1NCDH

Refined crystal structure of the influenza virus n9 neuraminidase-nc41 fab complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
221
Chain Sequence
b'QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNWVKQAPGKGLEWMGWINTNTGEPTYGEEFKGRFAFSLETSASTANLQINNLKNEDKATFFCARGEDNFGSLSDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INFLUENZA A SUBTYPE N9 NEURAMINIDASE
publication title Refined crystal structure of the influenza virus N9 neuraminidase-NC41 Fab complex.
pubmed doi rcsb
molecule tags Hydrolase(o-glycosyl)
total genus 38
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1992-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ncdH02
3NA9H 4K94C 4IJ3B 3TT1L 1FFOA 3HS0A 1N3NB 2BNRE 2F8VA 4JHWH 5TDOB 4DGIH 4GG6E 3I6LD 4UDUB 4NQCD 1H3TA 2DLGA 4B5EA 4YHKL 2P8MA 5DTFA 1U8IB 3RP1A 4QRTB 5CINL 5DDHB 2XQYK 4KHXL 1J1PL 1IL1B 5IJKC 4KQ3H 4ONFL 5DF0A 1NEZG 1YY8B 2FB4H 5CCKL 5CZVL 1TZGH 3P30H 4PD4K 1MJJA 5DEGB 4KI5E 4MGXA 4OTXL 2VUOA 3CZFB 4XI5C 5C0EA 1KPUB 4DTGH 3DOSA 2NZ9C 1KENL 4AL8H 2ESVB 4PB0L 3J8F7 1NCBL 4HFUH 3B2VH 4WEBL 3VW3H 4QYOA 2R0ZH 4G8FA 1KB5H 5ENWA 3NIFE 5CMAB 3C8KA 3NCBB 1AFVH 1HE7A 5E8PA 2DN7A 2RHEA 3FQUA 4KTYA 5CJXC 3MLYH 1K8IB 2EE2A 4ZUTA 4X7CC 1ZWIB 2DJUA 4PV8A 1A47A 1E4XL 1YQVL 4PBVC 3MQIA 1WWCA 3DWTA 2FBJL 1CTOA 2Q7YA 5C0GA 3KPPA 1I85C 1YEDB 4R96A 3ARBC 2YD4A 4RFOH 3RU8H 5IW6B 3S88L 4HPOH 4LEOA 2FL5B 1LVEA 1CDGA 2F53D 3DYOA 4ZFZA 4JFDA 1VHPA 4DGVH 3IETB 3KGRA 4NCC2 4PGBA 1JIBA 4N0UE 4CW1A 5SWZD 4XBGB 2YUXA 4GRLB 1A1OA 2Y1VA 4IRZL 3JWOC 4OZ4B 1D5XB 1ZS8A 4ODBD 3RUGB 1I3GH 2WQ8A 4RAVB 4K7PL 2C3VB 5KSBA 3MZGB 1KT2A 3MLVH 4A2MA 1MWAB 3ZLQC 1SYVA 5GSVB 4DZBB 4PJCB 3OHXB 3SY0A 3HC4L 3TBWB 4C54A 1PYWB 3D39A 1SJHA 2C4XA 2ICEA 2YSSB 3AREC 1Q9WA 3QAZB 1NGPH 4MNGB 1F11B 1XAUA 1FH5H 3FTGB 4J8RB 4KDWA 3VXTA 4U49A 3KLAA 4ZS7L 2X44D 2GUOA 4H1LG 2W65B 1WF5A 4MQ7A 2ZCLH 4NC2B 3HRZB 3EYOA 5E1HB 3DV4A 4MJID 3MBXL 1KB5A 1ONQA 5TQ0L 1ORSB 2ENYA 5IFJA 3MV9B 1FAIL 2PW2B 5C0CD 5J6GA 1B4RA 3MXVL 4FFWD 1CDYA 1S5HB 1AGEA 2NY3C 2C1OB 3L5HA 4FTVA 2FO1A 1I9RL 5E70A 2VZOA 2P46B 3VWKC 5FK9A 1BECA 1Q72H 5E6YA 3MBED 4K2UH 5DQDL 3ARFC 3FB8B 1X5ZA 2KQMA 3PWUA 1I3RA 1XGUB 1WTLA 1WCBB 1G1YA 3F12A 2ZOLA 3QPXL 3HZYB 4JFXA 3MUHL 3UO1L 4JN1H 1TIUA 2CLZB 4CMMA 5DURD 4EJ1C 5H8DA 5IHZB 2P24A 4P9HL 15C8H 4XC1H 3QQ3B 1EEYB 4XNZB 5DQJB 5DFVC 2ZG1A 4FNLL 4FQCL 4HUNB 5L2KD 1BZ7B 2CKBL 3F7VB 5IT2L 1QEWA 1E27A 3TBYA 2YZ8A 2J12B 3HAEB 2XA8L 1A3QA 2G2RA 4RGOL 2O26U 2ZPKH 2R1XA 2GJ6B 3I6GA 4G8IA 3MSPA 2Y6SD 3R06A 4QRRE 3I85A 4R2GC 1UFUA 3BRFA 1ZA6A 3W2DL 5E8OA 4U2YA 3MRDB 3QDMA 1W8OA 4Y4KD 1FGVH 3QCVH 4GLRI 2DQJL 2W9DH 3VWJB 4JM2B 4MD0B 5DJYA 5ALCL 4DEPB 4XMKL 4ELMB 2GIYA 1MVUB 1RUQL 1U8KA 3JWOL 1EBPA 3GKWH 1DBBH 4KUCF 4X4YB 1NUFA 1YYLL 3GHEL 4PBXA 5FB8A 1DDHB 1KYOK 2N56A 3UYRH 4KK8D 4NN7C 3L3OB 1RK1A 2NMSA 4YBLC 1WSST 1J0KA 5F3BA 4KZDH 4Z0XA 1P5VA 3QUYA 3LQMA 5FYJH 4E5XA 3U0WH 1NC2A 5ANMA 3DUSB 3W39A 1CN4A 3PWPA 1ZGLB 4N5ED 5ID0A 1EJ6A 2F54A 4NSKB 2EXYC 4QXTB 1B88A 4PRHE 4ODWA 1YEEH 1KEGH 2YMXL 3TM6A 2OX5A 4P5TC 3ZL4H 2OYPA 2NPLX 1MQKH 5D7JD 3MRBA 5HHXH 3VD5A 3MLRL 3U9UA 5HTSA 3MRKA 1WBXA 2ZCHL 4Q9RL 3AB0C 1U8QB 2R2CA 3E1F1 3RX7A 5FDYA 4ZUVB 1MIEH 1NLDL 2P44B 2CIKB 5D7LA 4B50A 3UZEA 5HGDA 1ZHNB 4K23H 3C09C 4J3WA 3ULUD 4U1JB 3CGTA 2VKXA 5INDB 3BDYH 3KPRB 4HMDA 4WO4D 2DKUA 3TT3L 2CKBB 1VFUA 2ZJSH 1KXQE 3QXTA 1QBMH 5TGBA 2DD8H 1JWUB 3QNXA 1MJ7H 5C9JA 4X98B 4RQQA 3ARBB 4LLDB 1KJMA 4GKSA 4ODSL 4RIRB 4JFDE 3BMWA 4NUGL 4KKLC 2AEPH 1RULH 4NKMA 4C58B 1I1YB 2YPKB 4M9OA 4R3SB 4OZHE 3CFDB 4Q6YA 4YC2C 1HINH 2D7QA 4EDXB 2VWEC 1Q0YL 4BK4A 4NZRH 4NKOB 1FVCB 2VTFA 2VDOH 4MB5A 2R9HC 4KROC 4HS6A 1T1ZA 4X6CF 2A77L 5KSBE 2I26N 5D71L 5HGBB 1I9JL 1OGTB 3RNQB 4PRID 5K9OA 4PJHE 1CLOH 2AK1L 2HT3D 4GRWB 3AGVA 1CGXA 3D39E 4UINL 2HLAA 1A1MB 1WK0A 1EDQA 3MCG1 3AREB 3CCHB 4HF5L 3G6JA 1XGQB 3WXVH 4M4PA 3FQXA 4OUOA 1BFOA 5EUOE 4ODTL 2QSQA 2PO6A 3BKYH 5B38B 1J0YA 4NQEB 5FM5O 3AXLA 1ZTXL 1J1OL 1S9XB 3C5ZA 4P99A 4JKPH 3SDAA 5B3NA 3F5WA 1T1WB 4FTVE 4JKWA 2D7MA 2NY3B 4WRLA 5I1LB 4XBPA 1NBVL 4G8GB 4LAJH 3VWKB 4HQQL 2FX9L 2A6JA 2FR4B 5DVKA 5H37G 2VZ1A 3ARFB 3VI3E 1DQMH 2B2XH 3GHBL 4GW1B 2FGZA 5D6CB 1X6NA 1WCQA 4HJGB 1XEDA 1HDMB 1NL0L 1OT2A 3EZ8A 1VFAB 3V6OC 2OXHA 2YD3A 5I18L 2DMBA 4JRYD 5FO9B 1CDCA 1HKFA 4JDTH 1T5WB 1UJ3B 4NBYB 2HJLA 4XH2B 3VMPA 1QO3B 1AH1A 1BWWA 1ORQB 4JFEB 2C5DC 3LKPA 4P5KA 1G7PA 5JQ6H 4YHNA 3GSQB 3BI9X 1P2CB 4TVSa 3WFCL 4P2OA 2P5EB 2UWEE 3HAEG 5E00B 1D5ZA 1MJUH 1T1YA 5IBTH 5EC1B 3LD8C 5C0AE 4NRYA 4R2GB 1ZSDA 5LG1A 3RZCC 4GG6F 4DKFH 3H3PL 3QDME 3QJFA 3ARGC 4H5SB 1LDPL 3ROLB 3X3FL 5D6DA 3IS1X 1H3PL 2I5YH 5AG9A 4HWBL 3Q3GA 4UT6H 1Q9OA 4O4YL 4KI5F 3BP6B 3A6CL 4XNMA 5HHNA 5T5NF 3ZHKA 4AEHL 3MOBH 1KCUL 2A9NH 4NN7B 5I1IH 3N1GC 1LEKA 2VXQL 1XFPA 4K7FA 5E8DL 1BBJA 4YBLB 1G7MB 5ANME 1NC4B 3PWPE 2EH8L 3CDFA 1MF2H 3NIFF 4X4ZA 4F9LA 1KLUB 3G6DL 1F58H 5F88A 2CGRH 5DSCA 4I18A 2AJYL 1CD1A 4P5TB 3L5XH 4HS8H 2BSED 4OFYD 4P46C 2EDJA 3OKMB 1JHKL 5A40E 1TXKA 3N1MC 1DLFH 2X7LB 4JZOB 4M48H 3RVWC 3AB0B 2NW2B 4CL7A 3VG0L 2VDML 3C09B 3P4NB 4U4BA 3EYFB 4KRLB 2FECL 1N4XL 5DD5H 5CGYD 1CXIA 1NLBH 4P4KC 1X6LA 1V7NH 5C3TA 2QADC 3CFEB 1G7LB 5F89B 3BXNB 1UZ8B 4P0DA 2YN5A 1GGTA 1UKQA 3PQYD 5C70A 3GBLA 1QSFA 3UPCA 1EFXB 2FWOA 4HXBL 4LQ1A 3S35H 1P1ZB 5JMOC 1WGOA 3AY4C 5DHVH 2C1PA 3OKKA 5E2UH 3O4LA 5IMOB 3PP3K 1MRCH 1FYTD 2KZWA 4JY4A 1IGML 2MCPL 4TNWF 3UBXB 1M7IA 5IVZB 2ADIA 1LEGA 4X7TB 4G6JL 1KJ3L 5ACZB 1T04B 3GRWL 3CIQA 4OM0L 4PJFA 4U6XB 2AJ3B 4YE4L 5T5FL 3QIBD 4JO2H 7FABL 3ELAT 4KROB 5SWQB 1OAZL 2H32H 4PGJA 3CXDH 3WHXA 2NNAB 3HLAB 1LMKA 3CVIL 4YX2L 1BLNB 5I76A 4URTB 2UZYB 1GC1H 4R8WH 5TE4H 2EIZA 5I1JH 1G9EA 4HKJA 4OCNC 3DBXB 3GMOA 3NVQA 4EBQH 4U6HA 5C07D 3ZYZA 1FIGH 1C12B 4UV4L 4CVZB 4ZAKA 1LO5B 3L3IB 2YPLE 1VKXA 3ARPA 3TNNB 2DMKA 3G04A 3PGDB 4L4TD 3OSKA 1L4IA 4IMKC 4G6AD 3X3GL 3FT2B 3MO1A 3VFNB 1H0DB 2ICWB 4PS4H 3T3PE 5B38G 4G43B 4J23A 4LEXH 5JXEC 2X6MA 4QRQB 2EDNA 5DFWH 5GJSH 2DRUA 1JK8B 1EVUA 4TSBH 1DANU 4D0CB 4D2NA 1J86A 3P4LA 1QD0A 3QXDB 4JY6B 4WTXA 4MX7B 5FKPA 5DHVA 1EGJH 3QEGH 3RY6C 3MNVB 3C5SA 1O7VA 4Y2DA 5HHOE 3PGFH 1OTSD 4JPIB 4WFFE 4JG0L 4RMUA 4JPVL 4X6CB 4WUUB 2ZKHL 4RFEA 3L7EA 3MUJA 5IG7B 4M5ZH 2HG5B 4CVXA 2H32A 4OKDA 4PR5A 3HUJA 1AC0A 4ETYA 4HEME 2Z91B 4MXVE 1XR8A 4XMPL 4H0IA 3OJDA 2JJTA 4H26A 5KANG 2KZ1B 3SCMC 1BVKB 1MCWW 1D6VH 2KBGA 4JPKL 1FG9C 4LNRB 5IFHL 3LD8B 2MCG1 3T4AA 1JF1A 2NLJB 5CIPH 5D72L 3RZCB 5DMYA 3ARGB 3O8XD 2OTWA 3TIDB 4XVUD 1JMXA 3NFPA 5JZ7D 3LHPL 3JZ7A 1U8MA 3FT4B 3VXUE 5MP6L 1PSKL 1OAXL 5ADPH 2F19L 2D7NA 2X9XA 5EBWA 4S1QH 3PF2A 2WM0A 5KZCB 3O41A 5DEFA 3HI6L 1MCOL 4DZ8A 1GGCL 1YMHA 3FRUB 4Y8DC 3RVVC 3V6FA 4R0LB 1NSNL 4FMKA 4Y5YC 1A6WL 3TN0C 3PP3H 1EGJA 1H5BA 4ZQKB 1NCAL 1EMTL 1QSED 4P2RB 3BKMH 3U82B 2QHRH 2FH6A 3PJSB 5L88H 4PLOB 1U8HA 4NNXA 4HT1H 4K3DH 4J4PA 3FRPA 4FQHA 3LPWA 1RZGB 1OAUL 4YHZL 1A3RL 1ZANH 3NZHL 5F7EL 3V6ZA 4P46B 3GBML 3TYFB 2X4PA 3TBTA 4QXGL 3DVGA 4MVBC 2YK1H 5DZNA 3UTQB 4N90E 4NCDA 4P2CG 3AAZB 1EXUB 1M4KA 1GZQB 1IBGL 3L5WB 3CXHK 4G7VL 4OZHF 2VISB 1FHGA 2BNRB 2Z31A 1T4KB 1Y0LB 2P45B 4GG6B 2G9HB 1YMMA 4UUJB 2IGFL 5CIPA 2CK0H 1YNKH 3FJTA 4Q9QL 1UM6H 5AD0A 5DMGD 3QQ4B 4E0RB 2VKWA 1YDPB 2QADB 5KSBF 2P8PA 4ZYKA 3RX8A 2VDLL 5EU3A 4K3GA 1CGVA 1R24A 4PREA 1AGCA 3LZFL 3NABL 1UXSB 4MXQC 1XH3A 3QFDB 3GI8H 4PJHF 4QRUB 3WLWC 3D5OF 1K6QH 1MAMH 2DM3A 4I0PC 3O45B 4ONHA 35C8H 3DMMC 5ESQA 4PJ8D 2H1PH 2PW1B 3LSOA 4RGND 4TSCL 1CLYH 3UBXG 4F58H 4PP2B 25C8L 4QTIH 1RUAL 2BERA 5I8CB 1MIML 5EUOF 4YBQC 1X5FA 3ECBB 2MTPA 3DO7A 4KVNH 4KZEL 2UZIH 4YDLC 2AJSH 4QNPE 2R4SL 3UTTD 5LCVH 5J6HB 5T1LA 4RISH 3K81A 3DXAD 2IEPA 1F3DH 4R4FL 5GGTL 2YEZA 2WWKO 4IRSD 3T65B 1W0VA 1ZHKA 5I1KL 2VYRE 3A6BL 4M1CD 4LGPB 1VACA 1V5JA 3VI3F 3BZDA 3K7UA 4HMEA 1JZ3A 1JPST 5D1XA 4KK5C 1FLRL 1M6OB 2X4SB 2DLFL 4YHOL 4WW1A 2R2BB 1LO0L 4N0FB 3C5JA 4GMSL 4MA7L 4D0DB 2GFBB 3RGVC 4GBXB 5CSZA 3FN3A 4XP9L 5D70H 2IADA 4ZFFB 5F7NC 3CUPB 5K59E 2IMNA 2J88H 1EEUA 1UH4A 1OT1A 3FQRB 3QH3A 1KACB 2BVOB 1GGYA 3FOLA 3VH8A 3DRQA 1EHXA 1A14H 1FDLL 2HKFH 4JZNB 2UWEF 4KMQA 3IFNH 2XYCA 5HD8C 1NGWA 2VLJD 3SE4C 4YR6B 1YUHA 3UROR 4ZNEA 1C5BH 1IC1A 3BH9A 2N7BA 2YS4A 5GGVH 1ACYH 1OGAD 5J8OA 3EGSB 2G60H 2H41A 4C55A 4XCYB 4JO3H 3NPZB 2R29H 3PHSA 2EC8A 1XF5B 4LU5L 2ICCA 5C6PB 4V2BA 3EFFA 3K2UH 5DO2D 3D9AL 3QDGD 4Y1AA 1AY1L 3D25A 4HHAA 3HUJE 4LKXB 3QEHA 1JTOA 4IMLB 4WFED 1DBJL 1T0NA 1GGBH 3FN0H 1A9EB 4D8PA 4O2EA 1HXMB 4WGWB 4XWOD 4RMSA 1F4XL 2Y25A 2W9EH 3WNMA 2Q86A 5E5UB 3BOVA 4PG2A 5A2JH 5C0JB 5BS0D 3SCMB 3HRPA 1J8HA 3L5JA 3NCMA 2X9WA 3WE6B 3IU4H 5DK3A 1IGJA 2GY7B 2HLFD 4Z0BL 3MLXL 5C0IB 4D9QE 1PAMA 4XGZB 2WBJC 4N0CC 1XGRB 4FG6D 5EO1A 5CGTA 3FO2B 4G6KL 5BMFL 5JOPD 1L0XA 1B4JL 1U8OB 1Z3GL 4HK3N 5LBSL 3MV8A 5DQ9B 3DGGB 3LKRA 5C0BD 1R3KB 3WJJA 1A3LL 3H3BC 5JW3L 2DQIH 3ZKNC 1CQYA 3KWWA 3TN0B 4FQJH 3VDCA 1K5NB 2K9UA 4K8RL 5ICYA 3TPKA 3DGCR 3TA3B 5ID1A 5F7LB 3C6LA 3VRJB 4HDIB 4F8QA 1CFNB 5F9AC 4UV7L 1VERA 4LCCA 2Y06H 1AO7D 2XY1A 3DSFH 3LPFA 1J5OH 2ARJQ 4BZYA 3RJDA 2YRLA 5DUPL 1P4BH 5J1SC 3ESVF 3SO3C 3EW3B 3RAJH 4GSDH 4JR9H 3UXFA 1JBJA 4HJ0C 1X5HA 4PTUA 3X11A 1D9KC 4KQ3L 5DI8A 5EU5B 1TZGL 3P30L 1TTGA 1DBAL 3SKMA 5HYJD 1JZ5A 4HXAH 2LV4A 1RMFH 2NR6C 1GVIA 2FATH 4R7NA 4PRHB 1EHLH 1I8IB 5CAYB 4E41E 4LIQH 2MFNA 2UVEA 4HFUL 3B2VL 5T1MA 2O5XH 1AKJD 2BNQA 2W0FB 4X80H 5D2LA 1NAKH 1KB5L 4BJLA 4LPCA 4CADA 1MJJB 3S8WA 3IGAA 1AFVL 2VXUL 1YEHH 5T5NG 3AU1A 3HG1A 3WS6C 3MLYL 3WO4C 5HBBA 3IYLW 1KPVB 1MCCA 2UV3A 4I0PB 1NMBH 1C8PA 3DMMB 3B8SA 1RFDH 3PWNB 5ENWB 3UTSD 1P84J 3C8KB 4PJXE 3QBTB 5DUML 3SKOB 3MLSH 3LDBC 4MDIA 4QO1A 5GRZA 3FQUB 1WVZA 1UCBH 4YO0A 1VGEH 3T3PF 4PV8B 5EWIL 2DQHL 3U7WL 1JYWA 1G84A 4YDLB 3OQ3B 2ZP0T 3OKNA 2EIBA 3KPTA 1EO8L 4NWUH 5C0GB 3KPPB 4XP4H 3VXSA 2DQTL 3IDNA 4JFDB 1PZ5B 2WLZA 2QBWA 4OZHB 4PGBB 4ALAH 4YHLL 4YHIA 3MRHA 4CW1B 1AGDA 1JPTH 2XTJE 3V2AR 2NY6D 4DN4H 4QT5B 1ZS8B 3IKKA 3LKQA 1FZOB 1NGPL 1CGTA 1FH5L 4Y16D 4XPTH 3U4EB 1NDGA 1AGBA 3QQNA 3MV7D 3RGVB 1KT2B 4LPTA 2GQHA 2NY1D 4ZPVA 3VFRB 4FQIL 4MMZC 4HCRH 3F62A 4PJHB 3SY0B 1NGYB 3WN5A 4P23A 5JW5A 3KHOA 1AP2A 4OLZL 1I8MB 1A6AB 3I9GH 4MXVF 5F70A 3ILQD 3EJJX 4K71C 3VXTB 3KLAB 2GUOB 1KLGA 5HHVH 1W8NA 1F5WA 1Q72L 3LN9A 4U31A 1D5BB 2BHZA 2PO6C 3D3VA 3DV4B 4K2UL 1KB5B 5EUOB 5HGGS 1R3IH 3QWRD 2MQCA 1TFHA 3AS0A 4U7KA 1DQQB 2B20A 3SDAC 1UEMA 5IFJB 2XZCH 4S0SD 2GTZB 1AGEB 1A9BA 2F8OA 4W4OC 5F6IB 3VXPB 1SEQH 3BEWB 3FZUC 2NQCA 3VA2C 3S35X 2ESVD 1MWAL 3B5HA 1JP5A 2C4FU 2EDEA 4K9EC 15C8L 4XC1L 2MKWA 2VDQH 3DX8B 2QR0B 4JB9H 4R4NC 5SWSA 1DFBL 3E2HC 2ZOLB 5GSRA 3T0VA 2R8SH 5DWUH 5F9WC 3WEXA 4ZDHA 4IOIB 4KQ4L 2P24B 2WBJB 1HSAB 1IZKA 2ZPKL 4IM8A 3JWNC 2VZUA 5JHDB 2VLME 3UAJC 3HZKB 3MV8E 3E8UH 4XNQA 2E5EA 4M8VA 4P2OC 4HCRA 1QEWB 5GISL 2W9DL 4AIZA 2E8ZA 1E27B 2YA0A 2UWEB 4GRLD 3REWA 2G2RB 4JQXA 3SJVE 1YEKL 3LRHA 2BNUB 4BUHA 3K46A 3JV4A 2JCCA 1DBBL 5C0AB 2GHWB 3FHQA 1FZKB 3U36A 3FFDB 3QJHA 3UYRL 3QDMB 3IFLL 4OCLC 5CD3B 2H2PD 1OSZB 3MGTB 1TMCB 5T3XH 5DJYB 4KZDL 3QUXC 1CG9A 4YPGA 3BD4A 2ITDA 3UJJH 3VE0B 3SO3B 1YEEL 4HK0A 5FB8B 1KEGL 4X9GA 5K9JH 4NFBA 2EZ0C 4TULL 4B41A 3V8OA 5F3BB 5HHXL 2WWMC 1TENA 2WK2A 2BMKA 2VO5A 3BFOA 3NFNA 5GGQL 3ZKMD 5ID0B 3MV9D 2CK2A 2G5BA 2BOCB 4PRBB 2YD9A 5DRXA 3G9VA 4IS6A 5CKGA 5BVJB 2BVPA 1CGYA 4XHJC 1S7VA 3HMXH 3RL1A 1JNNL 2IAMD 2PF6A 1X5YA 3QIWA 3V5HB 5D2LE 2BNQE 4JVUA 4K23L 3SE9H 4QNPF 2EDFA 2ATPB 5JOEA 2QKIB 3HG1E 3QPQC 3BZFA 3HR6A 2ZJSL 2P4AB 3WO4B 4UIMA 2FGWL 3KYMA 3V6BR 1MJ7L 3TCLB 4XX1E 1L6ZA 4OF8A 4U1NA 5LAXA 4LASH 4YDJB 3D85B 4ZNCD 3EOBA 4ORZC 2AEPL 1RULL 2YZ1A 4KC3B 5HHQB 1KBGH 1OAQH 3LDBB 1LD9A 4RAUA 4N9GA 4UDTA 4C57C 4PRPD 1I7UB 1HINL 1UB5B 5E9DA 4NYLA 3QNXB 1NANH 1OVZA 4PY7B 2EYSB 4NZRL 3N1PC 4RQQB 3VXSE 5K59F 1KJMB 2GJ6D 2VDOL 4BQCA 3X14B 3P73A 3U30B 4NKMB 1OTUD 3HFML 1Y6MR 1LK2A 3BEVA 4ODUA 2YD8A 4UQ2B 4JM2D 4X5WB 1JFQH 3ARDA 3HHRB 1K3IA 4OD1L 3N50A 5EBGA 4HS6B 1T1ZB 3HMXA 5AUMB 1F8TH 5AEAA 3WXVL 5E2TL 3MGOA 1RZJH 1N6UA 5T1DL 4TNVK 1CXHA 1IKFH 5ILTH 5FM4A 2V5TA 1T6WA 5DHYA 3HUJF 3H42L 3MRMA 4U1IA 3BKYL 5IB1A 2CRYA 5LQBH 1R5WA 3L3DB 5IHBA 4ZAKC 4GJTB 3QI9C 3HC3H 3MRIB 5I1EH 3TEUA 4K71B 1UWEH 2YPLB 3TO4A 1YQ2A 1M7DB 1QHOA 1IVLA 1LQSR 3DX9B 1BFOB 3D3VE 1BBDH 1S7TA 3T0BA 2PO6B 3FMGH 5IVXA 5CKAA 1DQML 2X4RA 2D4DA 4XPGH 1MFCL 1DQTA 1RZFH 2HP4A 4LKCB 1INDL 4N8CL 5J3HC 5MI0B 3SDAB 3F5WB 4XI5D 1WWBX 4LSSH 1QNZL 2VLKE 3C60C 3HE7D 2WP3O 4UQ3A 1F97A 4BH8A 2KPNA 1ZMYA 5ICZB 2CUIA 3H9YA 5FO7B 4HW6A 2Q87A 1NDMA 5DMIH 5FGRA 5SWSE 5L2JA 1KPRA 4W6WB 1IARB 4WJ5B 3KPRD 5C09A 5HHOB 3M07A 4W68A 3WJLC 2B1HH 5F9JA 4MCZB 2B1AH 5DD0H 4RMVA 1S78D 2BSSA 3LKSA 4XVJH 1MJUL 2HJLB 5A16B 4KHTL 4PJ9C 5BRZE 1DZBA 2R0LH 2FO4A 4RRPG 4JLRB 2DIJA 4P57B 4P2OB 1VCAA 5E5RB 1IGTB 4W81A 4FFVC 4HLZH 1QP1A 2JCCE 3EYSH 4ZTOL 3DVFA 4QHUA 5CJQL 3EYUL 1O5DT 4HKBA 1RK0A 5HI5D 3MOBL 3JTTA 4UAOC 2OTUB 3V5KA 2A9NL 1IEBA 4EN3A 4IOFC 5I1IL 4OI8A 4Z8FH 2BFVL 1C5DA 5C1MB 1BFVH 1LO4H 3LH2H 5CEXA 3ULVC 4CRPA 1CFSB 3U4BL 2CMRH 3VXUB 1KXVC 1A2YB 3MGAA 3QUXB 1MF2L 4QHLA 4YDVB 3ARED 3MX0A 3EAKA 1F58L 4XNMB 2D03H 4ZG1A 3T1FA 2CGRL 3SGJC 1H5BC 3L5XL 3NCEB 3RGHA 3GMPA 4GMTH 2ARWA 4NQED 5FV1L 3HI5H 4I5BB 1DLFL 4HWZA 4M48L 4PJXF 3FAXA 2CRZA 3STLB 1QACA 4O2CA 4LMQI 4M3JA 2NTSP 3QO1A 4I8DA 2UUDH 2NY3D 3B2UD 5DSCB 5C08A 4G8GD 3VWKD 3QA3B 4DCQA 3ARFD 5HSFA 4W70A 5L6YH 1CICA 2BSTA 1NLBL 3SDDA 4LVHC 4XPAH 1JGVL 3BUYB 1V7NL 2IH3B 1FNSH 4QCIB 2IQAB 4NT6A 1J0IA 4LAQL 5E8EA 3JVGA 4PLJC 1RI8A 4POYA 2E27H 3S35L 2DWEA 4D9LH 2UYLA 1JMZA 2VRAA 1LK3H 1KGCD 3HTLX 4RSVA 1MRCL 1HH9B 4JG1H 1ZEAH 4TVPE 5T3XE 1NH6A 5EN2B 1BMGA 2XXCB 2FWOB 1VFOA 5EDXA 3IJSA 4QTHB 4ELKA 3UPRB 2NY5C 1MFBH 4JO2L 2JJSA 4LLYA 1BJ1J 3WLBA 1I4FB 3U46B 4R2GD 2AW2A 4M1DH 1BQLL 3TPUA 1GC1L 5TE4L 5C0DA 3WHE1 4HIXH 3T8XA 5I1JL 5T3ZE 1M7IB 1O7SA 2ADIB 2D31A 4PRIE 1LEGB 3QNYB 5C92A 1FIGL 4JRXA 3MUY1 3RWFA 2D0HA 5IROC 3WNKA 3WHXB 3GUTA 4PLKC 3GM8A 4L3AA 4PS4L 1KCKA 3VFSA 3L1OH 3GMOB 3AMLA 4NWTL 3UYPA 1NC4D 2NZIA 4ZAKB 4EDWH 1T22A 3QI9B 2PCPA 2VZTA 5GJSL 2EXYD 1U2CA 3VFGL 4DFIA 3AMKA 2PXYA 2HFEA 1LEIA 4NQVA 1UCTA 1XF2A 3MO1B 1IC7L 5IVXE 4FP8H 4P5TD 1KCVH 4DQOH 1NUNB 1R3JB 5AYUH 1EGJL 3QEGL 5MENA 1CXFA 1QA9A 3QEQA 4N1HB 4PG9A 4KMLB 1MHPH 1Z5LA 4OZIA 4RCAA 5JW4R 2DIAA 3PGFL 1PLGL 3C60B 4M02A 4UBDC 3MLUL 4OD3L 4CBPA 4NNPH 1CD0A 3MRFA 5GZOC 5KS9A 2VDRH 4C56D 1R6VA 5DHVB 3IDIA 4M5ZL 5HGAA 1UZ6E 3OKOA 4JFPB 3CNKA 5HI3C 5C09E 1UXWB 3MMEB 4FQQB 1JI1A 3KJ4C 4GG8A 3UTZA 2X1XR 4L4VE 4P59H 3W11C 2X1WL 3SKJL 4JGJA 1C5CH 2CKNA 4MSWB 2Y07H 1D6VL 3GJEB 4KUCD 3L7EB 2BY0A 2R0KH 1ZHLA 1RUPL 4CVXB 2J8UE 1PKQE 4HAGA 2AK4A 4PJ9B 4PR5B 3HUJB 1KTDB 2QSTA 4KKLD 3D1MC 4B0MM 2AJVH 1QRNB 1O0VA 3ZT5A 2ED9A 3PABB 4WCYH 43CAB 2IALB 2C4FT 1K8DB 5HHPA 5DVOA 2D0GA 1NMAH 1JHLL 1SBSH 3OAYK 4CDHA 3T77B 2NY5L 3T4AB 2XNAA 2R9HD 4PRDA 1JF1B 1UKTA 4WI7A 3Q6GL 1LO2L 2OS7A 5FHBL 1QFWH 3P0VH 5DA4A 2AKRB 4M93C 3H0TA 5D2LF 1WQVT 4C4KO 1FP5A 3VDAA 5BJTB 3RVUC 3TZVC 5IGXH 2R2EB 3BKML 1GAFL 2X4OA 1G6RH 5ABDE 2XRAH 3BPCA 3T0EA 1T7VA 2X89D 4DZ8B 1Y18A 5E6IC 3T2NH 1YMHB 2X4NB 4HT1L 1WT5C 1TJGH 2ENSA 4A6YH 3C08H 1T1XA 1ZANL 2NY7H 1H5BB 4HIJA 5F6HI 2QV2A 4KTEH 3WDIA 1Y6KR 3C6LC 4M3KB 3BSZH 1BGXL 4FZ8H 2AJZA 1HYSC 2DQUH 2VXTH 4LCCC 5C08E 4M7JH 4NNXB 2AV7A 5E4IA 2AI0H 5F1SA 3OGCB 4CVUA 5DJ8A 1KNOA 3JUYA 5JDSB 2CK0L 1YNKL 4NJ9H 1ADQL 2XN9A 4PUBH 5DRZA 3GMRA 4NGHH 3T09A 4DKDC 2WQRA 3RBGA 3VGEA 1FFNA 2Z31B 3UJIH 3GI8L 1K6QL 1MAML 2VDPH 4D0BA 1KEMH 5CIPB 4E41B 3LEXB 5AD0B 2V7HA 2H1PL 1IAOB 5DRNB 5DK2B 2LQRA 2O61B 1CLYL 1QPPA 4LLMA 4NQTA 4QRPA 4X0KA 3BZ4A 3BJ91 5FYKH 5JOFA 3FFCD 2EEAA 1G6RA 3PWVA 3WIFA 4ONHB 3MJGX 5ESQB 2A6KA 3LSOB 3RZCD 5IMLB 2FLBT 4NFCA 4A6YA 3ARGD 4LSQH 3G5YA 2E7HA 4LK4A 4PJXB 4RGMB 1TTUA 1MFAL 1U95B 1H15B 4JRXE 3TYGH 3T4YA 2XKNB 3T2QA 3O3BA 2Q3ZA 5KZCD 4UB0H 1GZPB 4X7FC 5CUSH 1DEEA 4R90L 1CE1L 4WI3A 2FHFA 2Z8VC 1W0VB 2MWCA 1DSFH 4HD9A 2QEJA 1NCWH 4P2RD 2LVEA 3H9SE 3X13A 4Z7WE 3NACH 5J57B 2WIMA 2NYYC 3SBWA 1ZGLP 1KOAA 3CZJA 1J1XH 1NANI 5GS1A 2XTJB 5I16A 3S3JA 4RA0C 2HKFL 3IFNL 1DBKL 1Y6NR 5CSZB 2E9WA 4C4KT 4OZIE 4QOKA 5D2NA 3PDDA 2PYEA 5KTEH 4C83A 4O51A 3U0TA 1I7ZA 4P23C 1MNUL 2AJXH 4HZLA 3QH3B 4JO3L 2R29L 1T3FA 5KS9E 2BNRD 3FOLB 5C0FB 1NFDA 1SHMA 1X9QA 3K2UL 3NAAL 4RMRA 3MRPB 3MYJB 4FFWC 1QLFB 1YUHB 4X4MA 2JCCF 2Y36H 3RIFK 1U3HA 5C7XH 5LGHL 3KXFB 1GGBL 3FN0L 3KJ4B 5E08L 1XGYH 2QADD 3D18A 3MBEC 1JL8A 4ZPTA 4YFLF 3VXQB 4TTGA 2KKQA 4KI5D 3ZT7A 4NOFA 2W0LA 2V2XB 3CMOL 3EFFB 3VD4A 2AK4E 5JUEH 1INQB 2IF7A 2KUTA 3IFOA 3QEHB 4UILH 1S7XA 4M7LL 3OPZH 3V9FA 3LB6D 1XR9A 5HYQA 3T0DA 4AK1A 4LDEB 3GNMH 4M6OH 3TIEB 3OL2A 4Y4FA 3HNTL 4JHBA 4O02L 1LE9B 1FNFA 3QG7H 1IGJB 3MA9L 3DX6A 4OV5A 3RBSA 4MJ6B 1N64L 3SDCA 3LN5A 2VZSA 4M93B 5GZND 4HKXA 2GSIB 3D0LB 3L3KA 4MMXC 1U3ZA 2Y6SC 5CBEA 5GS2D 3OXSA 1MPAH 1EZVY 3MV8B 3TZVB 1NFIA 5DD1H 1FNAA 3DNKA 4NM8L 1SM3H 1U8JA 3T04D 4HWEH 4MWFB 2X4TB 2BP3A 2Y06L 4OCRH 5E6IB 2P42B 3DSFL 3SJVB 4EOWH 1J5OL 1MCRA 4WWKA 4HK3J 1P4BL 3GMLB 4G9FE 3RAJL 5ICYB 2C3WA 1UH3A 3BT2H 3FO0L 4KKAC 5ISZA 4LNVA 5JXED 4GBXD 3DUUB 3ZE1E 1P6AB 3C6LB 3KPQA 4F3FB 1P4LA 1Q9LA 3MRLA 3P3YA 5IM7A 2EXWD 4AQOA 4LCCB 4H8WH 3BPNC 2UY7A 3GIVA 5F9DC 1RMFL 3NGBB 4BSVA 3DX7A 3IF1A 2VSDA 4NHCH 2Q8AH 4N5EC 1EHLL 4PJBA 2P5WA 4NDMB 3RWCB 1A0QH 2DOCA 1LP9A 2O5XL 3P0YH 3QXAA 2D0FA 4X80L 1NAKL 2Q76A 2NY2B 4XC3L 3VFMB 4JEGB 3HZVA 4YNYA 4M62H 3IDJB 4ISVA 4PTTB 1E4KC 4LFHG 3O6FC 4OLVH 3VRIA 3QIWC 3GZKA 2Q3AA 2J5LC 5D2LB 2BNQB 3CVHH 2Z93B 5F9OL 5E24E 4RX4D 1S9YA 4QRPE 3ULUC 3HG1B 2Q6WB 3GEWB 1VGEL 2EE6A 3SCMD 3QULB 1AGFB 3KPLA 1Z9LA 1MHHA 3DTXA 4RNRA 4WO4C 2FJHB 3CH1A 4TRPH 4XP6H 5EBLA 2DKMA 4ZMAT 1RIUH 3OKLA 4ZSOA 3K8LA 5IWLA 4L8DA 1SEBA 2EDHA 3DPBA 4BQBA 3NZ8A 1OB1A 3PV6B 1MI5A 5IVXF 4YO0B 1PG7H 4GQ9H 2VIRA 4OCSH 4YK4C 3GSWB 4RDQG 3V0VA 4ALAL 4X6FA 3OKNB 5C71A 4KI1A 3ETBF 5HGHB 3VXSB 3RI5K 3RVVD 3IDNB 1H8OA 4KAQH 3TN0D 4XPTL 4QRRD 4WTZG 4IRJA 3TA3D 2X5PA 1CDHA 4AM0A 4P3DA 1UZ6F 3BISA 3MRHB 1A6TB 1S9KC 2FJGA 4KVCH 3RKPA 1WBYA 3VXNA 2QHLA 5ICXA 2DQGH 1FZJA 4L9LA 1DVFD 1YC8A 5HHVL 1NMCC 2LABA 2XTLA 4JFFA 4QOKE 5D2NE 2RBLA 3SKUD 3EDKA 3CVHA 5H35A 1DL7H 1NQBA 2J8UF 2OI9C 5CEZH 4PD4J 4MVBD 4JFHE 1R3IL 3CK0L 4P23B 5JW5B 3L6FA 4ZUUA 3RVTD 3S96A 2A6DA 1NFDE 1OQOA 2Z9TA 1NCDH 5E99H 5DR5H 1SEQL 4OLXL 4HUWB 5CP7A 3CSYA 2R4RH 4PRHD 5C0CB 3S4SA 1JV5A 4NRZB 2V17L 4LSTL 1MCKA 4PGEB 2VDQL 4P2QA 1QHPA 2RFXA 3Q1SH 3AROA 3QFJE 3P11H 3MBEB 3HPLB 4HFWA 1FZMB 4XRCA 2V7NA 2R8SL 1PDKA 4IDJH 4MXQD 2VLKB 2B0SL 3WLWD 4NZUH 3DRTB 4XWGH 4I0PD 3TWCH 3O6KH 3BAEH 1CVSC 1QVOB 3DMMD 1HSBA 5DMKA 1D6EB 1CLCA 5J9PA 3L9RA 5A1AA 5SWSB 1VFBA 3WMSA 3I75A 5J7CC 4YBQD 3E8UL 4BFGA 1E0OB 5FYKU 4ZDHB 2DS4A 4WEMB 1MUJA 1Q94A 1T89A 4K55A 2CO7B 2R23A 4I3SH 3IAGC 1DN0A 1G1CA 1DUYA 1BD2E 5A3ID 3H9HA 5F1NB 3V4PH 1XT5A 4K8RD 5BRZB 3GMQB 4JFDD 5FV2A 2J4WH 1PEZA 1F4AA 4JO1H 3EYVB 1D5MA 4TVPL 2YBRA 1F4WH 5T3XL 1BVLA 3F58H 4KK5D 5DJ2B 1FL3B 1AQDB 5C0RH 4XPFL 5E03A 3V4VL 3L3JB 3JV4B 3LS4H 3UJJL 2JCCB 2FH8A 1QFUH 1VSCA 2GKIA 2FHCA 4O2FA 5ISZE 4MAYA 3U36B 1RJCA 1N0XL 4EN3C 2VLRE 5T3ZL 4U6VH 1CG9B 4S0TD 4YPGB 1KIRB 3BPNB 3D39D 1ES0A 3RTQC 3RPIA 3W5MA 3JWDH 3BWAA 2ZOKA 3HMXL 2X4UA 1FVEB 4HK0B 5L9DL 4OF5A 1LP9E 2YA2A 3V5DA 1QFWI 2CH8A 3U6RA 1NBYB 5HYSA 3EDEA 1LE5A 2JELH 2G5BB 2OL3L 3FQTA 3SDYH 3QNZA 4FQPA 4FTVD 2J8OA 3HMWH 3O6FB 2AXFA 3QIWB 4PV9B 2GCYA 4JHAH 2J5LB 2OMBA 4LASL 1UB6B 1CICC 1UM4H 2EYTA 1RJLB 4OLYH 4X9BA 1KBGL 1OAQL 3SO5A 4LCWA 3BZFB 3LEYH 4K3EL 5CGYC 2DLTA 4NZJA 2IANE 5I30H 3DARA 2VITA 2F53A 4LHUA 3VD7A 4WO4B 1VADB 5CHNA 1B0WA 3JVGC 2YN3A 5GGVY 4MXWH 4XX1G 2WBJD 4ZSOE 5FOBA 4Z7WF 3HZMA 3FO1B 2FYYA 4N0CD 1M05B 1I7TB 4PYHA 3AUVA 3OR7A 1KCLA 3SOBL 1MI5E 1LD9B 5E2VH 2DL9A 1RURH 4UDTB 4LF3A 4YK4B 2BDNH 5BXFA 2HFGL 4OZIF 3RIAK 1FJ1A 2FZ3A 2DM7A 1JFQL 3BVNA 4J3SA 1WISA 2E9IA 2HMID 3ZKND 5F3HB 1KYOJ 5KS9F 3TJEL 5C0AD 5FF6A 3QIBC 1P6FA 1RZJL 1T2XA 3GSOA 4OIIH 3FOMB 3QDMD 3CD4A 3TV3H 4P49A 2F8XC 5LQBL 4Z78B 1QR1A 4OFKA 4PRIB 1HI6A 2G75B 2AEWA 5IB3A 4MJIA 1NGQH 1IC5H 3HC3L 1LGVA 1VENA 4EIGB 1UWEL 2R1WA 4JFFE 3F6IA 1AXIB 1NMCB 2A2QT 5EBMA 1DBMH 5F1IA 5IF0B 4HJ0D 4L8BA 4PRAA 3KYOA 4H0GA 5DHYB 2OI9B 5IB1B 1P7HL 4XPGL 4NQXB 5BW7C 3QUYD 1RZFL 1NC2D 1XZ0B 2OL3B 2VLLA 3PWPD 4LSSL 5E2WH 4XBEH 4JFOA 2X40A 2NR6D 3QO0B 1UADC 4BZ2H 4WVRA 3I84A 1AXSA 1S7TB 1SMAA 4P2QE 4R9HA 3K8MA 5DMIL 4YPJA 3GB7B 2P7TB 5IBUG 5F7MC 2IG2H 2IFFH 1TVBA 3OAUL 2VQTA 2B1HL 3OG4B 5KAQF 2GSGA 4UQ3B 1UWGL 1AHWC 2EH7L 1IAKA 3ARVA 2DJSA 4APQC 3BIKA 3BIBX 5CJOH 1OTSC 4AEIL 2Z4QB 2ZUTA 4PJ7E 3GSXA 3H3KA 1NDMB 2GI7A 1F2XK 4WW2A 3GO1H 3OMZA 4MHHG 1P4IH 4JRYB 1KPRB 1TJHH 3C9NB 4NKDA 1IT9L 2EE9A 2R56H 1INEH 5IEHB 2E7CA 4L4VB 5EU6E 4D94A 2MHAA 3ZE1F 1CFVL 3LKSB 2YWYA 4LARH 3QCUH 4RZCA 4Y4KA 2WBWB 3EYSL 2J8UB 1FNEA 2JIXA 1PKQB 1F4YH 1XCQA 1FORL 2ITCB 3RHWK 2FO4B 4OZFB 1CWVA 3CJJA 1BFSA 3HNVL 4Z8FL 3T2PA 1QSVA 1LO4L 5GRUL 1ZLWH 4AENA 2X1QA 2AEQL 4XVUC 1MFDL 2VAAA 3ILPA 3UDWC 5JZ7C 3EUUA 4G8EA 1I9IH 1YA5A 4G9DA 3T0XA 3I02B 4HKBB 1T6VN 2O5YH 5I15H 2Q20A 1RK0B 3TBVB 3V4UH 5IQ7H 5GRJL 3VJ6A 2NXZC 4EN3B 3CAFA 2MPAL 3MNWA 1K4DB 4O58H 1RIVH 2YR3A 4S1DD 2ZSWA 2BVYA 4MYWB 4XPHL 3VDBA 4QHLB 3N85H 3RTQB 3VFTB 1XGTA 1EEZA 1CU4L 3JXAA 3CFKA 2YPLD 5T1KA 3MLWL 4DVRL 5FUZH 1WEJH 2PO6D 2QSVA 3GSVA 3T2OA 1TQBC 2ZUYA 1OM3H 3EZJB 4XPAL 3C5ZD 2FD6H 3SDAD 1KCSL 3ROOB 2Z35B 3U48A 3N0PB 4L8CA 3FZUD 2IBZY 2DQDL 5E5MA 4ERSL 4EUPH 4FQ2H 5D5MA 5IHUH 1CGUA 3MYZA 5BZWA 1CICB 1T83C 4LCWE 5FM5M 4R4ND 5HHOD 1ZT4A 4JG1L 1ZEAL 2QQKH 3KLSA 3P4MA 4LLUB 3VXME 1G9MH 2P8LB 4X83A 5CWSB 4WHCA 3N1QC 4WFFD 1OY3B 4MA8L 3OR6B 2DWEB 2UYLB 3KJ6H 3H7BB 3O3AB 4LHJB 1W72H 1MFBL 2XWBB 3VD9A 1ZVYA 1S3KL 3LMJH 4M1DL 3RKDC 4IIQC 5I8EA 4WHDA 3UAJD 2HJFB 5T33L 1FFPB 4JQIH 4RGNC 4P2OD 4QXUH 5I71C 3MODH 3IJSB 3HI1A 5DYOA 2APWA 3WV0A 3GJFK 2VXVH 4HUXA 3WLBB 4NJAL 1NFDF 3KYNA 3QHZH 4P3CH 2FX7H 5FKAA 2Z0BA 3TPUB 2XT1B 3WHE0 4AEEA 3T8XB 3CLFH 1FCGA 4Z7UA 4IRSC 3W0WA 3D2UA 2L0DA 4JRXB 1WFNA 3QUXD 2I24N 4MQXC 4U33A 2HT4C 5DUBA 1KJ2L 3HNSL 4TPRL 3JTSA 1LO3H 2DF3A 4F57L 4EUPA 2H9GB 2D7TH 1OW0C 4FP8L 5DLML 4WIQA 2EZ0D 3SGEH 5JIIA 3K8KA 4MD5B 2WWMD 1X7QB 2FCBA 2BVUA 3H9SB 2PCPB 4Z7WB 5JPMB 3DECA 2JK5A 4HKZA 2AAVA 5GS1C 1H3GA 4XHJD 2VL5B 2QSCH 2IQ9H 2I60H 4NQVB 2VR5A 1NPUA 5IB5A 2VDRL 3U2SA 1W72A 2A6IA 2H45A 1MLCA 1A1NA 1M71A 1OP9A 4TTDC 4OZIB 3P9LA 5ITBH 4U1LB 3QPQD 1NKRA 4N90D 4LGRB 1C7SA 4PFEA 1AHWB 3LN4B 3VRLE 1N7MH 1CDUA 5GHWH 4APQB 3QRFM 2GJZA 1HILB 2CIIB 2DLIA 3IDIB 3X12B 4HGWA 1KULA 1HHGB 3OKOB 4F7EA 1HHHB 5DO2C 4NO2B 2AJVL 2YRPA 3UTZB 1ND0A 5F96H 3D69A 3FB6B 2JKXA 4ZO6A 5IIEA 4XWOC 1NJ9A 1OARL 1ZHLB 4JPWH 2HH0H 2SEBA 1BQHA 2OR9H 1ZA3A 4S2SB 1KUMA 2H6PA 2I9LB 2BHUA 3SE8H 4OZFG 1JCKA 2VQ1A 1HHJB 2X4QA 4XNYH 1RUML 1LP9F 4HPYL 1JNHA 1UKSA 5HPMB 3O3DA 4RMWA 5IGXL 1CGSL 4WHYG 1KJ2B 5JDJA 4MB4A 4X5XB 2EDQA 3BGFC 4PRDB 2FEEI 4LVOC 4WI9A 5CLWA 1W0YT 5TPWH 2NXZB 3C08L 2NY7L 5FXCH 2CJUH 2VXSH 3H0TB 4XP1H 5GGSB 3MUZ1 1MY7A 4KTEL 4JFZH 5BOZG 3BSZL 4ZAKD 1ED3A 1ZT1A 3MCKA 4FZ8L 4OFYA 5CEYB 4ODVH 4NKQB 4YWGH 5SV4A 4NC1E 5K9KA 5LXGL 2DQUL 2VXTL 3E3QE 1CXEA 3L95A 3GJFH 4PGCA 3OKEB 2AI0L 4KJQD 2JTDA 2PKDA 1CR9H 3P40A 4G9FB 2CLVB 5I8OH 1TQBB 3PGCB 4NJ9L 3SN6N 2R1YA 2AJZB 4PUBL 3FB5A 5MEOA 4FXKA 2J7LA 5DC9B 1UWXK 3CSPA 3RQ3A 3VA6A 3WL9B 4PJDE 3V79C 5BZDA 2DWDB 1DUZA 4J12A 5D7IE 4OM1L 1F3DJ 3PQYA 5FHAL 5L8JB 2V9QA 2VDPL 1NGXA 3TBSA 2WINA 4N0YH 5F8RC 1SJXA 2IPUG 5D9SA 1BP3B 4Y2DD 2AGJL 1WBZA 4GXVL 4WHTA 1B3JA 5DRZB 1A7NH 2H8PA 3GMRB 4I1NB 4LRIA 4PB9H 1RIHH 4HLZG 1RD6A 4ACPA 5M94B 1FYTA 1HH6A 5GGRY 3NCFB 1IEAA 2OP4H 2VDKL 4GLRH 4EXPX 4D0BB 2ERJC 4HIHA 5EZJB 3DV6B 5KVFH 3F6LA 3PL6A 5AWNL 4PJ9D 2V7HB 1IGYB 4IIQB 1YEGH 2A38A 5DJ0A 1AXTL 1RVFH 2F5BL 5DD6A 4JJ5B 4X0KB 3I3EA 4RGNB 4X7SH 4F9PA 4OGZA 1AD9B 3TYGL 4PJ5E 4AMKH 5I71B 4N8VA 3QDAA 5KVEL 1G9NH 1G7JA 1HWHB 3G5ZA 5IJVA 2ZUUA 4FFYH 5ETUA 1TJIL 5IWLC 1G7HA 3KLDA 1MQ8A 3IKCB 3UTTB 4G80A 4Z7UE 2W1NA 4HC1H 4L4TA 2ADGB 4IOFD 3TESA 4DK6A 2GITB 2EYRA 3W0WE 1I8LC 4NO5B 4K7PX 4FABH 4WI4A 1T20A 1X4XA 2BC4A 3FQNA 3DJ9A 2EDYA 5MERA 3WKML 3ARUA 4OCYH 3VU2A 1DEEB 5D1ZA 2A9ML 2EDOA 1A8JH 3CLEL 4BQ6A 4FXGA 2OJZH 4PJ7F 2OBGA 5AAMA 5EZLA 2ED7A 4Y16C 3EO0A 1S7UA 1U8NB 1RZ8B 4DAGH 2ZG2A 3CXHJ 3RWHA 1NEUA 2ICES 4JCMA 5GS1B 2QLVB 3WFEL 2W38A 5EOTB 1A6VH 4J4PD 1N26A 1OLLA 5GIRB 5BV7C 3RA7L 4WV1A 4QOKB 2YUWA 2F5AL 1MRDH 5EZIL 5TJWK 4G6MH 1I7ZB 4MQSB 4J3OC 2AXGB 4KRNA 3WS3B 5I66B 4WUKH 4GKNB 1BEYL 2IFGA 32C2B 2Z31D 1F3JB 3QUMH 1NFDB 4PLJD 5IKCB 1HCFX 4W6XB 1HIMH 2VABA 3BHBB 4LFHD 5DVMA 4UILL 5DGRA 5JO5A 4E41D 4G5ZH 5IQ9B 3QZWB 1E28B 3TO2A 4HC1A 1U6AH 1OLZA 4N5UA 4ZPTB 3QFJB 4XCEA 2BY2A 2VH5L 1F90H 1FSKC 1TCMA 3GNML 4M6OL 2KDGA 1B90A 4M7KH 4U1MA 3ZE0E 4J1UB 4EZMA 4X9HA 4ZUWA 3ARXA 2PTVA 4QEGA 1MCNA 5FIEA 1XR9B 1U8PA 5I17A 3EOTH 4Q9BA 3NTCH 4Q6IA 1U91A 3OX8A 1UVQA 4UIKH 5TE6H 1MPAL 1L9MA 1MCFA 2QL1A 5DJXB 1OQXA 4Z6AT 3OXRA 4UOW1 5IB4A 3S5LA 1T89C 1U58A 1QLEL 1QSEA 1JNJA 1VDGA 4LVOB 1E6OH 1EV2E 4S1SH 1A7RH 1BD2B 5EC2A 4X5LA 1UH2A 3WFHA 3WIHH 3EFDH 4NP4H 3BT2L 1Q0XH 4YEFA 4G3YH 3MRCA 1NFIB 3MNZB 1A7OH 2KL6A 3ALWA 1A7PH 5D1XD 2D3VA 4X4XA 4GRMA 4YUEH 2XTJD 3QUMA 4P9MH 4YBHA 5B8CC 4NHCL 4NOBA 5ISZB 5KJRH 2GT9A 5I1HL 1MCSA 5IESL 3MRLB 5EU4B 5KOMC 2VLRB 2F9BT 4XXDA 3S97C 3GIVB 3ULSA 4CDGC 2MKLC 5GZOD 2VNCA 1RZIB 3RZWA 3ZKMC 1BIIA 1TZIA 4OLVL 4ZS6D 3UMTA 1ZAGA 5BV7L 2HRPL 2EICA 5I2IA 4LPWA 5HI3D 1LP9B 4KH2A 2IAMC 3CVHL 5TFSL 3RI5F 1MRFH 2YD7A 2Z8SA 4YNYB 1RPQA 1IAIH 3SGKC 3K4DA 3PWLA 3C2AH 3VRIB 4TRPL 1U3JA 2ERJB 3MFFA 2GK0A 4UU9A 4MA3A 3FKUS 1IFHH 1S9YB 3G6AA 5DJAA 4OLUH 1M1SA 4OF3A 4YDKH 4WNQA 5LVEA 5HDQH 3DXAA 3WIHA 1YEIL 2A1WL 4XNZC 1PG7L 4GQ9L 1WZ1L 1PJ9A 1HKLH 3OAZK 4R26H 1VGKA 2IANB 3IDMA 4FA8A 5IFAH 3INUH 3UTPE 3OKLB 4ZSOB 5GRVL 4L8DB 4U1GC 1NCUA 2NX5E 1YZZA 4KAQL 4YFEA 1G7IA 1Z9MA 3NZ8B 1DN2A 3ARYA 4EI6A 3F8UB 3C2SA 1MI5B 2VLMD 5MEQB 1SYSB 5DEZA 5K33A 2YWZA 3MV8D 3RVUD 1S7QB 3VFVB 1IGFH 4NNYA 1HHIB 1BF2A 4ZTPH 3KNBB 5E6ID 3SJVD 2DQGL 3UC0L 2XIDA 1CFQA 1HZHL 3VRLF 5F1OB 1QUNA 5FGSA 3MJ6A 5F7KC 4WW2F 4U1HA 5IW1B 4XCNA 4Y16B 4AM0B 1DL7L 3C6LD 4Q74A 4GAJL 4ZO8A 2VLJA 1HYSD 4ENEC 1QLRB 1FN4B 3FQWA 2K7PA 4OIAA 3VXNB 4XB7A 3WNPA 4F7CB 3HB3D 43C9B 2AEIT 5E99L 1FZJB 4XZUA 2MOVA 2ATKB 1DCLA 4Y5XA 3RWDA 4X99A 5BV7B 4MNHA 4JFFB 5F6HJ 1SJEA 3CSGA 1AR1C 3CVHB 5H35B 3LIZH 5L7XL 3UX9B 1JGLH 3OF6A 3BH8A 5CLTA 1VB9A 3O3EA 2NY2D 3P11L 3SKNA 4H1LH 3AS2A 4ZUUB 4HUUB 2PETA 5I1DA 2PTTA 5I1AB 1MHEA 4IDJL 1RJYA 1CBVH 4QY8A 4HG4K 4NZUL 5BS0A 1JV5B 4XB8A 3IXTA 4XWGL 3TWCL 5IOPA 2D7PA 3E6FA 3HE7C 3BAEL 3QZWG 5JHLH 2B4CC 1S8DB 3MROA 1ITCA 2BNQD 5FO8A 4P9HC 3SDXA 3SGEI 3GMMA 3MA7A 4BFIB 5CJBA 1FSKB 4JY5H 3HG1D 4Y5VC 4TQEH 1KC5H 2WIIA 1FVDA 4YIQA 1G7QA 3VXRA 5DRWB 1X44A 3O2WH 5KVDL 1HSBB 3THMH 5DMKB 1EJOH 2IMMA 4I48A 4PJ7B 2QQNH 5JMRA 1S78C 1H8SA 3L9RB 5KSUB 3V4PL 5M95B 2N7AA 4F8TA 1CQKA 2A74A 3P4OA 1IJ9A 2J4WL 3LS5H 1FFQA 2FHBA 1WFTA 4JO1L 5KSAC 3NH7H 4JKMA 4NPYA 2R23B 2F58H 1BOGA 1CXLA 5EU6B 3I50H 4A2LA 3F58L 3BDXA 3OWEA 4MB3A 1DUYB 1IQWL 3VXSD 4LCUA 1U8LB 3NFSH 4PJDF 4EKXA 1AO7A 3QUZC 5D7IF 3MRNA 4JN2A 4NM4H 4PJAA 1U92B 1D5MB 5HI5C 1DQDH 1V3LA 5BCAA 1TETH 5JR1H 5KN5A 4H1LA 1MAJA 2YA1A 2NYYD 4X7EC 4NUJB 4PJEA 4U6VL 5IMMB 3IFPA 5DS8B 1OCWH 1L6XA 2OSLA 1JTTA 4Z7VB 4O2FB 5B8CB 2DMCA 4MAYB 1K3ZA 5FA3B 4OKVB 4RBPK 3PWJB 4HWUA 1I1AA 2XWJA 4F7PA 4DN3L 5J11C 2R69L 4P23D 3B6SB 4MCYA 3RWGB 4OUUA 3RPIB 4HJJH 3LKOA 2J8HA 3BWAB 3QDHA 5HVFB 1J88A 4NC1C 4JKKA 3R0MA 2X4UB 3SE3A 3HMWL 3E3QC 4BKLA 4F7TA 2APVA 4JFQA 3PIQA 3V5DB 5J13C 3UZQA 4JHAL 2IAMB 3D3VD 4CJ0A 3B2UC 4U3HA 3IRZA 1OSPH 2O5ZH 4LOUC 5DT1H 5FOJA 1ULVA 5HYSB 3NCJH 1UM4L 2IBBA 1LE5B 2XA3A 4OLYL 4POUB 5ADOL 2DBLH 3UTSA 3LEYL 4Z7UF 2VLKD 3LQAH 1DTUA 1RJZA 4LLWA 1NAMH 3BMVA 2FSEB 2BOBA 3NN8A 2B4CL 3LOWA 4OBRA 5B3JE 1BX2A 1T2QH 4LBEA 4DKEL 1ZGLM 3WFBL 2XFXA 2UY6A 4G7YH 5EPMA 4OT1H 4ZUSA 5SWSD 5E2VL 1UJ3C 3MV11 3F7PC 4LLQA 4LHUB 4DVBB 2BDNL 4Q97A 3VXMB 5FFLA 4NQDA 3T0WA 4U3XA 4LL9A 5FOBB 1FE8H 4PRPB 3HZMB 5D8JH 3ZTNH 4I2XA 2FYYB 3QHFH 3BP5A 3BP4A 5EORH 1ETZA 4X6EA 5D4QA 3QWOA 1T0MB 4U1GB 3OR7B 4QHMA 3ZTJG 5BRZD 2V5RA 2NY0C 2JB6A 1C08B 2MJWA 4LF3B 3BP7B 4HS3B 3MV7A 1KB9K 1BIHA 5DC4B 3BRGC 1NGQL 1IC5L 5IBLC 3HE6C 2ZNXA 5DVNA 5B21A 2OJEB 3TJHD 5TDOA 4KKAD 4UDUA 4KY1L 2IH1A 4DFHA 4GAGH 3S37H 4BH7B 4NQUA 1U8IA 2DLEA 4QRTA 1DQLL 3U4AA 3OB0K 4GW5B 1IL1A 3KPMB 2IPTL 4KDTC 1MWAH 3P9WB 5E2WL 1YY8A 4XBEL 4BZ2L 2Q1EA 5EBMB 4RMTA 1NAMA 5F1IB 3WSQH 3ZE0F 4L8BB 5FYLH 2ARJA 1QTYT 3Q48A 2JJVA 4YHKH 5DC0A 3QIUA 5CINH 2IFFL 3KPSA 2VLLB 4ONFH 5BO1L 1U93A 5L0QC 1II4E 5CMAA 3BW9A 4OTXH 1OHQA 3MLTB 3O6FD 4OB5H 5ESVA 3QIWD 1I1CA 3HE7B 1JGEB 1K8IA 2VAJA 3G5VB 4PB0H 3PG2A 1P4IL 1TJHL 5IW6A 1YEDA 1I7RB 4LDLB 1LHZA 1HEZB 2R56L 4Y5VB 1PW3A 5E4EC 5H37H 2FL5A 4Q0XH 3VXRE 4BSWB 7CGTA 1TVHB 1N59A 1Q1JH 3PHOB 3SQOL 4AH2B 1MREL 3R4DA 3QCUL 2AQ2A 1E4XH 1YQVH 4WW2B 2P48B 1KIPB 5ACMA 3DETD 4XBGA 4CU8A 4GRLA 1X5XA 1F4YL 3KYKH 3ES6B 3S88H 3CPLA 1D5XA 1QBLH 3AFLA 4O9HL 1TPXB 2VC2H 4TVPD 4RAVA 5KSAB 1QZ1A 2C3VA 1E4JA 5T3XD 2MHAB 3VFUB 1MWAA 4RZCB 5GSVA 4TUKL 3JV5A 1IKNC 4PJCA 4KGJA 3TBWA 2JIXB 1XCQB 2O5YL 1PYWA 4IRZH 4PJIA 3HAEH 4PJAE 3QUZB 4KWUA 3P9MB 4J8RA 5LGJB 1BVZA 1IGIH 1MJ8L 4ZFOL 4KRMB 5T3ZD 5GXBB 3HRZA 3ILPB 3N85L 4NZDA 1GIGH 3HC4H 5EIQA 3O6LL 3G08A 2F74B 1ORSA 1C16A 2PW2A 3PDOA 5FUZL 1WEJL 5I19L 5J11B 1T21B 1MFEL 2BY3A 1OM3L 2DYPB 4WI6A 3WFZA 2CUHA 3FB8A 3L3HB 3IVKA 3ZO0A 4JQVC 5TQ0H 4JRWA 1EEZB 5BVPL 4K94H 3CFKB 1WCBA 3MOAL 1T66C 2PYFB 5J1AA 3MXVH 4U6YA 5EULV 3HZYA 8FABB 5IHUL 5J13B 1MEXH 4PLNC 5HYSG 1YN6A 3GSVB 4UTBH 5IHZA 3Q6FB 1EEYA 1IM3B 4OCWH 1G9ML 2XZQH 4QGTA 5C6TH 4PJDB 5E5MB 1PBYA 1MCIA 1DJSA 5D7IB 1KN4H 1W72L 3F7VA 4J6RH 4CMHC 2ID5A 4JZJA 2VMFA 3HAEA 1OF2B 4B7LA 1FV1A 5C09D 2WUBH 4NQDE 4JQIL 4L4VD 4I4WA 4FQCH 2I07B 3MRDA 4I2XE 1JYXA 1ZVHA 3DURA 2K3TA 2CKBH 2WV3A 4M6NH 2VXVL 1IGCL 3PXJA 3PV7A 3VWJA 4FRWA 4JM2A 4MD0A 4HIIA 4NQSA 4X9IA 4HUVB 2BHYA 2XA8H 4P3CL 5CD5C 4ELMA 4XNXH 1MVUA 2NY0B 2HJKB 1N5AB 3O2VL 4ZFOB 3W2DH 3BQUA 1GGIH 1S9VB 1DDHA 2WW8A 5I6XC 1NCCH 3EOAB 4YLQT 3L3OA 1IAII 3B9KC 2COQA 4PJ5B 5DYOB 4LPVA 4Z76A 1HN1A 2DQJH 3HE6B 4JDZA 4Y4HC 5C8JB 4U0RC 2BVTA 4X9FA 4XMKH 1ZGLA 2CXKA 5TH2A 4D3CL 3JWOH 4QXTA 1S7WB 3IXAB 4EN3D 1YYLH 4R0LC 1OAKH 3CDCA 4H0HB 4LSUH 4BSJA 3W0WB 1DQJA 5IJKA 4ODHL 5DUBB 3RTQD 2EEDA 1A22B 4GRWH 4X6BB 2YKLL 1K4CA 2F54E 1PY4A 5HHME 2I60L 1A4JB 4XAWH 1RHHA 1S7SA 1C7TA 4H20L 4ZUVA 1QBBA 5IP4A 2CIKA 1D5IH 2YMXH 1FAKT 1P7QB 3KPSE 1ZHNA 3FN9A 4EI5C 2VOTA 5ITBL 4U1JA 5L0QB 2JK5B 3MLRH 4HKZB 4NRXA 3GMNB 5DJDB 3X17A 3KPRA 4I3RH 5J0BA 5C08D 2ZCHH 4Q9RH 2CKBA 2LVCA 1W72B 5EUKB 2A6IB 5D7LE 1MLCB 2HN7B 1TQCC 1JWUA 4C56B 1CICD 3TLRA 1GJIA 1BF8A 3SDDD 1HOCA 1A6ZB 1I85A 3ARBA 2OR7A 5GS0C 5F96L 4RIRA 5E4EB 5JIHA 5B39B 1I1YA 1VFMA 2YPKA 4R3SA 3TT3H 2BVQA 3OJ2C 4JPWL 1K9TA 2HH0L 1EA9C 4KI5C 3QEUB 5CILL 4ZOCA 4KU1A 5AZEL 4F7EB 3V0WH 2XV6B 5J12C 3IDGB 4JKLA 3D0VA 4HBCH 4NKOA 4KFZC 1ND0B 2E6JA 1YPZA 3LB6C 5IIEB 5HGBA 2RCSH 1OGTA 4DJMA 4YHYB 5LWYL 3QWQB 2SEBB 4KRPC 5INCB 5FYJE 2LE9A 3GSUA 4PJIE 2H6PB 4HIEB 2KH2B 2I9TA 4LPXA 1A1MA 5FYLE 4KV5E 3AREA 5TPWL 2EDKA 4I77L 1XGQA 1F45A 2CJUL 2VXSL 4XP1L 5D71H 1JNHB 3O3DB 5GZNC 5DHXB 4JRXD 3RJQB 2DJ4A 2AK1H 4ODVL 4GUPA 3KVQA 4YWGL 5B38A 1A64A 4LQFL 4L3EA 4HAFA 1S9XA 4KJYB 3G6JE 1T1WA 5KW9H 4HF5H 5I1LA 1KIQA 4G8GA 3OGOE 3VWKA 4Z7OE 3W9EA 2FR4A 5B3JF 3MCKB 3H9SD 1T7WA 4GBXC 3MJ7B 4PBWD 4GW1A 1P9MC 5FYJU 3L95B 3MUGA 4PGCB 4HJGA 2EXWC 5FUCE 1RZKC 1QBAA 1XIWC 1VFAA 5FGBA 1NBVH 5MEND 2PR4H 3UJTL 1N6VA 2FX9H 4QRSA 4F15B 2DTSA 4FS0A 5FO9A 2R1YB 1NGZB 4BM7A 4FXKB 2YD5A 1RIHL 4XH2A 3RPKA 3GHBH 2H26A 4U7MA 1QO3A 3WYRA 4Z95H 2OQJB 2OK0L 4LLVB 4ZXBC 4KUZL 4JFEA 1KG0B 3EO1B 1DUZB 4APQD 4M6AA 1I3VA 3GSQA 2V2WA 1NGXB 2P5EA 2WINB 4M61A 4CMHB 5HXMA 5D9SB 4AT6B 2OTPA 1WBZB 5E00A 2V5MA 1YEGL 3ZDZE 5GS0L 1AQKH 1WIOA 4X6DA 1HH6B 2YOCA 5GPRA 4H5SA 3STZB 2XZAH 2OCFD 3CDGB 4HIHB 4R7DA 4YXKL 4EIZC 2AK4D 3PL6B 3FFCB 4E42A 1FL6A 5F7DA 3BP6A 3MRQA 4CU6A 3RWEA 3S3PA 5I6XB 4FABL 4N8VB 3E6HB 2RGSA 3B9KB 1LDPH 5JPNB 3DUHA 4OQTH 3RX5A 1H3PH 5IJVB 3BKCH 4GKOA 4OCYL 3CC5B 4OBSA 4Y4HB 4U0RB 4HWBH 3WXWH 4O4YH 1KLUA 4G80B 3CFCH 4CVWA 4JAMA 2NXZD 2NX5B 1JWSA 2EYRB 4AEHH 3ZT6A 3BO8B 1KCUH 5EIIA 1T20B 4P5TA 3FQNB 5AZ2H 3TA3C 4DAGL 2EKSB 3IAQA 3OKMA 1HQRA 1URLA 1PVHA 5D1ZB 2X7LA 1G6VK 4YQXL 4JZOA 3G6DH 3MFGB 5IR1A 3GIZH 4UT9H 1MHCB 3WNNA 4G9FD 1Z9SA 2H2SC 3EO0B 1DVFC 1YYMH 4EI5B 1MRDL 4F37F 3EDFA 4G6ML 1ZE3C 4OFDA 4X8JA 1BPVA 4WUKL 1JHKH 4EQ3A 1R0AL 2ADJB 5GGUA 4LSPL 1JE6A 2HTLD 2LAGB 1UZ8A 3CU1A 3RVTC 3BE1L 1RZKL 1HIML 4QHNB 3U1SH 2ZUVA 3SPVB 1TQCB 1EFXA 4OLWH 2VN4A 4G5ZL 4HSQA 4OGAC 2VDMH 4NKIL 1U6AL 5B39G 5E94A 1L0QA 3L7FA 4NFDA 4PJAF 5IMOA 4WU7A 1QQDB 1NUGA 4BQ8A 4M7KL 3JV0A 3SQBA 4OQTA 1QSFE 3UBXA 5IVZA 3GSNH 4X7TA 2H3NA 4HXBH 4HWBA 5J12B 5ACZA 1T04A 1UC6A 2AV1A 4U6XA 2AJ3A 3B9AA 2J6EL 3RKDD 4NBXB 2EDXA 3EOTL 3O4LE 3NTCL 1YPZE 5C9KA 5SWQA 4XCEB 1ZT7B 4O5LH 3ZSSA 1F6LL 4QRPD 4NO0A 3QG6B 2DDQL 2NNAA 3HLAA 5TE6L 1BLNA 1IGMH 2MCPH 4UTAL 1R5VB 4GRWE 4KRPB 3DBXA 3MC0A 1V7ML 4GS7C 4G6JH 1KJ3H 4PJFE 4OM0H 1C12A 5T5FH 4CVZA 2Y5TA 4YE4H 1E6OL 4S1SL 1A7RL 7FABH 4TUOB 3HPJB 1U91B 3PGDA 4LGSB 3WIHL 5A3IC 3EFDL 4NP4L 3QXUA 1Q0XL 5EO0B 3FT2A 1A6UH 3V52L 3VFNA 4UOW0 4K8RC 1A7OL 3OXRB 1A7PL 5IB4B 5I1GL 4MQXD 4G43A 4L3EE 4N1EA 3KPOA 1XF3B 4TYUA 2HT4D 2I27N 4UV4H 1SBBA 1BFTA 1CD8A 4P9ML 2A73A 1E4XI 4N0UB 1JK8A 4UOJA 1NBQA 3MCLL 5J1TC 1P7KB 4JY6A 4TNWK 2BSRA 2Y7QB 1HXYB 2W60A 3S9DB 1WZLA 1KTLB 3DIFA 5A2IH 1Q9KB 3MNVA 4TOYL 3MREA 4L3CB 1DE4B 1WV7T 4H88L 3ALXA 4JE4B 4I0CC 2XG5A 2EIEA 1XIWB 4JPIA 3GSNA 4MJ5A 3V6OA 4QOKD 4WUUA 4TTDD 5IG7A 2HG5A 4JFHD 5EU7E 4JFEE 4QF1A 4ZXBB 1WUNT 2CO6B 2ILLA 3RL2B 2VZVA 3PNWB 2YC1A 3SE3C 1TZIB 5DZLA 5H94B 4WU5B 3DHJA 1S9WA 1T7XA 1WICA 5F6IC 4L1HA 1IFHL 3EDDA 3WIIL 3GGWB 2VN7A 4L1DA 4S1RH 5HPOA 4OLUL 4X6DE 3WFDH 5HDQL 1FG2B 3QFJD 2ZUWA 1JPSL 3E0GA 4HGKC 4ZODA 3ARGA 3TIDA 5TF0A 1FC2D 2VQUA 4OGYH 1YEFH 5IFAL 1XCTB 3BPLC 3FT4A 2HWZH 3INUL 4LP5A 4MA3B 1JF6A 2ZUXA 4YAQA 2ZUSA 1R3HB 5IFHH 1I8KB 1S7RB 4WNQB 4L29B 3C87A 3CFBA 5D72H 3B5GA 3OZ9L 4WY7L 3FRUA 4N8VG 1HHKB 2C3GA 3W9DB 5F71A 1VGKB 2DTMH 3LHPH 4ZQKA 3HCVB 5MP6H 4LCYB 1PSKH 3U0PB 2F19H 4YGVB 4P2RA 4ZTPL 4JANB 3SDCD 1G7IB 1BD2D 3C8DA 1GGCH 3M17B 1X5IA 2GAZB 3RDTA 4I9WE 2HMIC 4KTDL 3N9GL 1A6WH 2YPVH 1XGPB 4M03A 4QRRB 3VGGA 4P46A 1CS6A 1NCAH 3TYFA 4ETQB 5GS2H 3MRRA 1C1EH 3UTQA 3NA9L 3AAZA 1EXUA 2PNDA 1AI1H 1GZQA 3L5WA 1TLKA 3O9WA 4P48A 2X05A 3KLHD 2VISA 1MVFA 4JHWL 4DGIL 5ISZD 2BK8A 4XCNB 2WWKT 3LIZL 1DVFB 4GG6A 2G9HA 4MZ2A 5HYEA 2VLRD 3NZHH 4UUJA 3GBMH 1ITBB 4P4KA 4QXGH 4NN5C 2EIDA 2FB4L 1YDPA 4XZUB 3QUYC 3RWDB 1E4WH 1FFOB 3HS0B 1IBGH 4MNHB 1SJEB 4DTGL 1UXSA 1CE6A 4MJ2A 1YMME 4QRUA 3BZEA 4AL8L 2P8MB 3BH8B 5DTFB 5JW4Q 4PJIF 4M5YH 3AY4A 3O3EB 3SKNB 3O45A 1WZMA 5DXWA 3EJYD 4KV5F 3VW3L 4JY5L 2PW1A 2R0ZL 4NCC1 1MAKA 2HA1A 3M8OH 2VWEE 2BXYA 3OB8A 5FDWA 5C0EB 2FRGP 5IOPB 3OV6A 3ET9F 1R3LA 3O2WL 5C2BH 3MROB 5C6WH 3THML 1PKOA 1EJOL 5FO8B 5K9QG 3FCTA 1MH5A 3MA7B 3RU8L 4RFOL 3G6JF 1ZHBA 2W9LA 4QYOB 4HPOL 4G8FB 3KHQA 5E8PB 3T65A 2IAND 4Z7OF 1RUAH 4YIQB 3VXRB 1MIMH 2F58L 2BY1A 4GS7B 4DGVL 4ZUTB 4I48B 2R4SH 2Q7YB 1CT8A 3W82A 4R96B 1M6OA 2X4SA 4OCXH 4LEOB 1MI5D 2XG4A 4R4FH 2R2BA 4NM4L 3U30C 1I3GL 4ZFZB 4D0DA 3B9DA 4NPYB 4J3UA 4YXLH 1BOGB 3MLVL 4FQXA 5JXEA 3A6BH 4ZFFA 5EB9A 3CUPA 1QKZH 4U1KA 3IJYA 3DVIA 5C0NC 2V5SA 1A1OB 1FLRH 2ZZUT 1EUUA 2W07A 2P43B 4N68A 1LO0H 5D7KE 4GMSH 4MA7H 5KN5B 5KSBB 3RY6A 2ZCLL 2PUQT 3HKFA 1SYVB 3ZDZF 4S1DC 4HJJL 2GY5A 2OSLB 1OWWA 1OAYH 5E6ZA 3EGSA 3V6OE 3D39B 4XCYA 1SJHB 2EDRA 2ICEB 4JFFD 4WUUE 5H2BA 1Q9WB 5KANI 1XF5A 2CSPA 1FDLH 1I1AB 1OSPL 4MQ7B 3NCJL 4ZNEE 5CZXD 3EYOB 5D1QA 2DBLL 2NXYD 1A9EA 1ONQB 1H9VA 2DI8A 3KDMA 3C5ZC 5MI0C 4BKLB 5J6GB 1NAML 4JFQB 3SCMA 4JN1L 4Y1AE 4FTVB 1SMOA 4P2QD 5IV2A 4XP5H 5FK9B 4G7YL 1DBJH 1PY9A 3ZDYE 5KBNC 1EZVX 3M1BA 1I3RB 3PWUB 1F4XH 2HTKC 3ISWA 3FO2A 3IU3A 2RB8A 5HYFA 3F12B 4LLWB 1U8OA 3BPLB 4BA8A 1J8HE 4JFXB 3ZTNL 4FQLH 5D8JL 4CMMB 1GCFA 5I0ZA 5DQ9A 3DGGA 5EORL 12E8H 1HK6A 2I25N 1BX2B 5TQ2H 3MLXH 1ERNA 4U7SA 4JZJC 4ZUSB 4LLQB 4OZGA 4Y5YA 3TN0A 1F6AA 4G6KH 1K5NA 5BMFH 1B4JH 4WDIA 5EU6D 3TVMA 4AJ0A 3CH8A 3VRJA 4HDIA 1ETZB 4X6EB 1FGVL 3QCVL 5DMJB 3TBYB 1F6FB 3OKDA 3W81A 1L9NA 2R1XB 4QHMB 1IRAY 2CR6A 3I6GB 3S36H 4G42A 4G8IB 5JW3H 5CZKA 2JB6B 3R06B 3GKWL 3S37L 1ZA6B 5E8OB 1OL0A 1Z2KA 2E6PA 4GKZA 5D6DC 5HJ3A 1Z0NA 4CNIA 4UV7H 1J8KA 3U0WL 5FYJL 2Z92A 1PZUB 5HYIA 1U8KB 4MAYD 3WSQL 4M4RA 2IH1B 5FYLL 5DUPH 3K3QA 4PRHA 1I8IA 3ZL4L 1RK1B 5ITFA 1MQKL 1F13A 2W0FA 4NN5B 1YPZF 3DI3B 1QSZA 4CAGA 4Z0XB 3QUYB 1DBAH 4E5XB 3UBXI 1NC2B 5ANMB 3W39B 3GBNH 3PWPB 4ZD3H 4F9LC 1NAMB 5DJ6A 4OB5L 2X1PA 2F54B 5HHMB 1A7QH 5FECA 4GRWF 2ARJB 1KPVA 1MIEL 4ODWB 4PJFF 1J05A 3QIUB 4I18C 4I0PA 1CFBA 1RU9H 4XMLH 3KPSB 1WFOA 3DMMA 2DM4A 3LQZA 2E9JA 3DHMA 3MRBB 1U93B 3PWNA 4WTWA 1X5AA 1A4KA 1MCDA 3SKOA 1ZVSA 3BW9B 2VXUH 3BDYL 4L9DA 4Q0XL 3U9UB 3MRKB 4FOMA 5ESVB 1WBXB 4LMQE 1Q1JL 1QBML 2DD8L 5D7LB 3QB7C 5HGDB 1GH7A 3KYKL 3VFOA 2NY4C 2V2TA 4LCWD 2ICWI 1QBLL 5DUMH 2VC2L 4LHUD 3VXMD 1N59B 1PZ5A 3MJ9H 3B5TA 4OZHA 5TGBB 5EWIH 3ZE2E 2DQHH 3U7WH 1J87A 4F7MA 4XXCA 5C9JB 1MCLA 1X3DA 1EO8H 1X5KA 1MCHA 3ZKQD 1MCQA 3U7YH 4QT5A 3CPLB 4GKSB 1FZOA 2DQTH 5A2LH 1YY9C 2FECI 1IGIL 3TH3T 3U4EA 1I3UA 3RGVA 3EYQD 4XVTH 1M7XA 2RJMA 4MA1C 3VFRA 2FJFA 1CLOL 4YHLH 1L7TH 4PJHA 1L0YA 4YDIH 4HLJA 1GIGL 1PEWA 1NGYA 1XMWA 4PJIB 1I8MA 1A6AA 4JREC 2E7LA 2D4FA 1UACH 4LIQE 3V7AE 1REIA 2BCKA 3SE4A 4WFHE 5K9OB 4ENED 2DL2A 3KS0H 1D5BA 4HMCA 4ZO7A 1N6QH 4FQIH 5EUOA 4X6DF 3TNMA 4K94L 3G08B 4XCFH 2HLAB 1DQQA 1QPXA 4OLZH 1C16B 4JKPL 5EZOH 3PDOB 2GTZA 3K4AA 4R97C 3G6JB 1AR1D 1MEXL 3VXPA 1BREA 3BEWA 3FQXB 3DYMA 5J56B 4UTBL 2NW3A 4KJQC 1QYGH 3TH4T 5JLZA 3DX8A 3IVKB 5D93C 2QR0A 2B2XL 4K3HA 4OCWL 3AXLB 4PJGA 3C5ZB 2XZQL 3P77A 5J1AB 5C6TL 5IMKA 4U6YB 3MJ9A 4JVPA 2DKSA 1GOGA 1KN4L 4XBPB 1YN6B 5FGBC 1V3KA 4IOIA 4J6RL 5A43C 3QT2A 2A6JB 2WBJA 1HSAA 1EX0A 2IBGA 4JDTL 4Y89A 4FFZH 2WUBL 4MQTB 5JHDA 4Y2DC 5EU7C 1DFBH 3HZKA 3RRQA 2WNGA 5JQ6L 1MFNA 1FC1A 2XXMB 3OJVC 1EHAA 4RRPA 4M6NL 4O00A 4KQ4H 4JZJB 2UWEA 3CSBA 3SEPA 1FV1B 4XNXL 2BNUA 5IBTL 4OZGE 5EOQH 4RMQA 2BRRH 2XQBH 3LPGA 1H3WM 1GPOH 5C0AA 4I4WB 5KSAD 4DKFL 3VFWA 3LKPB 1GGIL 1FZKA 4P5KB 1G7PB 1GC1C 1NCCL 4YHNB 3FFDA 3DURB 5CD3A 2JJTC 1OSZA 3MGTA 5GISH 4NQSB 4HIIB 4MS8D 2I5YL 4DKAA 2P49B 2JIXD 4UT6L 4AIOA 1YEKH 4NN6C 1D5ZB 1T1YB 3QUZD 4NRYB 1ZSDB 3VE0A 4MLIA 4NHUA 1P69B 3BQUB 4JJHA 1OAKL 3QJFB 4LSUL 4RA3A 4D9RE 3IFLH 1D9KA 5GGRA 4Z76B 4MD4A 4JDZB 4NZTH 3Q3GB 3UPAA 4Y8AA 1Q9OB 4WI2A 5TH2B 2BOCA 4XAWL 4PRBA 2FX8H 5BVJA 3CFJA 5HHNB 5SV3A 1D5IL 3V5HA 5K9QI 1DQJB 1LEKB 2DYPD 4HS8L 4K7FB 4TULH 1BBJB 1G0YR 1MELA 2ATPA 4LSVH 1QFWM 2QKIA 4MNQA 1K4CB 5J89A 5GGQH 3CMGA 5T1KD 4I3RL 1VEMA 1RHHB 1S7SB 3WS6A 3JBG7 3B3IA 1JNNH 5F88B 5E56A 2UZXB 4J4PC 4I18B 4LOUD 1ZLUK 1CD1B 1X5JA 3TCLA 2VB5A 4M1GH 2XQYG 4YDJA 3D85A 5DD5L 4NRXB 5HHQA 4ONGH 1EK3A 3PDGA 1HCVA 2OXGA 4Q7DA 1RHFA 1KFAH 1I7UA 1UB5A 2FGWH 2Z31C 3V0WL 2XOTA 2RQ8A 4PY7A 1HOCB 2EYSA 2NY4B 4HBCL 4NC0B 2K7QA 4K9EH 5SX5K 5SX4H 3X14A 5E2UL 4OFPA 5FAAA 3LCYA 1JJUA 4NO3A 5IHLB 2RCSL 2BVQB 4RWYH 5E9DE 2WP3T 4HX1A 4TSAH 1QSFB 4UQ2A 3D0VB 3QR2A 4X5WA 1XF4A 3LV3A 2C1PB 4UNVA 3OKKB 1J0ZA 5MHSE 2NY0D 5AUMA 4H25A 5GJTH 3O4LB 1CL7H 1YPZB 3HFMH 3CXDL 5IVNA 4JY4B 2OM5A 2FDBP 4R8WL 4PJ5D 4MA1B 1YN7A 4RGMC 5IBLD 3GSUB 4EBQL 3HE6D 3L3DA 4PJFB 2I9TB 1G0DA 4JREB 4IDLA 5F7UA 4OD1H 1W2KT 3MRIA 3VGDA 5KW9L 4GFTB 3MR9A 4MLSA 2YPLA 1DEDA 5E2TH 1M7DA 3DX9A 5T1DH 5I76B 4OSUH 3W0WD 2EIZB 3D2UD 4HKJB 3U79A 3PUCA 3H42H 4GUPB 5HI4C 3RVXC 5FGCE 4LEXL 4U6HB 3O2DH 5JIPA 3ZDYF 2X70A 4L3EB 4LKCA 1TCRA 5D1XC 1VKXB 4R97B 4TSBL 3G04B 4W4OA 1CDIA 1KIQB 2CDEA 3IDXH 2XTJC 1VPOH 2PR4L 3W9EB 5ICZA 1P7QD 4U1SA 3EO9H 4PGZA 2BZDA 5FO7A 4LSRH 4IBLT 1JPFA 5D93B 2EC9U 3B8YA 4PJGE 4WI5A 1MFCH 4Z95L 1OD9A 1INDH 4N8CH 3MUGB 1BOYA 4WJ5A 4XAKE 5HHOA 2L7JA 1QNZH 2Q8BH 5CS7A 5DFTA 3BX7C 1TZHA 4MCZA 3S98A 4OD2A 3QRGH 4QRSB 3MACH 5FKPB 4ZS6C 2OLDA 2D9QB 4KPHH 5JHDE 2NCMA 5A16A 4OQ1A 1IMHC 1AQKL 2H26B 3C5SB 4Y2DB 3ARRA 4G6FD 1EPFA 4JLRA 2V2WB 4P57A 3CX5K 2XZAL 1WITA 1A02N 1IGTA 4M61B 4RFEB 4QWWC 4Z7QE 2E8YA 4POZC 1JGDA 5ALBH 4UT7H 1ZLUH 2H32B 4KHTH 4Y19A 1AR2A 4X6DB 2OTUA 5JPMA 1NUDA 4Z5RA 1XR8B 2R15A 1V3MA 4PG2C 4OQTL 3OJDB 3O2DA 4H26B 4R7DB 1BJ8A 5ADPL 3BKCL 1CFSA 3VXUA 1A2YA 3CX2A 4E42B 3QUXA 3MTRA 1FL6B 4NN6B 4S1QL 5F7DB 3WUWA 4ZTOH 4OIBA 4LLAA 3WXWL 2ED8A 4YDVA 3KPNA 1YNLH 3CFCL 3ESUF 5CJQH 3MRQB 1JN6A 3EYUH 3VXOA 5E1AA 1V8HA 3RWEB 5SX5H 1FRGH