1G43A

Crystal structure of a family iiia cbd from clostridium cellulolyticum
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
160
structure length
160
Chain Sequence
AGTGVVSVQFNNGSSPASSNSIYARFKVTNTSGSPINLADLKLRYYYTQDADKPLTFWCDHAGYMSGSNYIDATSKVTGSFKAVSPAVTNADHYLEVALNSDAGSLPAGGSIEIQTRFARNDWSNFDQSNDWSYTAAGSYMDWQKISAFVGGTLAYGSTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SCAFFOLDING PROTEIN
publication title Structure of a family IIIa scaffoldin CBD from the cellulosome of Clostridium cellulolyticum at 2.2 A resolution.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Structural protein
total genus 36
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00942 CBM_3 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.710 Mainly Beta Sandwich Immunoglobulin-like Endoglucanase-like 1g43A00
4B9PA 1G43A 1JS4A 3ZQXA 1NBCA 3ZQWA 4B97A 4B9CA 4C8XA 1GA2A 2XFGB 2WOBA 2YLKA 1TF4A 3ZU8A 2WO4A 4JO5A 3ZUCA 2WNXA 2XBTA 4TF4A 1G87A 2L8AA 4B96A 3TF4A 1K72A 1KFGA 4B9FA
chains in the Genus database with same CATH superfamily
1ADWA 4KRPB 1GY1A 3ZMRA 3DIDA 1TLKA 3FT9A 4NZRL 3VXUB 4JFDD 3EJYD 3ENEA 3CBKB 5L2JA 3UACA 2X10A 5L8LB 1ZHBB 3B3IB 2CBTA 2P5ED 3BAEH 5ALBH 5HYJE 3Q2CA 1P4BH 2IJ0C 4U4BA 4URTB 1T83C 1HHIA 5DHMC 2BVPA 4AVHA 1MFUA 4KQ0A 5I66B 2YAOA 3UG5A 3KH4A 3SPHA 5L9DH 1ZLWH 2GKIA 1J18A 2HLAB 5F97E 3NFSH 5T1LD 2ID5A 4JZOA 2X4RB 4G7VH 5LG1A 1A8JH 1K6QL 3IJYA 1S9KC 1W0VA 5CJQH 4LSVL 1KPUB 3UAJD 2ILLA 3DK0A 1FC1A 5D1ZD 5C0JA 1K4CB 5KJRL 3KZ8A 1TIUA 4AM0B 4I1RA 3BDBA 1JERA 1G7IB 4FQ2L 4ATTA 5F7FA 3S98A 2FJGB 1OPOA 3OAWA 3PREA 4KROD 2QPFA 4JY4A 5JOFA 1OT1A 4W1TA 5EU7E 4ZW5A 2KKQA 4E9XA 3QZOA 3WFDL 5IFJA 3QUMB 1X6LA 3ILQC 4HIEB 3OPUA 1BCIA 5LGHH 1U3YA 1QBML 4UNUA 4DZ8B 2ADIA 1AGDB 4HWEH 5B38G 1CIUA 5G4OA 3JWDH 4DKEL 3IJHB 2OXGB 3LOWA 3I50H 3GLAA 4A6YL 2EDFA 4Z76A 4XVSL 2HH0L 4XOCA 3BN3B 4TNWK 5CZXC 3BKJH 5D7LD 3IAQA 4JFVA 3KWWA 4UINL 5E2WH 2YBGA 4L4VD 2DL9A 3V6OE 1EEQA 3GMMA 2WNKA 4XP4H 3I6LE 1SHMA 3PWNA 4IJ3C 3UG3A 3MR9B 3H85A 2YFOA 4NN5B 3W39A 4D2NA 2K78A 3WTVA 4K9JA 1DJGA 5SWSE 4PJBA 1RI8A 2XTSA 3L9RB 2ZX7A 2WSPA 4Q2ZB 4F58H 3DHUA 5CU5A 3UAFA 1MNNA 1UYWH 1MIMH 2X2HA 4BA0A 3EBHA 5F9WC 4ZMLA 4MWFB 1F86A 2EH7L 3PJSB 5FYKE 3WG7B 1GZHA 3EZ8A 3S96B 4TSBH 3X12B 5IMLA 5DJDA 5AUMB 3WAKA 2VRAA 2CLZB 3JTBA 4Y5XC 3KR3L 5G5DB 3VTTA 2AXGA 5HHME 1DL7L 2XZZA 2X9XA 4P2QA 4U3XA 3GSQA 3VMOA 3NCMA 3PP3H 1AGBA 4UT6A 2D7NA 4V1DE 2P5PA 5DMKB 1UURA 1DSWA 2CUMA 4KMQA 1KIRB 3NSDA 1INEL 3E1F1 1QFOA 3T6VA 2ATPA 3QI9B 3MRQA 4WFGE 5CP3H 4FFYH 3IDGB 4UQEA 1O9WA 2V17H 2WTRB 3FAXA 4BH7B 3VFNA 3QRGH 4HK0A 3NAAH 4AYEC 2YAPA 3ISWA 4F15B 4R8WL 3AAZA 3HJ0A 4A67A 5BOZG 4HUVA 3RNQB 1BZ7B 3T4AB 1TJIL 1UVQA 2FBRA 4H88H 3LYRA 4P57B 1TZGH 2X9YA 3BZFB 3MYJB 4XNUH 5JPNC 5EEXA 4NXKA 2Y6TE 2N0MA 4WI0A 1ESOA 2WC7A 1SMAA 3DGDA 1XCWA 4IDJH 3ABGA 1R46A 1OCWL 3MLRL 3PUCA 3WJJA 1HHJB 3UGEA 4EI5C 3T8VA 5EO1B 5GS1C 2VIRA 2D7PA 1CTNA 1C5DB 1DQVA 2CLRA 3AWGA 2IOOA 2JB6B 2Z1PA 3RI5K 3RX8A 5HHVH 1ZA6B 3OLDA 4AEIL 1GW0A 3O3EB 1M2VA 5HI5D 3Q1SH 3PWPE 3VDCA 4Y1AD 5KSBB 4Y4HC 4IMLA 1U2YA 1DE4A 5JIKA 1MEXL 5AVTB 4X4YB 4RISL 2YD1A 4JRYB 1RK1A 1FZKA 1QR1B 4OGAC 3SPGA 4WHYH 2HMIC 5AZEH 3TO2A 2YQ2A 3CMGA 5D8JL 3RTQC 3MVSA 4DGYH 1FLTX 4WO4C 5A16A 3C12A 1AKPA 3AB0C 2APXA 3O45A 1KG0B 3L3OB 3O4OB 4JO4L 4UQ3B 1E9OB 4D8PA 1P6AB 3ET9F 1CC3A 4J6IA 2BIQA 3SE4A 2YAHA 1XH1A 3NJFA 3ZU8A 1OM3L 1ONQB 4A7TA 5B7FA 4Y4FD 3S3DB 1UASA 1QO3A 5E2JA 5GZOA 1ZJBA 5IHBA 1XGTA 5DRZA 2VZUA 3GMNA 3KGTA 4AVJA 4MNHA 2FECI 5D7JD 5DD6B 4OFYD 1A5FL 1Y1DA 2IALA 4HS6A 2YEVB 3I2CL 2JKIS 1NSNL 2R29L 3K4ZA 1I1AD 3ZTNH 3VFOB 4GINA 4GQPH 3IMRA 4OZFH 5FYJD 2W88A 1X9LA 1A7NL 2VL4A 3IS0X 4IGBD 2I69A 1FBIL 4YHOL 4HCFA 4NZTH 3OQRA 4TRPL 5EO0B 1GIGL 2WVSA 3IAPA 3GD1C 3QEUA 3ZUNC 3QJOA 2V2XA 2F5AH 3MAWA 3VSQA 3EYVB 4GQZA 3WYRA 2EZ0C 1NINA 3CDGB 4JZNB 4J3TA 4XPGL 3U1SL 4BZ2L 4F8QA 1H3PH 4OZIB 4KZCA 1EBAA 1L3WA 1M3IA 1FG2B 4YDVB 4OUUB 4ZFOA 4JFED 3RWJB 3U0WL 3GGWB 3KBHE 4RWYL 2VLRB 5T1KA 1AGEA 2H1PL 1H3TA 2IDFA 2WINB 4UDUA 1JPTH 4A2GA 8CGTA 3NBNA 3WS3B 3E1ZA 2E0PA 2Q3XA 2FD6L 5HHNB 4EVNB 4DUXA 1B88A 3CX5K 3DO7A 1WA1X 4QRFA 1TJXA 4RA0C 2DQGH 3WE6B 1BIIA 4MMZA 3AM8C 1MHCB 4PRAB 1J8HB 4KKLD 5E6IC 1YNTA 4PJFB 2Y1AA 4PJDF 3WOVA 3FTUA 3WJMA 2JCCF 2VN7A 5JTWA 5JMRA 3GSWB 5FKPA 5HYQA 5JHLL 2F53D 1EZUA 4WEMB 4NN6B 3WO4C 2GFBB 4OCWH 4GRLD 4L1SA 5ABDE 2NY1B 1YY8B 1YQ2A 3LIUA 3MGOA 4KQ3L 3VI4F 1NCBH 3MRBB 3TJHC 5KSAA 5BNXD 5DD0H 2XBDA 3N43B 1AVAA 4KK6D 1EXUB 4M8RA 3U36B 2ZJSH 4EUPB 1COBA 5I30H 1MJUL 3V55A 4HPYL 4WWNA 3OM3B 4OQTL 2DLTA 3I85A 4HWBA 4G5ZL 4GG6E 1IFGA 4XE0A 2CPUA 4RMQA 4Z7VF 4ZMQA 4JO3L 4PTTB 1BMZA 1T0PB 5DTFA 4FLHA 1A65A 1UXSB 1C16A 5C0IA 1T6WA 2XZAH 3AG4B 4DQOH 3RILA 4IYKA 2NYKA 4BKLB 4QYOA 1CF8H 4P9ML 4GRWB 2LE9A 4WWID 1ID5I 1UH3A 5FWQA 1QSFA 1DDHB 4XXDA 2CKBL 4QDGA 2K4WA 3F7KA 3TZVB 5JQHC 1RFDH 4YDMA 1JDDA 1NUFA 3G6AB 3MBEA 4G42A 1XR9A 4MBOA 1A1MB 3CZLA 2YSSA 1N19A 1KCVL 1K5NB 3STBA 1PZ5A 2A6IA 1KIPB 1UHVA 4LHUA 4RX4A 4Z9KB 3BZ4B 5DQDL 3W82A 4ZXBD 3H55A 2EXWC 3IRPX 3N9GL 5CD5C 2J44A 2YXVA 1KB5H 4NO3B 4ZD3H 3T0ED 3AS0A 3CFDA 3QUGA 4QHKI 1JXJA 2NY5H 1NBZA 3P0YH 2CGRH 2EE6A 2IQAB 1BF2A 1T5KA 3CPLA 3FJTA 1RZKC 3H9HB 3MBWB 4JW3A 1XCTA 2CIKA 2Y36H 4FFVC 4IRJD 4GSXA 4FERA 1VPOL 4ETYA 4JGMA 1HTYA 3CSBA 3BVUA 4K8RC 2IO5A 1H6FA 2P8LA 2EO7A 1B0RA 1M7IB 4TSAL 3U4KA 1JFQL 4JL1A 3VSTA 4JM4L 3I9AA 3T71A 1D5ZB 3QCTL 1MH5B 3TESA 3AU1A 4YLCA 1FO0L 1GZPB 3B37A 3ORJA 3U9UB 5JDSA 1XIWD 4PJ5E 3ARDB 1NAKH 2HT4D 4MB1A 2QSQA 2ICWJ 4PLJC 3WIHL 4M1CD 4MYWB 1AD0B 1CD0A 4FGMA 5IM7B 3FAWA 2VQ4A 2UUDK 2FGWL 4OCLC 3JTTB 4XCNA 4XVTH 4KAQL 4P5RA 1WFTA 1M57B 4BDVA 3ZE0B 2M1KA 3ZHNA 4NRYA 1BAFH 1DFBH 4X9GA 4DN3H 2AJZB 3RWHB 5IQ9A 4JKWA 3CQPA 3LKNA 4GQRA 4DP0X 3EOAA 1EFXA 4L4TA 1MFAH 2BCMA 1QI5A 1NAMB 3Q2LA 2P47B 2D7TL 3SYQA 4AV0A 4LLQA 4XT1C 3W0WB 1J0YA 4X9FA 3CXHK 1FGVL 3QCVL 4N2EA 3P9WB 3FW6A 2VDRL 3GXFA 2CD0A 4WW2C 5JW4Q 2FAUA 2CA3A 4PUBL 3K71B 5I1JL 4JB9L 3MSPA 2GTQA 5AOLA 3OF6A 2WZPD 4XBEL 1JGUL 1YUHA 3DUSB 2R39A 4DOHB 1X5ZA 3WN6A 4PTUB 3UAAA 4DN4L 3PAZA 4LVNC 5FKAA 3F85A 3ZYZA 4P5TA 1GGBL 4K94C 3IXAA 2D2OA 4AE0A 2H1XA 2V5MA 5TE7H 4E9QA 3L16A 3L5HA 3LN4A 1KUMA 3O8XA 4P48A 4HJJL 4L8DB 4LSPL 5EDSA 2FBJL 3MKKA 4KDTA 1OAZH 3EW3B 3NVQA 1HL4A 2AXWA 3FO0L 4FXGC 5FYKL 1ET8A 1JGLH 2VNCA 2WIMA 2YEZB 3FTZA 2JFCA 2FSDA 4JFDB 5EU6E 4W9FC 1XV8A 3DPDA 1GS6X 4PJDA 4OGYH 2XNAB 4QPEA 4JY5H 1JZIA 3QRLA 3ARSA 2JCCA 1IKFL 3MNVB 1G9EA 1I7RB 3V10A 3BD3A 4DTGL 4HMEA 4YUEH 5HGGS 4BCZA 5KYYB 4EUPG 2XZQH 3IPEA 1IGYB 4RFEA 1PKQE 3BI9X 1P6WA 3R7QA 4YPJA 1I8IA 5EOQH 3RWDB 1EHNA 1UWYA 4FLQA 4GI6A 3PNWA 4GUPA 3ILPA 5T1LB 2OULB 4NZDA 4A37A 1BXUA 5DCCA 3ESUF 2YD9A 3ISYA 2FK9A 3O2VL 2AMGA 5D1ZB 3PY9A 4AMXA 1PKOA 1HOCA 3RIFK 5F3HA 3UBXI 4PGCA 1I9JL 2FQEA 4XOBA 4QRPA 5DEFB 5AENA 5IBLD 4Z7VA 4N9GB 3K6SB 2BS8A 3RVVC 1JRHI 3DGGB 2UXGA 4FMKA 1SOXA 2R4RH 3L6FA 1T83A 2UXTA 4KROB 2QGCA 3SDCD 3G6JA 5C2BL 4AC2A 4YE4H 2FNBA 2BHFA 3MJWA 4JFSA 2J12B 3VJ6A 3VFVB 3X17A 1QVOB 4NSKB 1PLGH 2FJFB 2X4NB 4FN0A 3RQ3A 1MLBA 1OTUD 4KH2A 4OSUL 2VLKA 4L05A 4JJ5A 3V4VA 3CZGA 1E65A 3H42L 5JPMC 4JR9H 2WBJA 2IH8A 4L18A 1FA4A 4LCCB 5I1LA 3GJEB 1Z3RA 4MJ6A 4NKOA 2WLYA 1U8JA 4G6ML 3HR5B 4KKPA 3RURA 5J9PA 4N90D 5D7LB 1PQZB 3HN8A 3MRRB 4L4VB 1A4JB 2ESVD 4U3SA 4N2HA 2H47C 3HNVH 3S8FB 4JRXB 2FEEI 4N8CH 5K9OA 4WV1B 3U9PH 4ENED 1AS6A 1AKJB 3EFFA 1I8KB 2VJ8A 2FLBT 3V5KA 3BSGA 3CQFA 3GIZH 1O6SA 4KJWC 4PRIB 4LLVB 2ZX9A 3PXHA 1N59B 1UM5H 4BGDA 3STLA 1MVUA 3SBPA 2CCLA 4ZI8A 2Q10A 1NC4A 2J21A 3IDIA 2X6VA 1NCWL 1MCHA 4LPCA 3NPSB 4R97B 3V4UL 2BOBB 1FRGL 3VYNA 4U3CA 4M6ML 3MUGA 2IGTA 3HB3C 4ZMZA 3CN2A 4ZSOB 1JNHB 4XCYB 3DOSB 4HSAC 5E00A 3MJ9A 4APQD 2GTZA 1G9NH 3BP7B 1E5CA 3UIYA 4YPGB 4AL8L 4H1LB 2AEPH 2DN7A 2Z7WA 1ET5A 3H8NA 1MWAA 3QT2A 3GSNA 3LZNA 5DMIL 5INCA 1WO2A 4WCYH 4AEEA 5TE6L 2VUYA 3HZ3A 2XQYA 3KL0A 4M7LT 1YJDC 4A2LA 1ZSDB 3T3PE 4LPTA 2HX9A 3A47A 1HHHB 2KBGA 2W0FA 4N0UA 1KJ3L 2YD8A 1SGKA 2Z91B 1SDDB 3KVQA 1I85A 4ZAKD 4RBPH 4Y5XA 3QS3A 2WN3A 1XBRA 1F1AA 3GKWH 5D2LB 1FPTL 2DQHH 2QMKA 4JHBA 1XB6A 3FQNB 2BMKA 3KNBB 1BW8A 1NGWB 1NFDF 2NW2B 4XP5L 5D1XC 1MFCL 2J4WH 3UYRH 1FSKC 1RIUH 1QLEH 3SCMD 4FI7A 4UDTA 2XQ0A 1ULVA 2BJMH 2G2RA 1NZRA 2GAZA 1EDHA 3MV9D 3FN0H 3KGRA 4Y16D 5ANMB 3BFOA 2VW6A 4HJTA 1AZZC 4X2UA 1RAMA 4XVUC 3UTTA 1H3GA 1QBAA 1JTPA 1OAQH 3OR6A 3HZVA 3Q9QA 4KK5C 1KB9K 3VXOA 3GDCA 4L8BA 3QIUC 2ZOWA 5JPNA 3K2UL 2P1YA 2EVJA 1FI8C 4LASH 3VFWB 4NPYA 5T1MA 1DUYA 1EO5A 5EBMA 3O41B 1S3KH 1HDMA 3HMWH 4PJBE 5C3TA 3BZEA 3HVNA 4EI5A 4OGXL 5GS1A 4KRPC 5LDUA 1FNFA 4R96A 1KJ2H 2CXGA 1ZHLB 3FN9A 4BFOA 3O9WD 4XP1H 3AFLA 5HDBE 4BIKA 5DK0B 3PHSA 4NZUH 3TGXA 4M4PA 3EF4A 5IT2L 3RWIB 1JPGA 4Y4HA 5D96C 4ZW3A 3DECA 5D7JB 3CFBA 2KQMA 1TJGH 3AVEA 1A21A 3FU7A 4P2QE 3MCKA 4G8GB 2WVVA 3BQUD 1J1OL 4JY6B 1NLBL 3VVVA 3T6QC 4Z3EA 3EOTL 1XBDA 3FSVA 3L3KA 3QDMA 1EAPB 3GS7A 1A6AB 3QZWA 1RKRA 4IGBB 2IAMA 3QARA 3HPLA 3U82B 3BH4A 4ZMNA 4PWGA 2JJVA 1AYRA 5DJZB 5TDOA 1A6UL 4QTFA 2YAFA 5SWQA 3OKEA 2KC0A 4NZRH 5FM5O 4K5PA 3T8XA 1AY1L 5DEGA 1R5WA 3T3MB 3NSYA 3IDYB 4C58B 1XGPA 1XB3A 1A7QL 2WKOF 4JFEB 5IVXF 4LQ1A 3PP4L 5J6GB 3K0YA 4Y4KD 4L3AA 1YDPB 3EO1A 4TQEL 5F9DC 3SKJL 1E9PB 1JS4A 3SE6A 1BDYA 2OMZB 4K7FB 3VUAA 5DVKA 1WFIA 2ADYA 5DVPA 4WW2F 2JQZA 3R0NA 1K6QH 1M05B 1RLWA 5IG7B 4OFPA 3ZRSA 1YLBB 4LSVH 3ZL2A 5IREA 3VXSB 2DJ4A 1BFSA 1N0LB 5KJRH 3CDZA 5DS1A 1AHWB 1AIFA 3BPCB 4EKJA 2WMPB 4FQ2H 5IJKC 1JF5A 1FL6B 2F53B 1B6DA 5GS3A 3V0AC 3TS8A 1T20A 2NXYB 2YRBA 2B59A 2WQUA 4QLRA 4FFWC 4WW1A 5C1MB 1K2DB 1U8MA 4GRLB 4K71C 3UDWA 4PY7A 1S5HB 4LBEB 2BFVL 3SDXB 4AUYA 3DNKA 3Q3GA 3WFDH 2MKWA 3MNMA 5EB9A 5J6SA 4GSUA 1BAWA 4OZFB 1QBMH 4C83B 2XG5A 4U1HB 2LTQC 2F54A 2F5BL 3S3PA 4DKEH 5FM8A 1SN5A 3WEMA 4UBDD 3CX5J 1L6ZA 4G43B 4A6YH 4H1LG 3RY4A 1FCCA 3TO4A 4XVSH 1KF9B 2HH0H 3GBNL 3QO1B 3C5SB 4YX2L 3ZKND 3CWGA 4UINH 3AREA 4UTAL 5IVZA 4PHZA 1CDGA 4ENZA 5LXGL 1X6NA 3B9VA 4HAFA 4P46A 1U58A 3WL9B 2DQFB 1EUTA 3QI9C 3B8YA 3KS0J 1O5PA 5AL8A 2XN9A 4PLNC 3BKYL 3EGDA 1J86A 2NW3A 3SGKC 1C1EL 3O0RL 4JQIA 3SDAD 5BV7L 4JDVB 3W9DB 2EH7H 1QR4A 2FO4A 2XWCA 4F15C 4ZX3A 4KK8D 3LKQB 3K6IA 4NRXB 4DF9A 3KLAA 3BP6A 4N0FA 4PCKA 3KR3H 3IK2A 3T4AC 4BJLA 1TFPA 4ZXBB 1DL7H 4WWKD 1T6BX 2VLMD 1QNIA 3MGAA 2XG4B 1JP5A 5KW9L 3QWQB 2Z65C 3T0EB 5CD3A 3K6FA 1YPZF 1S5IL 3UYOD 4YEFA 4NC0B 1NFDA 3L3HA 5GGRA 2CRIA 3H9SB 4M8UA 4A04A 1INEH 3REVB 4IRJB 4JL2A 3SGJC 4AZ8A 1T5WB 2A9DA 3ALXA 3FFCD 4H4NA 3LKSB 2G4GA 4J1UB 4R7NB 3X3GL 4LLUA 2GB2A 1TCRB 4LGPB 2GCYA 4BFIB 4R8WH 2BZ7A 3NCJL 2W0LA 4YDKL 1HEHC 5E4EB 4RNRB 1GHFL 3VXRA 1WWAX 4HOXA 3QNYB 1MQ8A 1TJIH 5HHXL 4XNDA 4GW4B 5D7SL 3EYSL 3NCWA 4XPBL 2WAHA 3V0GA 1MRFL 2PMZA 4AT6A 3L3OC 3O4OC 4HMCA 4NCC2 4ODXB 1EHKB 3VD0A 5DFWH 1VFUA 1OCWH 3MLRH 3QO0B 5EA0L 4LRIC 1BGXL 1SDYA 4F2EA 2A0LC 4GPVA 1QPKA 3FRUB 2NZ9C 3ZTEA 3B1UA 4YSSA 3VFUB 2GVYA 3JQOB 4AEIH 1F6AA 4PJ9D 1IGJB 1E2VA 4JAMA 5FHAL 2I85A 3AACA 4JBSA 3RA7L 4EZKA 1BFTA 4O51A 1OGTA 2FBOJ 5ILTL 2W60A 3KBFA 1MEXH 1ZANL 2G0LA 3OKKA 4RISH 1MWOA 1LILA 1KB5B 1SQMA 1FJ1A 3I9IA 4NQEA 5LBGA 4G6FD 3SJVA 4I2XB 4RMRA 5D8JH 4Z7OF 2Z35A 3FMGL 4BHUI 1QSFE 4HZLB 2YAMA 4JO4H 3VD7A 4M4RB 2R2EA 4MVBC 3NPZB 1GVIA 2BOCA 2WLIB 1OM3H 2VYRE 2ZYHA 3GNML 4UCFA 3BUTA 2B14A 3NRQA 2IH9A 2OI9B 1FFOB 3QIBC 4HA1A 3LQZA 4U6HA 2V5RA 1A5FH 2NQ3A 5ECGA 3U9WA 2XFGB 1FHNA 1F3JA 2HG5B 5IVXA 3AADB 3BN9D 3I2CH 1ED3B 3E3QE 1A6ZB 4N2NA 5FCSH 4HG4J 5EEZA 1NSNH 2R29H 3FUDA 4CADB 4MAYA 4CDGC 3ULVL 3I9PA 2XFXB 3L1GA 1DUZB 4WW2A 1A7NH 4YHOH 1FBIH 4NQCA 4TRPH 4HKZA 2FT6A 2H0EA 4JMXA 1GIGH 2F58L 4U6YB 5IB5B 1J5OL 2MRYA 3HMXA 2ROYA 2Z93B 5KG9A 4AGOA 3KPRD 4LBAA 4CN1A 1IM3A 2DTML 2RD0A 3U1SH 4XPGH 4BZ2H 5MEPB 2VO5A 2P7TB 3V0VA 1DJIA 1HHKB 4HWZA 2NY1C 3U0WH 1CI3M 4RWYH 4OZFG 4DKTA 2H1PH 4X4MA 4HJGB 4XX1E 4Y2LA 1J9SA 3IE4A 1O6TA 3NACL 1DR9A 2UYLB 3NT0A 4MDRA 4ONFL 1NKGA 4PGBB 2QT6A 3F7YA 2FD6H 2YPKA 1PEZA 4NXSA 4TTGA 2NXZB 1BZ8A 4FXGA 4J4PD 3QULA 4D0DA 1XDTT 5F9OL 3SPVB 2CHZA 5GJSL 4U6TA 3RHWK 1I3GL 3HI1B 3P30L 4KRNA 1JF1A 1TO5A 4PLKD 4MXVF 2GJZB 4HEPG 3P3SA 2FIKB 4N2BA 4UNTA 4YC2B 1L7TL 4CVWA 5BXFA 4X83A 4MS8D 5MEOA 4MB4A 5JHLH 3BAYA 3RWEB 5H2BA 3LNEA 4JFFD 2PWHA 4WZ9A 5CCGE 1YVLA 4U0RC 3SDCB 3WTWA 4CSPA 1JPST 4L4TE 4K9EC 2EDNA 4OVVA 4KQ3H 4I5BA 4WDIA 3KPSD 1T7XA 3KE0A 1P53A 3WFCL 2EIBA 3IGAA 4ES8A 5GGTL 4M6AA 5TF1L 2XY1A 1MJUH 1AQKL 3KGUA 3TFKC 5E2VL 2WZAA 3EHBC 1HH6B 4FNLL 4OCNC 1ZVHA 3U0TB 2C8NA 2X6CA 4HPYH 1U8QB 2DYPD 4OQTH 3GLDA 4G5ZH 4JO3H 3A5VA 1DDTA 2X41A 2WV3A 1KJMB 2WOBA 1OCRB 3OAYH 1U0QA 1HHGA 2ESVB 2NYZA 3TVMD 1DN0B 3FSWA 5TPWL 1S4IA 4P9MH 4BHUA 4HGWA 3NSXA 2L7QA 2J1XA 4ZUSB 5ICZB 5CLTA 4N26A 2WQXA 1I1YA 1NGYA 2CKBH 3FUKA 2AQ3A 4ANKA 5JPMA 3OHMB 3QNFA 5DHYB 2VISA 3RGBA 4Z3IA 3OLEA 5KN5A 1KCVH 2ZYSA 4PB9L 1BJ1J 1BVLB 1Q94B 2Y5EA 1GMIA 5TK2A 1XAKA 1GS8A 2Z1KA 4PJDE 4QAWA 5DQDH 4OBRA 2JCCE 3QUZC 3D2UA 1P4LA 4HIHB 2VDQL 2TRYA 3N9GH 1O7DC 1FFRA 1OF2B 4PRPD 4EXKA 3D0VB 1ECYA 2E9BA 3ABKB 5JW5B 2IC2A 2HN7A 1XR8A 3G5WA 2GG1A 1QI3A 4QHLB 1CE6A 1NPUA 1Z2KA 1VPOH 2H3XC 3OKMA 1JZHA 1EO8L 2XDHA 2G75B 4LAQL 1FFNA 3MFFB 3Q6FB 4B41A 1PLAA 2ZOKA 8FABB 3NUKA 2IAND 4TSAH 4M61B 1ZHNB 3FOMA 4ZNCD 4AQ1B 4ZAKB 1JFQH 1X5GA 4CC4C 1BOGB 4QRPE 4LMQI 4ZK8A 4JM4H 4KTGA 4IHOA 2LHAA 4Z7VE 1GL4B 1WHPA 3P73A 3QCTH 4YWGL 5AW9B 1PX4A 1FO0H 4B9GA 3PHAA 5T5NG 3EAKA 3G6JE 3DRTB 4KVNL 3UTZB 3BAXA 4FLOA 5ICYB 3BUIA 1RK7A 3SCMB 3WIHH 3JTSB 4JO1L 3M17B 1CLOL 3U4EB 2VLKE 2CNZA 4V33A 1JV5B 4CN6A 4B9KC 2CMRL 2FGWH 2LAGB 5CSGA 5KS9B 2X88A 4NDMA 5J13B 4GQ9L 4KAQH 3QJXA 1IEAA 1CQYA 3CU7A 3FHAA 2I27N 3NCEB 2FHBA 2NNCA 3HCVA 4LB8A 1ORQA 2E6QA 3UPRB 3T0BA 1IBBA 3CSPA 1SHWA 2IBZY 4PBVC 3OGCA 5D1XA 3BUDA 4DO4A 1T1YB 3KPLB 2D7TH 3GZQA 2QR0B 5F1NA 3H6AA 1G6VK 1FGVH 2V3EA 4GXVL 1XAUA 2Y3NA 3O3AB 3QCVH 2R2CA 1CPUA 2VDRH 1CDBA 4FHJA 3C5ZA 1II4E 2A74B 3EJYC 4PUBH 5I1JH 4JB9H 2MFNA 4XBEH 1JGUH 4P5KA 3CFEA 4NM8L 5AFAA 4XOEA 1CFNB 5DJAA 3WHE0 2IPKB 1MJJB 3QUKB 4DN4H 2MCG1 2GUYA 2KDYA 2OXHB 4D0CB 4DGWC 1GGBH 3BQUB 2OMWB 5CN1A 5FO8A 4CW1B 1XGRA 2Y1VA 4GYBA 4HJJH 4LSPH 1QLEB 2FBJH 2YJLA 3GB7B 4J2XA 4WFEE 3UAJC 5D1ZC 3FO0H 2EDBA 5FYKH 4N0UE 2VLJB 2XPGA 1ZT1B 5E8NA 4XNMB 5EUKA 2MH4A 1FAKT 1N3NA 1TNNA 3GM8A 4KROC 1IKFH 3NJKA 4ZFOL 3NJVA 4DTGH 4OFDA 1BQHB 5T8IA 4BA8A 5JOPE 5F0MB 1PAMA 3MX0B 3J27A 1RURL 4RESB 4X7TB 1F4AA 2N7AA 2NNXA 3FH7A 2NOYA 5FO7B 2R0ZL 3BLBA 3HE6C 4XCEA 1G7JA 3REWA 2KUTA 1WZAA 2O93L 1RPQA 2J8OA 5EU4A 1KJ2B 4OZIF 3O2VH 3LMJL 4P06A 5KBMA 2CA4A 2P43B 5DR5L 5EU3B 3UTTE 4G1EB 3C8KB 2C7FA 1I9JH 2YMTA 3GSXB 3NJXA 5A2FA 2Y5TA 3CFCL 3OKLB 4Y1SA 2OV0A 3POCA 3N04A 4WRLA 3EFOA 3QIWA 4NZ8A 4AYMC 5HJBA 1RXLA 3T2PA 1T0NB 4WV1C 3ABLB 2X87A 5HD8D 5IJBC 1WFJA 5C2BH 1ZDSA 3I6LD 3WEBA 2VC2B 1CDHA 1HYRC 4UU9B 5IB3B 4ZUUA 2JTYA 1GYWA 4HCGA 2N4IA 5GRWA 4HOWA 2AJ3A 4OSUH 3ZO9A 3HNTL 4MMXB 3H42H 4H8UA 1G87A 2Z4QB 4P3DA 4R97C 2YSTA 1BXXA 4OCSL 4DP8X 4G6MH 1KNOB 3OXSB 4IJTA 2BSRA 4QRSA 3ROLB 3SO3B 3VAEA 4YBLC 1OANA 2IMMA 5F3BB 1LE5A 1HEZA 1V05A 4HLZG 4YGVA 1MI5D 3LZPA 4LKXA 4YHLL 4YXKL 4LVHB 2VR3A 3M7OA 1UXWA 3EDDA 4IEFA 4V1DD 1A9VA 4ALAC 5E8EB 3RL2A 4U4IA 5DLLA 3TEYA 4L8CB 3QDME 3N5AA 4ONHB 4PHXA 1NUNB 2PW1B 3SDAB 5F9JA 4KZ0A 2ZXEB 3T0WA 2G30A 3WIIL 4MDIA 1NCWH 2FECL 4EAEA 2IDUA 2YQBA 3HG1D 2N0KA 3V4UH 1FRGH 4CC1A 4MASA 4GRWF 3KYKL 4PJHF 4M6MH 3QC6X 4WWKB 5EWIL 1SBSL 2OMYB 3MO1A 4Z6AT 1UKQA 3BAKA 3L4ZA 4AL8H 4BZ1A 3RUGF 5DMIH 1WIUA 3D85D 3VI3B 1JD7A 2DJUA 1PEWA 4JPQA 5TE6H 4PRBB 4D9RE 3DSNA 4MAZA 4NO0D 1TXKA 4O58L 2UZYA 4OCMC 3SGKA 1JZFA 4UAHA 1R0AL 1I8MB 4HKBA 2HLFD 3PUUA 4PV1C 2F2HA 1KJ3H 4FP8L 2BY3A 5HI5C 3O81A 1ASOA 4JJOA 1BZ7A 3MV7A 3NZ8A 3CPUA 3FCTB 1IC5L 1FPTH 2A6DA 2YK1L 3VDAA 5AOJA 2DD8L 5B4MD 1KZQA 5L8KB 1P7QB 4XP5H 3TBWB 1MFCH 1ZTMA 3PDOB 5IUCA 1ECZA 2BVQB 2ZP9A 3PQYD 3SGJA 1P5UB 2PCFB 5EO1A 2D4FA 1WBXA 3ZT5A 3S3BB 7PAZA 2D9CA 1C08B 3HRZA 3R8BB 5AAMA 3B7TA 2WNGA 2WQ8A 4O5LL 5LNGA 3NCFB 4HISA 4Y4FC 5HI4D 2O6CA 2F54E 3CVHA 3NOIA 4KQ4L 5FOBA 2D31A 2Y7NA 1OE2A 5T5FA 1YNKL 1QHPA 4H0GA 3KYMA 4KBPA 3VM5A 3QDGD 1S7QB 1BP3B 5D7JC 3AJ7A 4HSQA 4LP4A 2O1AA 3FYIB 3NIDB 1FYTA 5DRNB 1MCFA 4N1CA 2J8UB 4XXWC 1CT8A 3K2UH 4FRWA 2HYMA 3ZGIA 4G6FB 1FYHB 1I1AC 1AGCB 1T7ZA 3ZT7A 1PYWA 4H5SB 4Z7WF 3UP1A 1Q9KB 2QVTA 4L3ED 4IGBC 4LRIA 5EBGA 3ZE0F 2VR5A 4OGXH 1Y0LB 2XN9E 4WFFE 2JJUA 4EE2A 4XXCC 3K6DA 2CRYA 2PP8A 4H44C 4QO1B 3LNGA 1GJWA 5K93A 1BQHG 4ODBD 1UG9A 4ICXA 5I8EA 4G8AC 3S34L 4G8IB 5F9AC 2DQCL 5BS0B 3SDDA 3VWKD 5IT2H 3H9YA 1VFAA 3IDYC 3QJVB 4G3YL 3U6XS 3L5WB 4M43L 2BP8B 5BRQA 2VJ0A 4HJ0D 1G7HA 4L1HA 3GHBL 4NKDB 5HI3D 1QFPA 2B1HL 1J1OH 4GP5B 1NFDE 1MAML 3V0DA 1NLBH 1LMKA 3C08L 3PWVA 2VQ1B 5CR8A 4X5WA 4LCVA 3EOTH 4WU5A 1INDL 1A3ZA 5E1HB 5EO0A 4N8PA 3S3CB 4ZS6D 2YBRA 2EXTA 3M46A 4AVKA 4KKLC 2Q6WB 1H15B 3DX0A 3ZTCC 2AF2A 2VITB 1JCVA 1A6UH 1AHWC 3CH1B 2AV1B 1HZLA 4JREB 3GMQA 1AY1H 3QIBA 3WNLA 2EDJA 1M1SA 4GUOA 3VXRE 1CFSA 5F70A 4CSTA 3VTAA 4H20L 3KCPA 1A7QH 4GRLC 2AV7B 3Q7JA 5I1KL 1JXKA 1SEBB 3PP4H 1WCQA 2WLHA 4X6EB 4MX7B 5IGXL 4TQEH 3SKJH 3SGEI 4KK6C 1A7OL 4BQCA 2A38A 3DX2A 2DOCA 5I26A 4N5UA 4K5LA 4FTDA 1TTGA 3OHXA 3TA3A 4NQDA 1A7PL 5ID0B 3HLAB 2VDKL 1X4XA 4NHCL 3UMNA 5I6LA 2ETWA 3TONA 1G84A 3AMLA 3KAAA 1JHTB 2F61A 3L95B 3W38A 4U1MA 2QJDA 1YG9A 1JE6A 1JYNA 3FRPA 5HHQB 3HHSB 3VWJA 1GTNA 4DK6A 2Q76B 1KCWA 1KJVB 1OTSD 4NQEE 2CJUL 3SJVE 2X3BA 1FF5A 2BFVH 4F37K 1YNLL 2P49B 3DMMB 2ZF9A 3V0FA 2FWOA 3KW7A 1F90L 4TUJB 4YJZL 4WU7B 2Q7YB 1C8PA 3CHPA 1UB6A 4ZPTB 2OTWB 5HP5A 2DYPB 4ZW8A 3GSRA 2F5BH 1JGVL 4BE5A 5CJXA 3GSOB 1RZ8A 1ZSHA 2H0PA 1MCDA 4FYSA 4ZFZB 3RG1C 1PG7W 2XTJB 3QYCA 3EDJA 4YHZL 3GBNH 4XR8C 4YX2H 4UTAH 1K85A 2X3AA 4NQXB 3SKUD 3RWCA 4PJHA 3T0EC 5E8PA 1VJSA 1WFNA 4B6ZA 3BEWB 4P5MB 3GDBA 5IVXE 4HYTB 4KMLB 5CU9A 1JI1A 5LXGH 1GYAA 1OSYA 5C0BA 4IRJC 3QEHA 3RUGA 2GPZA 4U1SA 3G6AA 2X1OA 4TUKL 1Y6MR 4UOW1 2H8PA 3EYUL 9CGTA 1ILSA 3BKYH 3PHOB 3RVXD 1A8ZA 1C1EH 3O0RH 1R34A 1WZKA 3ES6B 4NQCE 4HV8B 5BV7H 2XV2A 4Z7IA 2ZUQC 1KY7A 1BBJB 3EYOB 2QPSA 2H6OA 1JZ8A 2ZSWB 4HALA 4M62L 4PJAF 1XIWC 2NNAA 2ZX5A 1SPDA 2VMDA 1U8PB 2OMTA 3ALPA 5D6DC 1T7WA 2HT4C 3MMEA 4PRPB 2LAAA 3MJ9L 5KW9H 4U1GB 5IROD 4X6BA 1S5IH 4M1CC 4MKTA 4X4ME 5EBLA 5EMYA 4HS3B 1MWAL 3GSNL 2BVYA 5AW4B 4AZUA 1G1KA 5T3XD 1NFIA 5E9DA 3S5LB 1SLXA 3FUEA 3WCYA 3VXQB 2XX1A 4A7UA 1JWMA 4YSPA 4I4WA 3X3GH 4GW5A 5D1ZI 2IANB 3IFPB 1AD9A 3FQRB 3NCJH 4YDKH 1OZUA 3VXNB 3UX9B 3QUZA 1GHFH 5A2IH 1D6EA 3BH9B 4J8RA 2X7LA 4FYRA 5HHXH 3B5TA 4LDOB 2ZKYA 4DCQB 2NY5C 4QF1A 5D7SH 3OGOE 2AK4A 3EYSH 4XPBH 4MNGB 4F7EB 1MRFH 3JWOC 1KC5L 2COVD 2HUEA 3INOA 4MJ4A 5E70A 2CR3A 1JN6A 1HH9B 2N01B 4EN3B 1IT9L 3F7VA 4JRWA 4Z7WA 1V3JA 2CKBB 1DQJA 5EA0H 3SBWC 4G9DA 1UA3A 2RB8A 3RB5A 1BGXH 5D2LF 2R1YB 4YK4C 3M1OA 3PWJB 5EV7A 1X5LA 4JFWA 3LZOA 3K80A 1VGEL 7PCYA 4CNIA 1PGRB 3QUYA 5FHAH 4APXB 3RA7H 3PABB 1WGOA 4AY0A 5AVYB 1WFMA 2G5BA 2X6BA 3FF8A 5ILTH 1OSZA 1OB1A 4PJXB 4Z5RA 4YL9A 3X11B 1ZANH 2W81C 5PAZA 4NN7B 3V0WL 1WDAA 4WK0B 2VE6A 3NIGB 3QZMA 1E9QA 4LCYB 3FMGH 3ZQWA 2BSED 5I0VA 1RZGB 1DEEA 2X1WL 1WC7B 2UY7B 4NQSA 3BX7C 5GZNA 2RJMA 4NO2B 4X99B 3GNMH 3W5NA 2B5IB 1Z6JT 4FG4A 4M3HA 5CJ8A 2HRPL 3KW8A 4FQQB 5EU6D 1NGXB 4RFNB 1QW9A 1E4KC 1IAKB 2FEEL 5DA0B 1JWSA 1WWBX 3FCSA 5HYJB 1YC7A 2LFEA 5ITFB 2C9AA 3IDXL 2CUIA 4E0RB 3VH8B 1W0YT 4HUMB 5TF0A 1BX2A 4G82A 3NCBB 2YD7A 3ULVH 1ZIAA 3LVTA 3LY6A 2IOMA 3MUHL 1GZQB 4FJZA 4CVXB 4JG0L 3VB9A 4KX8A 2F58H 3QPXL 4ABQA 5IBLC 1J5OH 3C75A 2D3LA 4IK7A 3UZEC 4N1EA 3EIFA 2AKRB 4U05A 3W9EA 1Q9WA 1CXHA 4Y5VA 4FC3E 2P5EA 2DTMH 2VDLL 3B2PA 4HC1A 4X7SL 5C0DA 4ZJ9A 4LFHD 4AJVA 3SDCC 3GXNA 2HFFA 3KBPA 5BJTA 3TIDA 1IAOB 5E8OB 1TETL 2YRZA 4JPIA 3WS6A 2NDFA 4ZFQA 3BMWA 3ZKMD 1E28B 2OX5B 3NACH 4ONFH 1OTUC 3FQWB 1V54B 4PCYA 4Z7OE 3DBXA 5ID1A 4Z0XB 3UAJA 4HWNA 1A4AA 3RBSA 5EC2A 1NL0L 3QFJA 1A1OA 2W1NA 3GI9L 2VDRB 5F9OH 5GJSH 1OWWA 1I3GH 2QKSA 5JW4N 3B34A 3NGBC 3P30H 5IHUL 4P4KA 5CSZA 2X38A 3QNXA 4L3CA 1U92A 2ZCZA 3BE1L 4UMGA 1L7TH 3EOBA 5CJBA 3MLUL 1T22A 4LARL 5E95B 3CU1A 5D1XE 4ENEC 2FDBP 3FH8A 1T0MA 2EE3A 1S78D 3QQDB 4ABVA 3WFCH 3ZR6A 1FIEA 2UX6A 3HE6A 5C8JA 3C9NA 5GGTH 5SWSB 2ITCB 4HKXA 5TF1H 5JNYA 3ARBC 1V7NL 2ZXCA 1AQKH 3AWFA 3U0PB 1P7HL 5E2VH 43CAB 4FNLH 3IS1X 1A47A 1A66A 5IB1A 4PJ8A 5D7LA 1TG8A 12E8L 2NY4B 2EDHA 1BPLB 3M1BB 4L4VA 4C56A 1SMDA 5LXVA 3UPCA 2EECA 2YD6A 3B4NA 1OGSA 4QRBA 3KYOB 5ICXA 4APQC 5HHMB 1MI5B 4PJAA 1XH3B 3S5LG 3QORB 1NCUA 5PCYA 2GEQA 2FJHA 5TPWH 5KBLA 2EYTB 1J05B 2Q3ZA 1FCGA 4V1DB 1O9VA 3GHPA 4WI8A 4GLRH 2EC8A 2WSKA 3WNKA 3H0TB 2EDKA 1MCPL 2BVOB 4KKQA 3ZE2F 2EYSB 3ZT6A 4CUCA 4M3JA 5EFIA 2ROXA 4JQIL 2WLLA 2K7PA 2VRKA 4KU1A 4ZAKC 4AQ1C 4GH7B 1ZLWK 5IHLB 5KYUB 4L23A 3QYMA 1X7QA 4PB9H 2B9BA 3RKPA 3ZZQA 3RFZB 2Q86B 4X50A 4BWUA 2PYFA 5FECB 1WICA 4MXVE 3GMOB 1G7QA 2B4CC 2VDQH 1X44A 2QV4A 4AX3A 3SCMC 1BG1A 3MBXL 4WJKB 3D85B 1JJUA 3SBRA 1TYJA 3ME0B 1J87A 3PFQA 2C9RA 1XZ0B 4Y16C 7CGTA 2CGZA 3OC5A 4PGZA 1SM3L 3K2IA 1EO8H 4LAQH 1IIIA 3GSUA 3IGFA 5JDJA 2CLVA 1F4WL 4LMQE 4KX7A 2MIZA 2VXQA 2BIHA 1MZZA 3S7GA 2WXFA 4E5XB 4BSWA 4PR5A 3TBBA 5I5MA 2P5WD 3MJGX 1HS6A 3ZL4L 4AGNA 4YWGH 5ESQB 4PV8A 3AQYA 1HSAA 3K2KA 2GABA 4HX1A 4F8LA 3RWGB 4KVNH 5B3JF 4HKJA 1HE8A 1RZKL 5JW4M 4LLMB 4JO1H 1UOLA 7TAAA 1CLOH 5FUCC 2MSPA 3DV4B 5A2BA 4K8RL 4FFZA 3O9WC 5ESAB 2FR4B 5ACLA 2CMRH 3E2HB 2IDQA 5FW6A 2BM3A 3V9EA 5AZ2L 4FF9A 1E4HA 4GQ9H 3VFPA 2ITFA 4Y1AA 2IWGA 4JN2B 1T80A 6PAZA 3IMUA 1E3XA 3VH8G 5KVMC 3BQUC 1KGCE 1AAJA 4X9IA 1VADB 3BH8A 4FEMA 3S2CA 3H6JA 4RQQB 3IMBA 2NUPA 4Y9CA 5IIEB 4P9HC 3DURA 2R83A 1B0IA 4AH2A 3DVFA 4GXVH 2CBMA 2EXYC 3I6KA 3HC3L 3GEFA 2CDGA 2Y1YA 1UD6A 4Y4FA 5FGBC 2QKIB 4GG8B 3CN3A 4IRSC 4Q6KA 3BJLA 5HGBA 3ECBB 3VE0A 1LEIA 5KSUA 1QA9B 2GT9A 3EH5B 4YDNA 1CD1B 5ABAA 1FFPA 2R69L 1KGIA 3CZFA 3VWKB 4OFYA 1BQSA 2NR6A 4NM8H 3E6HB 4N3TA 4F2FA 3OXRA 4Y4KC 1MY7A 4XXWA 4D0BB 5JQIB 1I1AA 5T5NF 4FADA 5LAPA 3KYAA 4XMXA 4TF4A 2CBQA 4XXCA 1GYCA 5DJZA 3ELQA 3RGHA 1TSHA 5DZLA 3ISRA 5IJVA 2D3JA 2EVHA 1BFOB 5CZKA 4H26B 4LLDB 4FQXD 5L7XL 2XICA 3HMXL 1U8KA 4FE9A 3MV7E 3P4NA 3GT6A 2XHNA 2KL6A 2LABA 3GMLA 4K94L 1F5WA 3DIFA 4OFKA 4XTRD 1ILUA 1KDJA 3MROA 2F0CA 3HRPA 1KYDA 5L4IA 5JOEA 1NBVL 1RURH 4R4BB 4E2OA 2R1XA 2R0ZH 3QGVA 4MMXC 5KOMC 2FH6A 3V0JA 4ECNA 5A2CA 1CWVA 1FIGL 3B7YA 3TASA 2FVNA 3U6RA 4IOIA 1DBKL 4KZDL 3JUZA 2OJ1A 3U7YL 2VXTL 4UBDC 3LMJH 2GY5A 5DR5H 2QQNL 3OX8B 4GG6B 3IBEA 3SO3C 3ZKNC 2F1EA 3CFCH 4PB0L 4FQLL 2EDEA 4I87A 1A1NB 5DYOA 5TDNB 4XMUA 4R2GD 3FB6A 4LVHC 1FYTE 4KY2A 4G83A 4JHWL 2E56A 4F7CB 2QMJA 4MQTB 1UUNA 4JFZL 1N5YL 4I3SL 1PTZA 1NWOA 3S35L 2OCFD 4X8JB 4GRMB 3RDTA 3SKNB 1CGYA 2BSSB 2ZUTA 2I9LB 2AJYL 5EIIB 3BPOC 1OK8A 3SDAC 4P99A 1OF0A 1MRDL 3HNTH 3SIKA 2VN4A 3H3KA 3LQAC 3OL2A 4KK8C 4B5ZA 4LO9A 2QADB 4JE4B 4P2OA 5CP7B 3O2WL 5AW8B 4OCSH 1EZVY 5FS5A 4AV5A 1JK9A 2CO2A 4ISVB 3FONB 4YHLH 1FUNA 4YXKH 3PAYA 3VXPB 3OJDB 3V6ZB 4XPTL 4AIXA 1BZEA 1UWEL 3QS2A 3CD4A 4A63A 4E5XG 2GC4C 3H4FA 1GGUA 3ZO0A 5FB8A 1SXAA 3JYCA 3FTGB 3E38A 3ABZA 3MGTB 2WVUA 4Y19D 1I4FA 4FNUA 2C1PB 3WIIH 4LSRL 1K8IA 4I18A 4FX5A 5ANHA 1T21A 1ZVNA 2OSLA 2ATAA 3PPSA 3L2MA 3KYKH 3IJEA 1DQKA 2X4QA 1SBSH 4PJEF 5EWIH 4YIQB 1L6PA 4UZGA 1M3JA 3LH8A 1CICA 4PJ5B 2GJ6A 3MKGA 1UD8A 4YHNB 3WENA 4NQVB 5KSAD 1UA6L 1XGUB 1QD0A 4O58H 3L7FB 4PCTA 4Z7UF 4DVRL 2DLGA 1LK3L 1E90A 1KLFA 3G04B 3P3RA 4UQ2A 5KVEE 4ZFFA 1R0AH 1ZTXL 4G7QB 2KERA 1CMOA 4FP8H 4PJ9C 1QLFA 4NQDE 1HXMB 4GNKB 2X70A 3Q8BA 3K72A 4MKMA 1E27B 3IU3A 3VFRA 1TKWB 3HZKB 1XIWA 1I9IL 5TE4L 1IC5H 2YK1H 1BYPA 2ZWKA 2H3NA 3TBTB 4JZJB 2DD8H 4Y2OA 1HXYB 5I8KL 4Q97A 3UTQB 5LGJA 2G9KA 5BUGA 4XMPL 3FO2B 4RDQG 4Z23A 1XTMA 3KDMB 4X98A 1AZUA 3SSGA 3KPQA 1YJDL 2FH8A 1AZNA 1QSFD 4EPSA 1CLYL 5IP4A 2ICWB 4O5LH 1XSOA 4OKDA 4RAHA 3C6LA 4GBXB 4IRZL 4KQ4H 4Z77B 3MBED 4O02A 3T8MA 3TL5A 5AB1A 3FSZA 1YNKH 3H7BA 3E80A 3FBKA 4DK3A 2VB5A 4N2DA 2AANA 3ZVVA 1R5VA 2EIEA 2K0RA 4LHUD 1U30A 2NCMA 1WZLA 2EE9A 2RIKA 3QAZB 3U2JA 4GRWE 4PJHE 3ULUF 3LNFA 2EDWA 3IWVA 1HQ4B 1I7UA 3BN9C 2R4SL 2O5NA 2EC9U 3FQTA 4XRCB 3VQ2C 1G7PA 5DJ6B 3TC9A 2HVBA 2XBZA 3CIAA 5C0BE 2LU5A 2WXHA 4IBWA 3RUGE 4R5XA 3QFDB 3TEZA 3LKRB 2TRHA 3QK0A 2OFQA 5T3ZE 4A2HA 3JT0A 4WFHE 4AIZA 5BQ7B 3D4YA 4QHUA 3OSVA 3S97C 2O30A 3KVPA 4MD5B 3CK0L 3S34H 2DWDB 2DQCH 3LRSB 4G80A 4M93B 1CTMA 3GUTB 1U41A 1XMEB 5EU6B 1MN4A 5TGBB 4G3YH 2ICEB 3BP4A 4M43H 3KWUA 5KVDE 4DVBA 2APBA 3GHBH 3WHXA 1RUML 2J57A 1GOGA 1MOEA 2B1HH 3IETB 5EEYA 1MAMH 2W38A 1PKQB 2JELL 3C08H 3UCRA 3LPGA 3IFOA 1UZGA 3FT4A 1INDH 3CDCA 2GSGA 3AW5A 4J4PC 5E9DE 5JIHA 3QDHA 2B9AA 5JHDA 5HJ3A 2Z0UA 4M03A 3VGAB 4FXKC 4PLKC 2E9JA 3UZVA 3ZLQC 3BUPA 3AQDA 4MS8C 2OMBA 4LCUA 3DX8B 3S4SA 2MJWA 2X1QA 3FN3A 1FL3B 5IHWA 5EIIG 2H26B 1M7DA 4H20H 1FNEA 3K81A 3WV0A 5I1KH 4HFWA 5D4HA 5F7LB 5KSVA 3CG8A 1LWHA 5DHXB 5IGXH 2AK4E 1EFXD 4FDWA 2KDGA 1U8OA 5E1AB 1A7OH 1DVSA 1JTOA 5F7BA 3F65A 1RHFA 3S35X 4HIJB 4Z7WE 2HKAA 3ZE1F 3EXLA 1QWNA 5J11B 3H2WA 1NIDA 3D07A 3FL7A 1KTBA 1TF4A 1ZT7B 1TVBA 4Y9EA 1A7PH 3UZEA 4H8PA 2VDKH 2YA2A 1D2OA 1W2KT 4NHCH 1NJ9B 3F5WB 4P4RB 3VRJA 3KJ4C 1IGTA 1Z9SB 1UOVA 3BHBB 2LGNA 2V2TB 5JA9A 3OF6D 4N20A 1BJ1H 2CXKA 4TN9A 4JDEB 3TVMC 4TULL 1MDTA 5E6ZA 4J8QA 1CG9A 1IEHA 4IU3A 3KVDD 4K15A 3DVIA 4XN4A 3RX5A 3N41B 4K0OA 4P5TD 2CJUH 2O61B 2CJ3A 1MRCL 4ETQB 5CFAA 1YNLH 3O8XD 5CEZE 5KBNC 5E5RB 3NN8B 2DLFL 2CHWA 3I75B 3PDGA 4K7PL 2APWA 4K55A 4QRQB 5F44A 5A7EA 1F90H 1M2OA 2ORBL 4YVNA 4RZKA 3JT2A 2WKGA 1RJYB 2K45A 3DROB 4P49A 4A1RA 1JGVH 4X5XA 2SODB 1KT2A 2I9TA 2DLEA 1EWHA 4HOZA 2ARJA 1HNGA 4TNVF 4UYQA 5L2JB 3QP3A 3JVFC 4YHZH 3P3TA 1GMEA 3CFUA 4JMNA 5E5UB 4NAQA 1RHHA 1F18A 4PJEA 5DK2A 1HHIB 2FQFA 2BVPB 3HS9A 4MMYA 4Z3GA 1G4MA 2J88L 3PHQA 1GA2A 3ARBA 3VO0A 1Y6NR 4TUKH 3BVWA 4JZOB 3EYUH 3QUHA 4Z7UA 3T3PB 1M9SA 3IJYB 3RE0A 3IRCA 2G5UA 1W0VB 4JCLA 3LRMA 2Y0SA 5C0JB 3AQZA 1MCNA 4PRDA 2P5EE 4M62H 4APQA 4AKOA 2UY6A 5FLUA 4NT6A 5IZ7A 1KBVA 1CDYA 3MJ9H 4LNRA 4UV4L 1A3QA 4WUKL 4JY4B 5C9JA 5JOFB 1XD0A 1MWAH 2F19L 3GSNH 2Z7ZA 3HUJF 3WJLC 5ENWA 2V3FA 3D4GA 5IFJB 1GAFL 1H3XA 2VOTA 2L8AA 3QFJE 1CR9L 3PV7A 2GJRA 2ADIB 5DHDA 5LAXA 3ZZ1A 2WBJD 2D9QB 3P2TA 1B2YA 2Y2YA 2ATKA 4Y0GA 3VNYA 1I31A 4ZX5A 4YSOA 1E8XA 5GRJL 4Z76B 2JKSA 4LOFA 3VI3F 2QGDA 3KWWB 1LO3L 1QSEA 4PIBA 3L4WA 4AIOA 1T03L 3GMMB 3SY0A 5I6OA 3PWNB 1NCHA 1MXDA 4KTYA 1KC5H 2B16A 3MV9A 3W39B 4Y16A 3IKKA 1IJ9A 4ZUTA 3ILQD 3L45A 1IT9H 2GI7A 2VZ3A 4JFYA 4PJBB 3UXFA 1P7KA 3D30A 2YXWA 1B3JA 4WSGA 3QXVA 2B5IC 4J2QA 5KZCD 3CVHL 4LOEA 5HDBB 1VGEH 4YLBA 4RZCA 5D7LE 5T5FL 3UPRA 4PRNA 4S1SL 5K59F 4GSDL 2LQRA 3I02A 2W9EL 4L4VE 4C56E 1SDAB 5IMLB 4BFKA 1VCAA 5DJDB 2N56A 2AXGB 4OLVL 1LM8V 4B53A 3AG3B 4PJAE 3L17A 2VDQB 4OJYA 4P2QB 3GSQB 5IV2A 3V0WH 4IMKC 1AGBB 3DJZA 4RIRA 2ERJC 2IAAC 2KT6A 2NY0B 5LCVA 3O9WA 3FQXA 2E7LC 3VU1A 4RRPA 4LFHG 1H8LA 2ATPB 5CO1A 3MRQB 2XLLA 5EZLA 3CC5A 2YAQA 4HK3N 4MB5A 2GHZA 5I19L 1USQA 3VFNB 4BFRA 1RZFL 2QQKL 4OF8A 3FPXA 1LGVA 4HK0B 5C07A 4DERA 2PP9A 2HRPH 3CSGA 3Q13A 3AAZB 2D2CC 4ZUVA 3CFQA 2AK1L 2YGPA 2PETA 3SKOA 4FKKA 1KCRL 2CIIA 4HUVB 4AJYV 5K1NA 3PGDA 1OSEA 1UVQB 3DTDA 2OA9A 3Q9PA 3IDXH 2CBOA 4KV5F 5AB2A 2VUKA 4KJYA 4X5RA 1N6QL 1J0JA 1XD1A 4WNJA 1ZLSL 1UJ3A 4WI0B 1JZ7A 2YJQA 4Q9CA 5FGBA 3JYBA 5JQ6L 3GEWB 3QNZA 4IRSA 2HB0A 3WIAA 3S3JA 3AC0A 3D50A 4FNQA 4WGWB 1TYRA 1QSZA 2VIRB 3HZMA 4JG0H 3QPXH 3LD8C 2CLRB 3O4LD 5TDPA 2E9IA 1U3HA 3IDNB 4ZMXA 4E41D 1KYAA 4W70A 5F8QC 2PO6D 2ZT9C 2VDLH 1F4XL 4X7SH 2WZ0A 1M2VB 5D93B 4Y4KA 5HD8C 4HIPA 1ZLDA 4PS7A 3Q8CA 1TETH 4IMLB 5GISL 1DE4B 2WUCL 4OD2A 4BM7A 2MPAL 1RK1B 1FZKB 1RLBA 4LGRB 1BQ5A 3EJPA 3TO2B 1TVDA 2ENJA 2VKWA 1HXKA 2ZAHA 5HDWA 5A16B 1A3LL 3V95A 3O45B 5TQ2L 5JIPA 1RZIA 1NL0H 5KVEL 3ETBJ 4K7PX 4D8PB 2XI9A 3GI9H 2B39A 4M1DL 5GGSY 5DJ0A 4KKAD 3BYTA 3TFBA 3V4PA 2PCPA 1O5DT 4Y1AE 3LCYA 5IHUH 1I3VA 1QO3B 3KM1A 3BE1H 1Z0NA 4G7SB 1BHGA 1KN2L 1U95A 1XGTB 3GMNB 3QEGL 5DRZB 2Z9TA 5F72S 4BFGA 3MLUH 4MNHB 4AYFA 1I7ZA 4LARH 1X5IA 2GIMA 4MYPA 2IALB 3CSYA 3OKNA 5CGYC 1X9QA 4KKNA 3ARPA 4HS6B 5BVJA 2ITDA 4KI5F 3WIFA 5KAQG 1Z7JA 1FZMA 3QDMD 1RMFL 1V7NH 4PP2A 5HDLA 4Y8AA 1X5XA 2HAZA 4FQHA 4W6XB 2IAMD 2H6UA 1KNOA 4NUJA 3MLTA 4MCZA 3RFZC 3QEUB 3K5RA 2V2XB 2NSQA 12E8H 1EJ8A 1KEML 4P2RD 4OIIL 5DHEA 5JXEA 1AC6A 1MW3A 1PIGA 3EJZD 5JIDA 5LNDA 1X5AA 5CLZA 5M94B 1CGXA 3BC9A 3I74A 1U6AL 4ZFOB 2DM4A 4N2MA 4K9EL 3VNZA 2XWBA 4F3FA 5T1KB 1AGEB 1HILA 5DJ8A 2VDML 5BPPA 2PF6A 1WA0X 4FEIA 4UDUB 5FYJE 3RLSA 3HUJA 4BFEA 1K5WA 4MSWA 1MCPH 1CFMA 2HLFC 5AOMA 3Q5YA 4D9RD 4Q14A 5T3ZL 3DO7B 4OZ4A 2JJWA 1QLRA 2XPZA 5FFLA 4JQIH 4CBPA 2ZUVA 1BIIB 4Y19B 3FUHA 1OPGL 2BFGA 2WWMD 3B3BA 4MMZB 5IJCC 1WBYA 4ORGA 1CXIA 3DJSA 1YNTB 1P4IL 4FULA 2J6EA 2R8SL 2F7QA 2GI0A 4IM8A 3ZYJA 5B4MC 1VGKA 3WJMB 4MD0A 1NGZA 5HYQB 5FKPB 3MNWA 2X0WA 2C3XA 2IV9A 2HJLA 1I7TA 1IARB 2X2IA 3MBXH 3WKQA 1QABA 3MGOB 3FFCA 4RCAA 3BUBA 5KSAB 5B7EA 2BWQA 3E2HC 3D08A 1X7SA 1OW0C 1SM3H 5HI4C 4F8OA 4E36A 2GEEA 1Q0YL 5A2KH 5C92A 1F4WH 3FB8A 4ELKA 2F54D 2J1YA 4F91B 3IDMA 5HHOB 5DTFB 5KOVC 3Q43A 3TO4D 3ZL4H 4YQXL 1C16B 2OM5A 5C0IB 1FFTB 1WTGT 5FO9A 3ARED 5KUKA 1KPRA 2ZXAA 4QYOB 1RZKH 4H8VA 4EIUA 3MRMA 1T2QL 3PFUA 4P46D 2PPDA 1QSFB 1TQWA 1NA8A 2QKIC 4K8RH 4XXDB 3MXVL 2XN9D 2OYLA 4G7YL 3ZE2E 4PJ9A 4F27A 3GBLA 5AZ2H 4YFLF 1FL5A 3MBEB 3WNIA 4G42B 4NIYE 3VWKC 1XR9B 2YSSB 5F93C 2IADA 3B9AA 1PZ5B 3VSVA 2A6IB 2Q8BL 4LHUB 4HJ0C 4XO5A 2ENSA 5HI3C 4K3JL 1I3RA 1NAML 2DWTA 3H3PL 3O6KL 3QYNA 1KLUA 1LD9B 3TCTA 1UXLA 1EA9C 3UFIA 3KBEA 1XF1A 3CFDB 3EYFA 4MQ7A 1NOFA 5CEZL 2HX7A 1NBZB 4ZS6C 1GGTA 5BZDA 4Y88A 3CPLB 4U6VL 1XCTB 2CIKB 3HC3H 2VXVL 5F1KC 5DRWA 4B7LA 4H0IA 3F64A 1C5CL 2GBAA 1MY5A 3PXJA 3VB8A 3RJDA 5H35A 1B0RB 2V5SA 4BELD 2R69H 5C09A 4QWWD 4B3VA 5DWUL 3VXRD 4H13C 4K3DL 4WI2A 3AU1B 2V7NA 2IPTL 5JDSB 3LS5L 2GJ6E 1Y07A 1HYSD 1ETZA 1HZHL 5B3JE 5GGUA 2XY2A 3P0GB 1ROCA 1A2YA 2CGYA 2ZPKL 4ZMOA 2BXYA 1NICA 2AQ2A 4GKNA 1F00I 3KPRA 5L7XH 1M71A 4XCNB 3HMXH 1HSBA 3JZYA 4BDVB 1TENA 5AVXB 1NGPL 2V9RA 1RSYA 3N85L 2PXYA 4TSCL 4NRYB 5D2NC 3WO3B 1AACA 1BQUA 4YFLI 1T5XA 4DFIA 2OR7A 4K94H 5IQ9B 1OTSC 4XPHL 1DHKA 1IKNC 2X4UA 3LKNB 3SD5A 2V7HA 3EOAB 1EFXB 4L4TB 3ZHDA 1Q0EA 1QFWM 1NBVH 1ZGLP 5KBPA 3HIZA 4J4PA 4LLQB 5ICUA 1IEBA 4I0KA 2H2SD 1YC8A 4A39A 5I5RA 1FIGH 1U8IA 4M8VA 4KZDH 1DBKH 1OLZA 4FXKA 5JORA 4LPYA 3U7YH 2X40A 3FT3A 1FN4A 2VXTH 5DMGD 3C5JA 4O4YL 2QQNH 4EXPX 2QGEA 2O6DA 3BJ91 1MCOL 3OZLA 4JFFA 3EH4B 2DV6A 1IAMA 3DUHA 4AEHL 2OKMA 4PB0H 1YUHB 1OOWA 4FQLH 4C59B 2F7PA 4J23A 2AS5M 1A6TA 3KPSA 1TTBA 5FKAB 4JHWH 3L13A 4P5TB 3IXAB 4JFZH 1N5YH 4I3SH 3S35H 3LN4B 3OTTA 3O8XB 2XVKA 4UM9D 5J1AA 3B2XA 3HHRB 2AJYH 2XX0A 4PREA 3OG6B 5BRZA 3RVXC 1KEGL 2KS0A 5C0FA 4B60A 1MRDH 4MAYD 4HPOL 5FX3A 3ARGA 4YSRA 1DYZA 1A7RL 1S8DA 5C97A 3O2WH 3RRQA 3FHQA 4JKKA 1CVSC 3FOLA 3OJMB 4R90L 5KBDA 1SXZA 2R7EA 3TVMA 3P69A 1IM3D 4PJDB 3A24A 1Q9LA 4LOUD 5IROC 2JCCB 2KI6A 3EUDA 3KLDA 1CXEA 2C9PA 3MRDA 5DXWA 3UADA 4BCXA 4Q89A 3DVGA 4RFEB 4XPTH 1I8IB 1UWEH 1DVQA 4X8GA 4WTXA 4DJMA 4GUPB 1QTPA 3PNWB 3DRQA 3ILPB 5JHDE 5HGDA 3EYOA 4L2YA 1SOKA 4WTWA 1TEGA 1NM4A 2A83A 2OMVA 4LSRH 4FZEL 1HOCB 5F3HB 2DIEA 4PGCB 4DP1X 4N0CD 4QRPB 5I0ZA 4Z7VB 1UD5A 3MOAL 5KVGE 2Y6SD 3IJ8A 2YGOA 2RFXA 1HC1A 3L6FB 4WJ5A 3WY3A 2ZXBA 4GKSA 3G6JB 1CDJA 4N2LA 3U4AA 4ALAL 1MKFA 5F6IB 2ZKMX 3VJ6B 1UA6H 2CG9X 5I73B 1LWRA 2EABA 3MRHA 1WJ3A 4DVRH 1MLBB 4LHUG 1LK3H 2DYSB 3S88L 2VLKB 3V4VB 4JJ5B 4DP6X 5A6IA 1ZTXH 2WBJB 1CYXA 4DZBA 4JVUA 3H53A 4U7SA 5BW7A 5I1LB 1TO4A 4MJ6B 2FZ3A 4NKOB 3GXUB 2V8LA 1U8JB 5F7MC 5J9PB 2IGFL 3H2QA 1I9IH 3HJEA 3QAZC 5TE4H 3TH4T 2E7MA 4BFNA 4Z78A 1EQWA 1RJLA 3BEVA 3B56A 3J8F7 1QEXA 1DBBL 5I8KH 1I8LC 2MPVA 1J9RA 4KVCL 4XCCL 2X9WA 4U3SB 5AVSB 3BRFA 1S7UA 3WGVB 1OV8A 2Y7SA 4XMPH 4K2UL 2VZOA 3C87A 4NHUB 2OCJA 5K9OB 4DEPB 4KI1A 1NIBA 1QFHA 2PPEA 4FQJL 3EFFB 1YJDH 2ADGA 3OAYK 3V5KB 1TEFA 2FO1A 1O6SB 4OF3A 4FFZL 1CLYH 1FNSL 2OL3A 3UPAA 4DPAX 1HK6A 4ODSL 1MVUB 1QFWI 3IJSA 3STLB 3MJ8A 2JXMA 4IRZH 5F7HA 2E3VA 3ESNA 4M93C 1NC4B 1I3UA 4WJG3 9PCYA 2EDXA 3IDIB 3JV5A 3C8HA 1A64A 4FI8A 3MUGB 2K6ZA 1CGTA 3A4FA 3D2UD 2R4SH 4PJEE 5E00B 5JA8B 5IOPA 2GTZB 1M9WA 2MTPA 1MWAB 5INCB 3GSNB 2A9BA 4DQAA 4JKNA 4POZC 1HWGB 3V7MA 1DP0A 4FKEA 1DSFL 1OK0A 2WWNA 5F9WB 3CAFA 4Z7UE 1F42A 3WN5C 2W0FB 4N0UB 5HDQL 2YQGA 4NJAL 5J56B 3MCLL 4QI3A 1IB5A 2AP2A 3CK0H 4AQEA 4Y5XB 5DUML 1BECA 3EJTA 2JWYA 5EZJA 5DC4B 5TD4A 5KTEL 5JIIA 2BMKB 1F2XK 3ZKMC 3CBJB 1RUMH 2AERT 5JMOC 3L3JA 2G3XA 2JELH 5FYJL 2VM4A 2C3GA 5J11C 2VL5A 5EORL 1IC7L 2AQRA 4UDTB 1RZ7L 4LZKA 5DK3A 5CGMA 3AY4A 3I3BA 2G2RB 2GAZB 3E0GA 3QISA 4WI4A 5HBBA 1A9EA 5D7EA 3L3DA 5F7DA 3UTTB 2ZXDA 2GITA 4JG9A 3OR6B 2G5RA 3HZVB 1PJWA 3WEXA 3VXOB 4U1JA 1QSEE 1S78C 1LLAA 2P45B 4L8BB 2EC9T 3ULUE 5JPNB 3UG4A 5EEUA 4NPYB 5T1MB 1DUYB 3MV9E 5EBMB 1TLMA 1SJHA 4QTHA 1F56A 1WBZA 3HS0A 3HBPA 4KHXL 3BZEB 1NFAA 1RK0A 4EI5B 4PFEA 5GS1B 4KDVA 1U3JA 5CKGA 2AAVA 5EOTA 2ZE0A 4R96B 3D3VD 4LEEA 3C5ZD 3OMIB 1ZVSA 1E4WL 1ERNA 4DO6A 4JM2A 3MYZA 1NBCA 3ATBA 3J2PA 3P4MA 4KZEL 2OTUA 1IQWL 5HSFA 1S9XA 3ZTJG 1JPGB 4Y4HB 2TSBA 4TULH 1U91A 5EDXA 1QATA 1MW1A 3CFBB 3DLQR 1ZS8A 5DMJB 3ZDWA 3FU7B 1BD2A 3C2AL 5LKNA 3MCKB 2BP0A 4PWKA 2WVVB 1MRCH 3VFTA 1F3RB 2GK0A 3AB0B 3OLIA 2DLFH 3L3KB 4K7PH 2DQIL 3QDMB 3AZUA 3QR1A 4GG6F 2ORBH 4TVUA 1UQSA 3MRKA 4QHPA 5D7KD 3QZWB 5AZUA 2IAMB 1HKLL 3HPLB 1WZMA 3RGVA 5DJXA 4N8VG 2YD5A 4MA1B 4R7VA 4UB0L 5TDOB 4XMLL 8PAZA 1L9RA 5C07E 5SWQB 3OKEB 3Q2WA 4R7XA 2ZG3A 3T8XB 3TBVA 3DETD 3RIAK 1HZKA 5DEGB 3GPEA 2VDLB 2M8XA 4L29A 4Q6IC 3MRLA 1R5WB 4I85A 1XGPB 4HJUA 2MHAA 5DVOA 1S9WA 4QYAA 1HEJC 3EO1B 2J88H 1OHQA 5DC0A 3T65B 4HLJA 2BC4A 2X4PB 1QZ1A 5SV3A 4MJIA 2PCXA 3MRCA 1SUHA 3ZE1E 5J6HA 3LPPA 3HG1A 3LV3A 1KV7A 1N2RA 4HDIA 3SE3A 3GMRA 4G2AA 1UT9A 3CDZB 1AIFB 4WKXA 3ZKXC 2AXJA 1CLZL 1RSFA 2YOAA 3QIWD 4F93B 2XXGA 1T20B 3D4CA 1GS7A 3NRPA 2B59B 4QHMA 4UV4H 4XI5D 2J55A 4J3XA 4PCSA 1U8MB 4NO0A 2XPYA 1OM9A 3GZKA 2F19H 4PWIA 2W8CA 4WUKH 4PY7B 5I16A 4OV5A 3K1DA 3Q3GB 1GAFH 3SE8L 4JQXC 1GXEA 1TZHA 1CR9H 2XG5B 4TV3A 1UUSA 1M56B 2F54B 4NRZA 5G4MA 3W1ZA 5CZRA 3O3DA 4LEOA 4OZGF 5C0GA 3IFLL 3IXTA 4QHNA 5KVFE 1LDSA 5GRJH 3RWGA 3A4DA 1N12A 3L1OL 3TO4B 2UXFA 4CKQA 3AREB 1LO3H 3PQYA 5IVZB 4ZX4A 3GJFA 2XQYG 1T03H 1KGCD 3MCYA 5FYLD 4IOSA 4Y8DC 3DV4A 5HJDA 4FAAB 3GIVA 3F7RA 1N8OE 4P46B 3CDFA 1U58B 2WNWA 4UZSA 4N6RA 4A7QA 2XN9B 1RJCA 1SMOA 4L5FE 5T1JA 3NJHA 1OOAA 3EGDB 2NW3B 1QASA 3QDGA 1VEOA 5EO9A 3CVHH 1WEJL 4O02L 1OAJA 1MJ8L 2FO4B 5T5FH 1PZDA 3NCXA 4S1SH 3V7AE 4GSDH 1QNZL 2W9EH 1E40A 3KLAB 2Q1EA 3BP6B 4L48A 3VMPA 3IMTA 3TTYA 1UATA 3V9FA 4OLVH 3L81A 3MN8A 2ZAIA 3ZW3A 5I75C 1PD0A 1R3LA 3JWOL 3L8QA 4L3EA 5CD3B 3QXAA 1AOHA 1NFDB 4D9QE 3DDFA 3L3HB 2WQWA 3E9TA 1EXGA 5GGRB 3HUJE 4M7ZB 4AZ8B 4JN1L 2P52A 3PIQA 4FQXC 2AXFA 4RA3A 3LHPL 3QEQD 1IBGL 5I19H 1JXGA 4LLUB 1RZFH 2QQKH 5ERWA 4UTBA 1FZJA 5D93C 2GCYB 1B2WL 2YMOA 1PZCA 4TVSa 4XTRC 3VXRB 2AK1H 4XE5B 5KANI 4ERSL 1KCRH 1ZEAL 2XXCB 2O6PA 3WEAA 4BKSC 1PZ2A 3B7RL 4PS3A 3P77A 1S7TA 4OJEH 4NC2B 3SBQA 1ZE3C 2VW4A 4KVPA 5IVNA 1ID2A 1N6QH 4WQOA 5DQJA 5IOKA 1JGIA 3CHQA 3FFCE 4YSTA 1ZLSH 4AT6B 1KYUA 4M5TA 1LK2A 5JQ6H 2XKSA 4WNQA 1OE1A 4WLCA 5DO2D 2C9XA 3G08A 3VU2A 5JW3L 4X0KA 1OAYL 3TN0A 4DP7X 1H9DA 2XQBL 3DI2B 1F6AB 1F4XH 4R2GC 1TMCB 1WS8A 2QLYA 1CFTA 3DX7A 4JAMB 4O51B 5F89A 1OGTB 1AMXA 5GISH 2DLIA 2OBGA 2W60B 1FYTD 4Q74A 3VM7A 2WUCH 3OKKB 3QZWG 4WHTB 2MPAH 1FJ1B 4NQEB 3SJVB 4JFQA 1UTDA 1A3LH 2OQJA 2Z35B 5KJ7E 5TQ2H 5EBWA 3FUJA 3DJ9A 2AABL 3J07A 1L3NA 2X44D 2LOEA 4L9DA 3X14A 5KVEH 4Q0XL 3CE1A 4M1DH 1QBBA 4M29A 1SVBA 4I77L 2FEJA 3CVDA 5FYKU 2BOCB 5F6HI 2O5YL 1VFMA 5B39A 5D2NA 4N9OB 1KFGA 5AOKA 3SDDD 2GIXA 3QEGH 1KN2H 4HPHA 1N68A 1WCBA 2P48B 3LQZB 4U6HB 1U8NA 1F3JB 5IVXB 2PPCA 3S5YA 4EUPH 4KV5E 5BQDA 5FW7A 2DQDL 1CI5A 4JUTA 1X9UA 3HEIB 1JSYA 2UZIL 4W6WB 1RMFH 4MAYB 2YKKA 4UT9A 3LZRA 4L37A 4WW2B 4NQCB 3JV4A 4HKZB 1L0PA 4JFOA 3IEAA 3WAJA 2NQDA 5BOPA 1KEMH 4OIIH 5C09E 5KG9B 4LESA 1ROWA 3QIBD 1IM3B 1N64L 5A2AA 4KOBA 4WF7A 3I6SA 3B8SA 1PX3A 4GRWH 4LVNB 5CEYA 1U6AH 1R24A 2O4EA 3V0VB 1EX0A 3JZ7A 4K9EH 4HWZB 1F1GA 3VW3L 1JNNL 3BCFA 5KSAC 2VDMH 2WXMA 2WO3B 2K6YA 3F7YB 4ONOA 2YPKB 2XKNA 4K5OA 1R47A 5T3ZH 4X5PA 3ASWA 3V9CA 5HXMA 5HHOD 4FXGB 3ZSSA 3KPRE 3QULB 1LO0L 1OPGH 5CP3A 4D0DB 3TA3D 4FFYA 3DOIA 5LJYH 3ARQA 1P4IH 3L08A 2R8SH 5I23A 1JF1B 4OZGA 3WNMA 5BXFB 2PP7A 1S7SA 3HG4A 4L0ZA 5F7AA 3U83A 5MEOB 5BZXA 2H32A 3UROR 1DSYA 5H2BB 5I5JA 3GTVA 3CFKA 4OLWL 3QQ9D 2YHGA 4LKCA 3VWJD 4Z3HA 3T3PF 1QUPA 5AVWB 4BINA 4I5BB 4WDIB 2DM7A 3AMKA 1Z32X 4X6DF 2I7OA 3HVDA 3IGAB 3L3GA 4FG6D 4KI5E 5KAQF 3GO1L 2QSCL 4LXFA 3MBEC 1RV6X 1Q0YH 2X05A 5E94A 1G7MB 2FX8L 1QG3A 3ZIYA 1OKEA 4R7DA 4J12A 4YNYA 1CBVL 4JFFE 1B3IA 2EDTA 2B4CL 1UWGL 1UB5A 4YQXH 3SGEH 4K5NA 4PV9A 3KPSE 5AAWA 1HHGB 4QXWA 1KYFA 3ULUL 4FHKA 3DV6A 1GCFA 1NTDA 2VMFA 2HRGA 4FQCL 1T2QH 4HGWB 1YYCA 2Q20A 2WD0A 4CJ1A 15C8L 4P2CG 1I1YB 5BRZE 1KTLA 1NGYB 3ZL1A 5D7IF 2CAKA 1J5HA 3MXVH 1TJHL 3KGSA 3CIQA 5CCJA 5JPMB 4G7YH 4NBZB 5T3ZD 2VISB 2JKXA 4QJ5B 1QTYT 2NTFA 5KN5B 2WLKA 1R17A 5J3HD 4UQDA 2E4FA 3PL6D 2YKLL 4HAKA 5L0QC 1G43A 4H8WC 2Q8BH 3NP4A 1KB3A 1C7TA 1I8LA 1BYOA 3H3PH 1NAMH 4K3JH 3VXMD 1JTTA 2R15A 3D2UB 1P4LB 1JGEA 2Q3AA 1PL3A 3O6KH 4HK3J 2HPOA 4OZHF 4AQOA 2NRDA 2W9DL 1R3JA 5CEZH 1P69B 1OCOB 2HN7B 1XR8B 4LVEA 5LCVL 3VA6A 4A66A 1EJ6A 3F12A 5HDBF 5EPMA 4U6VH 1CE6B 2VXVH 3AWEA 4N68A 1YCSA 3OKMB 4QD2E 1FFNB 1C5CH 2ZOKB 4OVUA 3V6BR 4V11A 2OR8A 5DVLA 3T1FA 2OAAA 3FOMB 5ALCL 4B27A 4OIBA 3MRPA 4K3EL 4IHOB 4PRPE 3MRGA 5B1CA 3LNIA 3WE1A 3IETA 2VLLA 3D25A 5DWUH 3P73B 3O6FD 4K3DH 3S36L 2IPTH 1NBQA 3LS5H 4NUPA 4P9HL 4NO5A 2AK4D 1HZHH 2X9ZA 3BYYA 5I15L 5IFAL 5A40E 2ZPKH 1R9FA 2CK0L 1JCKA 1EANA 3T6XA 3WN5A 1YMMD 2BPBA 1B4RA 2R56L 3GHEL 3AUWB 1GKEA 3JUYA 4NDMB 2K8QA 1IEAB 2FTAA 1E5UI 1NGPH 3N85H 3IYLW 4TSCH 1RIVL 1XF5A 1LO5A 3QUYD 1KWGA 3HCVB 4BUQA 3S48A 1ORQB 4R3SA 4XO8A 5DDHA 2QPDB 4XPHH 2GSIA 5AW5B 32C2A 4EDXA 3OGCB 5D1XB 4PGJA 4UAOC 1FSKB 4Z7QF 3O8XC 2J73A 3FU9A 3DO4A 1BG9A 1E4XI 4MTMA 3QRBA 3H7LA 3BP5A 5CEZD 5F1NB 3HC4L 1ACZA 1J9CT 1QPPA 4O2CA 3QW9A 2FEDD 4JK0D 2WYZA 4E9RA 3C5ZB 3V4PL 3LX9A 1TTAA 4O4YH 3ECVA 5GZND 4Z8FL 1MCOH 3FUFA 4AEHH 1QACA 5KVFL 5I24A 4KY1L 1OY3B 1BBDL 3CFEB 4P5KB 4AV4A 5J1TC 1B0WA 5I0DA 1IC0A 5DJAB 4Q9BA 1NBYA 2VC2L 4YL4A 1DQDL 2FLRT 1ASQA 4XO3A 4XC3L 3G5ZA 1UFUA 3RIKA 5C6TL 4HT1L 2BK8A 1DQIA 4YOKA 3WI9A 5FO8B 1B4TA 2PKDA 2XRAL 2Q87A 2O5XL 1F6LL 4J7RA 1KEGH 2CE6A 3TP4A 2HWZL 1MHEA 3X13A 5C9KA 2OMUA 1WYJA 4L5FL 4HPOH 4YDJA 5IMKA 3K8LA 1GSKA 1A7RH 3EADA 3RBGA 1EERB 3MA9L 3CV5A 3U1QA 2XPGB 2ZUYA 1RUAL 3A22A 5E8NB 4CGTA 4R90H 5D96B 1I53A 2EDQA 2Z64C 5EUKB 5GGSA 7FABL 3ARFD 3VG0L 1N3NB 5BO1L 3MC0A 3IMWA 2NQCA 3MV8D 1XGZA 2VZVA 5F6IC 1M4KA 3LXCA 5EOCJ 3WSQL 5H8DA 3T5WA 5I73C 2WYHA 1ZWIA 2G9HA 2EYRA 4X6DA 3B2DC 3LQAL 1G7JB 4FCAA 4XCEB 2WBJC 3REWB 2AEQL 1THCA 1W8EA 2BSCA 4W4OA 1KIUA 3QFJD 4HCIA 4WTQA 3HBGA 5EU4B 5T33L 4Y2DD 4ZW7A 1TTUA 2IH3A 4DPBX 5SWZD 3ZDZF 2J6EL 4FZEH 4MRBA 4P4KD 4Q6IA 1L9NA 1KTRL 1NCDL 2Y5TB 1WTLA 2NX5D 3MOAH 1QRND 1HCYA 3EFOB 3QIWB 4GP4B 2OYMA 4H1LH 3SY6A 3V8OA 3VFMA 1T1WA 3JWNE 4A2EA 3LPFA 4DEPC 1M6UA 1W9XA 4ALAH 1V8HA 4N25A 3VVWA 2BP5M 5G4NA 3OKDA 3R4DA 4ZUUB 2HT2D 3HE6D 1KXVA 1S46A 1U21A 1YNTF 3VQMA 4NP4L 1BZ9A 2AJ3B 2HX8A 3S88H 5D7IA 1AQDA 3BVDB 2FYYA 3ECQA 2P5WA 4P3DB 4PJ8D 3W5MA 1V55B 2IGFH 1OAKL 3I84A 4NFCA 3VRIA 4C56D 4QRRA 4QRSB 2BSRB 4UOW0 4H25B 1F0LA 1DBBH 3K4AA 1HEZB 1LE5B 4YGVB 4KVCH 4XCCH 4LKXB 4K71B 1BD2E 4K2UH 4P23A 2VGLM 3FHEA 4OZHA 1UXWB 4IEFB 3AXLA 4FQJH 2JKJA 2C26A 3DX4A 3RL2B 4UILL 4JQXA 1ZV2A 4X8XA 1JVLA 2Y4SA 3GTNA 4AW7A 4FFZH 5I9QC 4TYUA 1FNSH 3EO0A 2LTQB 4ODSH 2BHZA 4KRLB 5F9JB 5E4AA 2BZCA 1I85C 3NEEA 4MDIB 1MI5E 1HL8A 2WYIA 1IUZA 3RPIA 2P24A 5ETUA 4W9DC 3MLSL 3S36X 4FABL 1CE1L 1ML0A 2XYCA 3MO1B 3F84A 3KWVA 2OYKA 4OW6A 1AANA 3HI5L 2JJSC 3IKCA 3OZKA 3DSNB 2QVMA 4MJIE 1CN4A 1DSFH 5AVQB 2UZYB 2LV4A 4PIRF 1Q90A 3FF7A 3HG1E 3P11L 4HKBB 4DH2A 2PO6C 3TNNA 5HDQH 4NJAH 3MCLH 2PYEA 3GTTA 1CZ8L 2RBLA 1J88A 4J3OF 1MW2A 1OHZA 3MV7B 3NZ8B 3NTCL 5DUMH 3V6FA 2A6DB 4FL4B 3B83A 4MFHA 3NABL 3OD3A 1REIA 3WUZA 1WSST 5KTEH 3F8UB 1PNCA 1BQLL 4LSDA 5FYJH 5AEAA 4ZQKA 1DVFC 5EORH 1IC7H 1RZ7H 1WBXB 4YSDA 5EF0A 4FQXA 5HJGA 4GS7B 1JMXA 4KKAC 3IDNA 3HRZB 4DNLA 1PZUB 4KGJA 1A22B 4N8UA 3CVHB 5LGKA 3W81A 5FOBB 3V5HA 2D31B 3BWZA 1YEWA 2WJ7A 3KYMB 4QXVA 2O72A 5AOZA 2XU9A 3PS6A 3ESMA 4S11A 4OR1A 1TQCC 1ZOXA 5AAPA 1FYTB 3PQYE 2VXUL 5I6NA 4NOBA 5EULV 1CT8B 2CO6A 4W6YB 5GHWL 3L5XL 2OMNA 2XYBA 3PV6A 4WSKA 3TV3L 1A9BA 1PYWB 3OC8A 3SQRA 1PS3A 2P8PA 3R0MA 4KHXH 2IAMC 3DHPA 1SVZA 4MA1C 4AIEA 3QDGE 2VJXA 2YUWA 4WY7L 1T1XA 4KKCD 1E4WH 5J0BA 5I8EB 3EJZC 4KZEH 1AIZA 2J1ZA 1NEUA 1ZV5A 3QXWA 4GO6B 1IQWH 3SDDB 2E5EA 2MKLC 3PWUA 3T2NL 1VFAB 3PU7A 2NR6D 3VGEA 2CHNA 4MCYA 1BVNT 4XNQA 1G7HB 3I9GL 3C2AH 2YD3A 4LP8A 4L3EE 4YHPA 5IJDC 5F7EL 4FNRA 2A7BA 3PWVB 4EIZC 5HGHA 4BD4A 1VB9A 2ZYIA 4X5WB 4WU5B 5B8CC 2DQIH 3CN0A 1NIAA 2WWMC 2YBRB 5C70A 4M1GL 3F7PC 1HKLH 2NY3D 3V0IA 3CN1A 4UB0H 4XMLH 2ICCA