4R2GD

Crystal structure of pgt124 fab bound to hiv-1 jrcsf gp120 core and to cd4
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
231
structure length
225
Chain Sequence
VQLQESGPGLVRPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLNSRAVISRDTSKNQLSLQLRSVTTADTAIYFCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Surface protein gp160
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 36
structure length 225
sequence length 231
chains with identical sequence J, N, Q
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gD01
2DBJA 2YOCA 1RVFL 1O0VA 3O3UN 1AD9B 5HVHB 3FMGH 5E2VL 1CE1L 1N6VA 1C08A 1KBGH 3L95A 2B1HH 3RNKA 4BH7A 1LHZA 2MKWA 2A1WH 3BQUC 3UJTH 1RZKH 4EDWH 4K3HA 3ULVC 2CDFB 3ARZA 3LKNA 3ZT6A 4F9PA 3A6OA 1YNTB 2HRPL 3OKOA 4U0QB 4IBLT 1JV5B 2DLTA 5LAXA 1X6LA 1BJMA 1H0DA 2R29H 3PDGA 4ELMA 4JRXD 1XR9B 4R3SB 2P5EE 1N26A 3WL9A 1QFHA 5GGRY 2FL5A 4LVHB 1LNUB 2Z9TA 1B0GA 1DN0A 3BP4B 3H3KA 5IR1A 4NC2B 5AYUL 3TYFB 5CJBA 1YEKH 3V6ZB 1F3RB 2F74A 3X3GL 2FB4H 3GJFK 4QEGA 1MCFA 4NQCE 4P9HC 1EFXB 1KPUA 5IQ9B 3HG1D 3EJYD 3T65A 2HN7B 4FFVC 1DBKL 5B3JE 5EOQH 4H26B 1FHGA 4IDLA 4POUB 3P4MA 3KYMB 3C6LD 3I3EA 4DTGL 3BDXA 4XC3H 2BNUB 1MRCL 4WV1B 1NBQA 4HV8B 3OL2A 5IG7A 4M3KB 4HKZB 5EA0L 3VXSB 4ETQA 1LEKB 2YN5A 1BFVH 1ZHBA 3F5WB 1IGFL 4XP6H 4HDIA 4OZHA 5DHXB 2N56A 5F9OH 3ZYOA 2FX8L 4M5YH 1BHGA 2XZCL 2H3NB 2FGWH 3S35X 3DIFA 1T5XB 4E42A 2VLLA 3U0WL 1NBYA 3GBMH 1MFEL 5F70A 4QHMA 3EGSB 4YHZL 2P8LB 4UAOB 3ULUF 4ODHL 1XF5A 2EO9A 3EYQC 3OAYK 2ZUTA 3ARPA 1K2DB 3MREB 4YHYC 1DUZB 1R3HB 1VDGA 1P4BL 2MCG1 3ZMRA 4X99A 4PJHA 1LD9B 1F4AA 4N0UB 4OFYD 1UB6A 5TH2A 3MRBA 5K9QG 3O6ML 4AEHL 2AK4E 4CDHA 3ARED 5K9QI 1EMTH 1U8IB 5ALBL 4OZIE 3OR6A 1MJ7H 3IGAA 4TNWK 1K8IA 1A7OH 4OQTA 2WV3A 5I9QB 1V8HA 1CFNA 2A9MH 2XG5A 3HCVB 2P43B 1CK0H 3A6BH 4NWUH 2AGJH 5T5FL 5E8NB 3OJ2C 1FORH 3GSNA 1Y0LA 4X9HA 3VXTB 5CZVL 4OZGB 5FYLD 5IFAL 1UCBL 1NGQH 3RX5A 3CFDB 3TBVB 2ZG1A 4XPTL 2MWCA 3RWFB 4PJAF 2GSGB 2R2BB 1CD8A 4FNLH 3S88L 4TUOA 1OHQA 5CILL 3B3IA 3EO0A 1MJJA 12E8H 4X6DA 3TBWA 1A6ZB 1UB5A 1YMHA 1F02I 4P2CG 3MBEB 1I3UA 3MUJA 4LEOB 1WF5A 1OSPL 4LDEB 3PQYA 3LD8C 4NKDB 4R2GC 3C9NA 5IJKC 1A4KB 5ILTH 1JZ5A 3LQAL 9CGTA 1A6WH 5J3HC 4PRHE 1L9MA 3CFJB 4FTVD 1DQML 2AJZA 2B2XH 3HE7A 3H9SE 1JUFB 3KJ6L 2HTLC 5J1TC 1RIUL 3C6SB 3MRQA 4M93B 3EOBA 1WBYA 4S1DD 4AMKH 5EU3B 1U8LA 2YBRB 4JQVA 4J3WA 1RJYB 1RK1A 3TN0C 4R8WL 1P84K 4LP4A 2GFBA 4CADA 5I76A 1GOFA 1G6RL 4LNVA 4LOUD 4PJ8B 1XIWA 1A2YA 4JFPB 2BXYA 4DZ8A 4TVPE 3W5NA 5LGHL 4JZJB 3G08A 3UJIL 4JFEE 4I13B 4GXVL 1Q1JL 5I19H 3OKLB 3O2DA 2A6KA 4ZXBA 4L29A 1Z2KA 3ZSSA 3KWWB 4NRZA 2VDLL 4P3CH 1BZ9A 1BLNB 1UWGH 5T3XD 1NEUA 4AL8H 3RJDA 4FP8H 3TA3D 1IE5A 5GGRB 3K4DA 2BCKA 3V6FB 5HHOB 5KJRH 1BD2D 4Z0XB 4JCMA 2C7UB 3BEVB 3VFVB 3O8XD 1XGRA 5ITFA 2Y1VA 3UC0H 4YQXL 4JPWL 2ILLA 4HGWB 3RDTB 5J6GB 5IW6B 2G9HA 5T3XL 1MLCB 4JFZH 2NYYC 5IHUL 1E4WL 5B38A 3Q6FA 3QDHA 4P5TC 1PAMA 5HGAA 4CU6A 1N5AA 2HT2C 1I1FB 1QNZH 2MPAL 4ZUUB 3MR9B 1VHPA 5DHYB 2VXTL 3O6FD 2UZYB 1QUNA 1WWWX 3D2UA 3VGHA 1NH6A 1AO7E 1MI5B 1RZGA 4Q58C 3QEUB 4NP4H 5F71A 3BKYL 4M62H 4RAVA 3S96B 2DQFB 2JF1A 3TYGH 2CUHA 3VFGH 1EUUA 4GUPB 2X70A 1IAKB 2XZZA 4NRXB 2XA3A 4YBQD 3GSUB 1ZK9A 3O4LB 1OCWL 4GG6A 1MHPL 1M6OA 1HIML 1BOGA 4XXCC 2Z31B 4PRPD 5ELIA 4NZDA 4TVSa 5EIQA 5C8JB 4JFQA 2CLRA 3DLQR 5ID0B 4OZHE 3WKML 3DVIA 1FZMA 3MV9B 2UV3A 3OJDB 3VFPB 2Q20A 4PRNB 5E8DH 3VWKA 2MKLC 4M6MH 5D96C 3MJ9L 4TVPH 5A2KH 1FNEA 4HXAL 1MHHA 3PABB 5L2JB 5DJ2B 1U6AH 1QPXA 1WQVT 2Q3ZA 5D2LF 1UH2A 2K3TA 3C60B 2VLRA 2QADC 2MHAA 2DL2A 3PL6B 2AXGB 1BX2B 1RZJH 3T2OA 5I1AA 4U33A 4JAMA 1OAXL 5I1DA 1J8KA 5MI0C 4N0CD 3MYZA 1G7JA 5AUMB 2ICWI 2W9LA 3EOAB 4OAWB 5E9DB 5CEXA 2WWMD 1FL5B 2QQNH 2ZUWA 1NCCH 4KKLD 4PGDB 5DK2A 1BJ1H 3VXRA 5DK0A 2DQGL 4GKZA 4XB8A 2DQEL 5IT2L 1KEML 1CD1B 4L8CB 4HH9A 1FNSH 1ZMYA 1ODAA 3MV8A 2X7LB 3K4AA 3WFEH 3MJ8B 3N9GH 4Z7WF 3T1FA 4M7ZC 1BQHG 1ACZA 1S7XA 1FIEA 3SPVB 4LCYB 1F2QA 3VFSA 2NY5H 1JFQL 3DV6A 3MLXH 4XP1L 1A1OA 1QSFE 3BW9B 3JV6A 5EO0B 5BOZG 1S9VB 4ZQKB 1WV7T 1RUAH 1RJCA 5K9KA 4RISH 3V52L 1JGEB 2CIKB 3MACL 1AQKL 3DURB 2Z93B 4KK5D 5HYFA 3QUZB 5I1LB 2PXYC 4Q9QL 5DD3L 4X6DE 3HC4L 1F42A 1FLRH 1CLYL 1SMAA 5T1MA 4Z7QF 4XCEB 5DR5H 5LWYL 5BW7A 3K1KC 5IP4A 1L7TL 3VMNA 4LSQL 5TQ2H 4YLQT 1HHHA 5IJVB 4D9LL 4F58L 1IMHC 3X17A 1ZAGA 2E7LA 1IEAB 4JHAH 1BGXL 5GSRA 5JA8B 2XWJA 4IRJC 1RJZB 2XWBB 1DLFH 1SJEB 1XT5A 3T0DA 1CDBA 4WO4B 1BVKA 2ICWJ 3PHOA 4L8BA 4ONGH 5ETUA 1SM3H 3G5XA 5HJ3A 4WWKB 4P2QA 3H3BC 2R1XB 3MUHL 1MNUH 4J4PC 4X4YA 4UTAL 3QIUA 1LDSA 3ORJA 3MV01 4OQTH 4KFZC 1OTTC 1T7YA 2BVQB 2XQBL 1KV3A 2EIEA 3QEQD 4MJIB 5J0BA 1S7WB 4PYHA 5DD6A 1HXMA 4LSTH 3GSNH 3P9MB 3LKSA 3MRLB 2A77H 2P24B 3NH7H 1IC5H 3QXUA 2P8PB 3D39B 2RAMA 3BEWB 5KVGH 4M6AA 1H3PH 4BFEA 5J11B 4Y1AD 3MUZ1 3ZDYF 4MAYC 4WGWB 4WHCA 3GMOB 3WSQL 1BFSA 5L2KA 3UTQB 4M8VA 4ELMB 1F58L 3N50A 1KJ2B 3OG4B 1PSKH 2FH8A 4Y4FC 5GSVA 2M2DA 5IMKB 3DX7B 1Q9LB 3HAEG 4NFCA 3JUZA 3AVEA 4NSKB 1KCSH 1OAYH 2A9NH 4YHIB 5D72L 1UWEL 1JNLH 4M6NH 2F74B 5FV1L 1HCVA 3EYSL 3L7EB 1JYNA 2IG2L 1KPUB 3FQUA 1G9MH 2HFTA 5CEYA 4QRRA 3ALXA 2IMMA 5EN2A 3SDDA 4GG6E 3DETC 3MLZH 3UDWC 3QDMB 1SJXA 1TITA 4Z76B 2AJUH 4PPTA 4YHKH 2CMRL 5D4QA 3WS3A 1WBXA 3MRIB 3RKDC 1G6VK 4OI7A 3EJZC 1B9ZA 5D7IF 3CGTA 3TBSA 5IG7B 1FG9C 4JANB 4PBXA 3VG0L 3JTTB 4WHDA 1X7QA 1TPXC 3QQ9C 5FCUH 3RUGF 2HJKA 4NO5A 2OQJA 1JYWA 5MEQB 4PRAB 2AK1H 1BZ7A 1CICC 2APBA 1TMCB 2FX7H 2HH0H 4NQEA 5JTWA 4CN4A 3DMMC 2FIKA 1IC1A 4JPVH 3HZKB 4KK8C 3BFOA 3O2DH 1RSFA 1TENA 1L6ZA 4KI5E 2VLRE 1A6UL 1HEZA 5IB1B 4P5KA 2NXYD 1RZJC 1SBSL 1J7VR 2NXZC 1BMGA 3T0XA 2IBZX 3D3VB 4L8SB 2IQ9L 4KKAD 2PO6C 3T0EC 1CF8L 2J8OA 3GSQA 1A6TB 5I66A 5L7XL 4D8PA 1XF5B 1S7QB 3VFOA 3SHSA 4XP4L 1YN6A 2HWZH 3LB6C 5IMMA 4Y4HB 1MFCH 3IDJA 5I1GH 4KDTA 3AY4C 4X99B 2DF3A 4CNIB 1TTUA 4MLIA 4K71B 4X0KA 2B4CC 4X6FB 3MV8E 3FB5B 2A6DB 6FABL 5SV3A 5GGQH 5CJQL 1GC1L 2HFGH 4D9RD 4EN3A 5KVEH 5IWLA 2J12B 1NMBL 1PZUB 3QIBD 1HHKA 4WU5A 1W0VA 2Y72A 1GRWA 2RFXB 3Q3GA 1CFNB 2F9BT 1EZVX 1IGTA 1OWRM 3CFKB 1U3HA 2PR4L 4J8RA 4N8CH 1Y0LB 4OV5B 1DBML 1NCWH 1RULH 5IK3B 3A6CH 3FFCD 5DT1L 3HA0A 4JY6B 3MV7A 3HN3A 2R8SL 3TM6A 4I5BB 4O58L 2BVYA 2P1YA 5JOFB 2G60H 4BKLB 5HDQH 5BS0A 2W38A 3MLTA 2PUQT 1WC7A 3V7AG 3GSRB 3B3IB 5IB5B 5ACMA 5HYQB 4HHAA 3EDJA 3RY6A 3JWDC 3VDAA 4QXGL 4XNMB 3QXWA 1K85A 1B6UA 2BY3A 3VXUA 3HNTL 5FHAH 4MNQA 4P57A 1M7IA 1OAUH 4RRPG 5E08L 3PQYB 2APVA 3NFSL 3SE9H 3FQNA 2P45B 4JJ5B 4Y2DC 4HKBA 3L3KB 1AGCA 1FJ1B 3K81A 4YE4H 2FR4A 4QHNB 3W39A 1KN4H 3TO2B 3EOBB 1WBYB 4JN2A 1NPUA 4FQPA 2VE6A 2QEJA 3L3OB 3TESA 1GAFL 3OF6D 1U8LB 3JZ7A 3MLWH 4OD2B 2BY0A 1J0ZA 4CRPA 1IKNC 4P2QE 1EO5A 2R0WL 3QXVA 3QZWG 3EYUH 5JXAH 2ZUYA 1XIWB 3L7FA 4JDZA 2CXGA 5C08D 2VZTA 5GHWL 3CDCA 5GZNC 2UZIH 3QWRA 4EKXA 3QNXB 4LLQA 2HJLB 1I7UA 3VRLF 3WFHA 1YYML 2XV6B 3G6JB 4NNYA 2FWOB 4Y19D 1QBAA 3EDKA 5HI5D 1AC6A 1U93A 3ZE0F 1F11B 1MQKL 3PF2A 2ZSVA 5JPNA 2H45A 4ZXBB 4PJEB 1XFPA 4KJWD 3PDOA 4OLYL 1AFVL 5DD1L 4XI5C 1JYVA 4P4KA 2NY2C 1FYTE 1QFOA 3WXWL 1FGVL 4LHUA 1KTRL 5F93C 2EIZB 5JW5B 4ENEC 1NFIB 2EIDA 4AEIL 1TQBC 3N1QC 4R97B 1DEEB 4MJ4A 4QRPB 3ROOA 4W70A 1UVQB 5L2KE 5E5MB 5ITFB 5ESQB 4OLUL 5EZLA 3HR6A 3MZGB 5BRZE 3UJJH 3B5TA 1Z9OA 2EE6A 2N4IA 2R2EA 2DQJH 4LRNH 2G9HB 1T66C 4KJPC 4NN6C 3B9AA 2ZSWA 1F2XK 3JSSA 2EDTA 2H8PB 2JCCB 4HT1H 3P30H 3H7LA 2IH3A 5HYSG 2EDYA 5FO9B 1N64H 3MOBH 4HWBA 5EUOB 2DD8L 1KJ3H 1MEXH 3HFML 1RZGB 4BSWA 5INDA 4QRRE 2RCSL 4Q9BA 5C86A 3QQ4B 5KZCD 1K8DA 5DO2C 4JO2H 3GB7B 2VAAB 3U0TA 1AHWC 2X1XR 3EYOB 3KPRE 2HMID 1N7ML 1BOGB 3W9DB 5D5MA 5IHLB 1OF2A 1O7SA 1IEBB 4UZGA 1Y6MR 3K4ZA 2VISA 3AM8A 4XMPH 3VGBA 4HCRA 3LH2H 3ZTJG 4QY8B 4XBPA 3QJFA 3S37H 4L3CB 2AJSL 3DBXA 1S9XA 2QHRH 4K3EH 2MCPH 3VWKB 1F3DJ 1MCOL 5CUSL 2CQVA 4PB0H 5ENWA 3TCXA 3D87B 3IT8D 4NT6B 4EXKA 4R26H 2AP2A 5CEZD 4KRPB 3G5YB 2BSTB 4LIQE 2MHAB 1QRNE 4BZ2L 4M03A 3C09B 3FQTA 2ATPA 3BJLA 1I85C 4QRTB 2VR5A 5I1DB 1S7SA 5LG1A 3ZHKA 2HVKB 1QKZH 3O11B 4HWEH 5HHMB 1E4KA 4MQXD 5BCAA 3WFCL 3HI5H 3VXPA 4I9WE 4OD3H 3WIFA 5BV7H 4F7EB 5BZWB 1GGIL 3ELAT 3B2VL 1S5IH 1NFKA 5CZXC 4MB5A 4O2CA 2YWYA 4MD0B 4U6XA 4MNHA 2IH1A 2H2SC 5AWNH 3TO4A 3K1DA 5D7JC 1RU9H 1CXFA 1I9RH 5EZOL 3WDIA 1RURH 1KXTB 3R1GH 1CT8A 5EOCH 4HPYH 3MRMA 3HC3H 3MV11 4QXUL 5FDWB 5TDPA 4YHML 2DM7A 3MRHA 1NGWA 2XY2A 4L4TA 1IQWL 2ADIB 3KS0J 5D93C 5C0CA 2ZPKL 3MV7E 4EOWH 4Y4KD 4F7MB 5KVFL 5C0ND 5EDXA 5F3BA 3VXOA 5BS0E 1S7VA 3NIGF 4PJ5D 3WFBL 2VXUH 4HWUA 2ARWA 3QO0A 3D85A 3RGVD 1EHXA 1MRDH 3U82B 1PFCA 4X6CA 4MNQE 4IIQC 4EDXB 3IU4H 3FOLB 4UIMA 4JJHA 4BH8A 5M7QA 4HIEB 1RFDH 3TBYB 4JKLA 1TQCC 1Z9MA 3IFNH 1UGNA 3ET9F 1CWVA 3EDEA 4LIQH 4ZPTA 4KRMB 2YD6A 1QSEB 3U9UA 4YX2H 3D69A 3JXAA 1UG9A 2GUOA 2OM5A 2NY4D 5LCVH 5DVLA 5C0DB 2XRAH 5DMGD 4UV4H 4JM4L 1T83C 3LS5H 5EIVA 2BFVH 4UT6L 1D5XB 4XNQA 5D7KD 3HZYB 2WBJD 3MC0A 5T1LA 4H20L 1XZ0B 4PJGB 1NBVL 2DIBA 1S7UB 4U3CA 4D3CL 4ZDHA 5D1QD 3LS4L 4H0HB 2LTQB 5D1ZD 1V5JA 4MZ3A 5ETUB 5F3HB 3IXTA 4J3SA 3OTTA 4JRYA 5GS0D 1II4E 4KROC 5DZLA 4GKNA 4GLRI 4HS8L 3GIZH 4XMKL 2OR9L 4G6KH 4M61B 4LGSB 1QP1A 2OS7A 1YYLH 4OKDA 5C92A 5JLZB 5DA0B 1QLRA 5GGVY 2XZQH 5D2LA 1WZ1H 2OJZL 5GS0L 2BHUA 4G7YL 4JHWH 1NFDB 5DZOA 5D9SA 1OARH 4P23B 1OGAA 1NCBL 5DQ9B 1KXQE 4TUKH 3ULUE 1J0YA 3MRRB 4LCWD 5MENA 2DLEA 2FO1A 4R7DA 3QUYA 2X4OB 5KW9H 3VGGA 3ZL4H 4Q6IA 3MRCA 5DMKB 5J57B 3M8OH 1DVFB 4OZFB 3GHEH 4OKVA 2YSSA 1ORQA 4J6RL 5EZIL 4RWYH 1VENA 1HYRC 4PG2C 4Z7WA 3C5SA 3THMH 3MRNB 1D9KD 2FO4B 2X09A 3T1WA 3QG6A 2G75B 2I9TB 1MCNA 3QEGH 4R0LB 4M5ZL 2J2ZA 2NTFA 5D5ME 3ZKQD 4GAJL 1FAIL 1F90H 3DI2B 2VB5A 3DX8A 1CLZH 4RFNC 4JFFE 5GGVH 5EG6C 4Z6AT 2OTWA 2YN3A 5HGDB 2FRGP 2WAHA 4ZUSA 4PV8A 4G8EA 2JB5H 2HJKB 4PJAE 3SO3B 3L5XL 1Z9LA 5TF1H 4GRLC 3RRQA 5HPOA 3BI9X 3OKYA 3V0VA 5F1SA 3B4NA 4NQEB 3EZJB 3TVMA 5HTSA 2R2CA 3LY6A 2HTKD 5HPMB 2WK2A 2R23B 3RWJB 1MVFA 4U4BA 2YD1A 1JZ8A 3EFDH 1FIGH 2XWTA 3G5ZA 1T1ZA 5L88L 4HXBL 3EIFA 4X4XA 4X5WB 3ZZ1A 1Q94B 2GTWB 3GMMB 4BZ1L 2OI9C 2M26A 4P2RD 4P59L 3SOBH 3NZHH 5EOTB 4PGCA 4YDKL 4G6ML 4K7FA 3Q6GL 3ULUH 2V5YA 1YN6B 3V5HB 2DLGA 4WJ5B 3H8NA 4Y5VB 4HF5H 5IKCA 3BDYL 2I60H 2A0LC 1K6QH 1HOCA 3QH3B 5E2WH 5EFIB 3ZDXF 3DV4B 3MROA 4RMTA 1JGVH 4LNRA 1JWMB 2F53E 5BZDA 3BQUD 4Z7VB 1MRFL 1HINH 3ULVD 2VQ1A 4LBEA 3V9FA 1FZKA 3QQ3A 2ESVA 4OQ1A 1NUFA 3KXFB 1J8HD 4PREA 1D5IH 4U1JA 4HWBH 3DSFH 3VFRB 5EH1A 3LZFH 4PGEB 15C8H 5ANMB 4IOFC 3IETB 1EHLH 3CSYA 5CFHA 4DN4H 1I9IH 5EORH 2X4PB 3HMWL 4J8RB 3W9EB 4L4TE 5CMAB 2E5EA 1Q38A 1YQ2A 1T0NB 5C0CE 4IS6A 2J7LA 4RNRA 1T0PB 3FT3A 3L5HA 1T2QH 1YEHL 4WW2F 4G8GB 5ISZB 4EJ1C 1FL3B 4IJ3C 4MSWA 4HCRH 1Q8MA 3PHQB 5KSBA 4XMLH 1FFNA 1FN4A 4FFVD 3ARFB 1FH5H 5I1HL 4OB5L 1VERA 2HKFL 1TJGH 2HVJA 4Y2OA 3U9PH 4AZ8A 5I1EH 4OIBA 1REIA 1X5YA 4OLXL 4XPAL 4GSDL 2J8HA 2E9BA 3TFKC 2IPTH 3QPXL 4P9HL 1BBDH 4I18B 3SKMA 1UH4A 4HZAA 3VXUB 1IQDB 4W4OA 4N0YL 4F7CA 4RX4D 1OP5K 1EGJL 5B8CC 3U0PA 1I3GH 4M1GL 2E8YA 2OTPA 3S8WA 5L0QB 5DC4B 4HKBB 1MCLA 4UIKL 1A8JH 4XNYL 2F8VA 4QOKB 4E41A 3KVQA 4PV9A 5DRXB 5MHSD 3KJ4C 4U1NA 3PHSA 1YEDA 3FFDA 5D7IA 5ESVB 4JQIH 1OVZA 4TTGA 3RI5K 4CVZB 1A6VH 1H3TA 4JRYE 2W60A 4CMHB 3EYQD 3RUGA 3L7FB 1ZANH 5A1AA 4LEXL 4M48H 1HH6A 4ZS6C 1VSCA 2GJ6B 1T21B 4Z8FH 4A6YA 1R3LA 5E6YA 4X83A 5ICXA 5C07A 1A4JA 5LGJA 5D2LE 3LVEA 1I1AA 1RHHA 4C56D 1XGYL 5D2NA 4IRSB 4X9IA 2BHYA 3N85H 3QBTB 1DZBA 2R69L 1OGAE 1B4JL 1H8OA 1KGCE 2GTZB 5IB3B 2VLKA 4NPYA 4K07A 4WVRA 1J1XH 3K2UH 2IAMC 1U3JA 4N5UA 3UZVB 3HMXH 3H0TB 3BKML 3BIBX 3BIKB 4FQXB 3IRZA 4EQ3A 4EVNA 5DYOB 4FN0A 5IVZA 2YRZA 5JIPA 5E8OA 1R3KB 3GSWA 4R6UA 1MCSA 4GW5A 5IB2A 4O51A 1NMAL 3HR5A 2H6PA 4Z7WE 5C9KA 5HVHC 2DQCL 3QFJA 2FZ3A 1CR9H 1WGOA 1JPSH 2EC9U 2I9LA 2Q8BL 3FO2B 1X5JA 1A3QA 4LSDA 5FGBA 4EI5D 5ALCL 4LGPB 1KLGB 4RWHA 4NHCH 5K93A 3NPSB 1ZSDB 3S5LB 3V95A 1IAOA 4XPFL 1CBVH 4HZLB 4I4WA 4R2GD 3KR3H 2EYTA 1BFOA 3ES6A 1AXTL 3MLYH 2P49B 1U95B 4LVHC 4OCMC 5J3HD 3PIQA 3PGDA 1JF1B 3QDJB 2VLJD 2P5WD 3ARWA 1EFQA 4GJTB 2HTLD 2ZKHL 4Q0XL 2F5AL 2Q6WB 32C2A 1AXIB 2R4SL 2VDPH 4Z7QE 3EYFA 3WN5B 4TSCL 3TN0D 4OCSL 1YMMB 1SVCP 5JNYB 1CE6A 2V6HA 4G9DB 4JDTL 3HNSH 4UUJB 3DVNB 2CLVA 4JRXA 3NFNB 4AY0A 4LCCB 4WV1C 4MB3A 2ENYA 1GH7A 2ATPB 1KCRH 2EC9T 1S7SB 2DM2A 3INUL 4O9HH 3MLUH 3RKPA 3WNMA 4KPHH 4LKCA 1UJ3A 3VXPB 3TWCL 1NKRA 2R56L 4JO3H 2EDEA 3HG1A 5I75B 3WIFB 5HYJD 4K2UH 5TE4H 3JVGC 2GYSA 3C6LA 2ESVE 1OLLA 3I02A 2LV4A 3SJVB 4I0CC 4O2CB 4FXLA 1M7DB 1UA6L 4NKMB 2IH1B 1ZEAL 3TO4B 4UAOC 2NYYD 3UTSB 5J4MA 2DDQH 4WCYH 5FHBH 2Q7YA 5CHNA 1KB9K 2Z4QA 3IXAB 4P5TD 3V5KB 1YEFL 2HT2D 4H25B 1RQ5A 1JI2A 1U8QA 3MRHB 3HTLX 4WFFD 1LVEA 3QO1B 4JFHD 3S7GA 2CH8A 1F8TH 5C2UB 4HK3N 2VYRE 4HX1A 5DD5L 3L3IB 3ZDYE 1EHAA 1KPRB 3HPJB 3S37X 1S7VB 2IWGA 3VXOB 5KG9A 1XGUA 4JZNB 4OGAC 3NCJL 3BZ4A 2NQCA 2NCMA 3KNBA 3IFOA 3QCUH 5I9QC 4W6WB 3GKWL 4HJGA 1NL0L 5FO8B 2YS4A 3M1BA 3P0YL 3CNKA 3KPSE 4BH8B 3WEXB 4UTBH 3FQWB 2WLYA 5IMOB 4DQOL 4L3ED 4YWGH 3SGJC 1IAIH 4OFYA 5DJAA 3NZ8A 2CO7B 4ONFL 4N0FA 3WKNA 4YJZL 1WFTA 5B38G 2H1PH 3DUSA 1J05A 3AREA 3MJ7A 1C16A 3D69B 4YFLI 4IMLA 1MUJA 2X4QB 5AYQA 1CU4H 2Y36H 1SYVB 5IBLC 3F7QA 2V2WB 3JWOC 1ZA3B 1IC4H 1P1ZA 1ORSA 1JTOA 2QADD 3FHQA 4KRNA 4JR9H 5SWZD 2PYED 3U7YH 5E7FA 5JW4R 2DQTH 5D7IE 5T1LB 3CDYA 1ZVHA 1JNNH 4DAGH 1U8KA 4G7VL 1MCPH 5CBEA 3IF1A 4O4YL 1AD0B 1T5WB 3RUGE 1QLFA 4U1IA 1LO0L 3OGCB 3VXME 4DGYH 4JG1L 2ZOLA 4DKFL 1I8KB 5E8EA 3CLEL 3AMLA 4O2FA 5IW1A 4N68A 4GQ9L 5FYKU 4UOW0 5C07E 3ARDB 2P5ED 5M95B 1A9BB 3T0AA 3NMEA 1UADC 4XVJH 1N8ZA 4WDIB 3GBLA 5D2NE 2Z35A 1C1EL 4M93C 1MFDH 2JK5B 1YPZF 2WP3O 1G9NH 3DROA 1G1YA 3SKJL 4X9GA 2VLKE 4XPGL 4PJ8C 4OI9A 5FYJD 4M7KH 3BT2L 4GW4A 1WEJL 2VH5H 1EAPA 4JZJC 4OFIA 4Z5RA 4HS3A 3QCTL 5H2BA 4FTVA 3KYNB 4YUEH 2NW2A 5JDSA 4KVCL 3GFUA 2YSSB 3QFJE 3RWGA 2A6IA 1JK8B 3J8F7 4OM1L 3CUPA 3GMPB 4OFVA 1DR9A 5FYJL 1EBAA 5C0JA 3F12B 3D3VE 2NY3B 2PXYD 3S36H 1PQZA 1DDHA 2JELL 3C5SB 1QTYT 2W91A 3P73B 1BAFH 1CFTA 5TDNB 4UU9A 2PW1A 5H35A 3O41B 4JO1L 3QG6B 1IGML 3VGAB 4WUUE 4GAGL 1LE9A 1IFHH 5ITBH 1KC5H 2VERN 4FQHA 5CCKH 2NLJA 3ZKMC 1V3KA 5D70H 3WXVH 4PV8B 3IJYB 3OKMA 4ERSH 3TT1H 4G6AC 4IRJD 3SE8L 2FBJH 3J7HA 4NO2B 3TA3A 5I71B 3TPUB 3V0VB 1PY9A 1BD2A 4NN7B 1ULVA 5K9JH 3O8XA 4NCDA 4NKIL 4A6YH 2AXHA 2GJZB 1IAIM 3BSZH 2F8OA 4JRXE 3N0PB 4KDWA 3GIVA 2MQ0A 4J7RA 4J4PD 4LASL 5DC0A 1MCCA 3G6AB 4S10A 2ZJSL 5KSAB 4XP9H 3MCLL 5IV2B 1OTTD 4FQ2L 4WEBL 3QXDB 5EZJB 5GRWA 1DBJH 2GEEA 3OG6B 3O6FA 2J5LB 2FHCA 5IF0A 2PYFB 2WW8A 5CSZA 3VFUB 2KPNA 1D5BA 1L7IH 5GGTA 3NABH 4KMTL 4K7PY 5GRVL 3C60C 1U8PB 4F7TB 4MAYD 1KJVA 4PRPA 3UPAA 4KVNH 3QXAB 3QRGH 4I3GA 1NUDA 3PWLA 1U8OB 3QHFH 4PREB 4U1JB 5EULV 4GG8B 5CD5C 3O3DA 3VRLE 3P11H 3S4SA 4Y4FD 2PNDA 4HS6B 3ZE0E 3SY0A 4Z7OF 3Q1SL 4TOYH 4AIZA 4YPGA 1CE1H 4JPKH 3LEXB 3PP4L 2QV2A 3G5VA 1UKTA 5FIEA 3QWQB 2AEPL 1FSKB 5DFTA 4B5EA 3GMLA 3U1SL 4RNRB 5ICYA 1YUHB 4LKXA 4LSSH 2HRPH 4LDOB 4PRHD 2HLFC 3X12A 5KSBB 1HHJA 2APXA 3JV4B 1FN4B 3ARRA 5JO5A 3DETD 4DW2L 2EDBA 3FB8B 2ZCLL 1OTSC 5C09D 3RKDD 4FFYL 3EJZD 3VRIA 1H5BA 1QFWM 2HLAB 5AYUH 1ZT1A 4N0RA 3Q5OA 3QQ9D 2CGRL 4YHNA 4TULL 3WO4C 5I18H 4QO1A 1YN7A 4K9EC 4ODVL 1CICD 5T5NF 3ZT7A 1J10A 3WE6A 4TTDC 2EKSB 4YHPB 4K7PH 4OF0A 3U0PB 5JORB 4OZFG 3LOWA 4QRPE 3DMMD 4Z78A 2ITCB 1ZVSA 1QPPA 1CG9A 1TVBA 3QUZC 4KK8D 5TGBB 1QACA 1FYHB 4WI3A 1MRCH 3CIQA 4ODWA 3WJJA 3O3BA 5EA0H 1TNNA 2NXZD 4E41B 4PV9B 4GMSL 5MEOB 4WEUD 4FQCL 1IGFH 2FNBA 3WFDH 3MUGA 2XPGA 1BBJA 2C26A 2D3VA 2PO6D 3T0ED 5DUBB 3MBXL 1HDMB 3BWAB 5T3ZD 5INCA 5IFJA 3ISWA 4NM8L 1ND0B 2FJHB 3LB6D 5JHDB 5T1DH 3NOIA 2XZCH 1HH6B 4MA8H 3T2NL 4OCXL 1WFNA 5I1JL 2N7BA 2XFXA 3F58L 2QQLH 3MLRL 2R2HA 3TNNB 2C1OB 4PJIF 1RUML 1MFEH 2F54D 3MNZA 5T3ZL 2AS5M 1INDL 3IDYC 4WO4C 4H1LA 4YDVA 4YHZH 3LEYL 1LE5B 4ODHH 4YDJA 5HI3C 2P48B 1AO7D 1MIML 3GJFB 5E6IB 4NWTL 4WWKC 5B4MC 3LN5A 3OR7A 2YHGA 1GGYA 4JPIA 1S9WA 3O6MH 4AEHH 3GSXB 4QF1A 1OB1A 2AXJA 4JM2B 4X98A 3QAZB 4G6FB 2UWEF 1TZIB 2FYYA 3WIIH 1R5WA 3FRPA 1NAMB 2VMFA 1RUQL 1HKLH 4AIXA 4C54A 3P4OB 2PTUA 1KSRA 2WWKO 4NJAH 3ULVF 3NCCB 5CZVH 4JY4B 4FQQB 4F33A 5IFAH 4JDVA 2XNAB 1XR8A 4ZO6A 4XPTH 4I4WB 4P2YA 3RIAF 1FDLL 3QEQA 1GZPA 3FRUA 3DTXA 2X41A 1HN1A 4WW2A 3WD5L 2R9HC 5CILH 4Y2DD 5T3XE 3I85A 1GYAA 3EFFB 3AAZA 3NIGE 5FYLH 1W72A 4DGIL 1CLOL 1VA9A 1BD2E 2W9EL 4XCNA 32C2B 4HUUA 4CMMB 4Y1AA 3FT4A 3IJHB 4I8DA 1IGIL 4KY1L 4LLUB 1NGZA 3L3JB 1CE6B 5DJ8A 3LQAH 4RIRB 2A83A 1W0YT 2Q3AA 4PLNC 1PX4A 4P5MB 5GZND 5FUCC 3KJ6H 3LEVH 4S0SD 2DBLL 1CDCA 4GAFB 4KXZH 1VFUA 5KS9B 1S9KC 1RIUH 1P4LA 3W0WD 1H3GA 4BQBA 3E6FB 2I26N 3E6HA 4U7MA 1JCKA 1QSFD 1TZGH 2OZ4L 1QYGL 4M43H 4JKPL 1K4DB 4XI5D 3U7AA 1RK0B 3QR2A 4IOIA 2NY2D 3DYPA 4QRQA 3HG1B 5DS8A 1A14L 1P9MA 1G6RH 3C08L 4ENED 1ZA6A 3BPNC 5LGHH 1JPTH 5FGCE 3DUUA 1FP5A 4PRPE 1CTNA 1T20A 2O61A 1U8MA 2KZ1B 1X5HA 4WI5A 4GXVH 4L8SC 4KTDL 4NGHL 5I1IL 4G43B 3X3FL 5IFHH 4ODSH 2Q86A 2CPCA 1T66D 4P9ML 4KJPD 3DGGA 2VDLH 5F96H 2W65A 4I48A 3CZFB 3BVNB 4Y8DC 5ACLA 4Y4HC 2YA2A 2J8UF 3BOVA 4CUCA 2WM0A 3RL1A 4NC0B 1ZE3C 4K71C 4ZD3H 3RVWC 2RHEA 3ETBF 2NW3B 1G7MA 1R3IL 4HPOH 1YY9C 3S34H 4GKOA 4OIIH 4QTHB 5K9OB 5AZ2L 1J1OL 5DO2D 3B6SA 4R96A 5T3XH 1X5ZA 3WHE1 3DOSA 2R1YA 2EICA 4PS4H 1E4WH 1XGUB 1CD0A 1CFVL 3CU7A 2D7MA 4LHUG 3IFOB 2X4RA 4WI6A 4TRPL 5DJCB 4HWZB 4XNXL 2O5YH 5D7LD 4J23A 3ZKSD 3M1BB 1AY1H 5IROA 4XWOC 4QRSB 2P44B 5JDJA 2WUBH 2D9CA 3BKYH 2VXQH 1F6AB 2YXFA 4X7DC 4ZFZB 3NZ8B 1XCQA 4N0FB 1RPQA 4EI6A 1OCWH 5EU6B 4DZBA 3AREB 3MJ7B 3ROLB 2CXKA 5I6XB 1NC2B 3AS1A 3WS6C 4X6BA 4PG9B 1SJHA 3QIBA 4HC1L 1CVSC 4LRIC 4I0PB 3QDAA 1BEYL 5GGTH 1ERNA 4HWNA 4P4RB 3S5LG 4IRZL 1KEGL 1QBBA 3QUXC 3HUJF 1QLFB 3MJ9H 4LLDA 1A5FL 4O02L 1N5YL 4PLOB 3KLSA 3DX6A 4JY5L 4TN9A 3K2MC 3FFCA 4KKBC 25C8H 5IW1B 4ETYA 5GXBB 3RX8A 1MELA 3V4VL 4P48A 1HQRA 4OLZL 1IM9B 1N8ZB 5CJXA 2Z35B 2RGSA 1AE6L 3JV5A 3KPTA 5CZXD 2DMKA 3NFPB 5FEBA 3VG9B 3DVFA 1ADQA 2AJYL 4PJ7B 3EDFA 1XH3B 4FRWA 4M7LL 2H2SD 4CKVX 2Q87A 1Q72L 2NX5D 5D7JD 1HSBA 4D9QE 2DQGH 5KTEL 2DQEH 3I84A 4L9LA 4PUBH 5IT2H 3TNMB 1KEMH 1EAPB 4FABL 5JZ7C 3V4PH 2J6EA 4Z5RB 4HS3B 4XVSL 5H2BB 5EBLB 3MRDA 2Q8AL 2BDNL 5J9PA 3ZDXE 3LRGA 2PW2B 4XBEL 4ZXBC 2YPKB 4FQ1H 4S1QL 4LCIH 2YZ1A 2A6IB 4PR5B 3CUPB 1AI1L 5F7NC 1JFQH 4ZO8A 3IDIB 5FO7A 3OF6A 1DDHB 1M05A 1FZOB 3LQZA 3EZ8A 2IALA 3G6DL 4R97C 4F2MA 2B20A 3DO7A 3UXFA 3PV6A 1PX3A 3BD4A 5H35B 5IB4A 3IDXL 4UQ2B 4HUVB 5C08A 1AIFA 2W92A 5C0AD 3OB0K 4PJ9B 3V52H 1BOYA 3GNML 3QEQE 1NDGB 4QHLA 4Y19A 2DJ4A 4OTXH 4HG4J 1PYWB 3ARBC 3VI4F 1EEUA 4Q9QH 1WWAX 1KCUH 2EDQA 4DOHB 2QSCL 3HC4H 3WDJA 1CLYH 4J3UA 3BUYA 1KPVA 1WIUA 3ME0A 5LWYH 4Y1AE 3OPZL 5ANME 1YC8A 3BAEL 1J0IA 2GITA 2NZ9C 3O8XB 4ZTOH 4MX7A 4P46B 3RY4A 2EDNA 4UMGA 4F58H 4KROD 1PJ9A 1QEWA 5C9JB 4H1LH 3IDGA 3LN4A 3L3DB 4X9FA 4BA8A 3LKPA 5F9JA 3IS1X 3L3HA 1E6JH 3CFEA 4H5SA 1LDPL 5CP3A 1UYWL 3MOQA 4LAJH 5ECJE 2VDOL 4QHUB 4GRMA 5IF0B 2JJSC 4S1RL 3QJHA 5FUZL 3HE6B 4WW1A 5E8PA 5B39B 4LQFL 3SE4C 4KRPC 5E00A 3SKUD 1S7TB 1P2CA 2IANB 1F3JB 3I50L 4D0DB 4I3SL 2KKQA 4V1DD 4JB9L 3HZMA 3S36X 3KLAA 4Y0GA 2XQBH 2EYSA 4YNYB 1FFQA 2BOCB 5IIEB 5GQBA 5EBWA 4JG0L 2B39A 4E9LA 5KSVB 1S3KL 4IMKC 4KU1A 3NBNA 1R5VB 1VFOA 2FSEA 1KULA 4JFOA 3ECBB 5IM7A 4POYA 3DGCR 4XAWL 2I07B 3BGMA 1UACL 1YPZA 3AXLB 1CGSL 5ICYB 2WIIA 5KAQG 1QBMH 1C5DB 2VXVL 1P7QB 3E3QC 1FCCA 1HHJB 1F58H 1DLHB 4CW1B 1RZ8A 1W72H 3GMNA 1LK2A 5BVJA 1A1NA 4ZFFB 3T0VA 1J88A 2OP4H 1R0AL 4P2QD 1NGXB 1ACYH 1UWEH 5F1KC 5J12B 4G8FA 5EBMA 4B41A 4D0CA 4YHNB 2IG2H 4GRLD 1JPFB 1A22B 2WWKT 1CFBA 2QKIA 2BNRB 1NLBL 3CU1A 2CMRH 4Z78B 1QO3A 4GBXA 3VJ6A 1CG9B 3IFLL 1GIGL 4OT1L 3ULSA 1PGRB 1E4XH 1UT9A 1I4FA 5F6HI 2VUYA 3O3BB 4K55A 3VG0H 4M6OL 4FOMA 4ZUWA 3HB3C 1FYTD 1NCNA 5DVOA 3RWDA 3BYYA 5ADPH 3GI8H 1ZT4B 4R4FL 4MDIA 3MRKB 4I3RL 1DE4A 3OAUL 2OBGA 5INCB 3FFCE 5BRZD 3RVXC 4U0RB 5GIRB 1KACB 1Y18B 3U6RB 4PY7B 1A6UH 1K3IA 4Y4KA 5LBSH 4CDGC 1DQDL 2A0LD 4ZS7L 1SBSH 3RA7H 4LLMA 4F7PB 4PJ5A 2R2HB 4YBHA 4G42B 5IOPB 2IQ9H 3O81A 3MNZB 3RGVA 2AABH 5I16A 1EERB 4HK3J 4YDVB 3OHXA 2KZWA 5L6YH 5FKAA 5SWSB 3CFBA 4HKXA 4XP4H 5FF6A 2LTQC 4GW1B 4XVUC 5BMFL 1EK3A 2AI0H 3C8DA 4BSVA 4IOFD 5ESAA 3LN5B 3CPLA 2M1KA 4NHUB 3OR7B 2Y25A 5IEHB 2JJTC 2C5DC 1D6VL 3DX9A 4K8RL 4NQXA 5DQDL 3KPRD 3QG7L 5CINL 2ZUXA 6FABH 1IM3A 2PCPB 5CJQH 3AU1A 4FQIL 2EECA 3EUUA 2PF6A 3CMOL 1R5WB 2BNQB 3FONA 2WBJA 1XGPA 5GJTH 3TV3L 4EBQL 4K7PX 4O5LL 4P23C 5D1QA 3R8BB 2DI9A 3STZA 5D1ZA 5DHVB 1UEYA 3L5JA 5C08E 3RNQA 3TFKD 1QFPA 1JTTA 5DT1H 4UDTB 5MP6L 1KCVL 2X2YA 4LCUA 1Q9WB 1DVFC 3AMKA 5H94A 1QRND 1P6FA 3ZYZA 5HD8C 3N1PC 4E0RA 1OW0C 2YD4A 1OAQH 3BN9C 4YK4B 1U8JA 4K23L 4HMEA 1A0QL 4OM0H 3Q2CA 3QULB 4U6YA 1UXSA 3KPPB 5I0ZA 5F6HJ 3HPLA 2B1AH 4QXGH 5T33L 1NANH 1MCQA 4I9WD 1AXSA 2VC2L 4XCNB 4JLRA 3WUWB 4HUUB 2E7BA 2DYPB 5E08H 4LCWA 2LU7A 4JFDD 1HXYB 1RJLB 4R0LC 3E2HC 1IGYB 3NFSH 2VN7A 2ZOKA 3RTQB 3IDNA 4U1KA 5EU5B 5HHQA 2I5YL 1MAMH 2W9DH 4NZUH 1ADQH 4ZS6D 1KF9B 3X11A 4F37K 3JTSB 5TF0A 1MQ8A 4KQ3H 1G7LA 4LLWA 3HZVA 3RWHA 4D0BB 1FNGB 1P4LB 1T04A 4DCQA 4JGJA 4RBPK 4QTIL 4WI4A 2VZVA 2P46B 1KTDA 1GAFH 2WBKA 1D9KA 2H26B 3U4EA 1WICA 2J6EH 3CFCH 1D7FA 5E94A 2R0WH 1KG0A 1F4WH 1ROWA 4JCLA 1AH1A 1ZA6B 5GHWH 1A3RL 2VITB 4DK3A 5HVWA 1U8MB 1A7QL 1YYMH 3RAJL 5F7DB 1GPOL 2IAMD 1LEIA 2CO6B 3TBTA 1MQKH 1WIPA 4AM0B 2V7HA 2MSPA 4TPRL 4LMQI 1LO3L 2E9WA 4EZMA 3NCYP 3DGGB 2XN9D 4CU7A 2W65B 4U1SB 1MCDA 3OKNA 5FA3A 5I8EA 1FGVH 3MX0A 4PJIA 4Y5VC 2MJWA 3DVGA 3NCFB 3MQIA 1P6AB 1G7HB 1YPZE 3QCVH 2XTLA 4PJXA 2GK2A 2X1PA 5CEZE 1YJDH 3PWPB 3LSOA 4RGNE 4OLUH 4LL9A 4J3XA 3O0RL 3UTTE 2NXYB 3CVIL 1MJ8H 5C0RH 5FECB 3I75A 3OKKB 1ES0A 3VD7A 3QUKA 4P2RA 5EC1A 1D5ZB 2X4RB 5DWUH 3IJSA 3CXDH 2V7NB 1FFOB 5DD0H 5DQJB 1G9EA 2UWEA 2CR6A 3AC0A 2ADFL 3KDMB 4PJBB 4HUXA 4PJFB 2RCSH 3QIWC 2W0PA 3M17A 3DXAB 3BQUA 1I8LC 3MTRA 1SMOA 4OLEA 3WIHL 3ARFC 5CP3H 3X14B 1J8HA 3B9EA 5F7MC 5HI4C 3MOAL 2XZAL 3VXSD 2RB8A 3CFIC 5DI8A 4I18C 2AJSH 2UVEA 2WZPD 1F00I 1JWSA 4XCCH 5CUSH 3V0WH 4OF6A 5KVMC 4S1SL 4BQ9A 2VZ3A 1NAKL 4G9FE 4ODUA 1LMKA 5L0QC 5DA4A 3VA6A 3DYOA 3Q5YA 2IPKA 1Q9KB 3N1GC 4BZ2H 1AP2A 1EGJA 3LPFA 2ADJB 4RA0C 5DEZA 5I73B 2FJGB 3U2SB 5BXFA 2E9JA 5LXGH 1VEMA 2Z92B 3VFMB 5CEZH 2Y7QA 3ARQA 3TIEB 2W07A 4CMHC 1ZHNA 4RX4A 3D6GA 1EIBA 2CKBA 4M4RA 4XCYB 3BX7C 5I17B 3HI6L 1GC1C 1KB5A 4NIKB 4JFFD 5E7BA 5EIIA 1ZS8B 5ACZA 1OP3H 1GVIA 5D6CB 4IRSC 1ONQA 1H3VA 2CLZA 3BZFA 1XF2B 4ZFOL 3P77A 5FK9B 5EZOH 4OGAD 5FO7B 1ZWIB 4ONHA 2AEWA 4U1MA 4OF3A 2QSQA 2HG5A 4YHMH 3ILPA 3PV6B 2DJSA 2OL3A 1JZ4A 2PTTA 1BIHA 2I24N 3L3GA 4Z7OE 5IB4B 2APFA 1IQWH 3T0BA 1ITBB 4FQXC 4DGVL 4PTTB 4HLZG 2J8UA 2ZPKH 5KVFH 3TIDB 4Y19B 1R24A 4HK0B 2D7TH 1ED3A 1IZJA 1L0XA 1LP9F 3WFBH 4NUGL 5E1HB 1M7XA 2YPLE 4C56A 4DEPC 1XF3A 1BIIA 4LLAA 1JHLH 5F1NA 5IBLD 4GQPH 1KJMB 5IMLA 1VGKA 1KLUB 1KPVB 1PZ5B 4TQEL 2BMKB 1AGFA 4LCWE 3FMGL 2OK0H 1B6DA 1KBGL 2AW2A 2Y9RT 4ZSOB 4MD4B 3QA3A 3EBAA 3NPSC 3ARTA 2ARJQ 2F53D 4NO0B 3UJTL 4XRCA 4EDWL 1S9YA 5C0GB 2EDWA 1OLZA 3UYPA 4YXHH 1JHKL 5BO1H 4RAUA 5C0IA 3JWOL 1NCUA 4X4ZA 2R29L 1K4CB 2A74A 5F9JB 1QR1A 5AD0B 1ZHLB 3CFEB 3QB7C 4H5SB 1L0QA 5DJ6B 1NBVH 2VKWA 4J3VA 1LEGA 4IHOA 4GRMB 3BPLC 2B0SL 2A73B 3LS4H 3QJHB 4PJDA 1YEKL 4PBVC 3BGFB 3WN5C 5E8PB 3P9LB 1UZ8B 3QEHB 3B83A 1NCDL 1KTLA 1T6WA 4PGBA 4PJ8D 3TH2T 2XOTA 4HFWA 4XMKH 5J6HA 3BP5B 5SWQB 3E0GA 4LCCC 5IJKA 3HUJA 2X6MA 4RQQA 4QT5B 3LKRA 5DJXA 3PWNA 3WUZA 4NQSA 3H6JA 3V4UH 2DM3A 1KFAL 2VLJA 1Q9OB 2OJZH 2P5WA 4PJIE 1BFVL 5GS0H 3GSVA 4UILH 4G7YH 3TCLA 2LE9A 1Y6KR 1JF6A 5LKNA 2IGFH 5I75C 1PEZA 5DRWB 4JRWA 4DN3L 3NCMA 3OZ9L 1CGYA 3O2VL 5F9OL 3TN0A 35C8H 4M5YL 4XTRC 1JYXA 5CKAA 3DECA 4QYOA 3LCYA 3T77B 3QNZA 3MFFA 4UT7L 4L4VB 4TSBH 2MTPA 4C83B 3GMNB 1IZKA 5DEFB 1ZGLB 5TE7L 4J6RH 5I0DA 4MJ5A 5EZIH 3H9HA 5C0EB 2H9GB 4KXZI 3ZKMD 1X6NA 2UWEE 2CUIA 3BZEA 3P4NB 4G6AD 5I1KL 2CJUL 1MI5D 5HYJA 3IU3B 5IHZB 3ULVE 4M5ZH 1J5OL 4ZOEA 3ZTNH 3NVQA 1FAIH 4PGJA 2VDQL 3O4LD 1I3VA 4PRDA 2OR7A 2ICWB 4LDLB 1EMTL 5JPMA 4NQTA 4YXKH 4PP1C 4ZUWB 2VAJA 1MJ7L 4RZCA 2K1MA 1A7OL 2EXWC 4P5TA 3UYRH 3MGOA 4AQ1B 4MDIB 2A9ML 5DC9B 3MV9D 3A6BL 4NWUL 1AKJB 1FORL 4JN1L 4KJQC 2AV1B 3O3AA 4RFOL 1C5CH 4NDMB 3IB4A 3GBNH 1NGQL 4Y4KB 2IQAB 2C3WA 5I1CH 2AJXH 5L88H 1BQHB 4BFBD 3BO8B 4PJ5B 4OZ4B 4HUWB 5GISH 3OQ3B 2ZUSA 3C60D 4HGKC 1CDHA 2D2OA 5E95B 4U7SA 2GAZB 5I16B 4XXCA 4BZ1H 1WBZA 4HUMB 3BKCL 4FNLL 4FZEL 4JVWA 3BD5A 5CIPA 4G6MH 4F80A 5CD5D 4RGNC 12E8L 4HKXB 1QVOA 1C7TA 1BVLA 4YR6B 5E9DD 4CJ0A 2JIXB 3DRTB 4L3EA 4LPUA 5DVNA 4LAQH 3WO3B 2VZOA 1U3YA 5FB8B 1IM3B 3ARDC 3VE0A 1MRFH 4J1UB 3BHBB 2DMBA 1HHGB 1A6WL 3MXVH 3P0VL 1YY8B 2HLFD 2B2XL 4IDJL 5SWZA 5MHSE 2PYEA 4QXTB 4OUUB 1K5NB 1XGPB 1OTSD 2EDLA 2NY6B 4G6JL 3SBWC 3SDXB 2KBGA 4KH2A 5B39G 1BQUA 3QDGE 5D1QB 3RWCA 4U1HA 1OPGL 3ULVH 3ZLQC 1BQSA 4J3TA 1V3MA 2J8UE 3VRJB 1YEHH 5ID1B 1N59A 5FDYA 1B88A 4WTWA 4Y8AA 4N8VA 4NNXA 5DUMH 2P5EA 3FO1A 4TTDD 4G3YL 1FVCA 4X7CC 5I1HH 1EJOH 1JNJA 3QUZD 2NY3C 4U6YB 1F6LL 4OLXH 1BJ8A 3V6BR 2AEIT 4GSDH 3L5WA 5BJTA 1VCAA 3ARVA 4P9HH 4QRUB 5HDBF 1U8NB 1U36A 1A6AA 1TCMA 4GRWB 3GI9H 4LFHD 4L8DA 2YD3A 5DFVC 3VGAC 1PD6A 2X4TA 3FN3A 1ZT7A 4UOJA 4MDJA 1EGJH 2EDKA 2ZCKL 5IESH 3MYJB 2NTSP 1GGBH 1UQSB 2GK0B 3UC0L 1JE6A 3CLFH 1S5HA 3QI9B 4XNYH 3IKCB 4JFZL 4FXGA 4PTUA 5DSCB 3RWHB 1R6VA 1A7NL 1T04B 1JHTA 2PTVA 5A43C 4ZMAT 2CKBH 2PXYA 3F6IA 4TNVF 1MCBA 1CGWA 1KTDB 4I2XB 1GSMA 4NN7C 1TXKA 4WO4D 2XACC 1WFOA 1KG0B 5HI3D 4NP4L 4AH2B 4L1DA 2AXFA 5DDHB 1QSZA 4OGYL 4WWKD 3H3PL 1VFMA 4M8QB 5B4MD 3REWB 3HUJE 5MEPA 4Q2ZA 4FG6C 5HHNB 3CC5B 3PGFH 5EC2A 3NGBB 2DRUA 1ETZA 3TBTB 5KSAC 3MJGX 5EWIH 4LLYA 2V7HB 2BSSA 1BECA 2VLJE 4MJID 2P5WE 4A2LA 1XGYH 5HYEA 2OL3H 4GAYA 1IJ9A 4IRJA 1INEH 3OX8A 4FMFA 2Y6SC 3MGAA 2R69H 3KPSD 5DRZB 4MNGA 2DQUH 5IBTH 3IDUA 3D39D 43C9A 5E8DL 4M6ML 4LSPH 5CD3B 3O2WL 2YZ8A 3LSOB 3REVA 3IFPB 3BKMH 3CH1A 4HUKB 2V2XA 4JREB 5C0BE 4B50A 2IADB 4PGZA 3FQRA 5FKPB 1IT9L 4J4PA 3I75B 4OFKA 5FM5M 1ES0B 2WQ8A 4H1LG 4P2RB 1RIVH 1KIQA 1ZGLP 2DQCH 4OSUL 1KIUA 3TZVB 5ALCH 3VXMD 3QUMB 4Z7UB 4KI1A 4ZNCD 5HYJE 2HJFB 1FNFA 1DFBL 3M17B 2DTML 5E99H 1HHIB 3BQUB 4ODXB 2G2RB 4XPFH 1C12B 3GSOA 4MAYA 1FNSL 2ED9A 1I8MA 3QDMD 5EUKA 3FRPG 3WFEL 1DSFL 2FHFA 3N9GL 3KG5A 3CDGA 4E5XA 3GGWA 1AGEA 2IBZY 4Y4FA 1MHEA 4WTXA 1CXEA 2OXGA 2GCYA 3VI4E 2NY5L 5E56A 1DUYB 2ZKHH 3N06B 4S0TD 3MLXL 1P69B 2F5AH 1U0QA 2OMNA 1JWSB 4BJLA 2LFGA 2R4SH 4R4BA 4X9BA 1YQVL 4F57H 2BOBA 4OCSH 1QLEL 4PRHA 1YZZA 1RUAL 4ODUB 5F88A 5KSUA 4FZ8L 3FCTA 4D94A 1H15A 2HT4C 3UDWA 1EEZB 1RUPL 3FOMB 5C09A 4F15B 5DJDB 2BVOB 5MERB 1HILA 4CGTA 3D3VD 2BJML 3INUH 3CMGA 5L9DH 1JPGA 1FLRL 1CDGA 4DOHE 3TWCH 3VFTB 4L3EE 5DR5L 1EZVY 2CKBB 1CICA 1VACB 1NGYA 4Y4HD 4WUUD 2A2QT 1IKFH 5JW4N 2XKUA 1JGDB 2VXSL 5TQ2L 1JRHL 1KB5B 4X8XA 2IF7A 3DMMA 5GJSL 5HHVL 2OYPA 3RVWD 3G04A 3OJVC 1YY9D 4C57C 5SWZE 2PYEE 5JXEC 2KUTA 4MJ6A 3B5HA 1ZEAH 1WAAF 4RMVA 5GS1C 1E4XI 4Y16B 4EIGB 1DLFL 1EBPA 1QQDA 2PO6A 2X4UA 3T0EA 1YEFH 4U1MB 5E6IC 4TSAH 2VDRH 4X80H 4NBXB 4XNZB 4YDIL 2PTTB 5FM8A 4ORGB 4W6YB 3OKDA 1UKSA 4ONGL 5FAAA 2CDEA 4XWOD 1SM3L 3KPLA 4MYWB 5C2BL 1N6QH 1NGPH 2YEZB 1MNUL 2R1WA 4JM2C 1KENL 1CIDA 3D0LA 5F6IB 2F54A 4XNUH 3L6FA 4HIJA 2IANE 3OXSA 3NN8A 4C56B 5AG9A 5EO1B 4ZUVA 2AJ3A 3TJHC 3VFWA 5IUSA 3GKWH 2BRQA 1P53A 1NL0H 2VZ1A 1MCEA 1AO7A 3O45A 5TPWL 2A77L 5DEGA 3P0YH 1VKXB 5FYJE 5CGMA 4HKJA 4HLJA 3AFLA 5DTFA 3QZWB 4O00A 5BQ7B 1T0MB 2VSDA 4DQOH 3FTGB 7FABL 4NNPL 4JFXB 1S9YB 1EEYB 3QUXD 1MH5A 5DUPL 5DK3A 4LPXA 2P8MB 2OTUA 4KKBD 5CIPH 3RWEB 1PSKL 1DQQB 4Y5XB 1PG7L 3MRFA 2GSIA 4X4ME 1FVDA 1KCSL 1OAYL 4ISVA 4EI5B 2A9NL 5DGRA 4M6NL 4WI2A 1JZ7A 1LO0H 4U1GC 1NSNL 4PJCB 3ARGB 4DKFH 1I1YA 3CLEH 5H37H 1RMFL 2D0HA 5I15L 4GQ9H 3DSNA 4OBRA 2HFEB 3BP7B 1B90A 2AJUL 4N9GA 3BPOB 1MLBA 5JZ7D 4KUCD 3LKRB 5DJXB 4URTB 4WHTA 2DI7A 4Y2DA 1FNAA 4ZFOB 1C1EH 5HYSB 1FO0A 2GT9B 3SKJH 4MNGE 1BQLL 3GSVB 3Q5TA 3QWOB 3ZHDA 4PRIB 1FC2D 4XPGH 6CGTA 3ILQC 1PKQB 4WENB 2FECL 2FEEI 2UYLB 2AK1L 3EJYC 3X13B 1CDUA 1NANI 2HH0L 3BP6B 3BT2H 1IKNA 3CSBA 4QRPD 3QCTH 3QNZB 3QHZL 5IVXB 1NJ9B 5FOBA 1QBLH 4KVCH 1JWUA 1AGDB 1NEZB 1A9EA 2YXMA 3W0WA 4OM1H 5FYJH 5TFSH 3ARBD 3C5ZB 1QSFA 5E5RB 2JELH 2WQRA 3SDCC 1KIRA 5E4IA 3BZEB 2HWZL 5JIIA 4APQB 3V5DB 5GRUL 4UV7L 1IGMH 2X4NA 2Q76A 4YH6A 4YGVA 4W68A 4GKSA 1N6UA 2IMNA 4GAGH 2NZ9D 5JW4Q 4MD5A 1CL7I 5GGQL 3FT2A 1U91B 2HFGL 4NC1E 4WI9A 3TPKA 1U8HB 4OZGF 2W1NA 5IVOA 3SE8H 1GOHA 1LP9A 2P7TA 5D1XB 4LARH 2AEQL 1ZHKA 1NBZB 4PRBB 3MMEA 1B4RA 1I3RA 1W0WB 1A21A 4NKIH 3UTZA 5CWSB 1NCWL 4MQ7B 1IGCL 3MODL 5T1KB 3GMRB 1S8DB 2JTDA 3A6CL 5DMIL 1FQ9C 5I6XC 5C09E 4LASH 4KRPD 2XTJB 4HMDA 1AHWA 5C6TH 2ZJSH 3OGOE 3MCLH 4I0PC 4FQ2H 4WEBH 4S11A 1I7ZA 5D7LA 4LPVA 4JZOA 3T2PA 2SEBA 4HC1A 3HNVL 2ICEA 5HHMD 4K3JL 5FHAL 3U36A 5CZKA 3RZCB 3SE9L 2QR0B 4ZUTB 1NC4D 3VFNA 4CJ1A 1X4ZA 3RBSA 3VG9C 5FOJA 1DL7L 2DQIL 4RAHA 5I8CA 4MA3B 3T0EE 1G7PA 3BUTA 4L5FH 1I85A 1R5IA 2DWEB 4YE4L 1CN4A 2Z91B 5T3ZE 3KPMA 2PN5A 1BF2A 4GO6B 2OSLB 3U1SH 4BZYA 3D18A 3PWJA 5JXAL 1N59B 3SCMB 4NNXB 4NUJA 5TQ0L 1F5WA 4DK6A 2F54E 1TTGA 1JN6A 4DW2H 4DUXA 3WFZA 2ZCLH 1MCRA 4FFYH 3UTOA 5BJTB 4NQCB 2NX5A 5D7JA 3HB3D 2I25N 1G7IA 3F7VB 4XX1E 2CGRH 3TH4T 4TULH 4WU7B 3D0VB 3MNVA 4Z7NF 4ODVH 4U1LA 4U6TA 4FQLH 5I2IA 3HRZB 4PJ9C 4YO0A 2BY1A 3STLB 3MA7B 3FAXA 3V6OC 3RVXD 3UJJL 1E4JA 5CJ5A 4C4KO 1VFAB 1QSED 3N1FC 2DQJL 4RA3A 4YAQB 1RIHL 2UUDH 3MZTA 4NO3A 1SQ2N 3PGCA 4YEFA 1WLHA 3P2TA 4GMSH 1NDMA 1JPST 4S2SB 4FQCH 4B7LA 3P30L 2PXYB 3UPRA 2ITDA 5DJZA 4PFEA 2HFFB 1N64L 3MOBL 3OWEA 1MPAL 3U46A 5IQ7H 4NM8H 4P46C 4P2OB 1KOAA 4IIQA 1YEIL 2CRIA 4XVUD 3B9KB 5C0AA 3O9WB 4AENA 2Y5EA 3AROA 3T2NH 1MCWW 4G80B 5I1JH 2AKRB 4JO2L 4JEGB 3MGTA 3D25B 4LLYB 3C8KB 1AGBB 3L1OH 4HJJL 5T3ZH 5TDOB 1INDH 1OSZA 1JTPA 3QNYB 1OAKH 4XMPL 1T83A 1ZLSH 2HKHL 4U05A 3R06B 1MIMH 4Z0BL 4F3FB 3AS3A 1TETL 1YA5A 3HE6C 4NWTH 1QA9A 4HIHA 2B4CH 2I27N 4JHBA 1FV1A 5HGGS 2MCPL 4P23D 5J13B 3HS0A 2ZUVA 4OCWL 2AK4B 4PB0L 4R26L 1R3JA 4OZIB 3ZDZF 1KCLA 2F15A 3QFDB 2QSTA 1T6VN 3W0WE 43CAB 1V3LA 1DVFD 1CFSA 1YNKL 4NKOA 2AQ3A 1T89C 5HD8D 1GJIA 4JFYA 3BN9D 3CAFA 1EEQA 1T22A 2VR4A 4ELKB 4HWEL 4W81A 1IC7H 3SGKC 2VDML 1MWAA 1Y6NR 4AEFA 3I6KB 3FQXB 3VWJB 1PY4A 4ODTH 4OD3L 3DO3A 5BV7L 3BZDA 1T1WB 4WHYH 4MCZB 4V1DA 4MAYB 4OZIF 1A1MB 1INQB 4EUPA 1FDLH 5CP7B 2R0ZH 1VESA 2NY0C 4OJFH 3WD5H 3HHRB 1MVUA 5HHPA 3JWDH 3MRJA 5A3IC 1MHEB 1LP9E 4XBGA 1RU9L 2YC1B 5DJ0A 1I9RL 2D7OA 4D9QD 4FS0A 1JJUA 2W9EH 1RURL 3I6LE 2GQHA 3BXNA 1U58A 4PG2A 1E6OL 3T09A 4HPYL 4ZAKD 5HGBA 3HC3L 2V17L 2IBBA 3DARA 1IGIH 5GGSA 4KY1H 4HIIA 4Z77A 1XF4A 3KPOA 1UXWA 3SDAB 2V5MA 3H9SB 1FO0H 5DRNA 3BMWA 1LK3H 2DBLH 1SY6L 2X4SB 3LV3A 3OKEA 2VXUL 5D7LE 2V2TA 3L9RA 2VABA 3FB6B 1MRDL 4WFED 3M45A 5J06A 1A3LH 2OZ4H 3VGEA 2W59A 4JKPH 1BF8A 5AZEH 1SEQH 3IU4L 4GRLA 4MXQD 4U0RC 1MF2L 4UB0L 1RFDL 4JFEB 3IFNL 2VDNL 4LGRB 2D7QA 4KZEL 1HKFA 3DMMB 3EO1A 1EVTC 3FHAA 5DJYA 4YX2L 1JNHB 4KTDH 4PD4K 1AQDA 3GK8H 5DURD 1U2CA 4OLVL 5LCVL 2V5RA 1C08B 2XRAL 4YIQA 3F7YA 3L95B 1FYTA 4NBYB 3KXFD 3RNKB 4X6EA 4BFIA 4BH7B 2BFVL 1N4XL 1OQXA 3LKNB 3C2SA 5JIKA 3OKOB 5JOEA 3OBAA 5LAXB 4WIQA 5BRZA 1MCWM 1GHFH 1H0DB 3HLAA 1R3IH 3C2AH 4NC1C 2DQDH 1WCQA 2R1WB 5AZ2H 1WVZA 3QIWD 3WL9B 4G8GD 1J1OH 2FL5B 5ISZD 2EDHA 3GIZL 3S97C 3LMJH 4AEEA 3L6FB 1B0GB 1DN0B 1VEOA 1YYLL 5AAMA 4AQOA 5IR1B 2JJWA 1CFVH 1HSAA 3ARFD 4LPWA 3FN9A 4G8IA 5DVMA 3VFWB 2XZQL 2NX5E 3CVHA 1AO7B 3O45B 1WZ1L 5HI4D 1GGUA 3T65B 5C0FA 4JHWL 3HAEA 5EPMA 3P4MB 8FABA 4DKDC 4ELMF 2CIIA 1IL1A 3KPRA 3QQNA 3MRPA 4ETQB 2L4OA 2ED8A 1FVEA 3IAQA 1ZHBB 4YK4C 5E6ZA 3D9AL 4K94C 4R4NC 2J4WL 4HDIB 4HC1H 4OZHB 2BC4A 2H32A 4YDLB 3GHEL 4FQJL 1A6PA 3CDFA 3IAPA 4QOKD 4DFHA 2VZSA 2NZIA 3KGRA 1BEYH 3RPKA 1X5GA 3BH9A 1KEGH 4IRZH 3SKOA 3THML 1H8NA 4O02H 4MXWH 5C0AE 3GO1L 5F7EL 3DIFB 3RTQC 1F4XL 4E42B 1OTUC 2VLLB 4M1DL 1J86A 1NBYB 4X5XA 2BSRA 1EDQA 1QRNA 4M9PA 4QHMB 3VD9A 1B2WH 3WLBA 3H9YA 3PJSA 5B8CA 4NQDE 1T2XA 2GJ6D 2Y5TA 2BY2A 1U92A 2PKDA 3I2CH 3TT3H 3QRFM 1KT2A 1AE6H 1M4KA 5GGVL 5F72S 4GS7C 3NCBB 2P47B 1M71A 1U42A 2JB5L 4IRSD 4I77H 4PJHB 5EO9A 1Q72H 5TF1L 3RVUC 1TJIH 1UB6B 1UENA 5TH2B 5KTEH 3MRBB 4JFDA 2ENSA 2AAVA 5DMJB 4FABH 1X5FA 3OR6B 1FPTH 1QHOA 3IGAB 2Q8AH 1K8IB 3GMQA 5A2IH 4FQXD 2LQRA 4XXDA 5GZOC 2C1PA 3DHMA 3GSNB 5AAWA 1AI1H 3UTPE 1IBGH 1TZHA 4DWHA 4OLWH 4PJHF 3G6DH 2NY2B 1WAAA 3V8CA 1YDPA 4ZFGL 3IVKA 2N1KA 1V3JA 4V1DE 5E2WL 1P5UA 1UM4H 4Q7DA 3GNMH 1MHCA 4MD5B 4TUOB 3VGFA 2IAMA 3EO0B 1MJJB 5CS7A 1TCRA 4X6DB 2YMXL 3TBWB 1UB5B 1QFUL 4LPTA 3WHXA 1YMHB 2QSCH 3FO0L 3O3EA 2E7CA 2XN9A 2Q7NA 4HWBL 4NN6B 4TUJA 2FDBP 1UM5H 3LZFL 4OFDA 2P7TB 3P0GB 3C9NB 1AD9A 1QSVA 1EHLL 3PG2A 1FGNL 4DN4L 1I9IL 4MA1C 1I3RB 5E0QA 1FBIL 2AJZB 5HDBE 3HE7B 2DKUA 1YNTA 3H9ZA 4N1HB 1JV5A 2LU4A 4TYUA 3SE3C 3MRQB 4HCRL 5GRJL 3O6KL 4OGZA 3STBA 4NM4L 1XR9A 1RK1B 3WIHA 1LDPH 3FKUS 1UYWH 1TJGL 4KWUA 4C4KT 1LNUA 2GFBB 2HA1A 4CADB 5I76B 4JZOB 4IOSD 4M7JL 2VDOH 5I1EL 5DLMH 1A2YB 3BP4A 4DZ8B 2X1WL 2ICEB 5FUZH 3G08B 3MCKA 2Z8WC 4ZTPL 5KVDL 5IQ9A 3KYOA 2A6KB 2HN7A 4L29B 1PDKA 4I3SH 4UT9L 1T7VA 4JB9H 4R9HA 4XTRD 2J3SA 4NRZB 3KYMA 1BZ9B 4FXKA 3SJVD 1T4KA 2BNUA 5I73C 4WV1A 2BCKB 4HV8A 1MWAH 4HKZA 2QSVA 1S3KH 3MA9H 3VXSA 1LEKA 1R5IB 3K8MA 3F5WA 3UTSD 4H8WC 4F9LC 1XGRB 2QQKH 2D03L 3B8SA 4JQIL 1UACH 4B0MM 4KUCF 1A6VL 4EUPH 1CGSH 3G6JF 5IW3A 5B38B 3Q6FB 1EJ6A 1OAZL 3NTCL 4M48L 2VXVH 4PJEF 5HGAB 2H3NA 1N5AB 4WEMB 4DKAA 4Z8FL 3JVGA 3GHBL 3D2UB 4PB9H 4LF3A 4RAVB 1C5BL 1KELH 5IGXH 4PP1D 5A2LH 2P8LA 2X70B 5F7UA 5GS2D 1NMCB 1A7RL 2LVEA 3MREA 2EXWD 1MIEL 4GG6B 1DUZA 2WINA 1R3HA 1M6OB 2YRPA 4KK6C 1Q0YL 2H2PC 2FEDC 1Z6JT 1CDJA 1I9JL 4YFLF 3K2UL 3NACL 5JQHC 1LD9A 2UY7A 4N0UA 1NLBH 2JCCF 4KJQD 1BWMA 4JFFA 3Q48A 1NEZG 5D93B 2DKSA 4JFQB 2CLRB 5DVKA 1GIGH 4OT1H 2BP3A 4RGOH 1YEJH 1FZMB 2ZCHL 1U8IA 3SO5A 4PJAA 2ICCA 2VTFA 4PLJC 5EUOF 1QHPA 2BHZA 1FNEB 1MHHB 3QXTA 3HCVA 3LPGA 4I3RH 4M02A 2ZWLT 4R90H 2WLZA 1JBJA 1PW3A 3OAUH 1IGJA 2IJ0C 4RGND 2DLFL 1JMXA 2VLRB 3VXTA 3UTTD 4NHCL 4WUKL 3CFDA 3TBVA 1DQDH 5I1AB 3SGJA 4JAMB 3KYAA 4WI8A 1G7JB 1HZHH 2XA8L 3KR3L 2OX5A 5CEXB 3ARDD 3JBG7 5DK2B 2GSGA 3VXRB 5DK0B 2R2BA 1FE8L 4Z95H 1LO4L 4GKZB 4KTEH 1KB9J 4JFDE 3BGFC 1F4YH 4LSUH 4HH9B 3RIFK 3MV8B 1FV1B 3BE1H 4LEOA 1DQLL 2F53A 3HS0B 1JMZA 4GBXD 3T1FB 1D6VH 4RGMB 1S7XB 2B5IC 5CINH 2D4FA 4KROB 3VFSB 1R3JB 3HNSL 4FQIH 4X7SH 3MLPA 3CVHH 3DV6B 4NKQB 2NR6C 1CFSB 3CMOH 4NKOB 1JUFA 3HAEH 1KCRL 1A1OB 5GPRA 3T2QA 4JFYB 4ALAH 3JV6B 4O9HL 1OY3B 5CJOL 1WAAE 4HEPG 2NY3D 1AJ7L 5EU3A 4CVUA 3VD4A 2YBRA 5K9KB 1RJYA 4BK4A 1EO8H 5F8QC 2H41A 4G9FD 3EO9H 4PJ8A 5MP6H 3HMXA 2H32H 4JFPA 4K2UL 3KHQA 5H37G 4KK9C 5DFVD 3PDDA 4JZJA 2O5ZL 3KLDA 2KH2B 3RHWK 5T1MB 2XN9E 3OKLA 3LRHA 4K23H 4XPHL 1BREA 4YHOH 1A0QH 3KWWA 2J1KA 3V2AR 2DDQL 4WCYL 5DJ0B 5JUEH 3V7AE 3ZE2F 3BMVA 1HHHB 1F6FB 5GGRA 5HGBB 3V6FA 4Z0XA 1XF4B 2C7UA 3BEVA 5GSRB 3F62A 3VFVA 4JKWA 2XWJB 1NUNB 3U4BH 1F8TL 3LKOA 3A0OA 3UP1A 4HGWA 5J6GA 4HEME 1MLCA 4FG6D 3MLVL 4WFHE 3LV3B 1BVKB 3UEZA 1SEBA 2V2TB 3RWIA 3PHOB 4L8BB 4KUZL 1JGUH 3N1MC 5KSAD 1I1FA 3QCUL 3G5XB 5HJ3B 4ZUUA 4Y5YC 4C58B 4P2QB 4KAQL 3MR9A 5DHYA 5I8OH 4X4YB 1BM3L 2GW5A 3QIUB 2Y07L 3BH8A 1DBAH 1YEGH 2Y6SD 5F7HA 1MI5A 3CK0H 2MNUA 2UVFA 3QEUA 4N1CA 4UTBL 5LQBL 3QHTC 3S96A 2DQFA 2R0KL 1CGUA 4NN5B 4GUPA 4IM8A 5BVPH 1HNGA 2EH8L 4DJMA 3EO1B 3KPNA 4NRXA 5DD6B 3GSUA 1HXMB 1MFAL 1LQSR 1A7QH 3O4LA 1CS6A 3RAJH 1QR4A 3LKSB 3TEUA 2H1PL 4KC3B 2YPLD 4PJGF 4FFWC 4MCYA 1CU4L 1M1SA 2Y36L 3VXSE 4YIQB 3F7YB 1FYTB 4X6EB 5C8JA 5I8KH 4JR9L 3BISA 5ID0A 5IVNA 3MV9A 3CX5J 1QD0A 1EAJA 2P42B 4DFIA 4DAGL 4KHTH 5L2KB 2MMXA 3OJDA 3VFPA 1AR1D 4PRNA 3RY5A 5BRZB 1WTLA 5BV7B 2OCFD 5A16A 1ZTXL 5GSVB 3O0RH 3PABA 5L2JA 2F19H 5DJ2A 5F9WC 1XAUA 3C60A 4HAGA 4OCRH 2AXGA 4HULB 4KGLA 1NFDF 2YWZA 4G8IB 2XY1A 2NY6C 5D8JL 2J88L 1WT5C 3FQUB 5AUMA 3WYRA 3EOAA 4OAWA 5JA9A 3K7UA 5CEYB 5IHBA 4QRRB 5E9DA 5EN2B 3SDDB 1T1YA 2ADFH 3WS3B 8FABB 1WBXB 3K8LA 1PKQE 3KPRB 4N0UE 3BGAA 2D9QB 1CD1A 4OGXL 3TBSB 3WIHH 1X7QB 1FVEB 2X7LA 4F37F 3MJ8A 4HBQA 4NO5B 3RL2A 2OQJB 1BZ7B 3MOAH 1F3DH 3SPVA 4LCYA 3E8UH 2IEPA 3RVTC 4X7TA 2FIKB 4YFDB 1HEZB 4OZGE 4P5KB 4MQSB 1BAFL 4S1SH 3BW9A 2ZG2A 5EO0A 4KZDL 2X89D 4ZQKA 1NAKH 5JHDD 4QWWC 1J9CT 3QI9C 2CIKA 1IFHL 3GSQB 4WY7L 5ITBL 5EU4A 3FN0H 5I66B 4D8PB 3DURA 2Z93A 3VFOB 1DP0A 3QUZA 5IMMB 4HSQA 4V2BA 5I30H 3IDJB 5D70L 5JXED 2R39A 3NCYS 2CK2A 4FMKA 4ERSL 4X0KB 5C1MB 4RSVA 4XCEA 2X9XA 4K8RC 2Y23A 5E6ID 4EN3B 3HI6H 2XT1B 3NGBC 1HHKB 2NY7L 4WU5B 5IJVA 1W0VB 1SHMA 2FBOJ 1Q0XH 2KQMA 3Q3GB 4XXDB 1IEAA 4JM2D 3VXNA 1IGTB 1P4IH 1S78C 1U3HB 2R4RH 4U3HA 4MA7H 1RJZA 2XWBA 1TZHB 1SJEA 3KS0H 5J56B 4EEEA 1AC0A 1DBJL 3PUCA 3TJHD 4WO4A 4EXPX 2DTSA 5CGYC 4Z7VF 2E9IA 3MV7B 4XC1H 4WWKA 4JREC 1MCHA 2R1XA 5EU7C 5BS0B 3NABL 3MLTB 1WC7B 4P99A 4HHAB 1NAML 1TCRB 4NUGH 4MXVF 2BZDA 3OV6A 3MCG1 2BVQA 4MJIA 1J18A 1V05A 3ZTJH 4MNQB 4P57B 1M7IB 3TZVC 4RDQG 3P11L 3P9MA 5JOPD 3KPSA 3MRLA 1X5AA 2P24A 4TQEH 4TOYL 2P8PA 5HHOE 3D39A 4JPKL 4WNQA 3BEWA 3FQNB 1XMWA 4ZOCA 1AGCB 2V9TA 3BWUC 3GMOA 4LSSL 4Z7NE 3I9GL 1JHKH 2FR4B 3W39B 3SN6N 3JWOH 3UTQA 2Y4SA 4JN2B 2F5BL 5JW4M 2VE6B 1KJ2A 4LHQB 2FLRT 1J0HA 3DX7A 1Q9LA 5IMKA 2BRRL 3QDGD 1J1PL 4NSKA 4XX1G 4Z9KB 4U7KA 4JDZB 3VXMA 2B0SH 4YHIA 1MI5E 4LLQB 1I7UB 3MCKB 3WFHB 3L7EA 3ILQD 2OLDA 1NCDH 4NNYB 5I18L 3KYOB 1U93B 2EDFA 5JPNB 2ZSVB 3O4LE 4K3DL 4K7PL 3HI1A 3PDOB 3QDMA 4WHYG 4Z76A 4OD1L 4F15C 1EHNA 3MRIA 4FXKB 4P4KB 3VU2A 1OWWA 4HJ0C 2RR3A 4LHUB 3RIAK 1TVHA 1T4KB 4LP5A 1Z0NA 4JANA 3JTTA 1KFAH 2OMBA 3MV9E 1XEDA 1J11A 3CZJA 3ROOB 3WFDL 5MEQA 4W6XB 5EZLB 4HW6A 4PRAA 1DTUA 3LHPL 1TDQA 4DN3H 3CH8A 3SDCD 2R2EB 3OZ9H 3O2VH 2ED7A 3KHOA 5T1DL 2ZSWB 3HZKA 1IRAY 3BJ91 4MA8L 1GGCH 3H42H 4UT7H 5IB1A 2MQCA 2IH3B 2MQ3A 2QQLL 1RZFL 3D3VA 4L8SA 2IPUG 2Z8RA 5TE7H 4Y16C 3ZDZE 3FZUC 4WGVB 4LF3B 4BSWB 3CXHJ 5INDB 5E9DE 4XNZC 1K8DB 1A6TA 1S7QA 4FFZH 3U0TB 5I1KH 4Y4HA 2WINB 2CJUH 4WUUA 1BJ1J 5D5MB 1YEEH 1OF2B 4CNIA 4X6FA 2VISB 1J5OH 4X7FC 4KQ4H 4HFUL 4RMWA 4JFFB 3FB5A 2A6DA 5F6IC 2EZ0C 2VDQH 5EU6D 4XBPB 3QJFB 1MAJA 4PJAB 1NC2D 3DBXB 1S9XB 1QRKA 3WIIL 1HKLL 5ENWB 2RFXA 4I0PD 1JGLH 3CFKA 1IGJB 4NJAL 2X9YA 4JN1H 4GLRH 4QLRA 4OV5A 5D5MF 1UWXK 5C0BD 4RFOH 5IK3A 3FQTB 5AG8A 1FC1A 4JVPA 2R15A 5HVFB 2X9WA 4Q9CA 4JY6A 3O4OB 4I5BA 4Y5XC 1G0XA 5JOFA 5E1AA 5KOVC 4BKLA 4P3WA 1IM9D 3BKCH 3WS6A 1RZ7L 4FZEH 2CK0L 3GSRA 5IB5A 4EI5C 5HYQA 4G5ZH 5FYLL 3S9DB 3WJLC 4LRIA 4XNMA 4YBLB 1I8IA 2YUZA 1DCLA 3ARGC 2F53B 4JE4B 1HI6A 3QUXA 5HY9A 2VWEC 3A67L 2D7PA 4U6XB 4MNHB 3BPOC 4KJYA 1T80A 2E6PA 4LSRH 4XVTH 4JJ5A 5L8KB 4KHXL 3P0VH 3L3KA 4JO4H 5D6DC 2FHBA 3HRPA 4IDJH 1CT8B 1FFPA 3LEVL 1FJ1A 2O5XH 3MRMB 2EH7H 5TDPB 2EDOA 3NCEB 4XAKE 4QHNA 4G6JH 1NGWB 3TO2A 4L4TB 5FM5O 3L3OA 5C0CB 1TZGL 1OPGH 4OD2A 4M43L 4POZC 4ZO9A 5F3BB 2YD9A 4I0KA 1BP3B 4XB7A 3P40A 3QO0B 3D85B 1JPTL 3QNXA 2QQQA 1HCFX 2HJLA 4PJ9D 4G3YH 3RZWA 3G6JA 4MJIE 2FWOA 2VQUA 4X6CB 2DI8A 1F11A 4UIMB 3C5ZC 4PJEA 5IFHL 4ODSL 4HIXH 5F96L 3D39E 1ZLUH 4APQC 4K9EH 2EIZA 4ZPTB 5JW5A 1NFIA 1RZKC 3U9UB 1W8NA 1DEEA 1ZLVH 4ZD3L 2GUOB 4BK5A 4QRPA 1UVQA 2ZCKH 5E5MA 4HPOL 2R0LL 4P46D 4PLKC 5ESQA 4OIIL 3S34L 4CVXA 3LKOB 2LAAA 4ELME 5TE6H 3QYCA 4XNQB 1MY7A 4X6CF 1G0YR 3MBEC 4A2MA 4PS4L 1HWHB 1SEBB 1A7NH 4ZDHB 3RWIB 1YNLL 4NYLA 2JCCA 2H8PA 3ARBA 1MREL 3IXTB 5D1XC 4JRYB 1TTFA 2O5YL 3H7BA 5FO9A 2GI7A 1AY1L 4GKNB 3BH8B 5EUOA 2W0KA 2VR9A 2WUBL 3HE6D 4OGYH 2G5RA 2VXQL 3H3PH 3QQ4A 3QDME 1VPOH 1QLRB 3KPNB 1KN2L 3MLSH 2XTJC 3GB7A 2VAAA 5D2LB 4KKCC 4ORZC 2IAND 3EYOA 4Q9RL 3W9DA 3ESUF 4MCYB 5FUCE 1IEBA 2DJUA 2FCBA 5D9SB 1OGAB 4QY8A 2WIMA 5MENB 4HQQL 4L3CA 4R7DB 5GGTL 3QUYB 5HHXL 4Q6IB 4KGJA 3MRCB 4M3JA 2JJSA 5KAQF 1G6RA 3RZCC 1GCFA 3O2WH 5A16B 4CL7A 4MGXA 4BUGA 4NT6A 2XI9A 4OKVB 25C8L 1ORQB 1IT9H 3SE4A 3G5YA 3W81A 4HBCL 2BSTA 1P7QD 3MXWL 1QFWH 1PBYA 3CX5K 4Z7WB 4PP2A 4H88L 4QRTA 1CDYA 2NY0D 3VD5A 2FD6H 4OSUH 2OR8A 2D7NA 2HVKA 3O11A 4LVNB 4IMKA 5A3ID 1T1YB 1RUKH 3RDTC 2NTFB 1DFBH 2DTMH 4PJHE 3SCMC 4PUBL 3UBXA 3DX8B 5D71L 5JHLL 1K3ZA 1HQ4A 3NA9H 1KJ2H 5BZWA 4F7EA 2OTWB 3V4PL 1NC4A 4ZUSB 1X4XA 3T8XA 4G8EB 2BNRD 1DSFH 3RL2B 3SDYH 3EYVA 3BKJH 4FQ1L 4MD0A 4LCIL 4LSVH 3MO1A 3TVMB 4X7TB 3UMTA 1OM3L 4UINL 5FDWA 2XWTB 1YQVH 4JQXC 5I74B 3G5ZB 2Z31C 1T1ZB 2HT3C 4X4XB 4EUPG 1QLEH 3WO4B 3B9DA 2ADIA 4DVBA 3DI3B 4FZ8H 1LWRA 2VN4A 4F7MA 3T3MF 4PGCB 1DBBL 1RUPH 5EU4B 4K7FB 2YPVH 4OTXL 3KYKL 3U7WH 5ADOL 2BJMH 1KCUL 5IKCB 3RQ3A 1HOCB 1XGTA 5F21B 3WNNA 3MROB 4LNRB 5SWSD 4P2OC 4EDXA 5BZDB 3FOLA 3PQYE 3PL6C 3B9KC 3MJ9A 4HIEA 3AGVA 3O9WC 2VQ1B 4LBEB 3TBYA 1FZKB 3QQ3B 4ZTOL 2ESVB 2VXSH 1JRHH 5HHVH 5GJSH 4M4PA 3S3SA 1QSEA 1EH9A 1RVFH 3CSYB 5E2VH 3ABZA 3VXNB 4HMCA 5C0DA 1X3DA 1T03L 1E6JL 1D5XA 2BNQD 3HZYA 2Z0BA 4IS6B 3WLWC 4YPJA 1XZ0A 2DN7A 3FT3B 3IDYB 4PJGA 3IYLW 1S7UA 4YDIH 4NZTL 4ZPVA 4MSWB 5J13C 3T3PF 1C8PA 1F97A 5F3HA 1FFNB 5C2BH