1G43A

Crystal structure of a family iiia cbd from clostridium cellulolyticum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
160
Chain Sequence
AGTGVVSVQFNNGSSPASSNSIYARFKVTNTSGSPINLADLKLRYYYTQDADKPLTFWCDHAGYMSGSNYIDATSKVTGSFKAVSPAVTNADHYLEVALNSDAGSLPAGGSIEIQTRFARNDWSNFDQSNDWSYTAAGSYMDWQKISAFVGGTLAYGSTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords SCAFFOLDING PROTEIN
publication title Structure of a family IIIa scaffoldin CBD from the cellulosome of Clostridium cellulolyticum at 2.2 A resolution.
pubmed doi rcsb
source organism Clostridium cellulolyticum
total genus 36
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 1g43A00
3ZQWA 4B9CA 3ZQXA 4B9PA 4C8XA 4B96A 4B9FA 4JO5A 1G43A 2XBTA 1TF4A 2WO4A 1JS4A 1KFGA 4TF4A 3TF4A 2XFGB 3ZU8A 1K72A 2L8AA 1G87A 4B97A 2YLKA 3ZUCA 1GA2A 2WOBA 1NBCA 2WNXA
chains in the Genus database with same CATH superfamily
4LP8A 2MEJB 1EFXB 2OMVB 5D1ZI 1BOGB 3GNMH 2WBJD 4N0YH 4RMWA 5B38A 5MENB 2DTSA 1NDGB 1HIML 4PJCF 1UUNA 4A2FA 4BGDA 4AZ8B 1E4WL 4ZMQA 1E28B 1VAHA 2ZP9A 1ROCA 1SN0A 3BAWA 5HYSB 4XP6L 2SEBB 1J5OL 1JTOA 4YLCA 4FAAB 4YMPA 4ZI8A 4RAVB 3JV6A 3FNKA 1ADQA 3ZHNA 1L9OA 4JLRB 1FIEA 2ADFL 1JVKA 1KBBA 3F64A 1JGEA 5E6UB 4EBQL 5I30L 1GCFA 5JHDD 4JFEB 2WWNA 2C4XA 2EIZA 2V17H 5KSBE 5DVMA 3MHZA 2RQEA 1YN7A 4JANB 2FWUA 2X4RB 3WIFA 1KIRB 1CR9H 3H4HA 4A68A 2JF1A 2V5SA 5FYKL 1QFOA 4IIQB 1AE6L 5HYFA 4LL1A 4KKCD 2IH3A 4CSPA 4BKSC 5IF0A 1J8HA 4JQIL 5DFTA 3VUAA 2X53A 4PV9A 1GS6X 5HYIA 3P02A 4JRXB 1I75A 1U92B 3RA7H 3L95B 4BZ2H 3QQDB 1S8DA 1CGXA 4OI7A 2BLFA 4KY1L 2R2HB 5GGVH 4Z77A 2O6FA 5E6IC 3UPAA 3FOLA 4S1SL 2GW5A 4Z7NF 5DD5H 1SBSL 4ZX3A 1T0OA 3L4WA 4FMVA 1A22B 2AF2A 2O1AA 4RBPH 4WTZA 3MMEB 4PGJA 3N44B 4I48B 5EUKA 5F9JA 1ILSA 1I3RA 4POYA 1KCWA 1MEXL 3I84A 2BSTA 4Z18A 3H7LA 5JXED 1L9QA 1YEKH 3CXFA 2QGCA 5T33H 2ZUQC 3ENEA 4JM2C 4PGBB 1XCQB 1GGIH 4TSBL 4BA8A 4WFHD 5ESQA 1ZVSB 4GRLA 3QIWB 2YRZA 4X7TA 3TPUB 1JWMA 3EDDA 2XN1A 2J3SA 3MRIA 4F1SA 3S4SA 1FBIL 2VDRH 3DETD 3QZOA 4MMZB 2ICCA 2CBTA 5KAQF 1F6FB 3IE9A 4HBCL 3UJIL 4NZTH 2BHFA 4I77H 1T80A 1WAEA 3D5OF 3NRPA 4LDCA 4LPYA 2Q20A 3UTTD 1XF2B 1CGVA 2XQYA 3QUMA 1IKOP 3OBAA 3QZWB 4PJFE 3IF1B 4EZMA 5INCB 2VRAA 3V0HA 2UZPA 4BQBA 4UIKH 4JRYA 3L4XA 5T1DL 3LZFH 2YRLA 4JFHE 1LEKB 3BPCB 2QPFA 3BT2H 4DGIH 3FQUB 4MA7L 1A7PL 4U1JB 3WFBL 2HFTA 4OUUB 3TBWB 3Q8BA 4M3HA 4RGNE 4X6CA 4BQ9A 5GIRA 4XMXA 1D7FA 4UT9H 4PWEA 2WCSA 2VN4A 4U6VH 5A3IC 2IOMA 3RU8L 2K6WA 1NMBH 1NINA 3Q43A 4GUCA 5KTEL 3GSWA 1W0VA 5HVWA 2NY3D 3V7AG 1UZ6E 3ZT5A 3FQ4A 1UXLA 3GSUA 4EI6A 3GRBA 3O45A 3AXIA 2B9BA 1D7DA 2ICEA 1GGBH 3B56A 1JK9A 3BP6A 4YO0B 2DQJH 3LH2H 4FE9A 4JO2H 1IQWH 4RFEA 1JF1A 3CSTA 1NAMA 1RPKA 1FIGL 3WNJA 2C26A 1AANA 2RCSH 4OI9A 1JGIA 1SMDA 4JVPA 4PJBA 2X05A 4F7TB 2FT8A 4ETYA 4R90L 3V6FB 4M8VA 4Y4KD 4NZFA 5CEYA 3QNYB 1TOXA 3IDIA 4PRNB 4LLYA 4MJ5A 5LGYA 2A0LC 3ATAA 4JO5A 1ADQH 3NZ8A 2QR0B 5B3SB 4XC3H 2YD8A 1GS7A 1PIFA 1QHQA 2BNUA 2E75C 4KO5A 2VSCA 1M71A 3EJJX 3DX4A 5E9DA 4JAMA 5G2NA 4BHUI 5TPWL 1MUJA 2VTFA 1U0QA 2Z4TA 4CAGA 3WTSA 4QRTA 3GGWA 2FECL 4L2YA 5I23A 3LJ3A 1CD1A 5KJRL 2F6AA 2VB5A 1MCEA 1NDTA 4I9XA 4W9GC 3L7FA 3ATDA 1YZZA 2W07A 1UD4A 1JWSB 1A6PA 2VXVL 5FAAA 1CURA 4MA3B 4MCYA 3GXIA 4X42A 1XTMA 4OQTA 5KVFE 5HHMD 3ZSSA 1KCSH 5DVLA 3DO4A 3OKEA 3IDUA 2FIRT 4HJUA 5CLZA 1A2YB 1FORL 3C6LD 5E0QA 2CUAA 1RZQA 2J5LB 4ZT1A 4FABH 4YDNA 4WWNA 2BCMA 4HUKB 4Y16D 2W92A 5CUSL 4P49A 1OP3H 4KJWC 4F3FA 2N0KA 4UYQA 2DM2A 3BISA 4KV5F 1Q9LA 3JVFC 5DRNA 5AVUB 3KDPB 3OKLA 2JIXB 4HU2A 3VXOA 3VXRA 1G9ML 4FTVB 4UOQA 3B7UX 5ACZA 1GOGA 2R0ZH 5A6LA 2WOYA 4GINA 4XVTH 2IH1A 3EZ8A 4LLWA 3EYSL 2JH2A 4L9DA 1KTJA 2QSCL 4HS6A 3KE0A 2DN7A 3T71A 5B4MD 5FX3A 4YSTA 5IQ7L 2HVJA 4EUPB 2YGQA 4KXCA 1QEWA 3INUL 2NR6D 4PJIB 3O8XA 2YMOA 1MJ7L 4X5WA 5CBEA 3RB7A 3BUQA 3APMA 3UTSE 2BMKA 4GBXB 1JNHA 1MRDH 1TZIB 2VDLH 3QUMH 3O2WL 3QHTC 4IOSA 1P6FA 3CFUA 3FO0L 3SDCB 5DEZA 1Y1DA 5F7YC 1L7TL 3WO4B 3BDYL 3SGKA 5CJBA 3FH5A 1BECA 3V0WH 3U7YL 2XV3A 2WB1A 3MUY1 3FONB 1EEZB 3GZPA 5AYTA 4YGAB 2PR4L 3GJFK 4AM0B 3FYIB 4WDIA 4P5KA 3HPLA 4GRLD 1I9JH 2FYYB 1FQ9C 3OKNA 2C1PA 1HEZA 1T04B 4HIEB 2CK0L 2EYRB 3BSHA 4G8IA 4K7PL 4CN1A 4APXA 3AREB 3OPZH 1UTDA 3KXFE 2XG4B 3U2SB 2KBGA 5JW3H 1A5FH 5I82A 5EC1B 2ODIA 2WXJA 1EH9A 1BAFL 4PLJC 3KNBA 3MAWA 1FG9C 4OBSA 5G4MA 3KPNB 5DT1H 3KPPA 5LNEA 4BSVA 2CHDA 3LV3B 3V6OE 2B4CC 2X2UA 1DJHA 1LVEA 1NAMH 1RUMH 3DPBA 3TO4B 4JRYD 4N1HB 4XTRC 4AUYA 3QZPA 4R3SB 5TE6H 1FFRA 5EUOA 3DNKA 4XN1A 4JO8A 3NCXA 4N2FA 3SPVA 2QVIA 4AVHA 4JHWL 2W60A 3U7WL 4D9LL 2ZWLT 3L1GA 1HYSC 5EBWA 1ZLDA 2L04A 3LRLA 4KNUA 3P0YL 2VN3A 3O6FB 1XSOA 1ACCA 2J5WA 2HVBA 3LRHA 2EEBA 5E7BA 4Z3IA 4ETQA 4W9JC 4JDZA 3LKOA 3MFFA 3RYMA 4ZXBB 1YPZA 2IC2A 1F13A 3GMMA 1A02N 3L9RA 1IAKA 3NPZB 3KYKL 4JKPL 3DGCR 5TDPA 2XWCA 2MTAA 3QORB 4E2OA 1PX3A 3SBWA 5K1VA 1QSEE 3KDMB 2OMTA 3MNMA 2J8UA 5GGSA 1RHFA 3U4EB 1MCBA 5ICXB 3F65A 4HWZA 1U3HA 4OQTH 3LQZA 4ZTEA 2NY5L 1YN6B 2GT9B 4IDJL 2JI3A 1F4XH 1LTXA 4I2XB 2BSEA 2DTML 4P2RD 2JTYA 5DXWA 3U2IA 4AK2A 2IWGA 5EU4B 3BP7B 4IRSC 4E0RB 1AS7A 2NY7L 2CJTA 2ZCLL 3CG8A 1JF5A 1E7UA 1KB9K 2YIHA 5TE4L 4G5ZL 3X12A 1NBZA 5TH2A 2ATKA 3JYCA 4ODWB 5SWZA 1OEZW 4RGMC 6CGTA 1JNNH 3LS5L 4DW2H 4YSUA 1LMIA 1EUUA 1K3ZA 2XPYA 5DQDL 1HDMA 2YGOA 3ARVA 4F57L 2D7TL 4NRZA 4MMXA 4YHKL 3GMLB 4ODHL 1BX2A 2CUMA 2TSAA 2BS71 2EYTA 1E8XA 4XO3A 4U6YB 4MAZA 1AXTH 1MFVA 3S3PA 3OF6D 3M8OH 4Q8BA 3ZE0B 3QIUC 3FB7A 3U4BH 2ZUVA 4WGVB 3CDFA 3WEBA 4YWGH 2DI9A 3WLWC 3LMJH 1HILA 3LDBC 3SDAC 1S9XA 3BWAB 4MXVE 4F8QA 1VLXA 3S36H 1TETL 2ADYA 4G43B 2Q7AA 4XRCA 2Y06L 4LCIL 4PTUB 2G9HB 1HXYA 1T89A 2MQ0A 3L7EB 4R2GC 3RTQA 1UQSA 1J8KA 2G4EA 1G7LB 1KZQA 3EJQA 5E08H 1GJIA 4B9JA 4OLZH 4UV7H 1HWGB 3KWTA 1YEGH 2J1WA 1O9ZA 3LD8B 2GBAA 5DHMC 4P2OC 3ULUC 1NAKL 3QG7H 1U2CA 3QI9C 1V27A 4FZEL 5I5IA 3S5LB 5FK9B 3LZPA 5D7IF 4Y1SA 4YHOH 7PAZA 3QUGA 3FUDA 4E41A 2HMIC 4PJ9D 3RRQA 4K15A 4L29B 2LE9A 3ZDYE 3KWXA 5KYWA 1H3GA 5IJKC 4JQIA 1YEEL 3PFUA 2I5YL 5GS1B 2X4NA 4IOSD 4QRBA 1U58A 3CZFA 3U48A 5KJ4A 1PG7W 3MRPA 3QEUB 2CLRB 2D7QA 4IQHA 2YFOA 3KL3A 4GOSA 1IMHC 4GSRA 3GTNA 2R8SL 2OMXB 2WBJC 1S7TB 1H5BA 2EILB 4QAMB 4ABVA 2QADB 3L5XH 1CG9B 1XD1A 3MRJA 3QULA 3CSPA 4LLAA 3H54A 1XB8A 4Y2DD 4BFKA 5F7UA 1DUZB 2EIDA 2VDML 3BVWA 3G6JE 4TVSa 4YHNB 3PLYA 1Q0XH 2WQWA 3SGEH 2GAZB 1FJ1B 1QASA 3PJSB 1A47A 3D4GA 3JT2A 2YPKA 4KK8D 3K5RA 3VGHA 1QNIA 1K6QL 1NCUA 5F72S 1CIDA 2OMZB 3EGXB 3CC5B 1RZPA 2J73A 2L3BA 2ENPA 5HP5A 1ERNA 4MD4B 3M1OA 2K8MA 5CJOL 4FQ1L 5EEXA 3MLWL 2X1WL 1A3RH 2HLEB 1NLDH 4PPTA 4KKCC 1UH2A 3GSNB 1H0DB 1R33A 1PBYA 3FT9A 4PJCB 5A2AA 3IDNA 3NFSH 3OR7A 1ZLWH 3RPIA 4EQ2A 2V8MA 3HMWH 2A99A 1E9PA 2APFA 4M93C 4GRWB 3WTVA 4MWFA 1PKQB 1T83A 4FXTA 4N8UA 4U1SA 1WVZA 4CMMA 1JRHL 1UKTA 3D39B 2BVUA 4JO1L 2XWXA 1KN4H 1BBJB 5JW4R 2X2HA 3LN5B 1BOGA 5IWLC 5IQLA 2JB5H 2VXUH 2VR5A 5KW9L 2A73A 2Y07H 5E9AA 3Q13A 1DVFA 4F58L 5HYSA 2SEBA 4MDIB 2VLKD 5FWRA 5JXEC 3AMKA 4RAVA 1HQ4B 5DJXA 2R15A 5D9SB 4M9OA 2XU9A 4OFYA 4KX9A 1A4CA 3D05A 2QDVA 1YY9D 2CBMA 4UQ2B 4IRJB 4JFEA 5I1LB 3APNA 3SGJC 1SFDA 5SWZD 3RWEB 1ANUA 5BV7H 3DETC 4JANA 3QISA 1P0SE 4LOUD 1A6UL 1HIMH 2C5DC 3SYCA 1ZHNA 2NQ3A 3L4YA 4Z7NB 4IMKA 4IIQA 3B1UA 4L8SB 1J5OH 3FU9A 4WI8A 2D2CC 2W9EH 3P1VA 1EJFA 4JRXA 1U92A 2C9VA 4EDWH 2FATH 3B43A 3L95A 2P80A 3I9AA 3GS0A 4EBQH 4A39A 3VMOA 4W6WB 1KY6A 2DMGA 4CNIB 4FJZA 2R2HA 3AQXA 1UJTA 1YNTA 2XVBA 3P4OA 2CDGB 5T1LB 3TNMA 3BRGC 2BNRE 4QRQA 5K9QG 1WHPA 3VXTA 3ZSTA 3BH9A 1JHLL 5DFVD 1L9MA 1ZS8B 1MCWM 5MEQB 5FECB 5FYKH 1TZHA 3AUWB 4FLSA 3X1EA 4GUOA 3IFNL 4OR1A 4WO0A 1BEYL 4QHLB 3MMEA 3SPHA 4M29A 3ESUF 2CHXA 4I48A 5JOFA 1AMYA 5ENWA 3AADB 1KLUA 1A7NL 2NY3C 4A2LA 4HUCA 1JD9A 2IWKA 1XCQA 4X8XA 4W9FC 4JVWA 5CLTA 4Y19B 4ODVL 3O6KL 4F1ZA 2BOBB 4K7FB 4MA1C 5I8KL 3V0EA 2WYTA 4KO6A 5T3ZL 1SBSH 4L8CB 4J3VA 4MMZA 1RZGB 2JJTC 4JDEB 3JWNG 4XPGL 5D1QB 4LARL 4PJHA 2GJJA 4Y4KC 3M1CA 5B1BB 2YXFA 1GPOH 4KGJA 1SNRA 5DUPL 2J71A 1KPRA 3KJ4B 2DLHA 3C5ZB 5ESAB 3QZWA 2VQ4A 3IF1A 5INCA 4LSTH 1CFVH 5CMAB 2EDNA 3OMIB 2VC2H 1BFOB 4G1EB 4NNPH 2PO6B 5I73B 1FBIH 3JZ7A 4U1JA 4N24A 1H3PH 3UJIH 1EO8H 3H3PL 4NP4L 4PQXA 2BERA 1UD2A 2EIKB 4G9FE 1UWGL 4HT1L 4QNPE 2WXOA 4NOFA 3EO1B 5F7DB 1RIVL 3Q8EA 4JZJA 4XVJH 3SE9H 1HHKB 1IGJB 5CJQL 7TAAA 2ITFA 1S7UB 3C6LC 4ZX6A 5LWYH 3CFTA 4HJTA 5I8CB 1INEL 1IGIL 3NIGB 4WO4A 4X9BA 2ED7A 3WEOA 4UTAA 4YO0A 1A7PH 3WFBH 1CTNA 4Y16C 3Q8CA 1R34A 1NSNH 4U3HA 1LD9B 5ETUB 5E03A 3HFFA 4F7TA 1JTTA 1DQVA 1OCOB 3RBSA 3ZTEA 5J5EA 5J3HD 4H25B 1X5AA 5I1JH 3QNYA 1J86A 4I9WD 4FHKA 4UNVA 1W72L 5LQBL 2QR0A 5SX5K 2DLFL 2XTJB 3DROB 1CDJA 4OM0L 3I9GH 1DQDL 4PY7B 1TJMA 2XZAL 4PI0A 3TNNA 4ZFGL 2AK4B 2ZWYA 2VSDA 1AQKH 5B4MC 4H8HA 1IC0A 1V3JA 1OLZA 2JNZA 3L3GB 2FL5B 4PW3A 4QCIB 4X6EB 3TV3L 2PABA 3VD2A 3QS3A 4N3TA 2VLMD 2NR6C 3AM8C 4R90H 5H2BB 1FAKT 1CFSB 1MF2H 3GXPA 4JGMA 1J11A 1JWSA 1RMFH 5A2FA 1IBFA 2WKLA 2UY7B 1EFXD 1U8HB 1F2XK 4MA3A 1TQVA 4X5XB 5MEND 3VMPA 3BVXA 5AOZA 4CU6A 4HH9B 4ZW3A 2LR4A 4J3OH 1MFEH 3WIHH 1PZ5B 2WPGA 3EKCA 1EXUB 1ED3A 4NZDA 2BSCA 4OD1L 4WHDA 1XF5B 2CUIA 3D69B 2Z4QB 3ZT6A 1U33A 3HC4L 4NQVB 3B3IB 4BDVB 2WYHA 2VSKB 4JDTH 1EV2E 4GRLC 4ZOCA 5JDSA 4YDLB 4JFED 3U30B 3FU7B 1YYCA 4TXVB 2VXVH 1IGCH 2ODHA 3ZDWA 4FXKC 1URLA 3F6JA 1NOFA 1RAMA 5PCYA 3OAYH 3WHXB 2QEJA 1BFVL 4FTVA 4JN2B 4HULB 5A2JH 1Q0YH 2V3DA 3EJRA 3VI3A 4LDEB 4NZRL 1DQML 3SY6A 3V0FA 4JRXD 4P2CG 2WIIB 4J3OD 4U1HB 2NX5E 4MXWL 4EUPA 1UT1A 3CH1B 2YUZA 2WANA 5HHVL 1AD9B 4B50A 5J56B 1R75A 2IANE 4PJIA 3L54A 1BYNA 2AQPA 1TCMA 1UXWB 1AFVH 1S9KC 2XZQL 1G9MH 3K1KC 3LQAH 4GBXA 4ZUTB 3LIZL 5HHQB 4KHTH 1FP5A 1TZIA 5AW4B 1KCVH 1MAKA 4C83A 5TE7H 3ZIYA 1ML0A 3NACH 3HCVB 3SDCA 1NCCH 4ZSOA 3AS2A 4PTTB 5AL8A 5D4HA 2QSCH 3NCYP 4NI3A 4QYOB 2Z1PA 4KQ3H 3QDGB 1HQRA 3FONA 4KKPA 2XG5B 2Y22A 4BD4A 3M6DA 2ICWB 4D0DA 1AC6A 2EDJA 5C0GB 2AGJH 2ESVA 1NC2B 5IQ7H 1U93B 2ICEC 4Q74A 3DDGA 3QIWD 3CVIH 2WKOA 4XPHH 1YY8B 1QSFA 4HIEA 2EYRA 2JCCA 1JPTL 3QXAA 5D1XB 5DI8B 4YSRA 1LK2B 1OF2B 3X11A 1BGXL 3ES6B 1AP2B 2CIKB 3AREA 4CGTA 4M61B 3P0VH 2F53A 1U95B 2BVEA 2XG4A 1DBAH 3U2SA 3U9PL 5EC1A 2MNUA 2NY1B 3BDYH 1XGTB 1T20B 3V10A 1DQLL 2CBPA 1KTCA 2CQVA 3D2TA 3KPNA 4UTAH 3LV3A 5FM4A 1ZV2A 3C75A 3LNIA 1EJ8A 3TO4A 3NTCL 4YZFF 2NYZA 5AALA 2P5WA 2D31B 5L88L 3EJTA 3U7AA 1AO7D 1JG9A 3WKYA 4GP5B 4O2EA 3HEIB 2ZUXA 1P9MA 1N64H 3O6FA 3O3UN 1M57B 2CD0A 2IPUK 4XO8A 2G3MA 1QW8A 4MKMA 4QIRA 3HBZA 1MI5B 2B39A 3MXVH 2VAJA 4NIYE 1A9VA 4GSXA 4ZXBA 3TS8A 2C3WA 3CCHB 3D85A 4M5TA 2AXWA 4MTMA 4Z0XB 4ADIA 3IB4A 4WVRA 2OCJA 3QORA 4PJEF 1IKFL 1LO3L 2F1AA 4LLUB 4ZTOL 5DK2B 3KDMA 2OYMA 3U4EA 4RSYA 4ZTPL 1TZGL 1WD9A 2OTWB 3P0YH 4KK5D 4X5LA 5ICXA 3E2HB 3TIEA 2DQGL 4DP9X 2I9LB 1YN6A 4I0PA 3HG1E 5ADOH 4PGDB 4I2XA 2X42A 4JRFA 2DD8H 3IMRA 4HV8B 3QXUA 5I0ZA 2ZCHH 4E0RA 2IDSA 4GKOA 4JKPH 3VD4A 3QWQB 5IESH 2QQNH 2GHZA 4XXCA 2R4RL 4ZQTA 2V8LA 2Y7QB 4Y2LA 3FT0A 1IGYA 3M46A 4FKKA 1LEIB 2I07B 4GP8B 1SXNA 3S98A 4AYEC 5TJWK 1T5WB 1EGJL 4R96B 4PJ9C 1WZMA 3O8XC 3LH9A 2DRUA 3GMLA 1GYAA 2GQHA 3PGCB 3QNZB 4WI2A 2RFXB 3BAYA 4U6YA 3T2OA 2IV9A 4HCRL 4HLZG 5DJ8B 3DYOA 3VFWB 2V2XB 4C56E 3ZE1B 2WWMD 3T04D 1KPUA 4X6BB 3SGKC 1NGXA 3SQOH 2DYPB 2O6PA 5DGRA 2PYEB 3GFUA 1G0DA 4EUPH 1NFKA 4JY5H 1S5HB 1NDMB 1IZKA 3BWAA 4QJ3B 3BKJH 5HHNB 3JV0A 4WENB 1BYPA 4PWFA 3NSYA 5AAWA 2AAAA 3VVWA 3H2WA 4F57H 3UJJH 1OM3L 4FQIL 3V5HB 5AG9A 4HUXB 2B5IB 3S3CB 2G9HA 3GDBA 1HCVA 2JIXD 3L7EA 2IBZY 4NO0B 3STBA 1WBYA 2R69A 4R84A 2AJYH 1FA4A 4FTVD 2MQ3A 5C8JA 4JX0A 3T3PB 5F1NB 1IBGL 4KK8C 3X17A 4MB4A 3BCFA 4ODXB 4XZUB 4OKDA 2E27L 1HCFX 1TETH 2E5EA 3KLHD 4Y4FD 3JTBA 4KDTA 2VJXA 5FK9A 3V9FA 1FN4B 5DD3H 5DRWB 5JHLL 4QHNB 3AXLB 3N1QC 1FE8H 4KRPB 3IWVA 4NWUL 1OARH 3BEWB 5C09B 3RJDA 1OT1A 3F05A 3B5TA 3P4MB 4HF5H 4QKTA 4GBXD 1WWBX 1ZVYA 1BM7A 4G8AC 3NGBC 1WFMA 5GS1A 3SDCD 2AV7B 4W9DC 1KXTB 2IVFC 1XSJA 2DI8A 5HDWA 2GSMB 3UDWA 1F4YH 1H6TA 3QEUA 1GH7A 3EZJB 1GGCL 3D48R 2WSPA 3DV4B 1JV5B 1P5UB 2GIXA 3FBQA 3FFOA 3OXRB 4K5OA 1Y0LB 1I9RL 2OMXA 2HKHL 5GQBA 4AH2A 4YX2L 5JORB 4AIZB 1INDH 1E30A 2JB6B 5F6HJ 5BZZA 3RIAK 3IRPX 3U9UB 1YEEH 3QA3B 3ARED 1DUZA 5F7LB 4X9HA 3QEQE 1Q1JL 3C09B 2GAZA 4OT1H 1FJ1A 3PJSA 1KGCD 2P5PA 5L4IA 1YY9C 4HWBL 4ELME 2FEEL 2OMZA 4MQSB 3EGXA 4XGZA 3TO4D 2R8SH 1A1OA 1B2YA 3IXTB 2BJMH 4WJ5B 4NKDB 4MD4A 1KG0A 1QFUH 2QVFB 4LOUC 2CO6B 4NDMB 1I8MA 2BS9A 5BUGA 3RUGB 2Z92B 1GZQA 1OE3A 4Y5XA 3MROB 1N0XL 1S2EA 2P48B 4HLEA 1HSBA 4APQB 3TC9A 4MMXC 1H0DA 1WUNT 3O6FD 4HX1B 4XN7A 5DJAB 4LPWA 3DIVA 4OFQA 2WY3B 4PJCA 3TCLB 4HISA 4HAFA 5F6HI 4GKLA 5ITFB 4TL4A 3D06A 1E4XL 5DQJB 3BLPX 2VDPB 3P9WB 4ZXBD 4YH6A 3T1WA 1PKQA 1Q72L 2H0PA 2C8NA 1LP9E 3CVCA 3II1A 5FPIA 2RALA 2CK2A 2D8KA 3D39A 4H5SB 1HTYA 1WRFA 3BFOA 2R23A 3QORD 1ULVA 3AU0A 5DFVC 1P7KB 5EB9A 3DC0A 4C4KO 3EH3B 4X5QA 1CFNB 2J6EL 2P8LB 2APVA 3ABGA 5BV7C 4JE4B 3W56A 1FLRH 1G5AA 2CKBB 3CFNA 3KWVA 4Q2ZB 2NY4B 1VSCA 2BNQB 2K70A 1PGRB 4MDIA 1OGAA 1HQ4A 5DK3A 1BLNB 1GMEA 1CMOA 1FL3B 5D9SA 2AEQL 1CI3M 4LOEA 1TNMA 2D3JA 4JO1H 4F2FA 4IRJA 2UZXB 3UACA 3DSFH 4JJ5B 2H0FA 1ZTXL 3RWEA 1DFXA 5E8PB 1J9TA 5DD1H 3X3GL 3UPCA 3V4UL 3VXUE 1VHPA 1T2JA 2R69H 4L8SA 4F58H 5IJDC 4G5AA 1MFCH 1W72A 3DX7A 4HAGA 4P5MB 1UA6L 1AQMA 1OAYL 4GEJA 2BRQA 4W93A 4ABWA 1ECYA 1FRGL 2J88L 3L3KB 5D7KE 4Z95L 4H88H 4X4XB 4PV8B 1Q1PA 3OQRA 2RMNA 1UB6B 5DEGB 4ONHB 4CNIA 1G4RA 5T1LA 3SKOA 2CDGA 3FU8A 1BPVA 1T1WB 3K0WA 4HOXA 3DX0A 2KLTA 1XX9C 3F58L 2EQDA 3RTLA 1A6UH 1U8JB 1KN2H 4IBYA 4J3TA 5MEQA 4HJSA 5HI3D 5FECA 1M2VB 2C9AA 4MKTA 2KZKA 4MS6A 3HC2A 3AJ7A 2WYIA 1GW6A 1LO2L 3HRZC 1HOEA 4WHYH 4XHJD 5CBAB 1H5BC 4KMTL 4QHLA 4FI8A 3MA9H 4P9HH 3V8OA 3RKDD 4ZQKA 4ILDA 3O6LL 2ATAA 4RA3A 1LILA 1RFDL 4AKPA 2UZIH 1T7VA 3RURA 4AYFB 4FFZA 4H26B 3ETBF 3L3OB 3QWOB 4Y19A 3L1FA 1F6LL 2BOBA 2E7DA 4JR9L 3QC5X 2ZUWA 1G9NL 4XCCL 4L8CA 4KJQD 1HNFA 1RZGA 4ODTL 5D2LE 2E46A 5J3HC 1CLZL 1Y1UA 4HVBA 3GMNA 1B4LA 3IGFA 4NQSA 2GBVA 3U6XA 3VGEA 4EJ1C 2VW7A 2EO7A 2B20A 4OM1H 3WOVA 1XFPA 2JLLA 3TFBA 2CO1A 3VWJB 3Q7JA 2LGNA 1RUQH 3L3JB 2YKLH 4DP5X 2VR3A 5FM5O 3B1TA 2WLYA 3L48A 1BFOA 4G1EA 2PO6A 1RUKL 3CFJA 1T83C 2KI6A 1FG2A 1IVLA 3I6GB 4PI2A 1YVLA 3NSJA 3MJ8B 4NLHA 5ISZA 2ZWZA 3GSNH 3AROA 5FWQA 3LIZA 2HVKB 4LESA 2QADD 3EO1A 4L3CB 1HHKA 2PTUA 3TVMB 4LCUA 2XFXB 3MV7A 3O3AA 4GRWH 5I8CA 3ARDB 4XOBA 2WXNA 4J39A 4M56A 1CDGA 3MJ9H 5JQHC 4KQ0A 1N6UA 5E0FA 1CF8H 2R1XB 4OUOA 1AGBA 4Y2OB 4NXSA 4TM9A 1LD9A 4IKJA 4FQLL 1ZSDB 2KS0A 5ETUA 1OALA 1E6OH 3H3PH 4DZ8A 1OAQL 1EZVY 5E2JA 3U4KA 1NIAA 2APXA 1ZD6A 4YHZH 1NGPH 1KB5L 1A7RL 4HEPG 1G1YA 4IMKC 4IIQC 1LE5B 1I1FB 1INEH 1VZGA 4TVPE 3DROA 4PY7A 5IFJB 2YPLD 3MKKA 2XZZA 5FHAL 3OC8A 2AK4A 1ZT1B 4J3OC 3L3GA 2FL5A 4X6EA 5HDQL 3F6IA 4P06A 3IDJB 4KI5D 3ISWA 4WSJA 3DVGA 3BGMB 5IB1B 1PLAA 2L0DA 1CFSA 2QVKA 3N1GC 3PXHA 3V5KB 4WHTB 2ARJQ 2V7HA 4JRWA 4JCLA 4HEMA 4WI3A 3ZTDC 5C08B 3K2IA 2K9FB 3SYAA 1CIUA 3WAKA 3OAZK 1PZ5A 1EXUA 1XF5A 3D69A 2Z4QA 2V3FA 4HALA 3QAQA 4NQVA 3B3IA 4BDVA 1ZGLM 3QIWC 5FUZH 4M7LL 4IRJD 3EYFA 4WFGD 1TTAA 3FU7A 1ZOXA 3SE3A 4HKXA 4MMZC 4PH8A 4AOFA 5IUSA 3ASNB 5BO1L 3T6XA 3WHXA 3LSOB 3P9MB 4JN2A 3E6FB 5I5RA 1W8EA 2WTOA 1G9MC 3LQAC 3QFDB 4PB9H 3WFCH 4HUNB 3DJRA 4FFZH 1SM3H 3UBGA 1AZNA 1QLRA 5EBLB 4AYBA 3HC4H 2WIIA 1R24B 3VG9B 3KR3L 5TK4A 4ES9A 3RY4A 3OLDA 1SOXA 5T1LD 1HH9B 3CH1A 4Y4HB 1GVIA 3HAEG 4H0GA 3FDWA 4N90D 4LVOB 1EGJA 1YLBB 2VW6A 1UXWA 2YC1B 4X7FC 1P4IH 5HYJB 4Y1AA 3WS6A 5D2NB 1BYOA 3OMZA 1MHEB 2JSFA 2MOVA 2X6MA 4FYTA 3HCVA 1KV7A 4J28A 4S1RL 2QV4A 1DQMH 1ZXKA 3BZ4B 1XBDA 4OCWL 3SDXB 3EDEA 4BE5A 4NUJB 5GRUH 2XG5A 1JI1A 2HRGA 2ICWA 1TTBA 1Y6NR 3L3HB 1F0LA 4MXWH 5C0GA 1CCZA 1U93A 2WWKT 1RIUH 4Y19D 1NKGA 1ETJA 2GG1A 4WNSA 3CFEB 4ZFOL 1I7UB 1NLBL 1YY8A 3BFWA 3KD4A 2OMNA 3QS2A 1MG3C 4KK5C 2VMEA 1LK2A 1OF2A 4KTYA 5D1XA 2NDFA 1AP2A 2UWEA 1SHSA 4OGYL 1OK0A 2I26N 4M61A 4GRMB 5D1QD 1BMZA 4K94L 3IDXL 1HX0A 3WTYA 3LVTA 1N9PA 4OZGF 1QFWI 1XGTA 1T20A 4GW4B 4LGSB 3GJEB 1XCXA 5K9OB 2N7SA 3C5ZD 3QEGL 3T0EB 2NZ9C 1QQDA 4XNUL 4Y5VB 1HZLA 4XWOD 3WDIA 3PQYE 5DTFB 1JPTH 4WUUB 2PO6D 3MUHL 4RBPK 5EIIB 5JHLA 5K93A 3KPSA 4IW4C 3PP4H 4EQ3A 3LZRA 3J07A 3VI4A 4FG4A 5ID0B 1CD0A 5ANME 1ZPUA 2FBJH 2E6QA 1GAFL 1MI5A 1NGWB 1X5IA 1QLFB 2CNYA 2CIIB 5HHOE 2WWMC 3CCHA 3QR0A 2ZF8A 4M6NL 4Z0XA 4MNGE 4AIEA 2V9TA 2J5LC 1HAWA 1KYUA 3NCEB 4OIAA 1Z9SB 2JKJA 4G8EA 4CMHB 5BJTA 2XQBL 4GT7A 2X6AA 2VZTA 3P54A 1FNHA 2OTWA 4JFSA 4BFIB 5AKTA 4HEPA 2IFFH 1K4DA 2I9LA 3NUKA 3S5YA 5FR3A 3HUJB 4PGDA 4LOFA 4W9CC 2XQ0A 3KW8A 2IAMB 1D7BA 4HV8A 1BVOA 4FHJA 3TX4A 1FNGB 4XX1E 4WI5A 3FU6A 4CBPA 2XTJD 3IETB 4X80H 3PV7A 1KNOB 5C3IA 5D8JL 3RZCB 1EO5A 4HWBA 4ZNEA 2MJWA 1Q9OB 4TQ8A 3KLHC 1HWWA 2X0UA 4BKLA 2I07A 1MJJB 5KVDH 4WHCA 1AI1H 1VJSA 3G3LA 4R96A 2DQGH 4ZK8A 1BG1A 1Z9PA 1BQ5A 3T3MF 3MV8B 3KXFB 3PGCA 2WTRA 5AUMB 1JBJA 2RFXA 4GBXC 2OXGA 3KS0H 2NQDA 2YR3A 3NJGA 4NO3B 2V2XA 4N0RA 3RPKA 3TT1L 3BPNB 1N6QL 1YMHB 3SDCC 2PMZA 1GW0A 4MAUL 4X6BA 3NG5A 3WO4C 4C54A 3BO8B 2DYPA 5CKGA 3TA4D 4CJ0A 1ZGLB 2APTA 2PYEA 5F0MB 2XIIA 4LRNL 5LN4A 4Z7OE 1S5HA 1NDMA 1V5JA 5HHNA 3GMOB 5KS9E 2XT1B 3TYGH 1DVZA 2VCOA 5E1HB 1KXQE 1EGJH 1PQZB 2CSPA 3ROOB 1VFBB 2DW5A 3EDKA 4JO4H 4L18A 2J6EA 3V5HA 4WGKA 4FLQA 2H3XC 4HUXA 3V6ZA 3MUZ1 4LSSH 4MZ3A 4NO0A 3BH8A 3AREC 5HI5D 5KVFL 1MREL 4FNTA 2WUCH 4FEMA 4LIQE 4AM0Q 4HUWB 3VX0A 1F3DH 5F1NA 3IVKB 4B41A 4HPOH 1JZ2A 3FQ2A 1ACZA 4FFTA 3MR9B 4ODXA 4GO8A 5E8DH 4XZUA 3SD2A 1LHZA 5BS0A 1AGFB 2E0PA 3QPQD 3TO4C 4Z3GA 3BKML 2VABB 1CB4A 5AKSA 1T1ZB 2JKTM 4MZ2A 3N41F 5DRWA 4QHNA 4R4ND 3AXLA 5FYLE 3MSPA 1PG7L 4NO5B 4F9LA 1J1XL 4OCNC 5KYXB 2F5AL 1UD5A 2HWZL 5C09A 1P9MC 1F6AA 3P4MA 5EA0H 5A43C 3O6FC 1UFUA 4LVEA 3L4UA 2DWEB 3T0XA 1IBGH 1UOKA 2Q8AL 5E5RB 1KXTA 2H1LM 1OP3K 3ULUE 32C2B 4ZXBC 2VKXA 5FDYA 4JFDE 1X5MA 3CWGA 3QDGD 3TM6A 3DV4A 1JV5A 1P5UA 3QORC 5JHLH 1LQBC 1NC2D 1Y0LA 2WVVB 2D03L 5JORA 2LVEA 2E56A 1QI5A 2ZKHH 4LSUH 4M6MH 4NWUH 1DYZA 1AYRA 5SWSB 3VMNA 4AIZA 4I87A 4F8NA 1KT2B 1SJHB 2JB6A 3DSNB 4IRZA 6FABL 1J5HA 1WZLA 1BZQK 5D1XD 3FH7A 3U9UA 4RIRB 2AERT 3K6NA 5E23A 3QA3A 4GSDL 1IC5H 1KWGA 3EF7A 3Q3GB 3WFHB 1RULL 2IAAC 3ARGA 3QH3A 3KPMB 5EH1A 3BVTA 2R2BB 4OF8A 2DEYX 2XZCH 4K07A 3MOAH 3EOTL 3RVVD 4RDQG 2VZ1A 5F0JB 1NPUA 2WK2A 2XYBA 4XXCC 3IXTA 4LASL 4NKDA 4PHXA 2WVSA 4CC1A 2MQGA 1CLOH 1NUNB 1UENA 4NDMA 5IB3B 1HXMB 4LL9A 3RUGA 2Z92A 4JHUA 4IBLT 4XE5B 1A64A 3MROA 3HG5A 4PJGF 2PXYA 2A6KA 4BFGA 5J6GB 3BW9A 5DYOA 4APQA 5DUBB 1GHFL 3QUXB 1Z0MA 4N0FB 4RFOL 2BPBA 3S35X 1MI5D 5ITFA 5DQJA 2XXMB 5JHDE 1AKJA 4HWBH 4I3RH 3VB8A 5ILTL 1NC4B 4H5SA 3RNQB 2AV1B 2I7SA 1M9SA 3P4LA 1P7KA 3RGVB 5F1IB 5HI3C 1HXKA 4HXBH 2VE6B 1CFNA 2P8LA 1H8OA 3F84A 5AAWC 1XXFC 4XHJC 5T1KA 4Q2ZA 4NPKA 4P23B 5F7EH 3RJQB 2BNQA 3FQRA 1N5AA 3D12B 4N2LA 3RKDC 5ID1B 3RHWF 4I85A 2CHNA 2L7EA 1E4XH 1BLNA 4TPRL 1FVDB 1Q72H 4PMFA 3K8LA 9PCYA 1OB0A 3V6BR 4YJZL 2KC0A 1MNUL 3X3FL 2CJUH 3W11D 1YYMH 1CDBA 2UZXA 4Z3EA 1OTSD 2CM5A 4JJ5A 3LD8C 5GSRA 3B2MA 5DJYB 2AJZB 2AQ1A 3IM1A 3MNZB 4IK7A 4UT6L 5AWNL 1ZS2A 4DH2A 4KDTC 1PYWB 4AW7A 2H2PD 4QR7A 1WZKA 5F96H 1RJYA 4JFZL 3R06B 2OYLA 1SZNA 4OB5L 2YGPA 4ONGL 1PSKH 3QJOA 1MCRA 5JPMA 3QUYA 1RHHA 4P5MA 4BELD 4M02A 1NBCA 1MFMA 1LQSR 1RSYA 2AEQH 3A23A 3GSVA 3K8MA 3L3KA 1W6WA 1KUMA 4QTFA 1DDHB 4WFHE 4PV8A 4X4XA 5CXPA 3VW3H 4MYPA 4P9HC 5GS1C 1UB6A 1VADA 4ONHA 3T0BA 2HUEA 2IBGA 1V3MA 2YBGA 4R5TA 3HC3L 4XNXH 5AZ2H 1ZTXH 3UDWC 1VPOL 2DYPD 3AT0A 1EJOL 1U8JA 4HGMA 1ZEAH 1M2VA 3L4ZA 3TIDA 2QGBA 4PUBH 3VQLA 3V4UH 3PHOB 4RAHA 3UTTE 3WJLA 4M1CD 5CBAA 2GEEA 2YZ1A 2QADC 1TTUA 3ILEA 3CVHB 4DUXA 5IEKB 1I7ZB 5KYNA 5EEVA 3ALWA 4B60A 5H35B 5I1KL 1QHPA 3NN8B 4XO5A 1IILE 3CN3A 1F58H 4A2EA 4H26A 4AYFA 3L3OA 1HNGA 3QWOA 2BWIA 3L2LA 5B1KA 1JNLL 4K2UL 2YA2A 1J48A 3ARQA 4JZOB 5JW4Q 4IRZH 4WY7L 2GSGB 4KXDA 1DJSA 1MHPL 4JFWA 3TWCH 4HWEL 1H8NA 4OFPA 2BINA 4G7QB 3MLPA 1QX1A 3LOWA 3EXLA 3O6LH 4MJIB 5C09D 4AI7A 1OZUA 1Q9KB 5K59E 3WXWH 3TF7C 3VWJA 5F9OH 3BKCL 5L2KB 2VJ8A 1HI6B 4OBRA 4YHYB 3L3JA 3CH8A 4JR9H 1J1PH 3UYRH 1H8SA 4G42A 2FK9A 2W38A 1G9NH 3LKQA 4NJAL 4WTWA 4HPHA 5DZOA 5FOJA 1U4FA 2AMGA 4KI5C 3I6GA 5K9KB 3ISYA 3O9WA 3MJ8A 3MFGB 3P9LB 2MOGA 3HI6L 4G6FB 4I89A 4JHZA 5E7FA 2UUDH 2RD0A 4L3CA 3TVMA 4DZBB 4OCYL 3FB8A 2VDPH 1JZHA 1XF1A 4EZLA 3ARDA 2IGLA 1L9PA 1IAIM 4M1DL 4OIBA 4YDMA 2UXFA 3KYAA 3CZJA 2R1XA 3EIFA 4NUGL 5I1GL 2VLRB 2BNRB 1ZSDA 5I1DB 3MZGB 2YRBA 2HTKD 5IEHB 4IRJC 5AQ0A 2WO3B 2CKBH 5PAZA 5HHME 1NIEA 1X9RA 1M7XA 4PCSA 4RQQB 5AOMA 1Z5HA 1SLVA 3B37A 5FCUL 3IMWA 3ECVA 4W9IC 4LCYB 1LE5A 1I1FA 4APQD 5CINL 4L8SC 5DS1A 4IKIA 4L4TD 1KEML 4YC2B 3RI5F 5E70A 3WXVH 2B7DT 5J7CC 2DWDB 4ODUB 5CJ5A 1QOKA 2LAGB 3L81A 1CD8A 1ZT1A 3CMOL 3V5DB 3PGFL 2F74A 3HS8A 4U6XB 3EJUA 3IDJA 1OAQH 1YAIA 3BGMA 4ORGB 3QXVA 4ANKA 3NEOA 4A7VA 1FZKB 2VXSL 3O81A 2B3RA 5D93C 2DMCA 3A21A 4WHTA 5I18L 3WN5B 1Z9LA 1AZBA 2NY4D 2YWZA 3AG1B 5GRJL 1DBML 5E5MB 3VFVB 4Z76B 2MNWA 1AKPA 1BJ8A 2CLVB 4L5FH 3D18B 4V2CB 1TCRA 5B1CA 4I5BA 2HN7A 2WLJA 3ZUNC 1A7QL 1L0XA 4N85A 3VRLF 4NHUB 3WE1A 1DUYB 3CX5K 1U30A 4HWUA 1TEGA 1EHAA 3EYVB 3VFPB 4NB7A 5CILL 3TJEL 5D1QC 4IBTA 3LSOA 3P9MA 4LLDB 1ZLWK 3E6FA 3ZHFA 4AYID 1PX4A 4M5YL 1P4LB 4OZ4B 1V8HA 2QT6A 3KJ4C 2O72A 3NEEA 3C5ZC 3HTLX 5TFSL 3RX9A 5MEPB 5JPNA 2PWDA 3TT3H 4OGAD 3BPLB 5IG7A 5KVGH 3O3BB 1S46A 1SVCP 1HK6A 1MIML 2EXTA 1MCOL 2WCGA 5C0AB 3D25B 3SE8H 4XWOC 4AVKA 3FZUD 1HH9A 1OP4A 4Y4HA 3FO2B 2PO6C 4G3YL 5I73C 4R9HA 2YUVA 2BP3A 4LAQH 3STLB 3TPKA 5BO1H 5IW3A 2IGFH 2PLTA 3IRZA 5HYJA 1BZ7A 5D2NA 5CLYA 4XCEB 5IBUG 1INQB 1MHEA 1QWUA 4S0TD 1DJWA 2AK1H 3FQWB 1CC3A 3BZ4A 4JRYE 3K80A 4NJ9H 3SDXA 3CLFH 4HIXH 1URZA 4MLSA 4OZGB 4EF3A 4U3SB 3MDJA 3NIFF 2B1HH 3L3HA 4HKZB 1DZ0A 3DRTB 1NWPA 3GC3A 1XEUA 1ZE3H 1Y18B 2V4LA 3NCWA 1I7UA 2GJ6B 1EAPB 1L6PA 3QCUH 2OXHB 3OZ9H 5C7ZA 3VNZA 4RGOL 3SDDB 1M42A 4EIZC 4S1RH 1SYVB 1QP1A 3QJTB 2IQAB 5AG8A 3GJEA 2VDOB 4FFYA 3HNVH 4PJAF 5EORL 2XTJC 4S2SB 4Z7WB 1NFDF 3VWJD 3T0EA 1V10A 3UERA 4Y5VA 1ZANH 4TQEL 5DTFA 1FAIL 4WUUA 4ABQA 2YEVB 3M17B 2V37A 5FGBA 4PJBE 1LM8V 3I75A 4OGYH 3ARFA 4A7GF 5C07B 4W9EC 4P2RE 3D4CA 2R7EB 3NPSB 1UOVA 2YXWA 1UM5H 1CTOA 3OTTA 3BUYB 1NGWA 1QLFA 1TVDA 3K6OA 2P7TB 4A37A 1IM3B 2CIIA 1VGEH 3JYBA 4KVPA 3SY0B 1E2WA 4XT1C 5FM5M 4XNUH 1YHPA 4N2HA 3ARDD 3E9UA 4PRAB 5JDJA 1MWAL 4U1GB 3BUDA 2ZXCA 3P77B 4TSAH 1IFHH 2IANB 4Y9CA 4BFIA 4YDLC 1L3WA 1L3NA 1IQDB 3U30C 4BK8A 3SE3C 1EDQA 1UWYA 1NWOA 3A3YB 4JPWL 4AMWA 3NJIA 2DBLL 3CQFA 5I71B 3VNYA 1GAFH 2P46B 2WB7A 3HUJA 5HI5C 3C60A 2G3XA 2IAMA 4YDKL 1MCHA 3LNFA 4Y9FA 3ZTJG 2H3NB 1A9EB 1QUNB 3BQUA 3OXSA 5F7KC 2B1OA 3IETA 1KNOA 3OM3B 2XNAB 1PZ2A 2WYZA 1NOLA 3FW6A 5GZOA 3LXBA 3RZCA 1J5IA 3B9EA 1Q9OA 3QPQC 1A4KA 5BW7A 1MJJA 5FW8A 3FULA 3TASA 3VD9A 4R4NC 4N3UA 3PWJA 1E40A 3VACA 2WUBH 3MV8A 3NMEA 3KXFA 2Z93B 3DV6B 1S7WA 5AUMA 2G4GA 4XODA 4DGUA 4LCCB 3GBMH 4AJ0A 4BUQA 3KH4A 1IX2A 1CGSH 4QXVA 4OLXL 5C08D 2R1WB 1EJ6A 4NQEB 4JFUA 3WN6A 4JGJA 2YN3A 1HAUA 5IBTL 3BO8A 4WI4A 4YHML 1KTKE 1ZGLA 2EC8A 4L1BA 3FO9B 5F1OB 4G72B 4M48H 1U42A 2EVIA 2WQVA 3ROOA 4OV6F 1F41A 3E9TA 4KNQA 2Z65C 1IJNA 2DZEA 1Y07A 5D1XC 4KMLB 3U0TB 4FF9A 4IOIB 4K8RH 5EEYA 1N6QH 4HUWA 2GBUA 1JUFB 1Z3GL 3VXPB 5JIQA 4MAUH 3G6AB 1KCRL 1T03L 2NY1C 4ANUA 2V7NA 2Y6TE 1T6BX 5DJZB 1A6WL 3MR9A 3FO1B 3RVVC 1CXEA 1GMIA 3RFRA 1DANT 1QSEA 2VABA 3EYUL 5CGYD 4KROC 3F01A 4PJDE 5HTSA 5KSBF 3O11B 4UT6A 1JPST 4Y4HD 5LGKA 2XRAH 3VXMB 1OWWA 4DFIA 5AVZB 3DURB 2WV3A 3ZDZE 4NRXA 1MPAH 5TQ2L 1MREH 1YEWA 3VFOA 1A6AB 3D2UB 2ADGB 2IG2L 5HYJD 1JGUH 4FFYH 1JZ4A 2DWEA 1IAIL 2YKKA 4ZO9A 2EH7L 2W9DL 2ZQKA 3CPLB 1WPCA 2AHIA 1G7PB 3T08A 32C2A 2HKFH 4DGVL 4K8RD 3MLSL 3WU1A 2YD1A 2ZWKA 3QIBB 1C7SA 2D73A 1DEEB 3BEVB 2QGEA 1SJVA 3Q1SH 2OP4H 3G9VA 2F0CA 1WBZA 2WVVA 2V5RA 3CQPA 4Z7QE 3OAYK 1KT2A 1SJHA 1X9LA 2LVCA 2VUKA 4JHAL 4Z0BH 5IMOB 1GOFA 1CYGA 4LMQE 4DTGH 5BUAA 5J06A 2D9QB 4RIRA 2PWEA 3E2HC 4XC1L 3Q3GA 4LKCB 4KVCH 3J8F7 4Q97A 2EVFA 3WFHA 2C3XA 2Z7UA 3MLZH 3KPMA 2R2BA 5I1EH 3IYLW 4JKMA 1TTCA 4RMBA 1N5YL 3S8FB 1QTPA 3G08B 4KMQA 1FPTH 3W11C 3T0ED 2C1OA 1OTSC 3FU5A 4QHMB 5IK3A 4WCYL 3PWNB 3UG4A 3D0VB 2OK0L 1O5PA 1VDGA 3GHBH 4WUUD 2H2PC 4PS8A 1M7IB 3C2AH 2VL5B 4R0LA 2FUQA 4R8WL 4GSDH 5J6GA 1HVXA 4LFHG 4A66A 4B9ZA 2VLKE 4GUPB 2XC8A 2YO3A 3QUXA 4N0FA 4O2CB 3HOGA 1FI8C 2W0LA 1LO0H 4E36A 3A4EA 3WIAA 4OJEH 1B9ZA 1SQMA 2K9UA 3FMGH 2EXYD 1KACB 3VRJA 3HNTL 1NC4A 1SY6H 3MRRB 3OHXB 3RNQA 1D6EB 1E50A 1UWXK 1D5ZA 1ITBB 3RGVA 4Y9GA 3NA4A 4ZD3L 3FH8A 5GGQH 3VCLB 2VE6A 1E27B 1GZPB 3SGDH 3QWRA 3AY2A 2PCPB 4M1CC 4P23A 1URIA 2X6VA 5D71L 1KC5L 2DMBA 2B5IC 5CLXA 5ID1A 1A3LL 1NCAL 1JGLH 5BXFB 3BQVA 1F4HA 1W80A 1NGZB 2IAMD 4ZNCD 5CP3A 1P5VB 2A6DB 1NCGA 3WFEH 2AQRA 2CRYA 4UQEA 1KTRL 3HB3B 5D6DA 4NQQA 3S3DB 3JWDL 3PHAA 2ZOKB 3K2KA 4MAYB 4Y5YA 1C5DB 3QYMA 1BQSA 3RZCD 4DK3A 5DJYA 2AJZA 5EO1B 2Y5QA 3CSYB 4GT0A 2Z91B 5DJCB 1GR7A 5E1AA 3AW5A 2IOOA 3R06A 4DK5A 1M1XB 4MBOA 4HCGA 4KRPC 3MV8D 1HH6B 5CU5A 3KXFD 4U0QB 2E8ZA 3VGBA 2VMJA 4X7SL 2PCXA 3LAFA 2YXMA 2OSWA 3TZVB 1IEHA 4BA0A 5DR5H 5GGUB 1ZA3B 2C34A 1BIIA 4ZUWB 4ANVA 4HIHB 5AWNH 4YFLI 5TDNB 1P5UC 2UXTA 3S2AA 4LPTA 3PHOA 4ONGH 1HL4A 5SV4A 4AL8L 2O6EA 3GI8H 2RH0A 3CU7A 3KVDD 3LRMA 1G1OA 5LDSA 3CVHA 4NNYB 5LAXB 2BH0A 5IEKA 1AC0A 1I7ZA 2WTPA 1PNCA 3PHQB 5I0XA 4CU7A 1IC4L 1ZDQA 2ZCKH 5H35A 1XZWA 3GDCA 3NN8A 1RK0B 3C09C 4ONFL 4WI6A 4AUUA 4DN3H 5IJCC 4YGVB 3AWEA 3IPEA 5E4OA 4UOW0 1LDPL 3S97C 1EJOH 4Y2NA 3KGRA 4B0MB 4AIXA 4JZOA 2HTKC 3ZGHA 2LLLA 3RL2B 5IFAL 1UA3A 4Q6YA 1G9NC 2GSGA 5CEXB 4GQRA 2GUOA 3GK8L 4MQ7B 1KF9B 2WZPA 5EOCL 3UO1H 2DQUL 1EAOA 1UA7A 3HC0A 4JPVH 1BFTA 4APQC 4F7CA 1BD2B 2KDGA 5I1KH 2IMMA 2ITCB 5BRQA 3CZSA 4UB0L 2FHCA 5D5ME 1M2OA 4GW1B 3WIIL 4X4YB 1SFHA 1HI6A 4H20H 1IV8A 4FDWA 2AVFA 4UOJA 3QJXA 4K2UH 4KH2A 2PWFA 4M43L 3HPJB 3QJFA 3B2XA 5CN2A 3RAJL 3APCA 3IKKA 2ZOWA 1NCDH 4LVNB 2HT2D 1R4XA 1SOSA 4I9WE 4ZODA 4HWEH 1PLBA 2VRQA 4H1LG 3AB0B 5SWSD 1N4XH 1NMAL 3CDYA 4HIIB 4G71B 5AZEH 4LQFH 4FQCL 2YRPA 1D9KB 1W8OA 4XH2A 4JM4H 2NY4C 2QKIB 4IMLB 3BKCH 1AQDB 4FLOA 5M7QA 1Q90A 1SDAB 2BIQA 4XE0A 4NJAH 2VL4A 1MH5B 5F6IB 5E5UB 4A2DA 2VLME 3H6JA 1FGNL 2BNRA 1MCIA 2H1XA 5I1DA 2OSLB 5IEHA 1DTUA 3LNEA 1R3LB 5KN5B 1UADC 1SHXA 5IGXH 3FL7A 5MENE 5DVNA 3O2VL 2Q76A 1XEDA 2BY1A 3QARA 3K2MC 4RQQA 2IGTA 3HMXL 3O2DL 3T8VA 4YL9A 3FCUB 1T2QL 1I7RB 5AW6B 3NFNA 3MJ7B 3ROLB 2JK5B 1XR8A 3QUXD 3S7GA 3B8YA 2DWDA 3LKSA 4ODUA 4NQUA 3SO3B 5IQOA 4EI5B 4DAGL 4OGAC 4XMUA 4NUGH 3GKWL 2NLJB 4XBEL 4Q9BA 4U1IA 5D70H 4JFEE 3FZUC 3FN0H 2F68X 4U6XA 4M8UA 1NC4D 3FUKA 1KLFB 4P3CH 1WAAF 3IGLA 2ED6A 1FZKA 3SIKA 4D0CA 1T7ZA 4KDVA 3RGVD 5INDB 3BD5A 5FCUH 3Q5YA 4HC1A 4LLVB 3BP4B 1YEDB 5D1ZB 1UH3A 4C58B 3DWTA 5CINH 3WN5A 2H6PB 2R56H 3UX9B 3WJLC 4JRXE 4JO3L 3CXDH 3HBGA 3IJ8A 3QQ4B 2F15A 5HD8D 3FCBA 4L1HA 5KOVC 1JF6A 3GEWB 2CLVA 1BSIA 1D6VH 5B3JF 2ZOLB 1X5YA 3L3OC 1G7JA 3KL5A 1S9YB 3MI6A 1MJUH 1F97A 1KJ2B 4GAJH 4KHXL 1G94A 2VXSH 2EICA 2ZZUT 3C8HA 4OCXH 4MJ4A 5I18H 2ROXA 1E8WA 1QBMH 3EYVA 1AOHA 3ETSA 5T5FA 4B9GA 1IBDA 5F9AC 3CVHH 2D7PA 4F5CE 4LLDA 2I7OA 2C4FU 3F3HA 4W6XB 1DBMH 5GRJH 3V4VB 1B6DA 4FG0A 1P4LA 5EN2B 4OZ4A 5TF1L 4OLUL 3D0AA 1L0PA 3I74A 5IB5B 2DWSA 2OCCB 5MEPA 1CDHA 4GG6F 3VWJC 3O3BA 5IQ9A 1YC7A 1A7QH 3D25A 1D2PA 1LL1A 2CU9A 3FO2A 3MNVA 2AJUL 3QAZB 3NIFB 4X8CA 2R0LL 1ZKAA 1CXHA 5DZLA 3STLA 1ZE3C 3O9WC 3VDAA 4E9SA 1CL7H 4RSVA 3G6DL 4F8PA 1QO3B 3FN3A 4XCEA 3CBKB 1INQA 5GGRA 1NL0L 5F70A 2XWZA 1XL6A 2ZPKL 1U91B 2ZYIA 5AVTB 4K3DL 1TJGL 1PMYA 2IWFA 4YBQD 3TVMC 3LXAA 3RDJA 3ARDC 3P3UA 4FL4C 4U1KA 5JR1L 1AO7E 1JE6A 4TQIA 1RUAH 3M88A 4FNRA 2VLJB 4GXFA 3DRTA 4P57B 1A66A 4PJAB 2DKSA 4DEUA 1NFDB 3VSUA 2GJ6A 4NM8H 1EAPA 2PP8A 2WOBA 3HI5L 2C9RA 1TITA 2UVEA 1JYXA 5GJSH 2X1QA 2OMBA 3S5ZA 3SDDA 4PV1C 4C4KT 4N2OA 5JTWA 4QWWD 2QZ5A 4WI0B 1SYVA 2DQHH 1U2HA 1UJ3B 2CE6A 3NZUA 4MJID 4ZO8A 5GRYA 5TF0A 2YD6A 2QHRH 1BIHA 4NC1C 4S2SA 4Z7WA 1KBGL 3W9DB 5BUPA 1MELA 2GYSA 1DFBL 2R9HD 3HZVB 5L2KD 4LKXB 1C7TA 2X6UA 3STZA 4GNKB 2W94A 1PFOA 3FHQA 3JUYA 4AXWB 2IWEA 3EGDA 1B4JH 2OR9H 3KG5A 4R7DB 5IMMB 3FYEB 3OKDB 3BGAA 1CI5A 4ZUVB 2GCYB 2VQTA 2HLFD 4LCWB 2MNJB 4A6YL 4PJ7F 5IT2H 1ZA6B 4ZMWA 3NZHL 1DO5A 2R7EA 1OP9A 4G6FD 4AC2A 4XB3A 3ZL1A 1FSKB 3BUYA 3ZDYF 2P7TA 3KLDA 2DM3A 1IM3A 4LP5A 5E2TL 4N8CL 4D8PB 1ZJBA 4G7VH 3SY0A 4JFFE 5IHLB 3UTPD 1DVTA 3MGOB 1N59B 4KX8A 3QE5A 4PRAA 1KJVB 3II2A 1MIEH 3I6LD 2HXAA 3H3KA 2VLRD 2BNRD 1MRFL 1F42A 2IANA 4HC1H 4ERSH 5CCKL 1IQDA 2W59A 2VKWA 3FU0A 4Z8FL 3JXAA 4DKFH 2AXFB 4FEIA 5EU3A 1W8NA 3WHE1 1DQJB 4AYMC 1OCCB 2Q6WB 3CUPA 3NEXA 4L4VB 1A9EA 4R4FH 5AFAA 1WLHA 5AVSB 4Z23A 3SKJH 4UILH 2Z7ZA 1I4FB 4CVXB 1UD6A 1ETB1 2LU7A 4HHAB 3VG9C 2JLPA 4XO9A 5FGCE 5CGYC 4ZMVA 5J12B 1F4WL 5T5FH 3VSQA 1GSMA 2FVNA 4K9EH 1E4JA 4Y4HC 3LEYH 2DBLH 3MJGX 1YEJL 2HH0L 1HHJA 1YDPB 3CN2A 1SVBA 4G9DA 4LVOC 4FTVE 5B1AB 5B7EA 3DV6A 3TBYB 1I8UA 5D2NC 4DN4H 2ADJA 2QSVA 2R1WA 2AZAA 4GMTH 2ZJSL 4NQEA 4TVPL 2GY5A 2V5TA 5JNYB 4K8RC 4JFVA 4EI0A 3FO9A 1OKEA 4LU5H 5I6LA 4LVHB 2OM5A 3LN4B 1KELL 1LO4L 2FECI 1D5IH 2XBZA 4P2QB 4PJIE 5DMIL 2DQCH 3BVVA 1JNJA 1BJ1J 3EFOA 1J12A 2YLKA 3T65B 4K23L 5F8QC 1WIUA 4FQXB 5C0BB 1JPFB 3U0TA 1KCUH 2NSXA 4O02B 3GXTA 1JUFA 2OZ4L 2GY7B 1IBZA 3VXPA 3WD5L 1IT9H 5E8NB 1DJGA 1E9QB 3LKPA 2Y36L 2X1PA 3P0GB 4IJ3B 5DJZA 4GUQA 2VUOA 1EEYB 3FO1A 4ZFFB 4Z6AT 3Q1EA 3T0EC 3LZLA 4Y5VC 5C0AD 4HLJA 3CZNA 3FTGA 2OPCA 5MERB 3PV6B 3O11A 5JIKA 1HHIB 3DURA 5FGBC 3WUZA 1OAXL 1L0QA 2DS4A 5AENA 1SMOA 5GS2H 3OAWA 3MBXH 1A6AA 1EUTA 3HG1A 3H55A 4PVLA 1KGCE 3BJ91 2VDOH 1T03H 3ERXA 1ODAA 3D08A 3AG4B 1MCKA 3CPLA 5BRPA 5B39B 5DC0A 1UC6A 2EXYC 1QR1B 1FYTB 4WK4B 2EUZA 4PGCB 3BEVA 1CLYH 1TYJA 1MZYA 2H0JA 4BK5C 3KLQA 1R3JB 3B9DA 3WHE0 2YMXL 4CMHC 4IM8A 7FABL 2GJ6D 4Q9RH 5IMOA 3QRGH 2BY0A 4RWYH 3VD5A 2J57A 4W70A 3MRMB 4LKCA 3SDDD 2EH7H 5F7AA 3VD3A 4C56A 4YXHH 2IAMC 3MLSH 5GS2D 5A2LH 1LXMA 4AJYV 5KYYA 1NEUA 4R26L 1YECL 3H0TB 2H8PB 4AQ8A 4FP8L 1ROWA 1DBKH 2V2WB 2O5ZH 4QHMA 3V7MA 3RZCC 2BW5A 4F2MB 1F11B 5GZOC 2YAEA 3FCTA 1S9WB 1TYRA 3PWNA 1ZCRA 2WZ0A 3H42H 4JHAH 1M1SA 1SF5A 5F7WC 4IGBB 4FNQA 1M7IA 3ISRA 3R1GL 2VL5A 3T2PA 1FL6B 4CC4A 2AABH 2HLAB 3BD3A 1QW9A 5C07D 3NIDF 4WW2F 4BGLA 4I2XE 2PW2A 1R6VA 3ZQXA 4O2CA 2A9CA 2HRHA 4LLMB 4MB3A 1VKXB 1MCDA 5B1JA 1IM3D 3BPNC 4OLWL 2VDNL 3DPDA 3MRRA 2GFBB 4OTXH 1I9IH 1ETZB 2BFGA 5EOQH 3VCLA 1TPXB 4J8QA 2DJSA 1E27A 5AD0A 3CLEL 1GZPA 3NFPB 3Q5OA 5DZJA 2AITA 4EZJA 3MOQA 4Z7VF 1G5GA 5I2IB 2B4CL 4CSTA 3FC8A 1NGZA 3EGSB 2A6DA 3T4YA 3ZZLA 1JCKA 1NANH 3NH7L 4GIPD 3VFTA 3O6MH 3IU4L 1EVUA 4NN7B 4JFDB 4MAYA 4WLCA 2DLEA 3FQXB 4TOYH 4ZD3H 1JS4A 2GKIA 1QI4A 5EO1A 4BXSV 3FB5B 4U31A 1OP5K 1ET8A 3CSYA 2Z91A 5DJCA 2G5UA 4R7VA 1M1XA 1QKZL 1YAZA 4AQOA 1DQQB 5L8JB 1KC5H 5FHBH 3B9KB 4YDZA 1CBVH 4RISH 1JZIA 1KEGH 5IREA 3GIZL 5I5MA 3L2MA 4NQED 4U05A 3TEUA 5EZPA 1EXHA 3ECBB 5BPPA 2PCFB 5GGUA 2BP0A 5IHWA 4ENZA 5K9QI 4NKOB 4ZUWA 12E8L 1YEIL 4K73A 2NYKA 3AGWA 2P8PA 3N1FC 1NPJA 1FHNA 1V7MH 5TDNA 5FW6A 4E9RA 4Q58C 1T5XB 3KPOB 4LSRL 5G4NA 1ZTMA 5JIIA 4BH8B 1O7VA 2FX7L 3EFDL 5J89A 4NNYA 4JKNA 4WEEA 5IVXF 5LAXA 3TONA 3PHQA 4L3EB 3KYMB 5HGDB 2XV6B 4Q9QL 1RK0A 1A3ZA 2FH6A 4H8UA 1A0QL 3TBVB 4YGVA 2YUWA 5CIPB 3L1EA 2XXCB 2FJGB 2WXMA 1BWWA 1JJUA 5DJ2B 4DPBX 1CE1L 3T77B 4AL8H 1ONQB 3CFDB 4O5LL 4D9RD 4XCFH 3ZL2A 3C8KB 4OGQC 4HCFA 2CR6A 4R7NB 3VXMD 5J4MA 1OK8A 2OLDA 1CDCA 3SCMB 4LB8A 4LIQL 4ZUUB 3QUXC 3SE4A 2ITCA 3D2UD 4X4YA 1J0YA 4GW1A 3VVVA 5JW5B 1OSZB 2QTVA 3QCTH 1LDPH 1EX0A 3HPJA 3MLUH 3UTZA 3FSVA 4NLAA 1WFJA 3M7OA 4ZDHB 4ZMZA 2QQKL 3R18A 1PKOA 2AJ3A 3QIBD 4AYGA 1S3KH 4TLSA 2B1AH 1F90L 5FYLL 2A9NH 3RGVC 2LU5A 1UWEL 4HIIA 5F7FA 2DQUH 3GPEA 5SV3A 3HHMA 1D9KA 4W9HC 3B2UD 2YPLE 2A6IA 4P23C 4PJCE 4IMLA 2IJ0C 3Q2VA 3QQNA 5HD8C 1JFQL 3CFCL 1UB5A 3UJTL 3R7RA 4GRWE 3ULUL 1OVZA 1O6TA 3FOMB 4WW1B 4H0HB 2MCAA 4KI5E 4GFTB 2ZT9C 4CVZA 3RAJH 4KKQA 5D6DC 3MGAA 2ERJB 2OSLA 3BDXA 3NJXA 3VFNB 5IP4A 1R3LA 2M26A 1QTSA 5KN5A 3F62A 1NJ9B 1NMAH 3HBPA 4J6RL 1MCPL 1WZ1H 2NDGA 2ZIDA 1MAMH 2UX7A 4MYWB 4XP4L 1I7RA 5IJBC 3MJ7A 3ROLA 3WTXA 3X2QB 1U8CA 2K6ZA 5EZLB 4CBZA 3EBAA 5DMYA 3UTQB 4JREB 2BIMA 4BE6A 1AHWB 5E6IA 5SX5H 4XP1H 4WFGE 2FZ3B 2GPZA 2P24B 5HGAB 1AG6A 1SEQL 4BFOA 1KLFA 3HG0A 2EDFA 3O2VH 4PCKA 5DVKA 3ALPA 5D2LA 4A6YA 1ZT4B 4Z7NE 4K3HA 1T2QH 2OX5A 3GSXB 3BP4A 1JI2A 1YEDA 4LLVA 4OQ1A 1KTDB 5D1ZA 1UGNA 3FUFA 2HT4D 1PJ9A 2EUWA 2OYKA 2E6JA 1G9EA 4GJTB 4TLKA 3LPFA 4R97B 1J1OL 1X5FA 3QQ4A 4PGZA 2V2TB 2GJPA 4DAGH 4YBQC 1UXMA 4XBEH 3KCPB 1C1EL 2NPLX 3KGUA 4DO5A 3GSRB 3HB3D 3C9NB 3DX2A 1HHGA 4N90E 1SXCA 1S9YA 4GG6B 4J7RA 1PPIA 1NCHA 3QBTB 1JRHI 2X4PB 4MAYD 4KXBA 4WWOA 4CC0A 1XAKA 8PAZA 4F93B 3X1GA 3MRHB 2YD7A 1NIDA 1QTYT 2AZUA 2JJSA 2NTFA 3MC0A 3GNML 4IKNA 4N0YL 2K8QA 3D3VB 2BW4A 2ADIB 3EYOA 5MI0B 1G0XA 4JO3H 3V4VA 3MGTB 4QWWC 5I8OH 5EN2A 4P05A 5CSBA 5EZOH 2X28A 4C55A 2K1MA 3WLBB 4Y19E 1R3IL 4JKWA 3TH2T 2R9HC 4YHYC 4J6IA 5DHYB 3TZVD 4B53A 4KHXH 2GTZB 3W0WE 1DVUA 2WN3A 1TKWB 3PXJA 5C0EB 2V17L 2NQCA 3PWPB 1NCWL 2ZSVB 1RCYA 3CSGA 3RX5A 5D1QE 3SO5A 4NGHH 4QGYA 4CN4A 2HLFC 1KYFA 4K5PA 2BK8A 4RX4A 4K7PY 5LNGA 1CR9L 1QO3A 3ZMRA 3QDAA 2D0FA 2CA3A 2X3BA 5DSCB 4W68A 1UCTA 3ZKND 1UYWH 4YBLB 3SKMA 2DQMA 1A1MA 4FG2A 2AKRB 3RA7L 4NM4H 2Y25A 1T1YB 4PRIB 2XWTB 2ZNWA 4XX1G 4PG9A 4BZ2L 5J13B 4MBRA 1VENA 2J2ZA 4PJAA 4RMQA 5GGVL 4UIMB 1ZLUH 1FDLH 1NFDA 1PZSA 2I69A 3H2PA 2QVTA 5DD5L 5EPMB 3BOVA 1HNYA 3MX0A 3HZMA 2ZX8A 1PCXA 1B3IA 4GI6A 2Q8BH 3O41A 5DZNA 5FFOA 2ZPKH 4WI0A 2CDEB 2EDWA 2WMPB 4MJHA 2OZ4A 5DHVA 1G7QA 1BD2D 1FFTB 2FO4B 3QFJB 3NIGE 4YC2C 1DVQA 3W9DA 5T33L 1T22B 3WMPA 2AJSH 1XV8A 3HZVA 1GGIL 2AANA 1IC1A 2XKNB 3BWUF 2WZ5A 4Q0XH 1XR9B 4R7DA 2MHAB 2X4UB 3MRQA 3HI5H 3Q2WA 3S35H 3OKDA 5IMMA 1R47A 4ZUVA 3WL9B 2VDRL 2X9XA 1ZA6A 3VA6A 2UY6A 3ELQA 2ZCZA 3DUUB 4NZTL 4XN8A 3N40P 3WS3A 1J05A 1TZAA 1L9TA 4B9KC 5EF3A 1I3VA 3HVNA 1D9KD 3WN5C 2ZNXA 2XTJE 3U0WL 4NUPA 4D8PA 3GD1C 1YNKH 3VXSE 2AS5M 2CO3A 4X4ZA 3K2UL 2FQGA 1A4AA 2R2EB 1S7QB 4PM1A 3MGOA 1N59A 2MKWA 4QPEA 4UIKL 2YGNA 4CVUA 3L13A 3LZFL 1KJVA 4ISVA 1KSRA 5JIMA 1OTUC 3BT2L 1WCQA 4DGIL 3NA9L 4P4RB 5IB4A 1D3CA 3MA7A 5T5NF 1C5CL 1E3ZA 1ET5A 3GMQB 1MXGA 1WIPA 4URKA 4E9TA 5AB1A 1KGJA 1SN2A 1R5IA 3MU3A 4GP4B 3K71B 3FTSA 4KV5E 2DICA 4UT9L 4K9EC 4JE0A 1JCVA 2I27N 4WKXA 5E2TH 1DANU 1DQJA 2HX8A 1NMBL 1N6VA 5AVYB 4Y88A 5LBSL 3LIUA 4EOWH 4KUZH 4JY4A 2F1EA 4LEXL 4EI5D 1I4FA 1KJ2H 1GGBL 4HHAA 4QRRB 3BPLC 4YXLH 2DQJL 3LH2L 4XN9A 5C2BH 4JO2L 1IQWL 1NBYB 2Z8SA 1D5MB 3NCYS 1E8YA 3S48A 4KK6D 2VMCA 1AZUA 1B0RA 5KVDE 2RCSL 4DO6A 4XNDA 4Z8FH 2OSYA 2UUDK 5HI4D 2ATPB 2DAVA 4PBXA 4OSUL 3V4VH 1IAOB 4XNBA 5FA4B 3TBYA 2PPFA 4IEFB 5D1ZD 4G6MH 4YVNA 4FULA 1YMMB 1N10A 1ADQL 3CVDA 5LHDA 4XC3L 3D6GA 4ZO6A 1FFOB 4CJ1A 3CJJA 3ZQWA 4FADA 3H2QA 4PP1D 1B9KA 1SPDA 3MVSA 1U36A 1Z7JA 2F1BA 5G55A 3LN4A 5EFIB 1PD1A 4QF1B 1JHTB 2R29L 3SYQA 1X5HA 4GMSH 4PVMA 5ABAA 3T65A 5HVHB 4NC2B 3UBHA 4FQXA 4P2RB 1JPFA 2ZD0A 5I15H 3WJMB 3P11H 5ANMA 5E94B 3SDDC 1KGWA 1KCSL 3BSZA 4P2YA 1KYOJ 5KBMA 3QDJE 1E9QA 1GIGL 3QDGE 3HS9A 3WTTA 4WU5B 4HD5A 4GAFB 3HHRB 4UT7H 4ZFFA 4FABL 1KELH 1T2XA 3VXQB 5DMIH 3EFFB 4QXUH 3BN9D 3UZVB 5D1XE 3QUZA 5D72H 4HUMB 4Y7MA 1HHIA 3FCSA 1EEQA 3Q0HA 4JM0A 2EDHA 2FGWH 2OZ4H 3FT3B 2FWOB 3NPSC 3QJZA 2R0ZL 2Y36H 2DJUA 3EH2A 5B39A 1J0KA 2YK1L 3LN9A 3BE1H 2CMRH 4LGPB 1QR1A 1FYTA 1FZOA 3PABB 4PGCA 4JL1A 5AW1B 3BI9X 1OCRB 2VLJD 4U1GC 2PCYA 4ZMLA 5JOPD 1R3JA 4NXKA 3E8VA 3UAJD 1U6AH 3BHBB 4IRSA 3MRMA 1MI5E 1MRDL 3MODH 1BZ9A 2VDLL 3QUML 4QRUB 4UDTB 5FYJH 4QOKB 2GJZA 2FE0A 2V6HA 3Q9PA 1UEMA 1CGWA 3G5ZA 2BVQB 3NIDB 4GAGH 2DQDH 4Q6IB 1CK0H 4WW2B 5FOBB 1TSHA 3V0WL 3H0TA 3OVUB 3C6EA 2E7BA 3N42F 1K5NA 4PBVC 5DJ6B 2V2WA 4K4KA 4TQPA 5KS9A 2DH3A 1I3GH 1KXQA 3DRQA 4X4MA 4IGBA 1IIIA 1FL6A 5DHDA 4S0HA 3IK2A 1KGXA 2R1YA 4LCWD 3OPZL 1UHVA 1WITA 3DXAB 2JQMA 1U3ZA 3H85A 4HPYL 2WINB 5JW3L 4BUGA 1A5FL 5E4EB 3W38A 4LLMA 4LCCC 4JM2F 3QIUA 1VKXA 3ATFA 4L1SA 4UQ3A 3UAEA 1BQHG 4LAJH 1O6SB 4DSYA 3DI3B 4Z7VB 4DF9A 5B22A 5IFHH 5DT1L 3FBKA 5FYJD 3PUUA 1NAML 1RUML 1I31A 2EIEA 3L45A 4TQHA 1MFBL 3MPCA 2RGSA 1ETZA 5TE6L 3TWYA 3CV5A 4KOBA 5BOPA 3V79C 4Y2DB 4X9FA 1IFGA 2F8VA 4GAYB 1MRCH 2AQNA 1SEBA 2WZ6A 1BQUA 3CZEA 5LN8A 1NMCB 3HRPA 1WT5A 3NJNA 5I2IA 1JZJA 1U4EA 1OHQA 2XFGB 3ZE1E 1A14H 2X9YA 3MOBH 1IC7L 1NZRA 2ENYA 1QUPA 1BF8A 1JD7A 4DVRH 3GMPB 4L4VD 2GC4C 3CSBA 4Q6KA 1LE9B 4JFDA 1WBXB 2VO5A 3B7TA 1ZLSH 1PAMA 4I13B 1A1NB 5H4YA 5D7IE 4BCYA 5IJKA 1D5RA 3B9KA 4O02H 3MBEB 1PZAA 3BSZH 2W80C 2UX6A 4HDIA 1KLGB 4BZ1L 1F4XL 3QXDB 4XBGB 1XBRA 3T3PE 1E4KC 2ZAHA 5IBLD 1WTGT 4RLDA 1O6VA 1YJDH 2PCFA 5G5DA 1IE5A 2I9TB 5EU6B 3IWUA 5TDOB 2GK2A 3QIBC 1A3QA 5FGRA 1RP8A 1JNNL 4DW2L 3ARSA 3KPOA 4P2QD 1OD9A 3F5WA 2WO2B 4W9ZA 1I8IA 4YOKA 1M53A 1N8OE 1P4BH 3CFKB 3MUUA 3T9WA 4BH8A 3MCKA 2CDFA 5DD0H 3B2UC 3CLWA 4AL8C 4FQXD 2D2OA 5C0BD 1UASA 5HGDA 1ORSB 3FAWA 3VFMB 2OL3B 2WHVA 2FT7A 4JW3A 4PJ5B 4P8QA 4BFNA 5JHDA 1AXTL 3TBVA 4IU2B 1OANA 3M8OL 3IMVA 5CIPA 4JG1H 3DI2B 2FJGA 2HT3D 1MFNA 3LVEA 4YWGL 3LMJL 3SBRA 3TLRA 4AQ8C 5DRZB 1OSEA 4XAWH 5IW6B 1PW3A 3T77A 1M4KA 4LSRH 5FO7B 2WNWA 4KC3B 3S36L 1ONQA 3CFDA 4EN3B 3CU1A 1AD0B 1WWWX 3IBEA 3X14B 5E5LA 2FX7H 3QC6X 2HTLD 3IDGB 4R7NA 4CKQA 1XB6A 2AP2A 4OVVA 2RR3A 4ZUUA 4LEOB 3CXHJ 3NJJA 4JCWA 1E2ZA 5JW5A 4F80A 1A0QH 1ZGLP 1OSZA 3FTUA 3PXLA 4U33A 3S6CA 4OLZL 4UV7L 3UOAB 5KEZA 3DA0A 3AY4A 5A2KH 1AGDB 4OCRH 4F2EA 2VM3A 4KTEH 4ZDHA 4F8OA 2NW3B 2XA8H 3P2DA 5E8EB 1FYTD 2CGYA 3QG7L 4V33A 4X98A 5IWLA 1EEUA 3OHXC 3RNKB 3CFBB 3DOSB 4WFED 5JIDA 1SDYA 3QDMB 3RUGE 3Q5TA 3THMH 4YSQA 1J10A 4YHOL 5L2JA 3TL5A 3ULSB 4KPHH 3S37X 4FS0A 5TK2A 4LNRA 4P5TB 4F7EB 4Z1PA 3UZQB 4L4TE 2HT4C 5C0DA 1DQKA 1UZ8B 3QJHB 2WP3T 5E4AA 2WXQA 3GI9H 4RNRB 2ZXBA 3TGXA 4PRPB 3US9A 1MFAH 4XAKD 4OF5A 1H6UA 3U1SH 5GRZA 3FOMA 4X8JA 1V05A 4HZLA 4CADB 4UAHA 2RJMA 4OJFH 3SGJA 4BZ2A 4W4OC 4FZ8L 1YQ2A 3HB3C 1HC1A 1WH0A 4OJDH 1E6JH 3VFNA 4MAYC 1RUPL 1I9EA 3ZHLA 1NJ9A 1EERB 2X4TB 2YPVL 4GI8A 2HYMA 2R51A 4IGBD 4ZS6D 2JE8A 3L5XL 1YUHB 3B2PA 3WBDA 1BQHA 2ENSA 1JTPA 4JY6A 2P5EB 3H9SD 3CFCH 1QABA 1Q0XL 4UI2A 1U3JA 1Z32X 3UTQA 4WEBL 4XVSH 5I26A 4GKSB 1AHWA 1EO7A 4NPJA 3TZVC 2AXGB 4NZUH 2FZ3A 2P24A 4AW4A 1GGUA 2FEEI 4QLWA 3DVNB 2AQ2A 1MCPH 4J6RH 1S7SB 4ZRGA 4HOMA 1IEBB 1ZT4A 4LSDA 2B15A 1KTDA 1GZHA 1A3RL 3OG4B 1NLDL 4B9YA 1VCAA 2K7PA 5I1HH 4PR5A 2X44D 4Y0GA 2PN5A 3OD3A 3BZDA 3ZKNC 5CLWA 2V2TA 2LOEA 2QMJA 4MJJA 5D7EA 2AJVH 2VAAB 3NFSL 1QLEB 5MEOB 4WK0B 1ASQA 4WAFA 2X4OB 2MCPH 3OAZH 4ONOA 1E4XI 4L5FE 2XETA 5BZDB 4LOVA 2E47A 1AIFB 2BX5A 3L17A 4ZX5A 4GG6A 1BV8A 2Y7MA 3N43F 4JFDD 1G7HB 2X4PA 1BEXA 1PX8A 5FIEA 4UQBA 4HJEA 1VF5C 1KN4L 3MRHA 4YDVA 4BBWA 1LNUB 4NSKB 4QRPB 4KKLD 2OV0A 5CEZH 2ADIA 1B0GB 5BO0D 1KIPB 3F6LA 3MGTA 4JG5A 2H26B 4AEIH 2Y07L 2J8HA 1IL1B 5BZXA 3B9KD 3WNMA 3RY5A 4G70B 4E5XB 5K39B 5LBSA 3SE4C 5CIPH 2R0WH 1X4ZA 4WK2B 1VACB 3HR5B 3D34A 5I66A 5MHSD 5DHYA 5KVGE 2GTZA 5FKPA 4GIAA 4FKHA 5GRVK 1TKWA 4J27A 3PWPA 5BV7L 2E7MA 2ZSVA 4HK0B 3WGUB 4LVNC 1I82A 4XMVA 4DP4X 3AB0C 3C6LA 1YCSA 1D9KC 4TNVF 1FL5B 5DSCA 4I7ZC 5CEZD 2W9EL 3W39B 2QKIC 1R3IH 4L3ED 3SD5A 2AKRA 3CZUB 1GYVA 4PLKD 2FATL 4Y16A 4EDWL 1T1YA 2K3HA 2XWTA 5J1TC 3UL4A 2YD3A 4UM9B 5E2WH 1T21B 4Z7OF 3AACA 4UIMA 5F6IC 5TQ0H 3WI9A 3DBXB 3HG4A 1NCWH 3CZLA 1PNDA 2AW2A 2R29A 3UBFA 2Q86B 1Q94A 5EPMA 5B21A 1KXHA 3MRFB 3ULVH 4H8WH 1E9OA 3JTTB 1MCFA 1BAWA 4N1CA 4NYLA 2NZ1A 3L16A 2JKWA 4OZHB 4QMEA 2VSMB 2CDEA 3L9EA 4G6JL 2A6JB 3RWFB 4HJ0D 1FO0B 3SCMD 2FO4A 3QFJA 2ARJB 5JO5B 4AEEA 1NKRA 4JQVC 1HEJC 1T22A 2WXKA 3QCVH 2RA1A 4DP7X 3SO3C 4PU2A 4EI5C 4P59H 4PIBA 2CR0A 2XKNA 2NR6A 3AM8A 3CHSA 2MHAA 2VM4A 2X4UA 2YWYA 2ARWA 4KK6C 5CSGA 1JPGA 5ICYB 2EXSA 4JUTA 1MCQA 4UANA 3WL9A 5HI4C 5IROA 2Q2EB 1OWRM 1R5WB 4Z7UF 4L0PB 4K5MA 1ILUA 3OAUL 4E9WA 5BZWB 5IB2A 4N2IA 5CR1A 5D1ZC 4I8DA 5J0BA 1GPOL 4NC1E 3JSSA 3ULVD 2XWDA 1Z9NA 43C9A 3GMRB 1FVEA 1VZHA 2FCBA 1RPQA 4LSTL 1CFVL 2R2EA 2XWJB 4AGPA 3OSVA 3RWJA 2IADB 3LZOA 4OD3H 5LVEA 2VC2L 3NCJH 3L1OH 4NNPL 2O6CA 2X10A 4FXKA 4JRLA 3QNFA 2WZAA 4EDXB 4JKKA 4UNIA 1HYRC 3D0LA 1H3PL 4JS7A 1LWRA 1AHMA 1EO8L 4GXVH 2JJSC 2AXHA 3KPLB 5C08E 3K71A 3A6BH 5EF1A 4KZEH 1TDQA 3U0WH 1MLBA 1TXKA 1U8LB 2R4SH 3JBG7 3ZL4H 4J2XA 3HI1B 2X38A 3K2UH 4XVJL 3SE9L 3WUWB 4BZYA 4TS6A 4WJKB 4YUEH 5LWYL 1C16B 4B7LA 2VRKA 4OZIF 1AO7B 3NVQA 3NA9H 5J1AB 5F89B 2BSSB 4ALAH 4BXVA 1NM4A 1C5CH 1NBYA 3BN9C 1D5MA 1NSNL 2WQXA 4QXTB 4WWKD 4ZPTB 4F8TA 2Y3AA 3QAZC 1XH3B 1S7XB 3BC9A 1WS7A 2ATPA 1Q8MA 2C3VB 2B8OT 1DEDA 5FA4A 4Q14A 4XBPA 5GGTA 5I1JL 4BCXA 1BF5A 4IEFA 4UUJB 5LBSH 3BIAX 4J3UA 4X9GA 4HGKC 1KGYE 5BQ7B 3O0RL 1FFOA 4CDGC 4LEXH 4DJMA 2VT0A 3I9GL 4GG8A 1UM4H 3TBSA 4YR6B 1AQKL 1SLWA 4JFQB 1KTBA 5E95B 3GXMA 2PP7A 1JHTA 2XBDA 1L7IH 1T5KA 2WLHA 1ZSHA 3TXAA 1Q9WB 1DSWA 1DCEA 2OR7A 3ECWA 3D4YA 4OSUH 4ZAKD 3US1A 2Y7LA 1MF2L 4JFPA 3ZDXF 5HYJE 4MNQB 1RMFL 4P2RA 5D2NE 2BO0A 4ACTA 3WJMA 1J5CA 5E94A 1AY1H 3D3VD 3BXNB 4PJ8B 5D7SH 4F7KA 5IW1A 4F7MB 1MFEL 3SDXE 3VTTA 3WIHL 2JJVA 1UJ3C 2OTUB 3B3BA 3KPQB 4JFFB 4UINH