1M71B

Crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
220
structure length
220
Chain Sequence
EVKVEESGGGLVQPGGSMKLSCVASGFTFSNYWMEWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTRGGAVGAMDYWGQGTSVTVSSATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKVDLIKEPSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain of the monoclonal antibody Fab SYA/J6
publication title Molecular Recognition of Oligosaccharide Epitopes by a Monoclonal Fab Specific for Shigella flexneri Y Lipopolysaccharide: X-ray Structures and Thermodyanamics
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71B01
4OI7A 3LS4H 5H35A 5C0BD 1I1AC 1MJ7H 3TT3H 3C8HA 1AQKL 5JDSA 4HIEB 4UQ2A 4R90L 3LKSB 3ZHKA 3U36A 4K3GA 5FYKU 3C5ZB 4ZSOA 2Q6WA 5TE7L 2VL5A 5DJYA 2OL3A 4NKOA 5GGSY 1DP0A 1T5XB 4H26B 1B3JA 1FYTD 3QO1B 3C6SB 4A6YL 1RIUH 4NRYB 1TZHA 1E0OB 1XF3B 3BHBA 4AENA 3OKOA 3U30C 4XPTL 4J23A 2IQAB 5CZXC 5EU6A 1UQSB 1FNGA 3KVQA 4LSTH 1X5FA 3U83A 5ITBL 3JUYA 4Z7OF 4BKLA 2F53A 2ZG3A 1ZT4B 5AZEH 3B83A 2UWEF 5I8CB 5HVHB 1Z9OA 3KLHC 2B4CL 4NFDA 3W2DH 2D7PA 2EDXA 4Y4FD 4HX1B 4YUEH 5DC9B 3SDCC 1S9YA 3UYPA 3VXMB 4M1GL 4AY0A 4J2XA 3FQTB 4PP1C 5F7YC 3RWEA 1CTNA 2WZPD 3MA7B 3QR2A 5HHOE 1I7UA 5F71A 1FE8L 3U0WH 3ARFB 2AXFA 1OQOA 1YECL 5L0QC 2MJWA 5DRNB 5E8NB 3GMQB 3NFNB 3VRIB 1NGPL 4NUJB 1S7UA 4Z7OE 4D9QE 4JQIH 1HEZB 2Q76A 1EBPA 4PRDA 4KY1L 5IB4B 3HE7D 1MNUH 1DN0A 3O0RH 1BQHA 3CSYB 4ONHA 5CWSB 5C9KA 1MCJA 4P5MB 1ZGLA 4NWTL 1BFVL 3P4OA 4QRPA 2LTQC 1G7QA 1CFVL 1UM6L 3NIFF 2LFGA 2XA8L 1OARH 4LASL 4Z7UB 1RZIA 2ARJA 2ZG1A 2ZNXA 3BH8A 3ROOB 3LS5H 4IOSD 4LIQE 5JXAH 1F3JB 3V7AG 3DV6B 3TN0D 2V5MA 3ESVF 1FNHA 4KK5D 3O9WC 5DMYA 3A6CL 4IIQB 4RRPA 3WO3B 3SQOH 1IM9A 2XXCB 3LD8C 3TLRA 4ONGL 3GNMH 2X4RA 1YJDH 1JZ7A 1U8JA 3NIFE 5B8CB 4Y5VA 3RWGB 4GBXA 1T0MA 4ZXBA 2BHUA 5D1XA 2XZCH 3SY0A 1XGYL 4PJDF 1EAPB 4NKQB 5FOJA 3LN9A 1X5JA 5HHXH 2Z35A 3EDFA 4HUWA 2BCKA 5F3HB 5FK9A 4H20L 5L88L 2I5YH 1OGAB 4LOUD 3UYOD 1FVCB 2FEEI 3MX0A 3QUML 1JHKH 3HN3A 3UMTA 4Q9BA 3OJ2C 5J6GA 4KJYB 3FO2B 3WFHA 3CVIH 3QDGE 1X5XA 5JW3L 3T77B 2X4NA 3V5KB 3V8OA 4IDJL 3MOQA 1ES0B 1JF1A 5F1SA 4PD4J 4YXLH 5GXBB 3B9KC 2NR6D 3H9SA 1Y0LB 5SX5H 3B3IA 1NFDF 5IVXA 4Y2DB 3O4OB 2UVFA 2AEPH 5GRUH 3QEGH 4YNYB 1RK0B 5GS1A 2EE3A 2J4WH 1JPSL 4RFEB 1KTLA 1QD0A 2WP3O 4KJWD 4ZFOL 3QQ9D 4HGWB 4RAVB 1G7JA 3GJEB 2EDOA 1BZ9B 4R4NC 3GSNH 3SO5A 1NFDE 4WDIA 4K94C 3VXUE 4UT9L 4GJTB 3TBSB 4TUOB 1H5BB 4L4VE 1PEZA 1R3HA 5ACZA 5IROA 5DR5H 2ZSVA 2XTJD 2CPCA 1QFPA 5C6PB 3GMNB 2VQUA 4GG8A 3VXTB 2FECI 4RISH 1TVHA 3ZKMD 4MQXC 1KFAH 5FO9A 8CGTA 3IFNH 4JO1H 3GHBH 3OHXB 4HWNA 1OSZA 5E95B 4C56B 4UINH 3E6HA 4KUZH 1Q9WA 1HNGA 3VE0A 4X7TB 2OS7A 5A16A 3SDDA 5IR1A 2VTFA 2BK8A 4U1JA 4XP9H 4PR5B 1E6OL 2MQ0A 2VLKA 4HBCH 2NY2B 1CFSA 1C12A 2DWDB 1D6EA 3RIAF 2H32A 3MREA 4NN5B 5KAQG 1NEUA 3MNWA 3M17B 5EFIB 3FHQA 5FO7B 3BKJH 5BOZG 4M9OA 2APVA 4MAYD 4XHJD 2AJXL 3EAKA 5JPMB 4WUUA 3IU4L 1Q9LA 4GG6B 4FQLL 1RZFL 3TF7C 1F5WA 2XG5A 3NCJH 3NMEA 1G9NC 1OWRM 4PBXA 1JUFA 2DIBA 3GM0A 2DD8L 4O51A 4M4RA 5DVOA 3TO4B 4B5EA 1QBBA 5ID0B 2HFGH 3MOAH 5C08B 3FFCE 2VDLH 2DQTL 3D85D 4HZAA 4W6XB 1PYWA 4WHTB 3ZDYF 1YN6B 2AJYL 1WF5A 1ZMYA 1AGCA 2C1PA 3V4VL 3ZKSD 4HKZB 3BDYL 2EDYA 4MQTB 1WBZA 2B1AH 3VGAB 3WJLA 5JHLL 4A2MA 3OG4B 4ZQKA 1ZOXA 4PLNC 2CRYA 2E9JA 4XCCL 2NY3C 4ZAKD 5GS0C 1QSEE 4H8WH 4GAFB 4UT7L 3WKMH 1JK8A 5GGSB 2YS4A 2V7NB 4P23B 2PXYC 3ZDYE 1UXSB 2F74B 5DQ9B 5CMAA 5C3LD 3EJZC 4HULB 1N4XL 2VZVA 1LDPL 4BZYA 1MHHA 5FHAL 2XZAH 4FFYH 3PP3K 5ICXA 1T20A 3EDEA 2GKIA 3V5DA 2DOCA 4GKZB 1NANI 4MSWB 2DQCH 2GUOA 2HH0H 1VHPA 4PRBA 3L6FA 3U4EA 5SWQB 3ULUL 2RB8A 3QDHA 5DD5H 4M5ZL 3RUGB 2XWJB 2FX7L 5IHZB 4QTHB 1DBJL 4KRPD 2YPVH 2UV3A 4JKPL 1DE4A 1U3HD 2HFFB 1N6VA 5MEOB 1RFDL 2WANA 5D5ME 5C0FB 3U9UB 5IF0B 2ZOLB 3NZHL 4Y1AD 4KKAD 1A0QH 5D1QA 4Y4KD 2H45A 2HLFC 3KS0J 4F7EA 3LKRB 4NN6C 4NKMB 3VXQA 2Y9RT 1MF2H 1MRFL 2EYRA 5KN5A 3WE6A 3KDMA 1NMAH 1QZ1A 5BO1L 1KCVL 4JPKL 3MRHB 4OFIA 1ZA6A 5C09E 1MRCH 1AGBB 3VCLB 5M95B 1I3RB 3RWHA 1ZGLM 4OD2A 4RFOH 1G7LA 3NCCB 4MD0B 3HI6H 3RVTC 1N6QH 1YEDA 3GSOB 1HQ4A 2FO1A 4PJ7B 1A1OA 1WBYB 1P4LA 1RUQL 2AKRA 4R3SB 3TJEL 2IALB 4LVEA 2W65A 2Q86A 1RZ7L 1J5OH 3SBWC 4RQQB 2G5BB 3E0GA 3QUXC 1U6AL 3JXAA 3MJ7A 5GGQH 4WFED 4YAQA 3NOIA 4QRRA 5TE4H 2WP3T 2VDML 1D5IL 5ICYA 2X42A 2XZZA 4EIGB 1MWAA 4MB4A 3ZKNC 1NJ9A 1A1NB 1BVLB 4HKBA 2A83A 4XI5C 2XWBA 3QHZH 3S88H 2FYYA 3ULUF 3DMMD 2DN7A 3MFFA 3VWJB 3VW3L 3CMOL 4P9HL 4MQ7B 5DMIH 4H0GA 4JAMA 5K9QG 2BOCB 4O2FA 1EUUA 5FGSA 5LGHH 4K2UL 2X4PA 2DF3A 3NCYP 4M6ML 3IDNB 2VXVH 2EE9A 4J7RA 1QG3A 1F00I 3OPZL 3W0WA 4DAGH 4LU5H 3HAEG 1ZLUK 2QSVA 2BXZA 2QSCL 3AREC 4NO0D 2F9BT 5E6IB 5CKAA 3ULUE 4WO4D 3D0VA 1LEKA 1H15B 3UTTE 5EZOL 2X1XR 4XWGH 2YZ1A 2F15A 2XQYK 3K4DA 3SGKA 5DK3A 3GSXB 4CMHC 5CZVH 2ICWB 1A64A 1KB5L 5GJSL 4B0MM 5F9OL 2FIKA 1UH4A 1T0PB 4YHZH 3VRJB 1I85A 1YQVL 5DO2C 3S6CA 1CFNA 1FNAA 4G6JL 2OXGA 4QY8B 4CMMA 2JJSA 3H0TB 4TULL 1A7PL 1RUML 3GRWL 3KPPB 3MUHL 4JN1L 4JFEE 2CDEA 2H2PC 4YH6A 1N6UA 1OAUL 3M07A 1HHHA 4UU9B 3RPIA 5CBAA 2CK0H 4G5ZL 3QFJD 5AYQA 2AK4A 1WWWX 1S7WA 4I3RH 2ZCLH 4KTEL 1UZ8A 2M8XA 2LVCA 3RWCB 1AE6L 1UJ3B 4TPRL 4XVUC 3DBXA 2KQMA 4Y89A 4F7MB 35C8L 2A74A 1SEBB 4PJIE 5D70H 1LO4L 4PP2A 3T0EE 1PX4A 4K94L 5DURB 2H26A 4GMSL 5E08H 2B5IC 2ZUQB 4LSPH 4ZUWB 4O58L 3BSZH 3D18B 2P46B 4F33B 1R3IL 3T8XA 3SE8L 4NQVB 3IFOA 4I5BA 2PNDA 3UDWC 1OPGL 5E8DH 4OM0L 1I8KA 3UO1H 1OB1B 2H9GA 2IG2H 5E00A 4ZTPH 5CJOH 4NQCD 4NQEB 5BVJA 5CBEB 3TA3C 5I1JH 1K2DA 3UBXG 1CVRA 4L8BB 1UWGL 2NX5B 4N8CH 2FO4B 4Y2OA 3IETB 1P7QD 1QFUL 3OAZH 1V3JA 1F2QA 1NGYB 3QUKB 5IHUH 5ADOH 1I7RB 3LVEA 5A43C 2GSGB 4P3DA 2WBJD 2N4IA 4MNQD 3C6LD 1WCBB 3MGTB 5E5RB 2NXZB 1KPRA 1BREA 3PHQB 4YE4L 5DD3L 5TDOA 1FC2D 4X4XA 3TT1L 3IKCB 4D9RD 5GRXG 3P4NA 2W0KA 4KVNL 5EZIL 3VFRA 4HF5L 1G9NL 4PJFE 3MLWH 3VU2A 4I4WA 5F7LB 4JFDA 4KTDL 5EBLB 3S5LB 2X4OA 4IS6B 4X99A 3V0VB 1WV7T 3OAYH 1TETH 5JXEA 2WLYA 3LRGA 3SE9H 1YY9D 5C6TL 3GBLA 4JPIA 2HLAA 1FBIH 1HKFA 5JTWA 3ISWA 1UA6H 2EKSA 4XP5H 1UGNA 4JE4B 1R3LA 2HJFB 3SDYH 5BRZB 1BZ7A 5DFWH 5GRYA 1J0HA 3JWOC 3AS0A 3IDYB 2QQQA 2W9EL 4MXVF 5MHSD 5E2VL 4Y19D 5DJ2A 2EIBA 4L8SC 3KHQA 3O6FC 5HY9B 1CE1H 2YBRA 3QIUA 3MROA 5E2JA 1QLFA 3PUCA 1T3FA 1J1PL 3KNBA 3EYUL 1T80A 2ZCHL 5FIEA 3KLAB 1S7RB 2NXYD 3QNZA 5I1DB 1YZZA 4Z8FH 1XAUA 2DQIH 4MXVE 3H7BB 4AMKH 1R3KA 2ZG2A 5BVPL 3C60D 3RGVD 3HPLA 2VXUH 5EU6D 3CFEB 3VWKB 1EXUA 1ND0A 1GHFL 5IV2A 1WIOA 2OTWB 1NC2D 3MRJA 2QEJA 1MRDH 2BJML 5T1KD 2F53D 5IMMB 4YBLB 2VDQL 4OIIL 3VJ6A 1DUYB 3NFPA 4P5TB 4X7EC 4HIJB 5DQJA 5C1MB 4ZOEA 2P5WA 3MRGB 4GRLB 1FORL 4WEMB 2GW5A 3HAEA 5GSVB 1G7MB 5T1LA 5I1HH 5KS9B 4K8RC 3S7GA 5GISH 5DZNA 4N0FB 4QWWC 1JGVH 1NL0H 5BXFB 4M61B 4PJAB 3FQXB 1OAYH 1FL3B 1OAZH 1T2XA 1JBJA 4IOFD 3DYMA 2BVOA 5F3BB 2PO6B 3TCLB 4V1DB 4Y7MA 2IH3B 5JZ7C 3RWIB 4M7ZC 5DJDA 4PGBB 3ARYA 3FOMA 1PX3A 5D7JB 5TGBB 5LKNA 2PTTB 3UTSB 4HLZG 1A6AA 4OCLC 5D2NE 2DM4A 1QFOA 3DURA 2JTDA 2UYLB 4O4YL 1T6VN 2AJSL 5IM7B 2R2EB 5J06A 3H3PH 5GRVK 1QTYT 1IM9D 4MDIB 1KJVA 3KPRD 3ULVD 3IXAB 1KG0B 2NY0B 3T04D 1OF2B 4MS8D 3VFTA 4D0BA 1HSAA 1A21A 4MCYB 1LEIA 1LK3H 4I13B 4GBXD 4CRPA 4ZXBD 3MRDB 4P4KC 5D1XD 4KQ3H 1CR9L 1C5DA 4ZPVB 1CDGA 1QUNA 2HTLC 3BUYB 1OTSD 4JY6B 4PJCA 3V6OA 3I02B 1JGLH 2EDLA 2BNRA 1XF4A 3BEVA 5MENE 5DHVA 1AHWC 1K9TA 3SJVE 2ARWA 2C4XA 2ADFL 4PJBF 3CU7A 3SCMB 2WINA 4ZOAA 3AMLA 1MHCA 2EC9U 4NBZB 5B4MD 2BVTA 1K8IB 1JVKA 4ELKA 2NY5C 3EO0A 3VG0L 2P4AB 3S37L 1Y18A 4NCDA 1B4RA 3OB0K 4RX4D 2OK0H 1IEBB 2F58L 3RKDD 4PJBE 3D39A 3UBXA 2FNBA 3BAEH 4OLXL 4FXKA 1SEQL 3SE3A 1U8OA 3CZJA 2IMMA 5E2UL 5J9PA 1OTUD 2NY7H 3B2VH 1EUTA 3U30B 3ULVH 5EU3B 3BP6A 5K9KA 4U3CA 4XCNA 3PJSB 2CRIA 2L7UA 1J10A 5HHOA 4HKJA 5KVFL 2XFXB 3QJFA 1WJ3A 2B39A 4XP4H 5T5NF 4PRHE 5I1LB 1BBDH 2CKBB 1YQ2A 3LHPH 3UJJL 2Q1EA 1S5HA 3MZTA 1FZMA 1L6XA 3ZDZF 2MQ3A 1LO2L 5KSBF 4JB9L 5I66A 1NFIA 2AGJL 1B90A 4ETQB 1CE6B 1K3IA 5INDB 1OCWL 3LQAH 5L0QB 3B9AA 4XP1L 1G9MC 5J3HD 2R1YB 4XBGA 5TFSL 5MERA 1DFBL 4QCIB 1JRHL 3QCVL 2Y5EA 4X7CC 1Q9OB 5EOTB 4DCQB 3ROLB 3OTTA 3GSNB 4CVUA 5KSBE 3O2DL 4XXDA 3VXOA 1I4FB 5K9JH 2LTQB 1FIGL 2PYEB 1WVZA 1MH5A 2DQJL 3HC4L 3CIQA 2I9LB 3HMWH 3MRCA 4MXWL 4OGYL 3NIDF 4UUJB 43CAB 2V2TB 4WNQA 2P8MA 4GXUN 4HUXA 2Q8AL 5LAXB 5ERWA 4G6MH 3D3VB 4K3DL 5HHPA 1GSMA 3IB4A 2YMXH 1GIGH 5INCA 3OR6A 3U4AA 2ZCKL 2FSEB 2R0ZH 2OJEA 1CF8L 4Z7UF 3K8LA 1JMXA 1E4WH 1S5IL 4C4KO 2P8LA 1KTRL 1X3DA 2ED9A 4A6YA 4RBPK 2EDFA 4WTWA 5FUOL 4BFIA 1INEH 2ZKHH 3QDGA 2ADJB 4RGNB 1DEDA 1B2WL 1KN2L 4WFHD 4PJDA 1TJHH 1TFHA 1MCFA 1Z9MA 4Z95H 4M7LT 2H6PB 1SM3H 3U7WH 3JUZA 3QIBA 4Z7UE 4R97C 4YLQT 1WLHA 3O6KH 1FO0B 1X5IA 4YK4C 1PLGH 4LVOC 4J3OC 1MLCB 4Z76A 2W0PA 3KGRA 5DK0B 4LARL 3BXNA 1U8IB 3P0YL 2YPKA 3L5IA 1NEZB 1TZGH 1WIUA 3DI3B 4HUUB 2LAAA 4YDLC 3C5JA 2YN3A 3EYSL 4X6DF 4ZFFB 5KSAA 1NFDA 3MRRB 4OSUH 2CKNA 5I1GH 1YEFH 3HC3L 5AD0B 1C5CL 5L6YH 4M7KH 3TO2A 2I9TB 3QSKB 4L4VA 3A0OA 4IMKA 5E9DB 4QXGH 1BJ1J 1DVFD 1WBXB 3DO7A 4NKDB 2VERN 1U8MB 2NW2A 1OGAE 3VFMA 3L3GB 1Q9KB 3DX6B 5I16B 1J8HE 1KCUL 1WC7B 3AAZA 3ARGB 1QQDB 4TRPL 5F1NB 2WUCH 4HK0A 4PREB 4XMPL 4YGVA 5DUPH 3WFDH 1F90L 4MXQC 1L7IH 2FX8L 3B4NA 5EBMA 3MNVB 1Q38A 5HDBF 1IM3B 3BGMB 1OHQA 1FGNH 3OJVC 4LNVA 4HJJH 1YPZF 4ZTOL 1NGWB 1NGZB 2A2QT 2BDNH 4HS3A 3LKQB 5IBLC 3JWDH 4QHLB 5HYSB 5BS0B 3F7YA 1S7VA 3OSKA 1YEJL 4AK1A 4UIKL 1P2CA 5HDBE 5EBGA 3AXLA 3QUMA 4G8IB 2XY2A 4LHUB 2J12B 4O2EB 1G7PB 4OD1H 3VFGL 4F37F 5F72S 2JIXA 3QUYC 4HWEH 5CEYA 4JO4L 1HHIB 1S8DA 4G43B 1T89A 2XG4A 2DMBA 1CICA 2DM2A 3FFCA 3TYGH 2R4SL 3MJ8B 3MNZB 2D03H 4P2OB 4EN3C 2B0SL 3IU3A 1KN4H 4LMQI 5HSFA 3GJFA 3G5YA 1TZIA 1ZV5A 3I2CH 4MJ6A 2EYTA 2IBBA 2YRZA 1KJ2H 3HZMA 4PJ8C 3I85A 4QO1A 1QSEA 1XF2B 4P9ML 3FO1B 3HNVH 1BD2D 1S7XB 3TZVC 3SPVB 4MWFA 1Q72L 5GGTH 4X7SL 5JQ6L 3WNMA 3LB6C 3GKZA 4NYLB 3GMPB 2A6KB 3LDBC 1F4WH 1YDPA 4GUPA 2GTZB 4KZEH 4S2SA 2Y36L 3GB7B 4RAUB 4HH8A 3VFSB 5DEFB 3NBNA 3MLRH 5J11C 4FABH 4X4ZA 4FXLA 3QHFL 3RDTA 4FZ8L 1U3JA 5I6XC 1HCVA 2Z8SA 4X6CF 5JQHC 1AXSB 3ZTNH 2H2SD 3DRTB 2O93L 3BWAA 4FFVD 2BOBB 4KJQC 1KIUA 4NNPH 5GZNC 3WXWL 2Z31C 3WNKA 3MV9A 3ABZA 5C08E 1A5FL 1NCDL 2NY5L 5D71H 4JLRB 1MWAH 5KSVB 5E56A 3RNQB 1WQVT 1T1WA 3QNXA 1U8KB 1KT2B 3P4MB 3CFDB 5FM4A 4XAKD 1SYSB 1S3KL 1JWMA 3PDOA 3TNMB 1E27B 3HFML 2XNAB 2DQUH 3INUH 4IBLT 4KKBC 3GMLB 4C4KT 1CLZH 2PTVA 5C09A 3CFKA 5EO9A 3PG2A 4P5KA 1MFEH 1XH3B 5ISZB 4LKCA 5ESVB 3PGDB 2G60L 3DOSA 4XNZB 3RI5F 5IEKA 3L7EA 3OAUH 3QFDA 4AT6B 4BH7B 4KPHL 3UTZB 1MQ8A 1S7SA 5HYQB 1ERNA 3LV3A 2BSSA 4P99A 4BH8A 2X41A 1C5BH 1SY6H 1DL7L 9CGTA 2C3VB 3RUGE 3OB8A 5BOPA 5DEGB 4QXUL 4HZLB 4ELMB 4K71C 3M45A 4L8DB 1G9ML 5CIPB 2ZWLT 2DTSA 1UZ6F 1KNOA 1FVEB 1P53A 4Y4FC 1WZ1H 3HB3D 1TJGH 4NQDB 1QSFB 4K3HA 1ZLSH 2CUHA 5I8KL 4PJ7F 3UC0L 4UTAL 2O5ZH 5C7XL 2Y25A 2QBWA 4PRNA 4KV5F 3HCVA 3MRMA 3U7YH 2EDQA 3KAAA 1IC4L 3U46A 1HKLH 4RMUA 2WWMD 3TJHC 1J0YA 4XPHH 5FYKD 5F1OB 3HE7C 5IB3B 4N0YL 2AQ3A 4G8EA 4P2RB 3UTTA 2VWEC 4GAGH 5DVMA 4PJ7E 5GGVL 4G7VL 5IFHH 4EI5A 3CSGA 2QADD 4KV5E 4XNXL 3MBEC 1KB9J 3V4PH 3NGBC 2BSTA 5MP6H 3T2NL 1D5MA 4IOIB 4C55A 4QHKI 1IAOB 1UT9A 2FGZA 1DBML 3AREB 3WLWC 1MJ8H 4X9IA 1HILB 5TQ2H 3TN0C 3NACL 2G5RA 4KK5C 2YK1L 5DEZA 1CGSL 3KPSB 5J0BA 4CMHB 4XB7A 1RULL 4JFEA 1R3JB 4LHQB 4K3EH 4JFFB 3TH4T 4HPOH 2GJ6B 1ZE3C 5HYJE 3UZVB 4PD4K 2P24A 1PSKL 2ATKA 5GGRB 1YMMD 3TWCL 4MVBD 3QIUD 3BFOA 4EUPB 4LOUC 4MDJA 5CJQH 1YYLH 3MRQB 2VDRH 1X44A 4QXWA 5FYKH 3T0EA 1S7TB 3HKFA 4YHML 5LJYH 1CLOH 4WWKC 3H3BC 4PYHA 4JFHE 1JCKA 4QOKA 4LGSB 3VRLF 5H37G 1HIMH 1UCTA 3R8BB 3I6GB 1UH2A 5I18H 2NR6C 2F5BL 1KJ3L 5D1ZD 4RWYH 1D7FA 1BF2A 4O02L 3U79A 4KHXH 5ETUA 2JB5H 3DETC 3HLAA 4IRSC 2B2XL 4I0PC 2B5IB 3G04A 3MRIA 5A2LH 1BIHA 1ZEAL 3O9WA 3MACH 3OKLA 2O5YH 3HI5L 3SN6N 4B50A 1QLEH 1CBVL 1YEKH 1G6VK 3D2UB 2P5WD 5EPMB 3VRLE 4HQQL 3QQ9C 4JRXD 1L9MA 3L3HB 3LQZA 5T1LD 3V6ZA 4EDWH 5IOPA 2CLZA 1PEWA 1EIBA 5CILH 4QYOB 2C26A 5C0AB 1HDMB 3MODH 5EOQL 5HHVH 3TIDB 5FYLL 2QTEA 4O9HH 1UB5A 2Z9TA 2EH8L 4QTIL 1BQLH 1IGIL 3LMJH 1XGRA 5D7KD 5EN2A 4TOYL 3TA3B 4Q2ZA 2X05A 5E99L 2XTJC 3RAJH 4TSCL 5ICZB 1JL8A 3EFFA 3W9EB 1FZOB 5BV7L 1KB5A 5ESAB 4P3WA 2XQBH 2CJUH 4ZD3H 1IKFH 5JUEL 1K6QH 3GBNL 1BJ8A 1KC5L 2V17L 2FB4L 3ILQD 1EJOH 3ZKMC 4FQXD 1H3PL 4Y5YA 5D7IB 4JQXA 3SKUD 2I26N 4JQVC 1FLRH 3P30H 3IDXH 3MV7B 1SBSH 1TQBC 1QEWB 2UY6A 3B9KA 3GRWA 3ARZA 4X0KA 4QRTA 1JPGA 2YR3A 5FECA 3BQUA 1PQZA 4X6FB 2Q7YA 4OCWL 5T5NG 3B8YA 4RWHA 2JCCF 1IGYA 2V7HA 2CUIA 5C71A 4OUUB 4MD5B 1G6RL 1GVIA 1IT9H 1P7KA 5DJAB 1NUFA 5F7EL 2H3NA 2EYSB 2BVPB 1A47A 1HYRC 2AEIT 1P6AB 4OZFB 4KH2A 5GGVY 4YDKH 3TGXA 4Q74A 4K7PX 3DGCR 3NAAL 2Z93A 4Y8AA 3PE9A 4XP6H 4F58L 4MAYC 2IPUG 2PYFB 4QHMA 5CJ8A 15C8H 4LFHG 2JCCE 4YC2B 3LS4L 3QT2A 5L8KB 1G84A 3GBMH 5LVEA 1A6PA 1MJ7L 3TT3L 2V9RA 1DBKH 1MI5A 2EEAA 3BDXA 3AS3A 5FOBA 1QPPA 3V6FA 4L8SB 5IB1A 1HH6B 5C2BH 3K1KC 1RIUL 3SKMB 5ITFA 1ZGLP 2DKUA 3RWDA 2R1XA 5CJBA 2NW3A 3FTGA 3G5XB 5JA8B 4IHOB 4LSTL 3HPJA 4PJ5B 1AKJD 1ZANH 2YSSB 4ZAKC 3ECBB 4KVCH 3MLZH 5AZEL 3O8XD 1I9JH 4L8CB 3S36H 3W2DL 2CDFA 4LPXA 2X7LB 3DLQR 3NH7H 3LKPB 1PG7X 3LKOA 4YUEL 4DZ8B 5FYLE 3BMWA 2FHFA 2FJGA 3RX7A 5I76B 2IADB 5HHOD 1VFAA 2X4QB 3GGWB 1VADB 3U0WL 1OAQH 1RZKH 1RJLA 5BRZE 4PLOB 4XNUH 2GT9B 3DX7B 3NZ8B 3EOTH 3CGTA 3BW9B 4LEOA 4JQIL 3H9HB 4U1KB 2G2RB 1MNUL 3O0RL 3JV6A 1DQLH 3SKNA 3BEWB 1U3HC 4JFQA 4RMTA 4UNTA 3S4SG 2VR5A 5EZJA 5B3JF 1OARL 2X4SB 3DNKA 3L3DB 4DZBB 6CGTA 4ZNEE 5DTFA 2FJFB 5C0JB 3L5XL 3LS5L 3Q5TA 3S3PA 4KKAC 4WU7B 5JXAL 2C4FT 3PQYE 4JDZA 1X5HA 2PUQT 3W82A 3FT4B 3TV3H 3FONA 5C0RH 2XN9B 3SQOL 3GNML 4M5YH 1YJDL 4PJAF 5B3JE 3UPRB 4DUWA 1OTTD 4Y5XC 3PWLA 2XZCL 4WFGD 3ARWA 2I07A 5F88A 1EEYA 2KPNA 1W72H 4Z77B 5HHXL 2DQEH 1JZ3A 5MENA 2ERJB 5KS9E 4M00A 2I5YL 1F11B 4K07A 1XF5B 1NC4A 1WCQA 4P4KB 4KZDH 1D9KA 4PJAE 3HC0A 2FRGP 2IBGA 1TPXC 4P46A 3PHOA 3HE6A 2Y4SA 3F12B 3CVIL 1FQ9C 4QRUB 4MCZB 4V1DE 1IL1B 1AHWB 4YXLL 2XOTA 2BSRA 3FQNB 4JFXB 3B9EA 3X3FH 1BFOB 4PRAB 4TQEH 2AJ3B 3QIBD 3G08A 3X12A 2MOVA 2FGWH 1DQJB 3UTSE 1B88A 2AEPL 5GRUL 3QEGL 4PJBA 2FEEL 3O3DA 2BNQB 5H8DA 1RURH 2J4WL 1X5LA 4JGJA 3NCBB 1JI2A 3PWPB 4BK5A 4U6HA 1TENA 1QFHA 1F3RB 1SJVA 5E8PB 5EU4A 1AO7E 3FB6B 1D5ZB 3VXSB 1MY5A 1HYSC 1U3YA 4XCEB 3BP4B 3GSNL 4MJ5B 4MJIA 3VXUD 5T3ZH 2X4TB 4OLUH 4PRHA 1E6JH 5C0BE 4EDXA 1EX0A 4LKXB 2FZ3B 2V5SA 1LE9B 4EOWH 2DL9A 3RPKA 5DR5L 4G9FB 1AC6A 3E2HC 4PJ9A 2OMNA 4X5WB 3GSQA 3KWWA 3Q1SH 1K5NA 4AM0A 5KG9B 4OV6F 1A6WH 4RISL 3RY6C 5CLWA 4NCC2 4HIEA 3LKSA 5DWUH 3B5TA 1HQRA 1TCRA 2WQRA 1KFAL 1LHZA 2ID5A 3IFNL 1JWUB 4JO1L 3GHBL 4UINL 5EBWB 4KUZL 2VLJE 4P4RB 3C6SA 3WIFB 2OM5A 1XF3A 5KSBA 1BAFH 2BC4A 5L2JB 3WL9B 4I48B 4MD4B 2W91A 1KLGB 3IDMB 2AAVA 5CGMA 2FECL 4XP9L 4Z18A 4AEIH 1KEMH 1DZBA 4ODUA 4XXCC 4HBCL 1IGFH 3EYOA 3PWNA 5I8CA 5IKCB 3KPLB 1AI1H 3DV4B 5K93A 1KUMA 2ZZUT 4NUGH 1BEYH 2DWEB 3STLA 3BKJL 3IGAA 3QRGH 4X9BA 1J1XH 2NMSA 2W60B 3QXVA 4LSRH 3NCJL 2JIXD 5DRNA 5E8NA 3GMQA 3NFNA 1DQDH 1ZLVK 3QEQD 4NZJA 1HEZA 3BPCA 3T0VA 2HFGL 3P77B 2AP2A 2VDLL 1FZKB 1I8IA 1V5JA 5C8JB 2F54B 2CXKA 2ZPKH 3K81A 1J05A 2BVQB 1F42A 4TSBH 5JW4R 4Z7UA 2XKNA 2B1AL 3IXTB 3WS3A 1RIHH 2C3HA 2R56H 5C0DA 1U92B 2ED7A 3ROOA 4LNRB 3MYJA 5LGKA 1QSED 1F3JA 4H8WL 5I71B 2DQGH 3NPZB 3WKML 1RPQA 2PCPB 1WZLA 1KV3A 1J0KA 2PYEE 4JRYB 4HXAH 4LSSH 1M05B 3K3QA 1BM3H 4R97B 5JOFB 3QO0B 1EO8H 4LRIA 3SDAB 3FAWA 1W8OA 4KI5E 2XZAL 4FFYL 2WBJC 4LVOB 5IG7A 3C6LC 3D3VE 2R9HC 5B22A 4PTTB 5E7FA 4NQXA 2GK0B 4FHBD 2DQCL 4E41B 3RDTD 4LBEB 2EIEA 3S4SA 3E6FA 1JGEA 4L5FH 2CD0A 5DD5L 3BKCH 4PY8J 1TVBB 4F37K 2BMKA 1OGAA 2ICCA 4YPGB 2YPVL 1J8HA 3RIFF 2XICA 4HEME 2XRAH 3IJYB 4HIHB 2Y7QA 5FF6B 3O2DA 4RGNE 1DQTA 1F45A 3HA0A 1YY9C 2L4OA 1ES0A 5DK2B 3HUJF 3RP1A 5HYFA 1Y0LA 4P59H 2VO5A 2R23B 2V9TA 3QNYA 1D5XB 1NMAL 4Y2DA 5BMFH 1IGTA 4KKCD 1EFXB 5F7WC 4OZIF 2H8PA 2HG5A 5FHBH 4J12A 4YNYA 1RK0A 4Y4HB 2OR8A 4U6XA 5DT1H 2WW8A 4G8FB 3S3JA 1MRCL 4OCNC 1FP5A 4RFOL 3HRZA 3REVB 3HI6L 3R1GH 3MCLH 1N6QL 1CD1A 4RIRB 4HGWA 4BQ9A 4TTGA 1YEEH 1MAMH 3AB0C 1NGQH 1I1CA 1CDUA 3EUUA 4OZIE 5IEHB 1TTUA 3KXFE 2AV7A 4L1HA 1J5OL 2NXYC 2B1HH 1H5BA 4ORZC 3PGFH 1WITA 5GGQL 4F2MA 2J8UB 5TE4L 4PGJA 2ZNWA 1W8NA 1U8PA 4H5SB 1JGDB 3QI9B 1TDQA 1L7TH 1P5UA 5TDPB 3GIVA 1ORSA 5FUCE 3REWB 1TNMA 3QHZL 2HVJB 1KIQB 4U1LB 4U2YA 3OGOE 3S88L 4MX7B 1E28B 1CXIA 1X5YA 1KIRA 4N5UA 1ZAGA 4L3AA 5DMIL 4EVNB 3JZ7A 5LGHL 1LEGA 1T1YB 4EN3B 4IJ3C 1SJHB 3ES6B 2A0LD 4X7TA 5DDHA 1UC6A 3L3OB 4OQTA 2VXVL 4KDTA 4DAGL 4LU5L 4N8VG 2IMNA 5BS0E 3JV4B 4LQ1A 4X7DC 4TNWF 4NC1C 4HMEA 4GW4A 1ZHLA 3M17A 3UTPD 5D2LB 5EFIA 3C9NB 4XWGL 3RI5K 3I3BA 4IDLA 1AD9B 3GI8H 1P1ZB 5CZVL 4FZEL 2VAJA 1RSFA 2GTWB 4E5XA 3AU1B 2G75B 5DD6B 1OD7A 1S7QB 4YHZL 3N1PC 3ILPB 4UT6H 3S35H 1C08B 3O6MH 4L9DA 1FRGH 1ZSDB 3KYKH 1HHJB 1QVOA 3TBVA 3HZVA 4WHTA 1QLRA 1PZ5A 5B21A 3N1FC 5FFLA 3CLFH 1NAMB 4MS8C 3LN5B 2XTLA 1TMCB 4POZD 4Y5VC 1HWHB 2FBJH 3FZUD 4HKZA 5JPNA 4GBXC 4JG1H 3HR5B 4ZXBC 5D1XC 2Z31B 1X4XA 2CK0L 5SWSB 1FN4B 4Q9RH 5HD8D 1ZHNB 4HWZA 4I3RL 2ZCLL 1KPVB 5DUBB 4JM2F 1JYVA 2V7NA 4P48A 1HXMB 2MCPL 1CK0H 5D70L 4JY4A 4I18A 4R7NB 5B4MC 4GKSB 5E08L 1J86A 5DRZA 4LSPL 3TBTB 4GKZA 4MSWA 3BSZL 3DX8B 1XF1A 3WKNA 5I2IB 1RVFH 2XWJA 1X7QB 4QTHA 4Y1AE 5GS1C 4ODTH 3TH3T 1QRKA 5E8DL 1AGFB 2VSCA 3UO1L 5AEAA 2IG2L 2BRRH 4ZTPL 3CDFA 5CJOL 1OTUC 3DUUB 5I1JL 3CAFA 4KFZC 4OF3A 1AGEA 3FB7A 1FNEB 5F7KC 4N8CL 4XTRC 3S5LG 1BVZA 4NKMA 2P8PB 4L3EB 3LEVH 5IHUL 5HGAA 3B8SA 2OSLA 3PP4H 5ADOL 3BGAA 4Y4FB 1LDSA 3HS0A 3EKCA 5IROC 1D5BA 4PV9B 3GI9H 2YWZA 4OFYA 4X8JA 5F96H 2RQ8A 5ISZE 3MRLB 1EEUA 3RJQB 4O2CB 2QR0A 2XZQH 3GSOA 2JLLA 3FRUA 2WV3A 5J8OA 4PJ7A 1T7YA 5JNYB 2A38A 1WBYA 4PRIB 1QKZH 3CLEH 3Q48A 5E8EB 4PRPE 3VH8B 2CMRH 3G9AB 3MLWL 4MAUH 3P9WB 4RQQA 3CFJB 4OGAD 4MGXA 3CH8A 4WW1A 4OZHF 1MFCH 1NMBH 1TETL 3T09A 3SE9L 1OW0C 1V7NH 1LVEA 3MBEB 1XT5A 2ESVD 1MHPH 2W0FA 4ELME 3RX5A 4OAWB 4F9LC 1BVLA 1UA6L 4XP5L 1F4XH 3TN0B 3SDYL 3SKOA 5HYJA 3RX8A 3VWJA 4NQDE 1QSFE 3T2PA 3A67H 4MQ7A 1VEMA 4OZHE 1FV1B 5HJ3A 1N5YH 4FQCH 5F70A 1CE1L 4LP5A 3IDNA 5FV2A 5C0ND 3N9GH 4Z7WB 4ORGA 5FKPB 1Z5LB 5IBUG 5E6IA 5I74C 1N3NA 2D0FA 4HMDA 4Z8FL 2DQIL 1KULA 4AMKL 5H2BB 2VXUL 1YY8B 3MMEB 5EO0B 3GSXA 4XH2A 3WJLC 1Z3GH 1WFOA 4LAQH 4LCWD 4AG4H 1MRDL 4WWKB 1IEAA 4TYUA 3JWDC 5TH2B 2BVYA 3EYFB 2OTUB 2AJZB 4LCUA 5KZCD 1T1ZB 3KPSE 3RVVC 5D7SH 4N8VA 3BH9A 4LLAA 4GKNB 4IRSB 5I1HL 4I0PB 4YGAB 3ME0A 5IWLC 5J6HA 5GISL 4N9GB 2YA2A 4ZO9A 2GJ6E 1JGVL 1NL0L 1ZWIB 4UU9A 4GRWB 1UWXK 4BFBD 1OAYL 1OAZL 1XR8B 3I75A 1G0YR 3FO0H 4Z5RA 4I77H 5CSZA 3BDBA 4Z0XB 2A6DA 3RFZC 5JIKA 1MFAH 1ZVHA 1UM5H 3JTTA 4HWBH 3T1FB 1SEBA 3IDIA 2W9LA 4XRCA 1MQKH 1L4IA 3DVNA 2ILLA 1A4JA 3MRPB 1CFQA 1JNHA 3U7AA 1QOKA 2BZDA 3T4YA 3P73B 2HWZH 2ORBH 5D1QC 4R2GB 3WUWG 4D0DA 3CH1B 1CG9B 5DRXB 4YDVA 4XCFH 3H3PL 5AG8A 1Y6MR 4NQCE 4FTVB 4K7PH 2HVKA 4PJHF 3L9RB 2VIRB 1LK3L 3ALXA 3E3QE 1TQBB 1XZ0A 4XVTH 3QDAA 2PR4H 4Z7QF 1UB6A 1QSZA 4KQ3L 1V3MA 3PNWB 4ZNCD 1RJZB 3ZE1F 1JGLL 4P3CH 5MEND 4YX2H 1YUHB 1R5VA 4DVBA 1LD9B 3CC5B 1R24B 3SJVD 5IB2A 2J5LB 5HHMB 2JCCA 4XGZB 1NC4D 3QRFM 1D9KD 1A9BA 1A1MA 3D69B 1A7NH 4P46D 3NN8A 4D9RE 4Z7QE 1ZHKA 5MEPA 1DEEB 3CXHJ 5IMKB 3IJSB 3TVMB 3BIKA 3MGTA 1FFRA 2BNUB 5CP3H 1A3LH 3ZE1E 4WENB 2WUBH 3NTCH 2VKWA 5D7IE 5MI0B 5FDYA 2OK0L 1FFPA 2ADIA 5FA3A 2AEQH 3P11H 5IQ9A 3QXAA 1JF5A 3D85B 4S11A 3CXDH 3H9ZA 5F6IC 3S5LA 4UAOB 4L4TE 4S1RL 2JF1A 5D72H 3J7HA 2AJVH 3FFDA 4HEPG 2NY7L 3B2VL 3HG1A 5EO1B 3ULVL 2VLRB 4PJEF 1RJYB 3I9GH 4CVZA 3RVXC 5MHSE 1PGRB 2ZUVA 4NNYB 4AEHH 3L7FA 4J8RB 4PRHD 4JFPA 4XP4L 4C59B 1BBDL 4G8GD 5D9SA 2IQ9H 3LHPL 1MPAH 4M93C 5IK3B 1YNTB 5F9WB 3F58H 1MFDH 3SGKC 1CU4H 3MC0A 1IE5A 4UOW0 1JYWA 1DDHB 4NQUA 3U0TB 4L9LA 4K9EH 4PJEE 2H2SC 3IRPX 3LQAL 4FFVC 1NDMA 2AI0H 1I85C 1N59A 1MSPA 3C5ZD 1U8HB 3PWVB 3OKNB 4XAWH 3ZMRA 1CIUA 4ZNEA 4YZFF 2DTMH 5I1DA 4W4OA 3H7BA 3B2UD 3PQYA 3WLBB 1G6RA 3CFEA 2CQVA 5K9JL 4NOFA 1U3HB 2GY5A 4LLMB 3HMWL 1UENA 4PJ5E 4HFUH 5CEZE 5IMMA 3RTQA 3H42H 2EXWD 1LNUA 2D4DA 4G6ML 4YZFE 4JANA 1W0YT 3UJTH 4P5TA 3VXMD 4OZ4A 2YMXL 3CFIC 3MRGA 3RNKA 4MA1C 5EC1B 1GIGL 3GK8H 1IGJA 3X14A 2EDEA 5GSVA 4RNRB 2R0ZL 5KS9A 5JW4M 3M1BB 4UIMB 3ARFD 4HUNB 5FB8B 3ZTJH 2E7LA 1E4WL 1J12A 2ZSWB 2YEZA 4Y5XB 3VFOB 1I9RH 3ULVF 4PJAA 1IILE 1RZGB 3UXFA 1INEL 4M43H 5F7NC 2ZKHL 4OV5B 4J1UB 3QXDB 2J3SA 4ZYKB 3CUPA 3RZCA 3TCLA 1WSST 1TJHL 5GHWH 5FO8B 3TESA 2VISB 3C5SB 4WI5A 4DGIH 4Z95L 2GQHA 2IPKA 5JIIA 2R2HA 1MVUA 1SM3L 2C5DC 3G5VB 3U7WL 1SMAA 4HAGA 3B6SB 5I30H 2PTTA 3UTSA 4RMWA 1PG7W 3O6KL 3HB3C 3KPRE 3ULVE 2UYLA 5ESQB 1PLGL 5CAYB 1QHPA 3W9DA 1INQA 3CDCA 5BZDB 5I8OH 5E94A 5IM7A 1KB9K 2R2EA 5DMKB 5F6HI 3LSOB 1KTDA 1NLDH 4WEBH 5IIEB 1AO7A 4LPYA 5IBTH 3IXAA 1KG0A 4QHKJ 1TZGL 2JE8A 4EI6A 2WWMC 4UOW1 4ODWB 3OKEA 3VFUB 2PW1B 5IMLA 2PW2B 5C07A 4OSUL 2ZUXA 5I1GL 1YEFL 2Q7NA 5SX5K 5L6YL 4M7KL 1PAMA 3QIWA 4ZPVA 5C0BA 5KSUB 3D1MC 1KENH 3W5NA 4NNXA 1BGXH 4QXGL 4JY6A 3I02A 3MR9B 1E4JA 3O45B 3MLTB 4LEXH 1AP2B 1NGXB 5DJ6B 1OGAD 1A4KB 3T4AA 5GQBA 4GH7B 3D25B 4NO0B 2IH1A 2VABB 3WUWA 1FYTA 5D4QA 4RMRA 2WUCL 1MUJA 5DUPL 1DJSA 3WFDL 2HRLA 2X6MA 1AD0A 3WHXA 5JXEC 1K8IA 1T04A 3PF2A 1L7IL 4Y16B 1HSBB 3CPLA 3E2HB 3VXRE 3MRBB 4HHAB 2VLJA 5E6ZA 4R8WH 1FGNL 3V5HB 4Y2DD 4HJJL 2F19H 2P5EB 1JN6B 4YHNA 2BDNL 3EO9H 5HVGB 3G6AA 4XWOD 1I3UA 3JWDL 1B0GB 5J4MA 3PWPE 2YC1B 5DJ0B 2YUXA 2EIDA 1U8QA 3QIUC 4NZUH 3VXSE 4JFZH 4N5ED 2GJZB 4ERSH 1A7QH 5EU3A 4OQ1A 3QFJB 1IAIM 2OQJB 4OD1L 4GOSA 4QT5A 5ALCH 4N0UB 1UXWB 2CKBA 4HWEL 1BOGB 4YHYB 1CGVA 4JJHA 4G6KH 1AQDB 3V9FA 4G9FE 3CZFB 3TYGL 2WLZA 2D03L 4F15C 5EC2A 5INDA 1CYGA 5EZLB 3RIFK 3SDXB 4BQCA 1Q0YH 1KN4L 4KRNA 2DS4A 3NA4A 3I2CL 1KIPB 1IEHA 1GH7A 5HYIA 2GAZA 1T4KA 5DJXB 1KJ2L 4H0HB 4F7CB 3HNVL 2MWCA 1RZJH 3GSNA 4ODSH 5CP7B 1KJMB 4XNQB 1I4FA 5GGTL 5CD3B 4OF0A 4UUJA 5TF1H 4OTXH 2BSED 2NY2D 3KPMA 1F4WL 4NZDA 5LAXA 4NFCA 4KZEL 2XKUA 4C83A 4R9HA 4Z7NF 3MLRL 4FABL 3TFKD 1G7IA 2F5AH 2IAMB 2FSEA 3ILQC 1GL4B 1JPST 3P9LB 3CD4A 4APQB 4DGVH 4XNMA 3ZTNL 3DGGB 1HOCB 5F7DB 4JZJA 2R2BB 3C6LB 5EOCH 4NNPL 3TO4D 2HT2C 5C08D 1VENA 3RJDA 3X11B 5D71L 1MWAL 2DYPB 2WK2A 5B39B 4TUJB 2ITCB 2HFTA 3AM8A 4HV8A 3KJ6H 3OGCB 3WN5B 4BZ2L 2DQUL 3ARDB 3INUL 5HPMB 3V6OC 4PTUA 1MCOH 1CLZL 3O41B 4YEFA 4KJPD 3PV6A 1MFEL 4NN7C 4P23D 1N7MH 4G7YH 4H88H 5DD1H 3RVUD 1Q0XH 3IJHB 4DJMA 3OAUL 4DUXA 3PWJB 3MRRA 1EHLH 1FL5B 4OZIA 3IS0X 3KXFA 5E8OB 2HTKD 3QUZB 1ED3B 1G0DA 5IVZB 5CD5D 4G6AD 4E41E 3BZFA 4GKOA 3MV8E 1C5BL 2MSPA 1MJJA 1SY6L 4JCMA 1VEOA 4NKDA 4UQ2B 4ZSOB 4UV7H 3AY4A 2Q6WB 2WBKA 3S8WA 2VL5B 5DFVD 5DJYB 4NKOB 3ARGA 4JN2B 3SE3C 4PREA 1UG9A 1GZPA 4XMKL 1Q8MA 4U1MA 1TZHB 4U0RC 3BHBB 2NY6C 1WZ1L 1DLHA 1TJGL 5B38G 1ZLSL 2YKLH 1FPTH 2O5ZL 1NBVH 4M3JA 4K7FA 3U7YL 4BKLB 4LMQE 4HFWB 2K1MA 1HKLL 5C0EA 2JJWA 1RQ5A 2XWTB 4ONFH 2OLDA 3ZKXC 2DIAA 4QRSA 4QHLA 5I8EA 1ONQB 5CCKH 1S9YB 5BS0A 2L0DA 4XPHL 2IFFH 3L5JA 4OFYD 3DUSA 4MAYA 3RWEB 3VD5A 2OXHA 3BZ4A 4YDJB 3H6JA 4GAGL 2AXFB 4IJ3B 2VR9A 5IFHL 3I84A 1S7UB 5A2JH 3V4PL 5MP6L 2Q76B 1ZK9A 4KKNA 4U6VH 1T21A 2DBJA 1GXEA 1BQHB 1MJ8L 4ONHB 4UBDD 5TQ2L 1HHIA 3BPNC 5DJ8B 4PG2A 3T3PF 4NZRH 2Y07H 2J8UE 4G43A 4U3XA 4WFFE 4QRPB 3QEUB 2R8SH 1G7QB 3MNZA 4P2OA 5CKGA 4BZ1H 1MCKA 1VGKA 3BH8B 2VDKH 3FQRA 4K3EL 3N0PB 4OLEA 1OP5K 1A14H 1BD2E 4NDMA 4HPOL 3QH3A 4JM4H 1OTTC 4HW6A 4FQJH 1EK3A 3PWUA 3VWJD 2AS5M 1FJ1B 3QBTB 5DGRA 4R0LC 4YDIH 1IGCH 2E5EA 1XF2A 4MJ2A 1S7XA 2X4RB 4YJZL 1U8JB 4Y5VB 5BW7A 5C2UB 1T0MB 5D1XB 4NYLA 5CJQL 3GMPA 1YYLL 2A6KA 2VDRL 3CVHB 5FYKL 1S9XA 2RBLA 5E6ID 2Z35B 1YN7A 5SV4A 4BK4A 1CLOL 4JFHD 3VFSA 3ZE2F 2BCKB 5FK9B 3BYTA 5CHNA 4ODHH 1HIML 5D2LE 1R5WA 5I18L 4TSAH 1LP9B 1OL0A 1MCCA 4L3CA 4JM2A 4RWYL 1A7BA 3QIBC 4WHCA 4KHXL 4ZDHA 4TUKH 5J6GB 2JB5L 1ORQA 2W9DH 3R06A 4Y1AA 5E70A 2BOBA 4Y4KA 4NIKB 3D6GA 2Q8BH 4G9DA 1JF1B 3CFBA 3MACL 2O5YL 4XAKE 4ZOBA 3ZE2E 1QLEL 1YEKL 3H9SB 4JLRA 5IVXB 3VMPA 1I3GH 1U8KA 4EDWL 2YA1A 5KSAC 5CILL 1HK6A 2FLRT 1FSKB 1SYSA 4AL8H 3MODL 5HHVL 1H3VA 5GS3A 4O9HL 2AQ2A 5SWSE 5KVMC 1BQLL 2XNAA 1MY7A 3LMJL 3BP5B 1G1CA 4LGPB 1G7JB 2ICWI 3EOAA 3RAJL 3IF1B 5ISZA 5ESVA 2QV2A 1SBBA 2OI9C 1M7IB 4WDIB 3ARTA 4GRMA 2AW2A 4DQOH 2XQBL 2CJUL 4ZD3L 1IKFL 1K6QL 1CGXA 4U1NA 2WQ8A 1G9EA 1EJOL 4X80H 5DURD 4PRPA 5ACZB 1XGPA 1FLRL 3OB0H 1J87A 3P30L 3OAZK 2ZSVB 2AVGA 2EE6A 3IDXL 1SBSL 3OG6B 1O5DT 2VH5H 3T3MF 4JGUA 4W6WB 3Q3GA 4NFBA 4HD9A 4JFYA 5F9JA 1TVHB 3WEXA 2C3VA 3CCHA 3DMMA 3H2WA 5DEGA 3HMXA 2ZOKB 2ADGA 1IT9L 5FO9B 4ZO7A 1A6ZA 1OSZB 3E6HB 1GC1H 1Q9WB 3OV6A 3CFCH 1FVEA 3BPOB 4NQED 3WFZA 2EC9T 4YDKL 2UZYB 4LSUH 3T3ME 4NQDA 1ODAA 1QSFA 1SVZA 3VE0B 2DJSA 5A16B 3SDDB 4EQ2A 5IR1B 4XP6L 1WK0A 2NX5D 4OZHA 3GSUA 4JO2H 2R4RH 15C8L 1IAII 5J13B 2VLKB 5KW9H 4L3EE 4HXBH 1ZS8A 4WO4A 3S37X 1C12B 3GBML 1D6EB 2H32B 3MREB 3H9YA 1DBKL 5FXCH 1T89C 1BX2A 1CICC 1UKQA 4YHIB 3UROR 2CH8A 1QNZH 2APTA 4WI6A 2O26U 4WUUB 4ZUVA 5C2BL 2ZUUA 3V6BR 4PRIE 3GSRB 4ETYA 1T83A 1BVKA 4LK4A 4O51B 1IAIH 3M8OH 4ISVA 4MNGB 1IAOA 5B38A 5LWYH 1ZANL 1F58H 1PYWB 5I74B 1MAKA 4KVCL 1HILA 1I9JL 1MREH 1AGCB 3S36L 3Q6GH 2NY4B 1C1EH 2DI7A 3NH7L 5BJTA 1WBZB 3PL6A 1UCBH 1R3JA 4ZQKB 3IDUA 5E5UB 1WGOA 4ODVH 1RZKL 2GJ6A 5BRZD 2E27H 1JK8B 1DCLA 4XNUL 3DRQB 3EOTL 1AFVH 2VAAA 3RDTC 3UPAA 2R39A 3BZDA 5CMAB 5FUZH 3UPCA 1MHHB 1U36A 3SQBA 1DQLL 1N64H 3VI3E 5ICXB 1T20B 3V5DB 4AH2B 2GUOB 3T2OA 4ZUUA 3F6IA 4PRBB 4W81A 3L6FB 3U4EB 1WAAF 3I6GA 2E8YA 3UJJH 1KPUB 1FNSH 3THMH 3W11C 3VWKD 4J3XA 3TV3L 2AEWA 2NY1C 2YD8A 4LPWA 5C0RL 4NQCA 4CU8A 1EJ6A 4KKCC 4CW1A 4YHLH 4M5YL 5ADPH 2ATPA 2X4UA 3VGHA 1NCTA 1QRNB 3B5GA 5D1QB 1P7QA 1EERB 2FD6H 4P5TD 3WDJA 3VXQB 3D2UA 4GRLD 1W72L 1W0WA 2EYRB 5KN5B 3WE6B 4BSVB 3KDMB 5CGYD 4P57A 1ZA6B 4HJGA 4QYOA 4S1SH 4MNQA 3TIDA 2DKSA 3WS6A 4ZFGH 3RZWA 4KZDL 1I1FA 4GRWE 3RWHB 4OD2B 4UB0H 1NBQA 1Z2KA 3L3KA 4PGCB 1HQ4B 4YHOH 3S96A 1A1OB 1P4LB 2VXQH 1DQMH 3RZCD 4OLWH 4V1DD 5JA9A 5IJVB 1F6LL 1XGUA 2W65B 2Q86B 1IVLA 5D7JD 5KVGH 3X3FL 4TQEL 2RFXB 2Q20A 3UTSD 3ZKQD 2FGWL 3MJ7B 3ARBA 4NHUB 5EIIB 3EGSA 5I0DA 4YAQB 4DVRH 3RY4A 1OGTA 4QRRB 1UM4H 2CIKA 1H3TA 1RURL 2J7LA 2CRMA 4L4TA 1IMHC 4DKDC 3TPUA 1NJ9B 3O81A 4HKBB 4RGMC 2A83B 4D94A 4FTVE 2A0LC 1BLNA 2FYYB 4PGDB 3MFFB 5C92A 1F2XK 4HGKC 1JPTH 2EDHA 5F6IB 3ULUC 5T3ZL 4FQ2H 4JAMB 5CEXA 3QIWD 4OLUL 4O2FB 1E6JL 2FEDC 3K8KA 3VFPA 5JW4N 4Z78B 4EOWL 4EI5C 1M6OB 1U95B 3UJIH 3W0WB 1A9EA 1DSFL 2GSIA 1HI6A 5I9QC 5HHME 2DLGA 3EW3B 2KBGA 1A3QA 3Q1SL 5DMJB 4PJEA 5J1AA 3SCMD 1A6WL 3D0VB 1LEKB 2WIIA 3SGEI 3C60A 3RGVA 1CT8B 4Y8DC 5DWUL 5D96B 3CDGA 3MXWH 4X98A 4LLDA 4GSDH 4GXVH 1NC2A 1HH6A 2VLJD 5T1KA 4FQLH 5C9JB 3SKMA 3U9PH 4GO6B 1BAFL 3G5XA 2NPLX 3IDJA 3OR7A 1CFNB 3PABB 4R4BA 1OP9A 5M94B 3TP4A 4PJ5A 2CO7B 4AEIL 1KEML 4CMMB 3FMGH 5HD8C 3FQWB 3NCYS 3SGEH 3QJHA 1IGFL 1WT5A 4L8CA 3RL2B 4U05A 3OQ3B 2X7LA 3LKPA 4K3JH 4DK3A 2VXTH 2APWA 3C09B 1HHHB 4NUGL 1BEYL 3RPIB 5CBAB 5I76A 3BD4A 3D5OF 4XZUA 2AK4B 3T0EC 2X4QA 5FGCB 4AYFA 3QRGL 1J1XL 2ICEA 4LSRL 3KLHD 5SWZE 4LLVA 5AZ2H 1DQDL 5JHDB 4ZS6D 3NZ8A 3LEXA 2YD4A 4Z0BH 4M1CD 4EBQH 2A74B 4MA1B 2W0LA 4OB5H 2A9NH 4N1CA 4PP2B 2ZPKL 2NZIA 2V2XA 4GAYB 4FG6C 4P9HC 3DUHA 4PJGB 4TSBL 2X4SA 4OFPA 2DBLH 1RIHL 2R56L 4BUHA 2XXMB 3T8XB 3KPRA 1KXQE 2DQGL 3O11A 4S10A 1QP1A 1GOGA 2PYED 3S97C 4I9WE 4HXAL 4LSSL 4WFGE 5T3ZE 1BM3L 2KL6A 5FEBA 3F7PC 2H9GB 4KK8C 1FNLA 5BVJB 1C16A 1EO8L 4KI5D 1K2DB 3UPRA 2WM0A 4DFHA 3AUVA 1PD6A 3D3VD 4I2XA 4URTB 1A3RH 1H3UA 4Z77A 1NBZA 5D8JH 4L5FL 1ZKAA 4PGEA 3EJYC 4M4PA 4Y5YC 2C7UA 4JQXC 3BKCL 4LDOB 1JI1A 2CKBH 2HKHH 3E8UH 2IANB 2K3TA 3F7QA 4OGAC 1KPRB 3I3DA 4U1GB 2XRAL 3BQUC 4BJLA 5HDOA 2VE6A 4X4XB 4RGND 3P4NB 4RX4A 4WI2A 1BZQK 4Q6IA 3VFRB 4NCC1 2D9QB 3VXRA 1KGCE 4YIQA 2YXFA 2OJZH 5AWNH 2I27N 4JFDB 4PRAA 3MBXH 1XIWB 3WNLA 2XA3A 3CDYA 1XCQA 1JHLH 4P59L 2X4OB 4X99B 4UOJA 5FHBL 5DT1L 4JPIB 2HLAB 3PWPA 2DDQH 2HJKB 3R1GL 3MCLL 3VXSA 3KPOA 1L0YA 4QNPF 1R3LB 1II4E 5C0NC 1BZ7B 3ZE0F 1YEEL 1MAML 3TBWA 1NGQL 2IFGA 4MJ5A 3KXFD 5DF0A 3HRPA 5DJ2B 4G6FB 2B1HL 4M7JH 5E9DD 4LKXA 5L9DH 2YBRB 5HPOA 3PGFL 1LE9A 3MROB 5JW5B 5SX4H 4BQ8A 1QLFB 4G9FA 1T3FB 1YEIH 2JELH 2JJUA 1VESA 3DTXA 1AIFA 2UZXB 3GSVB 3I50H 1P5VA 4QNPE 3ARGD 3ZE0E 4XVSH 1L7TL 3QNZB 2HJLA 5F7FA 5IUSA 1R3KB 3GSWA 4JFOA 4JKWA 2OYPA 1OW0A 2HYMA 1M7XA 3HPLB 3MCKA 1EXUB 1CXFA 2YD9A 4C58B 2FX9H 1ND0B 2EEBA 3QP3A 5A2KH 5IV2B 4P4RA 1JNLH 3OBAA 3WIFA 1MCWM 4F15B 2UUDH 4OKVB 4F9LA 1O7SA 3MRJB 1NUDA 1S78D 3ARPA 2M2DA 5GRJH 1FO0H 4MQXD 1GJIA 2P5EE 3WL9A 4NO5B 3ULSA 1JZ5A 3VJ6B 1KLGA 3IDMA 2FL5A 5DQJB 2OP4H 5BS0D 1OOAA 5IW1A 5L2KB 2P5WB 3QG6A 4CN6A 2WNGA 1T1XA 3KPQA 2A73B 1BQUA 3HAEB 5IKCA 1JGUH 3FO9A 5EIVA 1M71A 3KHOA 3EOBA 4CADA 1JV5A 3QEQE 2COQA 2ZP0T 3BRGC 3ZHLA 4LHUD 2Q87A 3WBDA 3GI8L 3LEYH 5D2NC 1TVDA 3MRFA 1JWSB 2BVOB 1IFHH 2CO6B 2A1WH 5DS8A 1IGMH 2YRPA 4UT6L 3S35L 3O6ML 1FRGL 4X8XA 5AYUH 5JDJA 3FOMB 3KYKL 4C57C 5C8JA 4P2OD 3CLFL 3QAZC 2XYCA 2FBJL 2BVQA 3QQ4A 4JG1L 3CXHK 5D6DA 3QDMB 4Q9RL 5IT2H 2J88H 4L4JA 4ZPTA 5IWLA 4KROB 4D0BB 3VFTB 1HSAB 1I8MA 2GITA 1K3ZA 5D5MF 1LEIB 5H94A 3O3AB 1Z9LA 2CLVA 3WV0A 1DR9A 1D9KC 1C5DB 1A6UH 1HXYA 1CK0L 4P46C 3QO0A 4X4YA 1DVFA 3HE6C 1B0RB 3SDAA 5GS0D 3RRQA 1N5AA 4L29B 2BNRB 3BEVB 4NN7B 1CQYA 4GW5B 4E41A 1H3GA 3MV11 3VXNB 5ID1A 2AABH 3MV8A 4GQPH 4JM2D 3TBYB 5DHYB 3EJZD 2WINB 2CLRA 1RVFL 4IMLA 1MHCB 1TVBA 2R1WB 1RHHB 4ELKB 4ODTL 1KJ2A 3EO0B 1MAJA 5FF6A 2BRRL 1N2RB 2Z91B 5GGTA 2VLLB 3L3JB 4DN4L 1G9NH 4FQIH 1FGVH 3D39B 1OM3H 3UBXB 4FXKB 4CDHA 2DLHA 1S9VB 4X4MA 1U8OB 2R23A 3LEVL 1RHFA 5BCAA 1EFXA 3ETBF 5J9PB 3PP4L 2NY6B 4Y4HA 4S1QH 5C6TH 3GI9L 1A22B 3BP6B 5F96L 5K9KB 4XCNB 5ISZD 4PJ9C 5DSCA 4HKJB 5DRWB 4YQXH 3REVA 5J1SC 1I1YA 2XZQL 3QJFB 3EDJA 4NT6B 2K7QA 2VXSH 4EXKA 4R26H 3SOBH 1QKZL 1IAMA 3CLEL 3KYOA 3EDKA 3ZKXB 5GS0H 4PRPD 4E9LA 2UWEB 1S5HB 1J7VR 2CMRL 4MAUL 4XPAH 3P40A 4G42A 1MCLA 3B2UC 4H1LH 4KK9C 1MFCL 1NMBL 3K7UA 1KEGH 4D9LH 1CVSC 1V7NL 3QI9A 4XBGB 1RI8A 1MHPL 5MERB 4HIXH 3DWTA 4QRQA 4I3GA 3ZSSA 4RZCA 5TDPA 1BD2A 5HVHC 4KMQA 3WFBH 1F4XL 4J3UA 3BPNB 3ZZ1A 4NQDD 1QSFD 3VXOB 4JHBA 5TQ0H 1MH5B 4R96A 3A67L 3GIZH 3T08A 3MRCB 3MJ9H 5I17A 3AFLA 3KS0H 1N5YL 1I7ZA 4WNQB 4FQCL 2P8MB 4M6OH 1D3CA 4HUXB 4XI5D 5ERWB 4OIIH 3UTPE 1HHKA 5HHPB 3N9GL 3VFNB 5C0CB 1C7SA 4J4PA 1ZT7A 3KYMA 4PLJD 1FDLH 3LZFH 1SY6A 3DROA 1BHGA 5INCB 3OR6B 2OJEB 1T66C 5DC4B 1P4BH 5D2LA 1JTOA 4OIAA 2P8LB 1P1ZA 1Z3GL 5DC0A 4A6YB 4BFIB 2XIDA 2B20A 3QDGB 1YNKH 2DQDH 4AG4L 2G75A 4PJDB 4PJIF 5JIHA 3MLVH 3KPSD 3WD5H 3HMXH 1MCIA 3PL6D 5D7SL 4PV8A 3CSPA 1RAMA 5CIPH 1NAMA 4LRIC 1MIMH 4JFFD 1TXKA 4WW2B 1JZ6A 4XVJH 2GJ6D 4OCYH 1OLLA 3QDJB 1H9VA 3B5HA 4Z76B 1B6DA 1LO3H 1FN4A 3IS1X 5SWSA 3JSSA 3BXNB 5HI4C 4ZS7H 2YPKB 1ADQH 1NCWH 4NZTH 1CL7I 5DI8A 1MFBH 4G3YH 2MCG1 3C5JB 3FO0L 3O2WH 4I77L 5KSAB 1NFDB 1MFAL 1UM5L 4HWBL 5E03A 4DTGH 2HN7A 3TO2B 1MQKL 2C1OA 5F8RC 3OKYA 1BIIB 4L4VB 4R7NA 1DUZA 4Q9CA 4LSQH 3WFCH 3DO7B 2SEBA 2HWZL 5JW4Q 2ORBL 2NW2B 4M8QA 4OKDA 2OI9B 3VFMB 1LP9E 3AAZB 1CL7H 4XCFL 5I2IA 3QA3A 4HK0B 4Y2DC 4YGVB 4K7PL 3O3UN 2WBWB 3BVNA 5CJXA 4XWOC 2ZUYA 3C08H 4XVTL 1AGFA 1UEYA 2PR4L 3D2UD 4P49A 4PJFF 5EUOF 4NM4H 5I73B 1CXKA 5IVXE 1REIA 4N5EC 4LVHB 4P3CL 4HS3B 2Z92B 4YX2L 5C0AD 4OLXH 2P8PA 5E5MB 1FAKT 4L3EA 4Z7VB 4PBWD 1A7NL 1H5BC 4KHTH 3BRDA 3QUMB 3OJDA 2YWYA 5T1MA 3PV7A 5CSBA 5EUOE 4EUPH 3DIFA 1A3LL 5F9DC 4I0CC 4PRIA 2JIXB 1TQCB 2WUBL 3NTCL 4G80A 3UZQA 3VGBA 1G1YA 5CEYB 1CWVA 2CR3A 3ARBD 1S8DB 5E8EA 3SE4A 1NCUA 4GFTB 4QGTA 5GSRB 1JHTB 3MV7D 1EHAA 4JVWA 1CICB 2AEQL 2ESVE 3FFCB 3P11L 4FFWD 5TJWK 1LO2H 2D4FA 3CFJA 3TEUA 4JHAH 3CXDL 3QG7H 4L4TD 4KUCF 5BQ7A 1RY7B 5D72L 2AJVL 4JKKA 1U91B 4XPBH 1NFKA 3DXAB 3IU3B 3DVFA 2YPLB 3GJFB 1TZIB 4KDTC 4ZFOB 1MLBA 1JRHH 4MJ6B 3I9GL 1ZVSA 4OI9A 4WU5A 2HMID 1ZA3A 3HZMB 1HHGA 1YMMA 5EH1A 4AEHL 4IRJB 4KMTH 1QSEB 1MOEA 5LBSH 4NN5C 3ZT7A 2IQ9L 1UKSA 4MWFB 1RK1A 1MPAL 2JB6B 1I7TA 3G6JF 3OKDA 4QF1A 5GGUA 1CGUA 3BX7C 3F58L 1MFDL 4HDIB 1CU4L 3ZO0A 1FV1A 2LV4A 2Y72A 3NVQA 2VLKE 4OZGF 4FOMA 4LCYA 1YDPB 3QCUH 3MRKA 4GUPB 4K9EL 3GMOA 1T22B 2MMXA 4S2SB 4Y0GA 2AI0L 1N0LA 4HPYH 5DJCA 5D1ZA 1Z5LA 2QHLA 4FXGB 4XAWL 5KVDH 1MCQA 2DTML 3C8KA 4LCWE 3G6JE 1VPOH 3QEHA 2PETA 5H2BA 3TYFB 3BWAB 5GRZA 8FABA 3CNKA 4OZGE 3H3KA 3OWEA 5JLZA 4MNGE 3MV9B 2D7MA 4PJ5D 1VKXB 4J3TA 2NCMA 1P84J 4HFUL 5CEZD 4WCYH 4JRXA 2EDJA 3H42L 4YHPA 5J12B 1T1WB 3QNXB 3F62A 4XPFH 2OTUA 4N68A 3UJTL 2R0KH 2W59A 5F89A 4OF5A 1JWMB 3T0BA 1WAAA 4IM8A 4YBQD 2NY1B 5LG1A 1FL6A 3GK8L 4OIBA 3F5WB 3PDOB 4QHUA 5FKAB 3RVUC 1EBAA 4JREC 4LQFH 3IVKA 2FWOA 4I18C 3Q6FA 4OZFH 5C09B 1ZWIA 4FQPA 2AXJA 4P5KB 1I9RL 2ZUSA 5CD5C 4G6AC 4FRWA 2EDNA 1XR8A 4M43L 5IEKB 3L7EB 4FQXA 1BQSA 2NZ9C 4K8RD 3JTSA 5GHWL 4S0TD 3ZT5A 2YD6A 4QWWD 1CD0A 4DGIL 2YRLA 3LV3B 2BSSB 3JWOH 5FGBA 1J0ZA 1HINH 3GMMB 3Q0HA 4WIQA 4BH8B 5I30L 3HNTH 3VA2C 4LF3A 4DKAA 5D6CA 4NQSA 3P73A 4F7TA 3PDGA 1DQQA 3L1OH 5JZ7D 5I8OL 4LLQA 5DRXA 4UQ3B 4Q58C 2NNAA 2XN9D 1NLDL 4WEBL 5IBTL 5CEZH 1KNOB 4JRWA 3TH2T 4JDTH 3IDGA 2QQLH 2A6IA 4NKIH 2VIRA 4JJ5B 2AV1A 1QRNE 3G5ZA 1CDCA 6FABH 1IBGH 1NCBH 2D7OA 5ENWB 1KENL 3HCVB 1QA9A 5IHBA 1BGXL 4RGMB 4V2CB 1MHEA 3U46B 2RHEA 4LEXL 5HHQA 3KLSA 1LD9A 1MCWW 5C86A 1TJIH 4CVWA 4P4KD 4U1HB 4G8EB 1EVUA 1U58A 5FGRA 3UTTB 1I1AB 1UEMA 3H8NA 4UBDC 1JPFB 4DFIA 5AG9A 1N0XH 2C3WA 4OF7A 4EI5B 4K8RH 3TVMA 3STZA 5DMGC 2BSTB 3VXRD 1AKJA 1D5MB 3X3GH 2D31A 5I9QB 1PDKA 3PXHA 3BN3B 5DA0B 5J57B 4R8WL 3O8XA 3G6DH 2X70B 5KANI 3O4LB 4N0RA 4LLYB 1VGEH 2F19L 3VWJC 2DQFA 3EO9L 1W72A 2EDRA 3U6RA 3MXVH 2P49B 5BZWA 1LE5A 3PWPD 1FCGA 5DYOA 4JFEB 5L7XH 4WV1A 4WRLA 3VXSD 1P4IH 4NZUL 4G8GE 3TNNA 4KGJA 4JFZL 1X9QA 5EUKB 4ERSL 3SDCB 1A7QL 4BUGA 2P24B 5T1DH 2ATKB 5E6IC 3WFEH 5SWZA 2QSTA 5ALCL 3KPNA 32C2A 4M48H 5LCVH 4MDJB 2N1KA 4G6KL 4G9FD 1RZ8B 1QBMH 3W0WE 5I75C 2RGSA 3T0EB 4HC1H 4M1DH 4CVXB 4QEGA 3BD3A 3QZWB 4QOKB 5I1EH 1Q0YL 1U8HA 3K4ZA 1I9EA 2IPTH 3OKMA 3QHFH 4EEEA 1QR4A 3I6KA 1QBAA 4OCMC 5ETUB 2GI7A 3MLUH 2R69H 1HH9A 3RA7H 1RZJL 1XMWA 4YR6A 1JTPA 1CDYA 3MRIB 3OXRA 3ZDXF 4MA7H 3O9WB 3OKLB 2ZUWA 3VXME 5B39G 3FT3A 4R0LA 4YWGH 4LAJH 5TF1L 3LD8B 1NBYA 5C6WH 4X5XA 1MIEH 1EDQA 3V6ZB 4HKXB 3MYZA 2CLZB 2E6JA 5C0GA 4PS4H 2PN5A 1CDHA 4S1DD 3BIBX 1INDH 1UB5B 2F5AL 4RFNC 2EH7H 5ALBH 4RNRA 3IT8D 3M1BA 3MO1A 1XGRB 5FGCE 5EN2B 3ZDXE 4Q2ZB 4DGVL 5E1AA 2ZUQC 2ZSWA 5JHDE 3SGJA 2QKIA 1M4KA 3EFFB 5EOCL 1AR1D 1KB5B 4XHQA 5T3XH 1FCCA 5FDWA 4J3VA 2XKSA 2EXYC 4J1UA 2F54D 5FO8A 5F8QC 5F7HA 1GZQB 4DUVA 4PJGE 4U1SA 1GRWA 3B9KB 3B6SA 1FH5H 3KJ6L 3L95A 4X0KB 2BP3A 4QRTB 3FRPG 3AC0A 1JPGB 5FECB 3BQUB 1PQZB 2JJTA 3RHWF 3VMOA 3FT2A 5ESQA 1MCOL 1IGYB 2V7HB 1K8DA 1CN4A 1F4HA 1KCLA 1U93A 3RIAK 4JG0H 3VXUA 1N7ML 4JRYD 1NCAH 4OQTL 2WAHA 4G7YL 4H88L 4ESKA 5DD1L 1Q0XL 3HZYA 4YO0A 3SDAD 1LO0H 4YPJA 2Z93B 2PW1A 2VZOA 2PW2A 1EHLL 3GJFK 4ODXA 1JFQH 5HDLA 3MTRA 1BFSA 3MV01 4QHMB 3BD5A 3EOYG 5KSUA 4E41D 1T03H 3PIQA 3MV8D 3FAXA 3MR9A 3O45A 1IC1A 1MI5B 4UV7L 2IANE 3FOLB 1IAKA 3DX9A 5IB1B 1ZTXH 4JZNA 5ITFB 5MEQB 1HE7A 3C8DA 2AK1H 4UDTB 2NW3B 1HSBA 2R1XB 3RWDB 5IGXH 2YKLL 4HHAA 1FPTL 3BN9C 1T5WA 5IVOA 3HPJB 4WJ5B 1NBVL 5F7MC 5F1IA 1DLFH 4YFLI 4LLWA 1EFXD 2P5EA 4MXQD 1NUNB 2CDFB 5BV7C 4ONFL 1NQBA 3DYOA 4Y4HD 5CCKL 4CNIA 2IFFL 2FJGB 1K85A 5KOVC 2YC1A 1VFAB 4L9LC 4OFKA 1Q1JH 3BP7A 3QEQA 2DI8A 1RJLB 4FQQA 5GIRB 1AY1H 2X1PA 3MLYH 3HR6A 4NP4H 5E0QA 4U6VL 4W4OC 3ORJA 1UXWA 5IMOA 1R0AH 3JV6B 4UILH 3Q2CA 1K4CA 4HS8H 3VA6A 4WFFD 3SKNB 4NZRL 2P1YA 2Y07L 3VGDA 2BHZA 2R8SL 4JFQB 3QI9D 3L5WA 3RVWD 3DI2B 2FR4A 5EZJB 4NO3B 4XC3H 2UZIH 3OXSA 5DTFB 4BZ1L 4RSVA 4C56E 5DVKA 2VDKL 1U8LA 1N8ZA 4KGLA 4YBLC 3RTQC 4U6YA 3TIEA 1A14L 4JDVA 4JM4L 4JDZB 2HFEA 3F7VA 4FQJL 4P5TC 4GG6F 1KIPA 2YD2A 1M7DA 3MA9H 2BY1A 2DJ4A 4YDIL 1F4AA 1IGCL 3KG5A 1UWXH 4AEFA 2NY3B 1HWGB 2QQNH 2MKWA 4E0RB 3GKWH 2E7LC 3PWLB 3QXTA 2GJJA 4NC0B 2PXYB 4GW1B 4J4PD 4LVNC 4H1LB 5L2KE 2DM7A 2NLJB 4GG6E 1B6UA 5JORB 1TITA 4BFGA 3RZCC 3EZJB 4OJFH 1ZVYA 4ODHL 4D0CB 4RA0C 4X6BA 1BBJB 2R15A 1NC4B 2NTFA 4TSAL 1JMZA 2IAMA 2OR7A 5D5MA 3HC0B 4TUKL 3HE6B 3QQ3B 5GRVL 2W9DL 5KBNC 3ZYOA 4APQA 2MPAH 3DGGA 4Q9QH 1HOCA 3BO8B 1NAKH 2Q8BL 4R6UA 2BSRB 4DKFL 1JP5A 3FN3A 3G08B 5B39A 4TVPE 5DUMH 2MQCA 5DLMH 3U82B 4MHHI 4HS6A 1I3GL 4OUOA 3V79C 4LCCA 4PJBB 3HZKA 5HGHB 5K33A 3O3DB 2EDBA 4AL8L 2HKFH 2EE2A 2Z31D 4NN6B 5SWSD 3V52H 3RUGF 3QIWC 5JO5A 3HHRB 3QDME 4U6HB 3HNSH 3ARDA 5EU4B 2ITDB 3K8MA 3O41A 3PXJA 1XR9A 2KUTA 3LN4A 4M62H 4HH9A 1CGWA 3GDBA 4MJIB 1V8HA 4AIZB 4DQOL 3SCMC 1F02I 5AUMB 4EDXB 2WIMA 4KKBD 1FL5A 1PKOA 3QUZA 2Z4QA 3L3IB 4JPVH 4JZOA 2VH5L 3O3EA 4PJ9B 4XBPB 2C9AA 3GSQB 1YJDC 4YXHH 2VNCA 3QUXB 3KWWB 1K5NB 4AM0B 3FRPA 1HQRB 1TCRB 3VFVA 4JN2A 5IJKA 3RQ3A 1T7ZA 2VITA 4BQBA 4RMVA 1GC1L 3U2SA 4R4FH 2VSDA 3ZSTA 3CFCL 2EIZA 1SVCP 5KSBB 1U9KA 4LSUL 2BC4B 1NAMH 1JE6A 3ZT6A 1VERA 1H8NA 3ARSA 2OR9H 3D39E 4JO2L 1WZKA 2R4RL 3RWJA 7FABH 1ITBB 3D0LA 4ODUB 4L3ED 1FFOA 3FB5A 4LCIH 1SJXA 3EYOB 3PWNB 2VDPH 4HXBL 5KW9L 1MCEA 4HFWA 3MUGA 2XWTA 4ZS6C 4OF6A 1ONQA 2FBOJ 3QYCA 4WGWB 4B7IA 1A2YA 4M1CC 3STLB 1MJUH 3QCTH 5ANMB 4NRZB 3CU1A 4LPUA 3UEZA 4YDJA 1QNZL 3IGAB 1GPOH 1AH1A 1F6AA 2XPGB 2LQRA 4PRID 3TJHD 1XGTA 3U0PB 1IAIL 2UWEE 4CJ0A 2G9HA 3M8OL 3BPCB 3RGHA 4FMFA 5LWYL 2RIKA 4LGRB 1I8IB 1F58L 3O3BA 1G7HB 5DJ8A 1MREL 1J05B 3Q6GL 4TTDD 1C1EL 3QEUA 4DOHB 3MBED 2XKNB 3UAJD 3WS3B 1UCBL 5C0DB 3L5XH 3WLWD 4UNVA 4KI5C 2YUZA 3MYJB 5ECJE 3ZYZA 1A7OH 4ODVL 2E27L 3EDDA 4AQ1B 4OLVH 3WSQH 4O5LH 1FJ1A 2Y06H 1AFVL 3O2VH 4WI3A 4PJIA 1E4XI 1T0NA 1TTFA 3DVGA 3VFWB 5FUZL 1IC7H 1DANT 4WGVB 1N64L 5IG7B 4JZJC 1N26A 1J1OH 5C0CE 3CVHA 4NQXB 1BMGA 1X6LA 4P0DA 4F7PA 3S4SB 3E6FB 1JGEB 1RUPH 1BP3B 4RGNC 4W4NA 1V7MH 4E42A 4HJ0D 2ENSA 3VD4A 3AM8C 2BMKB 4JGMA 1E4XH 1BWMA 3OKKA 1CTOA 4QLRA 3HI1A 1FNSL 3FQUB 1J8HB 1LP9A 4WUKH 3THML 4KJWC 4RMSA 4X6DB 4WI4A 4DN3H 4WW2F 1OT2A 2YZ8A 4XMLH 2Y7QB 5LQBH 2AXGA 4FQ1H 4WWKD 4YHLL 5ADPL 2UY7A 2Y23A 4PJDE 3RBGA 2QL1A 3SEPA 2YUWA 2FD6L 4Y88A 1AGDB 3KR3L 3MRNA 1GGCH 2FH8A 1EA9C 3DETD 3QNYB 1IRAY 4IRSD 1IGTB 2H8PB 1S9WA 1R5IA 2HG5B 4I0PD 4QXTB 1NCCH 2HAZA 4I3SH 4S1SL 2OZ4H 4U6XB 4FQHA 3QDJE 5EU7C 4GAJH 1B4JH 4ZFGL 3ZTJG 4UB0L 2CIIA 4GXUM 1FC1A 3HRZB 3VXPB 3BP5A 1CD1B 4M7LH 4PG9A 4YHOL 2VXQL 1DQML 3IF1A 5F9AC 2E6PA 4OLWL 4PJFA 5EUOA 3AY4C 1CQKA 1M7IA 2APXA 4LPCA 1YPZB 2AV7B 4OBSA 3ARGC 1J18A 5CS7A 5KVGL 4H8WC 4NO2B 1ZHBA 4YEEA 5FUCC 2H1PH 4F3FA 4Z6AT 5E2WH 5I1AB 1CDBA 4DVRL 4F2MB 1UM4L 2ESVA 1U8PB 4R2GD 4KRMB 3GM8A 2LU4A 2HRPH 4OFDA 1S78C 4FTVD 4NQEE 3GIVB 4D3CH 1ORSB 4CL7A 5F97E 4W70A 1AJ7H 4Z7VF 2ZOKA 4D8PB 4J6RH 1QYGH 1JPTL 2NX5E 4HAFA 3MGOA 4XHJC 1KIRB 4HT1H 4FNLH 1EEQA 4FQ2L 1I9IH 2APBA 1LEGB 4I8DA 4HWBA 4OI8A 5DDHB 1QHOA 3UJIL 3ALWA 3CK0H 1Q94B 5HHMD 4PY7A 4GRWH 3O6FB 4JO3H 4Z7VE 4WI7A 1K4DA 5C0IA 2YN5A 1JNNH 1B9ZA 4GW4B 1ZHLB 4PG2C 2FJHA 3A6BH 3MXWL 3T65A 4YHIA 3TVMD 4JR9H 3BYYA 4UDUB 4GSDL 4LCWA 3G6JA 4PLKD 4P2OC 4GXVL 1LWRA 4NPYA 3T0DA 4E5XB 3U9PL 3GSRA 5DJZB 4LLUA 4OZGA 3T0WA 5DZOA 4MNGA 4ZO6A 1QVOB 1X5KA 2JK5A 3TBVB 3FMGL 3HZVB 2BX5A 1QLRB 1PZ5B 2DQHH 5ELIA 3K1DA 2X40A 3SGDI 5ILTH 3P9MA 1H8SA 5BW7C 3MSPA 4K3JL 5JPNB 3DXAE 4X6CB 2VXTL 2VLRD 2YPLE 4MA8H 43C9A 4HWUA 5M7QA 4HWZB 3F65A 4MNHA 2XQYG 5SWZD 4CN1A 3PGCB 5AZ2L 3UYRH 3DRQA 4KRPC 4MA3A 3TC9A 5CP3A 4HCRH 4N9OB 1T7XA 4Z0BL 4JM2C 4EBQL 4OB5L 3SGDH 1FVDA 5D2NA 2A9NL 1CFTA 4JY4B 4JREB 4I18B 3LIZH 4EZMA 2GFBB 4KU1A 2GCYA 4Y4KC 1CDJA 2A6JB 5DRZB 4M7ZB 1TIUA 4AH2A 1FZJA 5KS9F 3FKUS 2DBLL 3WIHH 4F9PC 5DVLA 2CK2A 2RCSH 1IQWH 1KPUA 4L1DA 3IAGC 3EJJX 4I9WD 5T3ZD 3ZLQC 3MV9E 4P2YA 4JHWH 3K80A 1CLYH 4ZUTA 3VGEA 1QRNA 1AGEB 4OM1H 3FB7B 1NANH 4HIIA 2X5PA 5HGBB 3SJVA 4N1EA 3QULA 4RGOH 5K9OB 1A3RL 1JHKL 4BSVA 4XNZC 1OLZA 5D8JL 5HGAB 2OSLB 1CDIA 3JV5A 1RUAH 2CSPA 4MJ4A 4LPTA 3HS0B 1Z9SA 1D5BB 1LO5A 5HXMA 2CKBL 5IESH 4X8JB 5TDNB 2HKHL 3E8UL 4LPVA 4UTBH 1CS6A 5HTSA 2QR0B 4PGCA 4ZFZB 1RMFH 3FRUB 3V0WH 2IPUK 1ETZB 3IFLH 3QWOA 5IFAH 4BSJA 4XCYB 3DMMC 4PB9H 5IJVA 1KGCD 3RU8H 3GMRB 3EYVA 2OJZL 5HDQH 4QHNA 4LRNH 5AWNL 3BGFC 3MBXL 1JHLL 2RFXA 1UVQA 2EDTA 4NHUA 5EIIA 4WW1B 1NDGA 1UJTA 5DZLA 5IB5A 1XFPA 2W0FB 2ZJSH 3DVIA 4NM8H 1RIVH 4F8QA 2D7TH 2DDQL 4WO4C 1KOAA 4G8GA 4DGYH 1TLKA 5EU5B 3PDDA 5FYJD 3SKOB 3FB8A 5HYJB 4MMXC 4PGDA 1F4YH 1LK2A 4Q6YA 4ZODA 2VLME 4PLJC 2V2WB 1U8NB 2IBZY 3OF6A 5HJ3B 4M7JL 5L9DL 5J7CC 4Z78A 1T83C 3KYAA 1M6OA 3C5ZA 1OP3H 1HYSD 1YEIL 1U95A 1A8JH 2JELL 4ORGB 2X1WL 2ARJQ 2VUYA 1T5XA 1WWAX 4H26A 3I50L 3MFGB 3EFDH 4KAQH 4XVSL 3QO1A 1N3NB 1GGIH 4NRYA 1FG2B 5GRWA 1CT8A 4AEEA 2IQAA 3AVEA 3DO3A 4GQ9H 1OP5H 2NYYD 1UQSA 1F8TH 1PBYA 4Y16D 1NKOA 1MCBA 4XH2B 3OX8B 5I75B 5CJ5A 2FX9L 3PL6C 4NRXB 3ARVA 4FZEH 2EECA 1JNLL 1ZT4A 3W39B 5C9JA 2VZ3A 1IEAB 3O4LE 3GZKA 5FAAA 2P5ED 4HX1A 1FO0L 4KQ4H 5GRJL 5AAWA 5I1KH 3PABA 3RHWK 4NHCH 3VXMA 4BFEA 3VDBA 3FQTA 1OQXA 5EA0H 4LCUB 2OP4L 4OCXH 3FQWA 1J8KA 3MA7A 2BY2A 5KVEH 3NA9H 1KELH 2VC2H 4N8VB