2XKUA

Prion-like conversion during amyloid formation at atomic resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
MIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-2-MICROGLOBULIN
publication title Conformational Conversion During Amyloid Formation at Atomic Resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 7
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xkuA00
4MWFA 2BY1A 3UJTH 1EUUA 1WCBA 2VXQL 2NY0D 3DUSA 4J12A 2YXFA 5I1JL 1UT9A 5IB4A 4YDVB 2VXSH 1Z9SA 1AXIB 5CEXB 3WXWL 5J57B 1T1ZB 2UZXB 2LE9A 5CJXC 3V0VB 3GHEL 1JZ6A 4H1LB 3UAJD 1QRKA 3TT3H 4JM4H 3P0YL 4KKLC 3WDJA 5IFJA 2VIRB 3BFOA 4ZO9A 1ADQL 3TBYA 1YN6B 3CFCH 1XF4B 5TDOB 2VXSL 5CJQH 2CKBH 1KIPA 1YEIH 3EW3B 3H7BB 4LCCB 4YDJB 4MDIB 2XWJB 1ZAGA 1JTOA 2YRPA 3MZTA 4FMFA 3SJVE 3VMOA 4PJGB 2EO9A 3TT3L 4JM4L 2F53B 5ETUA 4PJEF 5ACZB 1VEPA 4X4ZA 4M3JA 2NY3B 1FE8H 2EYRA 1E28A 2AI0L 1CZ8H 2CKBL 4RZCB 4QTHA 1H5BB 3DXAA 1YEIL 4WU7A 4S1QH 3EDKA 3FT4B 3MLXH 4M43L 1LDPH 2E27H 5EU4B 2NY1C 3ARGB 2IBGA 3FFCB 1AC0A 3BZEB 1A7PH 1MCNA 1Z6JT 4HH8A 4EJ1C 1JMXA 5GRXG 2EDTA 1A2YB 4AEIH 3ZE2F 5H37H 2KL6A 4NJ9H 3X12B 3BISA 5TPWH 4KDWA 1FE8L 4Z77B 3LQAH 4CVWA 1WTGT 5DD1H 3ULVC 1CZ8L 4WWKD 5DK2A 4B5EA 1NDGB 5AUMB 3BOVA 5L2KB 4KK5D 2E27L 4G8GE 1Y6MR 4HDIA 5D1ZD 2YHGA 4Y5XA 4YPJA 1S9KC 1P4BL 2FECL 1MI5B 4HH9B 3BEWB 4AEIL 5I66A 4NJ9L 3S96B 1I9IH 3RPKA 3V6OC 1U58B 3ZKMD 3LEXA 5IFAL 3C6LD 3LQAL 5JPNA 3MRQA 2NNAB 5FYJL 2J8HA 4EZMA 4QXTA 5EZOH 1V05A 3SGEH 1NLBL 4YBLC 1V3MA 3TZVA 4F7MB 3RDTB 2A6DB 2AXHA 4DVRH 4GG6E 3EYFB 1X3DA 4IRJB 1A1NB 3Q5OA 4NM4H 5E8EB 2D7TH 5F71A 3GSXA 1JPTH 4LSPH 4L29B 4ZXBD 1J9CT 4XX1G 3JV4B 3K0WA 1I9IL 1G6VK 3PL6D 1NCBH 1PG7X 1YNTB 2OCFD 4RISL 2P8MB 1SEBB 2IH1B 3ARWA 5EZOL 4C4KO 1HCVA 4NYLA 5F7DA 3UP1A 5E5MA 3KAAA 5FDWA 3PWPE 4G5ZH 1NBVH 1T4KA 4HIJA 4PJCF 3V6ZA 5JHDA 3OG6B 4WI4A 3EFFA 4L3CB 1BP3B 4V1DB 4UBDC 3KXFA 1NCBL 3GSUB 1TZIB 1VKXA 1CGYA 3P4NB 5JDJA 4XNYH 1JGLH 4NZRL 1OSPL 1RZKL 2XZQH 2HWZH 1MCHA 1TJGH 5IK3B 3VFGH 1N6UA 3GMNA 3R06A 4HJ0C 1KPVA 4JPKL 4G9FB 2R0KH 5D6CA 4FP8H 1RJZA 1QFWI 5IJKA 1UWXK 3FO0H 4HHAA 3NA4A 1KEMH 2J4WH 5D96C 5KVFL 4DGIL 1S7VB 3VA6A 5JA9A 3BN3B 1FG9C 2XZQL 3RWJB 4Y1AA 4OFIA 5I1CH 3C5ZD 2RB8A 3TIDB 3VFGL 1HSAA 4NUGH 5TFSH 5EBMA 3FQXB 1AQDA 4NPYA 1RZJC 3KNBA 2G2RB 5I30L 5E99H 2F8VA 2R0KL 4I0PA 4FP8L 4P2QE 3WS3B 4X98A 1KEML 2J4WL 1T2JA 5E2VH 4TNWF 1OVZA 4L4TB 3NIFE 2X4OA 4M93B 4QRPE 5CZKA 5E9DB 1MCBA 4P59H 5HHXH 4NUGL 4XPBL 3BIKA 5ALCH 5KSBF 5IKCB 4O51B 3QEQD 5D7KE 2A83B 1ACZA 1OF2A 3H8NA 1KJ2A 4I0KA 3P77A 3OHXA 2BHZA 1MY5A 1XR9B 5D4QA 2GAZB 3DUUB 5HDOA 3VWJC 1H8NA 5GS1B 1JWUB 5FOBB 3TPUB 4UB0H 1GPOH 2HH0H 3AY4A 4TN9A 5ID1A 4I18B 2ZG1A 4P59L 3ELAT 3SDDB 2GITA 5ALCL 3GJFH 2JJVA 1RZIB 2DQTL 1CQYA 3MLTA 1G84A 3QDGA 5C0CE 3WIFA 3BP4B 3MRRA 1MCSA 1HHKB 4R97C 3QEUA 2HA1A 1ORSB 2VOTA 5E1HB 3MLUL 2AV7B 4UB0L 5IESH 4NJAH 1GPOL 5DJ2B 1EHAA 2R2HB 1ZV5A 1UWGL 4G6MH 5INDB 4FQQB 1WFOA 1YMME 4Y89A 2EYSA 4PJAA 1A3LH 3GKZA 3IS1X 4ZD3L 5F7WC 4LLYA 2MCG1 4M1DH 3G6JA 2X10A 1S5IH 1MHHA 3GMRA 5CCKH 3ROLA 4JFXA 2H3NB 3IRPX 5IESL 2QV2A 2R0WL 3QH3A 4NJAL 5FGRA 3REWB 4JLRB 3RTQA 3ZHLA 5F1SA 4OZGA 2CIKB 5KTEH 4DVBA 1IQDA 1HQRA 3LB6C 4KKLD 1HSBB 2X9XA 1A3LL 1BZ7B 3V0AC 4P57A 3ZE1E 1I1AA 5D7LB 4NN7B 4M1DL 1QSED 5CCKL 2XTJC 3O6ML 1FL5A 3ALPA 2WM0A 4EOWL 4LSDA 5JORA 4G43B 1F6FB 2OTUB 4RWYH 3QHTC 3IAQA 4XBPA 2WIIA 3S7GA 2IC2A 5IV2B 2CJUL 1ED3A 3MRNB 1AGDA 2AAVA 4KI5E 4LMQI 2R1WB 2VDLH 4BZ1L 2X89D 4U1NB 5ICZA 4RBPH 1JPGA 2DM4A 1QLEH 5SWZD 1PKQE 4GQ9H 4NQEB 1T1WA 4AL8H 2NY1D 3DROB 3RL1A 2WQ8A 1PSKL 4L4VD 1U93A 5TF0A 5KSAA 3VFNB 1XFPA 3RBSA 1T7XA 3VXMD 3V6FB 4PR5A 2VDLL 5EUKB 2EIBA 5IR1B 1J8HA 1JHTA 1FO0L 1H3GA 3ULVD 3AM8C 4D8PB 3MV11 4WW1B 2VWEE 5T5NF 5DJ8B 1IM9A 5J0BA 1JN6B 1UM4H 1QSZA 3GSQA 3MV7E 4GXVL 5E4EC 1X5GA 3O0RL 1NGYA 1OB1A 4XGZA 3CSYA 4EI6B 1KIRA 4P4RB 1NUNB 3UTPD 3C9NA 4FG6C 2HG5B 2H2PC 2ITDA 3VG9C 4CUCA 3ARUA 4L8SC 5IVZA 4GRWF 3ZKXC 2P5WD 2XQYK 4NQXA 4MX7B 1NCCH 1UM4L 3MODH 1ZHBB 5FO8A 5JW4N 2ZG3A 1NGXB 5GGRB 3LQMA 3LN4B 1DN0B 1EK3A 5DVLA 1U8PB 4QGYA 5F44A 3NCBB 3ZKQD 5CJ5A 4RQQA 3BDBA 1BF8A 3R1GH 4Z5RB 3U83A 4Z7NF 1ZEAH 1QZ1A 3UTSA 4QLRA 5E6ZA 5GIRB 1JNNH 5I71C 1TVBA 3OL2A 2OR9L 1NCCL 3MODL 4JZNA 1UZ6F 4DKFH 1IGMH 2XKNB 2V5SA 5IB2B 2ICEA 4U49A 1XR8B 3C60A 3AC0A 4QHUA 4YIQA 1NANI 4EQ3A 1P9MC 4UBDD 4EIGB 5FV2A 3PWNB 1IT9L 4YC2C 3HB3C 1ZEAL 3HE7C 4ONHA 4OFKA 4OQTH 1JNNL 4GKNB 3CLEH 4JRYA 1BFOA 1F13A 4LKXA 4M7KH 4MHHG 4Y4HB 5IVXE 3S37H 3VD9A 4JDVB 1MFAH 4GBXC 4DKFL 4PJEE 5FM8A 4GKZB 1WF5A 4GW1B 2CUIA 4XHJC 3C6SB 4HJ0D 1L4IA 1RY7B 1XGYH 5I18H 1HI6B 1JPSL 5D6DA 5BRZA 3DARA 4I3GA 2AJSH 2DKMA 4D0CB 3NMEA 4BZYA 4P5MB 1Z0NA 3RY6C 2VUOA 5CZXC 3SGKA 5J56B 3V5KA 1DBAL 1NGWA 1U8LA 4UDTA 3V4PH 2AKRB 5C08D 3DV4B 4M7KL 3T0XA 3U4EA 5BJTA 3S37L 5I1IL 1QUNA 3HE6A 1F4YH 4KJPC 2LQRA 1NJ9B 2CLRA 1BBJB 1YUHB 3RHWK 2AJSL 2YPLA 1KIQB 1B0RA 3BKYH 1BQLH 5DVNA 3V6BR 4Y19D 3P0VH 4LDEB 4JFDD 3QUZA 3QAZB 4FQIH 3VH8A 2HJKA 2VLKB 2YOCA 2XN9E 1F4YL 4PJ5E 1NUDA 3P40A 4U0RC 4PGDB 2P5EE 4JGJA 1K8DB 4PS4L 2ED7A 3LN5A 1II4E 2KZWA 5ICXA 3VWJD 1U36A 1EVUA 2J2ZA 2EDLA 4N0FA 3AREB 3CVHB 4U33A 2C3HA 3KDMA 4KC3B 3O3AA 3FQTB 2YD3A 4YFLI 4OV6F 1IAII 5DQDH 4FQIL 1SYVA 5GGSB 3QDAA 2L4OA 5HI4C 4PB0H 1P84K 1P53A 4JFFD 3IFNL 2IQAA 2WWKT 4M02A 3SKJH 1IGFH 4CVUA 3HRPA 5GGVY 5JXEA 1PY9A 2R2BB 3EO1B 3KVQA 4IOFC 3SDXB 2QR0B 3EUUA 4NC0B 4HUWA 5JNYA 4APQA 1MEXL 4LNRB 5LBSL 3O41B 4RSVA 4PJCE 5DQDL 1G6RA 4L4JA 5C86A 4PB0L 1P7KA 3NAAH 2IANE 4P9HH 1JHLH 3OX8B 5GJTH 3SKJL 1IGFL 2CDEA 4ODWA 3OR6A 5K33A 3MGTA 1T66C 1DBKH 1CIDA 3O3DA 3NZ8B 2R2CA 4HW6A 2CO6B 4HSQA 4CMHB 1RZJL 3QNZA 3RUGF 1F4XH 2C1OB 4S1DC 4XNQA 5FF6B 3LB6D 1JHLL 5HXMA 5FHBH 1K85A 3VE0B 1G9MC 3DUHA 4WW2B 5T1MA 4UOW0 2XZZA 1DBKL 3GZKA 3TYFB 2Y07L 5F3HA 3WNNA 2XTJD 1ITCA 4PRHE 1GGTA 5C1MB 3VW3L 2A74B 4YR6A 3WKML 5HDQH 1CGWA 2HT4C 1F4XL 2OTWA 2EKSB 3BDYH 3H0TA 3UYRH 3MJ6A 4JHWH 5L88L 2K1MA 3TO2A 3ARGC 1AGCA 2WWMC 3ECBB 4HZLB 4RMQA 2PNDA 1OD9A 1I3GH 3PV7A 4IJ3B 3KPSB 3TIEB 3QDMB 5KSBE 1IC4H 3DRQA 5HDQL 3NGBC 1J0IA 5DJCA 3EOTH 3RWCA 1JWSA 3BDYL 4UIMA 3B43A 5FUCC 1CT8B 3VXRB 1KB5H 4XPFL 1TENA 3WUWB 3PP3K 4QY8A 3O3EB 1I3GL 4XP6L 1QA9A 1QP1A 3T2QA 3SDAC 4XHQA 5TGBB 3PWVA 5I8OH 3IRZA 1IC4L 2UWEA 1OT1A 5H2BB 2YR3A 4XMLL 3LEVL 4FG6D 1NCNA 3MR9A 4OUUB 2H2PD 1KB5L 3F12B 5I0DA 5E70A 3RWGB 2J8UF 4I9WE 3OF6A 5I8OL 5CEZD 2OJEA 3LKNB 3H2WA 1RIVL 5I1KH 1QYGH 3CDGB 2DRUA 2HN7B 1VA9A 5EN2B 2DLHA 1OGAE 5DLMH 1C12B 1BVKA 1NC4A 4WWID 4M00A 2FJHA 5F7LB 2VR5A 3V7AE 4P3DA 1RMFL 4QRTA 2CDGB 1NBQA 5HHQB 3MA9L 1R6VA 5E8NB 3RGVA 1Q9LB 5DHXB 1EIBA 5J13C 3P9MA 4CJ1A 3B8SA 5DLML 1KJ2H 2CDFB 1CXHA 1PY4A 3MRBB 4I2XA 4RWHA 1F11B 3CH1B 2NPLX 3HB3D 2DJ4A 2R0ZH 2X4SA 3AROA 3C08H 1MPAH 2XWBA 5EUOB 4K71B 3GK8L 5E8PB 1CGTA 4GBXD 4F33B 4LGPB 4R4BA 4NCC2 1A22B 2ZNWA 1FLTX 4XHJD 5EOQH 1QRNE 5DEGA 3MO1A 3VCLB 3R0MA 2Z4QB 5I8CB 1FYTB 3K7UA 3TNMB 4OKVA 3FOMA 5EOTB 3R8BB 3U79A 2R0ZL 3C08L 4K3EH 1RZFH 1UM5H 5CZXD 1MPAL 2NR6C 1ULVA 3RVTC 4IMLB 1FJ1A 2AJYH 1YYMH 1JUFB 3PQYE 1S5HB 2P8PA 5EOQL 2FD6L 4K23H 4KJPD 3BAEH 4HUUA 2AXFB 3CFEB 1TZGH 5FDYA 1JHKH 4U1MA 1INQA 4G42B 3QUYB 3WNMA 4NRXA 3N0PB 4S0TD 3TA3B 5IT2H 4OGAC 5A3IC 1RZFL 5DRZB 4E41D 1JRHH 5HHVL 4R8WH 4DTGH 2VQUA 2PCPA 2DYPB 1RULH 3SBWA 2AJYL 1YYML 2XY2A 4PJ8B 2MFNA 4GKSB 4ZPTB 4R7DB 4M8VA 4K23L 5E6YA 4AEEA 5FK9B 3BAEL 2W9DL 4LSTH 3F7YB 1TZGL 1JHKL 3WN5C 3W39A 3T65A 3ILPA 5IT2L 1EX0A 4ORGA 1IQWL 1BJ8A 4R8WL 2JJSC 5ILTL 4HKBB 5C07B 3HUJE 1RULL 2VR9A 1BGXL 2JTDA 4L8BB 2Q6WA 2JJTA 5HI4D 4QO1A 1IJ9A 5DJZA 3EYUL 3S9DB 4DZBA 3ZSSA 4LSQH 1FH5L 4Z7NE 4YXHL 4NQEE 4BFIA 2NY2B 1SVCP 4IOFD 3S36H 3G5VB 2YN3A 5I6XB 3PHOB 1BBDL 1UZ6E 3WFDL 3BXNA 5ITFB 4POYA 1XGQB 3TN0C 5GGUB 1F3DH 3RWDA 2YA1A 5A2LH 3JTSB 4J3OC 3I75A 4F80A 3IU3A 1NAMA 3NFPA 3QULB 4XBGB 1NC2B 3RX7A 3W9EA 4LSQL 1A21A 1T66D 1WAAF 1AXSB 2ZSWB 3S36L 2QQKH 4WDIB 1L6XA 3V9FA 1NFKA 2VITA 3UO1H 4BQ8A 3ZO0A 1G7LA 1D5MB 4I3RH 3B3IA 5F88A 2I5YH 5DJ6B 3WNKA 5EWIH 4S1DD 4DCQA 4ZXBA 1JPFB 3G5YB 2G75B 3PL6A 3D87B 3TCLA 4X8JB 1URLA 4R7NB 2CRIA 3BYYA 3DX8B 1ZE3C 3B5HA 3CU7A 4NBYB 4YE4H 5INCB 5D2NA 1TITA 5E03A 4LDLB 4FNLH 4JREB 3EOBA 5T3ZE 3GEWB 1P69B 4I3RL 1TPXC 3PHQA 4PRPB 2ID5A 4P46B 1TQCB 2B0SH 1NCDH 1KJVB 3HRZB 2HT4D 1JL8A 5EWIL 3OBAA 4WFHE 3PDOA 2YS4A 3SHSA 2GTZB 4NRZA 5LXGH 1MJ8H 1KTLA 3NH7H 2WWMD 4P5KB 3ARBC 3GMLA 1Q0XH 1AXTH 2D4FA 1MF2L 4N68A 5IW1A 1MWAH 3UDWA 2YD7A 5DSCA 1KEGH 1T89C 4TVPH 3VFRA 1WIPA 1PX4A 1NCDL 2FIRT 5ISZD 2IG2L 4JG0L 2OP4H 2NX5D 1T7YA 4CN1A 1F2XK 1WQVT 4LHUD 5LXGL 1MJ8L 2FSEB 4O5LH 3BPLC 3RWHA 3RZWA 1Q0XL 1N8ZB 3TPKA 2ZUTA 3VDAA 4CNIB 5CD3B 2AABL 4XP9L 4X7TB 3UCRA 3C5ZA 1MWAL 4WUUE 4K3DL 3SDAD 1RJLA 1XGRA 5CWSA 5HHMD 4LLAA 2BSRA 5EU6B 4IHOA 4CU7A 4ODUB 4ODXB 5FA4A 3OR7A 5J9PA 3BQUB 3FO1A 5E2WH 3EGSB 1Z9MA 1ZT7A 3TJHC 4QOKA 5HY9B 1P7QD 1FORH 2Y5EA 4MB3A 4ZFOL 3IFPB 5GGRY 3OQ3B 1HILA 3H9SD 1I1CA 1FZJA 3QEQA 2EDBA 1T21A 3TGXA 4F15C 2RFXB 2CR6A 2PXYA 1G9ML 2X40A 4RFOL 1P1ZA 1DQQB 4UIKL 5E2WL 3UJIH 4JDZB 5DD6A 3IDIB 5D70H 5FECA 4JFPA 4KTDH 1NGZA 4LP5A 4AIXA 2FATH 3RUGE 2I26N 1QR4A 1D5IL 4U6XA 2YPVH 1M05A 5D8JH 3F6IA 4QYOB 2M8XA 3D39B 2O93L 1LEGB 5DJDA 3GSNH 1RUQH 4GLRH 4OIAA 3WFBH 4MD4A 3SEPA 4XPHH 4NSKB 5D70L 4FQLH 4RNRB 1AO7D 2BNQD 3FO2A 4BH8B 3JWNC 2A73A 3MNZB 3IJSA 4PJDE 3LH2H 2NY4C 3D9AH 4QT5B 1JFQH 4FHBD 5EBWA 3MA7A 4X5XB 2Z92A 5CIPB 5CBAB 1M4KA 2YPVL 5D8JL 4Y5YC 5DMJB 5L2JB 3BH8B 3M17B 1D5ZB 3GSNL 1RUQL 1DE4B 4Q9QL 4X83A 3SE9H 3WLBB 2MTPA 3WFBL 1XF1A 4LLUB 3TV3H 5IJVB 2I9TA 4FQLL 4AIZB 3HG1E 5J8OA 5KAQF 1A6ZB 1TZHB 3OKNA 3LH2L 1U8NB 2NR6D 3RVTD 3FKUS 3QUXB 5TH2B 2P8LA 5IEKB 3VWKB 3MRPA 3RKDC 4FQJL 4XPTH 3GKWH 4L4TD 2UV3A 3BD5A 4MJIA 5E7BA 2R1XB 3UYOD 4EN3A 4YXLL 4OCLC 2G9HB 4OD2A 1BQHG 5FO7B 1JIBA 5ACLA 5HYQB 3TV3L 4HWEH 5F9WB 4EXPX 2BX5A 2Y6SC 4OGAD 5A3ID 2DS4A 1HXYA 1WC7B 3B9DA 1FRGH 4NP4H 5EOCJ 4D9RD 3OZ9H 1CICA 5CHNA 4KJWC 1IGJB 5EULV 1K4CA 4X99A 2X89A 5EDXA 4ZUUB 1ZLWK 5EU3A 2OI9B 1MJ7H 4OGXH 5SWZA 4BM7A 3F5WA 1I1YB 3D3VB 3IDNA 3G08B 1QLRA 1K5NB 2G5BB 3O3BA 3NA9H 2V7HA 1H3VA 3BD4A 1S7RB 2BHUA 2PF6A 4L4VA 4BYHA 1FRGL 1S9YB 3OZ9L 1SJEA 1NFDA 2R15A 3NFNB 3WUWG 2ERJB 1UYWH 3G04B 3JUZA 3MRCB 4OCRH 3T1FA 4OGXL 3GO1H 4ZOBA 1E4XH 3D25B 4PB9H 4YZFE 3NFSH 2IAMC 1Q94B 1K2DB 1QBBA 2V5RA 2Y36H 3RWIB 4GAGH 5JOFA 1AD0A 2ARJB 1XH3A 5DURD 4M3KB 3EIFA 3TN0D 3VXSB 3OPZH 2DTMH 3T0VA 5I1GH 3DURA 1DLHB 2ITCB 3WXVH 3O2VH 1JCKA 1UH3A 2M26A 4M9PA 3VXQA 3V6OA 2P5WA 1VGKB 3N1MC 5D7IA 4HK0B 3JV6B 3MJ8B 5FO9A 4OCRL 3U0WH 5I0ZA 2F5AH 3CXDL 4BA8A 3MXWH 2P24B 3L6FB 1HOCA 5DVOA 4WW2C 5FAAA 4QKXB 2Y36L 4GAGL 1FN4B 4HT1H 3DI2B 3DSFH 5FM5O 5GGQH 1WBXB 3OPZL 4ODVH 2CUMA 3NCYS 5CGTA 3KLAA 4WHDA 3WXVL 4NKQB 3VFSB 2WP3T 1ZSDB 3VFWA 3MRIA 4K7PY 4YO0A 3T08A 1FVDA 2ADJB 1OGTA 3U0WL 1S7WA 3MLYL 1QSVA 5DVMA 3MXWL 4OIIL 3VJ6B 5JZ7C 1YQVH 1AR1C 3QQ9C 4V2BA 5FYLE 1ES0B 3DSFL 1MRDH 3JWDL 2R8SL 1A3RH 4F9LC 3I6LD 4PJIA 2Z91B 1MH5B 3ARBD 4ORZC 4L3EE 3VFOB 5I19H 5I17B 4LSVH 4YK4B 5EC1A 4R2GC 1YQVL 3N50A 1H3XA 1YQ2A 4FFWC 4HFUH 4N0RA 3D2UA 4MQ7B 1A3RL 1GVIA 1K4DA 1ZS8A 4GUPA 3L9RB 3AB0B 4M4PA 5DZLA 5I2IA 4RAVB 5F9JA 3MV9E 3MJ9A 4NHUB 5DDHB 1CDCA 3GBML 4PRIA 2N56A 3SDCC 5I19L 1VB9A 2IBZY 4LSVL 5C08A 1AGEB 5DD0H 4KKBC 2O5ZL 4G6FD 3LPGA 5F1OB 1MLBA 3JSSA 5C70A 3SKMB 1WBYB 5A2FA 1VDGA 2XXCB 1WFUA 1L0XA 1CLOL 4YAQB 1ND0B 5HHOB 4U6YA 3LKRB 2A6KB 2Z8VC 4GAYB 3TJHD 4Z6AT 2GJJA 5BVJB 4G6KH 4HUNB 2BDNH 4JM2C 4JFDA 3OKYA 3VFPA 3QPXH 2Z31C 4F7TA 4J2XA 1WZLA 3CXHJ 2GCYA 2FL5A 1PZ5B 3QFJE 5L8JB 5JOPD 5D71L 4XPAH 3G5ZB 3IFLH 3U7YH 2X9YA 4JPIA 1LK3H 3DBXB 4IIQC 1BOYA 4KWUA 2BDNL 5MP6H 2PYEE 1HKFA 1ZVYA 4PP1C 1WCQA 3FONA 3RPIB 4URTB 5KOMC 4LHQB 3ARFA 4OKDA 4JFFA 3I3DA 2RQ8A 5DFTA 3X17A 3IJHB 4FZEH 1IGYB 5D93C 3DX9B 4PJFB 2WBJC 3U7YL 1X5XA 5ADPH 2PW1B 1R5WB 4MD0A 5EZJB 2X9WA 1LK3L 1YEFH 4ZG1A 4M1GL 1L7IH 1MRFH 1R24A 2MQ0A 5C6PB 2NY4D 2HVKB 3V4UH 1KJ3H 3JXAA 5C2BH 3CPLA 3NIDE 4JFOB 2RIKA 4FZEL 5C0EB 2DN7A 1CFQB 2QLVB 3CDCA 1FZKB 4R26H 4OLZL 4Z0XA 5DS8A 5ADPL 5C0IB 2EECA 4LPXA 3IXAA 3L5XH 1L0YA 1YEFL 3HPJA 1NMAH 1L7IL 4Q6YA 3Q6FB 1QG3A 5D2LE 5JIIA 5DVKA 3V4UL 3WL9B 3FQNA 5AAWA 3ESUF 4ZAKB 1ZHKA 4KXZI 5IBTL 4M61B 5BXFB 3RKDD 4K94C 3PP3H 4NZTL 2VLJD 5A43C 1QPXA 1AC6A 5IQ7L 4BUGA 4MLSA 3QO1B 4R26L 5DRWA 3TWCH 1QR1A 1CXIA 3EFDH 2ENSA 1U8IA 1XGTA 2Y6SD 3LZFL 5LJYH 3P4MA 1OAYH 2Z8SA 4LAQL 5I76B 5F7KC 4CMMA 4NZUH 2DQIH 2WIMA 1I8MB 1BZ9B 1AGFB 3ZTJH 5E8OA 4KJWD 3RA7H 4F3FB 2X2YA 5I1HH 4YHML 1WCBB 3EFDL 2XOTA 3WIIH 2ATKB 1O0VA 4UDUA 2XXMB 4KH2A 2HLAB 4DN4H 3KYOB 3H42H 4FQ1H 4PGBB 3LEYH 1IL1B 4HS6A 1M7DA 4ZDHB 1SM3H 4PG9B 2BSED 2FHBA 5DQJA 2DQIL 5FKPA 1KN2H 1QFWH 1X6LA 4HCRL 5F1IA 1IEAB 3V5DB 3THMH 1MCQA 5IFJB 1MFCH 5I1HL 2IADA 3GHBH 3D69A 3AM8A 1DQJA 4P0DA 3TBYB 4DN4L 2ESVA 4UILH 4TVSa 2IAMD 2EKJA 3CX2A 5IHZA 3LEYL 3MRFB 1M6OA 4UV4L 1KIPB 3P73A 4YQXH 4NBXB 1ZLUK 1KN2L 2F5BL 4K7FB 5MENB 5CLWA 3JZ7A 1EHXA 3THML 4L8SA 1B4JL 2FBJH 3DETC 1MFCL 3GHBL 2W59A 3L3GB 5C9KA 4GSDH 1GOGA 1HWGB 1J0YA 5JDSA 1E28B 1RZ7H 3ES6A 2VZ3A 2D03L 3NPSB 2VLMD 3DXAB 5FEBA 4OLUH 3LHPL 3QPQC 5MEQB 4NDMA 2KKQA 4P46C 2FBJL 4KTEH 5FYJE 3UPCA 4GSDL 3MJ7B 4DUVA 4PG2A 2FX9L 4NQCD 5JZ7D 4W6YB 4POUB 4X6CB 3B5TA 1AR1D 4AH2B 4Z7WF 2W60A 1RZ7L 3QQ9D 5DK2B 3U7AA 3X3GL 3SOBH 4OLUL 1S8DA 2GKIA 4HDIB 5DEFB 5LKNA 4XCEA 2YEZB 2HT3C 4D0DA 1MFBL 1JE6A 1GSMA 2XYCA 4JQVA 4KTEL 1FIGH 5A2KH 3HE7A 1T6WA 4O02L 5I66B 4QRQA 2PW2A 3N1FC 3Q48A 2OL3A 1K3IA 5KS9E 4PFEA 4WFGD 4ZFZA 2VDOH 2DLGA 4GRWB 2HFGH 5BMFL 4GBXA 2ZCHH 4R2GD 3D39E 1HCFX 4PD4K 3SY0A 3MRQB 3VXRD 3MRMA 3MOAH 4HS8H 4QXTB 3U0TA 2BSTA 4O4YL 4MAYC 3QXWA 4FFWD 2AS5M 3SOBL 3EOAA 4KZEL 1A7NH 3QQ4A 3T0EB 1A6UL 3SCMC 1ZLSH 2GK0A 1KNOB 2VZTA 3RY6A 4YHIB 3GSXB 2ZKHH 3GGWA 3SDCD 2IH3A 3S37X 2XG5A 1JZ4A 2HFGL 2BVTA 5D9SB 4P2RE 5E6IC 1KN4H 4KKBD 3T3MF 4QXGL 3FHAA 3MOAL 2F8OA 5HGGS 4QTIL 4LEXH 5E94A 3NCCB 1NL0L 5F7DB 3Q1SH 1A9EB 2X1OA 5E5MB 5ESQB 3ZL4H 2IMMA 1BD2B 4HIJB 2XZAL 3V6ZB 4PIRF 2FH6A 4KKCC 2J88H 2BVOB 2I24N 2JE8A 3KXFB 1QTYT 1WWBX 4JM2D 3LQZB 4G8FA 1YNLL 2VQ1A 2Z31D 1YY8A 5FXCH 2R4SL 4LEXL 4OF7A 2FX7L 4JFYB 3Q1SL 3BJLA 3EBAA 4HWZA 1AHWC 1I9RH 3U2SA 2LABA 3HAEB 5F21B 2X7LB 5F7NC 4PJBE 4QCIB 3GMNB 3ZL4L 3S97C 3R06B 3VXNA 1KPVB 5MEOA 4ERSH 2NQCA 2X5PA 2VLRE 3VGAC 2J88L 4MD5A 3W0WE 5D6CB 1C16A 5HVGB 4PJ9C 2NW3A 3T3PE 3BYTA 4DOHB 1H0DA 4HHAB 4KDVA 4PP1D 3SJVD 2J6EA 1X5YA 1I1FA 1A4JA 1U41A 1J8KA 2CPCA 4XC3H 4Y1AB 4C4KT 8CGTA 3CZFA 4OD3H 2W07A 3GIZH 3DSNA 1HSAB 1BIIB 1I9RL 1QBMH 3Q3GA 4ZO6A 5HGHA 5CUSL 2J1KA 2WBJD 2EIZB 1DBBL 5FOJA 4ERSL 4M8QB 5IMOA 2EEDA 2KZ1B 4I0PB 4EXKA 3CLFH 3GMOB 1SBBA 4X98B 1CFTB 1FFRA 1U3HB 2YD5A 5BS0E 5BW7A 5F6IB 3SDYL 1BM3H 4MA1C 5CEXA 3MV01 3KGRA 1CR9H 4XC3L 1T1ZA 4IRZL 3V0VA 2IWGA 4Y4FB 1MCOH 2FGWH 3GIZL 4X80H 4ZTOH 3BIKB 3IS0X 1J18A 3PWJB 2AJUH 4W68A 3TJEL 1OF2B 3ULVH 2XPGB 4LF3B 3CLFL 1YN6A 5JIKA 5EZIL 5GS0H 4Y4KB 4G8GD 1OAXL 1RUKL 3QT2A 1BM3L 3DV6A 1E0OB 4LVOC 4LCCA 5KSVA 3ZE0E 4YDJA 1T03H 4MDIA 2X44D 1MCOL 2OYPA 5C0GA 2FGWL 4X80L 4ZTOL 5HJ3B 1EUTA 2P49B 4AQ1B 2F53A 3BPOB 4P48A 4EI5C 1IEHA 4LLVB 1N2RA 3MLTB 4DGVH 3UPAA 3WIFB 1SBSH 5ACZA 3MRRB 5GS0L 1JGVH 1H3UA 3QEUB 1TCRA 5B8CC 3TBTB 2R56H 2AXGB 5F7YC 1H5BA 5JW3L 2V5TA 1NANH 1FCGA 1T03L 4HMEA 3ARGA 2EDEA 3FFCA 3BZEA 5DO2C 4ETQA 5GQBA 4NNPL 4O58H 3K74B 3L3IA 4PJAB 5JIHA 1SBSL 3TM6A 4HG4K 4LLYB 3X12A 2DQDH 5KZCB 4DQOH 5F72S 5ISZA 3GMRB 2R56L 2W0KA 3PWPD 5D1QB 5AUMA 5L2KA 3QH3B 1KFAH 2BXZA 4AEHH 1JZ8A 1R3HB 2BVEA 4A2MA 4HH9A 1MI5A 1CE1L 3C09C 4O58L 3BEWA 4Y5VC 4BQ6A 3QXAA 2OBGA 2Q3ZA 2DQDL 4JANA 4DQOL 1U58A 3V79C 2NNAA 4P2OC 3Q5TA 4X7DC 5JORB 3RDTA 1AIFB 3WV0A 4XBPB 2WIIB 5KVMC 4IRJA 4OZIF 1P7QA 3DETD 5E8EA 3MJ9H 4IBLT 4LPYA 4ZOAA 4WJ5B 4LKCA 2DBLL 2D0FA 4Z7OF 2UYLB 3H9SA 1KB9J 2F54B 1YNTA 4G7VL 1JPGB 5J6GB 1NKRA 3F65A 4Z7UF 1SEBA 1AH1A 2COQA 3STZA 3IAPA 4LBEB 4HGMA 3QPQD 2EIEA 4P2QD 3RL1B 3MNWB 1ZHLB 5CJOL 4P46D 5KSAB 1IM3B 4OD1H 4NN6B 5SWQA 1TDQA 1JWMB 4L3CA 4WO4C 4V1DA 5DWUH 1IAIH 25C8H 2DJSA 3ARXA 4HQQL 3GSUA 5B4MC 4LCWE 1TZIA 4QRPD 1JHTB 3MLVH 1KPRB 2AK4B 4QRRD 2HVJA 1OW0C 5LGHH 1CG9A 1RVFH 5D7KD 5AG8A 1P5UA 4YK4C 4RMWA 5IK3A 1MAMH 1PG7W 1T0PB 3KLSA 1NGYB 2HT3D 4XGZB 2ARWA 3PXHA 3LKOB 3CSYB 1AO7A 1RJCA 3P11H 5EORL 1WIOA 2P47B 3P9WB 5DWUL 1N7MH 25C8L 2ITDB 5IVZB 2Y06L 3AB0C 1HEZB 2A6JB 3NIGE 4Z0BL 1ZLWH 1LE9B 1CN4A 3MLVL 3AS1A 2J8UB 4DZ8B 2YWYA 4LCIH 1S3KH 4MAYD 5LGHL 1RVFL 3RWJA 5FO8B 5C0CD 4RA3A 2CH8A 4TSCL 2FGZA 3ZTNH 4ZUWB 3FQXA 5DJYB 3SCMD 3CAFA 5JLZA 3HTLX 2G2RA 3P11L 4OZHA 1HWHB 4GAJL 2ENYA 2VDQL 4RQQB 1U8JA 1MFEH 3WS3A 3MV8B 3WDIA 5DJAA 5E6ID 3UTSB 1T1XB 4L4TA 1TVBB 4HGWB 1S3KL 1NBZB 4JZNB 1VENA 3ZTNL 5IKCA 5DC9B 5C0AE 3C60B 4KKCD 4YIQB 4QHUB 3WHE1 1HXMA 1XR9A 1BAFH 3DUUA 5SWSE 3CD4A 1JWUA 4DAGH 3TPUA 1LE5A 5IUSA 3WSQH 4PBWD 3U9UB 4ONFH 2C1PA 4LKXB 3WDHA 4I18A 3SDDA 2EDFA 4KHTH 1RZIA 2X4UB 1JGEB 2C3GA 2ZPKH 3MRHA 3CU1A 1CDJA 5BRZB 1UKQA 3MUY1 2JJSA 4PJ9D 1BAFL 3V7AG 5CP7A 3DVNA 1ORSA 1EH9A 2AV7A 4DAGL 4OLVH 3WSQL 5C0FA 5TE6H 1WZ1L 3L5HA 5C09E 4UDTB 5DJ2A 1T2QL 3U4EB 2R2HA 5ID0A 5T5FH 1K6QH 3REVB 3HE6B 4M7ZC 1FVCA 5INDA 4KHTL 3A67H 2V2TB 4OLEA 4R6UA 3SGEI 1GZPB 4TPRH 2CD0A 4EDWL 4Y8AA 4KZDH 1F6AB 1MJUH 2VLLA 4TNVK 4ELMF 4CGTA 3H7LA 1YPZF 4HK3N 3CFIC 4XMKH 2VDPL 3REWA 4JLRA 4HV8B 4H8WC 2CIKA 1K6QL 2HJKB 3PP4H 3LPWA 4OTXH 3LD8C 1BQUA 1HSBA 2ZUYA 4Z7QF 4QHNB 1AY1H 5T1KD 1BZ7A 3IETA 1UFUA 4PRBB 5D7LA 2X1XR 2W1NA 2FDBP 4IDJH 3LN5B 3IB4A 3MV7D 4AENA 5ICXB 1KGCE 5H94A 1S7SB 4LVEA 2GW5A 1BECA 5D5MF 3MLSH 3VD4A 4MNQE 2H8PA 5F8QC 6CGTA 3BRGC 2YRLA 2NTFA 2DJUA 3OGOE 1SYVB 2W0FA 5DD3H 4GS7C 4OTXL 1I8LA 5IV2A 2QKIA 4EI5D 5DF0A 1Z9LA 3MRNA 1I1RA 1UG9A 2IQAB 1LP9F 5T5NG 3MRKA 5HYJB 4WI8A 1BX2A 1DVFC 3DXAE 3B6SA 4U7KA 8FABB 4HEPG 2GEEA 3UXFA 4HUWB 4APQB 3MLSL 1X5AA 2Z8RA 5FYKU 5FCUH 4Y8DC 2OQJB 1A7QH 3DROA 5DD3L 1G6RB 4Y2OA 5DO2D 1MHCB 5C0BB 4Z76B 5IQ9B 3VFNA 1BZQK 1CS6A 4ODWB 3MGTB 3V6FA 4AIOA 3WJJC 1EMTL 1T89A 2B7DT 5EUKA 1ZLVH 3CUPA 5IR1A 1OAZH 4WW1A 2HTKC 1QLFA 5DJ8A 1JN6A 1UEYA 5T3XH 1UZ8B 3QNZB 2RCSL 3VXSD 1P6AB 4P4RA 5F93C 5C9JA 5F6HJ 2OL3H 3OMZA 4XAWH 4HGKC 4YHYB 4MX7A 5HTSA 5F3HB 1OAZL 4P2OD 3KJ4B 2GT9B 1CF8L 1RI8A 4XNZB 3B9KC 1ZHBA 4P23C 4YUEH 5T3XL 5GGRA 1FP5A 3LN4A 4X9FA 1DN0A 2OTWB 1D5XB 3V52H 4X6BA 1YJDC 4OI9A 3FB7B 1C5CH 2JCCF 5M7QA 3S6CA 1IFHH 2PO6B 4HX1B 5I73B 4OSUL 3HAEG 5GIRA 4WI7A 5JHDE 4HXBH 4JFEB 4YUEL 1CI5A 3DRQB 2B8OT 2XKNA 3DNKA 5CD5C 4PJXA 12E8H 5EBLB 4ZNEE 2UVFA 2Y72A 4M5YL 1JWSB 4UUJB 4LP4A 1UJ3C 4I3SL 3V52L 1WBZB 4UIMB 4WO4D 3QUMA 5B4MD 3ULUH 2VDNH 3GMMB 2BC4B 2XN9D 4PJ5D 4RGNE 1QA9B 1E6JL 2P5ED 3PWVB 1OL0A 1DUYA 4HXBL 2UWEB 4GKZA 4RAUA 4GW1A 3AGVA 3C6SA 1EHLL 1HI6A 3T0EC 3MR9B 3OV6A 4OCYL 4D0CA 4MVBC 4DW2L 1LK2A 4HPYL 4BJLA 1ORQB 3ULUL 4P5MA 2J6EH 2VDNL 1WJ3A 4JO4H 1FLRH 4MJ2A 3NABH 3LKPB 2FNBA 3NCYP 4Y5YA 1DZBA 3TBWA 3FAWA 2AKRA 1XMWA 2OJEB 2KQNA 5F9DC 4LPVA 1KJMA 1Q9KA 1LVEA 3MQIA 5KANI 3UEZA 1NJ9A 1NC4B 1YUHA 3GMQA 3L1OH 4JG1H 2FJHB 1LO4H 4S1SL 1WITA 1Y6KR 5TE7H 4LASH 5GGVL 4LLDB 4JO4L 1FLRL 4LRIC 3NABL 1LD9A 2IAND 3QI9C 4OFYD 3VD7A 4C54A 4JKLA 2E7LA 1R3LB 1H15B 2VLKA 4XXCA 3ZYIA 1CDBA 2MPAL 1FL3B 1VFAA 1K8DA 2IQ9H 3SE8L 1YEGL 6FABH 4I2XB 3D85D 1R0AH 2X4SB 3GSRB 5TE7L 4XP5L 1OQXA 4PJHF 2NZIA 3FQTA 2LTQB 3K8MA 4OZIE 3QDGE 4IRSC 3RU8H 4R4BB 4U31A 2NY0B 4W6WB 4Z7OE 3D6GA 4JZJC 4X6EB 3S35X 2R2BA 4GMSH 1GC1H 3SDXA 1DLFL 2QR0A 4Z7UE 3FOMB 4U1GB 1R0AL 4QXUH 2DI7A 3RWFA 1F90H 1QACA 4YH6A 4LNRA 3RHWF 4JGUA 4BFBD 2IPKB 5FYJU 3RU8L 5KBNC 1CLYL 3G6JE 3OX8A 2DQCL 4M5ZL 4F8TA 4NQUA 3KHOA 4K2UH 2X4RB 2IAMA 4U1SB 1GC1L 1INQB 4NRXB 4OZGE 5DMYA 4KRMB 4Q2ZA 1KUMA 2PCPB 4LOUC 5LCVH 1YEHL 2C1OA 3QRGH 4ACPA 1FCCA 2P7TB 4I1NB 4Q9RH 2EH7L 5LGKA 2LV4A 1F58L 3BIAX 4WW2A 5FM5M 2AEIT 3T65B 3TYFA 4KHXH 3BW9B 1J86A 1BQHA 3O6KH 5CKGA 5I74C 2A74A 1SMOA 4ZYKA 5LCVL 3QRGL 4F7PB 1FFPA 1JNLL 2EKSA 4PYHA 4NQCA 3FL7A 4K8RC 4I9WD 5EBGA 5IMMB 1DVFD 3ECBA 4HZLA 4WWKB 2X4PB 3X14B 4F9PC 4ENEC 4KHXL 4NWTL 1SQ2N 3K4DA 2B5IB 3O6KL 5D1ZB 1OGAD 3QDMA 1KC5L 1REIA 3RWDB 3S98A 3QG7L 3PGFH 5D1QC 4NUJB 5KJRL 3UX9B 1NAMB 2VABB 2Y25A 2DM7A 3K8KA 1J8HE 3W9EB 2CIIA 3AVEA 5FM4A 3RP1A 1UM6L 3C6LB 2VZOA 1CT8A 3VXRA 2H32A 1WSST 2WQRA 3E0GA 5GS2D 4BELD 5IW6B 3O3EA 3I02A 5EG6C 2HTKD 1G7LB 5TGBA 4B0MM 1VHPA 1LEKB 2A9ML 3CSBA 5H2BA 3PGFL 1TJIH 4DCQB 1NMCB 4ZXBB 3WFZA 2MNUA 3PL6B 5CS7A 3TCLB 3TEUA 2R2EB 4RRPG 4OUUA 3MLPA 5D2NB 3F12A 1JYXA 1DEEB 4JR9H 2DDQL 3B9KD 4WCYH 2BNRE 5CMAA 4P23D 5K9OB 3HC0B 3RY5A 2YUWA 3LKNA 3RI5K 2Q7YB 3DYOA 5KVGH 4RFNB 5EN2A 2HN7A 3PDOB 1BVLB 2VAAB 3IYLW 5BOZG 2Z31A 2BJML 5T1DH 3O4OB 3EJJX 1IC5H 3PQYD 1OCWH 2WAHA 1OM3H 2CDGA 4JR9L 4B7LA 5DSCB 1U42A 2JF1A 5HHQA 3L3KB 5E8NA 2EE6A 5CD5D 4C56E 1Q9LA 1DUZA 2C3VA 5A1AA 2CUHA 1NCAH 3MRBA 3U9PH 1F11A 5T1DL 4JRYE 3CH1A 3HKFA 1OAKH 1WZKA 4K9EL 3C5ZB 1IC5L 4HJGA 2XWTB 5EUOA 1RJLB 1E27B 4JKKA 1MVFA 3ZT7A 5E8PA 3DX7B 1LP9E 3HLAA 4IHOB 1EO5A 3UPRA 1B6UA 3T0ED 1NCAL 2Z4QA 5I8CA 1FYTA 3TNMA 1PEZA 3MRDB 2ZZUT 2WBKA 4MVBD 5EO1A 5D72H 5EOTA 4X9GA 1SHMA 1OAKL 2A9NH 3G5XA 1FZOB 5I9QC 1FZJB 3QEQB 1R3JA 1T21B 2YUXA 4KRPC 5TF1H 4DJMA 2YPLE 1HZHH 3BO8B 2DQGL 4O2CB 4FTVE 3QZWG 4G8GA 4XWGL 4F7CB 1JF5A 3CFEA 4JY4B 1BD2D 3TA3A 5DRZA 1NGZB 2A9NL 3QI9D 2DIJA 3KPTA 2DYPA 2DD8L 1BJMA 2BZDA 4PJ8A 2VKWA 1YJDL 5TF1L 3GI8H 2B4CH 4GKSA 1HZHL 3GMPB 3AS2A 3T77A 1Z3GH 4U1IA 5K9JH 4FFZL 1CXKA 1C7TA 4ELKA 2A1WL 4GG6A 2YPKB 4WFFE 2OXHA 3FO2B 1DBJH 1FO0B 4JHZA 2GSGB 1WVZA 3IJSB 1GJIA 2HKHL 1C08A 3W11C 3MA7B 2Z92B 1AE6H 1KLGB 3WIHH 4IRSD 2OJZL 1IBGL 1MQ8A 3O4LE 3GI8L 2B4CL 1B6DA 2JCCE 2ZUXA 5K9JL 4K3HA 4PBXA 5FCSH 1RZ8B 4XB7A 2I9TB 1TQBC 3G5VA 1IGIL 4TSAH 1UH2A 4XP4H 3AS0A 3NACH 3MUGA 3GFUA 4WFHD 3VGDA 3OKNB 1FDLH 5ITFA 1G9NH 1I85C 2EICA 1IKFH 1XGQA 2E7CA 2P8LB 1OHQA 5GGUA 3WIHL 3SE3C 3WHXB 2FX8L 5C7XH 4CW1A 1TVDA 3NCMA 43C9B 1LEIB 3GBNH 3VFMB 3QQ3B 2WW8A 3RNKA 4OD2B 3LMJH 4ODTH 1AXSA 1QSEB 3HNSL 2ZSWA 3L7FB 4JHAH 3VRLF 4XP4L 3MSPA 3QWRD 4X9BA 1FDLL 1J0KA 1RHFA 1G9NL 4Z8FH 1CD9B 3H9HB 1IKFL 1GGCH 5DJ6A 4I77H 1FC2D 4LOUD 4HWBA 3E3QE 4M7JH 3WNPA 1JGDA 4Q0XH 1FNLA 5CHNB 1T7ZA 5C7XL 1JPFA 1A6AA 4X99B 2EZ0C 4R7NA 3DX8A 3LMJL 4WNQB 5INCA 4JHAL 5D7JC 3IDNB 4TTGA 4NC1E 2RGSA 4P2QA 3PV6A 2NY1B 3O3BB 4NZJA 4U2YA 4Z8FL 4PRPA 1R5VA 4OZ4A 1GGCL 4P46A 3SKOA 1KJVA 3GNMH 3HRZA 4GRMB 4M7JL 3HFMH 4Q0XL 1G7JA 1D7FA 4RGMC 3VXMB 1D6VH 2H1PH 1XCTB 3BPNC 3RNQA 4K8RD 1A1MB 4N90E 4QRRA 1GHFH 5L7XH 1VCAA 4ENED 2NMSA 4WEBH 4N8VB 4JRWA 1BHGA 4PRAB 1XH3B 1OP5K 4LCUB 5GRJL 2CXKA 4U3CA 5D1QD 4KQ3H 5T3ZL 2H1PL 3VXQB 4JVUA 2P5WB 4PJ7F 3UC0H 2P48B 3BPCB 1U92B 4CNIA 1N8ZA 4U6VH 4PJHE 5CD3A 4MAYA 2UWEE 2AJVL 3PF2A 4YBLB 1S9WA 4G3YH 1CLZL 3GJFK 3IDXL 4UNVA 2X4TA 2AK1H 4PTUA 4QXWA 4AT6B 1XIWC 5EU6A 4KQ3L 3KS0J 5EU5B 3KLAB 4XNZC 4ODXA 5CEYB 3BQUA 3EGSA 1C5BH 3UC0L 4QGTA 2C7UA 4X6DA 3CVIH 4YO0B 4ZS7H 2D0HA 1OGTB 4KXZH 2XI9A 5GRVK 5HY9A 1MJJB 4U6VL 5J89A 2XV6B 3HI6L 1NH6A 3CXHK 3ESVF 3IFPA 4Z7WB 3CNKA 4YHPB 3WE6B 1P4IL 3LS4H 4TYUA 2FLBT 1NFDF 2PO6C 5DT1H 2RFXA 1RIHL 2AK1L 3JV5A 3HG1D 4GW4B 4JO1H 2A2QT 4PJIB 4OF3A 4PTTB 4JDZA 4ZS7L 4WHTA 5FUOH 4LGSB 3MLWH 1T2XA 5M95B 3KPMB 3V0WH 4GH7B 5I16A 5DT1L 2AK4D 4QYOA 4Z7VA 1D3CA 1K4DB 3RFZC 4GUPB 5KAQG 1KCSH 3QFDB 2PKDA 5I2IB 2ICWA 4PLKC 5D96B 5F9JB 1AKJD 4NSKA 5FUOL 3TF7C 5IG7A 1QNZL 4BH8A 4YHLH 3LVEA 2BOCB 3CVHH 5C08B 3MNZA 1U2HA 4QT5A 1CDHA 2MOVA 4UAOC 3V0WL 4ZUVA 4X5XA 5CIPA 5CBAA 4LRNH 5E56A 3RJQB 2D7MA 4NWUH 5ANMB 3RL2A 4NO0D 4PV8A 5L2JA 3BH8A 3M17A 1D5ZA 4RBPK 2P46B 4U6YB 3SPVA 3U30C 3WLBA 5IJVA 3TYGH 1QHPA 4EUPB 4Y19B 1I8KA 1U95B 1J1OH 4MB5A 3CVHL 1A6ZA 4JFDB 3ZKSD 3BD3A 1LGVA 1RZGA 2X6MA 3QUXA 5TH2A 4G8EB 4KUZH 4LRNL 4HK3J 4NWUL 3KR3L 1JBJA 4KRPD 2FL5B 4FABH 2BRQA 3QIBC 2D0GA 3FFDA 2AEPH 2R1XA 3MV7A 3VWJB 4RDQG 2V5MA 5FO7A 2EDRA 3ETBF 1QQDA 4TULH 1KIUA 5DR5L 1J1OL 5L9DH 2HFEB 3BP5B 4MZ3A 2CLZB 5TJWK 3FONB 4E5XA 4KDTA 5K9QG 4EI5A 4MS8C 4JFFB 4M6NL 1BFVL 4Q9BA 3T8XA 2Z9TA 3QXDA 2VERN 2WBWB 3KWWA 1R5IB 2AEPL 5F3BB 4JZOB 5BVPH 4R97B 4ZUUA 4LFHG 1I1YA 4MD0B 5AYUH 4TULL 4Q7DA 2PUQT 2N4IA 3G08A 3VGBA 4K7PH 4RX4D 3S88L 5L9DL 1K5NA 5I1LB 1A0QH 1L9NA 4MNGA 4LLWA 3W11D 3N9GL 4NHCH 2XRAH 3PWUA 3M8OH 4NM8H 2B1HL 3LQAC 3P0GB 2B39A 1S9YA 5FUZH 1PYWB 2OLDA 1QHOA 2ZCKL 1I7TB 1HINL 3MBEC 2H9GA 2CMRH 3G04A 3RX8A 2Z0BA 3MRCA 4YFLF 2ZUQB 1DQLH 1IRAY 1P4LA 3D25A 5FYLD 5AYUL 3N1GC 2X1QA 1Q94A 1K2DA 4K55A 4JQIL 2AQ3A 2ARJA 3VXPB 3QIUC 5FIEA 2FO4A 4JJ5A 3BHBA 2XRAL 4NHCL 3WNOA 3VXSA 3C8HA 1ZHKB 2V7NB 5FUZL 4ZSOB 4L3ED 1DLHA 2ITCA 5BV7L 5KW9H 4N8CH 3KPNA 4YGAB 3IU4L 2CMRL 1VGKA 4DGYH 4HBQA 5TDNB 4HK0A 3JV6A 3MJ8A 5DRWB 4XRCA 1PLGL 2H32H 4P2OA 1QR1B 2XTJB 2GY5A 4XPGL 1DQLL 2Q76A 2Q8AH 2P24A 1XGTB 1U8MB 4XMPL 1I4FB 2VZ1A 5HPMA 1FN4A 4X7SH 4XCNA 2Q87A 5F6HI 4NRYB 3MV9D 1W72L 1WBXA 4ZMAT 1RZKC 3DTXB 3VFSA 2EZ0D 4N8CL 4NFBA 1B90A 2Y4SA 1XF3A 5IROC 4DGYL 2ADJA 5C3LD 5D7JD 2DI8A 3VJ6A 5JTWA 3MOQA 1LO5A 4HS6B 4X7SL 4KUCF 5FYKD 1ES0A 5DQJB 3HNTH 1ACYL 3V8CA 3NIFF 4H88H 1MH5A 3MRJA 2XN9A 3D69B 3DPBA 3VFOA 4IMKC 5I17A 3WFEH 4WTWA 3QFJD 2XG4A 3UMTA 4MNHB 2Z8WC 5E4EB 1D9KC 5B3JF 1OAUL 5GPRA 1A7BA 3P73B 1XGUB 4HUKB 3DGGB 3TO4C 3HNTL 3VXUB 4ZFGH 4MQ7A 4I8DA 4JFQA 3VG9B 4L8SB 1TTUA 2A0LC 3L9RA 3ZKXB 4RAVA 4NHUA 4LEOB 4ALAL 1FYHB 5DDHA 3JVGC 3WFEL 1AGEA 5JDSB 4N0UB 1ODAA 1CGXA 4U7SA 2QSQA 1WBYA 1A6WL 1XIWD 4HIIB 3JV0A 3UROR 4QOKE 1ND0A 1T83A 1TVHB 3WEXA 3LKRA 4R0LB 4NN5C 4PJCA 3UJJH 2A6KA 2XA8H 4KROC 4RFNC 3LSOA 4GAYA 5BVJA 1HK6A 5I71B 2B1AL 3I6KB 1UXWB 4UOW1 1TJHL 1BIHA 1VEOA 2YBRB 1M1SA 3O4OC 3BKCH 2PO6D 4HIEB 4NCC1 3W81A 1PZ5A 4HMCA 4XCEB 3LAFA 4FQPA 4YC2B 1PD6A 4KMTL 4BSJA 35C8H 4N0CC 2XA8L 3VRLE 4PUBL 3HZVA 4QRQB 2PW2B 1UCBH 2X4NB 4QF1A 2H6PB 2OL3B 3DBXA 3LKSA 1PBYA 3WS6C 4K94H 5T1LB 4CJ0A 4ZODA 4GBXB 2P1YA 3DOSA 3ZE1F 3SY0B 5HGHB 2VC2H 3O45A 2BSTB 2DLFL 5J4MA 1EEZB 3BKCL 1E4XI 2M1KA 4FXLA 3QQ4B 5FHAH 1IGYA 3DX9A 4WU5A 3E6HB 3HR5B 4PLKD 35C8L 1R5WA 3BZ4B 3RJDA 1UCBL 4FXGB 2IH3B 1FQ9C 4KI5F 1C1EH 2PYFA 2VC2L 2DQHH 4TRPH 5E94B 1MSPA 3C5JA 4OJFH 4JFOA 2YN5A 5FGBA 5KSBA 5HGDB 2OR8A 2P42B 1ZVSA 1IMHC 2OSLA 5C0IA 4E41B 2JK5A 5ESVA 3QXTA 3BGFC 2NXZC 4G8FB 4LMQE 1I7ZB 3Q6FA 4A6YB 3QA3A 4OGYH 1C1EL 4MJIE 3WL9A 2GJ6E 3CK0H 5CSBA 4N5EC 2DQHL 4H0GA 5BXFA 4TRPL 2F58L 2X05A 3SE4C 3QIBD 3U2SB 2PTVA 3QO1A 5MEOB 4HJJH 3VXTB 4I13B 4EEEA 1FC1A 1XZ0B 4MD5B 3HCVA 2NY5H 3O2WH 5ITBH 5TQ2H 3QHZH 4KAQH 3ZKNC 4P9MH 1I1FB 1A4JB 3CK0L 4HWBH 4MS8D 1BZ9A 1AGFA 5ADOH 1G7IA 3SN6N 3TNNB 5SWZE 4F3FA 4N8VG 2EDJA 3L3DA 4O2EA 4C57C 2CGRH 3VFUA 2ATKA 5IMOB 2HLAA 4L4VE 4OZFG 2ATPB 3KYOA 2NY5L 3O2WL 5ITBL 4ELMB 5TQ2L 1NFDE 4PGBA 4EDXB 1IL1A 1YPZB 4KJYB 4ZDHA 5ALBH 4GRLC 1IKNC 4PG9A 2QTEA 4HWBL 2V2WB 3SGDH 5FYJD 3I85A 3ULVE 1IEAA 3V5DA 3WJJA 3MBED 1IEBB 1W8OA 3FQUB 5C3TA 3UJTL 1VGEH 5EIIA 3V95A 1M71B 5CLTA 3QUKB 2D2OA 3DMMC 3ULUF 4Q74A 4MYWB 1JF1B 4X5WB 2VXVH 3MRFA 4JFZH 2D3VA 2R23B 3QIUD 5D5MB 5EZLA 1UCTA 5ALBL 3DV6B 3V6OE 5KSVB 2FYYB 4UQ3B 3V2AR 4D9QE 4K7FA 5D7IE 5MENA 5C0GB 4OI8A 3EAKA 4HF5H 3BSZH 1JTPA 5IVXF 3TBVA 3O6FC 2DL9A 3DX6A 2G60H 4R3SB 3WO4C 1WEJH 1N2RB 1CDUA 4IEFB 3L3GA 3B9KA 4P23A 3CFCL 4JQXC 1TCRB 5BCAA 3GJEA 5CJQL 4JFZL 2RJMA 5IGXH 1CDIA 5MEQA 4HF5L 4ETQB 2EC9U 4P2RD 4I48B 1WEJL 3EHBC 3L3IB 4Q9CA 3MJ7A 1OLLA 3IVKB 4HLZG 4X6CA 4AH2A 5ISZB 3NGBB 2NX5B 4U4BA 3HZKA 2NY6C 4LHUB 4S1QL 1UJ3A 5EOCH 3MLXL 5IGXL 1LDPL 3FN0H 5DEFA 4LFHD 2YEZA 3VRJA 1KCRH 1A7PL 3K1DA 1N3NA 1X6NA 2WUCH 3LOWA 3QXAB 1EAPA 1JPST 3SDAB 5H8DA 4U1HA 4P3CH 4JANB 5TPWL 5CFHA 5HHMB 5K9QI 2I60H 5DD1L 1D9KD 4JCMA 1QD0A 1PQZB 1QFHA 1A4KB 1V7MH 2X4QB 2VYRE 2VLRD 5EOCL 1VPOH 4PJGF 3UTTE 3W0WD 3TO4D 3T0EA 4YNYB 5DC0A 3MUJA 4PRIE 5D1XC 4EUPG 1KCRL 2A0LD 2VISB 1P7QB 5AZ2H 1OPGH 2ILLA 3KYKH 4Q58C 3RWEB 1KNOA 4YHIA 3CIQA 4LKCB 5F1KC 2GQHA 4HIHB 1KLFA 3H9SB 5HGBB 4P4KB 1MAKA 4WHYH 5D9SA 5HHPA 2F74B 3QDJE 2I60L 2N7AA 5CIPH 4MXWH 2E6JA 3FZUC 3STZB 3G6DH 2O5YH 1A9EA 2E9BA 5ESQA 4DVRL 1YYLH 3OGCA 5BS0D 1BD2A 1OPGL 2BCKA 2VAJA 3KYKL 4KJQC 1UGNA 4NM4L 5SWQB 2D7TL 4KROD 4PGEB 2P43B 2BVOA 4LRIA 1JPTL 4LSPL 3QI9A 4XX1E 3LQZA 1T1YA 1RK0A 3BDXA 1A64A 5DTFB 1B0GB 4MXWL 2HVJB 1JK8A 3DVGA 1KPUB 3NCJH 1CG9B 3P9LA 5DI8B 1MY7A 5J13B 4JFYA 3G6DL 2O5YL 4FA8A 2FO1A 3HAEA 2X7LA 5E8DH 4QCIA 4G5ZL 1NBVL 3MRLB 3U0PA 5K93A 1AO7B 2BNQB 4N0CD 4WEMB 1V5JA 4U1KA 1U91B 3D5OF 3G9VA 1FV1B 4IRSA 3KYNA 3KG5A 5IFHH 4Y0GA 2NLJA 4XNYL 3NVQA 1JGLL 1PDKA 2IFGA 1MFDH 3NCJL 2HWZL 1TJGL 5K9KB 1KBGH 1BIIA 1D6EB 4MCZA 5E8DL 1NQBA 1Z5LA 3RIAK 2EIZA 5JLZB 1MVUA 4M8QA 2XZCH 4OZHB 2DMCA 1U8JB 3GMOA 1KSRA 3FO0L 1J0JA 1CFTA 1MIEH 1U3HA 5DJAB 1MHPH 2L0DA 5IFHL 4NIKB 4S11A 3UTQA 2BSSB 2C4FU 4C55A 5I1CL 4Y4FA 1F02I 1KBGL 1RUAH 1MCLA 5TFSL 3BZFB 1N26A 3PWJA 1OP5H 5T33H 5I8EB 5E99L 3QWRA 4Y5XC 2XPGA 4DK3A 4LF3A 4BKLB 5B3JE 4L3AA 4J3TA 1HXMB 4Y4KA 2AJXH 4L1HA 2NXZD 1YEKH 2W38A 3CFBB 3BMVA 5E2VL 4HXAH 1LE5B 4N5ED 4HKZA 4WGWB 3TVMC 1KXQE 1PG7H 1W8NA 3O11B 2C1PB 4OFVA 2XTJE 3GM0A 4ZPVB 3VI3F 4W4OA 5HJ3A 5HHXL 4J7RA 5SV4A 3WN5B 3UZVB 3LIZH 4LLVA 1IAKA 5T33L 1MOEA 4J3VA 3MRHB 3DWTA 3S3SA 4KKAC 1OSZB 2H26A 5CP7B 1FAIH 2EYTB 3DVNB 1YEKL 4H5SB 3TBTA 5BZDB 3ZKND 1HH9B 2AXGA 2WUBH 3BT2H 5C0FB 2HH0L 2VE6B 1N5AB 5ID0B 4BFGA 3B2UC 3QISA 2AGJH 1FVCB 1WV7T 3LIZL 4TUKH 4OF8A 5L0QC 4HUXB 5DURB 3TN0B 4TUOB 1FAIL 4GQPH 2VLLB 1OP3K 4OCWH 2ZUQC 5D1QA 3M1BA 4GRLD 5GRVL 4K3JH 3BRFA 1R3HA 2AGJL 4G6ML 4LCWD 1XGPB 3X11A 2ESVE 4TUKL 5DK0B 4FQHB 3BH9A 3J7HA 3IETB 3WCYA 3DMMD 3V5HB 1KCKA 4AENB 4OCMC 1S5IL 3HC4H 5H94B 3DHMA 4X4XB 4OCWL 2GJZB 2Y23A 2H8PB 4K3JL 1AIFA 2NTFB 2DWDA 2W0FB 5KTEL 2F19H 1T20A 3O6FD 3OKOB 2QKIB 1ZT4B 1LHZA 4DFHA 4WJ5A 1FGVH 3BJ91 3MRKB 1BX2B 2UYLA 4P2YA 1TPXB 3B6SB 2F54A 3O9WC 5J12C 5J6GA 1N4XH 3UBXB 1EPFA 4LBEA 4GAFB 4RWYL 3ARBB 3MNWA 1ZHLA 2F19L 1IM3A 1Y18A 3NTCH 3EHBD 2DQJH 4HIXH 1JWMA 1E6OH 2AV1A 3V8OA 9CGTA 2XIDA 2I9LB 2I27N 3CUPB 4F37K 5T3XE 1KPRA 1N4XL 1QLEL 2AK4A 3PGDB 4GQ9L 2J3SA 1QLFB 2NY6D 1T04A 5C0AD 5C6WH 2QSCH 1TTGA 4AL8L 3BPLB 1F6LL 4IOIA 4JO3H 3AY4C 1U8QB 3LKOA 5SWSD 5GISH 3NTCL 1EXUB 2DQJL 4YGVA 5C9JB 5E2TH 1E6OL 2ICCA 4G6FB 3OAZK 1HEZA 1U0QA 2A6JA 1LE9A 1S7XA 2J8UA 4DZ8A 3IF1B 4MDJA 3WFHB 2PTTB 2QSCL 4RMSA 3E2HC 3B9VA 4JY6B 4ZUWA 5D1XD 4JO3L 2XACC 5DJYA 1KG0A 3HUJF 4LNVA 2WZPD 5GISL 2D7QA 4X6BB 3MREB 5HD8C 5E2TL 5C09D 4NQTA 5HPOA 2BOBA 3MV8A 4R0LC 1J1XH 4F15B 2O26U 1T1XA 4RRPA 1V7NH 2V9TA 3K46A 4HGWA 2WSKA 1NBZA 3FZUD 5DZNA 1PFCA 3RTQC 4PJXB 2HJLB 5E7FA 4JKWA 1UA6H 5L8KB 4KJQD 3ULUE 2YD4A 1RSFA 3QUMB 4KGJA 4LU5H 3R1GL 1NEUA 4NOBA 3D18B 2ZUSA 3F6LA 2CR3A 1DN2A 3U9UA 1EJOH 2Q1EA 1DUYB 4C83A 2VJXA 2EE2A 4NKMA 1IGML 2EC8A 3TLRA 2FRGP 4RAUB 2X70B 1KGCD 2X4UA 4PPTA 1CFSB 1JGEA 1NUGA 4RX4A 2NY4B 1YY9C 4MNQD 4LU5L 2EEAA 1LK2B 3W82A 3O2DA 4OQTL 2OX5A 3L3OB 5MI0C 4Y5YB 4Y16C 1S7QB 3CLEL 3TBWB 1UKTA 2ZUWA 1MFAL 3I9GH 3REVA 1FFOB 4YDIH 1KJMB 5GJSH 3OB8A 1Q9KB 2V2TA 1XGYL 5I18L 1GZPA 3GMQB 2BNUB 1I85A 3H6JA 1G1YA 4M4RA 5GHWH 1F6AA 1F5WA 3BEVB 5GZNC 2X41A 1NMBH 3EYQC 2VLJB 1LD9B 1U8HA 4G6JH 4HV8A 3V4PL 4NQDB 1HH6A 1W0VA 3X13A 5EPMB 3VI4F 1MQKH 4K07A 5GS2H 3JTTB 1N59B 4QHNA 1VFAB 4PRBA 5DZOA 4MQXC 5C0RH 3MV9A 1S7SA 3BKYL 2GY7B 1BQLL 3QZWA 1NMBL 3HI1A 4PJGE 1X4XA 4Z18A 2F53E 3TVMD 4G6JL 1PX3A 3P0VL 1S9XB 3HR6A 1AR2A 1BWMA 1NLDH 3RVUC 2E8ZA 3TZVD 1MQKL 4XVTH 4YHKH 4BQ9A 1ZTXH 4NO3B 5HYJA 2E8YA 4LHUG 4KKAD 5C6TH 4D9LH 1NCWH 5C0RL 8FABA 4LSSH 4QWWC 5DUBA 3FFCE 4H26B 4S2SA 4UOJA 3RWFB 3R8QA 1DQMH 3ZLQC 2LVEA 4TNVF 2OQJA 1NLDL 2ORBH 2MCPH 4U0QB 3B2UD 4OFPA 1MHCA 4QRUA 5C0BA 4Z76A 3AAZA 5EIVA 5IQ9A 3UTOA 4CBPA 1TETH 2J5LC 3QO0B 2IAMB 1QFUH 1WAAA 1A14H 5L2KE 5JHDD 1NCWL 2MWCA 1JYWA 1KTDB 2FEEI 1MI5E 4Q2ZB 2O61A 5CKAA 3R4DA 1UZ8A 5FGCB 2BY0A 2MCPL 4F2MB 5ENWA 5TDPB 5LGJB 3NAAL 4P9HL 5HHME 1TETL 2CQVA 5GJTL 3WKNA 5CGMA 1QFUL 1A14L 4GRWH 1MUJB 1WWCA 3AU1B 3ZDZF 1BQHB 2BFVH 2GT9A 3CC5B 2CRMA 4WI3A 5CILH 4PJDF 4ZYKB 4DEPC 2OXGA 1FFPB 1D5XA 5IW3A 2OK0H 4NQCB 5FHBL 1UVQA 3S3JA 3FB7A 4O2FB 1DBMH 2XQYG 2YKLH 2A6IB 3O9WD 4HX1A 2PO6A 4M7LT 2BFVL 4JFEA 2DI9A 2EC9T 3VU2A 4V1DE 5EBLA 4B50A 4X5LA 1I9JH 5TE4H 4UUJA 4U6HB 1FG2B 3UYRL 1WBZA 1H8SA 4PJ7B 2CIIB 4JHWL 2EXWC 4R2GB 3QNXA 5DA4A 4JFHE 1DBML 1QFWM 1V8HA 2H32B 4KK8C 4MAUH 2YKLL 4X6FB 1CXLA 2BVPA 3GMMA 2BC4A 3O8XC 3I02B 4WI2A 2EIDA 3VI3E 1QSFD 1AO7E 1VFBA 4G9FE 3HAEH 1DTUA 3ZMRA 3EOTL 4JKPH 3JWOH 1I9JL 5TE4L 3QG6A 3SDCB 1Q72H 5JW4R 3VD3A 4TUJB 1C8PA 3VXUD 4ZFFB 3IKKA 4PGZA 1ADQA 4LCYB 2QQNH 3ARZA 3QDGD 1ORQA 4MAUL 4MA8H 5JXEC 2YWZA 4UT9H 3B2VH 3LKPA 3RAJH 4P4KC 5CMAB 4FFYH 1NPUA 4JKPL 3JWOL 4XCYA 1SJHB 4JM2B 5HD8D 4L4TE 2Z31B 4I5BB 5CSZB 2WINB 1K9TA 3RX5A 3HNVH 1VADA 4MA8L 2XKUA 5E9DE 4UT9L 4LLDA 2QQQA 1MCKA 3RAJL 1QO3B 3QIBA 4YZFF 4YDLC 5C8JB 1VESA 3B8YA 1R3LA 1H15A 1X9QA 5E4IA 3RTQD 1RPQA 1J88A 5I1KL 1QYGL 1DUZB 2EDXA 4IIQB 2C3VB 2C9AA 1FL3A 4D9RE 3L95B 5IB5A 3N85H 5C0JB 3SJVB 4G8IA 1DSFH 1KXTB 3E3QC 3HNVL 3MFGB 3GSRA 2QSVA 4HJGB 2D4DA 5D93B 5T1LD 1F00I 4LLMB 1OARH 2WBJB 2JB5H 3HLAB 5HDBF 5CGYC 1NGPH 3UPRB 4X6EA 4NC1C 3N85L 1KJ2L 2Z93B 4LLQB 1YY9D 5GSVA 5EO1B 3Q0HA 3QQNA 1DL7H 4JRXD 2IALB 1KELH 4Y16D 2HJFA 5JW4Q 4BH7B 3G5XB 4L5FH 3K81A 2FR4B 2IPKA 4K8RH 1R3JB 1VACB 3E6FB 3DIFA 2JB5L 2DM3A 3OKMB 3KPLA 3BVNB 2X4RA 2C5DC 4G8GB 4U1SA 3BESR 3QIUA 5GZND 4K3EL 1DL7L 5DQ9B 3EYQD 1UM5L 3WMSA 4OLWH 1KELL 5HYSB 1J8HD 4H20H 4L5FL 3VGFA 5ERWB 2W9EH 1X4ZA 1LO2H 3GSWB 5BOPA 1IM9D 5D7LE 4IS6A 2P7TA 1QBLH 3B83A 3JWDC 3T77B 3UBXG 4U1IB 5EU7C 5JR1H 4GG6B 4ELKB 3FOLB 1J1PH 4MQXD 4JPWH 3BW9A 3LN9A 3HC3H 1JRHL 2CSPA 5IOPB 1C08B 2R0LH 4DTGL 5J06A 2V6HA 3RVUD 5IROA 1IARB 1O7VA 2FIKB 4F7PA 2EEBA 3CFDB 1QBLL 1F4WH 1DDHB 2EH8H 5IMMA 1OD7A 4LSTL 4Z95H 1ZANH 2O5XH 2BNRD 3PWPB 4WWKA 2X4PA 4X0KB 1WICA 3X14A 3GUTB 4QWWD 4O9HH 4OLXH 3MUGB 1M7IB 3HC3L 5D1ZA 4NBZB 3VDCA 1RURH 4MXVE 4WV1B 4BZ2H 4NUJA 4CW1B 2VABA 1F4WL 1L0QA 2AJZA 3RGVC 3RNKB 2EH8L 3C6LA 1D9KA 2VR4A 1ZANL 2O5XL 1T22A 1GGIH 1HYRC 5IW6A 4O9HL 4C56D 2VLRA 2FCBA 1NGQH 4OLXL 4MHHI 3AUVA 2RR3A 3SQOH 5IVNA 4QRSA 1LEKA 4R96B 5LWYH 4HZAA 1JGDB 3ALXA 1A6AB 3JVGA 2R2EA 3LS5H 2E7MA 1BJ1J 4B53A 2QQKL 1GGIL 5EC2A 3UO1L 1DEEA 1MCPH 1NGQL 3L5IA 4P2QB 2WNGA 3PV6B 3SQOL 2ADFH 1R5VB 4OZ4B 3HC0A 3JBG7 5K9OA 5I8KH 2I5YL 5LWYL 5JUEH 3SKOB 3IDMB 2Q7YA 1G7JB 3PJSB 4ZQKB 1BVLA 2VAAA 3RNQB 5E08H 3LS5L 4QRPB 3NIDF 1SEQH 3D0LB 4QRRB 4YE4L 5D7SH 2LFGA 15C8H 1FIEA 4FRWA 4FNLL 3VI4E 1MCPL 2YPLD 5AWNH 4WENB 2EXYC 3L3KA 4FTVD 2IGFH 2DQUH 4GMTH 4MGXA 2B0SL 5D2LF 3RZCC 4X4YA 1FFNA 3WS6A 3NH7L 43CAA 5E08L 2EXWD 1IC7H 4KK8D 4M6OH 1AXTL 2VKXA 4MAYB 3TT1H 5C0CB 3O8XD 2BK8A 2XWTA 2APBA 5AWNL 1S9WB 1E27A 1KEGL 3ME0A 3SCMB 3H3PH 4TVPL 2DQUL 4GMTL 1ZXQA 4QHMB 4RAHA 3DX7A 2XFXB 2X4TB 3MXVH 4PTUB 2OP4L 4NO5B 5JQHC 4P5TC 4AG4H 4HC1A 4O5LL 3RI5F 4X6DB 2C7UB 5E6IB 5BO1H 3MRDA 4M6OL 5IWLC 2ED9A 1UJTA 3O2DH 3BE1H 3TT1L 4U3HA 1YMMB 5JXED 1RV6X 3AMLA 4EKXA 3O4LD 4P4KD 1FZOA 3H3PL 2DLEA 4Y2DC 2HTLC 1OP3H 3MXVL 1J5OH 5A16B 3BO8A 5IB3A 3FMGH 4GG8A 4O2CA 4AG4L 3IJYB 5MHSE 4UT6H 3C2AH 3U1SH 4F7CA 4HUMB 4WHTB 5IEHA 3W2DH 4JY4A 5C2UB 1FORL 3BE1L 2VLKE 1FGNH 3PUCA 1AHWB 3SE4A 4N9GA 3B5GA 5I16B 1JJUA 3KPRD 1IAIM 1D5BA 3VGAB 1G7MB 4Z7VB 3T2PA 1NEZB 3FMGL 3GMPA 4PJ9B 4TSBH 4ESKA 3UJIL 3U1SL 2ICWB 4J1UB 3ZHDA 4MCYB 1E4KC 3ZDZE 3W2DL 2YPKA 5IG7B 1FO0A 4GW5B 2GSGA 3T2NH 4KTDL 4LARH 1B9ZA 2FATL 4ZUVB 1KLGA 1V3LA 1PKQB 3B9AA 1BMGA 3RL2B 3SDXE 1N6QH 4PV8B 5CGYD 1A7OH 1WT5C 5I1AB 4TSBL 3SPVB 5IHBA 1RZ8A 2R1YB 4MA1B 4XPHL 5FYKH 3NN8A 1IKNA 3CH8A 1I8KB 5HHNB 4F58H 5CJXA 1S7UB 3D9AL 1RZGB 1JFQL 2ZJSH 1EA9C 3WHXA 1BPVA 1G6RH 4N90D 4NKDA 5T1KB 4XNXH 43C9A 1LEIA 1N6QL 3I3EA 3FFDB 3VFMA 3QQ3A 1A7OL 3MV7B 2IFFH 3SE9L 1BOGB 1QSEA 3L7FA 3W5NA 1QQDB 3ZYOA 5FGCE 2V5YA 4LVOB 2D31A 2UUDH 4JVPA 4O00A 4F58L 3I50H 3V4VH 5KS9F 3H9HA 4YHOH 4KMQA 2ZJSL 4XT1C 4E5XB 4EI5B 3OAZH 4EIZC 1G6RL 3T8XB 3FB5B 3T0AA 3QXDB 4XPTL 3GKWL 4XNXL 1ZA3A 3KWWB 2DKUA 5TQ0H 3T1WA 3OXRB 4JQXA 3QEGH 3QHFH 5B8CB 1YC8A 2IFFL 1ZGLM 4WNQA 4PREB 5HYIA 1HHJA 4HWEL 3I50L 1CIUA 4HKXB 3V4VL 4MNGB 4LLWB 4YHOL 4NQCE 3PWUB 1YEJH 4NP4L 3WNLA 4GRMA 3OTTA 4AMKH 5JO5B 3VXMA 4QHLA 1XCTA 2H9GB 5TQ0L 2ICWJ 2PXYC 1A1MA 1MJ7L 3KPSE 3QDME 1P4LB 2MJWA 3IT8D 3ARRA 1UQSA 4N8VA 3RGHA 3M45A 1FNAA 1U3JA 1RUPH 4PRAA 3NA9L 3N06B 2FO4B 4JJ5B 3BHBB 4LCUA 1VSCA 2XKSA 4OZFA 2OMNA 4YHNB 1Q9WA 1YEJL 3C09B 4Y5VB 3VXRE 3S4SG 3L5JA 5IVXB 3KPNB 3DO7B 1UYWL 3RGVD 2VXQH 2FJFB 2ZG2A 4PJEB 3AS3A 3BPCA 1U92A 4XRCB 4P2OB 4XTRC 1AJ7H 2FZ3B 3BP7B 3GO1L 4PJBF 1E4XL 2Q76B 4PB9L 1W0WA 1CDGA 4MMZC 3NFSL 3T4YA 5HPMB 5D1XA 4BK4A 1CWVA 3T3PF 5KN5A 4HAGA 4XCNB 1RAMA 5HDBE 4AT6A 2DTML 5I1GL 5EU5A 3O2VL 5CSGA 2VXUH 5CEYA 5J6HB 5DA0B 1ADQH 1XF3B 3K2UH 3DVFA 1AJ7L 1MJJA 4YFEA 2F5AL 2NZ9C 5LVEA 1LQSR 4Z7WA 1P6FA 4YHPA 3WE6A 4HT1L 3SO3C 1LO5B 1PKOA 5EO9B 4WRLA 4WUKH 4OF0A 5E2JA 4ODVL 5GGQL 4NQVA 4XXDB 4XVUC 2DB8A 4GW4A 4WO4B 4FQCH 2QADC 4OUOA 2VXUL 4PTTA 3MRJB 2I07B 1SJXA 3FB8B 3K2UL 4XH2A 2XN9B 4PJ5B 4EN3C 4LPTA 2YC1B 2P5EB 2AI0H 3KPMA 2EXYD 4M43H 4PLOB 1EFXB 3P30H 1MRDL 4WUKL 1OOAA 3BIBX 3UBXI 4XCFH 3RZCD 4MNQA 4JFQB 4FQCL 3ZE0F 1CICC 3QFDA 4EVNA 2EDDA 2CO7B 4NQSA 5EUOE 2L7JA 2BOCA 1WZMA 4ONGH 4HFUL 1LO3H 4GXUN 5ANMA 3P30L 1FYTE 3VFVA 1P4BH 4LVNC 4XCFL 4P5TD 2W0PA 3WEXB 4J8RA 1OTTC 4PJCB 5HYSG 3LSOB 3OJVC 2IANB 5IFAH 4J3SA 4EUPA 4Y19A 2A77H 1U95A 5FYJH 3LRHA 5DD0L 4OQ1A 4CN4A 4G8EA 1NLBH 1C5DB 2FEDC 4U3XA 5GS0C 3KHQA 4ONGL 1LO3L 4Y2DD 2HTLD 4MXQC 2YD1A 1H8OA 4RMUA 3D85B 1ZLVK 3QRFM 3PGCA 3RIFK 3VWJA 4ZUTB 2LAGB 2HT2C 3HZVB 3TP4A 4G6KL 4QF1B 4RISH 2A77L 3LKSB 5F7MC 1ZT1A 3TVMA 2HFEA 1KLUB 3BP5A 3OB0K 4XNMA 2CLZA 3ARDB 1S78C 3QPXL 5FA3B 3O45B 4L8CB 3TESA 3GI9H 5E5UB 4PRHB 5J1AB 1R5IA 4LDOB 4XPAL 2VL5B 4WU5B 5F3BA 4JZOA 3IFLL 3MYZA 3MC0A 1CQKA 3IDJA 5SX5K 5C07E 5MP6L 5DJ0B 3P4OB 4NZRH 1OSPH 5I1LA 1RZKH 5GGTA 1N64H 2PYFB 4M7ZB 1H3WM 3FO9B 1OT2A 1PYWA 2JLLA 3EDJA 3C5JB 3GI9L 3I84A 3K4ZA 1I7TA 5ICYA 1CFBA 4JPKH 5KSBB 4S10A 1ZVSB 2VH5H 2OSLB 4ZNEA 1KB5A 2JK5B 4HPOH 5IM7B 3ZT5A 5ESVB 3MPCA 5KVFH 4DGIH 1MRFL 1YMHB 2SEBB 3QA3B 3VXPA 1WK0A 1N64L 3LD8B 1AD9B 1KJ3L 2V7NA 5C2BL 4ZSOA 1BF2A 4JO2H 4LSUH 1NAMH 3L7EB 4HFWB 4CVZA 4NQDD 5I30H 5TDNA 3BP6B 3ALWA 2VH5L 1Q9OA 3L5XL 3ZDYF 4HPOL 3HCVB 3A0OA 5F8RC 1U8MA 4TOYH 1I4FA 1NMAL 4G9DB 4GS7B 4NRYA 2JIXD 3NIGF 1G7IB 4PD4J 4XPBH 4JO2L 1A5FH 4PJFF 3DTXA 4LSUL 1NAML 1DVFB 3QWOA 2FWOB 1J11A 1JMZA 1XCQB 2AJ3B 2AXJA 3O9WA 2ZUVA 4RFEB 4CDGC 2MKLC 3L3DB 3TWCL 4O2EB 3VFUB 4PRPE 1OGAB 1HNGA 1NKOA 4TOYL 1UB6A 4QOKD 1RHHB 1X5JA 1OAYL 4OFDA 2Y5TB 3ARPA 4KK9C 4NZUL 1JF6A 3LDBC 1A5FL 1ERNA 2DQTH 4QRRE 1DJSA 3RA7L 2PXYD 5DRNA 4DWHA 2KDGA 4WV1C 2J12B 5EIIB 3HMWH 3WIIL 2N1KA 1QSFA 3MLUH 1KOAA 3VDBA 4DN3H 3H42L 4FQ1L 2PN5A 3E1F1 4MNHA 5F7HA 1NBYB 5ACMA 1Y0LB 5EZLB 4D94A 1SM3L 5LG1A 4OAWB 3QJFA 2KBGA 1QFWL 1XGUA 1UWGH 3DGGA 1KT2B 3VXUA 3ARFC 5I75C 4OZIA 3TBVB 1S7TB 4WHCA 4ZD3H 3DX6B 5DMGC 1FBIH 4LEOA 3O3UN 1MCDA 2APVA 3HMWL 4XTRD 1QRNB 3B9KB 1YECH 3KPOA 4P23B 4DN3L 4UILL 3D0VB 3STLB 5EU6E 2R0WH 4KV5E 4N0UA 3GJEB 4Z7UA 4LVHC 3T4AB 4YQXL 4X6DE 4HIIA 3MROB 1UWEH 4X4MA 1TVHA 4R0LA 4LGRB 1VFMA 4HC1H 32C2A 4OCXH 1FBIL 2YZ1A 1J0ZA 3PQYB 2NZ9D 1YECL 3I6KA 1KYOJ 1UXWA 3O6MH 2YBRA 1NEZG 4EOWH 3A6BH 1KCVH 3HZKB 3C8KB 1EGJA 1UJ3B 4HIEA 3GBLA 4JHBA 4XVUD 1UWEL 2CJUH 1P9MA 2QADD 3VRJB 2B20A 3ZZ1A 1GOHA 4HC1L 1G7QA 3LKQB 3NCEB 1N3NB 4OCXL 4MJID 3U6RA 4BZ1H 2GJ6D 2MSPA 2X4NA 1EAPB 4EN3D 2H6PA 5AYQA 3BWAB 4U1HB 5T1LA 5IBLC 1F3JA 2CK2A 3OJ2C 5F96H 4Z7VE 4WTXA 3A6BL 1KCVL 1EEZA 1EO7A 1PSKH 3CFJB 4F57H 1K8IA 2DIBA 2GHWB 1MCWM 3HUJB 1CICD 3E6HA 3HR5A 1FIGL 3BZ4A 1YEDB 3FRPA 4JRXA 3TH2T 4FXGA 4MA3B 4Y16A 2EDKA 1FO0H 2NXYC 2VDOL 2ZCHL 5HHPB 1MCIA 5F96L 4HS8L 4GXVH 3O0RH 1H3PH 1A7NL 5HYEA 1UXSB 4F57L 4WY7H 2YUVA 5HGDA 5E95B 3OGCB 1JNHA 1OTTD 3MUZ1 1ZLSL 1GGBH 2BCKB 3C5SA 5GSRB 2ZKHL 4E41A 3QI9B 5F7UA 4UZGA 1ONQB 3BKJH 4X6CF 4KVCH 4Q6IC 1T1YB 1I7ZA 4A6YA 1RK0B 1KN4L 4HG4J 3P2TA 5GS0D 2FEDD 2NYYC 2Q20A 1JK8B 3DVGB 3P9LB 1INDH 1H3PL 4MXQD 1EZVX 3KS0H 4WY7L 1EEYA 3U0PB 4TTDC 1GGBL 1VEMA 3VXTA 2W91A 5IMKA 2HT2D 3ZYZA 1XZ0A 1TLKA 5DJXA 4U1KB 4D9QD 3BKJL 4KVCL 1IC1A 5E0QA 4IRSB 2DBJA 2DMKA 3KYNB 4LPUA 2OR9H 1S78D 2NLJB 5B38B 1INDL 4JZJB 3TNNA 4KI5C 3UZEA 1GOFA 2BNRA 3D3VE 4HBCH 4MCZB 2XNAB 1Z5LB 1MVUB 4MNGE 1J12A 1IT9H 4H25B 2ATPA 1J87A 4YEFA 1MWAA 4ELMA 3GSVB 3GIVA 4EDXA 1YPZA 4KJYA 4PG2C 4RIRB 3UTQB 4NKOB 2R69H 1MELA 2V2WA 3OKLB 2FHCA 2B2XH 1CCZA 4OD3L 4HUVB 2JB6B 4HBCL 1IEBA