H 1KJ2A 4P8QA 3T6ZA 1JWUB 4N6QA 2VSCA 4F2FA 2DLTA 4XCNB 3S3JA 1RJLA 2EH8L 4IW4C 3KR3L 2EUZA 4M93B 4IDLA 5CEXB 3HG3A 4AEEA 3G3LA 3P54A 2XWBA 1K5NB 2EUXA 3EJPA 1Z66A 5D4HA 5KJ7E 3BI9X 1TQSA 3TO4B 3G08B 5FV2A 4HWBL 1E8ZA 2I5YH 2YUWA 5IW3A 5FGCB 1DQLL 4PTUB 2C9SA 2AMUA 4FABH 2HTKC 1WPCA 2GK0A 5BW7A 3U2SB 2PKDA 5IREA 1IO4C 2EABA 3T0EA 3H3KA 1KB5A 4IDJH 5D6DC 2ZP8A 3MV7E 4LRIC 2G5UA 4WI3A 4GRLD 3ARSA 1F02I 3UCRA 3ZPDA 5HHOA 2UY7A 4ZSOE 1LK2A 3IAPA 4KX9A 3X14B 3HMXA 2O1AA 1UD4A 4N2MA 3MACH 4WWKD 3T8XB 4PVMA 3N50A 3W37A 4G70B 4JRXA 4OFVA 3GXMA 3QPQC 4JHZA 1K6QH 2DI7A 5M95B 1J1XL 2NW3B 3FT4B 3QUXC 1S5IL 5J3HD 2R23B 3GS7A 2PXYC 2KKQA 4X5WA 3EFDH 1DVYA 3IS0X 2ENQA 2YPKA 4JZJA 2HX8A 3DBSA 2J88L 1X9LA 4XXDB 3BWUF 3TYFB 4BSWA 1KC5L 1PZ5B 2Y7QA 4HUVB 4HIPA 3IFLH 5I6XB 3HAEG 3RGVB 3CBJB 4XO9A 1FO0L 2IDTA 3FXIC 1I7TB 2CKBH 2ZX9A 1IAIL 3L54A 3OZLA 3VI3A 5E6ZA 2OMYB 3C75A 2VDRB 3UPAA 2BSTA 3VFUA 4DO5A 2BHUA 1L9PA 5D72H 1XR8A 1Y0LB 2NNRA 4JFYA 2Z35B 4PJXA 4Z0BL 5H2BB 1OM9A 3QDJB 4GUPA 3TCLA 4NKMB 4IBZA 3UABA 2IDSA 4CJ1A 3WO4C 3BCDA 5B38A 3E0GA 4WI5A 2OMWB 2PETA 3MZGB 3MCLL 3NEOA 4MQSB 5DJ2A 1LWRA 3CVIH 2QGDA 2WLHA 3E8VA 3DVGA 4PB0L 4POZC 3HG1E 4OQ1A 1S9WB 3M6DA 4GXUN 3VWKB 1WFMA 5CZVH 1LO3L 1T3FB 1LD9A 2WJ5A 2R69A 2ITCB 4B96A 5CWSA 4Q9QH 2FUTA 3W3BA 3HNVL 4AQZA 3DXAB 3NDZE 3ZE0F 4PQXA 4AV4A 1M71A 2WINA 4IM8A 2ZKYA 4G80A 2NY3B 3P0GB 1BDYA 5FO7A 1TTAA 3E80A 5IBTH 2OFQA 5C0CB 1UZ8A 1NAMB 3LEYL 4KNSA 1IC4L 2XZZA 2YKLL 3HW7A 1A02N 4DUVA 1FFOA 2Z9TA 2DEYX 2B14A 1B6DA 3D39B 3LD8C 3NA9H 3IGAB 4TULH 4U1IB 1AJ7L 1G7QB 2Q76A 1NBCA 3MLXL 4KKRA 1QPPA 2DQTL 1IEBA 5KG9A 5FC9A 2IBGA 4N3UA 1G7HA 3WIHL 4UV7H 5DD5H 1RL1A 3P9WB 1RIHL 4LARL 4OJYA 4YXKL 1DJZA 1HILA 3NVQA 1SJHB 3QO1A 5AVWB 1GSKA 5KSVA 2VL4A 5FWQA 4IMKA 3IDXH 1DVQA 3MCG1 1JRHI 2BSSB 3HS0B 1INDL 1QZNA 3QIUA 2A6JB 3IPEA 4LVOB 3MV01 3OAUH 2XU9A 3BH9A 3UDWC 3HI5L 4WJG3 4Y8AA 1VDGA 2UYLB 4M1DH 3UAAA 1TJMA 1M05A 4DOHB 4F92B 5AB1A 2E9IA 4JDEB 3WN6A 1XCWA 1NLBL 1JK8B 5DD1H 2MCAA 5IVZA 5D1ZI 3R06B 4GIAA 3KLLA 1SYVA 3UJTH 3P11H 1YECH 3PQYD 2IPKB 2WK2A 1J0HA 1Y1DA 2OCCB 4FLQA 3KPQA 4U6XA 3EOTL 4X98A 4S0HA 1MFUA 1QFHA 4O51A 4NKIL 1T4KA 3H8NA 1D5ZB 3MKKA 4NBXB 4JPSA 4ZNEE 3LXBA 4GW1B 5D7KE 3W0WD 2H26A 1WCQA 2K7PA 3CMOL 2IG2L 3K80A 3KPRB 4WU7A 1JL8A 3Q0HA 3WKPA 1DLHA 2VDLL 3RNKA 2Y5QA 2JJVA 3PY9A 3DPBB 3BP6A 1K2DB 3MBWA 2SODB 4JM2C 4MTMA 3AU1B 4RGMB 1KLUA 3ZTDC 4QAWA 3KGRA 2YN3A 2GFBB 2YGPA 5LGJB 4KKQA 2AK4B 4ONHA 4UT7L 2NY2C 2HVKA 4NJ9H 3UIYA 3PWJA 1XF4A 3DKHA 3OGOE 4QHMA 4NX0A 1CLYL 4KQ3L 5E1QA 5TGBA 4MSWA 4UT6A 1OD7A 5J13B 1MCPH 1U8PB 1VRSA 4W9FC 1GS7A 2OLDA 1L0XA 4LCUA 2XBZA 4Y19B 2F08A 1S7WA 1FDLL 1QWNA 3MV9B 5G5DA 3KLAA 4YHLH 2IFFH 4EZLA 2W5PA 3O9WD 5EZJB 2IXQB 5EU6E 1O75A 4EDWH 3DX2A 1PY0A 1TITA 1MFCL 2CAKA 3WKML 1PZCA 4JO1H 5E8EA 3BZDA 3SD5A 1C08B 5GRUH 3FQWB 4XPBH 3TS8A 5GRVL 4V11A 1NLDH 2HFGL 1F00I 3LQZA 5HTSA 4X0NA 5IFAL 1WG3A 3GLDA 4HIEB 4LT7A 4R83A 4XE5B 4XCEA 3I3DA 4WU5B 3NGBB 3K4DA 4L2YA 3RUGB 4UQ2A 5GRVK 1OY3B 2ZUTA 1A22B 4NRXA 4XI5D 4HU2A 3RIAK 1ZJBA 1WT5A 3MSPA 3BW9A 2Q8BL 2Z8SA 4MYWB 1FPTH 1R19A 4ZS7L 4LVHB 2L7JA 1D7BA 1YMME 2Y36H 2X4UA 2A6KA 1EEZA 2AEWA 3U7YL 2BVYA 2QADD 1R0AL 1S9YB 1AZZC 1ZHLB 2CO7A 2HP4A 3D85A 4F3FB 1A7QL 1SDYA 1H8SA 1ES0B 3F7PC 3SDDA 4E9XA 3IE9A 4APXA 4EUPA 2JTYA 1WC7A 5FDWB 5HVHB 3N9GL 4E9WA 5D1XB 5I1HL 1FNHA 3JV6B 3T4YB 2EIBA 3NCYP 1Y6MR 4M93C 3MV8A 5C0EB 1DDTA 3HBGA 5SWZD 3MLRL 4YXLH 2ED8A 4K3DH 4JNXA 1UM5H 3BN9D 2Q7YB 4K0OA 1AGFB 5AL8A 1Q1JL 3TO4C 1NKGA 4Y16A 1REIA 1AGBB 1EPFA 4WQOA 3A24A 5A2AA 1U3ZA 1FE8H 2PWEA 4UIMB 1QA9B 3KPSD 1ID5I 1QFWI 4F15B 4BK5C 3RGHA 4YMPA 3GSQB 1I8KA 2O5ZL 5KVDE 1TQWA 2ZCLH 1KYDA 2EH8H 1CDJA 4XNQA 1PSKH 4U1GB 5EO9A 1P7QD 2RB8A 4L29A 4D3CL 5H37G 5FLVA 5DVOA 4IEFA 1G7IA 3PRZA 3FKUS 4I7ZC 5FOBB 4H40A 5JXAL 1UCBL 4JRYB 5IVXA 1F4XH 4L4TA 3GQFA 4JX0A 1XAKA 3ILPB 1GGYA 3PV6A 2GAZA 4PRIE 1RUQL 1XZ0B 4AK1A 4BFKA 1RY7B 4OGQC 2J71A 5GGUB 3L8QA 5DD0L 2H41A 3LIZL 3CVDA 5E8PA 4G5AA 4ZTPL 1AGDB 2Q9OA 3GBML 4Z7WE 5I6XC 3HE6A 3RGVC 4BWUA 2CJSA 4CMMB 1KY7A 3MA9H 1S9VA 4XB7A 1RZIB 1MEXH 4F8PA 5GHWL 1J5CA 3RAJL 4UB0L 1BZQK 3SDAC 1J1PH 1M9WA 4Y5XB 1T5WA 3K8KA 2BC4B 2X40A 1FBIL 2X4TB 1C5CL 4YZWA 2OXGA 3JXAA 2VDRH 4JO4H 2IVFC 3EDKA 2P48B 4OLWL 1ED3A 1EZVX 4G6AD 1UXLA 2YS4A 4XO5A 4PRAA 3GBEA 3UAFA 1YEIL 1SZNA 5CLXA 4JG0H 2ESVB 1BG1A 3EIFA 2X6CA 3F04A 5DJ6B 4OZFB 1TVDA 3UGUA 2VLKA 2LLNA 2KYIA 3K1DA 4NYLB 3L48A 2B1HL 1WAPA 3VXNA 1P5VB 3VWKC 4Z0BH 5HGAB 1S7UB 2IPTL 5DR5H 5E2WH 4Y5YA 2AERT 1L9MA 4C56B 4NUJA 2W60B 5DQJA 5BJTB 1PNDA 4X9BA 3U2JA 3LXUX 1KJ3L 4F24A 1OT4A 3L5XL 2VABB 3MRDA 2JNZA 3PWPE 3W39B 2NY3C 5I1CH 4QDGA 4X80L 1NUFA 1G6RL 3CSPA 1YEFH 4DGIH 2NZ1A 2NY0D 4ODBD 1OAKL 3R4DA 1BLNB 1IGCL 2NYYC 4KRMB 4OW6A 4MAYD 2J6EH 2Z7YA 2IO5A 1NUDA 4URTB 5DS8B 4A2MA 3THML 2AHIA 1A3RL 7CGTA 1AKPA 3OJ2C 1NAMH 4PWKA 4X0KA 5FUZL 3HNVH 5BRZB 4XBGB 4RVBA 5DT1L 2JXMB 1HWGB 2VM3A 4QNPF 2D9QB 1CBJA 3PWVA 1L7IL 2X4NA 4M8QB 5HJ3A 4N2CA 3UZVA 2VMDA 3CQQA 1NGZB 3HS0C 1IC4H 4OFKA 1RHHB 2YD0A 5AKRA 2OSLB 1KTRL 4LP8A 5C6WH 2YMXH 4H25B 3MOBH 3ARFB 5JDSA 5AYQA 4I77H 1CXLA 4XNAA 3M45A 3L3IA 3Q1EA 1A1MB 2NY5L 5DRWA 4YXKH 2ZYIA 2QQLH 3DX9B 5F7BA 1ADQA 2FT6A 4G3YL 1E4XI 5EF2A 3H7BB 3JTSA 4AT6A 2HLAB 4ORZC 1INDH 4YDVA 1TO4A 1JHKH 2EEAA 1HC1A 3C9NA 2XJKA 4KRPD 4RA0C 1RUMH 4CN6A 2YZ8A 3R0NA 3FUHA 1ZOXA 4L5FL 3SYPA 4IRJA 3TCXA 3G6JE 5JUEH 4RGMC 1O6VA 2R2BA 1IM9B 4RGNE 4GINA 2X4QA 4XPAL 4GMTL 1RIVH 3KEHA 4DH2A 2E86A 4NKIH 1BPVA 1EWHA 3KVDD 4M5SA 5J13C 1QAWA 4U3CA 3JWNG 2BVOB 4W6WB 5E9DA 3Q2LA 2WLLA 3GXPA 5JORA 2NY4C 2WWKO 1U41A 1IGFH 1UYWH 2R29L 1WAAE 2F54B 5I8CB 5M94B 2ADYA 4W4OA 5DZPA 1JDAA 4PTTB 2EYSA 3GZKA 1BZOA 3U79A 4Z7VF 3W9DA 1Z5LB 4OCSL 3LQMA 2XZAH 4HJIA 3O4LB 2F7OA 2WNKA 1E3XA 4PJFA 2FX7L 4FZEL 4AI7A 3CSYA 1R75A 1X7TA 4U3HA 1JGUL 3CCHB 5A6MA 1JYWA 1MSPA 4WHTB 3QEQD 3NGBC 2XWJA 5C0BB 2EXYD 1UUNA 3LKRA 3VU1A 4ETQA 4L3CA 2CK0L 1LEKB 5AAMA 2F8OA 5T1DL 2R39A 3UTQA 1KGIA 4QXTB 4YDKH 2I26N 1IIKA 4QJ3B 4IU2B 3WKMH 3HI1B 5SV3A 4GAYA 4H13C 5CU5A 2MQ3A 3BH8B 2WLKA 5A3ID 4LVHC 2KDGA 1NC2A 1PPIA 2DIAA 2XWBB 4F7EB 4JHAH 1DVXA 3EGXA 5HGHB 1IGIL 2B0SH 2Q86A 2J2ZB 3WNOA 2BNRA 4P3WA 1AO7A 2H32B 1UA6H 5GRJH 2JVUA 5E8NB 2JK5B 1J8HD 3CPLB 1YEJH 3DBXA 5D1XC 3WJMB 4YAQB 3MBEB 1N18A 4YK4B 2Q3AA 1ZTMA 2B5IC 4K5NA 5D7LE 5HHME 4LE8A 5HHOB 1BMZA 1HXMB 3B2UD 1T0PB 1LK2B 4M5TA 4S10A 1AHMA 4NQVB 1T2XA 2WKOA 3OG4B 1R0AH 2VR3A 5A2IH 2AEIT 4U0RC 1Q94B 4Y4FB 4MJ6A 3DOSB 4H8QA 3IJEB 3IU4H 4U6VH 1A7QH 1R3LA 5AZ2L 5JHDB 4PEEA 5DO2C 4UTBH 4F15C 3WEMA 1N6UA 4HH9B 4PV8B 1L6PA 1DJXA 4FFTA 4HHGA 4X5WB 1A14L 5LJYH 4J39A 5C0FB 4PJHB 4R26L 1FCGA 1PFCA 4EAEA 1HXYB 2YAMA 1Q1JH 3L9EA 1UADC 3MLWL 4LLMB 2B9BA 3EJUA 4ZYKB 3I02B 3BPNB 4JHVA 4P23D 4WW2B 4ERSL 2DI9A 2A1WL 3A4EA 3PGFL 1WD8A 3KH3A 4NQCE 2O5ZH 3BLPX 3OKNB 4FTDA 5I17A 1V54B 3DLQR 3P3SA 3RA7L 3VXSB 2VTFA 3SDCA 1HWWA 2KS0A 3GSXA 4WTZG 3IVKA 4UQ9A 1XR8B 4HJ0D 4TPRL 5KTEL 1KG0B 1VCBC 1WFJA 1LJMA 2VZVA 4LDCA 4D3CH 3TCLB 2BWQA 2XPGA 5HDBE 1DFXA 4YGVB 1HL4A 1G1KA 3BGMB 5DTFA 1A3LH 1NBVL 2PR4L 4Y1SA 1UCBH 1GGIL 2BVTA 1UCTA 1L7TL 1PZUB 3HPJA 4E41A 5IM7A 4YVNA 3MRLB 3PCYA 2JCCB 2OR8A 1GCYA 4Y5XC 3HG5A 2FATL 1PZSA 3S35L 5L4JA 1WUZA 4XP4H 4EBQL 1BEXA 1OSZA 4IHBA 5KSUA 4I5BB 1IZKA 2X1XR 5C08E 4BKTC 2ZX8A 4ZTPH 3LRSA 3ESMA 5DS1A 3AY2A 1UM4H 3BZ5A 4BFEA 5CWSB 4YSCA 3KWXA 4A2GA 1R5WA 1CDIA 1BFOB 2M8XA 2DM2A 1OAXL 3TZVB 4RMQA 3Q43A 1I75A 2X2HA 3FUJA 2BOBA 4KY1L 3LZLA 1XX9C 4CKQA 1YJDC 5KYUA 3VRJB 5HVFB 2P42B 4H8HA 4B97A 4AYEC 4LBEB 3OKDB 2A4EA 4KFZC 1N6QL 5C07E 5C0CD 1HHHA 3KS0J 5L4FA 2BK8A 3VWJA 4RAHA 4OZFH 1YJDH 3UO8B 2VN7A 3GKWL 1IGMH 4OLWH 2FTAA 4LEOB 3H54A 1WE5A 3IXAB 4NO0D 3LZNA 2UXTA 4RIRA 4HP5A 3QO1B 1FH2A 3T5WA 4CAGA 4XVUC 3TIDA 1QUPA 1P4UA 3QEUA 3SJVD 1MRFL 4F8QA 4HOMA 1PZBA 2YRZA 1O9VA 5HDQH 2HFFA 1M05B 2YD6A 1U30A 2PW2A 2Z92B 4ZOAA 1EXUB 5DD3H 3GSWB 5I1JL 2YEZB 4AQ8A 3K71A 3ULSB 1F56A 1T0OA 4NPYB 3RWFB 4OLUL 3O0RH 3LEVL 4Y1AE 1AXSA 5GS1C 4L4VB 4L9LA 3MAWA 3H9ZA 4OZIE 5EA0H 3KPQB 3APFA 1OAKH 4O51B 4A7GF 4XZ4A 4OJAA 5FA4B 5F9JB 3SOBL 3BSZA 3D18A 3THMH 1A3RH 1IJNA 1DLHB 1UFGA 1E27A 4DP1X 4PBVC 4IBYA 3OJDA 5B1CA 1R1CA 5DT1H 3DO7A 1MJUH 4LQFH 4ENED 5EIIG 3QXVA 3F5WA 1TZHA 1T83A 4A1RA 4AL8L 5AZEL 5IHHA 5D9SB 5ID1B 4Z3GA 4ZFOL 1NGYB 4P5KA 3O41B 4FZ8L 1L5GB 2WXLA 3AB0B 4HIIA 4J4PC 3HZMA 1PL3A 3GEWB 4BGDA 5ITFA 4JANA 4WSJA 1NCOA 4HSCX 3RWDA 1CDUA 1W16A 4XX5A 3VA6A 1SBSL 1CIUA 4FQHA 1DN0B 4ZFOB 1JXKA 4EVNB 3ESUF 1J1OH 4FEMA 5GGRB 3RWHA 3PE9A 2ADGA 4DETA 4JY4A 1M3JA 4GFXA 4G3YH 2K9FB 1TOXA 4NFDA 4ODVL 3HZ3A 1H15A 5I19L 2BIQA 3JYCA 4XP9L 3FB6A 5JPNA 2DY2A 1HT6A 2WGNB 1PLGH 4HFWB 5KWYC 5IQMA 2R0ZL 2F5AH 1RZQA 2XVBA 4OM0H 5FGCE 3IFPB 1NBYB 5IB3A 3HAEA 4PJEB 1EEUA 5HPOA 1C1EL 3L08A 5LBSL 5E6IC 2ID5A 3AG1B 5F6IB 2O26U 1DQIA 4PPTA 2WLYA 1U92A 1QR4A 2DIEA 1SEBB 2OR9L 5J11B 4Y4KC 5LCVL 2VITA 3K6FA 1SMAA 3NSCA 4LLVA 4KKBD 4QTIL 3MRJA 3CXDH 3G6AA 3KYMA 4QHNB 3ZTNL 3RY4A 1IGTA 4FL4B 3BWSA 5ACZA 4EKJA 3CHQA 1BGXL 3ULVL 1U33A 1XH3A 4UTAA 2A9MH 4FAAB 1HESA 3PL6B 5MI0B 2VDNL 5KOVC 4EUPB 3KMDA 1E3ZA 3CDYA 5E7BA 1RZPA 2OTWB 1AGCB 3DIFA 3S6CA 4EN3D 4FQIL 2VDNB 4OCRH 3DV4A 2P5WA 4NC2B 2BPBA 1XCQB 4PCKA 1SN5A 4Y16B 1JGUH 4D7BA 1GYAA 2EECA 2VW7A 5AW9B 4A6YL 2GIYA 4H88L 4N8VB 2CK0H 2O6FA 1ZLWK 4RZCA 3T0EC 1L0PA 3MXVH 3FRUA 1FNAA 1GIGH 3G04B 2C9AA 4ISVA 4YK4C 1G9HA 1DQKA 3VXOA 2GT9A 1HH9A 5BOJA 4N0FA 1MJ8L 4QCIA 4HJTA 2IAMD 2H32H 2Z64C 3HE7A 4LLUA 3W5NA 3O11A 2XNAB 5HJDA 3P2DA 1OAQL 3QDJE 2QKIA 2C4FT 2OMNA 3FH8A 5EZPA 3OV6A 4IEFB 3QAZB 3UTSD 4LKCB 4W81A 1GJIA 4J3OF 4FNLH 1B9KA 3CFIC 5ESAB 4BFRA 5IVXB 1T6WA 2ORBL 5IESH 4J3XA 4Q4EA 5DUBA 3FQTB 4L0PB 4L4TB 1FL6A 5TDNB 2GAZB 9PCYA 1T7ZA 1GZQA 3ECVA 1RMFH 2D3LA 3Q8BA 4BFFA 3NSJA 2EC9T 3DHJA 4M62L 4PIBA 4PGDA 5CGTA 4KK5D 1N67A 1LMKA 3WHE0 2FK9A 2NY1D 2NR6A 5IMLB 5AOMA 3HNTH 2E9BA 2AXHA 2XXMB 3DXAE 3VD4A 2O6PA 4JM0A 3DMMD 1CVRA 1G43A 2BCKA 3BPNC 1ZANL 3O6KL 4WW2C 5AL0A 3MJ8B 3U4AA 4QOKD 1TQCB 3N42B 5T8IA 4MJIB 2GITA 5F3HB 5LG1A 3IXTA 4JAMB 3RKDD 2Z3FA 3EJCA 3NCMA 3CX2A 4TTGA 1A14H 1KXQA 1T5WB 1UQSB 4MDIB 4I3SL 3VMOA 1EHLL 2LLLA 3D39E 4PJCF 3APMA 1N8ZA 3NACL 3SDXA 2ZKHH 3WEXA 3SGJC 5B8CA 4RFEA 3QPXH 4L18A 2VQUA 4ZD3L 1YMHB 4PRAB 1G7PB 4B9PA 4PRPB 2MSPA 1TVBA 3ABGA 3OB8A 3A5VA 3LVTA 3PGFH 5IQOA 1NGWA 3RA7H 3BHBB 1LEIA 5EBLB 1UEYA 4UV4L 1S6NA 3AS3A 3C08L 3KPOB 3P4NA 4TPRH 4G9FA 4UMGA 4DOHE 4EOWH 1ILUA 4XVJH 3UTTB 4EQ3A 1MNUH 2R56L 1QSEE 1GGCL 4JFUA 3US9A 4BZ1A 4F7MA 1DBAH 3CGTA 3LEXB 1WFTA 2DWSA 2PR4H 1MIEH 3ZGHA 1Y7VA 4L3EA 4B7IA 5IWLC 4DK3A 2AF2A 2D7TL 2H6OA 1YN7B 3IDGB 2GUOB 2L4OA 4AVIA 4C57C 1HHGB 1NDGB 2VXSL 4ORGB 2GKIA 1YVLA 4KO9A 3S35H 2ZPKH 3WNLA 4JRFA 4TNGA 4O4YH 4YFLI 4EBQH 4LVNB 1AKJA 1JWSB 1E28A 3EYSL 3KPRE 4PLKD 2JJTC 4PG9A 4GUOA 3NJLA 1IAMA 4X0KB 4HMCA 4Y7OC 1T6BX 4L37A 1J5DA 2H0JA 1F4AA 3MXWH 1KCRL 3PWVB 1OAXH 2VXQH 4ABUA 1EDQA 1NCJA 5IVOA 1MJ7L 2AK4E 2X4NB 5D7SL 3QZBA 4UM9B 3A47A 2QPFA 3NUKA 4GKLA 1SFDA 5EWIH 3QIUC 2YSTA 3L7FB 4N0UA 4CA4A 1N6QH 1P0SE 3CE1A 5A16B 3ARBD 1KT2B 4GOSA 3EOBA 3ARDD 3QORB 4QO1A 4Y19E 5C0AE 2WVUA 3GRBA 2JKNA 3MV9E 5FFOA 3HBZA 4ZUVB 3HB3D 1A1NB 1JV5B 3ARFD 1GYUA 1X5IA 2Y7SA 4R7NA 1UUSA 1MDAA 4PJ5A 4YSTA 3EO9H 5DEGA 2WZAA 2XXGA 3TT3L 1JTTA 4MCNA 5CN2A 2GTZA 5DWUL 4KX8A 2W94A 4IK7A 4OCXH 3VJ6A 1EX0A 2QV4A 1QSFD 5HYSA 2LV4A 5G4MA 3RDTB 3ULVF 1RZFL 3QI9A 1WUNT 5SWSA 3WS3A 4D9QE 5G4NA 5I1JH 3WFDL 1JGLH 1T2QL 5F89B 3U0TA 3RUGE 1ITCA 2YD9A 2EVGA 4OLUH 5TPWH 2R2BB 4DP2X 2OJZL 1EO8H 3C5XA 3EJZC 4K5OA 5DVKA 3RB5A 3ZIMA 1AQKL 1SY6L 2XPZA 3QFJA 4OGYL 4PJIF 5DGQA 4JGMA 1IM9D 2FT8A 4R96A 5MEOB 4M43H 3AB0C 3G5VA 1CG9A 3B9KB 5E9DB 1U91B 3SOBH 1TENA 4AXWA 3KL3A 3K6OA 3SBQA 1HKLL 1C7SA 4AQ1B 1E67A 3RPBA 4PBWD 3LB6D 2ZSWA 4TNFA 2GSIA 1SOXA 2QV2A 4HBCL 2LOEA 1WZAA 3R18A 4L1LA 2VAJA 1YPZA 2GJ6D 3CVCA 3W9DB 5D1XE 2OPCA 4ZFZB 2E27L 1QVOB 1ZS8A 1RUAH 3X1NA 5ENWA 4LQ1A 4DGUA 3FQXA 4FZ8H 1MHPL 4HC1A 5BS0A 4ODUB 1H9DA 1Z9PA 4ODXA 1EDYA 2K7QA 4TOYL 3KVPA 4HKJA 1YYLL 5JQIB 2F9BT 4XMKH 4KC3B 4Y2DD 5F6IC 1WT5C 3HZYB 1I1FA 4DUXA 2DQFB 2JKSA 3CDGB 4QHLB 5A43C 2CR6A 4GKSA 5MEPA 1ZDQA 2ZWKA 1RZGB 5J11C 5I19H 2NMSA 2XC8A 3MYZA 4ZTOL 2FWSA 3AJ7A 4YIQA 2CM6A 4WEBH 5DHVB 5AG8A 3MLPA 2R0ZH 2JI3A 1IEAB 2Q86B 4NDMA 2AQNA 4FL4C 4FN0A 4Z95L 1INEH 4JRYE 3BYTA 3REVB 3PL6C 1PKQA 5DS2A 5I1GH 3N1MC 3BSHA 3AT9A 3EJYC 5F7LB 1NKRA 3TC9A 1MCIA 4LSQL 3GMRB 1NH6A 4X6DB 2OR9H 3U25A 2JKIS 4JLRB 1PCXA 1WZKA 2FGWH 3IBEA 4WFED 1SDDA 3QRBA 4QTIH 4ZO7A 4K3HA 4R0LA 5DJ8A 5D5MA 5F7DB 3T8MA 3TVMA 1S7SB 4YSEA 1F18A 1ET5A 3MBED 1ZD6A 2MCG1 4EUPH 5FB8A 3CZNA 4Y16C 3ZTNH 5DYFA 5EU3B 1GRWA 5JMRA 4WKZA 2P80D 5E4IA 2QSVA 2VDNH 1T04A 1OV8A 3Q6FA 1JTOA 2ADIB 2JIXA 4NFCA 2Y07H 3EDFA 2BSCA 4GP8B 2FJGB 4PP1D 4UT9A 2WUCL 5I16A 4NCDA 2VN4A 5I8OH 4TS6A 4X7FC 3ZMEA 4KO5A 3ETTA 4YH6A 2NY6D 3T65A 5AW5B 5T1LA 1F4HA 3ZGIA 3ZE2B 4UBDD 4H88H 4R4FH 4KJQD 3EZ8A 4QRRB 3HPLA 1IM3A 2ESVE 2HZHA 4XTRD 1BIIB 2G3MA 4HJGB 1JXFA 1O7DC 4WY7H 5DHXB 4NO3A 2VDMB 5EIQA 3D4GA 3SCMB 3SDCB 4X6CE 3NRQA 1GOGA 4R4ND 5D1ZB 3OR7A 1MJ8H 1BVOA 3VXRA 1OB0A 4MMXA 3NJIA 2MMXA 3WMPA 4C56E 3SY0B 3M07A 3ZO0A 1F0LA 2OJ1A 1BLIA 1T5XB 4M7LT 5T3ZH 1L9QA 4HGKC 4RMRA 2RBLA 1EAQA 3Q01A 1QLFB 2ORBH 3ABMB 3FN9A 1TQCC 1FL3A 2CDFA 2GW5A 2OMZB 3CPUA 1FRGL 5KBNC 3MGOA 2RIKA 1A0QL 1JV2A 1X5ZA 2A38A 4H26B 4PGEB 5C7ZA 1DBML 4BYHA 2MHAA 1XVSA 4PJ8A 3RWCA 2Y1VA 3IMWA 2N1TE 5B4MD 1ZLSL 4M62H 3K0WA 1W72L 3PUUA 4QR7A 1S78D 4KGLA 1JZ6A 5ALCH 3F12B 3EO1B 3RZCD 5KYXA 2BY3A 3IKCB 4A2LA 5IQLA 1FZOA 4OAWB 4BELD 2TRHA 4XCCH 1R5WB 5BRZE 3BP7B 4WGVB 3AXHA 5LGKA 4K9EC 1ZANH 3O6KH 1W72B 3A21A 4ZJ9A 5ABDE 1TETH 3JUZA 4IOIA 3TZVD 1AY1L 3K6DA 4F8NA 1KGJA 3V5DB 3L4VA 4CDGC 4I3SH 4K9EH 4HS6A 5F9WB 3C6LA 1R24A 3DUHA 3QJXA 1UOLA 1N7ML 2X0UA 2K0RA 2W0LA 3VWJB 3GDBA 2XG4B 4FHKA 4IIQA 4JJOA 1UM6L 3BQUD 4FFYA 2FIKA 4YE4L 3ISWA 3NMEA 1KYOK 5C71A 4J3OD 4Y1TA 2DM4A 1S3KH 4H0GA 1BYOA 3MRKA 4TTDD 1Q0EA 3CFDB 3MRMB 1EXHA 2IF7A 3TIDB 4WSKA 4A68A 1E9QA 3I9GL 1X5XA 4NOBA 3BPCA 4OZGF 5I66A 1SJEA 5FECA 4I9WE 1FNSH 3ME0A 4LVNC 4PG2A 2EO7A 2R56H 1GGCH 4EIGB 3BUPA 5J12B 1RH8A 3CFQA 1PD6A 3QUMA 1HTYA 2Z31A 3V6ZA 2X4OA 3KDPB 4WTWA 4XCYB 2F68X 3BVXA 2D7TH 1N59B 1BBDH 4IGBA 1OAJA 5CD3A 1MN4A 5EN2A 1UH2A 3FQ1A 3TJPA 1SDAB 1FYTD 1K3IA 1ASQA 1RK0A 4DAGL 3D18B 2H2SC 3QORC 1D6VL 4JPQA 2ZCHH 4K71B 4HW6A 4PJDA 1E27B 5CZKA 3I84A 4XB8A 3BE1L 4OFIA 3H3PL 4PJ7E 4WI0A 5F21B 2YEQA 2F54E 2QPDB 4K4KA 3FNKA 3LSOA 3KS0H 1ZGLP 3STZB 1RUPH 5I1LB 5D2LA 2NY7L 3DX6B 3PG2A 3MROB 3QJOA 4WO4A 1QEWA 1W91A 3OAWA 4JR9L 4F8TA 1EQWA 3O4LE 4PY7A 4HVBA 3LVEA 2H8PB 3RDTC 1XGQA 4HIIB 5EB9A 1ZLVK 4OI9A 5EEXA 2HRGA 4IRJC 4E42B 5GGSB 3T0AA 43C9B 5AVXB 1U8CA 3GINA 5C0BE 5ITBL 4NQED 3D48R 5E1AA 2B59A 3LKOB 3K4AA 5BUPA 3RWHB 1QEXA 5E8DH 2XYCA 3GSNA 3N43F 2WXJA 3SBPA 3S48A 4JN2A 3TT3H 3ZHDA 3X1EA 1AOHA 5DWUH 2R2HA 1S7RA 1VFBB 1IL1A 5IBLC 4AV0A 4AQ1C 5JOPD 2W0FA 1CFVL 3TBVA 3ZDYB 1T2QH 2EE2A 1OHZA 1TUPA 4UNIA 3SBWA 4NUMA 3OF6D 3QIBD 4J1UB 3T0EE 1RQ5A 2IANB 4YOKA 2BINA 3CVHL 3ALPA 3GNML 4G6ML 3NIDF 2HFEA 4AJYV 1LYQA 1I1YB 4NQQA 2D31B 5HHOE 1ACCA 2X89D 3MRJB 5AYUH 3ATBA 2M1KA 4P2QB 1HKLH 2WBJA 2DMKA 2YPLA 5DMKA 3GSVB 5IQ7L 1UXSA 2DQUH 5JHDE 1XCTB 3KCPA 4HBCH 5AAMC 3BIBX 3UADA 1QKZH 1SXSA 3RVUC 2Q20A 1I82A 3L3HB 3UERA 1WBXA 2BVUA 1TZAA 3MRCA 3IDJA 4PJHE 4PH8A 4AGLA 4XGZA 4FFWC 3F84A 4TL5A 5FFGA 3MI6A 3OTTA 3R8BB 5LNGA 2TSAA 3VXUD 3ULVD 1BQHB 4BXVA 3QXDB 2F61A 3AG4B 4AITA 1IC7H 4TOYH 5EZOL 4G8IA 2CO3A 5DHVH 3S0PA 5LXGH 3TBYB 3FRUB 5HHQB 4KO6A 1V7ML 2JH2A 3D3VD 3PPEA 3FSWA 3WGVB 4G43B 4ISVB 3VXSE 4F1SA 4MD4A 2CDEA 3FUEA 4NNXA 4N20A 3CDCA 3EXJA 2R9HC 3L5WB 2CMRL 5KBMA 1MREH 1HINL 2VDPB 4ZUSA 4Z95H 2NQDA 5CBAB 3FHAA 5JNYA 2IC2A 4XWOD 5AKSA 4Q8BA 1L9SA 1D3CA 1A21A 3PXHA 5CP3A 2QVKA 4WLCA 4XAKD 2WWNA 1GKEA 2JCCE 2ZJSH 2DF3A 5T5FH 1SQMA 4ACPA 3T2NH 4BZ2A 1BAWA 1VKXA 1XIWA 1IKNA 2D4DA 2XZCL 1N9PA 5EBMA 1CI5A 1PQZA 2X42A 3CSFA 3MFFB 4ESKA 5T5NG 3VX1A 4U49A 3U0WH 3FU7B 4U1NA 3HVDA 4PJ9A 5JO5A 1ROCA 2DKUA 5DFWH 2BCKB 3APCA 4FTVB 1JJUA 1MQKH 1E4XL 3VA2C 1NKOA 1JRHH 1VFUA 2ZSVA 3JWDL 3SCMC 4GKNA 3SDCC 1T80A 1BM3H 5D1ZC 5AWNH 3C12A 4K3EH 4FP8L 3GIVA 2HJKB 2J6WA 4G8GD 3V0HA 4CC4A 4OLZL 4OZHF 1S7VA 5B8CB 2VDMH 2EUWA 1HEZB 1IBZA 2NNAB 3FQYA 5C9JA 3BUYA 4NT6A 4OZ4A 4WFGD 1TVBB 1OPGL 4YBHA 1G7MB 2KZWA 3HC3L 3QIWA 1X5LA 1FLRH 2XN9D 1JF1A 3HR5A 4X7DC 2QLVB 5HJBA 3J8F7 3O8XD 2O5NA 2PYFA 1C5DA 4H4NA 2CH8A 4G9FB 4KKAC 5JOFA 4AQAA 2OI9B 3AG2B 4Q52A 3FBKA 4PLNC 3PHSA 2XI9A 3IDNA 4CKVX 1T1WB 4G1MB 3HUJA 1PG7H 4F7MB 3IETB 4HJJH 2HRHA 3VGEA 1QLEB 4TQ8A 3G5ZB 2CRMA 3GRWA 4JN1L 4L4VE 3TWYA 4HOZA 5D7IA 3ARGD 4A2DA 3CLEH 2A99A 5JA8B 1J5OL 1T7XA 5F9WC 3EZJB 2HMIC 1AKJB 1I7UB 1W72H 2RHEA 4UQCA 4YHPB 3LNGA 4OKDA 4AIOA 3GMOB 3VWJC 3VRLE 5M7QA 1S7XB 4ALAL 3QZWG 4JFPB 1QTPA 3AUVA 4B9CA 3NDYE 2WTRA 1TQTA 5CSZB 5DJCB 3FTYA 2Z6FA 3I74A 2HN7A 4IOSA 3NIGB 2N3JA 3CDZB 3DDFA 3KGUA 4AH2B 4WWOA 2CUMA 1S46A 3IEAA 3D9AH 4G7YL 2AQRA 4OF5A 4MNHB 4GO9A 1AY1H 3ZYOA 1EJOH 2OBGA 3DJSA 2P5PA 4N0UB 4NQXA 3SSGA 4AVJA 5I2IA 3QDHA 2BS71 2OV0A 5ISZB 4XH2B 2Y3AA 2R2EA 4QGTA 3X2QB 3GSOA 3B37A 5J12C 2UZXB 3NFNA 1KIQB 1SRDA 4NUGH 2GJJA 3QUKB 2FWUA 4GXFA 4PGJA 1A2YB 4N2FA 5CN3A 2EILB 1HCFX 2YHGA 4OGAD 2BM3A 1YYCA 4GEJA 4KKCD 1D7DA 1V3KA 2EIJB 5SWQB 5IB1A 4XNUH 2KI6A 5IHZA 1I53A 1KSRA 1MFBH 3KNBB 1BWWA 3VJ6B 1RJZB 2J8UF 5DC2A 4AEHL 4F20A 1C5BH 1CYWA 2BP8B 1YQVH 1P5UA 4JZOB 4K71C 4RQQA 5K9OB 3MO1A 1YQ2A 1YN6A 3RWIB 4IRSD 4ZOCA 3EH4B 1CCZA 2V5MA 3TH3T 5IF0A 4PJEE 1B4RA 2AXWA 4DKEL 1BZ7A 1DBJL 5AUMB 4ABWA 4RFOH 3QCUH 4R90L 5JHLH 2BX5A 2KBGA 2K6ZA 5E1IA 1YNLH 1XEUA 3MJ9L 3K2IA 4K7FA 3O3AA 4DAGH 5DEZA 2ZUQB 4DEWA 3GXTA 2DBLL 2F53B 3KXFD 1GSMA 1TCRA 3M7FB 4G1EA 3IF1B 3MA7A 1OSYA 4MCYA 2ZSWB 4XN2A 1AZCA 3H3PH 3INOA 2HKHL 4ZFGL 1KN2L 2ZCKL 1RUKH 1QFWH 1K4DB 1FV1B 1NMBH 2C9RA 2CA4A 2YBGA 1ONQB 3FQNB 4LXFA 5GGRY 2WCGA 4ZX6A 2OL3A 4PP2A 2D7NA 4Z9KB 3F7YB 1T1ZB 4ANXA 4DGVL 3ECBB 4GAJL 1M1XB 1A7NL 1G1YA 1MWAB 1NFDB 3SIKA 3FQXB 4E0RA 1CS6A 3B2XA 1SXBA 3QPQD 2X05A 5CCJA 3P9MA 4N85A 1HVXA 2X38A 4X4YA 4GO8A 2HG0A 1XF5A 4YNYA 1NINA 1ORQB 2ATKB 5ITBH 4JREC 1NCCL 4J8RB 4S1DC 4Y5VB 1SVCP 1ZK5A 4LHQB 4NQSA 1JS4A 1P7BA 3FCSA 4U1LA 4GKSB 2PW1A 4GRMB 2I69A 4KNTA 4MMZB 4TNEA 4DUWA 5HYIA 1GC1C 4ZMAT 5KSAD 4LOUC 2KDYA 4OH2A 3EYUL 1SHSA 3AGWA 2YJLA 4NM4H 2EIEA 2JV6A 1CFVH 3B7SA 1GC1H 3DURA 1MIML 1KBGL 1X5FA 5IVXE 5EC2B 1IIIA 4L4TE 1O7DE 2BZ7A 4Y89A 1AYOA 1OTTC 4DP9X 2G5BB 3VI4A 3D06A 3L7EA 4G6MH 2BCMA 2H0FA 3KLKA 5DRZA 3C2AH 4LU5L 1IU1A 1HXKA 5E6SB 3IDUA 5T3ZE 1QUNB 3M86A 4O02L 2VE6B 4PUBH 2ED7A 4UYQA 2H0PA 3ML9A 2Q1EA 3IFOA 2VO5A 4K8RC 3QR0A 2X87A 1D5BB 4HPOL 1XO8A 1E5AA 1M7IA 4GKZA 4XMVA 2BS9A 4WKZB 4PS8A 3QS3A 3DX4A 3D5OF 4MJ5A 5JPMA 3Q6FB 3VTMA 3C60A 5BO0D 4MJIE 3FK3A 4K8RH 1GXEA 5EOTA 4JFOA 4D9LL 1KFGA 2WSDA 2H1LM 5KYYB 3NA4A 5I1DA 1QFOA 1GHFH 2AXGB 5IR1A 3EKCA 4OCWL 4ODSH 4KMTL 1H6EA 4AENA 4CVXA 3UG4A 2IV9A 1I9RL 5FKAA 5GZOA 4PRPE 4K2UL 4B27A 3DHPA 1NCAL 4OCYL 2FZ3A 3Q7JA 4HUUA 3WMSA 3PNWB 3TL5A 2VDPH 4P46A 4KI5C 1QRNA 4MFHA 1WBYA 2WP3O 4IRZL 3AUWB 4XPGH 5TDOB 1CXEA 1ZA3A 2ZUXA 3UTTE 5K9JL 5J1TC 5F9AC 3H9HA 3MLSL 2J20A 3HC4H 3DHUA 4QRUB 4AC4A 1CT8B 2E7LA 1VHPA 3EYQC 4X8XA 3PP3K 4NM8L 4B7LA 5INDA 1SBBA 4IKNA 1U4EA 3CH8A 4G9DA 1U8NA 4L8CA 2P49B 1DDHA 5I9QB 4A63A 4KZDL 1EO7A 3QWRD 4R84A 3N41F 1YEDA 2DYPA 3UBXI 4AZUA 2O72A 2F8XC 1T03H 5B8CC 5HYJD 2FHBA 3DHMA 1JZIA 2BVEA 4HK3J 5EF1A 3SO5A 4ELMF 4G6JL 4WEUD 1OGAA 1DVFD 2VDOL 4LCWA 1XBRA 1E4XH 3RGBA 3KL5A 5DVPA 3D30A 3JWDH 3U6RB 1WHOA 5LGHL 3FFOA 5AW0B 3WG7B 2FX9H 4JCMA 1ZLUK 5EUOA 1ZV5A 2HTLD 3T4AB 1XF1A 4FP8H 3C6LB 5EPMA 5F72S 4E5XB 5DLML 2OI9C 2AXFB 3DGCR 4MJ2A 3O45B 5D55A 1VGEL 3PS6A 1V7NH 3I6GA 3FTZA 1KEMH 1OSPL 4H2CA 5IJVB 4JFEB 1I7ZA 2BERA 1OPGH 1EEYB 3HC3H 4E2OA 1M3IA 3CFBB 3ILDA 2OMUA 4FXKA 3F01A 4BZ1H 4A04A 3D12B 3IJ8A 3FFCB 3BFOA 3TBTA 4F7KA 5ADOL 1QLEH 2PLTA 1KBWA 3A6OA 3O6ML 3F7VB 2NSXA 5IJCC 1EXGA 1SHMA 1TJHL 1C16B 1KB9J 1UVQA 2BDNH 2WAQA 5MENB 2OK0L 2VERN 5AW3B 3FZUC 2X4OB 3MC0A 3B43A 5AW8B 3WFEL 4KUCF 1P6AB 2H3KA 1DVTA 1A47A 4Y4HA 3EO0A 3BEWB 4X8CA 4F80A 3DX3A 1U58A 1PW3A 4IHOA 4JFFA 4TV3A 4C4KO 5E9DE 1GGTA 4DJMA 4KKNA 4PJGA 1BOGB 3FYEB 3IJSB 4ALAH 4MZ2A 4KFMA 3RTQA 2DMHA 3EHBD 3IN2A 1J05A 1KJ2L 4P0DA 1GMIA 2F7PA 1RURL 3WHE1 5DRXB 2Y6TE 5EORL 4G7YH 4QHPA 1EV2E 4WO4B 5CEYB 1IMHC 3BPOB 4AYFA 5BXFB 1JGIA 5I0YA 3V7MA 2AJUH 5AD0A 2V5TA 3K0YA 4ZXBB 1PX4A 1GGBH 4BQ6A 5B3NA 2WKGA 5SX5K 3FH7A 1KTLB 3QULB 5GGQL 4JDVA 2CUAA 2ZX5A 4KDTA 5C6TH 3IE4A 4ODWA 1QI4A 1FORL 3LPOA 3QNZA 1VESA 4P2RB 1Q9WB 4M02A 4PV9A 5LUMA 2QL1A 3QUYB 3A4FA 2WXHA 3GSNB 3GMNB 5C97A 1D5IL 2OSXA 3QQ9D 1R3IL 1ZVHA 2AVGA 1BP3B 2R2HB 1F3DJ 4XP5H 3HMXL 4XODA 1FG2A 3VX0A 4AEHH 3TA4D 2IWFA 3KAAA 3GI9H 5HHXL 3P3RA 3S35X 1BIHA 2ZUQC 3ZSTA 1M2VB 3LZFH 4HYTB 3CN2A 5AW4B 4E9TA 5KVMC 2BNQA 3VTAA 1JHTA 5I24A 4GAGL 4DKEH 1DBJH 4X5XB 1MI5A 1LE5B 2IH1B 1MFDH 3FBQA 1KLFA 3J7HA 2JLPA 4X6DE 3EH2A 4XMPL 5B3SB 4JQXA 2HFEB 1DJGA 5K39B 4X6BB 5HGDA 3MJ7B 3NRFA 2GI0A 1MCHA 5C0NC 4EQ2A 1SOSA 2D2CC 1ODUA 3BVVA 3JVGA 4IBQA 3PUCA 1KWKA 1DO6A 3OBAA 3B2VH 2CJUH 2WN3A 2WBJB 1X7QB 5DMKB 2CHZA 1XGPA 3ZDZB 1LO4L 4QJ5B 1MWAH 3CU7A 4MB5A 4Z7OF 3WD5L 4BFJA 2C7UA 3OKEB 4Y5VC 4P3DB 4Z3TA 5JZ7D 2ATAA 1A9BA 4JFZL 3RVVC 1S5HB 4YL9A 1JUFB 3NZ8A 2ATPB 2J56A 3OMAB 4JO8A 3O3EA 4EN2A 4CC1A 2AABH 4F58H 1QR1A 1ZHBA 4XPHH 1JYVA 4DP4X 1JZ5A 2EIDA 5LAPA 2E7BA 3AG3B 5MHSE 4DVRL 4ANUA 5IB2A 1JZJA 1UH4A 4DGYH 3T3MB 1MXGA 3ZE2E 2A6DB 1E2ZA 1F97A 3SDAD 1NCCH 2DQ6A 4LSSL 4QRRE 1BFSA 5HD8D 1CL7I 3QUHA 3GB7B 1YCSA 4LCYA 1AFVL 4KHXL 1IC5H 3BC9A 3LN9A 4S11A 2WD0A 3HN8A 4YHYB 5G4OA 4YHOL 3JV4B 3I3BA 2EVIA 2R69L 2F8VA 2AW2A 2Z93A 1A65A 3TVMC 4K3GA 2GJPA 2WLIA 4UILH 1ANUA 4B9GA 4Z77B 1BX2A 5AKVA 3C5ZB 4MZIA 5IHUH 4BA0A 4AIXA 3EFFB 5LB1A 2NX5D 4QRPA 3BD3A 4QTFA 1X4XA 3T71A 2PYED 2Y4SA 3M88A 2Y6SD 3UIZA 4M6NH 3H6JA 1FH5L 1CICD 2XACC 2HX7A 2YUVA 5EO1B 3LS4H 4JDZA 3MPCA 1VKXB 4PCSA 3FS9A 1PQZB 3WXWL 4XP6L 1OE3A 4TL4A 5ESQA 4ELDA 4PY8J 3T1FB 3EG9A 2W1NA 2V5RA 4KJYA 5IK3B 4YHZL 3VYPA 3QC5X 1LO0H 4X42A 1JMZA 1VPOL 1JBJA 5AVSB 4BQ9A 3TV3H 2G2RA 2V37A 1F8TH 2NYYD 3BMVA 3UX9B 3CQFA 1I4FA 1XR9A 1BJ8A 2DQCL 5T1MB 3L3JA 3REWB 2XIBA 4D9LH 5D1QD 1LQBC 5IV2B 2NXZC 3LTVA 5F9OH 3S5LB 5KSBF 4YHKH 1S7QB 1WFIA 1MRCH 5DQ9B 4N8CL 1N70A 4OCWH 2ZXCA 3ZYZA 2OMTB 2ZNWA 4Q9RL 1ZE3C 2PCYA 3FUDA 1RVFL 4QRQB 4OZ4B 1IILE 2H1XA 4NWTL 5CLWA 3VCLB 2V5YA 4BCZA 4OCYH 3SDYL 5I75B 1GTNA 4Q4IA 3QHTC 4AMKL 3OGCB 1HQRB 5I9QC 1QSED 3BCFA 3LN4B 3P40A 1ZE3H 1F42A 2GPZA 2HWZH 4ZSOA 1PBYA 4G42A 3VXMB 5JW5A 2J73A 4IRZH 2H2PD 2ITDA 3QNXA 1WWBX 3O6FB 4LHUB 3LZPA 2FQEA 2JB6A 5AW1B 1EZUA 3IDNB 1LWHA 3KPMB 4X7CC 2X2YA 3AT0A 2NT0A 2NZ9D 3FQRB 5T3XL 4ONGH 4YDLB 4NM8H 2I24N 3AROA 2UWEB 5IGXL 3TA3D 4Z23A 4ELKB 4A37A 2ZD0A 4OD3L 2W0KA 3QUZD 1GPOH 4TXVB 4TN9A 3C6LC 2FJUB 4W9KC 1NOLA 1QBML 3RURA 3MHZA 4JDTH 1EFXB 3L3DB 3E9UA 3FUKA 6CGTA 4GP4B 4WI2A 4MAUL 2FLRT 4LSUL 1ZLUH 1TJGL 2Q7AA 4GQZA 2P8LB 1XH1A 2YSSB 4HMEA 4OT1L 2PO6B 2ZT9C 1UACL 1UASA 4O00A 5C0AD 2NY4D 3ARWA 5I30L 4XN1A 1YNTA 2E56A 4WWPA 4U31A 2NNXA 2KZBA 5DLMH 5FCSH 4PG2C 1TCMA 5I1AB 1A6AA 4OF6A 1G4MA 1N5AA 1IT9L 3KM2A 3V6OA 1VAHA 3T2LA 1G7LA 2O5YL 3PWLB 3BZ4B 4JFXA 2Z31C 5DYOB 1U3YA 1CBVH 2X6MA 1H9VA 3HG1A 2DAVA 4TSAL 1W0WA 1ZDSA 2YO3A 5FLUA 1DQJB 2GBAA 4LPVA 2WTPA 1I8IA 4MRCA 2V7NB 3TEZA 3WFCH 3T3PF 1BXXA 3QQNA 3PGDB 2W91A 4HWEH 3ARED 4WFHD 3VI3F 4AGMA 4RRPM 1WISA 3IDMB 3RNQB 3ZDYE 4BK8A 4YHML 1KB9K 4BSJA 5A2FA 4PJXF 1TJHH 3FSOA 1G1OA 2OK0H 3H9SA 4LPCA 2IH3A 1SHWA 4YR6B 2IANE 3IAQA 4JO5A 3NCFB 4LGSB 1BF2A 4WO4C 2DPKA 4JRLA 2DEXX 2N4IA 3NESA 4M9OA 1NCGA 4AEIL 5E94B 2HVBA 1S8DB 2JCWA 2A9BA 1FFNB 2DQDL 3GXUB 4GSDL 5L88H 4ZXBC 5IROC 3TT1L 1J48A 3PWUA 1MCRA 3GD1C 3ZU8A 4G1EB 3MA7B 3Q3GB 5T1KA 3SKJH 4B50A 2ISDA 5GGSY 4DN3H 3VFVB 2H0EA 3QUYC 4NQDA 5F7NC 1KULA 5CR8A 3VFGL 5EORH 4LVEA 3HMWL 5SX5H 4RWYL 3IJYA 5I8KH 4XP1H 4QJ4B 4P4KD 4AQEB 5DF0A 3ROOB 5KVEL 3GSNH 2P5WE 2WN2A 4PJAB 3ULAB 4QRBA 1FORH 1SMDA 1WIOA 4NENB 5HHPA 4TVPH 3VFRA 2FECI 1JNLH 2GK2A 3BN3B 3HJEA 1KCUL 3QG7L 4BFNA 2XFXB 4WENB 4Z0XB 1U8OA 4XRCB 1D5IH 1R3IH 4KUCD 2K6YA 4ZMLA 3OM3B 2XG5B 4AVHA 4IKLA 4F93B 3QDMB 5GJSL 1KYAA 3EYOB 3RU8L 1I1AD 1H5BA 2BVQA 2G0LA 2WBJC 2YEVB 3TN0B 4HXAL 4KTDL 3CZLA 2J43A 3BP4A 5IIEA 1NAKH 3UBXA 3WTUA 3VTTA 1GTFA 1IZJA 5DVNA 2XRAL 3PWNB 4NIKB 4NP4L 4LSVL 1SOKA 4XMPH 4N2NA 1FFPA 1D9KA 2VIRA 3V0AC 4KI5E 3D07A 2PTTA 2XVLA 1H3GA 3GIZL 5C09D 2ZIDA 7FABH 2QR0A 2XWRA 1UTDA 1TYRA 2VRQA 4XHJD 3K8MA 3TBCA 1M56B 1RD6A 2PCPA 3PJSA 4M48H 2QT6A 2OZ4H 4U6YB 5BMFH 1LO4H 3CLFH 2F15A 3Q9QA 5JPMB 1AGEB 4FTVE 4MJ5B 4MJJA 5B1KA 1JXDA 3C60B 4OSUH 4QY8A 1TSRA 1SYSA 1U3HA 4QWWC 3VYOA 2X7LA 4JG1H 1I3VA 3EBAA 4JFOB 3L3GB 4XC3L 3NZHH 2EXWC 1NANI 1OAUL 4M8RA 1AYRA 4W9ZA 3VFWA 1J10A 1KJVA 3FOMA 4FQXB 3KWWB 4UNVA 5FO9B 3ENEA 1D5XB 1R6VA 3C5ZC 3K7UA 3FDWA 3MOQA 1SHXA 2K9UA 1AE6H 3QZWA 3QYNA 4MS8C 4LSSH 4B95C 5K33A 4G5ZL 1KCWA 1TFPA 4YLQT 4WCYH 1AFVH 4GEIA 3NABL 4NN6B 3GMLB 1JPTL 4JEGB 4WWKA 4QXWA 2DWEA 1YMMA 4CVUA 3Q05A 3BEVA 3ZT5A 4LCVA 3K3QA 2WLMA 5B21A 1FWXA 4G9FE 5F1IB 2FB4L 5CKGA 1NSNL 2Z8WC 5DD6A 3E8UH 3IN0A 5JW4M 3L3OA 1Q72H 2JKRM 2Q2EB 3H9HB 4X9YA 4X2UA 4NKDA 1CWVA 5E99L 1P7KB 2O61A 1SMOA 4ZAKD 2UY6A 2NYKA 4G9DB 1T20A 1FH5H 2AP2A 4S1RL 2Q8AH 1QLRB 1U8NB 3TJHC 4L8CB 3AITA 3VRIB 4FE9A 4MNQD 4P2AA 1C12B 4I0PD 1OARH 5C0GA 2DYPB 3U46B 2NRDA 1H3UA 3FB8A 1BMWA 1FUNA 5LN8A 1O6TA 2P24A 2VKXA 2J72A 3LRLA 2CBQA 1VPOH 5IUCA 3W1ZA 1ADQL 5B3JF 1YLBB 2FDBP 1BEYL 1KPVB 3NIGE 3HRZA 3MREA 4BWWA 5I75C 1L0QA 1KENL 3VFTB 5INCB 2DQCH 4N1HB 4O58H 3FO9B 2WIIA 5FM5O 2V5SA 4N0UE 4BFIA 1QD0A 2E6QA 3QWNA 5DUPH 5EPMB 1CFQB 4YFEA 5ISZE 3O6FC 1OM3L 2WXMA 3TEXA 2Z7ZA 4QXGH 2VC2B 3RX8A 4RNRA 5D7JB 1F6LL 3TNMB 4Q9RH 3CTTA 3WSQH 1RVFH 1MHEB 4R7DB 5GIRB 3H53A 4YDLC 4NWTH 4B5ZA 5FHBL 4PRIA 4FQJL 5CMAA 3D1MC 2OMUB 2IQ9L 4XPTL 2M83A 3AQZA 1JTPA 2A9CA 1KPUA 3BKJL 4Z7WA 1HIMH 3TH2T 1KV3A 3CU1A 1JPSL 4RMUA 4JGNA 2G3NA 3BRFA 2BW4A 3WIIL 2CBTA 3OD3A 2BIIA 1F6AB 2KZ1B 4OM1L 2DQIL 3PDOB 1T22A 3CSBA 2K45A 2ADFH 3DI2B 2PO6C 3NJMA 2EKSB 1LILA 5CEZL 2EVJA 1E5YA 2DM7A 5GZNA 3GPSA 3DPDA 3NAAL 4JFFB 4ZTEA 1QNZL 4O5LH 2ICEB 5EOQH 3C8KA 5CLZA 5DDHA 4FI6A 2F53E 5E6ID 4ZPVB 1TVHB 5J1AA 4FI7A 4C83A 3NH7L 3X13B 3BT2L 2PP7A 4EDXB 3B7YA 2AQPA 4GBXB 1TJGH 2ZZUT 1N6VA 4H5SA 3I6KA 3PXJA 4EI6B 4JL2A 1UACH 3CFEB 3EJJX 4FQ1L 5I30H 4NRYA 1NFDE 4XNYH 2SEBB 2EACA 4YO0A 4PYGA 5K59F 1CDCA 1P4LA 5TDPB 1VERA 1P5UC 4MAZA 3X11B 3VDCA 3WFBL 2AJXH 4OJFH 5TE6H 3TEWA 3SOTA 3PWPA 4FFZA 4ODTH 4PI0A 3MLZL 4AIEA 1DVZA 3X12A 5EOCJ 1NIFA 1IAII 3QNZB 3VSTA 1MCBA 2P47B 5FHAL 5F7EH 2F58L 1LP9B 4WUUB 4OI8A 5B1BB 1MLBB 1XGUB 3MU3A 4PRNB 3PIQB 4F7TB 1U93A 4WEEA 3FONA 4KVNL 4JFHE 4HX1A 2XQBL 3T6QC 1PJ9A 4MQXC 4MA1B 3T0ED 4GG6A 2AVFA 3VFSB 3GJEB 1SVBA 4CUCA 4OZFG 5D96C 4XMWA 5MEQB 2J8OA 2KQMA 4PAZA 4L4JA 4J2XA 5KZCB 2YBRA 3PAYA 4JKPH 3D0AA 3OWRA 1KLGA 1IBFA 1UWXK 2XKNB 1MPAH 1MVFA 2VLJD 3GF8A 4DHLA 3VW3L 4W1TA 2C9QA 4ABQA 4LKXB 3AQYA 2F1AA 3GUFA 1UEMA 3ILQD 4GSDH 4JRXD 2WCSA 2VMEA 1PYWB 1LHZA 5DJAA 1ND0A 3RVWD 3CXFA 1KTJA 3HC2A 3NN8A 5G2NA 4YSAA 3M8OL 4ENZA 3L1GA 2F2HA 1FL5A 4F33A 1W15A 5TK4A 1YEEH 1J87A 3DTDA 3V6BR 2JELL 5DSCA 4MBRA 3VFGH 4EZKA 1FVDB 5CSGA 2WWMC 4RWYH 1BZ9A 4OQTH 4YHNA 4PRDA 3U83A 3D69B 4GQ9H 1T1YB 4OUUB 5EUKA 5DJYB 2VMCA 4U6HA 1AHWA 5KVEH 4QTHA 1XFPA 3G6JA 3QQ4A 5B22A 3P30L 3TN0C 4OBSA 4OIIH 2VZ1A 5G55A 3QFGA 3KPLB 2BZDA 1VADA 1AZRA 2FJSA 2P26A 4NLAA 4TNVF 3ROLA 1F3DH 3SPGA 1CXHA 1KCUH 3QG7H 4OLYL 4Z8FL 3WNJA 3GO1H 4DEUA 4U2ZA 2FO4B 1MCOH 2PNDA 3BVUA 4ZX4A 4JCLA 1HNYA 2QSCH 2ZX7A 1JOIA 1UA3A 4HF5H 1WA0X 12E8L 2VXTL 2WLIB 2ZYHA 3O2DA 1WAAA 1BX2B 4QD2E 1G7JA 4DN4H 1TEYA 4XNMA 3U82B 3UZQA 4L8SB 3AS2A 1R3KB 1E5BA 4JE4B 5JPMC 3FFDA 1AD9A 3U6XA 2P5EB 3C60C 4LRIA 2JWYA 2XRAH 3GSUA 4NP4H 4LLAA 2GBVA 4H8UA 3ALWA 1FZMB 4ZUWB 5ABZA 1ACYL 1DO5A 3QWOA 4KVCL 4JDZB 3V5HA 5KVGH 1UXWA 1QP1A 3BZEA 4Z5RB 4X9IA 4FQXC 4XC1H 3IRZA 3UPRB 4XMLH 3QR1A 1HL9A 1NDTA 5J8OA 3WJLC 2JKTM 3RE0A 4N25A 1N10A 2PP8A 5FW8A 4PI2A 5GZOC 4LEEA 4N8PA 1A6TB 1RJYB 3H4FA 1BBJA 4OTXL 2PXYA 3QA3A 3QEGH 4F37K 2OX5B 4NN6C 3Q5YA 3OB0H 4B9IA 1NC4B 2VJ8A 4UF7C 2DYRB 2I07B 2AGJL 3JTTA 4M5ZH 4P46C 2CKBA 3ZKXB 1A8JH 2LTQB 4P4RA 3BLBA 2CBOA 1OAUH 3FB7B 3N44B 4BKSC 2LVEA 4M1CD 3HHSB 4PD4K 3W11D 3OKOB 4X99B 1NGPL 3UJIH 3C6SB 3FSVA 5EH1A 4JFEE 3N85H 4AYSA 1PVHA 2MNWA 4TUJA 1FZKB 3QIUD 4PJFF 1NL0L 5DMGC 1DSFL 4ZO9A 1RXLA 3MBXL 5D7LA 3VH8A 2KLRA 2CPUA 3CN3A 4P9HC 3VVWA 3OR6A 3BSZL 3FFCE 4JPIB 3FAXA 4LDLB 4RESB 2AEQH 5JW5B 3PHOB 4OV6F 1DQDH 2YRPA 2X41A 1IQDA 1GMEA 1Q8MA 2EP6A 4OCNC 1OGSA 2QQKL 4P9HH 3SBRA 2B16A 4YDNA 4DQOL 1O9ZA 4X6EA 4NNYB 5F7HA 5MENE 1FZJA 2C3HA 4K73A 1ESOA 4JQIA 2D3VA 1TZIA 4S1RH 4XBPA 5CXPA 4E9RA 4AGPA 1BHGA 4PS4L 1VACA 4Z78B 4KGJA 1OK0A 1D7CA 2F74A 2R4SH 3FSZA 5J6GB 1E4JA 1UURA 3K91A 4YDIL 3TYGL 1GAFL 4WSGA 4G8AC 3UC0H 2C9XA 3GMMA 2MWCA 4AOFA 1HJBC 5T3XD 2AJVL 1SLXA 5D7JC 5ETUB 1XWVA 1UWGH 1CGVA 3L6FB 1U2HA 3LMJH 4J28A 4NQCA 1G0XA 3VXQA 1J12A 1BYPA 4NSKB 2WKOF 5LLIC 3CUPA 2VC2H 5CILH 3A0OA 2IH8A 3MRNA 5D6CA 5L7XH 1GW0A 2FJFB 2G30A 2E46A 4LIQL 3D6GA 3DTXA 1A1OA 1IC0A 2W0PA 4J3VA 3ZJAA 4RDQF 4HKBB 2QDVA 4JPVH 5GS2H 3KYKH 2R1YB 2BWDA 1LTXA 4P2RE 1K4CA 3IMBA 5I1IL 1G84A 5FHBH 5FYLL 2EKJA 1F4YL 1A6VL 1Q90A 1ROWA 5KYWA 4YWGH 2GUYA 4Y4HC 2X28A 2K3HA 2W59A 4XO8A 3UDWA 1KTCA 3FO1A 3ESVF 5C08A 1NCNA 5L6YL 4TVPE 4PJBB 1GYWA 1RK7A 2DL9A 1PLCA 4APQB 3KLHC 1JPSH 2HPTA 4M5YL 5DJ0A 3T0WA 2Y06L 3BKMH 1UOVA 3H9SB 4GBXC 5H94A 3ZQ9A 2A3TA 3NCBB 2DQIH 2AS5M 5IP4A 1I9IL 4LK4A 4M4RA 5C07A 4HUXA 3IMSA 5LAXB 4LFHD 2CUHA 3D85D 1QNZH 2L7QA 1S4IA 4YC2B 4X7SH 1HOCA 4JM2A 3SDDD 2WQRA 1FN4B 2VL5A 2C3GA 4TRPH 1VEPA 4PRBB 4KDTC 2YK1L 4QRTA 4W68A 1SEQL 5EIVA 3ZDZE 1DEEB 2X6AA 3ZDXE 3IPBA 1U6AL 3MV8D 2Y1AA 5JYMA 2VLRD 2HLEB 3X1GA 3FU0A 5AEAA 5IW6B 3NTCL 3D2UB 2AV7A 4U6TA 2R0WL 2NT1A 3E6FA 3DGGA 4EXPX 2GC7C 5JR1L 4FG2A 1YA5A 3M7OA 2B9AA 1JI2A 2PPDA 4MA1C 4BSVA 3WFBH 3CD4A 1IB5A 3NEXA 3T3ME 1BA9A 2YD2A 4M7KH 4Y1AA 1Z3GH 2GSMB 2WB7A 1L4IA 1ZIAA 3A6BH 5E4OA 3VFRB 4OZIA 5DJZA 5HHVH 2OULB 3DRTA 4BJLA 2F58H 3OKLA 4ETYA 4I1PA 4I1RA 2Y3NA 2HRLA 4PRHB 1F13A 1HSAA 4JQXC 3RWJB 3IJHB 2CO1A 5J6HB 3UROR 3ZE1E 2BFGA 3MUZ1 4XPFL 1AS7A 3BMWA 3U4EA 4F2EA 4MQ7A 2XTJD 3ZK0A 3B6SB 1MZZA 2IIJA 1HHIA 5IIEB 3QG6A 4MX7A 2Y22A 3O2WH 4HPYH 4ADGA 1Q9KB 3BPLC 3QXAA 4RMWA 1FFPB 4PGBB 3VW3H 2MKLC 3HE6D 4ONFH 2QR0B 5MERA 1GS8A 3AY4A 3HZVA 3MLTA 2WQAA 3JBG7 5HGBA 1XGZA 5LWYH 4U3SB 4HJSA 4NWUL 1DANU 2H6PA 3CZGA 2ZOKB 1JN6B 1JWUA 4XCNA 4J3SA 1URIA 3KWUA 3COOA 3MLYH 1Q0XL 2HRPH 4IU3B 1CZ8H 4ZQKB 5CEXA 1K5NA 1TEFA 4N90D 1DQQA 3Q48A 3TO4A 1DJIA 3G08A 4DPBX 3VFWB 2FYYA 2Z65C 3LS5L 1KJVB 3NCYS 4PTUA 1P4IH 2R0KH 3U2SA 3GK8L 4LHJB 4P59H 1IFHL 2WYIA 4BK5A 4GRLB 4L8SC 3U30B 4UAOB 2VLKD 4X6FB 4BV1A 3ZKMC 4JO2L 3NPZB 4HWBA 3X3FL 4EO5A 4YN3A 5J57B 1MW3A 3PFQA 4JKLA 4WWKB 5AVQB 3S3DB 3LPWA 1BYNA 5FKPB 2WXPA 3VXME 1Z6JT 3TH4T 3X14A 1DCEA 3OAYH 2WYZA 1ZRUA 2BHFA 3SO3B 3T8XA 5FO2A 3WNKA 1EGJL 2VXUH 3GTNA 4UQAA 1ZWIB 4KPHL 4LLQB 5FYJH 3U9WA 1XD1A 3FN0L 4NKOB 3HBPA 1PAZA 4YUEH 4Z7NF 4NN7B 2O61B 3FT4A 1JPGB 1OCRB 1QYGH 2UWEE 2XOTA 2R23A 3CBKB 4DP5X 1HZHH 3ZL1A 5KJRL 4H0HB 3MGAA 2OA9A 2XTSA 1ACYH 3SYCA 4XXDA 2LTQC 3GHEH 5F2FA 4KVCH 4UOJA 3ZKXC 4G82A 3FN3A 3RL2B 1IBGL 4HWNA 4NIYE 1PZ5A 1PF3A 4P23A 4HUVA 4HLEA 3RGVA 2EVFA 4XO4A 4PBXA 1I7TA 1N5YL 3T2PA 3BWZA 5BRQA 1YEGH 2OMYA 4OTXH 3TO2B 3L4XA 2WUBL 1FSKB 1Y0LA 5H2BA 2Z35A 2YA2A 4QEGA 5ESVB 1YY9D 3QDJA 3OLGA 2YD3A 1RZ8B 4NKMA 4BCYA 5D71L 4CILA 1WA1X 4XXCC 5ICYB 1X44A 4ODHH 1DN2A 3MRGB 5DMJB 1NGPH 2OMWA 2UZIL 4RNRB 5ADPL 2FO1A 3OPZL 4EUPG 1JZHA 2KZKA 4UINL 5DUJA 2VSMB 1YDPB 3NEEA 5CINL 1NWPA 3ARYA 1S9WA 1CDGA 3D0VB 4FEIA 3D0LB 3VWKA 3SE9L 1U2YA 2VDKB 1W6LA 1KGCE 5I15L 4IRJD 5GISL 1T3FA 3APDA 4ES9A 3M17B 3HLAA 1NQBA 2ITCA 3ZR6A 1IVLA 5TH2B 1TQBB 4AUJA 1COBA 4N8VG 3JUYA 3I75B 1M6OB 3DXAA 1KIRB 4KK8D 2J6EA 4GQPH 3QCTL 3APNA 5CNHA 1X3DA 4G7VL 3PGCA 5E4EB 1AG6A 5C0CA 1NAMA 2A0LC 4HETA 2O6EA 3WLWD 1AQMA 3TPUB 3CFCH 1EERB 4HZAA 4PS4H 4U1IA 2XX0A 3IGAA 3QHFH 2EICA 4KZEL 1G7QA 3UJJL 4HC1L 3ZT6A 1OK8A 4FMKA 4YDIH 1QABA 2CNYA 2V2XB 2WHVA 4IOFD 3I85A 3TYGH 5F93C 3C8KB 2GEQA 5E8OB 3V6OC 1NMCB 3SJVA 4C83B 2IALB 4F7PB 1BAFH 4LSRL 4OY9A 2FBRA 3M1CA 3SE3A 1E5CA 2P4AB 3P0VL 2EDKA 2YFOA 1ZEAH 7PAZA 2BSSA 3INUL 4JG5A 1T21A 5CEZD 2A6JA 2IBZX 1OIOA 4WI9A 2UYLA 4CU7A 2YGOA 2WXGA 4YO0B 3FULA 2HT4C 4JDEA 3TESA 3LNDA 4APQC 3PQYB 3P3YA 1JK8A 4PJAE 4CADB 3VDBA 4XVTH 2AJ3A 3R06A 2B77A 1NCTA 4GB9A 4ONOA 3DJTA 3W0WB 2IPKA 3SDXF 3ATAA 1NC2D 5FYLH 1A6VH 3ZZLA 2YN5A 5FV1L 4H8WC 5AW7B 1BQLL 3AWGA 1D5ZA 4KOCA 5I1EL 4GW1A 4GRWB 1XSJA 1HH6A 1VZGA 3KPRA 4U33A 3OXSB 5L6YH 3DV6B 2BNRD 2C1OB 3QDME 4WUUD 3AXLB 4YC2C 1AO7D 1Q9LB 5MP6H 4CVZB 4H8WH 3DPBA 1K2DA 1S2EA 2C9VA 2EDQA 3AU1A 4M5YH 5I1KL 4GG6B 5LGJA 2GFBA 1N3NB 5HYQB 4N8UA 3Q1SL 4XCFL 5D4JA 2B8OT 2PPAA 1XB6A 4UT9L 3FPXA 3CFJB 3L95A 4XN5A 1HE7A 1ERNA 1KLGB 1M53A 1W8NA 4MYPA 3F7RA 3O9WB 5CD5D 3BRGC 4I3RL 3MV9A 1TTFA 2KHAA 4OGXL 5KEZA 2Q3ZA 1O7VA 1GY2A 4PS3A 4Q6IB 5EZJA 2IXQA 3TIEB 1DQML 3NN8B 4D8OA 1NCDL 1P69B 2YK1H 2X6UA 2E59A 5D2NB 3PFUA 1TZGL 1QMUA 3MLUL 4KJPC 5KVGE 5F1KC 4RZKA 1C08A 5EFIB 3FF7A 4LPWA 2ROXA 3GTVA 5DSCB 3OZ9H 3FQWA 5JQHC 1RZJL 2OXHB 3FQUB 3GI8L 3UACA 5EOCH 1U2CA 3O6LH 1WS7A 2V3EA 4HIEA 1WHPA 5EUKB 2OQJB 2VJ0A 2C8NA 5IB4B 4WU5A 2WO4A 4MXVF 3QQ4B 4QHKI 5JR1H 1H5BC 1AH1A 4N0CC 1QBLH 4MB3A 3RUGA 2I7SA 4HAGA 6TAAA 5CGMA 5T33L 2CXGA 4P3CL 1BZEA 4W9DC 4KI1A 3MODL 2QADB 5HI3C 3V10A 1JGEB 4G83A 4N0YL 1G94A 2YXVA 1JFQH 5GGVH 4N2DA 1FNEB 4J12A 1CLOL 1WFOA 3VM7A 2X0VA 5TQ0H 1ZHLA 4NERA 4F3FA 2FAUA 4E41D 2AFNA 1ES0A 1AIFB 1DLFH 2XPYA 3V5KB 1WFNA 5SWZB 5EDSA 3FFDB 5FDWA 5D1XA 3JV6A 3GSUB 1U3HC 2B20A 5C0EA 3L1OH 1QOKA 3K5SA 3MLVH 5DO8A 1KYUA 1TKWB 3FCTB 4K07A 1AGFA 2XICA 3C87A 1TDQA 2XA8L 3KPSB 4AG4H 1UXWB 1AGBA 5DFTA 1B0IA 3Q13A 2P8MB 2WBXA 2JB5L 1PIFA 2CIIB 1QA9A 1UD3A 4UIMA 4A7VA 1HQ4A 5J06A 3BT0A 2BMKA 3GSQA 4GRLC 4UAOC 3U30C 2QSQA 1KZQA 1OGAE 1P7QB 1QBBA 4GQQA 1OOAA 4WO0A 4OJEH 1Q0XH 4B9JA 4WWKC 1CFTB 3UTSA 4UYPA 5HVWA 4NNPH 5EU7C 2Q7NA 1UC6A 4AKPA 1YPZF 5EZIL 3SO3C 2FCBA 4A7UA 3LS5H 5FOBA 1CYXA 4ZODA 2Z1PA 4JRYA 2L3BA 2IV8A 2P45B 3R1GH 3U9PH 2YRLA 1BECA 1MDTA 4Z7VA 4NN7C 4J3BA 2A4CA 3IPFA 1WJ3A 1FHNA 3ILPA 3VG0H 4ZI8A 3DX8B 1XZ0A 4LMQI 4YEEA 5CJQH 4RX4A 3VH8B 4DF9A 4CSSA 2BS8A 3BH4A 1AGDA 3UZEA 1V3MA 2DQMA 3E7JA 5HPMB 1EGJH 4HK0B 4CMMA 3GWJA 3VGHA 4ZMPA 3FN0H 1UXMA 2YD1A 1RZIA 4Q58C 4DPCX 2X9ZA 2F5BL 1ZT7B 2ZG2A 3RX5A 4NAJA 4OD1H 4MA8H 1TZIB 4Y5XA 2V9RA 1FSKC 1BAGA 2BC4A 2DWXA 1TXKA 3OXRB 4X50A 5L2JB 4KHTL 3O0LA 5CGBA 2X4TA 5TTRA 2DQGH 5C8JB 3MNMA 4JFFE 3MRQB 4LEBA 2NW2B 4LOEA 2G3XA 2Z0UA 4OCLC 4QRFA 4PJGE 2A2QT 4YPJA 1OL0A 5CZRA 2DTSA 5HYFA 5E2VL 4KV5F 4NZTH 4ZRGA 5D5MF 1DEDA 5DJ6A 4WUKH 2FQDA 1FAIH 3P73B 4OZFA 2ZKMX 2E4FA 1MCSA 1HK6A 1CQKA 1I9JL 4NYLA 2G9HB 2QSTA 1P5VA 4I1NB 4JFVA 8FABA 5FOJA 2LLGA 3LHAA 2IDFA 3N5AA 1S7UA 5HGAA 1MCNA 1DJYA 2GBTA 2WVVB 4KBPA 5J1SC 3OG6B 3WENA 1U42A 4C56A 1TTUA 2W60A 1U8HB 2IOMA 5CJ8A 3LH9A 5I0VA 5BJTA 1JZ7A 1A1OB 4LDOB 3OSKA 4MXQD 4X9GA 4XBEH 2VMFA 1Y18B 2VDKH 4M6ML 1MRDL 2AK1L 3OPZH 3W39A 3HZKB 3QR2A 4KROD 5C2UB 3U7WH 5E4EC 4UINH 5F88B 1GR7A 2AV1B 4MAYB 3CMGA 2PR9A 1WH0A 2BP0A 3QZPA 3KBFA 1LP9E 1WZ1H 4M3JA 4XX1E 1BLNA 1VEMA 3H4HA 2LU4A 2D0FA 2Y1YA 3C5SB 4FCHA 4BUHA 5I15H 3MGTB 5DS8A 3IWUA 5GISH 4CU8A 2QQNL 4HFUH 5BOPA 4I0KA 5H37H 2YZ1A 5CJXC 4HCRH 1RZ7L 4XBGA 2DIBA 5GJTL 5BRZA 2JXMA 3L45A 3QJZA 1NMCC