4R2GD

Crystal structure of pgt124 fab bound to hiv-1 jrcsf gp120 core and to cd4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
231
structure length
225
Chain Sequence
VQLQESGPGLVRPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLNSRAVISRDTSKNQLSLQLRSVTTADTAIYFCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Immune system
molecule keywords Surface protein gp160
total genus 36
structure length 225
sequence length 231
chains with identical sequence J, N, Q
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gD01
2J12B 3EOAB 2VQ1B 5CMAB 3QO0B 2GK0A 2VOTA 2R0LL 1S8DB 5EU6B 2H32B 1CQKA 5B3JE 5DXWA 3FT2A 1MCWM 3TIEA 1FE8L 4RMRA 4Z0BL 4C83A 1T1ZA 4F3FA 4MLIA 2YUXA 3UJTL 2C7UB 5J1AB 4PREA 4EDWH 2ICEB 5FGBC 2FD6H 2V7NB 4I18A 4JPVH 3REWA 2R8SH 3O4LB 4WHYH 4XT1C 5CMAA 4YXKH 5TDPB 4TNVK 4Q9RL 5F6HI 4C58B 3DXAB 3EZ8A 1MRFH 1IM9A 2OTWA 3NA9L 4Z0XA 1ZT7A 1A7NL 3BW9A 1RI8A 1YEKL 3FONA 4NOBA 4DAGH 1KJ3L 3MRGB 3JTSB 3EYOA 1JGDA 5I1DA 4LF3A 3HNSH 1YMME 4GBXA 2BXYA 3T8XA 3ARRA 35C8H 2BOCB 5D7JD 3NH7L 2COQA 4U1MA 3M1BA 4N0UB 3MLRH 1U3HA 5CWSA 4UQ3B 4QXGL 4N8VG 1W0VB 3BQUD 3QDME 1F90L 3RNQB 1DN0B 4PJIE 4PGEB 5EUKB 5ITBH 3K2UL 3TC9A 2YD5A 2UY7A 5GGVY 1UEYA 4PJGF 3KXFE 2Z8RA 4JFED 1OTUC 5CSGA 1QBML 3ULUL 2BNUA 1SYVB 1V3JA 3BRGC 3O8XA 1IGMH 2UWEF 4XBEL 4WFEE 4G8GD 1B88A 4RQQB 3G5YA 1R3JA 3CUPA 1A6ZA 2KL6A 1CE1L 1H8NA 3C60A 4WHDA 1OF2B 1EJ6A 5IIEB 4LSPH 1BD2D 4OM0H 3FAXA 2F53A 1MNUL 3ETBF 3LN4A 5EU7E 2E9JA 1I1FA 2A9NL 3MA9L 1U9KA 2EH7L 2FL5A 1MCBA 3PDOB 5F3BA 3GSQB 2FEDD 5ID0A 1S9KC 3LRHA 4NWTL 1CGYA 5HY9B 4H88L 1VADA 1CK0L 4WI4A 4XGZA 3QIUB 3V52H 4O9HH 3HRZB 4KUZH 3MGTB 1JWUA 3QUZA 1I7ZB 3RY5A 1BFTA 1CVRA 1MCFA 1LILA 3FFCB 3O6KH 3CSYB 4TYUA 5E2TL 4OLEA 3RVWC 2ZPKL 5LGKA 3QZWA 1NSNH 2WINA 2BMKA 4M62H 1QFOA 3H9HA 4NKOA 4GRMB 2A6KA 4JZJB 2WAHA 4WWKB 1YQVH 2OXHA 3RGVD 1OTUD 1MQKH 3ZE0F 4KROB 4ODTL 5DEGA 2P45B 3MNZB 3QEUA 2XQBH 2E8ZA 2FB4H 4JO4L 4L4TB 4KRNA 2PW2A 5F9JA 5HYQB 1IC1A 1F4AA 4P4KA 5CZVL 1DBAH 2W60B 4GW1A 3QIWA 4HZLB 3B9VA 4IDLA 3ULUC 5MI0B 4YZFF 1WBXA 3JV5A 3AUVA 4HSQA 4Y2DC 1C8PA 4LPWA 1NC2B 1G7PB 5T1MA 4TUOB 1EHNA 3SDXB 1R5VA 4F37F 3TV3H 1QSVA 5GSVB 5EU3A 2FEDC 4U6VH 2AGJL 3RAJH 4JFFA 5I8OL 1NC2A 1KLFA 2ZSWA 3I85A 3WDHA 1WITA 3LEVL 1PLGL 1WZKA 2C26A 3UAJD 1KIUA 1MQ8A 1PLGH 3HE6D 2V5MA 3MOBL 2Q8AH 5E6IC 4HIHA 2GIYA 3CZFB 4YPGB 1J8KA 2R23B 4Q2ZA 4HBCH 4PRNA 3MJ9A 4PB0L 2X4NA 5DEFB 3QDAA 1JHKL 3MNWB 5D9SB 3W2DH 3G6AA 5FGBA 4QHMA 1GVIA 5KG9B 4JDTL 5FYKU 1FZOA 2WP3O 1A1NA 3NN8B 1CYGA 2VMFA 3DRQA 1D6VH 3QFDA 3P4LA 4HULB 5D6DC 5KVEH 1L7IL 5I1IL 1X4ZA 5GSRA 3ULSA 5GS0D 5I73B 3BH8A 4QCIA 3KYOB 3L5XH 4HHAB 5MP6H 3UTPD 1ZVSA 2GCYB 3EBAA 3E6HA 1NC2D 5E94B 3WNLA 3RVUC 3SGJC 4MXWH 4DZ8A 1YEDB 4BH7A 2XIDA 4NRXB 3SKNB 3O45B 3U46A 5TDNB 1JK8B 1RMFH 4G8IA 4NHUA 3RKDD 3T0XA 4LNRA 5ICZA 3VXQB 1Q72H 4X6CB 1ZVSB 3ZYIA 3RZWA 4NM8H 3L3DA 2Q3ZA 3VI3E 3UYPA 1SQ2N 3V6FB 3L3KA 4NQED 3T0EA 3MNZA 2CGRL 3M07A 4I2XA 1RUPL 3I6KA 4Y5XA 4H88H 2A2QT 2XWBB 1P4BL 4MJIE 3QFDB 1SYVA 4S2SB 5IGXH 4UIKH 2PF6A 5KW9L 2X9XA 1OCWL 5DJ2A 5TE6L 1RAMA 1CTOA 1NUDA 4M8QB 5E8OA 5F1OB 5HI4D 5I9QC 2VDML 1WEJH 3I3DA 5A3IC 3TBYA 5KS9A 5FGRA 1D3CA 4NQCD 5E8NA 2OZ4A 2DBLH 4OZFH 4DKAA 3NZHH 3BKYL 2O5XH 3FOLB 5C70A 3ZE1F 2DDQL 4DGIL 5HGHB 4NN7C 3BAEH 5IFHH 3UTSA 1KENL 3QCVL 4EN3B 1I3GL 3EYOB 4Y4FB 3EAKA 3T1FA 5BCAA 3RWJB 1YEGL 3O6LL 1BFVL 3PP3H 4FFWD 1A7RH 4HCRH 2IQ9L 5HDLA 3RTQB 4JRXE 2WMPA 2GTZA 4YQXH 4Z0XB 4M1GH 1ZOXA 3OX8B 3V4PL 4CU7A 2V2TA 2LE9A 5HVGB 2H32H 1AR1D 1L7TH 4FP8L 1F2XK 1F02I 4I3RH 5HYQA 1NGYB 3F7QA 1DZBA 4HUMB 3G6AB 1AFVH 4L4TA 1LE5A 1IEAA 3QEUB 1MJ8H 1YC7A 4LBEA 3GFUA 3EOAA 3K4ZA 4JFEA 5IF0A 4F57H 3P0VH 2D31B 5HI4C 4X6FB 5IBLD 1DDHB 2B5IC 1CXFA 2DKMA 3TYGL 4P5KA 4NN7B 1D5XB 2X89A 4U6HA 2ARWA 1FLTX 2P5WB 3LS5L 4KI5D 4G7YH 3EYVB 5BRZA 4ZFGH 1I4FA 3I6LD 4BSJA 1SJXA 2ICWB 5EFIA 3TBSA 3L5WB 4LPCA 4A2MA 1X5ZA 3I6LE 4MA7H 4H1LH 5DRZB 4PJEF 4QKXB 5TE4L 4NC1E 2F5BL 4PTUB 1ZV5A 4QGTA 3NIGE 1LO4L 4GBXD 3LSOA 2YD2A 5HY9A 5J9PA 4Z7VA 1D5MA 1DQMH 1MF2L 5T1MB 1S7RA 4OZHB 4XCNA 1KOAA 1M7XA 2HLAA 3AMKA 4PJ9C 1G7JB 2PTVA 5IB1B 4R7DA 3VXRB 1NGXB 1MHCA 4C83B 3MRQA 2UWEE 1J0IA 3C60B 4ZXBD 3FCTA 4XP9L 4DEPB 5LBSL 4QRTB 2BCKA 5IFAL 5K9OA 1UWEH 4EI5B 1RJLA 3FQNB 2ZKHH 5F7LB 1HQRB 3VFRB 3MV7B 3MNVA 1AGDA 4CMMA 4HQQH 5F7HA 1WTLA 4H0GA 4ODSH 2FD6L 4JPVL 1G7QB 1IGFH 4ODSL 4R2GB 4XPHL 2FZ3B 3GHEL 4X83A 2Y1VA 1KPVB 3FTGB 1KJVB 4HKZA 2Q86A 2GY5A 2VJXA 5GRZA 3D0LA 3GMRB 3QXAA 4D8PB 5A43C 3H42L 3UBXB 5BQ7B 2B39A 1G7IB 2HFFB 2EYTA 4XVUC 3RIAK 2JJTA 3LHPL 3PDOA 5F3BB 3PXHA 2X4RB 4PRPB 4EXKA 2AKRA 5DJYB 4FS0A 5JHDB 1WBZA 3GB7A 1XMWA 5HJ3B 5M95B 4LDEB 1BQLL 1QLFA 2ATKB 2NY2D 4PLKC 3MMEA 5GJSH 3GHBH 4X9GA 3MREB 3BH9B 1P7QB 3ZTJH 5C7XL 3C2SA 2P7TA 3PGCA 4FNLL 3KPRD 5TDPA 4D9LL 3GM8A 4CADA 4F2MB 1Y0LA 4HWEL 2CUMA 5IHBA 2R69L 5EB9A 2R2EA 4U1IB 4L8SA 1MF2H 2ZJSH 3LV3B 3PHQA 4P3CH 1YPZF 2AS5M 1BFOA 1CLCA 5FUCE 4WEBH 4AT6A 4IIQA 4G43A 2KDGA 5ICXB 3K46A 3P9LA 1UVQA 1FIGH 1OWWA 5IB5A 4M6NL 1JZ5A 5KVDL 1BZQK 3RIFF 5KN5A 2GW5A 3IDXH 4Y16C 3U0TA 4YHYC 1FBIH 4PY7B 2DM2A 3PL6A 3MMEB 4LLQA 1TQCC 2YKLL 4PTUA 5GHWH 1R24A 4P3DB 3TEUA 5DRZA 4Z7QE 3RY4A 4J8RA 5KJRL 3MV01 5I1DB 3RWFA 2J6EL 3DGGA 1FAIH 3J7HA 3RWCB 3TH3T 3LEXA 1KCUL 2ZCHL 5LGHL 1IGFL 3RVTC 4YJZL 2VAAA 3SBWA 4ZXBA 3MRFB 3PWJA 1CZ8L 1Q9LB 3CCHB 4HC1A 3S37L 5D7LB 3U0WH 5I1AB 4OUOA 2RCSL 1FL5B 3U0WL 1RZ7L 4HKZB 5EZJA 1U93B 1ES0A 3BMVA 4NSKA 4Y4HC 3P77B 4PLKD 2XN9D 2AXGB 3BVNA 1OPGL 1FPTL 3KXFD 1CDHA 2ESVB 4H8WL 4Z7VE 5TE4H 3O2DH 2FIRT 3D9AL 2RIKA 3AS3A 1N6QL 2AJUH 1HHKA 4BSWB 5FGCE 3RTQD 1FV1B 1YNTA 1C5CH 1HQRA 4UIMA 3RL2A 3L7EB 5F96H 2C4FU 5CGMA 2VLME 1DL7L 1U8MB 4NN6B 4YGVB 1GAFL 1CBVH 2NY2B 1T4KA 5BRZD 3KHQA 2GY7B 3MV9D 5EC1A 2X89D 4NBXB 4O5LL 2BY1A 3DVGA 3BPOB 2C1PA 4PRHB 5IWLA 5E70A 1G6RL 4B7IA 2AKRB 2XXMB 3DV4B 2D0FA 2BNQE 2EDEA 4YXHH 3WJLA 4OLVH 1CG9B 3GBNH 4PJHE 4POZD 4KRPC 1G9ML 3GSVA 5E95B 1XH3A 3ARFB 5FUOH 1KT2B 5J9PB 3WKML 4M4PA 1UQSA 5I8CA 2VQUA 4XPAL 3JV6A 1S9XB 2P47B 4M7JH 3RWEB 2B20A 5GQBA 2XY1A 1RK1A 1DFBH 3CVIL 1CFQB 4I0PC 4XP6L 1IZKA 4X0KA 5HHXH 2H8PB 4N5UA 1J0KA 5DT1H 1T1YA 1CD1A 2A83A 2DQFA 2X4OB 1JHTB 4A6YH 4ZYKB 3U2SA 5H35B 3FO0L 4J6RL 2BDNL 5DMJB 5CZXD 3HPJB 3GMOA 2HRPH 3EHBD 2I07B 4M1DL 1QSFA 4LFHG 5CEZD 2CDFB 1CGSL 3RTQC 2IAMC 1T22A 3FMGL 4U2YA 3P0YH 4G6AD 4NPYB 4PJCA 3FRUB 2RAMA 4XMKL 1H3VA 1JGUH 1EEZB 2YPLE 1AD9B 4GKZA 1FL6A 2Z91B 3MFFA 5I8EA 1K4DB 3DOSA 4QRQB 5ACMA 4KPHH 4HIEB 1LEGA 4LPYA 2QQKH 3O45A 1PDKA 4S1SL 2A77L 4CU8A 3MV9B 5IOPB 3OX8A 3VD4A 4JKWA 2VB5A 4UTBL 4OUUB 4JFZL 4BH8B 1R3LA 3SKUD 1AC6A 1EPFA 4YFLF 2C9AA 2VDPL 1A9EB 4ODXA 4HFWB 1I4FB 1UM5H 3P4NA 5IMLB 2XNAB 4LSPL 4QRRE 15C8L 2H2PD 15C8H 5GIRB 1FNGB 4LLUA 5C6PB 3HR5B 3KXFB 2IG2H 4YHNB 4Y4HA 3GBML 4P5MA 5ADOL 5EORL 3PWNA 2HVJB 5GGQH 3MNWA 2R4SH 5D9SA 3GSUA 1CT8A 1RUPH 1ZGLA 4HJ0D 4KKCD 3MRJA 1MCIA 1K9TA 1RK0A 5CZXC 1T2XA 1FNSL 1E4WL 4TUKL 1AGCA 4UB0H 1I8LC 3FQUA 4H25B 1U8KA 4GRLB 3ULVD 4G6AC 4U3HA 3QWRD 3S88H 4JANB 3AB0C 2Q8AL 3BKYH 4Y16B 4H0HB 3MXVL 1KB5H 3OGOE 4W6XB 5E7BA 5DHXB 4Y2DD 3UTQB 3BO8A 1NAMB 1T0MA 1H3WM 1FG9C 1JGLL 1VGKA 2EYRA 4Q58C 4EZMA 4M6MH 5IKCA 3I50L 1QO3A 1N3NA 4Z7NE 3LN5A 1FL6B 3QHZH 5DLMH 1G7LA 4HZAA 3QHTC 4OCSH 5DFVC 4MHHI 2VWEE 2Z93A 4F9LA 1IQWL 4X98A 4Z5RA 3NPZB 4UV7H 5GS1B 1A6UL 2DYPA 2V5SA 4CVUA 3GNMH 4XVSH 5EN2B 1FRGL 2EC9T 1P69B 1OM3H 3DI2B 1RZKC 2CDFA 5E9DA 2IADA 3QHFH 3WL9A 5L9DH 4M61A 1AI1H 2A6KB 4JZJA 2NTFB 5FUOL 2CIIA 4MWFB 5ACZB 4XHJD 3TH4T 1JV5A 3KPQA 1NCTA 4LLMB 1AFVL 3OHXA 1MHEB 3KPOB 5B3NA 1PG7W 3K4AA 4OQ1A 4QHMB 2APFA 1ED3B 4MD0A 4E41E 5DC9B 5C0GB 1F58H 2XYCA 2AV1A 5A1AA 4DUWA 3QPQD 1A5FL 1OTTC 3V79C 3H2WA 1SHMA 4YE4H 3WO4B 3ULVC 2Z93B 4OD3H 5FYKL 1VPOH 4Z18A 4PB0H 4GQ9L 3BPCA 3LN5B 3GGWB 4HGWA 3KG5A 4YEEA 4NQDB 2BXZA 3BDBA 2X1PA 1VACB 4KRLB 5AZEH 4GS7B 2VXTH 3RGVA 3LH2H 1JF5A 2XG5A 1CVSC 1UJTA 4P9HH 5DQJA 3O3EA 4HH9A 4P9HL 1IAKA 5C0AA 2YK1H 3B5TA 4LIQL 5HBBA 5IR1B 2QBWA 4TUOA 1FZMB 3QUYB 4MNQE 1SM3L 3NAAH 5HHOE 2Q6WA 1BX2A 5MEND 3IU3A 3B6SB 5LWYL 1F6AB 1HI6A 1A1OB 3GRWL 5MEQB 3WUWG 4V2BA 4G9DA 4PP1C 3MRMA 4X9IA 5FK9B 4JGUA 5BZWB 4JGJA 5KG9A 1VEPA 2O5ZH 3WD5L 4FFYH 5GXBB 1X5AA 5HGDB 4N5EC 3T77A 2ZUXA 4JHBA 5EUKA 3P77A 3TLRA 5A2JH 1VFBB 2JCCB 5TE7L 4YPGA 4QF1A 1OLLA 2EDWA 2F53D 4M1GL 2CGRH 3ARYA 1JN6A 1KIRA 1QVOA 2BOCA 5ELIA 4KAQH 1I7ZA 1A47A 2R2HA 5JXEA 2J8OA 2W9LA 1OT2A 1NEZA 1BBJA 3VFUB 3C87A 4MQ7A 3I84A 1XIWD 2GFBA 1FGNH 3LCYA 5JPMB 3FQTA 3V6OE 2AXFB 2FL5B 3BT2L 5I1JL 3O2WH 3MRRB 1F4XH 4OZIA 3L3IB 1U3HD 4N1HB 4CVXB 1TJHL 4KVNH 2AJXH 3IDJB 4FZ8H 5D2LE 4XNUH 3FT2B 1KB9J 2UY6A 3CUPB 3DX9B 1A6VL 3B9AA 4PV9B 1HHGB 3OKNA 1IE5A 2J1KA 3VXPA 5I19H 5SWSA 1GGBL 3WFCH 4N90D 5IB4B 1BAFH 5JLZA 3BPOC 5I1IH 4X9BA 4HDIA 2AEPL 4OF6A 5CSBA 2XZCH 2X4TB 3CSYA 3BZ4A 3D39B 5FYLE 2D7OA 5BW7C 1DLHB 4P57B 2DQFB 5K9JL 1BIIB 1T1YB 4V1DD 4L4TD 4M1CC 1IM9D 3MODH 3GI9H 1IKFH 4UV4H 4Y1AE 2VR4A 1FGVL 3BZDA 2XZAL 3DRTA 3IFPB 4I3GA 1KTLA 4ZPTA 5FYKE 4TSCH 2Z35A 3LKOB 3QQ9D 5I8OH 1Y18A 3Q6GH 1ZE3C 3NTCL 3WS3B 2X2YA 4D0DB 3UJIL 1FO0H 5E00A 5C0ND 2VLKB 1B3JA 4JO1H 2CLVB 3P9WB 5HYEA 3PE9A 1X9QA 4Z95L 4NM4H 2GITB 2VABA 1XIWC 1A3QA 1HWGB 1T1WB 2F5AL 5FYJL 3QQ3A 5D7LD 2HFGH 3BUYA 4XMLL 3DUHA 1WV7T 1H5BB 4XMLH 4ONHB 4MAUL 3MV7A 4O9HL 2VXVL 1KLUB 5TQ2H 3ZDZF 3OR7B 2IWGA 5EIIA 1J0ZA 1QYGH 3WFBL 1IILE 4RAHA 5L88L 3MLYL 3U30B 5HGBA 1RJZB 3ZDXE 4PJHF 1P2CB 2AVGA 1JPTH 3R06A 2P5WE 1H8SA 2E7BA 3ELAT 4MD4B 1BQHA 1R5WB 4XBPB 4L3CB 3RY6C 5B38A 4R4FL 1EAPA 4LASL 3WCYA 4LASH 4U1MB 2XFXA 4OD2B 2BZDA 2BSSB 4JPIB 4JGMA 4MA3B 1J0YA 1DBJL 2Y5EA 3TN0C 1BVLB 4W6YB 4XNZB 4KXZI 3G08A 4PV8A 4NQEA 3MRIA 3CFBB 4AMKH 5J1TC 4WEMB 3RWFB 3BI9X 2MCG1 4FHBD 3KPRB 1S78C 4I48B 3QNXA 2YD9A 2AAVA 3QEQA 1P4IL 4X6DB 4ERSL 1NCAL 3VW3H 1YDPB 3VGHA 4N9OB 3O6FD 4JFYA 3O11B 4M7KH 3VGBA 1A6WH 1L7TL 5KN5B 4M7KL 1FBIL 3HI1B 2C1OA 1MJUL 4YBLC 4L3CA 1BMGA 1T5XA 3FN9A 5A2FA 1XF3B 2NY2C 2OR9H 4BZ2L 2DYPD 1OARL 2J8UE 2D7TH 4CJ1A 3R06B 4WFGE 5LKNA 3QIWC 4AZ8A 2ITDA 2X4SB 3V6BR 4L9LA 4PGBB 5TPWL 4F2MA 2R0KL 1VEMA 4OCXH 4I5BA 4NBZB 4QRSA 1CLYH 4IS6B 4MJ5A 2VWEC 5F88B 1I7UB 3FO9A 1U2CA 5HI3D 1BEYH 3BZEA 5F6IB 1NCWL 2W91A 1JWMA 4O2CA 3V5HB 3QQ3B 1N26A 3QUZC 5DJDA 1YEIL 1KCVL 1QFUH 3GKWL 1RV6X 4PJDB 4AEHH 2AEPH 2EYTB 4YXLL 2VLKA 4HG4K 3FO1B 3PJSB 2X7LA 3KLHC 1NFIB 2NY4B 3FOLA 3UMTA 4HGMA 2DQUH 4C59B 3BKML 3H0TA 3IFNL 4G9FA 2VXSL 3F7YA 3DHMA 4U1LA 1AKJD 3O2VH 4WI5A 1LO2H 3TBYB 3RVTD 3GMLA 1MJ7L 4X6EB 5D7JC 3FFCD 4JRXA 1LQSR 1MPAL 1QRNE 5MEOB 2YN5A 3HRPA 5B39A 4KY1L 3S5LA 4Y4HD 5DJ8A 5IW1B 3KJ6H 2AXJA 3WIFB 2X9WA 1XGYL 5GS2H 5IB4A 5JLZB 2DQTH 4YFLI 4OD1L 5EUOE 5CEZH 3CK0H 2F19H 2I5YH 4MX7A 1ADQH 4E0RA 3OGCB 3QBTB 4G80A 2C3VB 4U3XA 2D7MA 1DEEA 4X6DF 3H6JA 3QDMB 5HI3C 3U82B 1RULH 1FLRL 3JUZA 2EDYA 4MB5A 2P8LB 5DHVA 3MV8E 5AYUL 1EEYB 1SY6L 2DMKA 4WTZA 2ZCKH 4M7LL 4NN6C 1MCJA 5E94A 4QT5A 3CLFL 1GCFA 3U4EA 2GT9A 1YN7A 4HKJA 5CZKA 1A0QH 4BZ1H 2I9TA 3KPNA 2P43B 3VD3A 4Y0GA 4POZC 1DBKL 2R1YB 2R2HB 3S3SA 3V5DB 4G7VL 4JDZB 4XNQA 3VFMB 4EJ1C 4FQQA 4DGYL 1OAXL 4KTEH 1BZ7B 2VDOH 4FRWA 4X6FA 3F62A 3ARDB 1K8DA 2NXYC 9CGTA 4XPFH 4G5ZH 4KZEH 1BD2A 4FG6C 4NQXB 3SBWC 2DQIH 1NAKH 3VI3F 4RFNB 4EI6A 4ZNCD 3RWIB 1NBQA 2ITCA 1N8ZB 5D1XC 1XCTA 3E3QC 3V5KB 4U6VL 2DQDH 4NNYA 3RGVC 1DP0A 1R6VA 2UYLA 3TFKD 1U6AL 1HHJB 2V2TB 1U91A 4AIZB 1X5IA 2UZIH 1D5ZA 2GJ6A 1F3JA 3QXDB 2IANA 5IEKA 3RA7H 4CL7A 2WIIB 4Z7WE 3MR9B 2XWTA 4KTDL 2VXTL 4FN0A 4IOFD 1U95A 4R96B 2FWOB 1ZGLM 3MUY1 5L7XL 4P23B 4UDTA 4JZOA 3HE7A 3DUUB 1A3RL 2VTFA 4JFPA 2KZ1B 1OP5H 1P1ZA 3V7AE 3ARDD 5LWYH 4MD0B 2UUDK 2Z31C 3Q3GA 5BVPL 4LCWA 1NBZB 3KPOA 5KVMC 4OF3A 4XPTL 2VLJA 4DCQB 1GGUA 3VWKB 5KSBB 5F1KC 2UZXB 1ZHBB 3QH3A 3V6ZA 3GDBA 1KGCD 2R1WB 1N5YH 5DLML 5BRZE 5DO2D 2HTLD 1WWAX 1SBSL 5HHPA 2JJWA 5C6TL 5IMKA 1LO3L 5JR1H 1U0QA 5EORH 5F71A 5FCUH 2X09A 1T0NA 1T6WA 5K59E 5D96C 1XIWB 5D1ZB 5DDHA 4YDVA 1CGUA 1N3NB 3IGAB 4XP4L 2VDLH 5E1AA 1MWAA 4LCUA 5GGSY 4P49A 1UB5B 1SBBA 5EPMA 3TJEH 3VXMB 4Z78A 4OGAD 1M05A 4QRRB 2Q8BL 4RZCA 4Z9KB 4TTDC 3NCMA 5D1ZD 1NAMA 3JVGA 4YWGL 4XP6H 2GAZB 1U6AH 4RFEA 1F45A 1C5DA 4JPKH 5BO1H 4FMKA 2JIXD 3KNBB 5CEXA 3RKDC 5FKAB 2Q87A 3EOYG 5HVHB 1YUHA 3UPAA 4UTAL 4Z77B 1HCFX 3L3GA 4FXKB 4EVNB 3ZT5A 3H3PH 4FFVD 1PYWA 5DA4A 4NO0B 5CILH 4GKSA 4JQIH 4Y5VA 3TNMB 4BQ8A 3BWAA 1GZQA 4O5LH 1INQA 4Z7UB 2F54D 5J3HC 3WSQL 2ZOLA 4Q2ZB 4R4BA 2V9QA 3BP7A 2ICES 3HHRB 1OAYL 5J12C 4NIKB 4P23D 1IAIM 4IMKC 3TYFB 1BFSA 1IGML 3OAYH 3WDIA 3DMMC 3SDDD 4K8RC 4AQ1B 5B4MC 1S9VB 1V8HA 5DMKB 5GS0H 4DGVL 4JM2F 3ULVL 3ULVH 2ED9A 4J4PA 1T21A 4C55A 5CBAA 3EYSH 4LHUG 3DYPA 1BLNB 5EWIH 2NY6D 5KSAA 1AHWB 1IC4L 4WV1B 1S7XB 4RIRA 1A6PA 5ADOH 5IMMB 3DETD 4N0CD 1OOAA 3S96A 1NCBH 2W38A 3MLUL 1RU9H 1S7QA 4KGLA 2HYMA 3LVEA 4PREB 4AEIL 4RGNC 1AE6L 2Y5TB 2Y4SA 2NCMA 2AK4E 1KELL 4X7EC 3IKCB 4RMSA 5TE6H 3GJFB 1NFDA 5C09D 4U2ZA 2XZZA 1Z2KA 1JI1A 2JLLA 3L5JA 3O0RH 1YEKH 4Q6YA 5DI8B 3MQIA 1GGTA 3DVIA 2MPAH 2BVUA 2FYYA 2NX5B 1X5YA 1BOGB 3W11D 4EKXA 1OAQH 2XA8L 1C5CL 4KK9C 5H2BB 3F7VB 4ZPVA 1CFQA 1IAMA 3N9GH 1KJ2A 2HJLA 2EZ0C 2GKIA 1S9XA 3VXSA 4PJ8D 3VXUE 1N2RA 4TNVF 1VADB 5DQ9B 2J8UF 2CKNA 2R1XA 4LSUH 4QRPE 5EOCJ 3CIQA 3OKEB 2FJHB 2WLZA 3CPLB 4F37K 1UKTA 5F1SA 2VITA 3AREA 5EO1B 5BV7H 1I3VA 5C0JB 4YBHA 5C6TH 2NY6C 4KWUA 5HHOB 5JW4R 1P4IH 2Y7QB 4ZUSB 1I3RB 4X80H 1VGEL 2XZQH 4Y1AD 1YNKH 3PHSA 2YA0A 5CJ5A 1TIUA 4GAYA 4XMPL 4U1JA 1K2DB 1PG7X 5EA0L 2HLFC 1YMMA 3IF1A 3PL6C 1MRFL 1U8MA 4L8CA 5KVFL 4CVZB 1U41A 4K7PX 2FDBP 2R56L 1JUFA 1RZ8B 5C07E 4TULL 2WBWB 3D2UD 3MOAL 2VDQH 4RFOL 5J11B 5DJAB 2O61A 1RUAL 1L0XA 2EIZB 1J10A 5KZCB 4OZHE 2LU3A 35C8L 3FJTA 1BM3H 4MCZA 3EYFB 4MSWA 2FBOJ 5HGAA 5CJQL 3KYNB 5DUBB 2CK2A 2DAVA 1XF2B 2EKSA 4H5SB 3ZKXC 5GS1C 2UWEB 5TDOA 3HNVH 3CVHH 4ZS6D 4JREC 1LMKA 5I19L 5IHZB 3GSRB 2M8XA 3BGMA 3WE6B 4EI5D 3P4OA 1QPXA 3CFJB 4ZDHA 5B8CA 4WGWB 5DRNB 4ACPA 4NQCA 1JGVH 1FCGA 3K2MC 3D69B 3EYUH 3FB6A 5I0DA 3MV7E 3MRGA 1GIGL 2EDTA 4AM0A 3D39D 1S9WA 2VNCA 5HPMA 5HHNA 4O2EA 1HSAA 3OKLB 1HCVA 1ZT1B 2HJFA 1JWSA 3BKCL 5C0RH 4PGCB 1KTKE 3QDJB 3IDXL 4LHUD 4PJIB 1U8IB 3QAZB 3HS0A 4Y5YC 5IM7B 5MI0C 2NZ9C 4OM0L 2VXQL 5ENWB 1CN4A 3T3MF 3D39E 2HT2C 1IC4H 4PLOB 5K9QI 3MRHA 3FN3A 3MA9H 3D2UB 4KTYA 4PS4L 1NBVH 4PJGE 2JJTC 3PXJA 4K94C 3ZKMD 3MACH 1XF5A 1YJDH 2A6DA 2P7TB 3PGCB 2IMMA 5AUMA 1F4WH 5IHUL 5DC0A 3UJJH 3DNKA 3BIKB 3PQYA 4BKLA 5IJKA 5D72H 1X4XA 5JTWA 3OJ2C 4P46C 2BFVH 1YEFH 4NC0B 1OARH 3SN6N 4H8WH 3ARFD 1BJ8A 1RJCA 1N6QH 4ZAKA 4ZTPL 3JV0A 2RHEA 3SGEI 2OK0H 2YBRB 2X4PA 4NJ9H 3O6ML 2XA8H 1F8TL 2AQ3A 4NO5B 4KDWA 3PWUB 1Q0YH 1LP9E 2VL4A 1ZSDA 2V2WA 4FQPA 3WN5B 1Q0XH 1KPVA 3VFPB 3U9PL 3MJ8A 3FT4A 2R2BB 1RUMH 1M6OB 2R4RH 3VG0L 3Q5TA 4NJAL 1HILB 3FFCE 3OF6A 4LOUC 5DJXA 4TSAL 4F15B 3WEXA 4X4YA 1MWAH 4TTGA 1LO5B 2ADJA 3LPWA 2DICA 1QZ1A 2DWEA 1NLBH 2HKHL 3IDNB 2R0ZL 3D85B 4Y19A 1OAKL 3L3JA 3O41B 4ERSH 4LPTA 1B4RA 4Q6IB 4X80L 5J7CC 3WFEL 5EH1A 3SE8H 2NMSA 1WCBA 1WAAA 4NO3A 2P8PB 3MODL 2DTMH 4PLNC 3CFCL 2WLYA 1UT9A 5DD3H 3FB8A 3WIHA 3AXLA 2Y9RT 2A9MH 3W9DB 1D5IL 6FABL 5TF1H 3QJFA 4HH8A 1Z5LA 5E2WH 1RHHB 5IFJA 4BJLA 2NX5D 4F57L 1A5FH 5EOQL 1U2HA 3L95A 1DVFD 3QT2A 4FQIL 4JJ5B 1OQOA 3JWDC 4OZHF 2JELL 3ZSTA 5C07D 5HVHC 2FX8H 4XX1E 1DN2A 5HD8D 3MO1A 3CVHB 3V7MA 4KJYA 1FL3B 4MNGA 2HFGL 3AROA 1NFKA 32C2A 4CAGA 2CKBB 4JDTH 3QEHA 2MMXA 1AJ7H 1F3DH 1KJMA 1PSKL 3R1GL 4Y4KC 2HG5B 3DSNA 1D9KA 3N85L 2XZCL 5GGTA 3QUML 3CX5J 4TPRL 3THMH 3PWPD 1MCOL 3V0VA 2OLDA 3O3BA 3OG4B 3L3OA 3QFJA 4L3EE 4M6OL 5BOZG 3RWHA 4I9WE 1CDJA 4PJXF 4PRAB 3GSOB 2Q76A 4CU6A 5L8LB 5HYSG 3B2UC 3MPCA 3GUTB 2ZUTA 4BQ6A 1YYLL 2ILLA 2HJKB 2QKIB 4OFYD 3HG1D 4P9HC 4OLYH 1OB1B 2NY4D 4ZTOH 2VL5A 2MHAB 5C0FB 3Q48A 4G8FB 4HWNA 2FJFA 3NFPB 4MVBC 2YD1A 4K9EC 1FN4A 5E99H 1MFCL 4LRNL 3BDYL 1ZLUK 1HK6A 4RWYL 3HA0A 1M7DA 3BDYH 4XRCA 4JRYB 1RD6A 1Q1JL 4NKQB 1CDGA 1A8JH 1MCPH 3CDGB 2JK5A 4PG9B 2BNQD 3E0GA 4RA0C 2H41A 5J0BA 3QO1A 1MCCA 3T2NL 3LB6D 3UTZB 2W9EL 1YJDC 8CGTA 3KVQA 3A6CL 5FECA 2DRUA 5DJ0A 1LK2A 3C5JA 2P42B 3H42H 1WEJL 1H0DB 4DQOH 4Q9QL 5DMGD 5E7FA 5DJ6B 1KFAH 3M45A 1IEBA 2Q3AA 2X42A 4QO1A 5T5FH 2DTSA 2QADD 5EUOB 3UYRH 1RUKH 3PF2A 4EOWH 1T0PB 3MXVH 3BQUA 3MX0A 1WZLA 1WF5A 4QRRD 1R3HA 4HUWA 4RISL 5IV2B 1CFTA 3U83A 4U6YB 1WSST 1TPXC 3I50H 5K9KB 1UA6H 1KLGA 1SJEA 2A77H 5IT2L 1OAYH 1U8JA 1YY9C 2NYYC 3RWGB 5T33H 2ZUQC 4E42A 4BUGA 3BP5B 5LQBH 3SGEH 5MP6L 1OY3B 3N50A 2C3HA 4M7ZB 3S4SB 2WBJC 5T5NF 2CDEA 3DMMA 3G5VA 1ULVA 4P4RA 5D6CA 5EWIL 4RX4D 4HKBA 3C08H 4HHAA 3QUYD 3MCKB 4JKPL 5FDYA 1K8IB 4IMLB 1VDGA 3VXNA 1ITBB 1PVHA 4NM8L 1VESA 1SEBA 3FQXB 3BH8B 1Q1JH 3ULSB 4LSQH 5LAXA 4LSQL 3WV0A 1IGYB 4R26L 5BVJB 4P5TB 3GJFH 1LEKA 4P2RA 1JFQH 1EO5A 1IBGH 1UACH 1L6ZA 3C8KB 4WO4B 1F11B 1FNSH 2CDEB 4BQBA 3PWLB 1TPXB 1Z9LA 1P4LA 1Q9KB 2P4AB 3D3VA 3QUXA 3TBTA 2PW1A 2PYEE 3TVMD 3KS0H 4C56A 1MVUB 5FA4B 3K1KC 1II4E 2EIBA 2XTJD 4PRIB 2VDMH 1NCNA 4PJAE 4DVBA 3I2CL 3LEYH 5MENE 2NNAB 3ZL4L 4RCAA 4JHAH 1IEHA 5CIPA 4OLZH 1V3LA 3PV6A 2AP2A 2YN3A 5A3ID 5DQDL 4HKXA 3RX5A 1IC7H 2IFFL 4JM2C 3LAFA 5EULV 2HFEA 4NZDA 4HIIA 1W72A 3VRLF 2VZ3A 3NIDF 3ARGC 3IXTB 2QR0B 5ANMB 3T0DA 3W9EB 3RZCD 5BS0D 3OKMB 3V0WH 5DFWH 1AO7D 5GGRA 5EU3B 2WBJD 1IKNA 2KUTA 4Y5YB 1T66D 3H9ZA 4E41B 3HZYA 5D1ZC 4YGAB 5HDOA 1FG2A 1EBPA 4MCYB 2BVPA 4XZUA 3REVA 3QNYB 4RGMB 5CEZL 2VDLL 2DL9A 3QNZA 4MQXD 4MA8L 4RMWA 2W60A 1EV2E 3T65A 5KSUB 2AEWA 5L6YH 1TZIB 1KB5A 5C08B 4NUJA 4UNTA 1QSED 5DEGB 2FGZA 5DT1L 1QFWL 4OIIH 4UDUA 4OF5A 3O9WA 3LKQB 4ONFH 5JHLH 3T1WA 2GUOA 5FDWB 3LHPH 4LVHB 1L0YA 4RDQG 2BDNH 1I1AD 3JTTB 2V2XB 5FGSA 3RHWK 1UEMA 4KJWC 1D5BA 4OCLC 3ARGB 2FO4A 5JMOC 2VL5B 5C0FA 2B4CL 1BHGA 4U05A 4HPOL 3ORJA 3OL2A 5E4IA 5IBLC 1PD6A 2HJKA 4YDLB 2IPKB 5BJTA 1KNOA 4ELKA 2DIJA 4MB4A 2K9UA 4LVNC 1F90H 3CSBA 5ITBL 3R8QA 3SE4C 2O26U 2BSTA 4YDIL 3RZCC 3FRPA 2VDOL 4LLAA 2YOCA 4Z7WA 5EC2B 1JBJA 5JDJA 3SKJH 1MAJA 2R69H 3GKWH 1NAML 1PGRB 1KGCE 1YY8A 3ARUA 4EN3C 1MIMH 4KKAD 3H7BB 2DOCA 3JWDL 4ALAL 4M5YL 2DLGA 2VDPH 1EJOH 4OZFA 4IRSB 1N59B 1NQBA 3C9NB 5FM5O 3UTTB 1JZ3A 2FJGA 5B22A 5CD5C 1YN6A 5C0BA 3FB5B 1YMHB 3IYLW 1DLFL 2CDGA 2YKLH 3GRWA 2NY0D 3BGFC 4WU7A 5E08L 3SEPA 5F89B 3QJHB 1TJIL 4LSVL 5I17A 3QA3B 3HUJA 4JY6B 4NP4L 4O4YH 1J11A 1TTUA 4O2FA 3IDGA 4KY1H 4XCEA 2VIRA 3PABB 4ZUWB 1FE8H 4Z0BH 3WHXA 3MFGB 3RDTA 1AO7A 3RUGB 5BS0A 4ONGL 2F8VA 1J8HE 4HAFA 4PLJC 3TJEL 3U36B 5FFLA 3KPPB 4QHKJ 5D2NE 5J89A 1AP2A 2QQNL 4O58H 1AXSA 3K81A 4XNXL 1H3XA 4R0LB 4YAQB 1CGXA 5E8PA 1EVUA 1M7IB 5F7WC 5AEAA 1U8HA 3K0WA 1KCLA 3IFOB 4L5FH 4LKCB 5IQ9A 4K9EL 1FJ1B 3MV11 1PZ5A 4YHPA 5D8JH 1M6OA 4WFFD 4PRHD 5C0NC 1GOFA 3ZKQD 3G5XB 3VRIA 4NO2A 1VFMA 5F3HA 1WLHA 3SGKC 3QQ4A 1ZT7B 4JY4A 4XPTH 3MLRL 3SO3B 3CMGA 4K94L 2NW2B 4Y1AB 5CLTA 3ULVF 5D70H 4JFDB 1HHHB 3TO4C 4JFHD 1U8NB 4TSBL 4HX1B 5I18H 4HJGB 3LQZB 1DUZA 3ROOB 1GRWA 1J05A 1MWAL 3SJVA 2IGFH 4LLDA 2ZJSL 2XV6B 1F4YL 3TA3A 2SEBB 2AI0H 1WC7A 4YIQA 3QWQB 4X5XB 5C0BE 5K93A 2I27N 5I75B 1IKFL 3GI9L 4UV4L 4ZFFA 4KJPC 1OGAA 3KR3L 1A22B 5KZCD 4DGVH 3MXWH 4UUJA 4L29B 3RWDB 3QDGA 4OFDA 1IC5L 1HH9A 2BVOA 2BSRA 2BX5A 5HDBE 3VRJB 3TT1H 3W39B 5ICYA 3L3HA 1MEXL 3DV6B 1TJIH 2YWZA 3BP4B 4WFFE 3SJVB 4OV5A 1K4CB 4FQIH 4JM2A 1DUZB 1WUNT 4MAYA 4EDXA 3ZYJA 3O3DB 3TN0D 4EUPA 4HX1A 2HN7B 2WUCL 4JY5H 2PUQT 1BBDL 3VMOA 5LGJB 2V9TA 3QIBC 3T3PE 3WUWB 1QNZL 3VFSB 1CIUA 1R3KA 5IHUH 1Z9OA 3N1PC 3TESA 5DJZA 2AJYH 5F7KC 1DANU 4O2EB 4XC1L 1S7UB 3KJ4C 3VE0B 4YDJB 1MH5A 4HFUH 2FX9L 4ODWA 3HZMB 5C0IA 4LIQH 1HEZB 3KAAA 5ESVA 1OAUL 3O6KL 4WU5A 1FO0A 3FZUC 4XAKE 1FYTD 5HVFB 2OJZH 2V5YA 1MIML 3B3IB 4XP5H 4NDMA 3B8YA 5KS9F 2G2RB 3RX8A 3HMWH 2FATH 3TJHD 2ATPA 1FZJB 4X4XB 4JKMA 1EJOL 1VCAA 2QEJA 1QEWB 4XNZC 4U1SB 1MREH 4GRWF 4KJPD 2VLRB 4I0PB 1RUML 3SY0B 1T6VN 3DARA 4YO0B 4XPBH 4AG4H 4HUNB 1AQDA 1SBSH 2HAZA 1I8KB 4JHZA 4YXHL 4HK3J 4P46D 1W8NA 1A4KA 3ILQD 5JORA 4NQVB 5T1LA 4PRDA 3I6GB 3X17A 3GMMB 4D0BB 5JW5B 1YEJL 5IJVB 4ZG1A 3C9NA 2DKUA 1NDMA 1MIEH 3EO9L 4IRJC 3AY4A 4RWHA 5C0CA 3QIBD 1ONQB 1OAZL 3SOBL 4KDTA 1UM4L 5EU4B 5L2KA 5EU5B 1I3RA 1YY8B 4FTVB 1KG0B 3RPIB 5E5MA 3MOAH 4RFOH 4ORGA 1D9KD 3IDIA 1CWVA 1OSPL 1SMOA 5I16B 4XWGL 3V8OA 3TZVA 5I76B 3UTSE 4OCXL 4ZUUA 3CLEH 3G6DL 4F58L 4L4JA 4U1GB 4QXUH 2YD7A 4K3GA 4DZBB 5J12B 3RDTC 5EZOL 3W82A 3WIIL 3NVQA 1MRDH 3NACH 1NDGB 1EUUA 3MV8D 1HQ4A 2G75B 1A7QH 3OPZH 3FQWA 3FRPG 5DD6A 3UZVB 5IT2H 1NCUA 4UUJB 4AEHL 5BMFL 4KXZH 3VDAA 1JVKA 1J5OH 3C6LA 4JQXC 4PJ7A 4JFQB 2D9CA 2APBA 1T2QL 1LP9B 1MHPL 3IKCA 5C08A 1EO8L 1K5NB 3KR3H 5IW6B 5D4QA 3UX9B 1S7QB 3QG6B 4BSVB 5GGVH 2LTQB 1FYTB 1MCQA 5HPOA 1HHHA 1DUYB 1JNNH 4AL8H 1N6UA 4N9GB 4PJAF 5DZOA 3SE4A 1CF8L 1XGRA 43C9A 5DVNA 1V7NL 1RUAH 1PJ9A 5I71B 4I0KA 2W9DH 4G6JH 4YE4L 3BZFB 5JNYB 2ZUWA 4NCDA 1BM3L 3X12B 1LEIA 3Q0HA 4MJIA 4F7EA 5D7KD 5AZEL 2YEZB 3FOMA 3VCLA 1X5HA 4UIKL 4LHJB 3U0PB 4MZ3A 4WW1B 8FABA 4QRUA 3LKPB 5KVEL 2ZG1A 5AAWA 2ZG3A 1HN1A 3CZJA 5F21B 3TZVC 1LDPL 2FHBA 4ZFZA 3HLAB 3ES6B 2XPGB 1NPUA 3U7YL 3TCLB 5JXEC 1XGUA 2EDXA 2JB6A 4XCEB 2LVEA 4ZS7H 3QULA 3DX6A 1I3GH 3EO0A 4WY7L 1HNFA 1KENH 1TENA 1P5VA 3S34L 5SV4A 2K7QA 2ENSA 3MJ9H 3NZ8B 4WFGD 4NUGL 4KVCL 5HYIA 4PP2A 3MTRA 4HJJH 3SDAC 1A7RL 4HCRL 1HXMB 3OR6B 1CICC 4L3EB 2BOBB 1C5DB 1MRCH 1WWWX 4GUPA 4LAQL 4OQTA 3H7BA 5KAQF 1GGCL 3CC5A 1MCKA 2OSLB 1PY4A 3QHFL 5D7IF 5GS3A 1UCBL 3QPXL 4W4OA 4Z7UF 4Z7WB 3FN0L 2PO6C 1NUGA 4Y2DB 3BE1L 4ZOAA 1MI5D 5EBMB 3EW3B 2Q8BH 4YR6B 3IJSB 2PCPA 2JCCE 4K7PL 4OKVB 2I9LA 3OMZA 5L0QB 3GJFK 1KFAL 1JCKA 4RRPA 4EXPX 5K9KA 2CIKB 3DVNB 4JG0L 1G1YA 4XHQA 5EOCH 1FVEB 4RMVA 4MNQA 3BHBA 3QPQC 1HSBB 4F15C 4YLQT 1RIUL 5DYOB 2PNDA 1XGPB 1S3KL 4KK8C 2EIEA 5EBGA 4K7PY 2AJSH 1QR1A 2GJZA 5LXGH 2IF7A 1I9JH 3FO2A 1YEGH 2FRGP 2PETA 1N7MH 4TSAH 2E8YA 4K3JL 4Y88A 1KB5B 4AQOA 3P73B 2CSPA 4HXAH 1Q9WA 4IRJB 3QNZB 3CXDH 5CAYB 5DQDH 4M6OH 5HHQB 3WO3B 1MI5A 1IL1A 4P2OD 1Q94B 4C4KO 3GSWB 3BYTA 2E6PA 4JFOA 1U8OB 1J1OH 3MJ9L 2GJZB 4R4NC 1CE1H 4J1UA 4ISVB 5CKGA 1CDCA 2DF3A 1MLCB 4OJFH 5FIEA 4LRNH 2YRLA 4AMKL 1MFNA 3UPRA 1Z6JT 1CF8H 1NKOA 3O4OC 2HFEB 5E9DE 3FQWB 4KKLC 2XTJC 2QQLL 4EDWL 1A4JB 3P30L 3AS0A 4U1KA 3T04D 1T1XB 1A9BA 2CUIA 5J57B 3FN0H 3GUTA 3LD8C 4APQA 4K8RD 3S98A 3MOQA 3BX7C 3FB7B 2CKBL 3VXMD 2WQRA 4XVTL 5CJOL 4F7TA 3PGDA 2JJSA 5L8JB 5D7IE 1D9KB 4H20H 5F1IB 4Z7UE 4M00A 3IXAA 3NGBC 4NRYB 5DZLA 5C0DB 4LEOA 1EZVX 3UYRL 4OF8A 3W5NA 4PJ5A 4M62L 5C0CB 2D2OA 1DBKH 4MJ4A 1F8TH 3MBEB 1FL3A 2CXKA 4MQXC 4LP4A 4BQ9A 2YXMA 2JJUA 4PG2A 5F72S 5FF6A 4LSTH 2DQCL 4MNHA 4F8QA 5INDA 1PKQA 2A1WL 2J88L 4M3KB 1IFHH 1JPFA 1MFCH 5I1GL 3C8DA 2VUOA 1I1AA 3FHQA 3TIDB 2MOVA 3BRFA 4N8VA 1IGJB 1ZAGA 2HP4A 5F7NC 3HPLB 4S10A 5KSAD 2CLRA 3ZDXF 1AGFB 4OZGA 3G6JE 4F8TA 5EBWA 4W68A 2GI7A 5C3LD 5KVDH 4J4PD 1KN4L 5ANME 1E27B 5DJCA 3D0VB 1F13A 4M7JL 4GG8B 4C54A 3TPKA 3TZVB 5ISZA 1P7KA 4QEGA 3LKPA 5GRJH 3SDAB 2FSEA 5GHWL 4GKNB 3DHJA 1GYAA 3IU4H 5I6XB 1LNUB 4PR5B 3C8HA 2FR4B 2W0PA 5KJRH 3ZHLA 3X11B 2XN9B 1QLEH 2ESVD 1IQDB 2W0FB 1BZ9A 4M1DH 2DQTL 3DBXB 3MV8A 4U1LB 2D03L 4M43H 1UYWH 3RZCA 2VKWA 3H0TB 5JW5A 3UZEA 1ZA3B 4F33B 2BHZA 3RL1A 1A64A 2X10A 1TZHB 1HDMB 4GMSH 4OIAA 1QSEB 1A4KB 5JORB 4OFVA 3BP6B 1OPGH 1QOKA 4PJCE 3RP1A 3VGEA 1A6AB 3TN0B 4UNUA 4F7MB 1QFUL 1TLKA 5FEBA 3TBWB 4OV5B 4HS6A 1JGEB 2JIXA 3VWKC 1WFNA 2ZPKH 3VFTA 3HC0A 4O51B 1A2YB 1B0RA 4C56D 3TVMA 3CDGA 2PXYA 1G7HA 5I30H 4NKDA 2ED7A 3JWOL 4NFCA 1H3PH 1KBGH 3WFZA 5E2UL 4HGKC 4JRWA 4PGJA 2DQEL 1UZ6E 3C5ZA 1MPAH 2V7HB 4Q0XH 3B9KD 1FP5A 4HV8A 2I60L 4LSVH 5I1GH 4IOIB 4P46A 4F7PB 5FV2A 4ZFOA 4DZBA 5C0EA 5H37G 3RWHB 1MCPL 4WHCA 3ZTJG 4R90H 2Y06L 3UTTE 3V7AG 5HYJE 1CZ8H 1TJGL 1MIEL 3EO9H 1DQQA 4JZNA 3T0AA 3N1MC 3KPSE 5HYJD 2I5YL 4ZAKC 5HHNB 3VRIB 3BEVA 4Y5VC 2EYSA 4OTXH 4DAGL 3ROLA 3HE7D 5AZ2H 2YC1B 5SWZD 4DQOL 5F7FA 4PR5A 4NQEB 1I1CA 4LQFH 4U1NB 2IBGA 5F8QC 1XFPA 1MCHA 4JY5L 4F58H 4PRDB 4D9QE 1XF4B 43CAB 3AVEA 4I77L 2EDKA 2DQHL 5CJQH 2ARJB 4ZFOL 4PRBB 4PTTB 4R2GD 1FFNB 3RUGA 4GG6F 3V95A 4P3WA 2BVQA 4OZGB 4QY8A 1T04A 5F1NB 2WQ8A 2N7AA 2APWA 4W4OC 2PO6B 3GJEB 3TN0A 4MAYD 1A1MB 3X3GL 5JDSB 2K1MA 3G6JF 1ORSA 3I02B 4PJDF 4KU1A 3ARFC 5T3XH 3OR7A 1J1XL 2YD8A 4LMQI 4LSRL 2H9GA 1KLUA 5J6HB 2EH8H 1ZA3A 4U1NA 5D5MB 4XCYB 1ZK9A 5HYJA 2W1NA 3QDGD 5C0IB 1UCTA 1E4JA 3SE8L 3ALXA 2AJVL 4XC3H 1EH9A 5D1QB 3E2HB 1LO0L 3OAZK 2DQEH 1X5LA 3EJZC 5C86A 5DUMH 3BMWA 2KPNA 3TA3D 1JZ2A 5D7IA 4JKPH 1FQ9C 4P48A 3QIBB 5FYJE 3P40A 1NLDL 3ZHDA 2H3NB 2AV7A 1VKXA 3D87B 1VPOL 3OWEA 5EBLB 3P0VL 1IGIL 2ZOKA 1BP3B 3I02A 3QDGE 4H1LA 5JDSA 1ZHLA 4UT9H 1KELH 1KNOB 3KYMA 4PJBB 1R5IA 5H94A 4M43L 2CK0H 5FKPA 4P46B 1MUJA 3BXNB 3F58H 4CW1B 5E03A 4O58L 1JHLL 4XNXH 4MA7L 4LL9A 2A6IB 1QBLL 3B9KB 3SJVE 4HBQA 3IJHB 1I1AB 5CGYC 2LVCA 3UXFA 3SKJL 3DSFH 1ZTXH 3LKQA 4WU7B 3MJ7B 3OJDB 1WC7B 4YIQB 4OF7A 4JHWL 3CLEL 3G6DH 3FL7A 4NUJB 4AYFA 1XZ0B 3MRCA 4G8GB 4W81A 2ZSVA 4U6TA 4G8EA 4X7TB 3CGTA 4M6ML 3GMQA 1TZHA 4L8BB 2E3VA 1EEUA 4DW2L 5KS9E 4L3ED 1I7RB 4HC1L 1DVFA 2IQ9H 4Y8AA 3GBMH 3QQ4B 1UH4A 3RU8L 1AGEA 5I0ZA 2EE3A 1AGBA 1EGJL 3DBXA 2NPLX 4OCMC 1QR1B 4AM0B 2AI0L 4JN1L 4X9FA 1J1XH 2XTJB 4OCWL 5T1KB 1MFAH 1CFVL 2IPKA 2AW2A 1ZT4B 4R3SA 4UAOB 1GSMA 3CH1A 4HIIB 1VFAB 3E8UH 4YHLL 4K07A 5DD5L 2IALB 4NZJA 4HKXB 1C12B 1FVCA 2PTTB 3TYFA 1BJ1J 1UXWB 4ZUTA 5FB8B 4O00A 3TPUB 2G60L 1IKNC 4DTGH 4X5WA 1VFBA 4PJIF 3UC0L 3PWVB 1B0RB 2R15A 4GOSA 2DMCA 3CJJA 5FYKH 3MLUH 2VIRB 3PABA 3CFKA 2DI8A 4ZUWA 1S7WA 1TJHH 4KVNL 3KLAA 2L7UA 4Q97A 4I77H 4XB8A 3QA3A 4LU5L 1CGSH 2MCPL 3CXHJ 4GXVH 4UZGA 5TJWK 4FTVE 4TVPD 2F5BH 2YR3A 4TN9A 1KIPB 4K7FA 1MFEL 3IF1B 1W2KT 4GXUN 4K23L 3OB0K 1N7ML 4MXQC 5E56A 2KKQA 3SHSA 3IDMB 4IM8A 3ZKNC 1I9IH 2IAMB 5ALBH 3SDDB 2NXZC 4ZO8A 5DK0B 2E7LC 5TH2B 4YNYA 4GXUM 3H9SB 5JO5A 4KI5F 3DTXA 1N0LA 1ZWIB 3NAAL 3ESVF 4N8PA 5IMOA 2FX7L 3HC4L 4PJAA 5ETUB 1P9MA 1X6LA 4LGRB 3W0WA 1YEHL 4FXGA 4UT6L 3EJYC 4WI7A 3HUJF 4WW2A 3MLWL 3SDYL 4OSUL 5C9JA 5F8RC 3BHBB 1RZKL 2VLLA 1ZHKB 3MLWH 1YPZA 1DBMH 3LIZL 2F58H 3VWJB 2BC4B 4DVBB 3MC0A 5ADPH 3MBED 2EH7H 4P2RE 1JMXA 1B2WL 3QUXB 1G6RB 1YZZA 4OD3L 1EK3A 2QTEA 4ZQKA 2ARJQ 2JB5H 1ZXQA 1ZHBA 3HI6H 4ZD3L 2WBJA 3LOWA 1MFAL 1YC8A 4H26A 4L4VB 2WM0A 4YDKH 2Z0BA 4XP1H 5KSBA 3QPXH 3UBXI 3ESUF 1JPGB 1MLBA 5INDB 1NBZA 3MUJA 3DIFA 2L0DA 1CU4H 3WS6A 1X4YA 3EGSB 3GO1L 5MHSD 4OAWB 4R7NB 2J5LB 4LARH 4WI3A 3OR6A 2LFGA 4HUVB 1S7SB 4PJFA 4JFOB 4Z5RB 4IMLA 3GSWA 3WLBB 43C9B 2VISB 3X14B 3HE6B 2OJEA 7FABL 5JOEA 4HUXB 4YPJA 3SDCC 3BESR 5CCKL 4UU9A 5IK3B 2GSIB 3QUXD 3DMMB 2YZ8A 1MAML 4Y5XC 1UZ8B 2RFXA 5EZOH 5IVXE 1F2QA 3D18A 5CHNB 3TBVB 1G6RA 5K9QG 4GXVL 1AD0B 1S3KH 2VZOA 4P2RD 3BWUC 4NGHH 3EJYD 2GJ6B 1C7SA 2GEEA 5HHOD 3WXVL 1F00I 1JPGA 1MLBB 2Z31B 4XCCH 1QRNA 2LV4A 4YQXL 3STZA 4N8CH 3BN3B 4LLVB 2WBJB 2YRPA 3F7PC 4WVRA 2VDNH 5AD0B 5HYFA 1NDGA 3PG2A 5FO9A 1OM3L 3SQOH 1HHIA 2CIKA 1CLOH 2DJUA 3TO2A 3LS4L 1WIUA 2AGJH 4R97B 4N68A 3AAZA 3RAJL 3VXUB 5F7UA 1BVKA 4OSUH 2DIAA 2VLMD 2A0LC 3NFSH 1XAUA 2H1PL 1RMFL 4V1DA 4FQHB 5JMRA 1CTNA 3V0VB 4MS8D 4XNYH 5A16B 4Y5VB 1CD8A 1UZ8A 3HKFA 3MOBH 4KK8D 5E5MB 4OJFL 2LU4A 5F97E 4K7FB 3TWCL 4P5TC 5GRVK 4NHCH 1BGXH 4YHKL 4PJAB 5ETUA 4XNQB 1UH3A 1I1YB 2X1XR 2ZSVB 5SWSD 1M71A 1N5AA 3IETA 3DO7B 5KOVC 3ISWA 2R1YA 1LD9B 2CLZB 3SDCD 3VXSD 2CPCA 1JZ4A 4P2QA 2H2SC 2DLEA 1CXHA 3C6LC 3GMMA 1CQYA 4GAGL 5CSZB 3IB4A 4GW4B 3NZ8A 5E6IA 1ZA6B 4NQVA 5I1HH 1XR9B 3PHOA 5ECJE 1L7IH 1D7FA 1UXWA 2BFVL 1E28B 3RUGF 4GG6A 4XBGB 5GRUL 2AJUL 4HUUA 1G7MA 1FVCB 1Z5LB 4QHNB 2FJFB 1PKOA 2F54B 1XIWA 1FVEA 2MTPA 3AXLB 3P4MA 3CH1B 4JN2B 4J3VA 4UTBH 3JV4A 5E2JA 3QP3A 2HVKB 4S0TD 1SYSA 4AEFA 1WCBB 2Z8WC 4NO3B 1S7VA 1IAOB 2NW3A 4ZUTB 3HAEA 3MROB 3IJSA 4KK9D 4QTHA 3NABH 5DRXB 2AQ1A 1Z3GH 3IDIB 3E2HC 4NGHL 3MLXL 4WW1A 3UO1L 5DTFA 1NMCB 3FOMB 3ZKSD 1MI5E 1V7NH 4AG4L 4WI6A 3PQYE 1XGTB 2NZIA 3BQUB 2R0ZH 4OI9A 4OD1H 1P1ZB 1TXKA 1G9NH 2R2BA 4OIBA 5DK0A 4LLYA 4R8WL 3X3FH 2IAMA 1H3GA 4ODVL 2JJSC 4MHHG 4L1DA 1AQKL 1AHWC 2W9EH 1I7RA 3QDJE 2WWKT 4GRLD 3WFDH 4Q9RH 3MJ7A 4NO5A 3GMNB 2YPKA 4G42B 3NFSL 3ME0A 3GO1H 3SDXF 3IJHA 4XNMA 3HFMH 1DQTA 4WIQA 4UT7H 5DGQA 3VXOA 4RAUA 3WJJC 3EYQC 4I0PA 5C1MB 4PJGB 5HI5D 5I1EH 4DN3L 2IANB 3CU1A 1V7MH 1TDQA 2P24B 2C5DC 1M7DB 1CLYL 3GHBL 4MJ6A 5KSVB 2IPTH 3U4BH 2B2XL 3WIIH 3WUZA 4XTRD 1NGWB 5C7XH 3L3JB 1OD9A 4J4PC 3CFEB 3U0PA 2KZWA 2BJMH 4NQCE 1NCWH 4PGBA 5D7IB 5AWNH 3BIAX 3QUKB 4TSBH 3MRHB 4HLJA 1F4HA 1FNHA 1I8IA 2RBLA 4QNPE 1KCVH 1DE4B 4L9DA 3N85H 1LEIB 4KMQA 5JNYA 2VDKH 4D9RD 3BEVB 1BF8A 1XF3A 2VDKL 2OTPA 1J5OL 5I76A 4DK3A 3QFJB 5I16A 4JFXA 5A2IH 4OCNC 2HMID 3QIBA 5I1AA 5FA3A 2HT4C 4J7RA 2AJVH 5BOPA 4FTVA 1I9RL 1JI2A 4TSCL 1S9YB 4KUCF 5DD3L 5F7EL 3HZKB 4KQ3H 5C09E 3SKMB 4O4YL 4GW5A 3CFBA 1HOCB 1U8LB 5DD0L 3WE6A 4XCYA 5B8CB 4QRPD 1IGIH 5SWZE 3CFEA 1YN7B 2B0SL 1A6TB 1XGYH 4ONOA 2XXCB 3K7UA 3EYQD 1ORSB 3T2OA 3MACL 2MNUA 1H8OA 3P9LB 3RGHA 2VR9A 1S5IL 1EMTH 5C6WH 2HT3C 3GI8L 3P11L 4K3EL 1KPRB 2IMNA 5JW4Q 3LV3A 3PHQB 4XTRC 1PEWA 2R2EB 3OTTA 2WWKO 1WWCA 4PJXE 3QJHA 1KYOK 1M4KA 3QEQE 1U8IA 2LAAA 3O41A 2OK0L 3WIFA 3SGKA 4P2QE 3JWOH 4KKNA 1JWSB 3WIHL 1H3PL 1NGQH 3PQYD 1YYLH 4NWUL 3UTTA 4ZNEE 5JXAH 5KAQG 2XRAH 3HI5L 3L9RA 2BK8A 1GAFH 3BKMH 3IFNH 4NWUH 1ZLVH 5JXAL 1FNLA 3OKKA 1OGTB 1X3DA 4MZ2A 1MREL 4FNLH 1DBJH 2IAND 3TP4A 2EC8A 1FSKC 4DFIA 4DOHB 5EC2A 1JF1B 3PWUA 5DMIL 1O5DT 2Q7YB 1FFQA 5TE7H 1FIEA 1UWGL 4YHZL 5CUSH 2BNRD 3DX8B 3CSGA 1RY7B 3FO1A 1XF2A 3S35H 5MERB 4F9LC 1PG7H 5BXFA 3E6FA 3GHEH 4LHUA 1PG7L 2HJLB 5KANG 3S7GA 3V6OA 1E4KA 1I9RH 4XXCC 3S6CA 1OAZH 3TBWA 4N8VB 1KN2L 3D39A 4RGOL 1A6AA 4F7MA 1E28A 4K7PH 4JVUA 5T5NG 4GG6B 5I17B 3CXHK 2GYSA 4YHYB 4MNHB 4EI5A 1X7QB 1AIFA 4JO3L 2Q7YA 3TVMB 1IT9H 1HH6B 1QPPA 3MLTA 2DWDB 3TA3B 4PJEA 1DVFC 1KCSL 5AYQA 4OZFB 3F6LA 3KPSB 4LLYB 4ZFGL 4MA1B 5F7DB 3IJYA 4NYLB 4YBQC 3DVFA 1IZJA 2FR4A 2VITB 5JQHC 2VLRE 4FFZH 2VR5A 4GKNA 4NQEE 2XWJA 5A16A 3VFSA 3VD7A 3I75A 4V1DB 1Q38A 5CP7A 4HUKB 5KSAB 2R29H 4WHTA 1TTFA 1YNLH 1N0XL 1TVDA 1EFXD 2WUBL 4JM2B 4EDXB 1KACB 4YHPB 2X40A 1X5FA 2E27H 4U1HA 2YD6A 2DQUL 4N0UE 3BJ91 5IVNA 4KI5E 5IQ9B 1A4JA 3OXRA 1KPUA 5I9QB 5CJ8A 3RDTD 3T0EE 3EOTH 4HUUB 2BSSA 4TVPL 4PJBF 1VB9A 1HKLH 1UWEL 1XGQA 3U36A 1ZA6A 1UB6B 1NCCH 3INUH 1B0WA 1MFBH 4MCZB 1YPZE 3TYGH 1AD0A 2Z8VC 3VXTB 5E6YA 3ALPA 1RU9L 3HPLA 4JRXD 3D18B 5CHNA 3WFHA 5A40E 1WISA 2RFXB 5JOFA 3NGBB 1L4IA 4Y4KA 5C0BD 5I15H 1IL1B 3SE3C 1B4JH 5IESH 4LEOB 1EGJA 4UU9B 5IK3A 4GO6B 3SKOA 2H26A 5IEHA 2CDGB 3A0OA 1JNHA 3FT3B 1A7OH 3VH8G 3RTQA 3BD4A 3SO3C 2LAGB 2FGWL 4MD5A 4ETYA 3IVKB 5L88H 3STLA 2OBGA 1CI5A 5GGRB 3BT2H 3ULUD 4WUUD 3HAEH 3PGFH 4KHTH 2XN9A 4LCCB 5J6GA 4JE4B 5CILL 1MHHB 4LK4A 4ETQA 5E1AB 1F97A 4R0LA 5E8PB 4YAQA 5ISZB 4G6KL 4Q0XL 3U4AA 4ESKA 4PRIE 4HT1L 3MLPA 4ZUVA 5MENB 4PRIA 2ZP0T 5EBMA 3V4UH 4E5XB 3C6SB 1PX4A 6CGTA 4FQJH 1P4LB 1FNAA 5GGTH 2DQIL 3C8KA 2XZAH 2EDOA 1HWHB 2Z92A 1QP1A 4FQ1L 5DI8A 4NZUL 3SDYH 4RMTA 1Y6NR 2X1WL 3UJIH 4X7SL 4Y8DC 4JFPB 4L4VD 3WLBA 3SDDA 3W81A 3EYSL 4QHLA 5J13C 3C08L 1JYWA 2VDQL 1HXMA 4FQXB 1YECH 3TWCH 4P23A 3EFFA 2NY3D 3SDXE 4B50A 1T7YA 3T4AA 4UTAH 4MXQD 5HHQA 2GSGB 3REVB 2R4SL 1CLZL 2YMXH 4NRXA 1QD0A 5DVLA 3NH7H 2HKFH 5IB3A 3C09B 2E6JA 2C3WA 3E6HB 2C4XA 3RI5K 1TITA 4KKBD 3TO4A 3O0RL 2XKSA 2E9IA 1RHFA 3ZSSA 5FYJU 2VLLB 1QSZA 5KBNC 1AH1A 1KB5L 3L7FB 4JAMB 1QVOB 3CXDL 5IBTH 3ZMRA 3LRSB 3HMWL 4MNGE 4RGMC 5ESAA 5IBTL 3DUSB 3OQ3B 5T3XD 1MAMH 5B8CC 1DL7H 3ARBB 3VWJC 4YFEA 2VDRL 4HIJA 3DX7A 1NGPL 2VDRH 4NZTL 3TO4B 3WXWL 2BP3A 5CSZA 4CN6A 4ELMF 3VA6A 3CZFA 5J1SC 4HWBA 4PJFE 5IEHB 3NIGF 3QCTL 1Q9OB 2V5RA 5DJ0B 1JZ8A 1E0OB 1HXYB 3GKZA 4UI2A 1G9NL 2Q6WB 2DLFH 2BRRL 1RVFH 5LCVL 5ILTH 1CFVH 3P2TA 3KNBA 5ILTL 3LS4H 1DCLA 2VLJD 1QHOA 3HLAA 3OJDA 5L0QC 3V4VL 3WDJA 4BUHA 5D6CB 3ARBA 1R5VB 1KTDB 2QR0A 5ANMA 3ZE0E 3DUSA 4PPTA 4M6AA 1MEXH 1HHIB 1NCDL 3ALWA 4JAMA 3OB0H 4XWGH 1RPQA 5JA9A 1VFAA 4HZLA 1QBBA 1GPOL 4MJIB 3RWGA 5DVMA 4HPOH 1ZHLB 5D2NB 2ZG2A 5E1HB 1FNEB 2DI7A 4QXWA 3EFDH 3NACL 4DVRH 1RQ5A 1ZHKA 1UH2A 1Q9KA 4ZO9A 1AR1C 3BGFB 3L5IA 2CJUL 4KFZC 3VDCA 1WGOA 4PB9L 2ZCLL 2AABH 3ILPB 1MCRA 2GJ6D 5B39B 3SKOB 3CFIC 3QG6A 3RU8H 5F6HJ 5HDQL 4HUXA 3RVVD 5FHBH 3K1DA 4XI5D 4XPFL 3STLB 4ZNEA 5GZOC 4FQXA 4LRIC 5EU7C 3QDJD 5HTSA 5IVXB 1RZGB 3DROA 5IJVA 3HRZA 1G9EA 5GGTL 2G5BB 1HH6A 3MLTB 5E8DL 4JFDE 1AIFB 4HK3N 5CEZE 3IDUA 2XQYK 5D1QC 1RZKH 1VEOA 2GJ6E 4OLUH 5E5RB 2D0HA 2ADGA 5DHVB 1KJ2H 3WHE1 1OT1A 2PR4L 4KC3B 4MA1C 2UVEA 4UILL 3TCLA 2NY1C 2EICA 2ZUYA 4JDVA 1T04B 4E42B 4O2CB 4U1HB 4Q6IC 4GAFB 4PJ7B 3LKRA 5GGQL 1FAIL 1YJDL 1T4KB 1FVDB 1FZJA 2ARJA 2BC4A 4XCFL 1ACYH 5KSAC 1KC5H 4WHTB 3S37H 3ZT6A 4Q6IA 2A6JA 4N0FB 1CU4L 3F58L 1HQ4B 3QUMA 2VZTA 2YD3A 3V5KA 5IWLC 1QBLH 1YEFL 4XWOC 3ROLB 12E8L 1CL7L 1OGTA 3H9SA 5D1QA 1FFOA 1CE6B 4PP1D 5CCKH 3AM8A 3HI1A 1Q0YL 4XVJL 4OGZA 1XGRB 2AK1H 4P5MB 2AERT 2FO1A 2H26B 3WUWA 2VLRD 1SEQL 1KIQB 2VRAA 2FB4L 2GK2A 4R6UA 1O7SA 4BSVA 2B8OT 5EU5A 4QXGH 4ZAKB 4CKVX 4ZO6A 3UTZA 3ECBA 3OKDA 4Y4KB 5C07A 1A14H 3IAQA 4IRZH 3DJ9A 5C2BH 4IMKA 3NIFF 2JB5L 1EGJH 1TVHA 4BH8A 1ZKAA 3GM0A 3KPSD 2B5IB 1I7UA 2NY1D 4L8DB 5DUBA 4IS6A 5HGAB 3NCJL 4G9FD 1T83A 1FO0B 5IB5B 5AAMA 2ZUVA 4XB7A 1BQHB 3CD4A 5CD3B 4GBXC 2EKJA 1NEZG 5ESVB 1OB1A 1J12A 1HEZA 1QSEE 1A7NH 1UM4H 5AG8A 4FQLL 1JGEA 1QEWA 2UZIL 1RIVH 4NPYA 4PJCB 5T1KA 4B5EA 5HGBB 3H9YA 5EUOF 4HJGA 5EU6A 1GZPA 2Q76B 3ARBC 4OI7A 1KJ3H 3QDMD 4WWKC 3NCEB 4PRAA 4DJMA 1U3HC 4NDMB 2GK0B 1NL0H 3L3OB 4XWOD 4JPWH 3R0NA 4ZXBC 5FA3B 1JF1A 1QTYT 3EDEA 2NXZB 4JFYB 1ZT1A 1K2DA 4XXDA 5L8KB 3HMXL 2C3XA 1IM3B 4X7TA 1R0AL 2P48B 4ZFOB 4X0KB 4MMXC 4J3TA 4F7PA 1EUTA 5E5UB 1KPRA 1HNGA 4OGXL 5C0JA 5F93C 3RWEA 4ZAKD 4G9FB 1BFVH 3W39A 4PJEB 5ICYB 5FOBA 1UM6H 2HFFA 3LKSB 1NMBH 1YNLL 1ROWA 3QXAB 1NMBL 3GIVB 4D8PA 1JZ6A 4D0DA 1KT2A 5DRWA 4ODHL 5C8JA 3VXSE 4ZFFB 3OKOB 3RI5F 4XVJH 1S5HB 2A6IA 5DWUL 4JFFD 2FATL 1KJ2B 4FP8H 3O4LE 4DKEH 1BF2A 1DQJB 4QWWC 3VJ6B 2D0GA 3MGOB 3DYMA 4JFDD 5DJAA 5E0QA 3QEQD 4XNMB 2FYYB 3FO9B 3D25B 4M93B 4H0IA 4CUCA 2ZWLT 4Z7OE 4UILH 1KXVC 3L7EA 2LQRA 3IDNA 2W07A 3MRKA 5FOBB 1C5BL 1EZVY 4QRTA 3QIWD 4AIXA 1WIOA 1TJGH 3EDJA 4BSWA 4J3WA 2VZUA 1CE6A 3SDCB 1J05B 4RNRA 1NGXA 1N64H 3IFLH 4X7DC 3WFDL 4D0CA 5DVKA 3HS0B 3L9RB 5EO1A 4LARL 4PGCA 3MRKB 1RIVL 1ADQA 2H45A 3UTPE 5SWZB 3EIFA 1BLNA 5I1EL 3KPPA 3QUZD 4PD4J 1DEDA 1E27A 4LDOB 3F12B 2DDQH 4IJ3B 4HW6A 1JTPA 3BP4A 5D5ME 2QJDA 1DQDL 2OMBA 2FCBA 1TMCB 3U9PH 1J87A 1QSFD 1T7ZA 3UO1H 3QXUA 2GUOB 5FDWA 2FECI 4OGXH 4X5LA 2P24A 3VXRD 5GISH 1OW0A 3GMNA 3LKSA 2W92A 5INCB 1JPST 2X70B 2DM4A 4NNXB 4UV7L 4K3HA 4M3JA 5C2BL 4P2QB 4X6CF 3UTOA 2Y36L 4OT1H 1GGCH 4WUUE 3SQOL 2O61B 1AQKH 4LCCC 5DK2A 4BFIA 2EIDA 1A1OA 5MEQA 5C0DA 3BP6A 4CADB 1MJ8L 3QDJA 4IRJA 1QLRA 4Y1AA 5F1IA 3O8XD 1OTSC 2MSPA 3S36L 3ZYOA 4ONFL 3BH9A 2P5WD 4X8JA 3BPLC 4JY4B 3ZYZA 2EEDA 4YBQD 3STBA 2FHFA 3MYZA 4IRSA 1AC0A 4Z76B 4C57C 4R0LC 1S9WB 3ZDZE 5C0EB 3ULVE 3GZKA 4Z95H 3VXUA 5SV3A 3LS5H 2YSSA 3NCFB 1I8IB 1NL0L 2EE2A 2WK2A 5ESAB 2AEQH 2DN7A 4YHOH 1I7TA 1JFQL 1UWXK 1I85C 4GMSL 5DRXA 2JJVA 4HPYL 5D7JA 2R1XB 2EEAA 4EBQL 5FM8A 1P7KB 2XG4A 3GI8H 1AY1L 1S7VB 3O9WB 5BV7C 1I9JL 4UDUB 3LKRB 2VO5A 3RDTB 3LMJH 4K3DH 4M4RA 4K8RL 4N0RA 1LDSA 3JWDH 3WJLC 3QI9A 4O2FB 5GZNC 5C09A 3VFWB 1AGDB 4S2SA 3GBLA 1PYWB 3KPQB 1X6NA 2CRMA 1LEKB 3CU7A 3BAEL 1JUFB 1QR4A 4G42A 1EDQA 5JXED 4ODBD 2ICWJ 4J3OC 4MLSA 3V0WL 1HHGA 3OKNB 4TOYH 5D1XD 3OXSA 3RZCB 4QLRA 2R9HD 1NMCC 3ZE1E 4HH9B 4UDTB 3TFKC 3L3IA 4X7CC 2QQLH 3MRRA 4J3UA 1DBBL 3IXTA 4GSDL 3ZKND 3IXAB 3LRSA 4OZFG 4GSDH 1WWBX 3MBXH 5JPMA 1KN4H 1ZVYA 2MJWA 2JB6B 3ET9F 1FFPA 2BSTB 4F9PC 2M26A 3SCMA 3PV6B 3V4VH 3BO8B 4Y5YA 3STZB 4QTHB 2NXYB 2XPGA 2GCYA 3T0EC 1WIPA 1IAOA 2NW3B 3WYRA 4OZGF 4M93C 4ZUVB 5MENA 1INEL 4K9EH 1SJEB 1INEH 4YX2H 4XAKD 3M17B 3HNTH 4JN2A 1YPZB 4PGDB 4JFHE 2F54A 5AD0A 1FFPB 5CP3H 5T5FL 5I1KH 1MHEA 3NZHL 3WNOA 4BZYA 2EXYC 3SGJA 1CXEA 2Z31A 1JV5B 1QA9B 4JZJC 1N8ZA 2B1AH 1KTDA 5LAXB 3GSNB 1JE6A 4NCC1 2Z31D 1BD2B 2YXFA 4OQTL 3SE9H 1HE7A 1RZGA 2DQCH 3D3VB 3DROB 3GJFA 2R23A 3OXSB 4KK6C 4QHLB 3VXNB 3H8NA 4M9PA 4HIHB 1AR2A 1UA6L 1UXSB 4Y4HB 4K3JH 1X5KA 4LPUA 4X6CE 3RJQB 1SJVA 1I1YA 4P2RB 1KCRH 3GBNL 3QR2A 5F9WC 4I13B 1P5UA 2OJEB 4PYGA 5C0CE 4AH2A 2EH8L 1CD0A 4H26B 4L4VA 1YEHH 2OXGA 3QXWA 2NY3C 3QI9B 5ESQB 1XGUB 4L4VE 3SCMD 3WNKA 3RFZC 1S7SA 3UTQA 1OL0A 5CIPH 5ISZE 2LABA 4OAWA 4R7NA 5DHVH 3EGSA 1NGPH 4NZTH 3WXWH 3GSNA 4MQSB 1JNLH 4AIOA 1PW3A 4Y16A 1QUNA 4KUCD 5DYOA 1QA9A 4JANA 4A6YL 4I9WD 5H8DA 1WTGT 1S9VA 5D7JB 4U6YA 1NCCL 1ORQB 1NCBL 3RVUD 1BGXL 4YHKH 4NWTH 5D1XA 4MGXA 4L8SC 4XP1L 1B0GB 4RGNB 1F5WA 3DTXB 3VI4E 2R39A 3LDBB 1U8JB 1IBGL 1UACL 5HHPB 2ZNWA 1AGEB 3SCMB 4GRMA 1JGUL 4WWKA 5DFVD 4WW2B 3OV6A 3QI9D 3ARDA 4Y2DA 5ESQA 1Q94A 1WJ3A 1A7OL 1RULL 2QQKL 1FNGA 4LLUB 1HXYA 5T1DL 2XWBA 2FGWH 4N5ED 3L1OL 4JR9H 2APVA 3HNSL 4K3DL 5DK2B 1KSRA 2JF1A 4JRXB 2KH2B 4OLZL 3FQXA 1RZJH 4QNPF 4HUVA 2DWDA 4J3XA 4WNQB 4RFEB 4LQ1A 1RURH 4XGZB 2E5EA 5B4MD 2N7BA 3DGCR 2E6QA 5DO2C 3R8BB 1MJ7H 3DIFB 2WIMA 3RBGA 1EFQA 1NBYB 2ZZUT 2I60H 3B2VL 4GQPH 3NMEA 3QISA 2NY5H 4HT1H 5EPMB 1IQWH 2YPVL 4LAJH 2IALA 4IRSD 4OB5L 4Z7NF 4MNQB 4RWYH 3DVNA 5L9DL 4KZEL 4PJBA 3FRUA 4WI9A 1QG3A 4OGAC 2R8SL 4XPHH 4OM1H 2O5YH 1EHLH 5IW3A 1I9EA 2DJ4A 1H3TA 1QFWI 2V5TA 2DQDL 2XWJB 3HTLX 1U8KB 1NANI 3VWKA 2V17H 3Q1SH 1PY9A 2OR9L 4BZ2H 3QIUD 3HZMA 2YPLD 2OSLA 1ZWIA 4NYLA 4EI6B 4G8EB 2Q20A 1QQDA 5TH2A 3C60C 4I1NB 4PGEA 1ZLUH 5C2UB 5DURB 5HYJB 4LSSL 1DVFB 3VFVB 3I6GA 4N9GA 3O11A 1QLRB 4YHNA 3MRFA 3UTSD 5T1LB 3GMQB 2X7LB 2XICA 4M1CD 3D25A 2Y07L 4EUPB 5IMLA 5IW6A 2MWCA 4ZOBA 4ZSOB 3O2DL 5L7XH 2WIIA 1DQJA 3QG7H 4HWEH 1Q8MA 2N4IA 2X70A 4M03A 3CVHA 5FUZL 1HH9B 1F4YH 4G5ZL 3KYMB 4X5WB 3BIKA 3PQYB 4BKLB 3E6FB 4U1GC 3TPUA 3Q5OA 5MERA 3DXAA 5K33A 4FQXC 4MJ5B 2ZOKB 43CAA 1A6TA 2QSCL 4I5BB 4QRSB 3UPCA 3BKJH 1LO0H 5GGVL 3AMLA 3LIZH 4NKMB 2YEZA 2YC1A 2VLJE 4F7EB 4LCCA 1R5IB 1JRHL 2OP4H 5H94B 3F12A 1G9MC 4FABH 4LMQE 5LJYH 4U7MA 1Y0LB 1S7UA 3BPNC 3VE0A 5DD0H 4NSKB 3B9EA 3ZDYE 3QIUC 4NKOB 3I75B 3BSZH 4JFDA 5CP7B 4Y7MA 1G9MH 4TNWF 5JHDE 1F4WL 2HJFB 4Q7DA 1QLFB 1UJ3C 2ATKA 1YEJH 3H3BC 4PD4K 4FZEL 1XZ0A 3MRCB 25C8H 1Z9SA 4EIZC 2VLKD 4Q9QH 3QUKA 4WTXA 4ZDHB 1ACZA 4ZS6C 2H9GB 5J6HA 5IG7B 4NFBA 1U3JA 4PJ7E 4MA3A 1OSPH 3QDGB 3U7YH 2B7DT 5FUCC 1AP2B 2EZ0D 4RBPH 4L8DA 1KV3A 3ARSA 5DD1H 3LKOA 5ID0B 4O02H 4PJ8C 4ZPTB 4XNUL 2DQHH 1FORH 3HB3C 1KPUB 1QBAA 1X5JA 4POYA 4IIQC 1GC1C 3WHXB 3LN4B 1YQ2A 4CW1A 2DLTA 3WLWC 1CBVL 1VFUA 4RAUB 4MDIA 4XAWL 3HZKA 4LHUB 3UBXG 2L4OA 1H3UA 1JP5A 3GSXB 5F9DC 1H5BC 2OL3H 2W65B 4ZUUB 4D3CH 2YPKB 2AV7B 4L8CB 1PX3A 1VKXB 4QYOA 3I3EA 1UWGH 3WN5C 1UJ3B 2BRRH 4ODHH 2L7JA 1H5BA 2X4SA 2BRQA 1FGVH 4D0CB 3B5GA 1QQDB 3BKCH 1IQDA 1UFUA 3S37X 2VAJA 3TH2T 4OM1L 1DQLH 2AXGA 4P99A 4WGVB 3KPSA 2EE6A 4N1CA 1WQVT 5DUPH 3MGAA 3P4OB 4N0UA 1UJ3A 1KUMA 4S1DD 2Y72A 2ESVE 4Z7VB 3GSRA 4N1EA 5T3ZL 1NGWA 1A7PL 2B0SH 3BYYA 3PJSA 2W65A 2F5AH 5FYJH 1NFDF 2XTJE 4GG8A 3GSXA 3QEQB 1NBVL 3RIFK 2QV2A 3UZQA 1QFHA 3DRTB 3KPRA 5FCSH 3MGOA 4P4KD 5KTEH 2KQNA 5GJTH 3VJ6A 2VLRA 1MFDH 3JWNC 2CLRB 4WI2A 4EBQH 3C5ZB 3VGGA 3O81A 3IDGB 5BXFB 4JY6A 1JN6B 3OKOA 5JW3L 2OTWB 1J18A 3VFRA 1OGAB 3ZTNL 1IVLA 3FQNA 4WUKL 1IMHC 3QDHA 4JFEB 4MJ2A 3DX8A 4RRPG 4I0PD 1TZGL 2CRZA 5IG7A 4F33A 3O6FC 5K9JH 4L9LB 5FUZH 3LKNA 1J8HD 1GOGA 4PJHB 3GRWH 5HVWA 1NGQL 3GSNH 4K55A 3SKMA 2BY2A 5GS0L 1CGVA 1N5AB 3IETB 4CVXA 1SY6A 2VC2H 1FZKA 5DF0A 3EDDA 1ND0B 1IM3A 1NUNB 4WENB 3NTCH 3Q2CA 1OWRM 2IAMD 4G9FE 2VXQH 4D9RE 1JTOA 4CDHA 3MRNB 2FLBT 3GB7B 1F3DJ 1FNEA 5BV7L 4NM4L 2W0FA 5D2NA 3KLDA 3VXSB 1DE4A 5IUSA 3FB6B 2OYPA 4ODVH 1L6XA 2IQAB 5L6YL 4NZRL 1FJ1A 4HV8B 1VACA 3CPLA 1ZLWH 2QSQA 4N0FA 1W0YT 5D93B 4LLVA 5TQ2L 2IPUK 1NH6A 1QRNB 1JPFB 3HUJE 4JCLA 4EUPG 3HFML 2YPLB 2Z35B 4NQUA 4F7CA 3BP7B 25C8L 4WWID 1PKQE 4YH6A 3M8OH 1CIDA 2JCCF 3Q6FA 5EBWB 2SEBA 1GZQB 2O5XL 3UAJC 5I1JH 2R0KH 5D8JL 4GRWB 5E6ID 3B43A 2ADGB 1JHKH 2NXYD 4JEGB 4R4FH 5BVJA 4KV5E 4P2QD 3I6KB 4FZ8L 2NTFA 1RJLB 1K3IA 1BQHG 3HNVL 4DUXA 2BERA 1NMAL 4NUGH 4TRPL 2A1WH 3L3KB 3RVWD 3T0EB 3WXVH 1AHWA 2CRYA 4J23A 4U1JB 3FB7A 3MV8B 3VXUD 1K8IA 1Y6KR 1JPSH 3FFDA 4EIGB 5DQJB 1RFDH 1BVKB 1DQML 4WEUD 1GL4B 4HXAL 4MVBD 4RMUA 1JIBA 2VABB 5I74B 1PZ5B 2X41A 1A6UH 2GTWB 1NCAH 3LQMA 3VW3L 1A3LL 4KRPB 1LNUA 2W0KA 2EECA 3LRGA 1UCBH 4E9LA 3QB7C 3ZE2F 3MRPB 4XMPH 3C2AH 2A6JB 1AXSB 5E08H 3MROA 4MQTB 4XNYL 4ELKB 4TOYL 5JOPD 4Z7UA 4ZPVB 4LRIA 4CDGC 3JV4B 4MDJB 5HD8C 5DMKA 3UYOD 1QLEL 3T4YA 1DLHA 4P57A 2W9DL 3KYKL 2BY0A 5JW4N 4WUUB 3TIDA 3F7RA 3ZO0A 4HUWB 3HI6L 5I8KH 5FF6B 5JO5B 1LK3H 1AE6H 2JCCA 3ARDC 4ISVA 3WL9B 1R0AH 2WANA 2G5BA 1D6VL 1SEBB 2YUWA 4XHJC 4JG1L 1CCZA 3LH2L 1NGYA 1QYGL 3WFBH 5FK9A 5JIPA 1CDBA 4LNRB 4X7FC 4J2XA 1XGTA 4NHUB