2XKUA

Prion-like conversion during amyloid formation at atomic resolution
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
94
structure length
94
Chain Sequence
MIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords BETA-2-MICROGLOBULIN
publication title Conformational Conversion During Amyloid Formation at Atomic Resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xkuA00
4YHIA 2X41A 2OS7A 1F3DH 2DMBA 5BRZB 1OW0A 4RA0C 1DCLA 4LVOB 2R0ZL 4BFIB 3KPTA 2IAMA 3AU1A 1T7ZA 5D1XD 5GIRA 2HT4C 3BQUC 4JDTH 4PJBB 5H8DA 4OQTA 3KGRA 3SGDI 5HY9B 3CDYA 4BA8A 2C26A 3MRJB 1TZGL 2CIKA 4WUUB 4DJMA 3MROA 4JFED 4RMTA 1ZGLP 5EOTB 4C56D 4PY8I 3O6LL 4JPWH 1ED3A 3BP7B 1T1YA 1UB5B 2IBZY 6FABH 3DYMA 3X3FL 4LAJH 1DVFC 1T22A 1T4KB 3U6RA 3ULVD 2QQNL 4NP4H 2OZ4L 3CSYB 4WI5A 4X4XB 3RGVA 3G5XB 4G9FD 4I1NB 4RWHA 1G0DA 2P44B 1IM3A 2CDFA 4I5BB 4X6CB 5MENB 5FFLA 6CGTA 1FPTH 4BQBA 2EKJA 3OMZA 3R06B 5CIPH 1Y6KR 3U7WH 1IFHH 3PWPA 4LLMA 1GH7A 1IAKB 3BPOC 3PHOB 5IT2L 4L8BB 5F6HJ 1A7PL 5C2BH 3LS5L 5MEPB 4XXDA 3RVTC 3UTQA 2QHRL 2EE3A 4JVWA 5I19H 1N5YL 2W0FB 1CFQB 1I75A 3JV0A 3MXVH 5DHYB 3UDWA 3QUZD 4BSVA 5I2IB 4KJPD 1GJIA 4RDQG 3L6FB 2NY0B 5TF1L 2VAJA 5H2BB 3DV6A 4NRZB 2NY1D 2UZXB 4LRNH 4MD5A 3MACH 5D7IE 3F58L 2CLRB 1HEZB 2KPNA 4MCYA 1V5JA 3RWDB 3OXSB 1OARH 1QLFB 4H25A 5CZXD 3TN0B 3PHQB 4LSPH 4Q9QH 5JPMA 2FBJH 3BSZH 4YK4C 3GK8L 3PWLB 3JV5A 3SJVB 1MNUL 1DDHA 1IEAB 4NKMA 3G04B 5FCSH 4P3CH 3SE8H 3QIWC 3TP4A 4F9LA 4R4ND 4WU7B 3RP1A 5I1JL 2W38A 4QRRE 3OB0H 3QDMD 4IRZH 5D1ZD 5D6DC 4PRPD 1YECL 1YPZA 2WUCH 4WO4D 1VERA 1MF2H 4PIRF 1D7FA 4QO1A 3SOBL 3HUJE 2YD1A 4NNYB 5H94B 4YFLI 4MAUH 2AP2A 1RJLB 2VITB 1KT2A 4Z95L 4NWUH 1U3HA 5EO1B 5SWSE 2P43B 4WFGD 3TYFA 3ZO0A 4CU8A 4YHYC 4LASH 3SO3B 1K5NB 5KN5A 3DETD 4P2OA 1A6AA 1CDYA 4WEMB 1H3PL 2DIJA 4I48B 4WHYH 2W07A 1JGVL 4UU9B 5HDQL 1P5VA 1KUMA 2BDNH 3ZDXF 1X5YA 2PW2B 4CN6A 2VZOA 1LILA 2CQVA 4OZFG 4U1HA 1T89C 2A77L 4GRLC 4PB0L 4Y1AD 3BKYH 1ONQB 5EZOH 1P9MC 5LQBH 3I50L 4U3HA 1ZS8B 4NZRL 5L9DL 4XAKD 4I2XB 3EOAB 1EEZB 2E6PA 1DTUA 1MIML 2Q76A 4NCC2 5IESH 3KXFA 4M6OL 3EOYG 4NQSB 4Z0BH 2RCSH 4AH2A 3HNSL 1K85A 5FA3A 1I3GL 5GS1C 2OR9H 5GJSH 5FYLL 1ZGLB 1S8DA 5ALCH 4C56A 1DQML 3OAYH 3WNOA 2GTZA 4OZFA 4UI2A 3ZMRA 5TF0A 1QBAA 1HZHL 3IYLW 5EN2A 3MJGX 3AUVA 1KJMB 4NKOA 3I84A 2E5EA 1F8TL 5E4IA 2P4AB 5I8CB 4PB9L 2AV1B 5GS0L 4M4RA 4G9FA 3ZDZE 3BEVB 3MRLB 2BY3A 2IANA 3VFWB 3WNPA 3DRTA 1MCPH 1QSFB 4RAHA 1AO7B 1IKNC 5HYQA 5D71H 4DUXA 3MV7B 4Y4KD 3KPMA 3AB0C 4X5WB 5E2JA 1XGUA 2DL9A 4P3DA 1V7NH 5HGAA 5H37H 3T0ED 3NH7H 5D70L 3QQ9D 4LIQL 3HRPA 5MEQB 1MFCL 4DVBA 3C08L 4FG6D 4UDTB 4LVHC 1SBBA 3NAAH 3RDTB 2X4TA 5IB4A 3G6JA 1DQDH 1G6RA 1YNLH 4L8DB 2DQFB 1KYOJ 1GGTA 4Y2DD 4G6JH 4LLWA 3QFJD 1V7ML 5E1AB 2R4SH 3RWHB 3T1WA 1CFVH 1MHPL 4QXGL 3PL6C 1WFUA 4QHKJ 3TBVA 4UIMB 3HMWL 1G9NC 2FJFB 2MHAA 3FQNB 4NJ9L 1CFTA 4XMLL 3EFDL 1GOGA 15C8H 1CLYL 3KJ4C 4J4PC 3CZFA 1JRHH 4X6BB 3JWDH 4XX1E 4POYA 5C0AA 3WFCL 2GJJA 1DR9A 4KMTH 4XP1L 1KCSL 4Q74A 4HC1A 3P4OA 1U8NA 1QPXA 1YN6B 4KJQC 3BWAB 3LN9A 1IC1A 4Y4HD 1YYMH 4PGJA 2VDNL 5J57B 1PAMA 1WIUA 1WZLA 2ZSVB 4BH7A 4U1MB 1CL7H 4HUXA 4ODTL 1FNFA 3R4DA 5DUML 4EVNA 3QJHA 1RHFA 3DWTA 3IRZA 5CZVH 2E27H 5D2LB 3C60A 3GJEA 5JNYA 4E41A 2FGZA 1HI6B 4S1DD 5TGBA 3D0VB 1MIEH 1BZ7B 3CH1B 4YO0A 1HCVA 2CJUH 2H2PD 4JDVB 4TOYL 5EBLB 1CGVA 1FNSL 4MSWA 4HIJB 1DLFH 2KZ1B 5C0JB 3B8SA 4LSVH 3CPLB 3HE7C 4XPHL 5KAQG 5JXAH 2XY2A 1DQJB 1YEGH 4PJ7E 2D3VA 4FXKB 4MVBC 1OOAA 2NYYC 4Z7QF 5ANME 1J0KA 3LSOA 1S9WA 4UT6H 3C5ZD 1C5DB 2EDFA 1IGFH 4S2SB 3WS3A 1VFAA 2Q87A 3C6LA 4ZPTB 3FQXA 2CMRL 2Z8RA 3WEXA 4PRAA 1BAFH 4XB7A 3PQYD 5CEXA 3MJ7A 2DICA 5CKAA 1GGCL 2Q1EA 1GPOL 1X6NA 2G75B 2D7PA 4JG1H 4PJFF 2KKQA 4MMZC 4XAWL 4ALAH 4ZTOH 3FN3A 4LCCB 2V2WB 4M1GH 1TMCB 4Y5XA 1ZLSL 3RWEB 1BFOA 3EYQC 5CJOH 2GYSA 3OJVC 1KN2H 1RUKL 2JCCF 1HHJA 3LQAH 4IMLB 1QBMH 5C0NC 3OTTA 4EN3D 3CFBA 2NW3A 4JZOA 3IFPB 4M48L 1UXWA 3GDBA 3CFEB 3DRQA 5L2JA 3LKOB 4F3FA 4PPTA 4G3YH 1QKZL 1YY8A 3S37H 3IF1A 3Q6GH 3IDGB 5ESAB 4U1KB 4CVXA 2P5WD 3DX8B 1FDLH 1QLEH 3L3OA 5E7FA 4QHNB 1P84K 3T0EA 2OXGA 1GAFL 1KIPB 1L4IA 4WHTB 4R3SA 2PYFB 3U9PL 2GJ6B 1CDCA 3WKNA 5J6HA 2HKHH 1Y0LA 1PYWB 5I1AB 2HTLD 1UCBL 4YBLB 5EU6E 1IGIL 5F9WC 4B7LA 3Q3GB 4R8WH 5HHQA 3ARQA 1ZMYA 2V9QA 2NY7H 4F57H 4OI7A 4XMKL 4KZEL 3QFJA 4BM7A 4BUHA 1JL8A 2DQTH 3PWNA 4RGMC 4PRIA 2H6PA 3INUH 4LCUB 5C0IA 4XP5L 3K1KC 5F7YC 1D5IH 1PDKA 4I4WB 4PY7B 3T2OA 4Z77A 2EDTA 4QHMB 3LKQA 1HNFA 1Y18B 3ZSTA 4Z6AT 5C9JB 4L3EA 5E4EC 4DK6A 3LH2L 3SN6N 1UH3A 3DXAE 1FGNH 1T03H 1U6AL 5JHDD 1HSBB 2HH0L 5E5RB 1N0XL 2Z93A 1F4WL 1A1NA 1X5GA 4ZUTA 1KIUA 3DUUB 1M71B 2XWTB 3QUXB 4LFHD 2ESVD 2E6JA 1CD8A 3D69A 2VQUA 5E2UL 3G5ZA 3CJJA 1P4IL 5DSCA 2FX8L 4WI6A 1TVBA 2MQCA 2PYEE 3O2WH 3DURA 1X5KA 3R8BB 1DZBA 1EVUA 4BSJA 5TFSL 5C0FB 2BSRA 2WINB 4NHCL 4N0RA 4D0BB 5ISZE 2DN7A 4JRXD 5BOPA 4MX7B 1BMGA 4WVRA 4PGCA 3HZMB 3L7FB 4NO2A 3KYMB 5D7IB 3VWKA 1OT2A 2AI0L 3QDJA 1FORH 5AYUL 4JGJA 3RHWK 1GHFL 3PIQA 5HJ3A 4JCLA 1QVOB 4X99A 5E6ID 5T5NG 1FFNB 4PJFA 1AC0A 3TO4A 1MSPA 3F65A 2YKLL 4ZO8A 3QHZL 1SYVB 5FKAA 4NT6A 2YOCA 3BGMB 4PJ9C 1J1XL 4G42B 4PLOB 3PQYA 1BIHA 3D3VE 3QXUA 2F53A 4AEHH 1IEBB 4OGXH 2CRZA 2R69L 3MLVL 4LCIH 4M61B 4TULL 1FFOA 2G9HA 3DVIA 1TNMA 1VEPA 5D1QD 3IKKA 3FTGB 4HIHA 1BECA 2NY4B 3KPRA 5LBSH 1ZHKB 3FCTA 4FNLL 2HVKA 4XXCC 3PDGA 4GG8A 1JGLH 2AJZB 5HHVL 4YUEL 1JCKA 5SWSB 2YD3A 1IC7L 1P5UA 1E4WL 3JUZA 4U6YB 4G7YH 2EYTA 3UJTL 2DYPB 4WI3A 3IDIA 4KMLB 3QIBA 1NAMB 4V2BA 5HGHA 5LWYL 2AXGB 1TQBB 2DM2A 1IILE 3HE6D 4RIRB 4KRMB 3ZE1E 1K8DA 4TVPH 2GITB 3TA3C 1SBSH 4O51A 5DMJB 2BNQD 4BKLA 4DFHA 5GSVB 1OQXA 2X70B 3HI5H 3SGEH 4R97C 4KJYB 4UUJA 2X40A 2VDPL 4L29A 3MNVA 2P45B 4DFIA 4J8RB 1CR9L 4MCZB 3NFNA 3FZUC 1EGJH 3T77B 4CW1A 4U0QB 5KSAD 3KR3H 2HFGL 1R5WB 1H5BC 1C5BH 4K2UL 3DJ9A 2XKNA 3NFSL 2DQEH 1Q0YH 4NC2B 3T0VA 1KG0B 4K3EH 3RU8H 2L7UA 1R0AH 5DD6B 1FYTE 1OD9A 4GLRI 1H15B 3H42L 1MCIA 4WJ5B 2KBGA 4ZFZA 1BVKB 3JV4A 5CEZD 1MH5A 4LSTL 3DX6A 1H8SA 1MOEA 1U92B 4AIZA 2EH7L 4K23H 4OCWH 5F70A 5I74C 2OL3H 2ATPA 3BHBA 4RBPH 1X44A 1WVZA 2HVJA 2RHEA 4UTBL 5HYSG 5T3ZL 3T65A 5J9PB 1UYWH 5F7LB 3WKMH 4R96A 3FO0H 3X12B 4YBQC 2PTVA 4POZD 3V4PH 3B3IB 4OLYH 1YY9D 1BEYH 4OQTH 5B3JE 1CDUA 1SY6A 5DJZB 2EDDA 4TPRH 2P47B 3W9EB 1KNOA 1RI8A 4WHCA 1EBAA 3P9LA 4JHWL 3MLRH 3ALPA 5DZOA 5T1DL 2I5YL 3QEUB 4GQ9L 1VADA 3DECA 5EFIA 3RTQC 4MQ7A 3PWVB 5IB1B 5CIPB 4PJ8D 1VGKB 5ESQA 5HYSA 2OI9B 4ODVL 2FJGA 1Q8MA 3UTZA 3TF7C 4OTXH 2Z8WC 1X5XA 1NSNH 4LHUB 3V6FA 4OGAD 3RWGA 3DVNB 4EXKA 4WWKD 3WNMA 5MI0C 2HJFB 2IALA 5HI5D 2ORBH 4F7CB 3BEWB 2XZCH 1AHWA 4FFYL 2VSCA 1A6VL 4QRQA 1ZT1A 4XBPA 3DPBA 2JF1A 1Z5LA 3S35X 3KYOA 1NANI 4M8VA 3E6HB 3GBNL 2XN9E 4Z7VE 4BSWA 3BXNB 1NCBH 5I1IH 4XBEL 4KQ3H 4OZGB 4Q6YA 1EK3A 4PS4L 1RHHA 5ITFB 1O5DT 4X6EA 3ZE2F 1U8IB 2X4QB 2D2OA 5JMRA 3EFFB 4H26A 1AKJA 3RVUC 5JW4R 4YGVA 5GS0C 5I1HH 2EDOA 2ITCA 4FQHB 4N5EC 2NX5D 1NCWH 4K3JL 4Q0XH 5ECJE 3W82A 3D0LB 2FX7H 1F58H 2IEPA 4R7NB 1IBGH 4Q58C 5KZCD 4U6HA 3BFOA 2XFXB 2ZG2A 1MFNA 2BSTA 4WW2C 3F8UB 2FCBA 1GC1L 1EMTH 5IR1A 2AERT 4N0UE 5TDOA 4XPTL 2DQIH 1EHLH 2FJHB 2BVTA 5FEBA 1FNGA 1KJ2H 1WUNT 3WJLA 3MLWH 4NZTL 5HI3D 3HNTH 5T3XH 1AXSA 2IFFL 1U8QB 2L7JA 1A4KA 1JF1B 2E9JA 4LPTA 1KB9K 2ZSWA 4ZFGH 3D2UD 4GAYB 4PJ7B 4TSBH 3DI2B 1JMZA 5BJTB 2P48B 5I66B 5E5MA 5I71B 2GTWA 5ANMB 4HJJH 2PO6B 1QG3A 1BWMA 2AQ2A 3M45A 5IFHH 4FQXC 1GZPB 2R1WA 4U1JB 1IAIM 4JEGB 3WO4B 4PYGA 1OAYH 2ADIA 3AMLA 4YPGB 1KTKE 2RQ8A 4QRPD 3BQUA 4F7MA 2V6HA 4LLUB 1EHAA 3DROA 3UPAA 1IAIL 3JTSB 5B39B 3ORJA 3NZHL 5C0CA 4TVPE 3TT1H 1XF2B 5B3NA 1CGXA 3U0TB 2FWOA 3RWCB 3UTTD 3FT4B 3ZKMC 2F58H 4P2QE 1BF8A 4MNHB 3D39E 5I6XC 4HF5H 2XZQL 4ZPVB 3QG6A 4EI5C 4YC2B 3HC4L 4NPYB 2BC4A 3PGDB 3FFCD 3DYOA 3MLUH 1P1ZA 4OCXL 4PJDE 2OTWA 4Z7UE 1P7QB 2NW2B 2QQQA 1TZHA 3RPKA 2MPAL 2UWEE 3CX5K 4XVJH 5IEHA 4JFFE 5D7JB 3WIHA 3FB5B 1FQ9C 3HRZA 4PUBL 1YEDB 5EU6B 3U46A 2W9EL 5JLZB 4XBGA 2WANA 3GI9H 5GJTH 3HC0A 4OZFH 1Q0XL 4YIQB 4KUZL 1BLNB 1RJYB 4TSCL 4S10A 3ULVH 2B2XL 1DBKH 5KTEH 1SYSB 3MUJA 4J12A 5K93A 1ZHBA 1ITBB 5E70A 4HFWB 4OCMC 2EC8A 1TCMA 2IPUK 4LVOC 4J7RA 2GSGB 5EBMB 3U4AA 5CINL 3VXTB 1J0JA 5DJCB 5AD0A 4KKBC 3RKDC 4CUCA 3DXAB 1SJHB 4MXWH 5ENWA 3HR5A 4WI7A 2LTQB 2J1KA 1W0WA 2QR0A 3R0NA 1WAAA 3W81A 3VI3F 2C3VB 1ZSDB 3BUYA 4B5EA 1YEFL 1S7QA 4Z78A 4XRCA 4NUGH 1KIQB 5BS0A 3QI9D 4PRNB 1SJEB 2DM7A 3GEWB 3SCMB 2VXUL 1CD1A 5EZJB 1CWVA 4NZJA 2JJWA 1XGQA 3CFJB 3N1FC 2MJWA 3RX7A 3PWPE 1GGUA 1F3JB 2X2YA 2XT1B 4OIIH 1PKQB 4J6RH 2FO4A 4LAQH 1MLBA 1OGAB 4GKSA 5FGBC 1QNZL 1WBZB 4GXUN 4YWGH 1NAML 3IFNL 4XPBL 4W81A 4XT1C 3QULA 1PQZA 1BFSA 2NY0C 3SKNA 4OD1H 2Q6WB 4ZOAA 1FFPA 3EO9L 2ICES 4JKPH 4OCSL 3OF6A 1S7TB 4GRLA 1FL6B 1G7LB 1EAJA 1K6QH 3S8WA 3CVHA 4P2RA 3H3PL 4HDIB 3UP1A 5CEYA 2KQNA 1RZ8B 3K74B 4AIXA 3UO1L 2BERA 4LKXB 3TN0C 5JQHC 4HJ0C 4NC1C 4I3SL 2ED7A 2ZUQB 5FYKL 4JVPA 3P3YA 2Q7YA 4PJ5A 3B6SA 4UV7H 3TT3H 4P5TB 4XVSH 4H88L 3LKRB 3GSVB 2ZPKH 4HXBL 4D9RD 1U58A 3CVIL 4S11A 2WUBH 4NCC1 1AIFB 5HD8D 3HHRB 1XF4B 1JP5A 5F7UA 5KVDH 5GGUB 2AXFA 3P0GB 1YPZE 4R4BA 1LMKA 4X8JA 5DK3A 2VXVH 3FFCA 2OQJA 3V0AC 4JDTL 4OAWB 4WFFD 1IKNA 5C3TA 4ELMF 3THMH 2VDQH 2HRPH 5BQ7A 4M7JH 4XCNB 6FABL 3TEUA 4S0TD 4TUOA 4OD2B 3SO3C 4CN4A 1QSEB 2X1QA 1GZQA 5JORB 2HLAA 4P46D 3L5HA 2UZYB 4GRWF 3UTSA 3QPQD 3REWB 4EDXA 1A7BA 5E8OB 1H3TA 1M4KA 1QO3A 3FKUS 3MJ6A 4G6AD 4QHLB 1FPTL 1YQVH 1ZT4A 2YPLD 3TBSB 4PG9B 3Q0HA 3U7WL 5F1IA 5J3HD 2VLRD 1IFHL 5E94B 2VQTA 3OAYK 1FYTB 5IV2B 4QTHB 4YFLF 5C2BL 5D5MF 3KXFE 1F4XH 3VRIA 2GJZA 5I19L 5DQDH 2AGJH 5IMLA 3MXVL 2Z4QA 2KQMA 3LKPA 4C56E 1PW3A 3MNWA 2V2XB 1J10A 4C59B 5BVJB 3MMEB 1G7PB 4LRNL 3MACL 3TM6A 4KH2A 3OGCA 3VD5A 2HJLA 3IETA 4OLZL 3M17A 3VFNB 3HI1A 3GMMB 3N85H 1FVDB 1OARL 1D5BA 4G9FE 3CUPB 3WN5B 5FOJA 3TNMB 4K7PY 2IANE 4LSPL 4Q9QL 3BSZL 4ENEC 1I7ZA 3C5SB 2LAGB 4CBPA 1HXMB 5JR1L 4IRSD 4JHZA 1OAQH 2BNRD 1Z9SA 1Z9LA 1CFSA 2EDHA 1Z2KA 4MA7H 4M93B 4PR5A 5GGRA 4IRJB 3TCLB 4QLRA 2AXHA 4GMTH 3SDDB 1WZKA 3SE8L 2HYMA 2P49B 5MEOB 2VDMH 3ELAT 3CX2A 3F12A 1CGSH 1B0WA 2VAAB 4NNXB 2MCPL 1ORSB 5DJ6A 3B9DA 4IRZL 4MDIB 3S4SG 1W0VB 4TNWK 1CLOH 5DJDB 2WUCL 4M9OA 1MF2L 5DZNA 3MC0A 3G6JE 2OYPA 4JM4L 2XN9B 3RDTC 1BD2D 4MYWB 3GMNB 4MAUL 1UADC 4TQEH 3QEHB 3LPFA 4F7EA 1T3FA 4NWUL 2XY1A 4ISVA 4JAMA 1NMCB 1JWUB 2Q7NA 1HINH 3RWJA 5K9KA 3VWJB 1JF5A 3X14A 4M62H 3S4SA 4LP5A 5EU3B 3TZVD 3VXUA 4MS8C 4GUPB 2V9TA 3QZWB 5C0AE 2BDNL 3I3EA 4ELMA 1LO3L 4N0UB 3BH9B 4Y4FB 3RIFK 4Z7WA 2CDEB 3TBYB 5DYOB 5IWLC 3S36H 2CLZB 3BKYL 5EZOL 5HBBA 5LQBL 2HKFH 5D7LB 4F80A 3GSNA 2EECA 4LEXH 4KDTC 4NQCD 2BVOB 5F88A 5C6WH 1DQQA 4Z0BL 1YNKH 2RCSL 4UNUA 2YRLA 1EA9C 1JUFB 5SX4H 2OR9L 5GJSL 3LB6C 3VGGA 5ALCL 4HHAB 3TVMB 1EXUA 4WFGE 2IC2A 5CLWA 3UYOD 4HS3B 4WFED 1R3HA 3D48R 3ZKSD 5DMKB 4E41E 2R4RH 2XTJE 4LLQB 1JE6A 3FQUB 5MERA 3D1MC 3FOMA 4OQ1A 4JFPB 1FJ1A 4J2XA 1XIWB 4N8CH 5E9DD 2G2RA 3CK0H 4Z76A 2VKXA 1XR8A 1MCPL 2MWCA 1EEQA 1JN6A 2OTUA 1S9VA 3H7BB 4WI9A 4HUUB 4JFYB 5D71L 2VLRA 2QADD 2VISB 3MREB 2YUWA 4H0HB 3IJYB 3OWEA 5ACMA 5DVMA 3T3PF 2OP4H 2Z35B 1V7NL 3BH8B 3O6ML 2GUOA 1MHEA 4EUPA 1U8KB 2EYRB 4HX1A 4Q2ZA 1B0GB 4F9PC 1PVHA 4JZNB 4XCEA 2WLZA 4YHKL 1EO7A 2B39A 3ZKNC 4JLRA 1GC1C 1LK3L 3HZVB 3NAAL 4LCCC 1DQDL 4Z7UB 4LOUD 1YNLL 1LEGA 5IVXF 4ACPA 2UWEB 4IIQB 5DDHA 2DKMA 2QLVB 5TH2A 4G6JL 5FF6A 4UNVA 3VFUB 4HUVB 1CFVL 3KLSA 2VDKH 1Q9OA 2Z31D 2JK5A 2BNRA 4HUNB 2W9LA 1AR1D 3SKMA 3L3HA 2OL3B 4ZXBB 15C8L 1OSZA 3SDYH 2BCKB 3K2UH 1JRHL 3JWDL 4YEEA 3CXDH 1U91A 4KMTL 3T0EE 4MA3A 4Z7NF 5ELIA 3MR9A 5GIRB 4WW1A 3BT2H 5C09A 2P8PA 1DFBH 2WBKA 2NXZB 3ARXA 3KPQB 1XF1A 1T7WA 5K33A 1YYML 2CIKB 3GSUB 2M1KA 1BOGB 4YBLC 3WS6A 3EYSH 3BN9C 1RULH 4Y0GA 1JWSA 3MROB 4YE4H 4ODXB 3DX9A 5MP6H 1CL7L 3RVWD 1T1YB 1UB6A 4Y88A 5J11B 3QFJE 4QXUL 4U33A 5I18L 1T22B 4PRIE 1X5ZA 2BSSA 4YZFF 5CZVL 3RGVB 4YHZH 5EO9A 2OZ4A 5A2IH 3SKJH 2HT3C 1MIEL 4MHHG 1ERNA 4HGWA 4L3EE 1IQWH 2CJUL 4WU5B 1IGTA 1X4YA 3P0YH 5FIEA 3H9SD 1DLFL 2XA8H 1N3NA 4LSVL 3PWPB 5JXAL 5JOEA 4R7DA 3PWUA 4O02H 3H9YA 3QXVA 4WDIA 3QUXC 3UTQB 1I8KA 4LSSL 3W11C 1ZOXA 4UT6L 4RAUB 1IGFL 2XZZA 4LCWD 1UQSB 2YZ1A 3D5OF 1BAFL 3SBWC 3NCJH 2FYYB 5KVEH 3P4MB 4N8VA 1PZ5B 5FCUH 1MWAA 3MFFA 4JG1L 4WW2F 5FKPB 1BREA 4NFBA 4MCYB 4ALAL 2IF7A 4Z7QE 3WBDA 4ZTOL 2DM3A 2EYSA 4L4VD 4M1GL 3RVXC 3TH2T 4H25B 3QDJE 4QEGA 5CJOL 2FNBA 1KN2L 1CXKA 3AS0A 3LQAL 4S0SD 1NH6A 5LAXA 1QBML 1KJ2B 4B7IA 4AENA 2VMFA 1CXIA 2X1XR 5HI4C 2BVPB 5E9DA 3DMMD 3S96A 4IS6A 1CFNA 2VXTH 4PJFE 4FFVD 1H5BA 1XH3A 2CUHA 4OJFH 5C0DA 4G3YL 3LEXA 4ZOCA 3ARZA 1NUGA 3Q6GL 5HHPA 1A6UH 1KN4H 3DYPA 4A2LA 3PQYE 1VESA 2F53E 1FDLL 1QLEL 1I9JH 4QOKD 5IBLD 1YPZB 1CT8A 4TNVF 4X7FC 2HKHL 3GSWA 3KPRE 1CF8H 2NY4C 5DR5H 4R8WL 4L4TA 3RPIA 4QRTA 2H8PA 3QO1B 4ETQA 1QBLH 1LDPH 3TYFB 2NY7L 4F57L 2UYLA 2O5YH 1VACB 3MCKB 3VXRD 2YEZB 3U0WH 1AXTH 5J4MA 1HHHA 5KN5B 3DVGB 3ARUA 4P2OB 2DQTL 1DBAH 2R29H 2X89D 4K3HA 4M02A 4OGYH 4KWUA 2MCG1 3INUL 4N0FB 4X4MA 4E5XA 3KWWA 1S7XB 4JHBA 3P9MA 3O6FD 1FNLA 2XICA 3VMNA 1I1YA 5I8OH 5C07A 2W65A 1TQBC 4U1HB 1BJMA 2C4FU 4JFQA 2AV7B 2DAVA 3RTQA 1FGNL 3C8DA 4QTIL 5ITBL 2GAZA 4RA3A 4JKWA 1CDGA 2I07A 3IXAA 5DJYA 5KS9F 5BVPH 5CEZH 3MYJA 3CFKA 2Q76B 3CD4A 1EFXD 2BFVH 3B9KD 1OTSD 5T1LA 1JTOA 3GMQA 3OQ3B 1QFUH 5E8NA 4NYLB 4W4NA 5F7HA 1FC2D 2A6IA 3O2WL 4JFEB 1S8DB 4KI5D 5HYJA 4C56B 3ARDD 1UGNA 2GTZB 3EHBC 4OZFB 1EHNA 1HILA 3DTXA 4G6ML 4V1DD 4H5SB 4WTWA 5EN2B 2B1HL 3OKOA 5CJBA 2FO1A 3ES6A 1JZ7A 3V7AG 1NCNA 1CE6B 3WIHH 2HLFC 4G9FB 3OHXA 1FO0A 1FORL 1WBYB 4NKIH 3DRTB 3NOIA 4PJBF 3D25A 3PDDA 3PUCA 3FRUB 3P2TA 3ZTJG 4WW2A 3LRSA 3KPMB 4KXZH 4OBSA 1FNEB 3RIAK 4L9LA 4Q9RH 4O5LH 4P3DB 3D18B 1T1WB 1J1PH 4M5ZH 3FAXA 1SMAA 1Q1JH 2AKRA 2VZ1A 4GKNA 4DVBB 1C16A 2VQ1B 3QUZB 5K59E 4UOW1 1VFOA 4OGXL 5AWNH 1IGMH 1KGCE 5IQ7H 4LCIL 2NY1B 2QTEA 2X4TB 2ADJB 3ARWA 3G6JB 4L9DA 4X6CF 4JQVA 3GRWA 1KLGA 4JN1H 4HKZA 4L4VA 5LBSL 1SEQH 2OI9C 4FQXA 4NQEA 2MTPA 5DRXA 3ARED 5DK2A 2MHAB 4G7YL 2FB4H 1J86A 1ZEAL 1CFTB 5T5FH 3DMMA 1I7RA 5JOFA 4C57C 4G8FB 3PHSA 4KJWD 1Z0MA 1AGBA 4UQ2A 4TTGA 4BQCA 4TVPL 4OT1H 4LBEB 1CICD 1SBSL 1U8NB 3P4OB 1VDGA 5MHSE 2O61B 1FRGH 3C8HA 4PRPB 3BKJL 3HI5L 3ECBA 4WO4B 3HZYB 2AABH 3QXTA 4XI5C 3VGDA 1GGYA 1P4LA 1D5ZA 1OWWA 1QRNA 2EDLA 1XR9A 4HWBH 4BH7B 4XPAH 4HH9A 1ZLUH 1EGJL 4NZDA 1E4JA 3KR3L 4EVNB 3CVHH 1DEEB 4KRNA 3GJEB 1C5BL 2E9BA 3VXRA 2DQEL 4E41B 3T2QA 4K3EL 1CBVH 4KRPB 4YO0B 3MOQA 4ODWB 5SWQA 1R0AL 2R9HD 2P46B 2IJ0C 1G9MH 2VB5A 4DAGH 3DHMA 5F1SA 4XCCH 2XQBH 4Y1AB 1CXEA 3O3AA 2YUVA 4OCWL 4K23L 3DARA 3QQ4A 3QCTH 2OL3L 1AP2A 5ICYA 3MRCA 2NCMA 1DBJH 3LSOB 1RJZB 5I71C 2VUOA 2PO6C 3M07A 3VD3A 1B3JA 1UYWL 1VFAB 2CDGA 5IBTH 3WKML 3FQXB 3PNWB 4PRAB 3WO4C 3UAJC 5CEXB 5BRZA 1NGXA 4HT1H 1BBJB 3V4PL 4LLAA 4HIXH 1MREL 3V4UH 4FQPA 4OLYL 4BFIA 5DS8A 3VDCA 4OQTL 1YYLH 3W0WD 1MRDL 4U6TA 3MRJA 4CJ0A 2EE6A 5CSZB 4Y5XB 5C0CE 3MLRL 1A4JB 5HGDB 1T7VA 5F3HA 4M5YH 2E7HA 2HP4A 3BP7A 4G5ZH 1OQOA 1UB5A 3CFBB 2NW3B 2YRZA 3ZYJA 5SWZA 1NSNL 1WBXB 3LAFA 5DEFB 5A3ID 1UXWB 2H2SC 4X4XA 3DRQB 3G5XA 1TPXB 3RA7H 2ORBL 4OCRH 4YC2C 2VLMD 1YY8B 2GK0B 2OTPA 4H1LG 3GMLB 4I5BA 4X6CA 4Y4KB 5DQJA 4F7TB 4LLVB 4JY6A 2WQ8A 3L3OB 5D7KE 1NCBL 3T0EB 5I1IL 5A2LH 1IAKA 2QKIA 2Q8AL 2FR4A 12E8H 4KQ3L 4L8BA 2BHUA 2CUMA 1N6UA 4G9DB 3WJJA 1LHZA 5J6HB 2C4XA 5MEPA 3K80A 3NN8A 5FGBA 5D7JC 3FRPG 5I1HL 1NCWL 1AD0A 2MNUA 4Q0XL 3LEYH 1JGEB 2FX7L 1F58L 2WBJA 4Y2DB 3L6FA 4H1LA 2IBGA 2N56A 5H2BA 3QFJB 4NRZA 2ICWB 1NBYB 2GT9A 4OBRA 1EMTL 5ACLA 2H6PB 1CU4H 2CLRA 1UM5H 2D9QB 1BIIB 1W8NA 3ZE2E 3RWDA 1EHLL 5BW7C 1HHIA 3QQ3A 4D9QD 4I3RH 3LKQB 2FEDD 3TN0A 3PHQA 1KJ2L 3MLWL 4L3EB 2EE9A 3HNTL 3UYRH 2ZG3A 1CXLA 5F93C 4M7LH 3UZQA 2CK0H 3CDCA 3DUSB 3SJVA 3CC5A 4ZFGL 1A1NB 4ZUTB 1IEAA 2LTQC 2YPVH 4TSBL 5JOPE 1WAAE 2BRRH 4HK0B 4HJJL 3D69B 1ZLWH 5IFHL 3G5ZB 4WU7A 2HT4D 3MLZH 5DSCB 5BS0E 3AS3A 3MJ8B 4TTDD 4YXKH 1OAYL 4LDEB 4PRBB 4BFGA 3SCMC 3O0RH 2X9YA 3LKSA 4JY5H 4PGCB 4NO2B 5LKNA 4NNYA 4JRYA 3C5JA 5H94A 1FN4B 3VWKB 1NC4D 2LV4A 3JWDC 5T1KD 1G7MA 4A2MA 4DOHB 3RHWF 2CSPA 4R2GB 5EO1A 5CGMA 4RCAA 5LXGL 3PIQB 5HJ3B 3QB7C 1I3VA 1IM9D 2F58L 4F8TA 4OF3A 1NMAH 5IB3A 4D3CL 1DEDA 3MLSH 3P11H 4HF5L 4UU9A 4NKQB 4WENB 5IROC 2PW2A 1FCCA 3C5ZB 2AK4D 5FKAB 3RVTD 4P2RE 5IHUL 3KPSA 1FL3A 1CD9B 1C08B 3KS0J 1ONQA 3PQYB 3VJ6A 2F53B 3GSNH 5D2LF 5B4MC 4YHOH 4AT6B 4J3VA 3TO2B 4HWUA 4APQD 1EEZA 1FFOB 3PWJA 1FZKA 3MRQA 2A9MH 4MXVF 2ZUQC 4NQSA 4PJ5E 2BVQA 3KPRB 3FCTB 3GKWH 2R39A 5HDOA 5KOMC 4P5TC 3GI9L 5GJTL 3WFBH 5I76A 3N1MC 1ZGLA 1Q9KA 1X4ZA 2WWKO 1WCBB 4HKXA 4EN3B 2AXJA 3C09B 1U0QA 4HBCH 3ULVL 3I6KA 1DBKL 3FHQA 4O9HH 5KTEL 1JPGB 1R24B 4NQXA 4UIKH 4KKCC 5HGHB 3K4ZA 4JPVH 5JO5A 1E28A 2ZOLB 1LVEA 2VZUA 3FFCE 3MNZB 3BEVA 1QEWA 3MRLA 1K8DB 1J9CT 3VFWA 3SDCD 2WWMC 1NAKH 5JMOC 3WNKA 4Z0XB 4O51B 5E24E 1AO7A 3VG0H 4NN5B 3IKCB 2J8OA 5GRVK 4L29B 2NY6B 3MNVB 4X5WA 5CLTA 5FV2A 3LQAC 2X9XA 1AI1H 5DURD 4XTRC 4IDJH 1XCTB 3LMJH 1PG7H 4NUGL 4CW1B 3UTSE 2EIDA 5DO2D 5MEQA 4P23A 4I3GA 3LD8B 4UDTA 5IJVB 1A9BA 3D9AL 5EOCH 2XKNB 1IGYB 3BDYH 3LIZL 1YMHA 3C6SB 4JKMA 1SJVA 3TBTB 4ZD3H 4ZYKB 3NIGE 3VI3E 2DQFA 2W9DH 4OIIL 2NTFA 1HQ4A 2EEBA 4Y19A 5E1AA 4LAQL 3RWHA 5F6HI 4RSVA 4PJAA 2FLBT 1RVFH 2ATPB 5DMYA 2FJFA 4YWGL 2HVJB 1S7RB 4PRHD 3MRKB 3ARFD 4QXWA 3T65B 2JB5H 2ESVB 4FFWC 4OD1L 5KJRH 3ZE0E 4HC1L 4JKPL 3DX7A 1JNLH 2A0LC 1K6QL 5IWLA 4F15B 2XG5A 3GFUA 3QDHA 1JHTA 3U4EA 3E3QC 5FGSA 1YN6A 3WN5C 5D2NA 3BWAA 4JRXB 4HMCA 1RMFH 4KDTA 3NMEA 5A2FA 5A40E 5EFIB 4MQ7B 5DMGD 2ZSVA 3SGJC 3T8XA 4OD3L 5HYSB 1UC6A 4UV7L 3TT3L 3PGFH 4XVSL 2FJGB 4M93C 3UTZB 4IRJC 4HIIA 2ZPKL 3U30B 1IZKA 3SDDC 1WGOA 5F72S 5D2LA 3QXAB 3T0BA 2YHGA 4OV5B 2IALB 1B0RA 1AHWB 1F11A 1X6LA 1HI6A 4XBPB 5KVDL 2WZPD 4F33B 1BZ7A 3CH1A 3TFKC 3OBAA 4JDVA 3KYOB 1GIGH 5EBLA 4ELKA 2SEBA 2VXVL 1U2CA 2QV2A 1DQJA 4OKDA 5D7IF 5F7EH 2F19H 4X6EB 3MRPB 3THML 2VDQL 2HRPL 4DTGH 1PD6A 5GGSB 4H26B 2F54D 1AKJB 4M7JL 1R6VA 1C5DA 2ITCB 4JO1H 1NMCC 5I8KL 3RJDA 4ZPTA 1D5XB 3L5IA 5D1QB 2Y36H 3V8OA 3VWJC 1C1EH 4MXQD 1G6VK 5DGQA 4PJXA 2X4NA 5DQ9A 4PP1C 2L0DA 3O4LD 1MWAH 4U6HB 1MCEA 5DD5H 3VXUE 2G75A 5IR1B 4ELME 4ZUSA 3TBWB 5TDOB 4YXHH 4Q6IB 4Z7WE 1YQVL 4Y4FC 3PL6D 3MV8D 1S3KH 1FNGB 5DD0H 4HPOL 1B9ZA 4UB0H 3UXFA 1AXSB 3HE6B 1A14H 4PLJD 1XGRB 4E42B 3IFPA 5DQDL 2BNQB 3CFEA 2AGJL 2GTWB 3LKOA 3SHSA 2F8VA 3IDGA 3TVMC 4U1KA 3DX8A 1I4FB 2H45A 3T2NL 2UY7A 5ETUB 4QHNA 2NY3D 3JWNC 4WHTA 4YJZL 3N85L 2HTKD 2GJ6A 3DROB 4ZDHA 3GJFH 4M7ZB 1PYWA 1XIWC 2KDGA 4Y16A 2FWOB 5IW6B 4RFEA 2VLRE 3GBMH 4MA7L 5J06A 2G60H 5C3LD 3CCHA 4GMTL 3AAZA 4YNYA 5C0RH 2A73A 2VDML 3QG6B 4PY7A 3I6GB 2BC4B 4D0DB 1DL7H 4LGSB 4KK8D 4YDLB 1I1AA 1T80A 4MVBD 1P1ZB 1CLOL 1BJ1J 1MI5D 3O3EB 1KV3A 1R5IB 2BK8A 2C4FT 3P40A 2N7AA 4XH2B 1JFQH 1TZHB 3O3DA 4GH7B 5I16B 5IEHB 4TQEL 2R2EA 1M71A 1UA6H 4IIQC 2I26N 5KSVA 3HRZB 5IOPA 2XTLA 5GRXG 3ZHDA 4JHAL 1HINL 3F7QA 5E99H 3GSXB 4KQ4H 4QHKI 2BNRE 5C0FA 5E03A 2WINA 4CL7A 4HEME 5C08D 2Z9TA 4ZXBC 4MX7A 1LQSR 2FATL 5DA0B 2YD4A 5C0ND 3HZMA 3L7FA 3KYMA 4JZJB 3DV4B 5EPMA 4MZ3A 5A2JH 2GCYA 1OW0C 5FO9A 2X42A 1AXIB 4G80B 3S36L 3HN3A 1KXQE 5C09E 2HKFL 5AD0B 5L8LB 2ADGA 2NXZC 4NFCA 4RGNE 1JNNH 3ESVF 3I6LE 1X5LA 1P7KB 1YNKL 2EDJA 1FFNA 2QR0B 5LG1A 2MSPA 1N59B 5J11C 3B2VH 5JW5A 1SYVA 2XYCA 3BUYB 2VH5H 1XF3A 4DN3H 2D0HA 5CGYD 5BS0B 1VFBA 2P5EA 4LCYB 3RGVC 2M2DA 5CHNB 1WIOA 4KK5D 5KZCB 4ETYA 1KB9J 4M61A 1XGQB 4UILH 3VXPA 3ZTJH 1AD9B 4N8CL 3FTGA 3CK0L 4DUWA 2YXFA 1UWEH 2FO4B 2YA0A 3MV8A 4OZGF 1FG9C 1U3ZA 2RBLA 1MLBB 1T7YA 4GKSB 5T33L 3RBGA 4G43A 2YXMA 3QULB 2B20A 4M1CC 2OP4L 1E4XI 3UDWC 1PQZB 3SKNB 2JJTA 4HKJA 3I9GH 2FIKA 4RIRA 1OT1A 1H9VA 3GGWB 2GITA 3UJJH 1CG9A 3CVHB 4P2RB 1VSCA 5GS3A 1PX4A 3EUUA 5GSVA 2VLJD 1U8JA 3N0PB 4KJYA 5J0BA 4QRPB 2DWDB 2CD0A 1J1OH 2DB8A 2X4SB 2DLHA 4XVTL 3QXWA 5F89B 5E9DE 2Q7YB 4PJ5B 4JJ5A 4OB5H 3B6SB 1ODAA 5D7SH 3T77A 1BQHG 3GM0A 4AQOA 4JFXB 1JV5A 1MJJA 1U58B 3EJJX 3S6CA 4PJ7F 1R5WA 4NQUA 3T1FB 3UTTB 1F02I 5CJXC 3SDYL 3CU7A 4F9LC 4OFYA 4NJAL 2IPUG 3K2UL 5DC0A 3IDNB 1KG0A 1A1MA 2YSSA 3CXDL 4YHLH 3V52H 3HR6A 1TIUA 3B4NA 4YQXH 4R4BB 5AZEH 1F3DJ 4F58H 3FFCB 4JFDD 5J1SC 4OZHB 3BT2L 1DFBL 1EJOH 4XCYA 1U92A 1N5AA 1BQHA 3GMRA 3N06B 3MZGB 4G7VL 4L4TE 3EYSL 5BQ7B 1GRWA 1S78C 4PJ9D 3KHQA 5MP6L 3ULUD 2ENYA 4KU1A 2J7LA 3X12A 4P2OC 4JKLA 3B3IA 4NWTH 5B8CA 1GZQB 4X4ME 3OKYA 4L5FH 3UTSB 3LQZB 1P6AB 2BJMH 4YHZL 4JO2L 4ZNEA 5C07E 4EDXB 5BOZG 3SKJL 5E1HB 2GY5A 1QO3B 3W9EA 1LO4H 1LEKB 1IQWL 3OKKB 1MVFA 3NCFB 3P0YL 3OR7B 2XA8L 5F1IB 3LOWA 3PWVA 3NCYS 1A0QH 4O02L 5CIPA 4PGDA 1DE4A 3KVQA 4LARH 1MCWW 1I9IH 4LHUA 1LNUB 2NXYB 3VRIB 2R23B 4PLKC 3DVNA 4YDIH 2GJZB 3ARBA 4GSDH 2HJFA 4JFHD 1G84A 1XGYH 2L4OA 2VZVA 1Z9MA 5HYJE 2Z4QB 3R8QA 1A8JH 3NCJL 5EWIH 2B1AH 2WP3O 2DTMH 1OVZA 1NCCH 1RPQA 3OGCB 3ULVC 3ARTA 5ADPH 2HJLB 3IETB 3QI9B 4OZGA 3HI1B 1RK1B 2HT2D 4XP9H 1D5BB 1QFWI 3BMWA 3VGHA 5EU4B 2X4QA 2VLKD 4NHUA 1JNJA 3EFFA 2C5DC 1CTNA 4Y5VB 3GBLA 5ID1B 5IBUG 1I7ZB 4U7SA 4PBWD 3B2UD 1MCDA 3LZFH 3S3JA 4H1LH 1R3JA 3HAEH 4BH8B 2QSQA 4R7NA 2V17H 2H3NB 1QSVA 1S9YA 1NGZB 5GGRB 2XFXA 5F7FA 1MCNA 1F6FB 4OJFL 1A7RH 1UKQA 4JO4H 2FEEI 3F12B 2FJHA 3PXHA 1A6UL 1KN4L 4KUCD 5I73B 3V0WH 3EDFA 1I9JL 3QUZC 1V3MA 4KJPC 1I8IB 5HHXH 2NY1C 3LVEA 1T1XB 3L3GA 5CWSA 4GAYA 4L4VE 4F7EB 4C55A 5BJTA 5DR5L 1T3FB 5I66A 1YN7B 35C8H 4JAMB 2PO6A 1QBLL 4NQEE 4U1JA 3RWJB 5K9KB 1LDPL 3QWOB 2O5YL 1UM4H 4N9OB 3U0WL 1AXTL 2JLLA 4YPGA 1DBAL 3S4SB 2XOTA 3VXUB 4Z7OE 4ZUVA 5I8OL 4LLUA 3DLQR 2H32H 3JTSA 3TIDA 4KHXH 4R4NC 3RWIB 4Z7WB 2CRYA 4IHOA 1XF2A 1G9EA 3T4YB 5HYIA 2NZIA 4X7EC 3GSNB 3FT4A 4WO4C 1QRNE 5BVPL 5CEZL 4MNHA 4EDWH 5F88B 2BFVL 2FRGP 1DQQB 2X4PA 4R0LB 1CQKA 4ZPVA 4QWWC 5EULV 3IFLL 5F7KC 2V7NB 3CLEL 3UX9B 2ZOKB 5IMOB 1EH9A 3EZ8A 4P9MH 1X5JA 4AL8H 5A1AA 3WE6A 3VXRE 3H6JA 4HUWA 3WDJA 4N5ED 1YJDH 1P7QA 2NW2A 4KRPC 4P46B 5DD3H 3WIHL 4FP8H 4NKIL 2DBLL 2G2RB 3IDMB 1YEDA 1MELA 4LVNB 1JN6B 2OTUB 4O58H 1K3ZA 2QSTA 5CD5D 2VLRB 1BLNA 1ROWA 4OSUH 4JQIL 3IU4H 1OL0A 4Q9RL 4PRDA 4O5LL 3JWOH 5BRZE 1U8PA 4HFWA 5BW7A 2MQ0A 3QR2A 4KAQH 2R8SH 5IW1A 4M5ZL 4R4FH 1JVKA 2YK1H 5K9OB 2GSGA 1Q1JL 3Q48A 4XCEB 2KH2B 3VXTA 5DUPH 5AWNL 1IGML 5IQ7L 1FZMA 3K3QA 3D85D 4Y5XC 1J7VR 3L7EA 3CZJA 3FO9B 3T2PA 1RSFA 2FH6A 2A1WL 4JN1L 2DQCH 3P73B 2W1NA 4AMKH 3QAZB 4U1SA 1SEQL 2C3VA 2VLKA 5SWZE 3MV9D 3CXHK 5DJAA 1Q9OB 1CK0L 1SJEA 2FB4L 2ZG1A 3MA7B 2BNRB 3SCMA 5T5FL 1TPXC 1J87A 1I9EA 4X6CE 1OSZB 2AJUH 4Y4KC 4U1LA 2UZIH 5E6ZA 4KROD 5GHWH 4GG6A 1FNAA 4EIZC 1U91B 1F3JA 2CR6A 4OT1L 3O8XD 5GSRB 3T0EC 1PKQA 1FE8H 4D9LH 3MR9B 3QQ9C 3RRQA 3NA9H 4JR9H 4EI5D 5JIPA 5B3JF 2AABL 5HHNA 1OGAA 1U8MA 4AG4H 1YEEH 1ZE3C 4RGNB 5F1OB 2YN5A 2VR9A 3OR6B 2VERN 4WY7H 1A7OH 3DX9B 5A16A 4HFUH 4XPAL 4Y2DC 2DM4A 2JIXD 3CVHL 1G7LA 4HK3N 2V5YA 1NGPH 4Z9KB 3U83A 4HDIA 1XF5A 5EO9B 4Y89A 1NBZB 4ZUUA 4BZ1H 4LKXA 4NC1E 2B0SH 3TZVB 1WSST 5JIIA 1ZLWK 4M00A 3RY6A 2Y5EA 1G9ML 2X1WL 4MD4B 3RWFA 3SJVE 3NTCL 2F74B 4P5TA 3LKRA 1MCBA 1YMMD 4WDIB 3QCTL 2VL5A 4N68A 4HV8A 1DBJL 1ZHNA 3QNYA 4M6NH 4ODSH 4HQQH 4WTXA 4XNQB 4NQCB 2PCPA 2WQRA 3RKDD 2CO6B 3VU2A 3K2MC 3IDJA 4HT1L 1FP5A 4DCQB 4HIXL 1UT9A 4RFOH 3V4UL 4DK3A 2EIZB 1MWAB 4PP2A 4X0KA 3MFFB 1Q72L 4JRYE 3O9WD 4K8RH 4ZO9A 4YX2L 4OAWA 4X6FB 1EUTA 1EO5A 1WZMA 3VWKC 2EYSB 4WV1B 4HK3J 5I1KL 1QLRA 1CDBA 4OZIA 1OAUL 3MYZA 4M5YL 3OSKA 3P0VH 3QUYA 4S1DC 5D4QA 3SPVB 5LAXB 3TPUA 4DN4H 4R2GC 4N8PA 4G5ZL 2OM5A 4AENB 4PTTB 2EDQA 3EO1B 3L5WA 5E9DB 5MEND 3S96B 2FDBP 3LKNB 5HPMB 5FV1L 1QSEA 2LU3A 5JORA 4N9GB 1DUYA 4AK1A 5F7WC 3KPOA 2XIDA 3RA7L 4CMMA 4OCRL 5C0DB 3QHFH 3ZYZA 5KANI 2D0FA 1A9EA 5HHPB 1BJ8A 3C5ZC 3T0WA 1WV7T 5GRZA 2AJYL 1EX0A 3KPSE 5FM5O 3ZSSA 2F5BH 4KTYA 4ZQKA 1QPPA 2JB6B 3CH8A 5E94A 4YHMH 2CXGA 4CDHA 12E8L 4JM2A 1S7UB 2JTDA 5DFWH 1BQUA 2DWEB 2NY0D 1OAKH 3FOLA 4MA1B 5I0DA 2Q8BH 4GW1A 1J8HD 4L4TB 4QRTB 5TQ0H 2H8PB 3LEYL 5CKGA 3MO1B 1TDQA 2YR3A 3ARPA 3AMKA 3BKML 4PV9B 4EN3C 3C09C 5L88H 4NRYA 4GO6B 1G7PA 3MV9A 3O4OC 3VFNA 4DUVA 2ID5A 4PJEA 1FVDA 1RZGA 2BVUA 1GGBH 4KDWA 3WN5A 1KOAA 5FOBB 3MRNA 4I3RL 4XP6H 3TNMA 2C3GA 3KDMB 5GGVH 5GRYA 2LU7A 4JFQB 3AXLA 3H8NA 2APBA 3UYRL 3F7RA 1D6VL 1AO7E 3C5SA 2C1PA 4M7LL 2ICEB 2X4UB 3G5YB 2CK0L 3SGJA 3IXAB 5HHOD 1ZHLA 3NPSB 4LU5H 4NN5C 7FABH 3MYJB 2PTTA 2Q3AA 3TCLA 3CMOH 3CFKB 2NY6C 2YPVL 4Z7UF 4Z8FH 1F6AA 2BRRL 5T1LB 3LN4A 2UWEF 1D9KD 3GMQB 5MEOA 1JF6A 2HTLC 2IBBA 1A64A 1MLCA 3MLZL 5E8NB 5FA4A 4U49A 1HWGB 4YXKL 3HG1D 4MDIA 2EEAA 4PJGA 1H3GA 5ALBH 2CRMA 3DHJA 5E95B 1HILB 1ZA3A 3LD8C 4FXLA 3LDBB 43CAB 4GT7A 4JY5L 5IEKB 4PD4K 2D31B 3GMNA 5I1DB 1UKSA 4Y19E 5DT1H 2PNDA 3QEHA 1FO0B 3OJ2C 1YC8A 4P2YA 1AFVH 4WUKH 5L0QC 3MRDA 1XT5A 4P48A 4PJAE 3X3GH 2AW2A 4RNRA 2UVFA 1NMAL 2YRPA 3EIFA 2YA2A 3P11L 1I8MB 4L9LB 1YMMA 5T3ZE 3SDAD 3SE3C 2J8HA 4HKBB 3GHEH 3BH9A 4R6UA 2DQJH 2K7QA 1TJGL 4LCWB 2AKRB 4GKNB 5DYOA 4F15C 1I1FB 4A6YH 5ICZA 2R56H 3GSNL 5D2NE 1RJCA 5D7LA 2DLEA 4HEPG 3ZHLA 4PJHB 5SX5H 3MUHL 4L4VB 1FGVH 1K4DA 1JUFA 1HH6B 3IGAA 4HHAA 2YPKB 3TVMA 3NVQA 3QBTB 1RUML 3MLXH 1NCUA 5DRXB 3U30C 5J13B 5D2LE 4HBCL 3N50A 4GMSL 5I1CH 4O9HL 4HZAA 4ENED 1RUAH 3DMMB 4U1IB 1I7RB 1WEJH 2DMKA 4N90E 1AHWC 5JOFB 4UIKL 2AEQH 4JPVL 4LLQA 5EUKB 2VN7A 4ERSL 3FQUA 1X7QA 4XWGH 1L0XA 4JFPA 1AGBB 4UQ2B 1YEHL 3MV7D 3NGBB 1FHGA 4WRLA 1RUPH 3C2AH 1CQYA 4ZFFA 3H7BA 3VG0L 3IJHB 3ECBB 3HA0A 4KPHL 2VISA 5C6TL 1D5ZB 4GBXD 1KELH 2F8XC 2PXYD 2R2HB 3SO5A 4NQTA 1IMHC 2VE6A 3K8KA 2FD6H 4PJXE 5D1QC 2Z35A 1AI1L 2DQHH 3UZEA 3BH8A 4HH9B 4IDJL 3LMJL 1U8KA 2EYRA 3E8UH 1PEZA 5L8KB 4RDQF 4JZNA 3S5LG 4FTVD 5EOCL 3VXRB 1Z9OA 4LRIC 2VWEE 4DGIH 4WFHD 3BDYL 4Q6IC 1OB1A 4TYUA 2W9DL 5SWQB 1N0LA 4IIQA 1GOHA 1UH2A 1YPZF 1ACZA 3HE6C 3F6IA 4MJID 4MS8D 5JPNB 4HUVA 5GISH 3O3AB 3UJIH 1RVFL 1AP2B 1JPST 5FO8A 5ICYB 1BPVA 1NBVL 3ZLQC 2OL3A 4ZXBA 1N26A 3GJFK 5CMAA 3GM8A 3S5LA 2CDGB 2JB5L 4RMUA 2BCKA 1CGYA 3B9KB 4WNQA 1NGXB 5KJRL 1JNLL 1MCRA 5DS8B 4FXGB 5E2VH 2DLFH 5FYJE 5C9KA 3MA9H 2GJ6E 3ARGA 3ARDB 4RX4D 3TYGH 3IDXH 3E0GA 4PG2A 3OKLB 3T4AA 4XWOD 2EXYC 3KPQA 4M7ZC 3RVVD 3LB6D 4V1DB 4TSAL 1RMFL 3GSUA 4JQXA 1BOGA 1OAZH 2IMNA 3QP3A 5DK0A 5F3HB 3BE1H 3DVFA 4LMQE 4ODXA 2LABA 2H9GA 4F2MA 2ARWA 3OG6B 1J12A 2APWA 4P2CG 5SWZB 2MFNA 3PDOB 2E7LA 3BD5A 2N4IA 3CFDA 1LGVA 3K0WA 1HNGA 4HBQA 4I0PD 4UAOB 1WLHA 1RZJH 2VNCA 5DQJB 4YDLC 4NFDA 2NY2B 1GIGL 3QDGA 4WU5A 4JY6B 3ZYIA 2O5XH 5J6GB 3FQTB 3SDAA 4POZC 2QKIB 4GRWH 2FR4B 1QACA 1FYHB 3ULVF 5LGJA 5F7EL 3RZCD 4YHPB 1YQ2A 1UWXK 4GQPH 4X5XA 3NN8B 4DTGL 2GEEA 1MCOL 5GGVY 4HD9A 2EZ0C 1TETH 1E6JH 2C1OB 1ORQA 4RAUA 4JO1L 1AD0B 2ARJA 3ZKND 2Y36L 1UQSA 3V0VB 1C1EL 2WBJB 2FYYA 4RISH 4H1LB 4J3WA 1MWAL 4UBDD 1M7DA 3P4MA 3TV3H 1PZ5A 5DD5L 1FVEB 2GT9B 4XGZA 5FKPA 4JZJC 4NUJA 3AREB 2QQKH 3IS1X 1HHIB 4N0CD 3QQ3B 2RGSA 5HI5C 3M1BA 2FHBA 2NY5H 3Q1SH 1S3KL 3NBNA 5DD0L 2H1PH 4LNRA 4UB0L 1KJ2A 1L0YA 1A14L 2BVPA 3BGFB 5L2KA 3CC5B 3G6JF 1CICB 4DGYH 4KVNH 1AR2A 4ORGA 1FIGH 5CJXA 4PREA 3FB7A 2ZUUA 5FAAA 2PXYA 3FN0H 2EICA 2P5EE 3VFTA 3TC9A 3QHTC 1MRFH 3V2AR 1ETZA 4GRMB 3LKSB 8FABB 4OV6F 5JUEH 3VRLF 4JRYB 3U1SH 1FVCA 3C5JB 4B41A 2W60A 3TESA 4NGHL 3MTRA 1G7MB 1VPOH 1TITA 3EZJB 4MD0B 3ISWA 3MV8E 4IOFD 3MRIB 3QO1A 5DXWA 4MAYD 5CP7B 3MCG1 3GBML 5HI3C 5F8QC 2HT3D 1VACA 3K1DA 3MCKA 2YEZA 4ZODA 5J89A 1KTLA 1Z0NA 3DVGA 5D96B 1HWHB 1KENH 5IB3B 5ICXA 3JTTB 4N0FA 5D6CA 1S7XA 4LPCA 3O41B 5JQ6H 1TZIB 4C58B 1DL7L 2EC9U 3S36X 2HWZH 1M6OB 2AV7A 5A43C 3KPSB 1FL3B 3NIDE 1WT5A 3OKDB 3QUXD 3W11D 4HW6A 3VJ6B 5I1EH 2Y25A 3Q5YA 3AS1A 3QNZB 4CVZA 2HFEA 3PWJB 1FZKB 3MRQB 1NCAH 5D1XA 3JSSA 3VE0A 1UA6L 4JO3L 1HHGB 5FYKE 5I17A 2BVQB 3DUHA 2XPGB 1G9MC 4KQ4L 3U4BL 4NYLA 5I76B 4JFEA 3ULUH 5AYQA 1Q9KB 3MXWH 1I1CA 1BOYA 3K4AA 4HKXB 4Y5YB 5FUOH 3I6KB 4H5SA 2VSDA 4NQXB 5C0BD 3MBED 5DZLA 4X98A 1CE6A 1E28B 5JO5B 1FO0L 2AJXH 1R3IH 1LE5A 1WBYA 1QEWB 1MFDL 4K55A 3LS5H 4MQXD 2OMBA 5KAQF 2QHRH 2E6QA 3QWRD 3FRUA 3OPZH 3VGAB 3WIIH 1MJ8H 4QRRD 4K3DH 1FNEA 3RZCA 2DOCA 3D18A 1ND0B 5FK9A 1T1WA 2UY6A 3B2VL 4FMKA 2VH5L 4DN3L 1KIRA 5D9SA 5DJXB 4ZNEE 5IKCA 4P23B 4XC3L 2VQ1A 3QUZA 4RRPG 5DI8B 1A9BB 1RIHH 3GRWL 3QUKA 2ADJA 5EC1B 4UILL 1YMHB 4KKNA 1MFBH 5FGRA 3UBXI 5SWSD 4U0RB 1N8ZA 3L9RA 2NTFB 1HQ4B 2BVEA 4Y19B 2OJEA 1MNUH 1E4KA 2DYPD 3U48A 1UWEL 5M94B 1T0MA 2EO9A 4YDKH 2NXYC 3L3IB 5FM5M 3S34H 3G08B 4PJAB 5B38G 4CMHB 5I1JH 1E0OB 4LPXA 4G8FA 2NNAB 2PW1A 1AGCA 1JMXA 3DX7B 3SOBH 3UJJL 1BHGA 4LBEA 4OZGE 2NPLX 3LRGA 4J23A 3EO0A 1ZT7B 3QI9C 3AROA 1JHTB 3QDMA 3U4EB 5D1ZA 2O61A 4PRPA 2J8UA 5D2NB 4BQ6A 4WO4A 3HZYA 1A1OA 4Y5VC 1J1OL 3VXOB 3NABH 5B38A 1IEHA 2EXWD 2ATKB 1WQVT 1NFIA 5AZ2H 5T1KB 4OB5L 3T8XB 4MB3A 1N4XH 5D7SL 3G9AB 1YEJH 5GPRA 3SGKC 4HIIB 3EJYC 1DEEA 3W5MA 3E1F1 2HLFD 3KLDA 5EZIH 4W6YB 3X11A 1U41A 1IM9B 1RZ7H 1B0RB 1L6XA 2A77H 1F11B 5FHBH 3H9ZA 5I73C 4YQXL 5JXED 4ODWA 5AZEL 4ELKB 2V9RA 5L9DH 1CFBA 2SEBB 4F58L 1NGWB 5D8JH 5F9JB 4NKDB 2EO1A 2IADA 5F97E 4PLNC 4Y1AA 4M6OH 5KSBB 1A6ZB 3O2DA 5TJWK 1RJZA 1A2YA 4APQB 1BVLA 4HPYH 3GNML 1SVZA 3GIVB 3PNWA 3G6DL 4L3CA 1NFKA 4PJXB 5IP4A 2X4NB 2VRAA 5DQ9B 5C70A 1BBJA 3O6KH 1SM3H 4XCFL 5F96H 1RZFL 4NWTL 4L5FL 4WTZG 2BHZA 2BJML 1PBYA 4ZUSB 3F62A 1LO4L 5CSZA 3SKOA 1A4JA 5HGDA 5HD8C 1FL5A 5C0BA 5L7XL 3MBEA 3JVGA 3BIBX 4L3AA 1D3CA 1LE9A 1EPFA 4LARL 1I9IL 3SDCB 1WBXA 4LLDA 1CN4A 4YDIL 5DEFA 4ESKA 1ES0B 2KZWA 4GSDL 4R0LC 2R1YB 2DD8L 2FIRT 3QWRA 1XGYL 5T5NF 3BZDA 1ADQA 2OR7A 4FQLH 2Y06L 2GK0A 3GMLA 5EWIL 4Y4KA 1MFCH 2B1AL 4F7TA 2DTML 4LLVA 4ZO7A 3T0DA 4XI5D 3WNNA 2CH8A 5DURB 3N1QC 2NZ9D 3ZT5A 4NBZB 5ADPL 3B9EA 4XP9L 4P46C 4G9DA 3QPQC 4ZDHB 1MVUB 2A6DA 3HB3D 4Y16B 1NUDA 4EQ3A 4G6AC 4OM0H 4LVNC 1QHOA 4G6FB 5IQ9B 1JGEA 1KLUA 4RFEB 4X6DA 1MFEH 4Y2DA 3EFDH 2ICWA 2MQ3A 3CCHB 4FRWA 3AAZB 1NBYA 2ICWJ 3HFMH 4YNYB 4KHTH 1A7RL 1FCGA 1BIIA 1S5IL 4JO4L 2A73B 3LRHA 2RR3A 3IT8D 4MJ6B 1I1RA 4IOIA 4PRHB 3KJ6L 1KCSH 3OKEB 1I1AB 3V0WL 3SE9H 2FHCA 3I3BA 2XNAA 1C7TA 5HHXL 3DUSA 4HCRH 7CGTA 3RGHA 2VDNH 2N7BA 4O2EA 1UCTA 1KC5H 5HVFB 3UAJD 3O3DB 2C3HA 1T5WB 2R2EB 4OZ4A 1QTYT 4HK0A 35C8L 2VLKE 4X5LA 5KSVB 2APXA 3QAZC 4Y4HA 5IOPB 2FECL 4YFDB 5DUMH 1UM4L 1FFQA 3MJ8A 4KDVA 3BD4A 4PRBA 3QUMH 4ODUA 3IB4A 5F3BA 1BWWA 1X5IA 3DO7A 1KFAH 1TJHL 3KLHD 4GG6E 2DKSA 5EPMB 4TOYH 1CGUA 1FN4A 3WV0A 2GCYB 1PKQE 4KHXL 5FO9B 5BZDB 4P4RA 2DL2A 5CJ8A 1L7IH 2H2SD 5HDLA 3MUY1 4OIBA 1RIVL 4A6YB 1OGAE 2ADGB 1P6FA 5K59F 2R0WH 3WS6C 4RGNC 3Q2CA 1MQ8A 4EDWL 4ZMAT 1M1SA 2EDRA 1REIA 1DSFH 1Y6MR 4UV4H 1CI5A 4X7DC 1PLGH 1NJ9A 2F54B 5JW5B 3VFVB 1XF3B 3C5ZA 4PJIA 3CU1A 1VFBB 4AL8L 2P5EB 1C08A 1ZGLM 5D7JD 3JV6A 4XX1G 5EU6D 3O4LB 1YJDL 3P4LA 5CSGA 4AT6A 4KV5F 3TO2A 5DD3L 4FN0A 1PG7W 4H20H 3VXPB 3TZVC 1AJ7H 2AQ1A 4FP8L 4XPGH 3L5XL 1ZTXH 3ZDYE 1NGQL 2GIYA 3X17A 1ZVSA 5DC9B 4S1RH 2ZUYA 3MV8B 4O58L 4XNYH 1QQDA 1YEIH 2C3WA 2WNGA 3QCVH 5E2TL 4NQVA 2FLRT 1DN2A 4OSUL 1AGEB 1WCBA 4EN3A 3IU4L 4JB9H 4ZAKD 4G43B 1JPGA 4GLRH 3JWOL 1RZKH 2UUDH 1R24A 4BK5A 2HMID 3TCXA 5EU7C 3DXAD 4NO0D 5GZOD 3PV7A 4KAQL 2R8SL 3QXDB 4R4FL 2ZOLA 2YK1L 1NFDB 4HKJB 1HYRC 5DJ2A 5I30H 4H0GA 2FIKB 4OKVA 3MNZA 1WJ3A 5DVOA 3MUGA 3V4VL 4IEFB 1CG9B 5DUPL 2P5WA 4Z0XA 4WV1C 1U8JB 4OZIE 3IKCA 3FAWA 2VXQH 2NY3B 2EIEA 4N0YH 4QYOA 5GS2D 2PYED 5IIEA 2APFA 2DQCL 2GSIB 3PP4L 4AMKL 5ISZD 3VGFA 4JJ5B 3WLWD 2H26B 3WHE1 1BM3L 1QSEE 1XCTA 3KPPB 4HG4K 1JV5B 1MJJB 1UJ3B 2HG5B 4UINL 5IJVA 1MJUH 5F7NC 4JDZA 4LFHG 2HN7A 3GSQA 1IGYA 1A1MB 3BZFA 2YSSB 3C6SA 5GHWL 3TBTA 4ZYKA 2J88H 1FE8L 4D9LL 3P9WB 5B39G 1F4WH 1ZVYA 4JR9L 4XCYB 4KFZC 1DLHA 1N5AB 4MA1C 4AG4L 1BQHB 1YEEL 3GMRB 1UXSA 5JHDA 1NANH 4HMDA 1WC7A 1P4IH 1S7RA 3MRKA 5E00B 5JHLL 1I3RB 1A7OL 2X6MA 1I85A 3L3DB 4HFUL 1U42A 1CDIA 3D3VD 2ESVA 2IMMA 3SE3A 3VFGH 1CDHA 3MV9E 4G8IA 5B8CB 4ODBD 1NGPL 3E3QE 3NIFE 4PJEE 4KKAC 3BPCA 3WXVH 5KVGH 2AI0H 4YXLH 1AR1C 4G8EA 4PGEA 2B0SL 4JRXA 1QFOA 5JW3H 4QNPF 1J18A 1IQDA 4GS7B 1WTLA 4P4KD 1XEDA 3NPSC 3ROLA 4PGDB 5F9AC 4POUB 3H9HA 4U1GB 1DE4B 2JELL 2VJXA 3AGVA 1NLDH 1B4RA 4WI4A 2HA1A 4ODSL 1UJTA 3ARBB 3QXAA 3GIZH 4OV5A 3O3BB 1CLZH 5E6IA 4F33A 4PJGE 5ESVB 2AJSL 2I27N 4RFOL 4ZFOB 1ZLVH 3RVWC 4X9BA 2H41A 3LDBC 3MLVH 1Q94B 4MA8H 4K8RL 2CKNA 2DLIA 5CILH 4BYHA 1YA5A 1PY4A 1BP3B 3MRPA 1AC6A 4HULB 4NHUB 5GGSA 3P0VL 4DN4L 5GRWA 1OM3H 1D5XA 5D1QA 1R3JB 1I8LC 3C8KA 4JFOA 1S9YB 5AEAA 1YMME 2WAHA 1CZ8L 5LWYH 4L9LC 3TBWA 3QHFL 1WAAF 4AZ8A 5DFVC 4LRIA 5SX5K 3FT2B 3FB8B 2OJZH 5AUMB 3RNKA 3HS0A 4Q6IA 4ZAKA 1FG2B 3ME0A 3MRBA 3IU3B 2F5BL 4NO0A 3N9GL 4YHML 4JANA 5CD3B 5D7LE 1KJ3L 5IBUB 4ZTPH 1OF2A 4W6XB 2VDPH 3HE6A 5TQ2H 1G7IA 4UTAL 4I9WE 4M4PA 1MCJA 1XGRA 3L3GB 4JQVC 5CWSB 4FFWD 2YD5A 3WIFB 1LO2H 4E42A 2Y7QA 2BNQA 2Q8BL 1TVDA 2VLJB 2D7TH 3M8OH 5TQ0L 1QD0A 3CFCH 3MRFB 3EJZD 2HFGH 2MOVA 4XHJD 3VI4F 1QA9B 1RZIB 4CADA 5J13C 5L88L 1I4FA 1XAUA 2R1XA 1UVQA 4K2UH 5ETUA 4MJ5A 5FYJL 1JIBA 3DMMC 3HPJB 1GL4B 4KKLC 5KSAA 4FFVC 4ZUVB 3H3BC 3V5HA 4XP6L 3LN5A 3RX5A 5GGVL 4YGAB 3TIDB 4IRJD 1B4JH 3NGBC 4IHOB 4QY8B 3SDDD 3I75A 5DVNA 2QQLH 5IW6A 5F9DC 4LU5L 3TWCH 1NEZG 2QJDA 3GMOB 5IBLC 3S3PA 3UTPE 5C71A 3A0OA 4TN9A 4V2CB 7FABL 2B8OT 3CMOL 4Z8FL 4JFDB 2XV6B 4JCMA 1J11A 2X4PB 4CAGA 2ADFH 5C0EB 1KF9B 2FH8A 2XN9D 3QCUH 3I02B 3I6GA 4O2FB 4K7PH 4WGVB 4D0DA 1P4BH 5EOQH 2HRLA 1K3IA 5ALBL 1DUZB 2NMSA 4ZUWB 2F8OA 2E7MA 3WE6B 3O3EA 2EC9T 1R5IA 4O2CB 4HUWB 4G6KH 1XFPA 4XH2A 2APTA 1NEZA 4GXVL 4J3SA 4PP1D 5I16A 4LPVA 5DT1L 5DD1H 5LGKA 2VDLH 1MHHB 1AFVL 4WUKL 1N6QH 3GSXA 4OZHF 3SKUD 3X3GL 4WGWB 2A83A 4GW4B 2NR6D 1KEGH 4P4KA 2DDQH 2W92A 4PJ8A 3BJLA 2P8MB 4FFYH 5IK3B 5GZNC 3EOTH 5I9QC 4PRDB 2XWBA 1YZZA 4JZJA 4NOBA 1U8PB 3DV4A 3B9KC 4BK4A 1OTSC 4BJLA 4WWKA 2OBGA 5IW1B 3GHEL 2DQJL 4XBEH 4G80A 4W4OC 1AQKH 5IFAH 4KI5C 2F9BT 2R56L 3ARDC 3OZ9L 3KYNA 2YBRA 5EORL 1FZMB 4XZUB 5FGCB 1OLLA 1KACB 3ROOB 2BSED 2QSCH 3L7EB 3LEVH 3MRRB 5IHLB 4RAVA 1P7KA 4MDJA 5IG7A 3T08A 2ZNWA 1ZANH 1FGVL 4HAFA 3NIGF 3WFEH 4U1SB 4OF5A 2VLKB 1N59A 3QEQD 5ADOH 4U6XA 3MLXL 2NX5A 3L1OH 3O45A 5DJAB 2B5IB 3K8MA 2ED9A 1XIWD 4ZO6A 4LCYA 5I1CL 1RUAL 2CPCA 5CHNA 3KPNA 5TPWH 4HSQA 1WEJL 4UAOC 1P2CB 2AEQL 4OLXH 3QDGE 4U1LB 4NM8H 4M3KB 3FL7A 1NLBL 2NY2C 4XWGL 5CBAA 2EKSB 4GG6B 3WD5L 4LDOB 1AD9A 3EYVB 1P69B 4MLIA 4P2QD 1RUPL 5FXCH 3V9FA 3ZE0F 3D39D 3C2AL 3VD9A 3WJJC 1JPFA 3MBXH 1U8HB 3OB8A 5HHNB 5IFJA 1UZ6E 1U8MB 3BZEB 2CO7B 4YPJA 3ILPA 1HKFA 3WDHA 2DI7A 3HCVA 3ILQC 2N1KA 4Q9CA 2FD6L 4HWBA 4DZBB 3D2UA 2DQHL 2WBJC 5A16B 4OLVH 3MCLL 1QOKA 2YUXA 3GGWA 4PV8A 4JFFD 3AREC 3PF2A 1XF5B 5E8PB 4DGIL 3FQWA 4ZUUB 2IQ9H 2R2CA 4TVSa 1U8OA 4JREB 4LHJB 3FHAA 4QRPA 2DWDA 2Q86B 4MNGA 2X4SA 2VDOH 5T3XE 3RWFB 4KJWC 5F89A 5L2KE 5HGGS 3LHPH 3BGFC 5GISL 5TE7H 4KVCL 1CICC 1U8LA 4JFXA 3UJIL 2VL5B 4QCIA 4HV8B 1ZHNB 2X7LB 2LVEA 3QNYB 3T1FA 2IAMD 3R1GH 3UTTA 1HCFX 3WO3B 4X9GA 2PCPB 5LVEA 3GKZA 5HYFA 3IDNA 1JTPA 5BV7H 3IDJB 3STLA 2VL4A 2C7UA 4KRLB 4J3XA 1IL1A 5E2VL 1HQRB 4PP2B 3MA9L 2HAZA 2K7PA 4RMWA 4X0KB 4ZS6C 3IDXL 4OZHA 5ID0B 3NZ8A 5IF0B 3O2DH 2Y5TB 5EIQA 1BFTA 1OAZL 1QLRB 2I60H 3QRGH 4OZIB 3BE1L 3RFZC 2XA3A 25C8H 3QUYB 4Z7WF 3TPUB 5EB9A 4JPWL 3RGVD 4E0RA 1IAII 2WV3A 3L5WB 1CGWA 2B2XH 4DZ8A 5D96C 5KVFH 4HJGB 4NP4L 1EEUA 1DUYB 3KPOB 3LQZA 4CMMB 4DKFH 1MAJA 1T66D 1RZJL 1A9EB 4B0MM 1LEKA 3OKKA 4B53A 3LPGA 5JIKA 3BP6B 2O5XL 3OR7A 4ZQKB 4OLWH 1YNTA 1NUNB 3PP3K 3HI6H 5CGTA 5INDB 4JM2B 4QXTB 1YJDC 4HIEA 1LNUA 3FOLB 2R23A 2IQAB 1E6JL 2J6EH 2Y07H 1ADQH 3D85B 5BZWA 4GW1B 3MLTB 4JFEE 4ZFOL 4RISL 1SEBA 5HVGB 4Y5YC 2VXUH 4NRYB 3TV3L 1VKXB 3QEQA 3ULVE 3MV9B 2I25N 2ILLA 1IGCH 5A3IC 3QI9A 1GGIH 2Y23A 2IFGA 3JWOC 4PJEB 1RK1A 4M8QB 1RZGB 3MRNB 3MRHA 3Q1SL 5EU4A 2HFFB 4Y5VA 2H1PL 2FBJL 3AXLB 1KBGH 5ID1A 4KROB 2E3VA 4QRSA 2C1PB 3KPLA 4KGLA 5F7DB 3VA2C 3RY4A 2OMNA 4AYFA 4BH8A 1ZHLB 2IWGA 4HXAH 1ZK9A 5CCKH 3O8XB 2H3NA 3TJHC 4UNTA 2WWKT 2PTTB 1NGZA 3SGKA 1PY9A 3VGAC 1F6AB 4DGYL 4KVNL 4P3CL 1BF2A 1HXYB 3LN4B 5JW4M 3WMSA 2GQHA 5FA4B 1MLCB 1F4YH 3EO9H 3FN0L 3MUZ1 3F6LA 4PJGB 1MRFL 4P23C 1EEYA 3WUZA 1ZA3B 1I8IA 3QUMB 1S78D 1BGXH 5F71A 2JIXB 1U3HD 5JUEL 3U1SL 3PABB 1T1XA 1T7XA 4XVUD 1OP9A 4U0RC 1VPOL 3EAKA 3NCCB 4P2OD 1YN7A 1MCQA 1ZXQA 3RL1A 3MRDB 4HXBH 3QWOA 1QFHA 1PFCA 4NN6B 4RNRB 1JYVA 4BQ9A 5JDSA 4X7TB 4LASL 3VRLE 1KENL 4CMHC 5F7MC 3REVB 1YMMB 1JPTH 3SEPA 3RUGA 3VDAA 5JQ6L 1OHQA 1D5MA 2WIMA 1CTOA 1JYNA 2HWZL 3BISA 1N64H 3RWIA 2IH1B 4PLKD 3IXTA 3KXFD 3QDME 4TTDC 4UOJA 3T4YA 5ICZB 4PRPE 4OCNC 2J8UE 5I1EL 3B9AA 2V5TA 3TLRA 4X8XA 1A3RH 2VLLB 5D2NC 4PJCB 5IESL 1NCAL 4IMKC 3O9WB 1K8IA 32C2A 1WWCA 1W72A 4HZLA 4R0LA 3GUTA 5E2WH 5J1AA 1K4DB 3IGAB 4IDLA 1JZ8A 2V7NA 3ULUL 1I3UA 1GCFA 3MXWL 2ZOKA 5FUOL 5IMOA 4L1HA 4RZCA 3U7YH 5FUCC 1HH9B 2IAND 1WTGT 2Q20A 5HSFA 4ONFH 1MUJA 4J3TA 4P46A 2AJXL 1X7QB 2HJKB 1R3IL 2QEJA 5FDWB 3IDMA 1LEIB 1TXKA 4Y1AE 1TCRB 2YPLA 3PV6A 4ZFFB 4ZOEA 1O7VA 3H3KA 4YDVA 4M3JA 4K8RC 2ITDA 4XAKE 1G1YA 1K4CB 3OPZL 3WIIL 1MJ8L 4APQC 5JZ7D 3WSQH 4L4JA 4K3DL 2VR4A 2VE6B 1XZ0A 1MEXH 1IC4H 3NH7L 1IARB 5K9OA 1J8HB 1CD0A 4OLZH 1MQKH 2A2QT 1OTUC 2IPTH 1RIHL 1DQLH 5EBGA 1OB1B 1XGTB 2VWEC 1FBIH 5C0BE 1MFBL 5GRUH 4DWHA 3FO9A 4FQ1H 5EOCJ 3VXMD 1RQ5A 5JR1H 3P73A 5EU5A 1CDJA 5IM7A 5HDBF 5C7XH 2R4SL 4YDKL 3SDCC 5SV3A 5C0AD 3S34L 3QFDA 1TTFA 5FO8B 4IRSA 3MA7A 5HHOB 3T3MF 1WISA 5CMAB 3CIQA 2MCPH 4YHNA 3S5LB 4PD4J 1U95A 4WNQB 1D9KB 2DI8A 1A5FH 1FAIH 4JM4H 3F7VA 5GSRA 3FFDA 1KEMH 1HYSD 3HG1B 3ARGB 3H7LA 4TNVK 5DO2C 4QWWD 3T4AB 2QSVA 4Y16C 5DK0B 3NABL 5KG9A 1KCKA 3OR6A 1BD2A 4X6DE 3QWQB 3OJMB 3C60D 5AZ2L 2H9GB 3Q5TA 4F2MB 1XGPA 1N4XL 4E41D 1YEJL 4KRPD 2XTJD 5EZIL 2E27L 3DBXB 1XCQB 1LO3H 1H0DB 1Q9WA 1JGUH 3CFDB 1RZ7L 4BELD 1NBZA 5FHBL 1T2QH 2VZTA 2V2TA 1RFDH 3ARFC 1I1AC 3TZVA 3MV11 3QDGB 2ZJSH 3BPLB 4D8PB 3DO3A 2OCFD 2OSLB 4XNXH 3SDAB 4MD4A 5D8JL 1Q9LB 5EUOB 3RL2A 5FHAH 3C6LD 1YEGL 2EIBA 3O11A 2F74A 5LGJB 3BP5B 2WBWB 2ICCA 4X5XB 2BNUA 4NCDA 5HHMD 1NDGB 1ORQB 4HPYL 4XNQA 5HTSA 2ARJB 4GKOA 4NQCA 3HPLA 4GOSA 2GY7B 2OXHA 2RFXB 1NQBA 5DMGC 2VXSH 1AGFB 3E2HB 5L6YH 3O6KL 1SM3L 4K71B 4NRXA 5F96L 4DCQA 1M7DB 3TH3T 1JNHA 5K9QI 4ONHA 5GRJH 2EIZA 3KAAA 2J12B 4XGZB 1KULA 4NUJB 4XP4H 5F9OH 4ODHH 4X6FA 4WV1A 2J5LB 4DOHE 5DGRA 3M1BB 1LP9B 3BP4A 1EAPA 1J88A 1B90A 4LNRB 3SPVA 1DJSA 4MLSA 5JW4Q 1U3YA 4HS6A 4PTTA 3FQRB 3EO1A 3SDXB 4I0KA 5DTFA 5L2KB 3LKNA 3QIUD 5HPMA 1IT9H 4PJHF 2BOBA 4N9GA 3IVKA 4UDUA 3MGAA 3O6MH 3FN9A 4ORGB 1DBMH 4FQLL 4PREB 3S37L 4GBXB 3FB7B 4PJIE 1KXTB 4JN2B 2PXYB 4YHKH 3VFTB 1G7HB 4MXQC 1LK3H 1ETZB 2JB6A 3OGOE 4EBQH 1S7UA 2JJVA 1FVCB 2DWEA 2W60B 3STBA 3CDGA 1MCLA 4FTVB 2UUDK 4Z7OF 5BXFA 3STZA 3GJFA 1EV2E 4OM0L 5GS2H 4PRID 4P49A 5GGTA 4MQSB 2C9AA 3MO1A 3VXMA 3VG9B 1MFEL 4PV9A 2ZP0T 1JPSH 1KTLB 4L3ED 4MJIB 5EBWA 5ICXB 3HFML 4PLJC 1LWRA 5JIHA 4KHTL 5DWUH 3MRGB 5D6CB 4QHUA 1F2QA 1D5IL 3ESUF 2Z31A 4LEOB 2JJTC 2AEIT 3A67H 5FOBA 3KDMA 4M7LT 2P5WE 3SE9L 4AM0B 1T03L 4OIAA 2ICEA 2X4UA 3G5YA 4HCRL 4CVZB 3QA3B 1KC5L 2HFEB 2NY3C 3PG2A 5D1XB 3QO0A 3VE0B 5H35A 1OCWH 2HTKC 4L8CA 1QRKA 3PGCB 1S9XA 2VUYA 5I17B 4QXUH 5I18H 1T04A 2GFBA 2OLDA 1LD9A 4UT9H 1EIBA 4QF1A 2A74A 3VWKD 1UJ3C 3QUML 1S7VB 2VIRB 2WMPA 1MY5A 1C12B 3QDJD 5CS7A 43CAA 4R2GD 1KFAL 1GYAA 5IEKA 4QRUB 2D31A 4X98B 5I1DA 4LSUH 4PGBB 3UPRB 1OGTA 5ERWB 2VN4A 3SQOH 1LE5B 1TJIH 3BO8B 4I0PB 1JRHI 4C4KO 1L7IL 3B83A 4KK8C 3TO4D 2X4OA 4KI5F 1I8LA 3H9SA 4LSSH 5JHDE 2R0WL 5FM8A 1F90H 3DGGA 1VFUA 2VC2H 1EFQA 2DJUA 4OUUB 1JYWA 1I8MA 3RZCB 1X5FA 2F53D 5ABDE 1DSFL 2ESVE 3QH3A 4UV4L 1PLGL 5FK9B 5L8JB 2CKBH 3FO2B 3EGSB 4HKBA 1NKOA 1KIRB 4ZS7H 2RB8A 1CL7I 4LCWA 5D9SB 5B8CC 5IKCB 3WL9A 1FLTX 3UC0H 2ENSA 1I1FA 1BQSA 1UKTA 3KPRD 5DHVH 4AEHL 3VFSA 4JRXE 2OR8A 1LK2B 3QUKB 4H20L 4PJHA 1JZ4A 1AJ7L 1RZJC 1I7TB 4XPGL 1N8ZB 3MODH 4GS7C 1ZTXL 3L9RB 2CUIA 4EOWH 2OJEB 2Z92A 4S1RL 4FQIH 4WEUD 1ZLVK 4JGUA 1HH6A 4U1GC 3QIBD 4XNYL 4J3OC 1YEIL 1T0MB 4FQQB 4P59H 1JGLL 2YPKA 3QCVL 4JB9L 3ARBC 5GGQH 4KV5E 3VH8G 3IDYB 4BZ2H 3EDKA 1RZKL 4U1IA 3QIUA 2BOCB 5EUKA 2LQRA 2P1YA 3WHXB 1UENA 2PW1B 1DANU 5DMIH 1BVZA 5I30L 3V6OC 1AGCB 4J3UA 2DRUA 1OP5H 3V6ZA 2NY6D 4LKCB 4JVUA 5B21A 2OK0H 1KTRL 5CGYC 3EO0B 3QISA 3QDMB 2X1OA 2Y4SA 5D1ZB 3NFPB 2J8UB 4QOKA 3IJHA 2VXQL 4KK5C 4N0YL 43C9A 1A1OB 3JBG7 1EO8H 3QNXA 5B38B 2NY5C 2R2HA 4JPKH 4NSKA 3VH8A 1JJUA 1MCSA 1NFIB 4P5KA 3BDXA 1CVSC 2WP3T 3NACH 3KLAA 3UZVB 3BD3A 1T2XA 1I9RH 4P9HH 4MAYB 1KJVA 3UPCA 1WIPA 3X11B 1MJUL 1Q0YL 3MX0A 2BMKA 2X89A 2XXCB 4JGMA 3RU8L 1Q38A 4QTIH 2J88L 3VFPB 5ITBH 4LPYA 3O6FA 5BV7B 3U2SB 1LO0H 4U3XA 1JZ3A 5DRWB 5IMKA 5JPNA 2IADB 1II4E 2BNQE 2AJVH 4HWZB 4K94H 1A2YB 1BVLB 2XZAH 5IVOA 4L3CB 1EFXA 3B9KA 2W0KA 3FO0L 3VFGL 1A6WH 5DJ8B 3F5WB 1KGCD 4G6MH 5K9JH 2B1HH 4N1HB 5GXBB 4FXGA 1VFMA 1BEYL 4W4OA 4H8WH 3ARDA 3WXVL 5KVGL 3OKLA 4TPRL 4YXLL 3SKOB 4V1DA 3D6GA 5TE4H