1NCDH

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
221
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLEWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDKATFFCARGEDNFGSLSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
total genus 38
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdH02
1MCQA 4J1UA 3KPOA 3HN3A 3FFCA 3X12A 1QNZL 4OCXH 1J10A 3DO7A 1ACYH 1P4BH 1UZ8A 4AT6B 1KCRL 4O9HH 2AVGA 4TRPL 5C0DA 4OLYH 4OD3H 3QDMD 4G5ZL 1VA9A 3GK8H 5C0RL 15C8H 1RJLA 4NT6B 5ICXB 1A1OB 4XPBL 3LAFA 3QWQB 1WZ1L 4RIRA 4BQBA 1IKNC 2ZOKA 3QUYD 1F4WH 5GRJH 3UTSB 5J9PA 2E6PA 3I3BA 3KLHC 1RK1B 4QYOA 4MA3B 3PJSA 2YD3A 5CEZD 1OOAA 1MJ7H 4IRZH 2WP3T 4X4MA 2Z8SA 3UYOD 3MYJA 1U8NB 3VG0H 3BP4A 3IJHB 2QADD 4UBDD 3T8XA 3TZVC 5D72H 2UWEE 4XPFH 5CZVH 5H8DA 1SYVB 2F8XC 4F58H 1XGPA 2A6JA 5CJOL 1IRAY 2DQDL 4Z78B 4MD4A 1MWAH 3JTTB 2W38A 4H1LA 4G6ML 3FB8B 2B8OT 5J6HA 2Y1VA 5BCAA 1J8HD 5DSCB 3JXAA 4TSAH 3W0WB 1CL7I 2FD6H 5HGBA 4QY8B 4DQOH 2DOCA 4NQVB 3BP6B 1KIRA 1I1FA 2D03L 3BGFC 1RSFA 4R4FH 5DD1H 3SDAC 1LVEA 3ZHKA 2Q86B 1ZHKB 43C9B 1UWEH 2FB4H 2W60B 1A9BB 1NFKA 3BRGC 3TF7C 4PG9B 5JA9A 3ZKMC 4QXTA 4O9HL 2VXVH 3LV3B 4LNVA 5EU5A 2DKSA 4HULB 5GISL 3MSPA 1HQRB 1WIUA 5FB8A 4PJAF 3OPZL 2Y7QA 5E5RB 5BV7H 3C5SB 1X44A 2X4PA 2CO7B 2XN9A 1MFEH 1AR2A 1LWRA 2MKWA 5BO1L 1UVQA 3O3AA 4G7YH 2HFTA 4WDIB 4P5KA 5DJYB 4GRWB 5T5FL 2CXKA 4L8SC 1OARL 4ORGB 2VXUL 5HDQH 4Y5VB 4XC1L 2IH3A 1I3VA 4JDVA 1R3HB 4HF5L 4OKVB 1JHKL 5CKAA 3SJVE 2SEBA 3FOLA 3BDYL 2I5YH 1KJ3L 2EDJA 2ICEA 3MRIB 3RJDA 4U1JA 1IJ9A 1NUDA 2QR0A 4JDTL 4L3AA 4ZPVB 1GYAA 4K9EH 5MEPB 3L9RA 2CO6B 1TZGL 1JF6A 2ZSVA 3SKOB 3WE6A 2D4DA 4KHTH 2F5AL 2IGFL 4L9LB 1A8JH 2ICWB 2OR8A 5IOPA 1T0MB 2NY3C 2AJYH 3FQNA 5B3JF 1CGUA 3MLTA 2R69L 3VFUA 1WZLA 4H1LB 1BX2B 2EDWA 4UIKL 1YEGH 2A6IA 5IM7B 5KSUA 5A3ID 5A3IC 3K1KC 4Q7DA 5ESAB 1LK3L 3CZFA 4LLAA 1PFCA 3P9LB 1FORH 1I1AA 4G80A 5F6HI 5E2JA 1W72A 3A6BL 4FQ1H 3LKOB 1Q9LA 1NQBA 2IFFL 4JRYA 4XH2B 5FM8A 4RBPK 4MJ6A 4E42A 4A6YB 1MCWW 3ARTA 3KLSA 3QWOB 3ROLB 1QEWB 5SWZE 1E28B 4AZ8A 4QXUH 4AJ0A 4PLJC 2ZUSA 5CWSB 5L2KD 1F6LL 3GMNB 4K7PY 4G8EA 4P2QB 2DN7A 1OGAA 2VXUH 4PRPB 2AXGB 5IB1A 1LO0H 1DEEA 3MLRL 5DJ6A 3BDBA 4ONOA 4I4WB 4G7YL 5D1XA 4EN3B 5FHAH 3CFEA 2DWDA 1BFVL 3TVMD 4MA7H 1T7ZA 4KZEH 3WEXB 3W5MA 3GMLA 3QXDB 2DWEA 1CZ8H 1GZPB 4FQLL 3OAYK 2X40A 3RWCA 1CBVL 3O3DB 3O9WB 3MRMA 1PZ5B 4QWWC 3H0TA 3L3KB 5T1DL 4XRCB 1AP2B 1NDGB 4MS8D 3OR7B 1OCWL 3D85A 5I17A 3WFZA 1I7RA 5F1NB 5ADPH 3QXTA 2A9MH 1DUYB 2X4UB 5A2FA 2I07B 1Q38A 3RNQB 4I0PC 2HLAA 4XPTH 5EU4A 1QO3B 2IAMA 4X5WA 3O2DL 2OQJA 3E0GA 3RX8A 1JN6B 4AEIH 5HI3C 5BVJB 3OKDA 4X7TB 2IPUK 3EOAB 1IAOB 2B4CH 3ZHLA 3X17A 2DLFL 4R97B 4B7LA 1HI6B 1MWAL 4G6MH 3BUTA 3GSOB 1PYWB 5IFAH 1ZGLP 4MAUL 1KENL 3NA9H 4MCZA 1XIWC 1T22A 3AB0C 4LHUA 3ZMRA 5D5MF 1K8DB 4HJ0D 3VXNA 3QIWA 5E2UH 4OB5L 1PLGL 2X4OA 4DVRH 1X5FA 1NBQA 1IEBA 3X11B 4UT9L 3QWRA 1MI5A 5C0FA 5FYKU 2BVTA 1J86A 1PVHA 2D9QB 1U92A 1BQHG 1KIRB 4W70A 4UZGA 3HUJF 2X1QA 1DBKL 2NY0D 4PJCA 3MV7E 4IRJC 2PYED 4GG6F 3NIDF 3QIBA 4KMQA 4LOUD 5DURD 4N9GB 1E27A 3HAEB 5M94B 1NBYA 4MJ5B 4EI5B 5JOEA 1JCKA 3LQZA 3U36B 4Z7VA 1A0QH 1GZQB 4YHYC 3QDME 3UTTA 3SDDA 2J4WH 3T0VA 3ARBB 2XN9B 4JB9H 2ADFH 3V0WL 4WIQA 3GMLB 5CSGA 4LKCB 1TZHA 4GG6A 1FNEA 1GPOH 3RGHA 3IFNL 2VAAB 4AMKL 1P4IL 2FO4B 4JKPL 3PWPB 2CLVB 1VFOA 1JNNL 3HUJA 2G9HB 3BFOA 4S1QH 3VFWA 3UTSA 2J2ZA 4HUUB 3PL6B 1X5YA 3DUUA 3HUJB 2R15A 4QRPA 3VXQB 1HWHB 5I2IA 1HOCB 3ZDZF 1N7MH 5F3HB 1RJYA 4F9LA 1N6QL 5J57B 2J1KA 2V7NA 2NZIA 3EDEA 2PYEB 2BNQE 3GIVB 3CSYA 4NJAH 2H2SC 5I1GL 2W0KA 3QWOA 1A1MB 4U7SA 5IB4A 1G9NL 4MNHA 3H7LA 3EFFA 4M7JL 3AY4C 2ITDA 3O4LE 5KTEH 3PWVA 4Y2DB 5I30H 3BP5A 4UIKH 5J6HB 3O3UN 4LFHG 2J88L 2P5WA 4PJ7F 2EE2A 2QKIA 4Z78A 3AAZA 3K4ZA 5FOBB 3I6GA 4IS6A 1FGNL 3S5LG 5BRZD 4YO0B 1CICD 3R06B 5B3JE 3QUZD 4APQB 2ZG2A 2NY5H 4FNLL 2LU4A 4WV1C 3TNNB 1GGCL 4HAFA 3HPLB 4PRHB 1UWGL 3S88H 3SN6N 2R0KL 1YYMH 4YBQD 2VQUA 1CXLA 3LRSA 5I8KL 3NZ8A 3ROLA 1S8DA 4FQPA 1EAPA 4OV5B 1KFAL 5CAYB 4NT6A 3JV6B 2HRPL 4M48L 1FGVH 5ETUA 3RVWD 1BJMA 3O0RL 4HIEA 4QOKE 5I1KL 1G9NC 3E2HC 1JGUL 3CSPA 3OXSB 3LVEA 1G6RB 4NIKB 4XXDA 3JBG7 3DURB 4Z7UB 1BAFH 2EXWD 2EDTA 4LKCA 4I0PB 1JN6A 4DZBB 5JORA 4XBEL 5GRVK 3SDDD 1OW0C 3MGAA 3BJ91 3C5ZC 1J1OL 3KXFB 5MEQB 1OT2A 3SOBH 4C55A 5KS9E 4KMLB 1CF8H 5CP3H 4JQIH 1ZK9A 4M5ZL 3K2MC 5GGRY 5D7SH 2OMNA 3LDBC 2ICEB 5E9DE 2AQ2A 5HHMB 4A2MA 3TYFA 1D5ZB 1OLLA 5F9DC 2C4FU 3MLUL 4JO1H 2CRYA 2JIXB 1NCAH 5FEBA 1ZLWH 4Q97A 1J9CT 4TNWF 4ZODA 5C0AA 1U92B 5DHYB 4EN3C 5F7DB 2B2XL 4NN6C 1H5BB 1I1FB 4YHLL 2ZUVA 3QULB 1MH5A 3IKKA 3WCYA 2GW5A 4NP4L 4F33A 3PWPE 5KBNC 3V2AR 3OAZK 1BPVA 2YA0A 3DYMA 4FTVD 3RUGF 2EH8H 1HQ4B 4XI5C 3P30H 3F7VB 4DUVA 4P23A 2ZSWA 2VDPH 1U3JA 3CDYA 1WBZA 1DDHB 4UV7H 1OY3B 5F9JB 3WLWC 5IGXH 3MLWL 3WO3B 2C5DC 4BM7A 4RGMB 5CEZL 1T5WA 3MOBL 4PTTB 4HUWA 3NPSB 3KJ6H 4R3SB 4LAQL 2CR6A 5D4QA 4QRTB 5KVMC 4G5ZH 3MV9A 1DQTA 1MCHA 3RDTA 3VU2A 4NP4H 4IOIA 4ZFFA 4UU9A 2I07A 3X3GH 2X1XR 5MEOB 3VMOA 4POZC 5CGYC 2NLJA 4NKMB 5IBTL 1ZA6B 4JRXA 4GRWE 3I02A 5FA4A 2Q7NA 1IGFL 5DT1L 2WBJA 4XCFL 3RU8L 4IM8A 2GCYB 3FMGH 3HZYB 4C56B 3DBXB 1YEHH 5IEHB 2R0WH 5SWSA 4FFWC 1XR8A 4OCRH 3TBWB 3HMWH 1KPUA 4PRIA 1QSFB 3NOIA 1SEBA 3NFNA 5DURB 4ONGL 3QI9C 5E4EB 1MJ8L 4G9DA 3EOBB 4OD1L 4NZRH 4U1LA 1GHFL 1DEDA 4D3CL 3BKJL 4LU5L 4ZUWB 3EGSA 3WFCH 4MNGB 1F5WA 3CLEH 4NHUA 5HDLA 5FDWA 1HIMH 5FCSH 2BP3A 3QI9D 3CUPB 4KK8C 3TBVB 1YNKH 4PJBB 3ZKQD 4EIGB 1CU4L 5DJ0A 5DZNA 4HC1H 1C7TA 3T65A 4JFPA 5D1ZD 1MCKA 3RTQB 2YXFA 3VWJA 5ISZA 1A5FH 4E41D 4HIIB 1SJHB 5CUSH 3KVQA 4G6AC 4LSTL 4OF5A 4RMVA 2ESVA 3RBGA 4XMKH 4X7EC 5D7IA 3L7FB 1XMWA 2AJVH 1ZT1A 1NLBL 5J3HC 5I1DB 4GUPA 4DUWA 3REWA 4PJBA 3Q5TA 5ACZA 5EIIA 3QIWC 3EYVA 4Z0BH 2JE8A 4N1EA 1NL0H 2G5BB 3Q6FB 3LKQB 3G04A 2J5LB 1KPRA 1YNKL 4FTVB 3QUKB 1GH7A 5DEGA 2R29L 1EHLH 5FO7A 1JFQL 5EU7C 3FT3B 2GTWB 2CLZB 3U0TA 1LP9A 1A6WH 3RGVA 3ARDA 4L4VB 3WIIL 3QO1B 2DTMH 5L7XH 4HEME 4HZLB 4XGZB 4N9OB 2YWZA 3IKCA 5FYLE 2NX5D 1DQML 1T5XA 4PGBB 3QNYA 4PJ8C 2VLRA 5EU6B 1WVZA 4HIHB 1O5DT 1XCQA 4MZ2A 3F6IA 2P44B 2R0WL 4HWEL 1AO7E 2E9JA 1U9KA 1H9VA 1U93B 2AJ3B 3FMGL 3KHQA 4WUKL 3MV11 4LVOB 1FFOB 1DVFA 1U8QB 2P5EE 1IGFH 4G8GD 5DT1H 1IARB 1BWMA 1DBBH 3IJSA 4YEEA 4I0PD 2AEPL 5L0QB 2AW2A 3PV7A 1EFQA 3TCLB 4PG2C 4NOBA 3DRQA 3SGEH 3U9PL 1MLCB 4OUUB 2VZTA 3X3FL 1TQCB 4WFFE 4RA3A 4EI5A 4TUKH 4GAGH 3H7BA 3ALPA 1B4JL 1NBZB 1VPOL 4GLRI 2X9WA 3AY4A 4O4YL 4MNGE 4CW1B 5ID1B 1ERNA 2MCPL 1U91A 3JVGA 1ZHNA 5D96B 3JWNC 4O58H 5E2UL 5E99L 3SE3C 4GOSA 2WWKO 5H37H 1NKRA 2V6HA 4NNXB 1E0OB 4KVCH 5LAXB 1M05A 3GJEA 5HHOE 2Y36H 2CK0L 4GAJH 1GVIA 1H3UA 5DJCB 5IVOA 2FJFA 1U93A 2AJ3A 1ZVSA 3TYFB 1L7TL 1TTUA 2XPGB 4JREC 3VFGL 5HGGS 2DQUH 2PTTB 5KN5A 1IC5L 1KYOK 3GRWL 1HSBA 2FJGB 3CLEL 5CEYA 2BY0A 2D31A 4PRHE 4UIMA 4F57L 1DLFH 3QG7H 1GJIA 2VDML 1DR9A 4NO5B 3H9YA 4R2GC 5HHPB 4R90H 5DJ0B 4PY7A 1ZSDB 4K7PX 5CS7A 5F7FA 5F93C 2EEDA 4JPIB 2X4TB 5ADPL 2AV1B 5CKGA 3N1GC 5IMKA 4GQPH 4HH8A 3T0EC 3FL7A 4N8VA 1J0HA 4RWYL 5DTFA 2GHWB 4K7FB 4X8XA 4AMKH 2Z31D 2VQTA 2W9LA 4QXTB 1CFSB 1QLRB 3VXPA 1UJ3B 3BQUC 3QXWA 2JIXA 3RY6A 3WIHH 4OJFH 3WD5H 4ZFOA 4YPJA 1DE4A 4KZEL 4Z7NF 2NW3B 1FPTL 3PWPD 3MODH 3QJHA 5FHAL 5GS1A 3N1MC 4FTVE 1FV1B 5DD6B 4Y5YB 4PJEB 5H37G 4YEFA 4DN3H 3IDIA 3D2UA 1HKFA 3ISWA 4ZAKA 1BOYA 1QQDA 3IAGC 1J87A 3H9SB 5LVEA 2XZCL 4EOWH 5E7FA 3LH2H 2EDLA 3NIFF 5DJXA 1JRHL 4P46C 3HTLX 3IGAA 3WNMA 3MOBH 5D1XB 4EN3A 1OL0A 3EKCA 3UBXG 1F90L 2W65B 1G0DA 2OMBA 2ATKB 3CFKA 4R3SA 2DQTL 2A0LD 5E2TL 4GFTB 3KLAB 1T66D 2H6PB 4PTTA 4YBLB 1JF1A 1FJ1B 4M7LH 3GMOA 3B2VH 5D71H 1J8HE 4LLUA 1JF1B 1P7QD 1VFAA 4LHQB 1XZ0B 2IPUG 5KTEL 3QIUD 4NN7B 2FYYB 1N59B 3QEQD 1RZKH 5IR1B 4YBLC 3HPJA 4RZCA 3MBEC 4NRXB 3KLDA 1FRGL 1NBVL 3U1SH 5IVNA 1F3DH 2XZZA 5FUCC 1T20B 4GS7B 5IBLD 2JF1A 3TJEH 3P3YA 4XP4L 2VERN 5D1XC 4WHCA 5F7EH 3H9SA 4PD4J 12E8H 1KJMA 4FFZH 5ACLA 3ARVA 1FL6A 1XGQB 1N5YL 3UTSE 4M1GL 3OJMB 1RZKC 3WO4B 1MCDA 1XF4A 3U36A 4C4KO 4UILH 4U1JB 1I8IA 1QKZH 5CP3A 3EBAA 5T3XH 1MJJA 5L6YL 4H20L 4OF7A 3MJ9L 5IJKA 3ARQA 5JLZA 1NCCH 4ELME 4OI8A 2J4WL 2CDGA 4B53A 2Z0BA 3BUYA 2Y07H 4GUPB 2CKBA 2WIIB 3SDCA 3KPRE 3JWDL 4LLYB 4G6AD 2IH3B 1FGVL 1XH3A 3PP3H 4Z0XB 2ZUQB 5CHNB 2C9AA 5I0ZA 3O45B 3SDAD 3STLA 2B20A 3EO0B 4TYUA 2IAMD 2ILLA 3ESVF 5DJ2A 1B0GB 3D3VB 4XZUA 4TUOA 4PJ7A 5F9OH 1OSZB 4N0RA 4EN3D 5KAQF 2CLRB 2NY5C 4M9PA 5ISZB 3VMPA 4OFDA 3ARFB 2GSGA 2D31B 5B38G 3R1GH 4XP5L 2D03H 4N9GA 3QR2A 4LCCB 5GJSL 2PTTA 1GOFA 1R24B 2LU7A 4OV6F 4MNQA 4PJ9A 3U6RA 4HFWA 5JW4M 4U2YA 5F3BA 3FQTA 4ZDHB 4OB5H 2Y23A 3NA4A 5B4MC 1JHTB 2YOCA 1WZMA 4D94A 4RDQF 4WI6A 3T0DA 3BPCA 2NY2D 5HHXH 1NAKL 2H32H 4NQSB 3QG6B 2P1YA 3VWKB 5DMKA 4XHJC 4YQXL 1AY1H 1RIUH 4PJGE 3GSUB 5EZLB 2VIRA 3HI5H 3ULVL 3MCKA 3W0WA 4BKLA 2GI7A 1NMAL 3I2CH 4WUUD 3C6LB 5FECA 3BPNB 5BQ7B 2X9XA 1YEDA 2PCPA 3S35H 1NDMA 1IGCL 4MQ7B 4ETQB 4KROC 1R0AL 4U6XA 5IB4B 5LWYL 2EDYA 3QNXA 3MLYH 3KPSA 3CPLB 4JG1L 5A2JH 4LLDB 1JHKH 3MOQA 3KWWB 2HMID 1T2JA 5E8NB 5E9DA 3BOVA 3MUJA 3SJVA 4JKPH 1OB1B 5EC2A 5K59F 4JLRA 2NXZB 1FNFA 4Z7NE 4NWUH 3ARDC 1EMTL 5DFVD 4QYOB 2DM7A 3T1FB 3VRJA 4F15B 4QTIL 3V6OA 5C3LD 3BT2L 3RWHB 3O6ML 2HJLB 1A6TA 3FO0L 2VLKB 2PTVA 4P57B 4U7KA 3ARDD 2HFFA 1EAPB 5HI4C 3W39B 3RVXC 4FABH 1J0YA 4F3FB 3GHBL 1FJ1A 3RVUD 3RWCB 1GGBL 3VXRB 2APFA 5KOMC 2YRLA 1S7UB 2ZKHH 1VFMA 2V9RA 1T66C 3F6LA 3P9MA 5ABDE 4KQ4H 1F6AB 2BVQB 1A3RL 4XBGA 4K55A 1G6RH 1KJVB 3C6LA 4D9QE 4U6YA 4GMTL 1S5HB 5TDPB 1QLEL 2CKNA 3SKJH 4CN1A 3ARGB 4N1HB 4R90L 5DEFB 3VXOB 1BVZA 3C08H 1RHHB 1T7XA 1A14L 5CGMA 2NTSP 5EUOA 4F57H 1DQQB 5JW5B 1M7XA 1ZA3B 5SWZB 3GKZA 3NN8A 1U8KB 1JBJA 1MNUH 5C07D 2J5LC 1JHLH 2DI9A 3OG4B 3GJFA 1KENH 1T0MA 1I3GL 4DVBA 2HKHL 3PNWB 4YQXH 4ZUVA 3V6FB 1EVTC 3MRBA 3BAEH 1KN4H 5JQ6L 3L3DB 2YN3A 3QIWB 3AGVA 2A6DA 3THML 4M43H 1N4XH 1N6VA 3EYOB 4N0CD 1S9YA 5ISZD 5KSBE 2JELH 1A6ZA 3T4YB 3UXFA 5TPWH 5JIIA 5E99H 5EPMA 3TT3H 4L4TE 3DUUB 1BMGA 2C26A 1A7BA 4IRZL 4O2EB 4WTZG 2IBGA 3WBDA 4JVUA 5HYJA 4O2FA 3QT2A 4Q6IA 1FE8L 4L3EE 4WTXA 5JUEH 4JPVH 5D7JB 4AIXA 4DKEL 4W68A 4X7TA 3MRPA 4HG4K 1KV3A 5FXCH 5C0RH 4XVSL 3T65B 2OLDA 1OWWA 3RL2A 3CXHJ 2ZOLA 3V79C 4MA1C 4ZXBC 5FA3A 1ACYL 1P4BL 4NKQB 1UXSB 4BQ9A 5FGSA 3O8XB 3LCYA 3G6JA 3LQAH 4RISL 3OAUH 3HE7B 4QTIH 4HJ0C 1RZFH 4XT1C 3RY5A 1UACL 3CCHA 4I9WE 2PYFB 5ITBH 3O81A 4OFYD 2B5IC 3KGRA 1UB5B 4ZOAA 1VFUA 4ODSL 4FA8A 5BV7L 5FM4A 5B21A 4LVNC 4OFYA 5CBAA 3E3QC 5C07A 2R2EB 4Y16B 5TDNA 4G7VL 5LG1A 5IMLA 1CE1H 3GM8A 1CS6A 1I7ZB 2VDNL 1AHWC 3QEHA 1X5HA 3NTCH 1N64L 3ARGA 2XZAH 1CLYL 5IVXA 1ED3A 2XQYK 3IAPA 3QIUB 4OFKA 1YPZA 4IMKA 3I3EA 2WM0A 5FA4B 2R39A 5EU3A 4LVHB 1NEZB 3FN3A 1IM3B 4MJIA 3CSYB 2NY3D 4ZYKB 1RZKL 3UPCA 2VLLA 2H6PA 4HWBH 4QNPE 1OLZA 3GBNL 1FVCA 1R3KA 3GKWH 1WTLA 4MAYA 2BNUB 2BC4A 3DETD 2ICES 5ELIA 4G80B 4GBXC 3VFWB 3V4UH 5F7YC 3SE9H 2NPLX 5E2TH 1T03L 5FM5O 4YDKL 2FR4A 4ZNCD 4X80H 3RDTD 4I3RH 3PXJA 4MD5B 2AJVL 3T3MF 4NSKB 3ZT5A 3RVVD 3BXNA 3SGKC 1G9EA 5I1AA 5K59E 1JGVH 1I4FB 4YX2H 3BD5A 1IGYA 3R4DA 4POUB 5H94A 1RUAL 1KCSH 3FFCD 2MOVA 3PQYE 4UNVA 1KJMB 4CVXB 5GRUH 5T5FH 1EUTA 3MGOB 3C09C 4XB7A 3D0VB 1H5BC 3AU1B 3C6SA 4NO0A 5BZDB 3FQWA 1HIML 3D0VA 1S3KH 1MCIA 1DBAL 1A2YA 5DQ9B 5KZCB 3LRHA 4PJGF 1T2XA 4QRSB 3RUGE 4OZGB 5E8OA 4PLKD 1JNLL 1B2WH 2CR3A 1CGWA 1NC4D 5J11B 2OBGA 1QBBA 3REWB 2CUHA 3DO7B 4PJHA 2VKWA 9CGTA 1H3PL 4IJ3C 3NCFB 2XTJB 4U6VL 4DKAA 1YNTB 1AGBB 3GSNH 4UNTA 1YEHL 2WINA 2MMXA 1FH5H 1S7XA 4QGYA 3QQ4B 1KLFA 3MMEB 3L1OL 1ZHKA 5EOTA 4M8QB 1CD9B 5I73C 1M71A 4HXBL 1RZIB 5IBUB 4XWOC 1A47A 3QDAA 5E6ID 5C0EA 2BVUA 4UOJA 4N0UB 4WUUE 3GMQB 3HB3D 4P4RA 5ECJE 2DMCA 1RIVL 1F8TL 2HJKA 3UTPE 3H42H 3WNOA 4KQ3L 4O5LH 4ODWB 3KHOA 1V3MA 5E5UB 1VCAA 1F42A 3HKFA 3A6CH 5L0QC 5MP6H 3QFJE 5HHOD 1FVEA 3HNVL 2FNBA 3O6FC 4QT5A 1WZ1H 3P30L 2WIMA 3X3FH 5HHME 4QHKJ 1XF2B 3T77A 4HT1H 4JFOB 1YC8A 1A3LL 2QV2A 3E6FA 3SGJA 1IAIM 2IC2A 1UFUA 3TH3T 1FHGA 1FNSH 4M93C 4YAQA 4GRMA 5IR1A 2P24B 3NFPB 1RUMH 1DBJH 5CD3B 1EHXA 1SY6L 1U3HB 5I1CH 1QVOA 2EICA 4P2RD 2NX5B 2F8VA 4WGVB 3DXAD 5K9QG 1FH5L 1XF3A 2QQKL 4LOUC 1RURL 1QKZL 5T3XL 5L6YH 1ADQL 2A74B 3OTTA 4KMTL 3ZTNH 2P4AB 2ORBL 2RBLA 3PL6C 4NC0B 5IEKB 4NKIL 1BEYL 3WUWG 5EUOF 3PWPA 4Y89A 1U95B 3Q6GH 1HNFA 2EDRA 5TDOB 4QRUA 2LU3A 4N0YH 3LS5H 4MXWH 1J8KA 3L3OA 5BS0B 3GNMH 4XP4H 5GSRB 3P9WB 5DUPL 5AUMB 1WT5C 2EIZB 2VDMH 5T3ZE 4U0QB 1Z5LB 3I9GL 1NKOA 1YNLL 2YPVH 4Y4FC 2UWEA 3BWAA 1OD9A 2VQ1B 1KCUL 1X7QB 4JM2B 3WYRA 4EI5C 5DJZB 4RAUA 2AJSH 2CRIA 1K8IB 4QXGL 4UI2A 1EZVY 1MH5B 1BOGA 4ZUVB 3HZMB 1NAMH 3MV9E 3V5HB 4Y5XA 1WBYA 1OTUC 1JPGA 3GEWB 5MERB 4KU1A 3ZTJG 4E41B 3TA3B 5EBMB 5CJQH 3KR3L 1UJ3A 1MCOL 4R4BB 3UJIL 3S34H 3CC5A 1SJHA 2Q7YA 3RTQC 1J5OL 3I6LD 4FQQB 1J5OH 3U7WL 1F90H 4E5XA 4LRNL 2OZ4A 2BRRH 3H3PH 1W8NA 4GKSB 2P47B 4WEUD 1T83C 3C87A 2Q8AH 3N0PB 5DI8A 4OZHE 5CMAB 4R8WH 3CFIC 2CGRH 3HR6A 1QSFE 1T83A 1CD0A 3V6BR 1MLBB 4R7NB 5IIEB 5EZOH 4K8RC 4U6HB 4HKJB 3T77B 1JP5A 5TQ2H 3RWIA 5DJDB 3MXWL 4YHPB 2J12B 3F62A 2Y06L 4OLVL 4PRAB 1QFUL 2ZUXA 3Q48A 5DA0B 3RNQA 4HDIB 3UO1L 4LPVA 1F2XK 3RI5F 3WKML 4JANB 5E94B 2J8UB 5KAQG 3MLZL 2F19L 2Z93B 5IF0A 2GEEA 1N64H 4I48B 2A38A 4ALAL 1YUHA 5I1LB 1SM3L 3HMXH 2HWZL 2J6EA 1A7QL 3O3DA 3O9WA 5AG8A 2DLHA 3GMQA 2DQHH 5C1MB 4OM1L 4RAVB 1KJ2A 4Y0GA 2FO1A 3O9WC 1XGYH 3BXNB 4JY5L 4M00A 1SBBA 4JB9L 2HLFC 5DD5H 4L8DA 4ERSL 2DQCL 4IHOB 1RUML 3B2UD 3GRWH 3QISA 2BZDA 3HZVA 1FZKB 4K94H 4P4KC 1AKJD 3Q2CA 1OAYL 3RQ3A 4Y19A 4YLQT 4A6YH 3NPSC 3LQAL 1OF2B 3SKUD 2EO1A 5C92A 3G6DL 4GXUM 5CWSA 4ZTPH 1U8MB 5JDSB 4OZFH 3N1QC 1TVBA 2Y36L 4L4TB 2XFXB 2FZ3B 2HVKA 4XP1L 3I84A 1JZ5A 1Y6KR 4JO2L 1Q72H 4XWGL 3SY0B 4XNQB 1UZ6F 4Y4KA 2DDQL 3F65A 2F58L 4XP6L 1OAXH 5GS0L 3EJZC 5MP6L 1CLZL 4Y8AA 4ZUWA 4L4VE 5HYQB 1U8PB 3T1FA 3MCG1 4DFHA 3RI5K 4D8PA 4ZMAT 1QZ1A 3BVNB 4NBXB 3CDGB 5IESH 2VLJB 2FL5A 3BGMA 4XP1H 2VLRE 4HH9A 4U6TA 2VR4A 2OXGA 5J6GB 4POZD 4MXVF 3RZCD 2WBJC 3ROOA 4HUXB 4K2UH 1KTDB 3G04B 4EUPG 1KSRA 4BUHA 1A4JA 2JCCF 5C09E 4XNUL 2E5EA 4GXUN 2E7HA 2GITA 3JTSA 4K7PL 1NFIA 3KXFD 3DX6A 1RHFA 4GH7B 4O2CB 3P40A 3L7EA 1CFTB 3V0VB 2FEDD 1SMAA 5CZXC 1A3RH 4PJIB 1JWMB 2VZVA 4O02L 4N0UA 5LXGL 3P73A 1U8JB 5IHUL 3DPBA 1FO0B 4S1DC 3TYGL 3OKOA 5L2JB 5HD8C 5BXFA 1TVHA 3PDDA 4L3CA 1NJ9A 2YA2A 4PS4L 4EUPB 4QRRE 2X4OB 5F7LB 3WKMH 3QP3A 4XCFH 1SYSA 4P5TB 4OLZH 4DEPB 3QBTB 4GKSA 5CEYB 1NCBH 2R29H 1RUQH 2AK4B 4UDTB 5J11C 4Z7UE 4YZFF 1D6EB 2DTSA 4EI6A 3GO1L 3MXWH 4F33B 3TBVA 5DK0B 4D9LL 4XZUB 2VWEC 3O4LB 5ESVA 2ADIB 1N2RA 2P49B 4QOKD 1YECH 1YMHA 1ZKAA 1JPGB 5HSFA 3B9AA 1YYML 1DJSA 3VWJD 5ICZB 2ARJB 3I6GB 4IS6B 4JFFD 4XXCA 2OK0H 4GRLA 4D9RD 1EV2E 4OBSA 4OAWA 2CH8A 1T03H 3W9EB 1QBLL 4MD4B 1N0LA 3L5WB 1LK3H 2A6JB 3L3IA 5HYJD 2N7AA 5CP7B 5D5MB 3LQAC 4P2RE 4MCYB 4ZFGH 5DVMA 2CRZA 3I02B 5DVKA 3QDGA 3PL6D 5F1IA 2KPNA 2XG5A 2P5ED 1HOCA 4NJAL 4MD5A 1AXIB 2B1HH 1CCZA 4KKAC 3SDXB 1CDJA 2YPVL 2YBRB 1F00I 4ONHA 1CDUA 5DC9B 1F3JA 2J8UE 3TZVA 3GFUA 4ZFZA 3CMGA 1EHNA 1AQDA 2XN9D 1MOEA 4TQEH 5FO8A 4KY1H 3ULVE 1FL5A 2AK4E 2X4TA 3P4MA 3DIFB 2CKBH 3KDMB 4XVTL 2VLRB 3P11H 4HWZA 4YHYB 3GMOB 4PRBA 5GRWA 1IM9D 2Y25A 4FG6C 3AC0A 4PGBA 5HY9B 1E4KC 2PUQT 4H5SB 2ED9A 4LCYA 4HPYH 1CFQB 3F7VA 4KRPD 1QFWH 4IRJB 3GJFH 3ULVC 4S1RL 3HG1E 4JFEA 2QSTA 5CD5D 3BZ4B 3KYMA 3ARED 3O6FB 1ES0A 5I19L 1LO4H 3MJ8B 2CMRL 3FB7B 4ISVA 4PUBH 5C6PB 3IFOB 3RIAF 1BX2A 2NW2B 4ETYA 2EKSB 4Y8DC 4DAGH 3SE4C 4NYLA 1EEZA 3CVHA 3T4AA 2QHLA 2EDXA 2FECL 3MRJB 3DYOA 1AXSB 3SDYH 3WDHA 1D6VH 2VDQL 1V7ML 4LSUH 4LAQH 1Q0XL 2GTZA 2XWTA 3U6RB 5E4IA 3G5XA 1U6AL 5CSZB 1TCRB 1FBIL 2GJZB 2PXYA 5EBLA 2RIKA 1TJHH 3KJ4C 4RRPG 4UV4L 3WFDH 3VRJB 3ZT6A 4JHAL 5E1AA 5ADOH 4JFQA 2W91A 4LCWB 3ALWA 3PGDA 2OR9H 1EFXB 4JRXD 3F7PC 4J6RH 5DQDH 3V6ZB 1MEXH 1PSKH 5D2LF 4M3JA 4NC1E 4X8JA 4FQXB 4FHBD 3TGXA 2PTUA 3OKLA 3ORJA 2WSKA 2XN9E 3S4SB 3QO0B 3FFDB 4TUJB 4Z5RB 3CUPA 3O2WL 3QUXB 4ZO9A 2DL9A 2VDRH 3A6OA 1RUKH 5KN5B 4GXVH 4N5UA 3MLUH 4JO1L 4JFHE 5GZND 3MA7B 4GMTH 4NKOB 3QCVL 5ALBL 4R7DB 4XPHH 1IKNA 1NGYA 2YZ8A 3L3GB 3AXLA 3CXDH 4U1IB 4YWGL 3A67L 3IFNH 3GHBH 5F7KC 2YK1H 2G2RB 1JMXA 3L3HB 4MD0B 5C9KA 3R06A 3V0WH 4FP8L 5ENWA 5CBEB 1U91B 2XIDA 3F7YB 4X83A 5L2KB 4HV8B 3K8MA 5E00B 3G5ZA 2VSDA 5I1KH 1B0RB 3E1F1 4OJFL 4KUCF 1H0DA 2NY4B 1FLRH 1PYWA 1KB9K 4LLUB 5LJYH 4N0FB 2BSSA 2VWEE 3BO8B 4EXPX 4M6AA 4AEEA 2XFXA 3LIZH 5J89A 1HH6B 5FFLA 1UWXH 1TENA 4PJGA 3GUTA 4PJXA 1IILE 4CN4A 1UCBL 2DLIA 4JRYE 1IQWL 4PB0H 4P9MH 5BRZE 2Q8AL 4PJXB 1FCGA 3NCMA 1PD6A 4XC3H 1R3IL 4NQXA 2V5RA 3MC0A 2I27N 2FSEB 3O2WH 5SWQA 3L7EB 2X4UA 3IDNA 4WU5A 3HI1A 4I3RL 3UJIH 1WFTA 1JV5A 4PGCB 3RZCC 5CD3A 3HS0B 4X4ZA 1WISA 4U3XA 3DV6B 2QHRH 5GRZA 3UROR 5F97E 4AQOA 4CJ0A 5I1JL 3U4EA 2I25N 1NAML 5ENWB 1DN2A 1AO7D 5CBEA 1ZHLB 1KLUA 5ADOL 3WJJA 5FECB 3ULUC 2P42B 1CFVH 3S5LA 3V6OE 3KLHD 2XACC 1YNLH 4ODHH 5DEZA 5T3XD 3VWKC 1R3LA 1R3LB 2Z31A 1G7PA 5C2BL 4J3XA 1QFPA 1MY7A 3ULUD 1P2CA 2F74A 2B5IB 1F11A 2XQBH 1Q9KB 1VEMA 1WTGT 4JZNB 2KL6A 3LEVH 3SDYL 4G7VH 1W0VA 4L29B 3TO4B 4LCCC 3U79A 5IROA 3BKCL 1YPZF 2ZOLB 4GSDL 1TPXC 1IFHL 4P48A 3ARFC 2Y7QB 2M1KA 5C09B 3B4NA 4LCCA 4ZXBB 5IVXF 4I3SH 4CU8A 1TTFA 3VI3F 4WNQB 1CIUA 3L7FA 4OFPA 2ATKA 3LKOA 3TH2T 1KCVL 4ZO6A 4ZO8A 5FK9A 1QBMH 2X4SA 2X4SB 1KB5B 4D0CA 2JB5L 4IHOA 3DXAA 1FVDA 5HYSB 2A6IB 3ULUF 5IM7A 1V7NH 4JM4L 4MAYB 2PW1B 5I6XB 4CDHA 3MACH 1AGEB 4M62L 2HFEB 3K81A 5IKCA 4OCWL 5C8JB 3LN5B 4NCC2 4G8IB 1PDKA 1L0QA 4G42B 1J8HB 3GRWA 3PGFH 1J1XH 1TPXB 3PXHA 3M1BA 4ZSOA 3QDGD 4NZUL 5IJVB 1IGMH 1OPGH 1AJ7H 4P23B 2IF7A 4XCNB 3MRIA 3CK0L 4L3EA 4X9IA 2OJZL 4IRSA 2VDRL 3TO4C 2JTDA 1YPZB 1XEDA 1KEML 4GW1B 3OX8B 4K8RH 3QEUB 3VRIB 2R8SH 1TJGH 5F89B 1GC1L 4GS7C 5GJTH 4WY7L 5GS3A 1JUFA 2R9HD 4Y16A 3WMSA 1MHEB 5KJRH 3MNVA 5DWUL 2FL5B 3PWVB 4Y2DA 1Y18B 3AXLB 4U1IA 4ZFOL 4I4WA 5D6CB 4WFGD 5HGHB 1MNUL 4KXZI 5IVZA 3MR9A 1GRWA 1OWRM 5FYJE 3V7AE 4NN7C 2HTKC 5GS2D 5DMGD 1MFBH 4XNXL 5J0BA 3QDMB 2VLKA 4P57A 2VDLH 4OGXL 3IETB 3FRUB 3CFJB 4CNIA 4UQ2A 3ZE1F 4Q2ZA 5C0DB 5DHVA 5DQJA 2BSTB 2A9ML 4GAFB 3VW3L 1RFDH 4QHKI 1YDPB 2PF6A 4AYFA 4ZG1A 4P2OC 1TVBB 5HBBA 2VXTL 5EC2B 1OARH 3MXVL 1MHEA 1JPFA 2FEDC 1F4XH 3VXTA 4XXDB 2AABL 3P4NA 2H45A 2P5EA 5J1AA 1CLOL 1VACA 1S9XB 2H26B 2VO5A 4FXGA 3L95B 4PPTA 4CW1A 1P53A 3QPQD 2WV3A 1NBZA 1LO2L 1GGYA 5ESQB 2YD7A 3DSFH 1KPVB 1OAUL 4I2XE 4RFEA 1ZLVH 1WT5A 4JHWH 4Y5YC 5CCKH 2AJUL 5FYKD 5DRWB 4NQTA 5ACZB 3IDJA 3C6LC 3MCKB 1ETZA 2YA1A 4BH8A 1I85A 2BVEA 4R4FL 5DD1L 1OGAE 2PR4L 4GXVL 4YX2L 5E5MA 5A16B 4Y4KD 5DEFA 1IEAB 3VXOA 1INQB 5ERWA 3QHZL 2IFFH 4AL8L 1P7KA 2IPKB 3H9HB 4D0BA 5FYJD 3RTQA 2NYYD 1KTKE 2NYYC 5DWUH 5JOFA 3EFFB 1VGEH 2BDNL 1ZMYA 1C1EH 3EO9L 3IFLL 3TJHD 4XTRD 4PRBB 1ZT7A 4QOKA 5IFJB 4NKDB 5F70A 4EDXA 3Q0HA 1MELA 1EO7A 1T1YB 4CADA 3IU3A 4JGUA 3CNKA 5E6IC 2ZCLL 2BOCA 4O2FB 4FQCL 1DN0B 1UB6B 4KTEL 1F4WL 5GRJL 1J1XL 2ZUQC 3J7HA 1ZV5A 4JFXA 4Y1AD 4PGEA 4OGAD 3MLVL 5JW4N 3IDMA 3HRZA 4XBPB 1I8LA 5GGVL 3SCMC 4YBQC 3SCMD 4XNYL 3MLSH 1OB1A 5TE7L 2R2BA 2R4RH 4GMSL 1BZ9A 2HMIC 2YSSA 1UKQA 5A2IH 4XMPL 1TETL 3HZMA 1NCDH 1S7SB 2GTZB 3L6FB 5D5MA 4LLWA 1QHPA 3R0NA 3RA7L 1X6NA 2BSED 3PWNA 4G43B 2DQCH 2DAVA 2GAZA 5BO1H 1T3FA 3U4BL 5DMYA 3VA6A 3FQRA 1ZA3A 3JV0A 3MJ9H 1OM3H 1WLHA 3CDGA 3MO1B 1KC5L 1ORSB 5T1KA 4HUVB 3TBSB 4LBEB 1D5XB 4Z77A 2R0ZL 4RA0C 3C8KB 1AHWA 4ODTL 1JJUA 1A7QH 3RPIB 1BLNB 1F6AA 4OZIE 4QF1B 3U83A 1R3KB 4H5SA 4IRJD 1B4RA 5LXGH 1UWEL 4GAYA 4BELD 2FWOA 2FWOB 3EAKA 3KG5A 1BAFL 3WFHA 4WVRA 1IM9B 2K1MA 3IETA 3DRTB 1J0ZA 4OM0H 4MDIB 3QDMA 4DJMA 3RWFA 1NEUA 2FHFA 3V8CA 1K3ZA 1T1ZB 2XY2A 5FCUH 2VZSA 1UGNA 4R96A 1I8MA 5D7IF 5IW3A 2LV4A 1VKXA 3IJYB 1MCCA 5DGRA 3B83A 2XYCA 4CVUA 4Y1AE 4CVXA 1D5IH 2EDHA 3D0LB 4YHNA 3RZCA 3U9UA 3I6LE 3ULUE 2W0FB 3ALXA 1LD9A 1YY8B 3DMMA 3SPVA 3P4OA 3TPUA 3UJTL 3UPRA 4HWBA 3T1WA 1ODAA 1OW0A 1LNUB 1ORQA 4OFVA 1R3IH 2NY5L 4FNLH 4DGYH 1UXWA 5DD0H 1BVLB 4Z7OE 2EEAA 2G60L 4LSTH 3QUXA 3VI3E 2BNQA 2CDFB 4ZQKA 4LIQH 2DDQH 4P9HH 3NIGF 3MRMB 5JHDD 1WZKA 2P45B 4OKVA 4X7SH 5KVDH 4ZTOL 4UDUA 4RGOL 3LN5A 3ZKMD 4PRAA 2GYSA 4FABL 3BQUB 2WZPD 4FQXA 1PBYA 1BD2D 5E8EA 4I1NB 3ZYIA 4HIJA 1QP1A 5D2NA 4EIZC 1KNOA 5HDOA 1RD6A 4TSBH 1VFBB 5IB5A 4HIEB 1C5CL 4RMQA 1I3UA 5F7HA 2YD1A 4JE4B 3CMOL 1UM4H 4C4KT 1JE6A 2YMXH 2Q87A 4R2GB 5LCVL 1RU9L 5GGTA 4MXWL 3WNPA 1VFAB 2IPTH 5C7XL 2VLJE 1R3JA 5E0QA 1NMBH 5ILTL 5TE4H 1C5DA 4ZUTA 3V6FA 5ILTH 4DEPC 2QQLH 3CFDB 4M3KB 4URTB 2ORBH 1JWUB 2VUOA 4WJ5B 5KSVB 3W11C 1MFNA 4TN9A 3U30B 2HJFA 3EGSB 4PJ5E 2B0SL 5I1CL 3RU8H 4HW6A 5I1EL 5GXBB 4OCMC 4WW2C 2BHYA 4L8DB 1FIGH 2EDBA 2AXJA 3BH9B 3Q3GB 1M4KA 4Z6AT 1Q9WB 3DGGB 3MX0A 4XXCC 5E95B 1A7PH 1AP2A 2VH5H 1HINH 1UXSA 2VISB 1MIMH 4ENED 5SX4H 2HA1A 3HC4L 3BRDA 2W0FA 4DK3A 2FIKA 2ZPKH 3ZYJA 3HNVH 4UB0H 2LVEA 1CVSC 3FB5A 3QB7C 2WBJB 1FFRA 1FC1A 3D0LA 1FO0H 4P2CG 3RZCB 4YIQB 4YHNB 4IIQA 2MCPH 1FQ9C 3UX9B 5DD0L 1G7MB 3MLWH 1TJHL 1UM5L 5I8EB 3MFFA 4UT9H 1LP9E 1UM5H 1VPOH 2OCFD 2UV3A 4XP6H 4GAGL 4YHKL 5HYQA 4K9EC 5DHVB 5E6ZA 4KK6C 4PJDA 2FO4A 2EYSA 2IH1A 3JV6A 4QRPD 3X13B 1QSED 4LCWE 4U6HA 1S8DB 1G7JB 4OV5A 25C8H 1AO7A 4HGWA 2NY4C 5AAMA 2FX9L 2R23A 1TZIB 5EORH 1QR1A 3UEZA 1U58A 1HCVA 4PJ8B 1FFPB 3OMZA 4PJ9C 4NUGH 4KXZH 1E27B 3HAEA 1XGRB 3TEUA 5FKAB 4Y19E 1A21A 3D25B 5EUKB 4G8GE 1MAJA 2GTWA 5F71A 4IDJL 5C08A 1AH1A 1QPXA 5DUPH 4CMMB 1VADA 4GKNB 3PWLB 4GW1A 3MO1A 5JXAH 5TQ0H 4FOMA 3L3HA 4MD0A 1WQVT 3GJEB 5HGAA 2W92A 3QG6A 3AREA 2M8XA 5MERA 4MDJB 1Z0NA 1N26A 5F7EL 2X9YA 4NKIH 4PP2A 3RP1A 1CDIA 1IEBB 4HK3J 3UO1H 3QHFL 1JFQH 4FFVC 1K4DB 4NUGL 3VG9B 1M71B 4PV9B 2HVJB 5EORL 3HRZB 4XBPA 3D39E 3LKPA 4YDVB 4RMWA 1JTPA 1GAFH 5B39A 2YPLB 4S10A 1NGQL 4FFWD 4Y4FD 3UTTD 3W2DH 4DFIA 1J18A 5DS8B 1MHCA 4FQ2H 1EX0A 4K7FA 2MSPA 4OLUH 1RUAH 4EDXB 3BQUA 3S35X 2AS5M 2F54D 5C09A 1T89A 4LLQB 3QUMA 1MVUA 1T89C 5KW9H 2F53A 3C5SA 1GZQA 3RNKA 2C4FT 3MBXH 5IQ9A 2IANA 2Z92B 3N1FC 4OGYH 4O5LL 5GGTL 2AERT 4UB0L 1G1YA 5DHXB 4Z7QF 3VXSD 5KVEH 3JV4A 4FQ2L 5IMMB 1RIVH 1WEJH 3T2OA 4AY0A 4X6DA 5I8OH 4XMLL 3TO2B 4G9DB 5KSBB 1EO8H 4APQC 3S5LB 2AAVA 4U3HA 1Y18A 3TA3C 5FYLL 5I1GH 1X3DA 3S36L 4WGWB 2VITA 3AMLA 1FIGL 2A77L 3NIGE 2BY2A 3V5DB 3QHFH 1MIEL 1TNMA 4OLZL 4G8FB 1OP5H 1N6QH 3CDCA 3MV8B 4M6NL 5H94B 4LF3B 3ZYZA 2OS7A 1JF5A 2P7TB 4C59B 1CG9B 1G9ML 3BEWB 4TNWK 4LSPH 3GSNL 5C0GA 3GMNA 3WDJA 3CLFL 3DV6A 1C16A 3E8UH 3GHEH 2QQLL 4C83A 4MNHB 3OZ9L 4F9PC 2CLRA 3GSOA 4PYGA 3D39B 4FZEH 3HLAB 3B5GA 3MV9B 2B7DT 5CCKL 1LO5A 5EO1A 3HG1D 3Q1SL 5BS0D 3MCLL 1DANT 3MBEA 4PJCF 4K7PH 4Z0XA 4NRZB 1KG0A 1Q9LB 4JRYB 3RKDD 2NZ9C 4U1KB 4NHCL 1EAJA 4NO2B 1BQSA 5D7KD 3HZVB 5I16A 3ZTJH 2HG5B 4Z7VE 1X5KA 2X4QB 2X42A 2AABH 4JPKH 1RZ8B 3INUH 1NCDL 2NX5E 3CFJA 3ETBF 1U8OA 5T5NF 3MXVH 4LCIH 4WI4A 4P2RB 3T0WA 3RGVD 3B2UC 1LEIB 4QCIB 1DBKH 3KWWA 4XVSH 4MWFA 3ZDXE 3GMPB 3VW3H 4LLWB 2VISA 3HUJE 4G8FA 1U8HA 4U49A 1WC7B 4ZPVA 4HQQL 1A3QA 4HKXA 4FMKA 3LEYL 3CFEB 2J8UA 2VDPL 5ANMB 5CBAB 1XF1A 3BW9B 4X6EB 4L8SA 2D0GA 1IEAA 5HHVL 3TESA 4PLJD 1X9QA 2Y5EA 3UYRH 4J3SA 4X6DB 2E9IA 3WFEH 1CDYA 3MGTB 4NO0D 4KAQL 4EXKA 1VSCA 4LHJB 5KJRL 1KB5L 4FG6D 4ORGA 2W59A 1ZHLA 1N0XL 1GC1H 4NKDA 5GJTL 3O4LA 4YHLH 2ZCKL 2UY6A 3STZA 5DRNB 4KRPC 3MOAL 5H35B 3X11A 3AB0B 3RUGA 3NACL 1BWWA 3K74B 2X89D 4HIXH 4UDTA 4WHTB 4XPTL 5EOTB 3BE1L 5D1ZA 3LPFA 4J4PC 4PJHE 4OIBA 4R97C 5ERWB 2GQHA 1CD1B 3H8NA 3FZUD 4P46A 1KUMA 4JFYB 4RQQA 2VDNH 2Z35A 1LEGB 4OCWH 3VXTB 2R2HA 1DQMH 2G75A 5FGCB 1B0WA 5A2LH 3TN0A 4J4PD 2GFBA 3F5WA 5FF6A 3D3VE 1QFHA 3NCCB 3HB3C 4MNQE 5HVFB 4POYA 5H35A 3ZZ1A 3FHAA 3OWEA 4PP2B 2UVEA 1KCVH 4EVNB 4UQ2B 1NCWL 3QJHB 4JFDB 2BNQB 2CDFA 2DLEA 3GSXA 4FXKB 4PRHA 4PRID 4TVPE 4I3SL 4NCC1 1UXWB 5LGJB 1WBXA 2HTLC 4HV8A 4OZ4A 4X9HA 3IXTB 8FABA 4Y1AB 1JZ4A 3MJ8A 4ISVB 4PP1D 2VXTH 1NC2A 1G7LA 3WL9A 4WO4B 3VH8B 5AWNL 1JTOA 2NTFB 3IDUA 1J12A 5I18L 3BMWA 2DIJA 3T0XA 1BJ8A 1QOKA 1HXYB 3LEVL 1AC0A 3P4NB 5CJBA 4NZDA 4GW4B 2XQBL 5EO0B 4WI8A 3QH3A 1JNHB 5I9QB 4XX1G 2P48B 4XNXH 2QQNL 4Y2DC 4D8PB 2A1WL 3S34L 2PO6C 3UJTH 4X80L 1XF3B 4JR9L 3DX9A 4ODUB 2X09A 1P7HL 1CQKA 4MDIA 3MA9L 5FO8B 3CH1B 1KEGL 2EYSB 1HHGA 3ZT7A 1F6FB 5JW3L 1N4XL 5FO9A 5MEQA 3PGCB 4XCCL 4YXHH 2G9HA 3RFZC 1I3GH 3TN0D 4XVJH 4X7FC 4Y2OA 4NFBA 5IKCB 4H25A 3HAEH 1HHKB 3ZSTA 3WSQH 3SJVD 2VABB 2HH0H 2GSIA 4K3HA 4RWHA 4KK5D 4Q6IB 2IALA 3V5KB 4YZFE 3LB6C 4RX4D 5DZOA 1XGUA 4KKBC 1D9KB 2NY3B 1EA9C 5DD3H 1MJ8H 3VFUB 3T2NL 4R26H 4W4OC 1AXTH 1DQJB 1KGCE 4I2XB 2ZZUT 4LVHC 1FYTB 1X5GA 2VZ1A 3LKNA 4BQ6A 1MF2L 5EZIH 1J8HA 2X2YA 4X7CC 4Q74A 4ZUUA 3QIUC 4I77H 5D93C 3TO4A 1KIQA 4D9QD 3D39D 4HD9A 3QNZB 4ODBD 5F7WC 3LKRA 5EN2B 4JPWL 2HYMA 4MHHI 4NGHH 1WK0A 3WDIA 2DBJA 3K1DA 3OJDB 4RGND 5L88L 4LRIA 5DUBA 3SE4A 1ONQA 3N50A 4KK9D 1G7PB 4KK9C 4I5BB 1FNGA 4L8SB 4NFCA 1Q8MA 3RPKA 4Q6YA 5IMMA 2FLRT 1TETH 4C56E 1C12A 5DXWA 3IF1A 3S97C 5CINH 1IAKA 3RWDB 1I9IL 4YHIB 3QUYA 4P49A 3HE7C 2AEQL 4R7NA 4JQXC 4Z7VF 3QO0A 4XNMB 1S7QB 1S7QA 2L7JA 1BREA 3BN9D 3WKNA 6FABL 4WW2F 3STZB 5C2BH 1VFBA 5LWYH 1RK0A 2IADA 5FGBC 1Y0LA 4PFEA 4JEGB 1HSBB 4J12A 4QRSA 1HILA 2ZUTA 2ICWJ 4PTUA 3FO9B 1F3JB 2V9TA 1YJDH 3SE8L 2APBA 4WW1B 1A4KB 4IOFD 1T7VA 3MV01 2P8LB 1OAKL 5D7JD 5KSAC 4MAUH 2YD5A 3SDCD 2WQ8A 1JGDA 1KB5H 4P23D 5JIHA 3I75B 1I7RB 5F1NA 3QDGB 1G1CA 1CK0H 1UYWH 4YDJA 4GO6B 4PJ7E 4PJFB 1MCEA 4HPOH 4JM2C 3PHOA 5FUOH 1UKTA 4AEIL 4Y4FB 3NCYP 4ONFL 5C9JA 2XA8H 4PJAB 1YJDC 3E6HB 2BCKA 3DXAE 3T0AA 1QBAA 2VLJA 5HJ3B 3KPMA 1JV5B 4GRWF 4KQ4L 5BS0E 4PJ9D 4OTXH 1K3IA 3CD4A 3FONB 4GG8A 3MYZA 4CBPA 4DTGL 4MZ3A 1AGDB 2AXGA 4OLYL 3BESR 2DQEH 4G6FB 2BNUA 3F7QA 3TBYA 4ZUSB 5C0CB 4DAGL 2CMRH 2C7UA 4JKLA 1HDMB 1BZQK 3W0WE 1BM3L 1U3HC 2FDBP 3SDXE 1BM3H 2HTKD 1IE5A 1K6QH 1PGRB 5J8OA 4ZOBA 4BZ2H 4JZOA 4U7MA 3UDWA 4FP8H 1H0DB 4JFDE 5E00A 5IWLA 1RIHH 4ZO7A 4BZ1L 1I3RB 2HN7A 3OKLB 1I7ZA 3LOWA 5FHBH 3VXUA 1MPAL 4YJZL 2NY6D 1J88A 4WHDA 1IC4L 4OZHB 4X5XA 1RUKL 3AUVA 2NXZC 3VXUD 4KUCD 5F88B 4AH2A 2UYLB 2ICWA 1N3NA 1EEQA 2HLAB 5DMIL 4FQJH 3ZL4H 3IDIB 3ZE2E 3QNXB 2CDGB 4YDVA 1L7TH 4Z95L 1TIUA 2BSRA 2Z92A 4KROB 3OGCB 4RAHA 3S3SA 5I1IH 3MGTA 1AC6A 1DQLH 3GBNH 3BPNC 4E0RB 4N8CL 1MVFA 3PV6B 4K8RL 4PJDF 5I73B 2FHBA 1LD9B 4XPGH 1OHQA 5C8JA 3MA9H 3PF2A 4MDJA 2OSLA 4CADB 3CK0H 4CAGA 2VYRE 3U30C 1VEPA 3EO1A 3BRFA 5GHWH 3LKSA 1WFNA 1RY7B 3IRPX 5DC0A 1OGAB 2Y6SC 3NMEA 1LEIA 4HF5H 5DJAB 3NIFE 5I18H 3IF1B 4XC1H 3QXAB 3SY0A 3DVIA 3UBXI 1GSMA 3HR5A 3VH8G 3DWTA 4L4JA 4XB8A 2APXA 4PY8J 3GSNB 2DM3A 1WWBX 1QFWL 3OAUL 4H20H 2K7QA 4UUJA 3TFKC 1NH6A 3UBXA 3SDAB 2O5ZH 3TBSA 3GSQA 2VL5B 5DRWA 4MHHG 4NQDE 5ESAA 4TVPH 4QWWD 1JPTL 4ZQKB 3EYSL 4M5YL 3A67H 3CXDL 3RVWC 3T2NH 4OLWL 3P9MB 4XPHL 2BJML 3UP1A 3L3KA 4PREA 4UNUA 3N1PC 4U31A 2F53E 2R56L 2WWMC 1S78C 4FQXD 4DQOL 1LO3H 4LPXA 4DVRL 2VR5A 1EFXD 4JRXB 2AK1L 4XNUH 3G6AB 4YDLB 4YXLL 2Z93A 1MFCL 3TZVB 4PGCA 3L3JA 5AYUL 1X5IA 2O26U 3LY6A 4GG6E 5JDJA 1CFSA 2CK0H 3LD8B 4GAJL 4LSSH 5MHSD 4DN4H 1PY9A 2V2XB 4PG2A 4IMLA 1ZGLM 3KPNB 1INDH 2F15A 3MUHL 5IESL 3V4PL 3IT8D 3PIQB 3CFDA 3QEQB 4RSVA 5F6HJ 3SGDH 4OI7A 2GJ6D 4UT6L 2BVYA 2OP4L 1LEKA 5K9KB 5JIPA 5IVZB 4OIIL 2AEWA 4KJPC 1PKOA 4J1UB 1JPSL 2F8OA 2AK4A 5IBLC 3U7AA 4Z7QE 4Y19B 3OF6A 3V95A 3V9FA 3O11B 4GRLD 2JJUA 3B3IB 5B39B 4NPYB 1TDQA 4DZ8A 1HHJA 2V17H 3V4VH 1QTYT 2HKFH 1UM6L 4LVNB 1S7TB 5E8EB 4CKVX 2QADC 4UBDC 5EN2A 3LSOB 3F8UB 3NCYS 4KJWC 5T5NG 5IJVA 1DBBL 2WWKT 1ITBB 3QXVA 5D7LA 2Y4SA 3OXRA 4OQ1A 1NPUA 1XF5B 1U42A 4MVBC 1OGTB 3WXWH 2B0SH 5BW7A 4UINH 5D7LB 4V1DA 1PQZA 3O8XC 4PB9H 5IHZB 4HPYL 4HKBB 4JHBA 1AGEA 1QFWM 2OL3B 3I75A 2DM2A 2P46B 3IDMB 1Z3GL 2Q1EA 3HNSL 4HUUA 1CLCA 4P99A 5FYJH 1CIDA 3KXFA 3H9SE 2Z8WC 3SGDI 4MX7B 3CU1A 4JAMA 3BZFA 1T1WB 2ADJB 4TQEL 3MLYL 5D7JC 2WINB 4P3CH 4BH7A 1G9MH 5T3XE 1KYOJ 3N85H 4XNZB 2LE9A 1HHKA 4LMQI 3NACH 5CJXA 5EZJA 1DFBH 3BYTA 2CIKB 4MA3A 3RGVC 4D9RE 3D9AH 1FFOA 1UEMA 2FATH 3G08A 2BSTA 3D48R 1UM6H 4Q9BA 4HKBA 5DO2C 3OKKB 1ZANH 4H0HB 1KTLB 1AE6H 1IAIH 3MLXL 5KVDL 3WFEL 5IB3B 4Z0BL 4XNQA 5DA4A 1M7DB 3QNYB 2Y6SD 3DMMB 3TIEB 3CSBA 1KN2H 4MJ4A 3LEYH 5I8EA 3C9NA 3NH7H 2XI9A 4OIIH 1NLBH 4JDTH 2A6KA 4OFIA 2R1YA 4WWKC 2DWDB 1QSVA 3L5HA 5EU6E 3IDJB 4Y19D 2X89A 4AG4H 2AK4D 5GS0D 4JFFA 4FFYH 2GK2A 3FB6A 3Q6FA 1N59A 3EW3B 4GQ9L 2ITDB 4P5TD 5M7QA 2HP4A 4OI9A 3ESUF 5JW4R 3NAAL 2Z91B 5D6DA 3WIFA 2JCCE 4WEBL 4GAYB 4NQXB 1O7SA 2LAGB 1YEJL 4ERSH 4F15C 5BVJA 3MCLH 3RDTC 4M8QA 3KYAA 2QBWA 2F9BT 3G9VA 1HXMB 4LBEA 3ZHDA 4Z77B 4NQEE 2RB8A 5D7SL 1GHFH 1C5DB 1BJ1J 4JO4H 4ZUTB 4OLWH 4QHNA 3BKYL 1CGSL 4KHXL 5KSUB 3HMXL 4YDIH 3JWDC 1LE5A 1AKJA 3GMRB 4KZDH 3Q6GL 4MNQD 3HCVA 2R0ZH 4HKJA 3H3KA 4DKFH 4UMGA 3RUGB 3WIIH 5FOJA 2QQKH 3TIDA 1E4WH 3U1SL 4PREB 3SKOA 1NGZA 5D1QB 3KPOB 4N68A 4HGMA 5DI8B 2B1HL 3OKEB 3O0RH 2MKLC 5E7BA 2R2BB 2BVPB 4LMQE 4PR5A 5F7DA 1P2CB 5E94A 1RZJH 1HXYA 5TQ2L 4K3DL 3T0EA 4I5BA 4PLKC 4R7DA 3GZKA 2QSQA 1H3TA 4UT7L 3PV6A 2VZ3A 2D7PA 4JGMA 1KJ2H 2ED7A 4AG4L 1OP5K 1L6XA 1NGXB 4FN0A 4N8VB 5DDHA 2DQTH 1UWGH 3EHBC 3RNKB 4H1LH 4N5EC 4EVNA 4ZUUB 1LNUA 1ORQB 4PV8B 4XAWH 3TIDB 3HZYA 5C08E 1IGYB 3L5XL 4DGIL 4MS8C 1IGTB 2JJSC 4UQ3A 1OAXL 1A6UL 5I1AB 4JVWA 4DGVH 1UWXK 1MQKL 4XPBH 3TT1H 4DW2H 2V5TA 4ELKB 1WUNT 5CJ5A 5I6XC 2HRLA 1AI1L 5GGQL 5DRXA 1RZGA 1I3RA 3L3OB 4PJIE 3VCLA 3LMJH 5FGCE 3KPLB 4JPKL 2FX7H 5EWIL 3QDHA 4HXBH 4BSVB 3P2TA 1OAYH 5EULV 3HZKB 4U3CA 4HCRH 4L9DA 3HAEG 3I50L 3V8OA 5HGBB 4NC1C 5I1HH 2EE9A 3L9RB 5ID1A 3OXRB 4O2CA 1YN7B 4ZOEA 1HNGA 1ZGLB 1N6UA 3G5VB 5DK3A 2AQ3A 1UG9A 3MRJA 2F53D 1B0RA 1WAAF 4RFEB 3AREB 5HYFA 3VD7A 2A83A 4BFIB 4PJBE 2IWGA 4Q0XH 5J13B 2C3HA 4I18A 4HHAB 2AJUH 2HWZH 4GG8B 4RGNC 4KRMB 5AUMA 3UPRB 3CLFH 2BERA 3C6SB 3EOBA 4IEFB 3FO1B 3P0YH 2EIBA 3DSNA 1KJVA 3VFPB 1W72L 3KS0H 1DLFL 3QG7L 2PW2B 3OKNB 5KVGH 1GL4B 3G6JE 2MHAB 4PJ8A 4S1SL 4LASH 1OAZH 1WWWX 1UVQB 2VE6B 4F3FA 5IW1B 2GCYA 1G7LB 2C3XA 3BN9C 4NN5C 1JL8A 3X13A 5DGQA 4P2RA 4H8WL 1T21B 2OJEA 5C08D 4XMLH 4NKMA 4GRMB 5MENA 3VMNA 3FFDA 2FZ3A 1MWAB 2YKLH 1CI5A 4J3TA 5JNYA 2EZ0D 5J1TC 4LLQA 1TTGA 2XWBA 1DVFC 4O4YH 3CFKB 3GBLA 3MNZA 1C5BH 3SDCC 2XA8L 2XZQL 7CGTA 1TZHB 4HK3N 4GG6B 3D2UD 4XVUD 4P46B 4D0CB 2GIYA 4N0FA 1P9MC 2D7TL 1H8SA 3RVVC 1AD0A 3BZEA 3IU4H 4JFFB 4HBCL 1FAIL 4PJAA 1JNJA 3F7YA 2DQGH 4RFOL 4HCRA 1UH4A 2AK1H 5AD0B 2BNRD 1JK8A 4M9OA 3S3PA 2E6JA 3BSZH 6FABH 4M6OH 2QL1A 3O4OB 4K07A 4F80A 2CXGA 4WTWA 3DXAB 5TH2B 4KZDL 1UH2A 1M7DA 3QZWB 4OCNC 3T0EB 4N0YL 1CGSH 4KHXH 3JV4B 3MNWA 3OJ2C 2QKIB 3QRGL 2JIXD 2QTEA 5FKPA 4Z18A 3WS3B 1KLUB 1MSPA 3IFPA 1T22B 4PLOB 3ZTNL 1ZT7B 4L8BB 2DQIL 5GGSY 3UZEA 4MA7L 3QUMB 4M4RA 5EZJB 1RZFL 1ZS8B 3B9KA 2HFFB 5C6WH 2VABA 1I4FA 2BRQA 4ZAKD 2L0DA 3MRPB 3MRKA 2DBLL 2O5XH 1F11B 1FNSL 4BFGA 4HMEA 5D7JA 1ULVA 3QUXD 4U05A 2OTPA 1KACB 1O0VA 5TH2A 4F7EA 4HT1L 2R4RL 3DECA 3HNTL 2G60H 4DOHE 5KSAA 2GJZA 2XZQH 4K23H 1KIQB 3C5ZD 4BFEA 5JHDA 4GW5A 2EKJA 3F58H 2DQJH 3TBTA 4G6KH 1T7WA 3NABL 4MJ2A 1FL6B 1GZPA 4JFHD 2VLJD 2I9LA 4YXHL 2J88H 5C0IB 5JQ6H 1LE9A 4KJPD 1HINL 1C1EL 3JUZA 3EO9H 2R1XB 2YPKA 4HWBL 1T0PB 3IDXH 4WV1B 5DRZA 4BKLB 4EDWL 4BFBD 1T6VN 5CFHA 1RV6X 2AJYL 1OQXA 2ZJSL 3P4LA 2X1OA 5E8DL 1BFOA 1VDGA 2VITB 4KPHH 2A73A 2R4SL 4KHTL 4MQSB 1OP9A 1NC4A 2DKUA 5EOQH 1MI5B 2H41A 5EH1A 3WFCL 1RK1A 3K8KA 4X6CE 3WLWD 4JCMA 3GIVA 5F3BB 2UUDH 3EZJB 4ODVL 4ONGH 1UCBH 1T2QH 1Y6NR 4LDEB 2AJXH 1N8ZA 4JFED 4LSQH 4QKXB 5SX5K 1LEGA 5T1DH 4RMRA 2IQAA 3CZFB 2D7MA 1P84J 4RGNE 5CGYD 3CMOH 5E6IA 3EFDL 4C54A 3HE6C 5FYJU 1EZVX 5AYQA 2ZCHL 4QHUA 2I9LB 2Z31C 4LSRL 1HCFX 4N8VG 3MRRB 5I8CA 4LLDA 2DLGA 3LB6D 2CKBB 3VH8A 5FGRA 4HUNB 1IZJA 3LMJL 1W0YT 2DICA 4Y1AA 4KKBD 1FV1A 1CL7L 8CGTA 3ZDZE 4FQHB 4WHYH 1B3JA 3M45A 4EI5D 3WXVL 1Z2KA 2FB4L 5B38B 3PHSA 2SEBB 4JG1H 4BK4A 5CEZH 4LEXL 1N3NB 4NDMA 1S9WA 4NUJB 1UC6A 1PLGH 3SQOH 2H32A 4YDKH 1CT8B 1NMAH 3I2CL 1I1AC 1F8TH 3VRLE 3U46B 3I6KA 4LPTA 1R5VB 2H1PH 3AFLA 4X6CB 2V2WB 3GSVA 3O3EB 1UQSB 3MV7B 5D2NE 4Q9QH 1EGJA 3IFPB 4HLJA 1OAKH 2ADGA 2P8MA 1Q94A 1NANH 1NFDA 2NY7L 5E70A 5AYUH 2JJSA 5HHVH 3TA3D 4PBVC 3O4LD 2IG2H 1XR9A 4Y4HC 5GRYA 3EO1B 5A16A 3EOAA 1BZ7A 1AQDB 1H3GA 1Q9KA 1G6RL 2EKSA 3B5TA 4NQVA 2AEQH 4JVPA 5D8JL 3MQIA 1TMCB 3ARPA 4M7KL 5CINL 1G9MC 1P1ZA 1P4LA 1PG7L 1QG3A 2CRMA 2F54E 4Z7WA 4ODTH 5JPMB 1B2WL 1QSFA 1MJJB 5C0BD 4JQVA 3EJYC 3INUL 4YIQA 4LCYB 4J7RA 5TF1H 5C0BA 2O5YL 4PY8I 4LSRH 5JMRA 1S3KL 4Z76A 2EYTA 2ZCHH 1S9XA 3QEGH 5DD6A 3L5WA 4XP9H 3O9WD 2R1YB 4V1DD 5C70A 4PP1C 4UILL 3BGMB 4KUZH 4U1NB 1U36A 2XY1A 3MV8E 3QSKB 4QTHA 3ARXA 2ENYA 3K7UA 3EYFA 3PL6A 4BA8A 1YEEH 3TVMB 2AJXL 5EZLA 2XTLA 4XNYH 3E8UL 4RZCB 1MQ8A 3RX5A 4CUCA 1C8PA 4OGXH 4WENB 5LGHH 1BZ7B 3S35L 5GSVA 1A64A 4XPAH 4G6JH 2E9BA 4LNRA 4MQTB 4P2QD 3WFHB 5MI0C 1QFOA 3SE9L 4EI6B 1YMMB 3KPSB 3T08A 5F96H 4YFEA 3S36H 5CSBA 4KK6D 4KTDH 1X5ZA 4H88H 4OQTA 3MNVB 1P7KB 3T0BA 1I1CA 2CIIA 4HS3B 3MRNB 2LFGA 3PGDB 3FQXA 3FO1A 3QXUA 2R1XA 2YPKB 3FTGA 4M4PA 4P4KB 3RBSA 1NJ9B 5DK2B 5BRZA 5AAWA 2NMSA 1IT9L 3SO3B 3VXRD 1XH3B 1D5MB 3P0VH 4JFDA 1UH3A 1FFNA 1MJ7L 4NQEA 3PABA 4P3DA 4YR6A 3FQUB 4O51A 5EIIB 1U8LB 1QRKA 2CSPA 5DJZA 1HHHA 1AQKL 4CMHC 5C0EB 1BZ9B 4H1LG 5HDBE 5FYJL 2XZCH 3C60D 4EOWL 2K3TA 2D9CA 3S37L 3QAZC 1GGBH 1AIFB 1NGQH 1S7TA 2R2HB 3O8XA 1GAFL 4TRPH 4QLRA 3U7YH 4DN3L 2H26A 5HYSG 3OR6B 4BZYA 1H15B 2XTJD 4NM8L 35C8L 4PTUB 4QRQB 3TWCL 1HK6A 3E2HB 3OKDB 2J6EL 4Y5VC 3T0EE 2N7BA 1I8MB 2BFVL 2WIIA 4PJHB 3PGCA 2RR3A 4D2NA 1BF8A 4F9LC 5DQJB 5FO9B 3BDXA 3HC3H 3PWUB 4KVNL 1FL3B 2HFGL 2YC1B 2VDOH 2Q76B 3C6LD 5IHUH 1FYHB 2FYYA 4OTXL 3OR7A 1EBPA 5EBGA 1S9YB 3W82A 4HS8L 4TSCL 2E9WA 3TT3L 3LSOA 4UT6H 4M7LT 4LLVB 2MPAL 3QO1A 1IC5H 4IDLA 2YZ1A 2I60H 3NN8B 3MOAH 2CLZA 2EDFA 4MXQD 3VE0A 5JW5A 2ZJSH 3RWJA 3U0PB 1L7IL 5C07E 4UAOC 3FQXB 3VXRE 1DEEB 4LQFL 4OLEA 4HHAA 4Y88A 3W0WD 2A83B 1O7VA 4PBWD 2WK2A 4YHKH 3JTTA 4N1CA 2Q8BH 2UZIL 4Y4FA 3F7RA 5C9JB 3CVIH 4X0KB 1LEKB 1EJOL 1U41A 2WQRA 1R5IA 4XWOD 1XCTA 4Y5YA 3QDJA 1QEWA 4N8PA 4KK5C 3MRDA 4K71B 3BPLB 1KG0B 1MRDH 4A6YA 1U2HA 1IQWH 5TFSL 3PGFL 2RQ8A 4GBXA 1NAMB 1FNHA 4XCEA 3IXAA 2A9NH 4L3ED 4YNYA 5HVHC 4H26A 1DBMH 4KI5C 1MAKA 3BJLA 4KVNH 3LPWA 5JMOC 2R9HC 5IV2A 1A7PL 5F44A 5MENB 4OD2B 3GSWB 1EUUA 3UTSD 2ZSWB 4JKKA 4PJEF 3O3BA 4JJHA 3UTQA 4JFZL 3O6MH 2J6EH 4X98B 5E2VH 3BIAX 1TLKA 1J11A 5I1EH 2LTQC 2GT9B 5D70L 2DF3A 3QJFA 3ARBA 3DVGB 5EC1A 4M93B 4Z76B 3RWJB 5EFIB 3O6KH 1J0KA 5GS1B 5BVPH 4OZGA 1U3HD 3UMTA 1ZEAH 5EA0L 2XKSA 4OCYL 4KJWD 4WI7A 1F58L 4XVTH 1RULH 2E8ZA 1FNLA 2VIRB 3SKNB 3RIFF 1MCPL 4LDLB 2G5BA 4X99B 1XT5A 5KSVA 3OKEA 1J7VR 1IGJA 5MEND 1A4JB 5T1LD 3PP3K 4Z5RA 1B90A 3M1BB 2A77H 3VFGH 4MXVE 1BOGB 1U8LA 2ZNWA 3HI5L 3ULVH 2R0LH 3FQUA 2O61B 1XIWB 4I2XA 4ZFGL 4HBCH 4I0PA 3VGFA 2V5MA 1AI1H 5I1JH 4ZTOH 2IAMC 4U0RC 5JW3H 3TT1L 1UA6L 2PXYD 4RQQB 2L7UA 2FR4B 4JAMB 1FZOB 1QBLH 5EBMA 3H9ZA 2DQFB 3MBXL 1TZGH 3BPLC 2A1WH 1B4JH 1IGTA 4UQ3B 5AEAA 4HUWB 1IM9A 2K9UA 4UTBL 4IJ3B 3HNTH 4HC1A 2BSSB 4H0GA 5J4MA 1MCSA 3DX7A 3Q5OA 3ULUL 2NY1C 5I17B 1C16B 4OSUH 4YGVB 1WITA 1CFNB 3LIZL 5EO9A 5C0CA 2OXHA 1BFOB 1FLRL 3RAJH 3VFSB 1SJXA 3AU1A 1RVFL 4PJ5D 3QH3B 4IRJA 1E4WL 1FSKC 5KVGL 3OB0K 1Z9OA 2OTWA 4XHJD 5F89A 5EFIA 5KZCD 1PEWA 2P8PA 3DTXB 3VFOA 1YEIH 3SGJC 5I75C 4P2QE 1SQ2N 4XTRC 4LFHD 4YGVA 3ARWA 4D0DB 1VEOA 2BY1A 2C4XA 4IMLB 1XZ0A 4KMTH 1WAAE 2X70B 1IKFL 1F4YL 1RURH 5MEOA 1NSNL 5C6TH 2NXZD 3D18B 5ALCL 3FFCB 3GI9L 1M6OA 3HZKA 5M95B 4GBXB 4XCEB 2DYPA 3RWGB 1LP9B 1OF2A 1UENA 2Z35B 3QFJB 2ARJQ 4JFQB 1A6AA 4LCWA 5DRXB 4AK1A 1DLHA 4X4XB 3TP4A 4KDTC 3TN0C 5A43C 3TM6A 4LHUD 3CX2A 3ULVF 4C83B 4MLSA 1I1AD 4HGKC 4M61A 5JOFB 2DB8A 4UOW0 4L9LC 2PXYB 4PJXE 1NCUA 5BZWA 4FQQA 4CL7A 2BX5A 1F4HA 3PHOB 4LEXH 2EE6A 5BMFH 2YKLL 5F6IB 2XV6B 1FFNB 4NQEB 4LKXA 3OJDA 5EUOE 3KAAA 2NW3A 3H42L 4NYLB 4G8GB 3K2UL 3WFBH 4MB5A 4KTYA 2VAJA 4OD3L 2IEPA 4TULH 5DYOA 2C3VA 4U1LB 5GPRA 3ARFD 1Q94B 3DROB 2VDKH 4J2XA 4HKXB 4GRLC 3TNMA 5CD5C 3EFDH 5IEHA 5DD5L 5TE6L 2O93L 4PS4H 1LDPL 4FXGB 2YD2A 4C56A 5IB5B 2E7LA 1A6AB 4L1HA 3OAZH 3U46A 4JM2F 2LAAA 2VN4A 4L4VD 5IK3A 5EZIL 1FDLH 5BXFB 2E7LC 3J8F7 2J8OA 2DIBA 4KK8D 3B9KC 4GRWH 4GT7A 2IPTL 5C7XH 1T2QL 3FT2B 2DD8L 2IBZY 4PG9A 3O8XD 4LSPL 3DUSB 1F02I 4NO2A 3BGFB 4HJJH 3EHBD 3NFNB 3DGCR 5E5MB 1ZLSL 5EPMB 3LZFH 5FUZL 2I9TB 4JG0L 3MUY1 2EDQA 1K4DA 1RVFH 3M07A 1CN4A 1YEJH 3BO8A 3D69B 1K8IA 3MZGB 5HI5C 5K33A 3G6JF 5IMOA 2A2QT 4FRWA 4NZJA 1FYTA 5J6GA 1AXSA 4HWUA 1X5JA 5IHLB 3BZEB 3I85A 2HRPH 2KDGA 3LQMA 2E7BA 3FB6B 4GW4A 2VSCA 5C0JA 5KANG 2V5SA 4NQDB 3QIBB 1A9EA 5D9SB 4OGYL 4WI5A 1CTOA 5GGTH 2D2OA 3H3PL 1A9EB 3W9DB 3T8XB 4TTGA 2A6KB 2OL3H 3RTQD 1YEFL 3DOSA 1MFDH 3GBML 3MV7D 3ARGC 1CFQA 2PYEE 1YPZE 5C07B 5IEKA 1KXQE 3V4PH 3GJFK 1VESA 3WNKA 3TBTB 1U8QA 3EYQD 2ENSA 5DJ8B 3D69A 2YEZB 2YEZA 4Z7WE 3MRGA 3W39A 4PJFF 3ARGD 4ELMF 2HFEA 2OJEB 2YN5A 4MA8H 5H2BB 5F3HA 2Q76A 3G6JB 2A73B 4P5TA 4B7IA 1CGTA 1I1AB 1I8KA 3D9AL 4J3UA 5DC4B 3UYPA 3QQ3B 4K8RD 3UAJC 1L9NA 2DQIH 1CT8A 3QPQC 1DQDH 1DCLA 3MREA 1IAOA 1YEKL 4CVZA 3LZFL 1T3FB 2W9DL 3ARDB 3JV5A 1N7ML 2D7OA 4L4VA 2VN7A 5IK3B 4D3CH 3PE9A 4P3CL 1PJ9A 3HI6L 4C56D 4M7ZB 4MX7A 4LPYA 1K2DB 1YEIL 4M62H 5E1HB 5MENE 4E0RA 4I18B 4PJFA 4V2CB 3MLZH 4X99A 1NGXA 1JZ7A 2HT4D 1A22B 5L8JB 3PG2A 1F2QA 3C60B 3PHQA 4HIXL 2Z31B 5JXEA 5I1DA 5KS9F 2KBGA 2FHCA 3MRRA 3PABB 4JZJA 4P3DB 1YY9D 2W9EL 4Z9KB 2JKXA 4OZFB 4RMSA 3ZKSD 3T4AB 1HILB 3P0GB 2XA3A 1J0JA 2YD9A 3VCLB 7FABL 1I7TA 4PJ5B 5FOBA 4HIIA 4OZHF 5I8KH 3ILQD 5IB1B 4MWFB 5ETUB 1KXTB 2IBZX 1CICA 3ELAT 4X98A 3D87B 4LPCA 5E56A 5TFSH 2NY1D 4NSKA 1FE8H 4AENB 1BBJB 2NY2B 2E7MA 3CC5B 4OLXH 4HQQH 3BPOB 4QHMA 2WUCL 5C0AD 4OZFG 4ZPTA 4R0LB 2UZIH 1Q9OA 1HXMA 3KPSD 4J3WA 2H32B 1JYVA 2HJLA 1C7SA 4HG4J 4MB4A 5AZ2H 3C8KA 1W72B 1LO5B 2BDNH 4OUOA 1ETZB 4WUUA 2DL2A 3FONA 4OCSL 4HUMB 1CGVA 4OGAC 2JJTA 2R0LL 3GI8H 5HHMD 5HVWA 5DRZB 1DUYA 2FATL 2DLFH 1S5HA 3MGOA 4U1SB 3D3VD 2WLYA 1L0XA 5F1IB 2X10A 4HXAL 1BVLA 3CZJA 5ALCH 1D9KA 1SBSH 4JQVC 3E6HA 1A6VL 1A1MA 1IC4H 1FFQA 3GNML 4EBQH 4NNPH 3SDDB 4NZRL 2IALB 3V5KA 5F7MC 3QUMH 3LS5L 2IANE 3QFJA 4U33A 4OM1H 1JNNH 2G2RA 3BN3B 3CH8A 1JPFB 4YPGA 5DR5L 3WUWB 1JWSB 3GHEL 5K9QI 3WJJC 4IOSD 1BHGA 5ICZA 4UINL 3FO0H 2GY7B 1JGEB 2X70A 2NNAB 2VB5A 3BT2H 1QSEA 3I50H 5EU6D 1L0YA 1URLA 3MBEB 4S11A 3HMXA 1UZ6E 4KH2A 3MUZ1 5IQ9B 1JGUH 5C0FB 4YK4B 4NM8H 1TFHA 3IDYB 3U7YL 1MCJA 1ZSDA 3X3GL 4EEEA 5T1LA 2VE6A 1EO8L 4M48H 4DTGH 3RL2B 4MSWA 4YWGH 1DBML 3GMMA 2BOBA 3ZE0E 2PKDA 3SKMA 1CICB 3VJ6A 2BNRB 3S3JA 1LILA 5KVEL 5FIEA 3QIUA 1AGDA 3M17A 2W65A 5EBWA 5DS8A 1P7QB 4LRNH 1MI5E 1JGVL 2UUDK 5D1ZC 5IGXL 1KPRB 3IGAB 5C3TA 3NCJL 3EYUL 3FT4B 3C9NB 4L3EB 4BJLA 1HN1A 4KJYA 3FN0L 3TO2A 4EQ2A 3D2UB 2VZOA 4LQFH 4LQ1A 4AM0A 4R4NC 1K8DA 4YDJB 1OTUD 3WN5C 4DCQB 2D0FA 3AS2A 1DE4B 4TUJA 1QA9B 2NQCA 2YD4A 3GI9H 2EIZA 5J1SC 1KEMH 4TPRL 5EUOB 1NCAL 3VFMA 4FQJL 1MFAH 2EDEA 5C08B 5D1ZB 1UJ3C 1JYWA 1CE6A 1X6LA 3STLB 2VMFA 2XZAL 3IJYA 1S7VB 1MHCB 1KLGA 1YZZA 2HN7B 4Q9CA 3HC3L 1Z0MA 32C2B 5I71B 1MWAA 1YEEL 3V6OC 2DS4A 3MACL 4QRPE 1J0IA 5ICYB 1ZEAL 5FV1L 3QEQA 4NN5B 2AI0L 2HAZA 2V7HA 3AROA 4HSQA 3HCVB 3QCUL 3W11D 3LHPH 3LS4H 2NY0B 2DLTA 5IW1A 3MR9B 4JREB 1MCFA 5E2VL 2O5YH 1LO0L 3G5YB 2UZXB 3CIQA 2BVPA 1MI5D 3BKML 1HHJB 4WWKD 3JUYA 4M1GH 3B3IA 1KCSL 3NGBC 4Z7UF 4WV1A 1S7RB 2Z91A 3WIFB 3VFSA 3D85D 5D96C 5DJXB 3D6GA 4QCIA 3TJEL 2BY3A 5TGBB 3UTQB 4OF6A 4JO3H 1ZA6A 1IT9H 1WWAX 1XGUB 1PX3A 1YN7A 2AV7B 1A1NA 4FQ1L 1NGPL 5K9KA 3IDNB 4AIZB 2CJUL 5MEPA 1TQCC 3L5IA 4G9FE 4UUJB 2HTLD 1YQVL 3MTRA 3LRGA 4M43L 5TDOA 3MLPA 1RZIA 3O41A 2V2XA 2OZ4L 3ZKXB 3B2VL 3OKYA 5D71L 3HR5B 1CD8A 1GCFA 4LSVL 5F96L 4LRIC 5F9WC 2B4CL 4X0KA 3SDXA 1WBZB 3FRPG 4I8DA 4LVOC 4K9EL 2MPAH 3FRUA 2BHUA 1KOAA 1AGBA 2LABA 3MRKB 3VG0L 4CGTA 2NY2C 2AJZB 5LGHL 2W07A 3BZDA 1RI8A 3S36X 2P7TA 3S98A 1BIIB 2O61A 4PRNA 4ZAKB 3NTCL 3MV8A 4S1QL 1YMMD 4PJEA 4TUOB 3RIFK 5F1KC 2EDNA 1H3PH 3TC9A 5TE4L 3WS6C 3R8QA 3MRCA 2HFGH 3H9HA 2H8PA 4NRYA 4X5LA 3SHSA 2XTJE 1KCRH 1T1XA 3IS1X 1OAUH 4PRPD 3UTZA 4E41A 3GDBA 1UACH 5IT2L 3T0ED 4J8RB 1I7UB 1A7RH 2COQA 4NGHL 3C60C 1JVKA 3GSXB 4FXKA 4W4NA 1JZ2A 3SCMA 4V1DB 4WDIA 4U2ZA 4N5ED 3ZE0F 1KB9J 4B5EA 1F3DJ 1KGCD 4KFZC 3WHXA 2EDDA 5D8JH 4KKLD 2IBBA 1FIEA 3FB8A 2GSGB 1U2CA 2BNRE 3BE1H 4OD2A 2BXZA 3HI1B 3OR6A 3WJLA 3ARUA 5I16B 3KYKL 5J1AB 4KJQD 1MFBL 4P46D 4YHMH 2DQUL 3MYJB 1U8JA 3A6BH 3P73B 4BK5A 5CIPB 5E8DH 3BAEL 3ZKNC 1JWMA 4PJIA 4Q9QL 1UCTA 4ZYKA 1ZVYA 3ILPA 3LEXB 1INEL 4PRHD 3D39A 5DJ8A 4KRLB 2XT1B 3PNWA 4HKZB 1NAKH 2C7UB 2OR9L 4WI3A 3D85B 4PJBF 2I60L 2OI9B 1KEGH 5BRZB 1I7UA 1YMME 1JI2A 1JGEA 3NABH 3B8YA 4G6KL 3O2DH 3ME0A 4YO0A 1E4JA 5IVXB 4WWKB 3SPVB 3TPUB 1RHHA 1CLZH 4ORZC