1M71B

Crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
220
structure length
220
Chain Sequence
EVKVEESGGGLVQPGGSMKLSCVASGFTFSNYWMEWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTRGGAVGAMDYWGQGTSVTVSSATTTAPSVYPLVPGCSDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKVDLIKEPSGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Recognition of Oligosaccharide Epitopes by a Monoclonal Fab Specific for Shigella flexneri Y Lipopolysaccharide: X-ray Structures and Thermodyanamics
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords light chain of the monoclonal antibody Fab SYA/J6
total genus 34
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1m71B01
2OZ4L 5E8NA 2I60H 5ADPL 3VFTA 2FJHB 5DK0A 3UZVB 1MCWW 3O6KL 1MH5B 4U6TA 3ZKXB 4R96A 4RMSA 4S1RH 2RFXB 1S9YA 5FB8A 1G6RL 1W0VB 3RDTD 1WLHA 1DUYA 5DHYB 1N2RB 1C1EH 2IH1B 2MQ3A 3GMOB 4YGVB 1AXTL 1MQKL 2HKHL 2ITCA 3QFJB 2C1OA 4PJFA 2D9CA 4PJXF 5IB2A 1A7PH 2O93L 3HR5A 2Y7QA 4P4KC 1CE6A 1IGJB 1JPSL 2K7QA 4KMLB 4RBPK 4Z7WB 3RVTC 3MLZL 3VW3L 3MRJA 3ARBC 3S37L 2DQDL 3T3MF 4MNHB 3DI3B 4WO4D 2EC9U 2D7QA 5I18H 3ZKSD 1FIGL 1UM5L 3ARBB 1S7WB 2DM7A 2BX5A 1QSFA 4LPTA 2HT2D 1HQ4B 5DEGB 1S7VB 4ZFGL 3GSVB 1MNUL 3MRRA 1V5JA 5E08L 2OL3H 4EIZC 3U9UA 4XPHH 25C8L 2HAZA 5INDB 1JNNL 1CWVA 4WHYH 1RZ7L 4XMPL 3W39B 2G9HB 1IM3A 4HCRA 4X9BA 2EYRA 3N1GC 3LIZL 1P6AB 1ZT1B 3WIHL 1NFDA 3G6DL 1CXHA 4TVPE 3E8UL 2FCBA 4PB0H 2W59A 4GMSH 4U7SA 1A47A 1QVOB 1F00I 1UFUA 4I9WE 4Y5XA 4L3AA 3EYVB 2C3VA 3EHBC 5FK9A 3VFOB 1WK0A 1YEFH 1NBYB 1EA9C 1S7QA 1U3YA 4N8VA 2P7TA 4FFYH 1LEIB 1T89C 3DV6A 1VESA 2P5EB 3JWDL 1UKTA 3D1MC 4ZFZB 2KZWA 1EVUA 4Y16D 4UAOC 4YPGA 5CSZA 5D7IF 5IBTH 3UJTH 3QPQC 1UZ6F 3BEVB 3TESA 4D0CB 1R3IL 3EDFA 2IWGA 4Z0BL 4XVUD 2NY5H 3QIWD 1OM3L 2DQGL 5A40E 3OJDA 1FP5A 2Z93A 4GXVL 4IIQA 4M6NL 4HWBH 4X6CB 5KJRL 1XGYH 2VDRL 4M9OA 5J12C 4MNQD 3WNPA 4AT6A 1QFHA 4KK9C 3AREB 2XWBB 1H3TA 1WISA 2YPVL 2YBRB 1M7XA 3VGGA 1KB5L 3B9KB 4G8FA 5I30H 5DJ8B 3I75A 3OAYH 1A6ZA 3RAJL 1ETZB 3CXDH 5TFSL 4JANA 5T1LB 4DKDC 2AV1B 4BFBD 2EE3A 3LZFL 4K2UH 4XNMB 3NCCB 2IANA 5E2JA 3KNBB 3LKOA 1YEDB 1LP9B 3O4LB 2A77L 4YFLF 4ZO7A 5IB3A 3C8DA 4WHTA 4XCYA 3C09B 4OLZH 4FXLA 4OSUL 2EKJA 1B2WL 3D18B 5F1IB 3HN3A 1CTNA 4KROD 4L4TD 4XNUL 3RPKA 1ERNA 3GHBH 3HZYA 5DTFB 4AEIH 5JHDD 1INEH 1DQDH 2D7TH 4I0CC 4KUZH 1JNJA 1CXKA 5CD5C 5TQ2H 4LLDB 3WO3B 3V5KB 4R90H 3BP7A 3LEYH 3T0BA 5I76B 3GBMH 2AJYL 1UVQA 2IAND 2GK2A 2H32A 4BK4A 5IQ7L 1CVRA 2KQMA 3MO1B 3WE6A 1A9EA 2OX5A 3LKNB 5CZXC 4OZIE 4PJ8C 3BKCL 4JEGB 3ARDD 1UCBH 3RX7A 4JFDB 3NPZB 1BVKB 2CJUL 4G80A 4MJ6B 4GO6B 3BH9A 3GI9H 1HILB 2IPKB 2EDKA 3CAFA 1GOFA 3MUZ1 4PJXB 2P8MA 1CYGA 1EZVY 1W0WB 3RVWD 5JPMA 2N4IA 4RMUA 4AG4H 1J11A 1IM3B 4JFPB 4EQ3A 5C0BE 4OF7A 1XGPB 3CD4A 3P11H 3MQIA 1A6PA 3UBXB 1DBAL 2GSGB 2CK0H 3EOBA 2FYYB 1PKQA 5BVJB 1NMBH 1KJ2H 2YPKA 4OF3A 3SOBH 5C0EB 5F7EL 3M45A 4U31A 3RTQA 1S7VA 3IDYC 1QACA 5JQ6H 4IEFB 4J1UA 2PO6C 3MOAH 5KSAC 2VXQL 1T6VN 1R5WB 3CMGA 1YY8B 1XF4B 3PWPE 4HH9B 4HIXH 4HUMB 1FO0H 2VLLB 5HD8D 1HYSD 2VITB 4HIEB 4NNYB 1G6RB 3B2VH 3BZ4B 4N90E 3QUXB 3HZMB 3GI8L 5T3ZE 3D39A 1GC1L 4Y88A 4JM4H 2XN9A 5E5MB 3UYOD 3K1DA 4JFFE 1DE4B 1FL6A 2ED9A 2ZCHH 3BEWA 3ALPA 2VNCA 2X4RA 2BSED 1JMXA 1JGEB 2KQNA 4HC1L 5GS1A 3U30C 2ESVE 2DICA 1QSEB 1VFBA 5M95B 1N7ML 4LPYA 3R06B 4L8BB 4P59H 3C5ZD 1WFNA 3LKQB 4OV6F 3SDXB 4EI6B 3O6FB 1XCTA 3N85L 4JM2F 3MJ8B 1UM4H 2CLRA 4PRIE 4OLXH 1C08A 2VR4A 4F2MA 1YYMH 3R4DA 4XXCA 4OCYL 3I50H 3BWUC 3PWLB 1H5BC 4JO1L 1MOEA 4JFXB 3VU2A 1D5BA 2GYSA 1KBGH 32C2B 1I1YA 2YUZA 4LEOB 4NM4H 1J8KA 4NZTL 3ZSSA 5KSBA 3MYJA 5BS0B 2B1HH 4FQLL 5EOCL 4Z8FL 5I66B 4HUUA 4Z0XB 4P48A 4UOJA 2X9YA 5IJKA 5DA4A 3JWDC 3HZVB 3VGBA 3WHXA 1TTUA 1D9KC 5BS0E 5DUMH 5HGHA 2A9MH 5D5MA 2ED7A 3WE6B 3DX7A 5DC9B 2I5YL 1QLFB 1U3HD 2D3VA 5I6XB 4PG9B 1XCQA 4KRLB 2PCPA 5D2NB 1T03H 4XNYH 5CGYC 1DTUA 4WTZA 5EZJA 3VGAB 3TIDA 2ZUQC 5F1SA 4EI5C 4G8EB 3RWFA 1JYXA 1KJMA 4K3EH 3ME0A 3REVA 1EEYA 4WWID 5DYOA 4OAWB 4ZUWB 3RL1A 4J1UB 2UZIL 4P3WA 4BH7A 4L3EB 3EJZC 5ANME 3HAEG 4UT6L 4NO0A 2YPLE 3G6JE 4Z9KB 3TA3C 4EKXA 2VE6A 2UWEF 1BOGB 1Q0XH 3ARFD 1CZ8H 3OZ9L 5EO0B 3LS4L 1P4LA 3V95A 1NC4A 2YD9A 4YWGL 1TQBC 3HE6D 5D1XB 1GGBH 4ZS6C 3L95A 3EFFA 5BQ7A 3UTSA 4XAKD 5CCKL 4YDJB 3EOYG 4A2LA 3P30L 4LSVL 1KENL 3VD9A 2VLRE 5D1XC 3SY0A 4HH8A 5FV1L 3SE8L 4DOHE 1Z6JT 5FM5O 3FB7B 4LSDA 4OM0L 1ZHKB 4PD4K 3SO3B 4HK3N 4E42A 3HPJA 3DMMB 5C0AE 3MLTB 5C2UB 4JZOA 1YNLH 5J11B 5CSZB 3QT2A 2XQYK 3FZUC 3HG1A 4A6YL 4XVSH 4QRRA 2VZSA 2F53E 3QNZA 3HE6A 4PJBF 1EERB 3QFDA 4J3VA 1B0GB 1ZGLM 1FZMB 1MCLA 2QEJA 5EIIB 2FH6A 1S9WA 1QP1A 1IZKA 1IGIH 4WI9A 5KVEH 3FO2B 1WAAA 2BERA 4G9FE 1QFUL 3NZHH 1J05A 1A5FL 1RFDH 2DI9A 2HT4C 1EUTA 1J8HE 4F33A 1X4XA 1J0ZA 3UO1H 4JRXD 1LEIA 1CDIA 2EDBA 2NY0B 1GZQB 5TDNB 1LE9B 2XWJB 1P4BL 1TITA 3GIVB 3QG6B 3HG1D 1FN4B 5KN5B 3S35H 2ZUSA 1KELL 4UZGA 3HB3D 3LSOA 3H7BB 3VCLA 3Q48A 1LD9B 1FYTD 4P2CG 5L88L 3AY4A 5EBWA 1YEHH 5BRZB 1EEZB 1DDHB 3WXWL 1IQDB 2IFFL 4HKJA 5DXWA 3VXSD 2YRPA 2ZOKB 3T2NL 2PYEB 4M1GL 5GZND 5CEZE 4NWUH 5HDBF 4G8GE 1TLKA 4YPGB 4ZTPH 1W0YT 4HZAA 5HI3D 3BDYH 2ZKHH 5EWIH 4F9LA 1YJDL 4WU5B 4HMDA 5HYFA 4UOW0 4Y4FA 1LHZA 1W0VA 1YPZF 5E8DH 2Y7QB 3BRGC 4QY8B 3OKOA 5GRXG 5KSAB 4I0PD 5D1ZB 1IVLA 3RY6A 4KI5D 2BY2A 3BT2H 4PRBA 4Z7UE 1IC5L 1UZ8B 3MRBA 4JHBA 5KSBF 4PREA 1KCUL 1UWGL 4XP6L 1P1ZB 4PPTA 1DP0A 2E6PA 4G9FB 5T3XH 2XWTA 3SCMB 2EDLA 4LLDA 2XA3A 4JFFA 3MGTB 4J8RB 35C8L 4HWUA 1EGJL 4OLYL 3RTQD 1JRHH 4F9LC 3MXWH 3IFNH 4ERSL 1JZ3A 3VXMA 1HQ4A 3EAKA 3RHWK 2BRRL 4KY1H 3NIDE 3V52L 4XCYB 4NOBA 3FOMA 4H0GA 1ORQA 1UH2A 2H26A 4JPKH 5ILTL 4WWKB 1A7OL 3A6CH 3HG1B 2XIDA 2ZNWA 4XT1C 1A6VH 4ZXBA 5FDWB 3JZ7A 1AC6A 5J3HC 1WEJL 5CD3A 2HFTA 5IV2B 3HZMA 2QKIA 2CPCA 4DTGL 1MPAH 4RZCB 2YXMA 2DBJA 4IMKC 3WIIL 5IHZB 3HNVL 4MGXA 4XI5C 3IXTB 5DZOA 4YPJA 4NRZB 2Q8BL 3QDJD 4PJ5E 3FQRA 3MREA 2VL4A 4U6VL 1M6OB 3GSQB 4P57B 5HYQB 3PP3K 3MRCA 1Z5LB 4OCMC 4YHKL 5L2KE 1P4LB 5HHXH 2VDMH 4N8VG 1NCTA 4AQ1B 2QHLA 5JORA 4YDIL 2VXUL 3WO4B 2MPAH 3OAZK 4PJIB 4XPTL 4DCQB 4RCAA 1LNUB 4WDIB 2APTA 2EEBA 3UROR 3VI3E 4F9PA 1IAKA 4GMTL 2FBOJ 4NKQB 4OGXL 1RJZA 2Y06L 1KJVB 4M61A 5DFWH 3RWJA 4WUUD 1DN2A 1KIQA 4N0CC 4P2RA 5C92A 3HUJE 5D2NE 4KKLC 3PHOB 4U33A 4PYGA 4JJ5A 5C0CE 1GPOH 3S88L 1LO4L 1T04B 3UC0H 5E24E 4TTGA 2B2XL 4ZOBA 4LOUD 12E8H 5FGCB 1YZZA 2VQUA 4XWGH 4OCXL 4JRYD 4FQQA 3RWHA 5I8KL 5KVGH 2VXTH 2VQ1A 5D70L 1XZ0B 3B2UD 5D6DA 5DR5H 4MD5B 4X99B 1I85C 1WZLA 1JZ6A 2XFXB 4W6XB 5DVOA 1OTTC 1MAMH 4LHUG 4KKAC 2CMRH 3NFSL 3O9WB 5KG9A 4P49A 3P0VH 4MX7A 3Q5YA 1C12B 1PEWA 2NNAB 2ERJC 1ADQL 4J6RH 1AGEA 2BVQB 4WO4B 3ULSA 4S1DD 4WI7A 5GGTL 2GK0B 5HHOA 3RIFF 4F7EA 1K8IB 2PKDA 3T0EA 4OB5H 4M3KB 1U8OA 5ESVA 2NX5E 4DZ8A 1T5XA 2DJSA 4GW5A 2F53A 4U1NA 3NCYP 4DVBA 4BFIA 1YYLL 1SYSA 4Z76A 3QWRA 2AQ3A 5E95B 5FUOL 3FMGH 4B50A 2B20A 1PZ5A 4TPRH 1JGLH 3AREC 4NKOB 1NCBH 1HWHB 1KIUA 1WAAE 2K9UA 1N59B 4OLWH 3G6JA 5EZOH 3RY4A 1X3DA 4YHYB 5DJAB 3N9GH 4XBEH 1RZ8B 2ZUXA 1RIUH 4Z0XA 4LSTL 2B4CH 4N5UA 2E27H 1A4KA 3D85A 3BZDA 4PGBA 5IF0A 3F5WB 4S10A 1ZLUK 3LD8C 3GJEA 4I4WA 4WFHE 4HIEA 3FOLA 4NUGL 1HXMB 5J9PA 2FLBT 2CLZB 3HE7B 3EYSH 2HJLB 2Y36L 5AZEH 3QI9A 1Y6NR 2P5WE 4L4VE 5KBNC 4RFEA 5ICZB 5E7BA 3VXRA 1A6TB 2G75A 2D7OA 3ECBB 1Q9OB 4FNLL 4K7PX 2BSSA 3UYRH 1RMFL 1UJ3A 2Q76B 3L3KB 2H2PC 4NRYB 4QHLA 2E7MA 2XPGB 3ROOA 1YEJH 2A0LC 1ZVSB 2HRLA 1N6QL 1U3HC 1WFOA 8FABA 3MRRB 1I1AB 1WVZA 2DLTA 1ITCA 5CGYD 4CVWA 5B39B 2J8HA 3MOBH 1JK8A 3BP6B 5FF6B 4I0PA 1MI5D 1AE6H 5K9JH 4O4YL 5E4IA 3KXFD 2R0ZL 4PJCA 1QR4A 2NXZD 4WUUE 3CVHB 2WSKA 1T3FA 3SGDH 1TVBB 1UH3A 5AYUL 3LN9A 4LBEB 5DMJB 5JXEC 3QCUH 1QR1B 4KTDL 1DQJA 1MFDL 4KI5F 4CAGA 1I7UA 1FO0B 2ICEB 1FYHB 2AXGB 2QSTA 1AGFB 4UBDC 1FZOA 2D0HA 3CFBA 4ZFFB 3VI4F 4LKCA 3DX6A 4J3TA 3ARDB 1NH6A 1NAMB 3CCHA 5D1XD 2RBLA 3VFPA 2HKHH 4HS8L 2FWOA 4UI2A 1VGEH 3TZVC 3DYPA 5FM5M 4LLVB 5KS9E 1WT5A 2UVFA 3HMXL 1YNTB 1ZEAL 4EVNA 3TM6A 5C0AB 5IVNA 3S37H 3VRLE 1A02N 5DO2D 3U6RA 4QRTB 4MA3B 1RUKL 5F3BA 1X5GA 2VDPL 4I3RL 1WWCA 2DWEB 3MLWH 5K9OA 1CLOL 3BDXA 3QDMA 1MCPH 4EUPH 4MX7B 1NGQL 4KVNL 1J86A 1UYWH 1TJIL 4AIZB 3DETC 2BY3A 4APQA 5T1LA 1ES0B 1CDBA 1OAKL 5B22A 2ESVA 4FQXB 4MA8H 4L8SA 5E08H 2BSRB 2A73B 3G5VB 5MHSD 4X0KA 5JDSB 1QKZL 4YX2H 5IB1A 5EZLA 3L7EB 4HGWA 5DUPH 1LEGA 3V5HA 4OI7A 2A6JB 1UJ3B 3MJ7B 5C0AA 4LSSL 5DC4B 1RIHL 2Y5EA 4RFEB 4E41D 4OZIA 4JLRA 2OR8A 5ERWA 1KN4L 5ADOH 4JRYA 1G7LB 1ACYH 4GQPH 4JKKA 2RB8A 4ZFOA 3TN0D 5B39A 3DX9B 5DJ2B 4NC1C 1NDGB 3KPLB 1MY5A 4R2GD 3O41A 4J4PA 2O61B 3PGFH 4I18B 2NY5L 2NZIA 3DXAD 1AY1L 5C07E 2R2BA 3BISA 4D0BA 4HX1B 1IEBA 3IETA 5I6XC 1JHKL 2Q76A 3L3KA 3L3GB 1A9BB 1S7TA 3QRGL 4KHXH 2X4QB 5EU3B 5LBSL 3EYOB 2NR6D 1WUNT 1FYTE 3E0GA 2C9AA 4IOIB 1XGTA 2XPGA 3VFMB 3RAJH 1P84K 1KLUA 4QEGA 1XIWB 3V6ZB 2V2WA 4R4NC 3MNZB 5ENWB 2J6EH 1BZ7B 3MNVA 5EH1A 2VQTA 2KL6A 1BQUA 1HSAB 4JRXE 5I19L 3BIBX 3R06A 1IC4L 4L8BA 3VG0H 4LEXL 1HINH 4X8JA 1B2WH 1JV5A 3MLRL 3NA9H 1O5DT 3CFJA 3QWRD 4JO4H 3ZL4L 5FDWA 4ACPA 4PB9L 5IEHA 2DKMA 1TCMA 1Y18A 4L8CB 1G7IB 3E6HB 3L6FB 1INEL 4F8QA 3GBNH 5E8OB 2AK1H 3BGFC 4F7PB 1BFTA 3NACL 2V7NA 3JV6B 4C56D 2EO9A 2R1WA 2OJEB 4WNQA 3MRFA 1HN1A 3SDCD 2EYSB 1UXWB 3N06B 3QPXL 4ONHB 5CEZH 3D85D 1OVZA 3FO1A 1FG2A 3VXUE 4OFYD 3WIHA 4N8CL 2J8UA 5CLWA 4JZJC 3O6ML 4ZUTA 4G43A 3SO3C 1GGUA 3PGCA 2PYED 3C6SB 4FS0A 1AGBA 2BNRD 4P5TD 2FGZA 2NYYC 3MPCA 4XCCH 3S7GA 5F72S 1T21A 4RAHA 3BVNA 1U9KA 5GGRA 2V5TA 5ALCH 2GY5A 1F6AB 4TSCH 4PBVC 4WFEE 2YA0A 3DYMA 4WHCA 3TBYA 5KG9B 5K59F 2CR6A 4X6DF 1G0DA 1R5VB 3QUZC 4WU5A 3U4BL 3O45B 3DXAE 3PV6A 4NCDA 4F37K 2PYFA 5FB8B 2YPLD 4Z7NE 4JY4A 4LSUL 1FBIH 2NW2B 2W0KA 4NQUA 3RNKA 4LIQL 4XC1H 2FX9H 3OB0K 4Y1AB 3I6GA 1MH5A 5DQ9B 2ZUWA 2BNRA 1CXIA 3L5XL 4YZFE 1U8OB 5LG1A 1S5HB 5CJQL 2FD6L 3KLAB 1FO0L 1V3MA 3UTPD 2WNGA 5EPMA 5DJXA 1H3GA 3MCG1 4LFHD 1U41A 2BMKA 2XKNB 4MAUH 4WENB 5FO9B 2DOCA 5J6GB 4POZC 3CC5A 3UTTD 4CN4A 4XNZB 1W8NA 2ICWI 4H1LA 2V17L 1C5CL 3CFCH 1IQWH 1C12A 1HCFX 3IXAA 3KPPA 1F3DH 1IARB 4OKDA 5T3XD 2NLJA 1YPZA 1K8DB 3H9SE 1JTTA 4X7FC 3WJJC 4HFWB 1DLFH 4L9LB 5FKAA 3MRGA 4KU1A 5JR1H 1WTGT 5EBMB 5CINL 2FB4L 2A83B 1OWRM 5JORB 1HHIB 1FH5H 1MHHA 1LMKA 1X6LA 4PRNB 2IG2L 2ZP0T 1E6JH 4MS8D 2XV6B 1ZLSL 3GDBA 2E9WA 1PSKH 4LCYA 4DKEL 1OCWH 2PTVA 1Q9WB 1T7WA 3BDBA 4O2FA 2J4WL 2XI9A 1DL7L 2BZDA 3GRWH 3LV3A 1QBLL 3U0WH 3SGKC 5HI4D 1G1YA 3FQRB 3MREB 1UWEL 1I3RA 1AIFA 5T5FH 3ZYIA 2HH0H 4PRID 4P5TC 4LU5L 3C08H 4PYHA 1U8PB 4DVRH 3X3FL 4RX4A 4LASH 2OM5A 3V4VH 4ODUB 3T3PE 3MJ9L 4OZHB 4XH2A 3GFUA 4YGAB 5FM8A 1Q9KB 3NCBB 3BEVA 5DUML 1AGBB 1Z5LA 1J0HA 1P9MC 5AEAA 1MRCL 1SY6A 5DRWA 4M02A 1AFVH 4OBRA 1ZOXA 5KTEL 1XF5A 1CFVH 5E03A 4OT1H 1R3JB 2B4CC 4U6HB 3ZO0A 3ZKXC 1BECA 5SWSB 4O9HH 3CDFA 4CDHA 5IROA 2YZ8A 3MLXH 3N1QC 4TUJB 4JG0H 1T7XA 3UPCA 1JNHA 5DT1H 5EORL 3RVWC 2HT3C 1NLDH 4GJTB 4JFDD 3S5LG 2X41A 2R69H 1MLBB 1V3KA 2ADGB 4D9LH 1JN6B 3OX8B 2R0LL 1JP5A 4BSWB 5T1LD 2CRYA 5H37H 3GSWA 5IFAL 4KDTC 2D31B 5EU7E 1F02I 3VDAA 1NC2B 5E99L 1X5FA 1SY6L 1YEEH 1RZFL 4L5FL 4CUCA 3QQ3A 5HDBE 2ZOKA 5C0BD 1KG0B 1VHPA 4XBPB 3N1PC 2W38A 1YMHA 5CCKH 4M93B 5GQBA 5TDPB 3BN3B 5D7JC 4F7MA 5B38B 3O2VH 2R39A 4BFEA 3SGEI 4GQ9H 2AXHA 4MJ5A 2XICA 1MCRA 3DPBA 1JGDB 5BO1L 2ZJSH 3FQWA 4UB0L 1CL7I 3REWA 4NHUB 2BDNL 1FZJA 5D7JB 3IDIA 4OGAC 3SDDB 4M5YL 4Q9RH 5A2FA 3BPCB 5HPOA 5LAXB 1RZKL 2F58L 1YMME 2W9LA 1Q9LA 4CVXB 1D5XB 1H8NA 2QR0A 1C08B 3ETBF 4OFVA 2RFXA 3DX9A 4UU9A 3PIQA 3QEGH 1NCAL 3OGCA 2HLAA 1VFAB 1MFEL 3IAGC 5TDOB 4O2FB 3D0VA 1GHFH 5F8QC 3BD5A 1A4KB 2XTLA 4U3CA 1I9RL 3AU1A 2YC1B 5KZCD 2P44B 1QFUH 2EECA 1UKSA 4M7LT 4RGOL 2C1PA 1NFDF 4LDLB 5CJXC 4GRWE 4PJAA 4FQPA 1GGYA 3CSGA 4JN1L 1JNLL 3BMVA 2A6KB 2VLMD 3O6FD 3U7WL 3QUYD 5L0QC 3FTGA 3T1FB 4FFZH 1GVIA 4OCLC 3MLUL 3VGEA 2VUOA 3S4SA 1CFBA 3W9DB 1LK3H 4NP4L 3BPOB 1BFVH 5DD0L 2J1KA 2Z0BA 5C0CA 3LV3B 5J11C 4KFZC 1N4XL 2NQCA 3NCJL 4U1IA 2PW1A 1QLRB 3K0WA 3FB6B 1HI6A 4LNVA 2B5IB 1N64H 5FO7A 1DEDA 4LVOB 1XF4A 3DETD 3X14A 1SMOA 3L9RB 3WKMH 3DVIA 3QEQA 3O8XC 2A83A 5F6IC 3T2NH 3RTQB 4PRHB 4QOKA 3BH8B 2NZ9D 2JCCE 3CVIL 3CZFA 3VXTA 1PYWA 4DKAA 2BJML 4WW2B 4FXGA 1H15A 1NGPL 4O00A 5EU6D 5GS1C 4D8PB 1PQZA 2UWEE 2Z91B 3Q6GH 3LY6A 3QEUA 2K1MA 4HT1H 4LKCB 5ESAA 1T1WB 2N7AA 1MJJB 4K8RL 5DRXA 4KK5C 4TNWF 3DVNA 2B0SL 1F90H 1IC5H 2HFGH 5KSBB 1FVDA 3BYYA 3CPLA 3TN0C 3VGDA 3VFNA 3BHBB 5JHDA 2IAMD 5T3XL 1HYRC 2AJZA 3O2WH 4MA7L 4RFNC 3HI6H 2WUBL 1MEXH 1HHJA 2GCYA 4G8EA 3G5ZB 5GRWA 1U42A 1A7NH 4XNZC 1NFKA 3RWJB 4ZUTB 3FHAA 4JDTL 4UTAH 5AWNH 4PJGF 3V52H 4PLOB 4V1DE 1QLFA 3GMNA 1OP5H 2DAVA 1C5BL 1KJ2A 3V8OA 1SM3L 1D6VH 4OI8A 5DTFA 4B7LA 4FZ8H 4WEMB 3MYJB 4NO2A 1A6VL 2DBLL 5CGTA 1QBBA 1DQML 5D1ZC 4X4ZA 1V7NH 1A6WH 3KPOA 1RURH 3AGVA 3BKYH 3JVGC 5BS0A 2HG5A 1MCBA 4NNPL 4K55A 5GGSA 2IPTH 5C0GB 2EXWC 1AD9A 3O6LL 1FNEA 4LP5A 3Q1SL 5SX5H 5KSUB 3CX2A 1T20A 4NN7B 1A0QH 3SKJH 1L0QA 4PJGE 1NMAH 1HXMA 2R0KH 5DHVH 5J9PB 1W8OA 5C07B 4EZMA 5HYJE 5JW4Q 3U7YH 5E6ID 2IQ9H 3QDAA 1IGCL 4JR9H 1D3CA 1A7RL 1U91B 4PJGA 2ITDA 3BPNB 1EO5A 1G9NH 1TZIB 3MV9B 4R4FL 4WTXA 1TJHH 2C5DC 4K3JH 3MROA 4XMKL 5GS0D 1N59A 2OBGA 3M1BA 2JLLA 1JFQH 2DMKA 2PTUA 5IIEA 3O3EB 2YD7A 3GMQB 5F97E 3VFMA 1WCBA 4H8WL 5EOTB 4PJ7A 2JK5B 1I1RA 5KAQG 4NO5B 5MENA 4WUUA 1RULH 1ZT4B 3ARXA 3VJ6B 5GJTL 3V7MA 4NT6B 4NWTL 4KROB 3TBVA 2LQRA 4P4KB 4IHOA 4G7VL 3W0WE 3K4DA 1HZHL 5DRXB 5L2JA 5DR5L 2EXWD 5TF1H 4PJ9A 1RJLA 4L8DA 5DLMH 2DDQL 3LOWA 3H9SD 3SGJA 2CMRL 1I1CA 3ESUF 5DMIL 5LCVH 2CIKB 4MD0A 5IESL 1H15B 3D39B 3HG1E 5HHQB 3MA7A 5J06A 1S7SA 4AZ8A 1MCOH 5ICYA 2ZCLH 2VITA 2MSPA 4NQEB 5IFHL 1NGXB 1CI5A 2D9QB 5BJTB 2F19L 4OLUL 1G7MB 3RA7H 5DHXB 1I3VA 3AY4C 4HQQH 3MZGB 3WDIA 4YH6A 3QWQB 2HVKA 2YD1A 1WJ3A 4MB4A 5CJOL 4RMQA 1VPOL 3UYPA 4LMQI 4OLWL 4MS8C 5EZOL 1J1XL 1NGWB 2CK2A 1FDLH 4WFED 3VFTB 2B4CL 5DZLA 3KDMA 1FO0A 2DS4A 4WJ5B 2EIZB 1LNUA 1BVKA 1EFXB 4GRWH 4JN2B 1K5NB 4N0FB 2EE9A 4OZFH 1FL5B 5LQBL 4JZJB 2V5MA 2YD8A 2IADA 1EJOH 4L4TA 1NAMA 4D0DA 5H35B 3W0WA 5BRZE 3HFML 1UVQB 4QHUA 2FX8H 5TPWH 5TH2A 1T4KA 1U92B 3MV8E 5IV2A 1RUQH 5F7FA 3IFOB 3UTSD 3IDGA 4MAYB 1NFDE 3X13B 2NXZC 3WEXB 5C08A 4NC0B 4L4VB 3NFNA 4YE4H 3MV8A 4J3XA 5HPMB 4RBPH 3O4OC 3OR7B 1CGYA 1NBZA 1UZ6E 4OD1H 5D7IE 2H26B 3ULVF 1NUNB 4FFVD 1EK3A 5ITFA 1BQHB 3OF6D 2ILLA 2H9GB 4U3HA 5CKGA 5JW3H 1YC8A 3AMLA 2NY0C 4OF0A 4W68A 4X7DC 4FQIH 2HTLD 4K94L 4KTDH 4Y1AE 4HS3B 5IM7A 4OLVH 3T0VA 2YR3A 2P45B 3W11D 3BSZL 3UPRB 3BI9X 4PG9A 1QEWA 5DJYB 1DFBL 4YGVA 2M8XA 3T3PF 4ZO8A 4OFKA 4LLYB 2X7LB 2EDXA 2EZ0D 3U9UB 1A22B 5FYJU 1MJUL 4LOUC 5DF0A 3CH8A 1MWAB 3KJ6H 3TNMB 4HFUH 1VGEL 2X4TA 1E4JA 1NL0L 2EO1A 1J5OH 4JKLA 2GTZB 1MFCL 3EYVA 1YQ2A 1IAIM 3CH1B 4U1GB 2YEZA 1UEMA 1AR1D 2ZPKH 4QF1A 3CVHH 4N0UB 4RIRB 3VXUB 3QJHB 4MCZA 4PBWD 4BSWA 3MACL 1MQ8A 2E8ZA 5CP7A 4P46C 3Q2CA 5ANMB 4BUHA 5DHYA 3QH3B 2OMBA 1NGQH 1TJIH 1M7IA 4BELD 4H20H 1K4CB 4R2GB 2IPUK 5ACMA 1ZMYA 5H8DA 5DK2B 1L7IH 2WWKO 3G04A 4TVPH 4UV7H 4YFDB 5FA3B 4U49A 1YECH 3LEVL 3MLVH 4FG6C 2OJEA 2HJFB 3QIWB 4WNQB 3V5DB 1A7QL 3KS0H 1A6UL 5L6YL 1QA9A 1XZ0A 1T2JA 1CICB 5IEKB 4XNXL 1AJ7H 5J8OA 5HGAB 3IFPA 9CGTA 5JIPA 1E6OL 3K2UH 2K3TA 2OP4L 4F7EB 2NXYB 4UQ3A 5FUZL 1PX4A 1OSPL 3GSXB 2NNAA 4LSRL 1UXSA 3BIKA 3U46A 4ELMA 2FJGB 5ADOL 1CL7L 1MHEA 2C4XA 3SBWC 1FZKA 4LARL 5CILL 5D6CB 4Z7VA 1QNZH 5D7KE 4HUWA 4H0IA 1DCLA 3FO9B 4X99A 3UJIH 2PXYC 1JHKH 2H9GA 1FC1A 2DL2A 3UPAA 4YHLL 4W70A 3QRGH 5IVOA 5LBSH 3IKCB 1NUDA 1N8ZA 4XNQA 3VRJB 4PS4H 4U0RB 3STBA 4G42A 4K7FA 1BLNB 1QBAA 3RBSA 3SE4A 2NW2A 4Z7VF 3ULUL 5ALBL 3MRLB 4HLJA 3V6OE 3VFGL 1OTSC 3F7VB 4UUJB 4CW1A 1MHCA 1NMCC 4OZGE 1MI5E 4B5EA 1FNHA 3GGWB 1IGMH 3RL2B 4FA8A 1HQRB 4PP1C 2MCG1 1D5ZA 3OXSA 3H3KA 3O0RH 4XP9L 1NMCB 4DFHA 1FFNA 2CH8A 5HBBA 3GBNL 4RGNC 4UT9H 5FO9A 2AK1L 1FVCB 1RPQA 1T22B 3GNMH 4QGYA 3WFEL 4AEHL 5C2BH 4Q6IA 1CTOA 4NZJA 4P5KA 3SE4C 1ORQB 3GKWL 1QOKA 4M7KL 3C60B 3L3DA 4XHJC 4KQ3H 4OCWH 4NQDA 1DBBL 4Z7NF 4U1SA 5E6YA 2P5WD 1ZKAA 2DTMH 3OG4B 2MCPL 3MBEB 3K46A 4C56A 5HHNB 4N1HB 3FHQA 2CDEB 4G6KH 3OSKA 1EZVX 1PG7H 5EC2A 2AJXL 4G6JH 2PETA 1PJ9A 2VDOH 1IAOB 3ILQC 4OD3L 5ALCL 2DJUA 3UP1A 1NANH 4QRRD 3UTTB 3EOTH 1J87A 1G7MA 1R3KB 2JJSA 2W65A 1R24B 5K9KA 4ONFH 5EN2B 3E3QE 4DGYL 3WBDA 2X4TB 5JMRA 1U8MA 1QFWM 3DX6B 2IAMB 3PABA 4HEPG 3VFWB 3AAZA 3MA7B 4HPOL 3WSQH 3NZ8A 4KTEH 4ZO9A 3WL9B 4JB9L 2GSIB 1FRGL 5F70A 2DQFA 4ZMAT 1CDCA 1H3PL 1KPVA 2APBA 2YUVA 4NYLB 3CCHB 4PJEB 1LO0L 5GS1B 4R0LC 3BE1L 4POUB 1YNKL 3V4UL 5GRVK 2AKRB 4H26A 2P5EA 4ZFZA 3BWAA 4IOFD 2Q87A 1FL6B 5ETUB 5IMKA 4X5XA 4MJIE 1H3VA 2WINA 4K3DH 5H2BB 3IGAA 3P4OB 1D5MA 3S36L 1IC1A 3ARYA 4GLRH 5FYKH 1B6DA 3OQ3B 4G8IB 3RVTD 4C4KT 1IKFH 3MRHA 2FB4H 4N5ED 3TVMB 4P4KD 2NR6C 3QUYB 4DKFH 4JQVA 1FH5L 2VAAB 4J23A 3O11B 5ICXA 1YC7A 4GKOA 3L7EA 1J1PL 5IK3A 1U91A 1FGNL 2VISA 4GG6F 3FAXA 1IFHL 3FRUA 3WCYA 4XP4H 3VRLF 1BZ9A 5F71A 5FO8A 3U0WL 4HX1A 1CN4A 4UDTA 2NTFA 1P7KB 4X9IA 2AW2A 1P4IL 3IU3B 4PTTA 1VSCA 2FIRT 2G5BB 3A6BL 3WLBB 4HIHA 3OGOE 4PV9B 1EIBA 2YN3A 1FFOB 4LASL 4JLRB 3V4VL 2FIKA 2DQTL 5C9JB 3Q5OA 4JDZB 4KKLD 2E9JA 3QCVH 4YHIA 1KEML 2ITCB 4GRLD 2YD5A 5DQDH 3S35X 5BV7H 2EDRA 1NQBA 2KZ1B 4RSVA 1KLGB 4MNQB 3G6JB 2VLJB 4KQ4H 1KNOB 3QNZB 4I4WB 4ZOEA 3SDCB 3SDAB 4BZ1L 3MRPB 1F6LL 3K4ZA 3NIFE 4OT1L 3L3IA 1R3KA 1F3RB 3I85A 1TJGH 2JB5L 3ALWA 2ICCA 3JXAA 4AENB 4KHTH 4F8TA 4PGDA 4JFYA 1KXQE 3WLWD 3V4PL 1HE7A 4WEBL 3QUXC 5B21A 5ESVB 3LQAC 3KS0J 5DYOB 4K7PL 3PABB 3RDTA 1EFQA 1B0RA 5FGRA 1J12A 3QG7L 2CLVB 4LDOB 1PY4A 2FBJH 1OQOA 3QEHA 4GKZA 1KTRL 1T5XB 4P2QD 7CGTA 5IMMA 1BBJB 3FN0L 4AMKL 1YEEL 1MREH 3OJ2C 1ZGLA 2I9LA 3TO4C 4GG8B 5CZXD 3QQ4B 4LQFL 4JO3H 3L3OA 5FGCE 3JTSB 1ZA6A 3JUYA 5D2LE 3UTTE 3TT1H 4P9HH 2R2CA 1I9EA 4FTVE 4C56B 3EW3B 5EBGA 3L3JB 1ADQA 2J88L 1A14L 4YIQA 4KI5E 4TUKH 5C70A 1N0LA 3VWJB 1RZGA 15C8L 4M5YH 1EAPA 3LKSA 4NSKB 2DQIL 5FYKU 3DLQR 4QTHB 3G5ZA 1UEYA 5ID0A 3U82B 2CLVA 3LRHA 3RKDC 3UTOA 5GGVL 2H2PD 4P9ML 2F74B 3MJ9A 2YWZA 3LPFA 5J56B 2NW3B 3GHEH 4I2XE 3FB6A 1TVBA 5HGBB 1FVDB 2ID5A 5BXFB 3LEXB 3KLHC 5I73C 3TCLA 3M8OH 3TT3H 1GZPA 1DJSA 2FGWH 4LCIL 3KYMA 2HVJB 2Z35A 4CMMB 2W0FA 4J3WA 5ESQA 1OAUL 5CUSH 2H1PH 2AQ1A 3PQYB 3U7WH 2XTJB 3BJ91 4QTIH 5I74B 2I24N 5J0BA 3GKZA 1WZMA 3SDDC 1YEGL 1LO5B 3GSNB 3QCTH 2BNRE 4Y5YA 5C3TA 3WLWC 2Z8WC 1MCFA 2QADD 2WBJD 3EFDH 5GGQL 2PN5A 4JM2C 1S9KC 5IT2L 4I13B 1RD6A 4K3HA 1MRDH 3FT2A 1RIVH 2GJ6A 1YA5A 2EDNA 1GAFL 4H5SB 3K81A 2Q86B 3RNQB 2O5YL 3RPIA 4U7MA 3WNNA 4F57H 3EGSA 5IGXL 2BNUB 4C56E 4WGWB 2FJGA 3ZE0F 2BJMH 3BD3A 4IS6A 1F6FB 3C5ZB 1C16B 5C0GA 2OI9C 4N8PA 3H9YA 4YO0A 1FVEB 1BFOB 1FNGA 1Y0LB 1G6RA 4NJAH 1P7QB 4WWKA 2NY2D 4GW4A 4EN3D 4O58L 2V7HA 4CJ1A 3HRZB 3HZKB 4NO2B 3KVQA 5FHBH 2B0SH 2B5IC 2XZAH 3HUJF 3LCYA 1U8NB 1XGRA 3DI2B 4CN6A 5DEFA 4OJFH 3P0GB 3CMOL 3TV3L 7FABL 5I1JH 1K6QL 2B1AH 4P2YA 4MXVE 5FGBA 5SWQB 2WUBH 4OIAA 4MD4A 4R0LB 4YNYA 2ADJB 1HXYA 1IAMA 4POYA 5I1DA 3IJSB 2V5RA 3MA9H 1KV3A 4G6ML 5K33A 4NBZB 3QULB 5B8CB 2WP3O 4M5ZL 1EO8L 3W0WD 3ARGA 1PX3A 3O4OB 5C07D 5DD1L 1CT8A 2YEZB 1D6VL 3I02B 4X4XA 5I1GL 5GISL 5I2IA 2DBLH 1RUPL 4R4BB 1GOHA 3BUYB 3WMSA 3QO1A 2FZ3B 4O51A 5IWLC 4PGZA 1A6WL 5DRWB 2Z92B 1MWAA 2OQJA 5SWZA 1EH9A 1MLCA 2GQHA 5BOZG 3JTSA 3EJZD 2QLVB 3TEUA 2FATH 3BKYL 3K2MC 1KTDA 5F6HI 1I7ZB 2P8LB 2IPTL 4Z7QE 2DTSA 3BIAX 5MERB 4K8RD 4WW2A 2F5AH 1E4XH 1A1OA 3WHE0 5HI5C 3HRPA 2RJMA 4YHNB 1EMTL 4FTVD 5D93C 3PJSB 3S9DB 1MLBA 1J0JA 3SBWA 4G6FB 2R2EB 4XTRD 5BS0D 2UZYB 2P24B 1MJ8L 3MR9B 4ZPTB 5KS9A 4A6YA 4LPWA 1C1EL 4XHJD 5KZCB 3VI3F 1YN6A 1WBZB 3NABL 5D93B 4KH2A 2FL5A 3EUUA 4TN9A 2IQ9L 4XP5H 1KB5B 5I75B 3ARTA 5J1SC 4AT6B 4NHCL 1I4FA 2N7BA 1IGCH 4FN0A 3KYKL 5C0JA 3P4MB 4R2GC 4MVBD 1Q94A 3NOIA 1TENA 1FZMA 2YK1H 1JPSH 4P2QE 4CGTA 3MLZH 4XMKH 5LKNA 2HT2C 4WUKL 3FB8A 5FYJH 1XR8B 2Y6SC 2QQNL 4PJ7E 3BJLA 1JHTB 2JIXA 5E2WL 2VLRB 4FZEL 4MB3A 3GIZL 5IR1B 1CGXA 1XGQA 2O5XL 4XPGH 1A3QA 4Y5XC 1BGXH 4NC2B 5TE4L 3BPCA 4ZFGH 4NWTH 1CS6A 5DVLA 5C9JA 4ODWA 1JF1B 3W0WB 1FL3A 2ESVD 4JPVH 4L4TB 5JOEA 4YDJA 43C9A 2IC2A 4M03A 4UOW1 2E3VA 5KVMC 5AD0B 3LIZH 4U1LA 1QSZA 3BPNC 3B9VA 4JFFD 3WIHH 3I2CL 3RZCD 4EXKA 3REWB 1ZAGA 3TLRA 4PY8I 4WW1B 4ELMF 2ZCLL 2CIIA 3MUJA 3C8KA 3QIUA 4XRCA 4YLQT 3U4EB 5DD3L 2APFA 3BXNB 5JUEH 1WFTA 1OAXH 5B8CA 5FKAB 1JYNA 1U8HB 3DGCR 3IDXH 4Y8DC 3O45A 3SCMA 3T04D 5M7QA 2DIBA 1MFAH 1LO2H 1KFAH 1ZV5A 2ZSVB 5KJRH 1JTOA 3HI5L 4NQXB 5SWQA 3WNMA 4ZUWA 5EOQH 2PW2B 3QNYA 1ZLWH 5I8CB 5FA4B 2P48B 1K3ZA 5I1DB 3B5TA 2EKSB 1AKJD 3ZMRA 1GZQA 2R8SL 4RGNB 1WWWX 4PP2B 2AJVL 4MVBC 3MZTA 1E4WH 4L4VD 1BOYA 3KWWB 3BN9D 5CEYA 4H25A 5KW9H 2DWDB 2FJFB 2J8UE 4LHQB 4WHDA 4NQEE 4OSUH 3LQAL 3FCTA 1Z3GL 2C1OB 5IB2B 2XZQH 3RWDB 3X12A 4KK8C 4KGJA 1IQDA 5LWYH 1FFPB 4MSWA 1ONQB 1XH3B 2R15A 3PL6C 5SWSE 4PFEA 2EXYD 4YHZL 1GSMA 2NPLX 5L7XH 5TPWL 1U8QA 4ZAKB 2RCSL 3A67L 4ODUA 2I26N 1J0KA 2W65B 1LEKA 4KUCD 1U93B 1OD9A 4WU7A 4LPUA 1MIMH 3C6SA 3OG6B 4LHJB 1QSEA 1VFBB 3MFFB 3MNWB 3ES6B 2MKWA 4M1CD 5T33H 2FO4A 5E6IB 3HMWL 5D72L 3HMXA 4PRNA 1UCBL 2A6IB 1M4KA 2NX5D 3MJ8A 4PGJA 1YMMD 1L4IA 2AP2A 3U2SA 2P5WA 4JVPA 2VLKA 2H6PA 4NN6B 2QQQA 5EUOA 4YXLL 2PO6D 3P9WB 5KSAD 1DQTA 3MJ6A 2FL5B 1MUJA 5AUMB 1MCKA 3RX5A 3LN4A 3VD7A 1EHAA 4M1DL 5F7EH 2YPLA 1JF6A 3DNKA 4ZUVB 1NGYA 4KK8D 4QTHA 1G7QA 2CO7B 3T0EE 3GMRA 3ZYZA 2Z9TA 5I0DA 1FJ1B 2NY3B 1NAKH 4ZSOE 1I7TB 1OPGH 1TPXC 3T09A 43CAB 1MHPH 3KJ6L 1BX2B 4AH2A 5C0CD 5C6TH 3JTTB 3U36A 2VABA 3GI8H 3ULVL 4JFDE 2BVUA 4I9WD 4Y19A 1N8ZB 4OF6A 4XNQB 4NM8H 3EJYD 5C0IB 5D2LF 3W5MA 1VB9A 4OCNC 1HH9B 2X89A 1ZS8B 4AQOA 4BH8B 4U6XB 1NBVH 2RQ8A 4OAWA 1EJ6A 1RUAL 1F4YL 3K8LA 3W81A 4HC1H 4JRYB 5ERWB 4U1MB 1MIEL 4AL8L 3HNSH 2OK0L 3IJSA 2AEQH 1HIMH 5KOVC 3HPLA 5ISZB 5F88B 4UV7L 4MMZC 4ONGL 4I77L 1IGTA 4PJ5D 1YECL 5L2KD 3DO7B 1LEGB 3HUJA 4MQ7B 1DN0A 3LRSA 4KRMB 5EA0L 3F7QA 4K9EL 4XNXH 4OCYH 1VEMA 3I50L 1ZHNA 1T1XB 4LLWA 3JV6A 1E6OH 4Z7OF 5D7KD 5GRJH 3CLFL 1MSPA 4KV5E 4BSVB 2W1NA 5FECB 1E4KA 4K3GA 5HHME 4FFWC 4FQLH 5I0ZA 3NIFF 3VXQA 1VGKA 4NZRH 1BPVA 4LCUB 4QXTB 1BM3H 5MP6L 5ACLA 1NGXA 5F7WC 4E9LA 1NBQA 4TTDC 3V6FB 3MNZA 5IEHB 2YBRA 3QIWC 3ES6A 4TSAH 2AK4A 3ARDC 1XGTB 1ZA3A 4X7TA 2VL5B 4X6CA 3D25B 4DAGH 3WIFB 1ZT7B 4J4PC 2FSEA 3L5JA 1NEZG 2WINB 1QO3B 5T3XE 3BP6A 2DQUL 3MV11 2GTWB 4BM7A 3B9KA 5JIIA 3V6ZA 3MSPA 1DBJL 1I1AA 4WV1C 1PG7X 4JRXB 4QHMA 5D1QB 5IW6B 4LSPL 5FHAL 3FN9A 5MEOB 1LK2B 1T7YA 3U7AA 1N3NA 4HS6B 2BHYA 4OZIF 2DLGA 3O3DA 1OHQA 3H9HB 3QB7C 1RZJH 3O6FC 3WHE1 3TVMA 2NY4D 2ICES 2R1YA 3O0RL 4XP9H 2UYLA 4CMMA 4NQCD 1SYVA 2HFFA 1ZT1A 5ICXB 5TJWK 1XMWA 1IT9H 3VWKD 6FABH 1K2DB 3D6GA 5C2BL 3WFBH 3BWAB 2P7TB 5CEZD 3LKNA 3AS1A 4F7CB 3T77A 3VXSE 1DBBH 4UDTB 4EQ2A 2BVYA 2HFEA 3E2HC 4NYLA 1INQB 3SKNB 3JV4A 2FECL 4Y1AD 1F58H 2ZOLB 4X7SH 4MDJA 4Z7WE 3BP7B 1A1MB 1JGUL 4FP8L 3QUXD 5C08B 2RAMA 2AJXH 2LTQB 5F21B 1T0NA 3R1GH 4KUCF 5GGVY 2XTJC 4ENEC 5HDQL 5IMLB 4I0KA 3ECBA 5E94A 2DQCH 1WZ1L 1TFHA 4PJXA 4KXZI 3BZEB 4C4KO 3CK0L 5FXCH 4JZNA 4LAQH 3EZ8A 4ONFL 1QTYT 4AIZA 4G9FD 4YEEA 2ZUQB 3WS6A 4RDQG 2YS4A 1FORH 4HAGA 4XCNB 3KPOB 5C09D 1E4XI 1WCQA 5IHLB 1N5AB 3B8YA 1I1FA 4KK5D 5I9QC 4QRTA 3IU4H 1OGAD 1SJEB 4WY7L 5HHVL 5KSVB 1QYGL 5FUCC 3UEZA 4JB9H 1VACB 4UAOB 3IFLL 1FRGH 2X40A 1KELH 1DN0B 3B4NA 2IBBA 2ATKB 1VFOA 4PJFF 2R29L 1T66C 1R3HA 1B3JA 2XZCL 3DURA 5DFTA 5D7IA 1AC0A 3D3VE 4E5XA 3VFSB 2IFFH 1P53A 5FKPA 3TZVD 1QHOA 1Q9WA 4PJDB 4NO0D 3S36H 4ORZC 1NAMH 4Z78A 3MMEB 4ZOAA 3X3GL 4NWUL 5JMOC 1I8IA 4XAKE 1HSBA 5T5NG 4PR5A 3G5XB 3UAJC 2ZKHL 4PJHA 1CGWA 4Z95H 4KMTH 3EO0B 1S7RB 2X2YA 3C5SB 2FHCA 2EYRB 3OHXB 3TBWB 3MCLH 4QXGL 4DWHA 5HHQA 2XY1A 3RTQC 5E6ZA 5HY9A 3PP4H 2PO6A 5IB4A 1UWGH 4PJIA 4JDVA 5IROC 3C60A 1P4IH 4MWFA 5I1CL 4MCYA 4E41B 4XMLL 4FQJH 3VG9C 2EICA 4EUPG 5HYSB 4K71C 5DMKA 3HAEH 2OR7A 3MXWL 4ERSH 5D7SH 2Y23A 5AUMA 2BVPA 2P47B 3ZHLA 5F3HA 4NNXA 3BGMA 1JIBA 4KRPD 3BYTA 5D6CA 3JWOH 5ILTH 3I6KB 5FYLE 1E28A 1SMAA 5DK2A 1UJTA 2X1OA 3DSFH 1I9IH 3EYUH 4M62H 1A7OH 3RWEA 1T2QL 1TNNA 4P2RB 1I3GH 2DKUA 1I7RA 4YDLC 4NKIH 1CD1B 3C60D 4ODHH 2OXHA 1XF2B 3BN9C 2DMBA 2XZZA 2W07A 3MROB 5IJVB 1TJGL 2OR9H 3MV01 4YDLB 3VA2C 3V4PH 5I75C 1G7JA 1RHFA 5D5ME 1WC7A 2J7LA 2IMNA 4DZ8B 2DQEH 2HLAB 2X42A 3RNKB 4RWYL 2A6IA 3NIDF 3QIUC 3QG7H 4P0DA 4X9HA 1JCKA 2AJ3A 3QAZC 1M71A 3NH7L 5GIRA 4FMKA 4XPTH 5HHOB 3GSRB 1SYSB 4Z76B 4O5LL 3QISA 4R4ND 4YO0B 2G2RA 1X9QA 4CRPA 4GMTH 4FQ2L 2Y06H 3DWTA 5HYJD 2BNUA 4AM0A 4PJ9C 1KCVL 4A2MA 1M05A 1K8IA 3RP1A 5EO1B 4XCNA 3EIFA 5T3ZD 5GSRA 3S5LB 3VH8B 4BKLB 3WXVH 2R2HA 1LO4H 5I15L 3RGVB 4X6FB 1HSAA 3ZDZF 1Y6MR 2Z31D 4WGVB 4F7TA 4KKCC 1UENA 3KXFE 3ROLA 2NY7L 3QNXA 3QUZD 3GMMB 2B39A 2X05A 2ARJQ 2OJZL 1SEQH 2CKBH 3SE9L 3Q3GB 4LF3A 2WUCL 3HPLB 5ISZA 5D70H 2AXJA 4JKPL 1P1ZA 1GGIL 2VDQH 1BIHA 3T2OA 4PRIA 1CGTA 2R9HD 4Z7QF 2APXA 3C5SA 5TE7H 1YEIL 3NFSH 2BNQB 1JI2A 4V1DD 1PDKA 4PRAB 4MAYD 1ZS8A 4GG6B 4PJHB 1CDGA 2H8PB 3GIVA 1ZANH 1ADQH 3P9MB 3ZHKA 3L3HA 1HSBB 3RJQB 5IKCA 2V6HA 2GY7B 1T1WA 5MI0B 1O7VA 4O2EA 3GK8L 2BVPB 4ZTOL 3TNMA 3STLB 5JXAH 4MJID 1CIDA 1YEGH 2BVOB 3QCTL 1K5NA 4N0FA 5GZNC 1P7QD 4BZYA 3P9LA 3I6KA 5DURB 4WFHD 5H94A 1UB5B 1BMGA 1E27B 4UTBH 1QQDB 1G6VK 5F7LB 3C9NB 4RGMC 4OGZA 4HJJH 2PUQT 5FUOH 4X7CC 4RRPG 2ADIA 4GKSA 4XAWH 5HJ3B 4IDJH 5TH2B 3BRFA 3MCKB 3O2DA 4M4RA 5HYEA 1YN6B 2IANE 4R26H 2I9TB 3F7PC 3OKLB 2WBJA 3PDOA 2NY1C 5IUSA 4U1JA 4POZD 2ZSWB 1LO3H 1BWMA 2R2EA 4XBEL 4HF5H 5EU6E 2Y07L 5T5NF 5KN5A 3TNNA 4FHBD 1RIUL 3VXSB 4ETQA 4IJ3B 5KOMC 2E27L 1OAYL 5GJSH 4IRSD 5JA9A 2MQCA 4Z18A 1JZ5A 3MFGB 2Y1VA 1F4WH 4L4TE 4JCLA 5GRZA 5DZNA 1TZGH 4YHPB 5TQ0H 4F33B 2LE9A 5F1KC 3BW9A 4FXKB 3EYSL 4QRRE 1AH1A 5DS8A 1CFNA 2OZ4H 2Z8SA 5J13B 4J8RA 4I0PC 3WFDL 1CICA 5EUOF 3F7YB 3FONB 3JV5A 1BEYL 3TV3H 3K7UA 3QZWB 5DI8B 5CIPH 3HI1B 1WSST 3FT4B 4QGTA 4JPWH 1F8TL 4KI1A 4M6MH 4OKVA 5ECJE 5AZ2L 1ZLVH 5F89A 1YEJL 1T2XA 4PLJD 2JCCA 2DB8A 4IRSA 3CDYA 3QDMB 1AO7B 3MRIB 1NFIB 2Y4SA 4PJBA 4XVTH 5D9SB 3DTXB 3MA9L 3CFBB 5BZDB 2HP4A 4M5ZH 2DLHA 3J8F7 4PV8B 4FQHB 3IT8D 3V0VB 4NT6A 4Q9CA 3K74B 4FQXD 4PJBE 4EVNB 4O4YH 4X6BA 2WBKA 4TSBH 1RUPH 4L29B 2DQDH 1CICD 3QUMH 1NCDH 1SHMA 5BQ7B 1XF3A 3OF6A 3EDEA 4LQ1A 1KEGL 1GXEA 4S0SD 3DUHA 1JPTL 1UM5H 5B3NA 3PHSA 2RIKA 4GAYB 4IRSC 1FV1A 4KJWD 4I3SH 4WFFD 2EYTA 1E4XL 4HIJB 4XZUB 3P9MA 4BYHA 4ODXA 5I66A 3KLHD 1A6AA 5FA4A 2BNQA 1C5DA 3GMLA 1RJLB 1RZ7H 4XMPH 5IK3B 4M7ZB 1T0NB 4C55A 1I8MB 1TPXB 2MOVA 4ODTL 3OKKB 5GRUL 3O9WD 5EZIL 1HHKA 3T4AB 4NHCH 3K1KC 1U8JB 3QDJE 3KYKH 1ZT4A 4MXQD 5GZOC 2E9BA 3OR6B 5GS0H 4V2BA 5J6HB 3VXPA 2CIKA 4WUKH 1G9ML 4F7TB 4HLZH 3UJTL 2C4FU 4EBQH 4L8DB 2VDPH 3F12B 2VDKL 1DANT 4FZEH 3Q5TA 3F58L 4BFGA 1NEZA 3P2TA 1KJ3L 4L1DA 5I1LB 4XPGL 2CDFB 4P2OA 1FNLA 2R1YB 1XGYL 2VDRH 3ZE2E 5D2LA 4TYUA 3GJFB 5FOBA 5T1MB 3P77A 1QO3A 4IMKA 4GKNB 4C83B 4MA1B 5HYJA 3VGFA 4HUXA 1G7HB 5TE6L 4Y89A 4GSDH 1PAMA 1J1OH 2IAMA 3D9AL 4D0DB 4CN1A 4I5BA 2WV3A 4NCC1 4NQCB 3OJMB 1DEEB 2XRAL 3MV7A 3QRFM 3WUWA 5BZWA 4RGND 3WYRA 2C7UB 1RIHH 4S2SA 4GAJL 4JG1H 5ESQB 3IAPA 4UDUA 3DVNB 5DD3H 5IG7B 3I9GH 5CP3H 4HPYL 4XGZB 4Y5YC 3MRMB 3KJ4B 3QIBC 1H3UA 1PKQE 1SJHA 5EFIA 3RHWF 5L8KB 3QHZL 4LVEA 2NZ9C 1R5IB 4EDWH 3ZT6A 4LLMB 2M1KA 4K94C 3O2DH 3HI5H 2RGSA 4G8GD 3DVGB 3KJ4C 3PWPA 4DVBB 4TQEL 2XFXA 4WI6A 4JQXC 5IQ7H 4M1CC 2VWEE 3RBGA 3U30B 1CDJA 3BKCH 2GCYB 3RWHB 3WS6C 3QUKB 1X7QA 2YPLB 1X4YA 4IIQC 5D1QC 2Z31A 1Q0YL 3CSYA 4ZUSA 4HGMA 5D9SA 2BVQA 4WO4A 3ULSB 1E4WL 3TYFA 1NCNA 3QXVA 1D6EB 5AYQA 4U1IB 3VRIB 3VE0B 4F3FA 2UV3A 3OXSB 1QHPA 2GT9B 5CJ8A 4RRPA 3NA9L 4Y2DB 4P23B 2FX7H 5LWYL 1S78C 3T65A 1SQ2N 3L3IB 4PGEA 1R3LB 4YHZH 3UTPE 2F54E 4ZODA 4BH8A 5L7XL 4KRPC 5E9DD 1J8HD 2RCSH 4W6WB 4JY5L 1U8KB 2VH5H 2J5LC 3VXNB 3MOAL 4RGMB 3TVMD 1YEDA 4KRPB 4IRJA 1PG7W 3B43A 2A1WH 3HC4H 4FQCL 3ZTJH 3UTSE 5IBLC 5D96B 5T1KD 4ZUSB 4UINL 2DL9A 2Q6WA 1CIUA 3B2VL 2XG5A 1UWXK 1B0RB 2G5BA 4XCCL 3ILPB 3DX8A 2HKFL 2VLKE 5D96C 5C0AD 4GW4B 2EDHA 1SVCP 1L0YA 5C0CB 1KNOA 2QKIB 2ATPB 1KJVA 1KB5H 4HUXB 5I30L 5FO8B 4OUUB 3S96A 1QQDA 3LRGA 2ZCHL 3TP4A 3GJFA 4PRHA 4QOKB 5FOBB 1WWAX 5I74C 3R0MA 1VERA 4G8GB 3TN0A 3ZTNL 3IJYB 5CEXA 5FYKE 1N7MH 3L9RA 3KAAA 2PYEE 3DVFA 3D48R 2BY0A 1IKNA 5C1MB 2C26A 4ZS7H 1U95A 3TFKD 1JRHI 3ZKQD 3NAAH 3OKKA 4LSQH 3QP3A 3VXPB 2WM0A 5DJ0B 4ZYKA 4HH9A 1MVUA 4O2CA 1SBBA 2VLJE 1DQDL 2D7TL 4QKXB 5FF6A 3G04B 5TQ2L 2YRZA 1NJ9B 3F6IA 1RSFA 4X4ME 1I9JL 5JW5B 2IPUG 1UKQA 4QXUL 3GMPB 1QPPA 4HCRL 3DIFB 3U48A 3ZE2F 1U8LB 2BCKB 3Q6FA 3QJHA 4MCZB 4PRDA 3ULUC 5A2LH 3RVVD 3OAUH 4Y8AA 5AG8A 3DMMC 4MJ5B 3MRHB 4JKWA 5EU6A 2ARWA 2HFEB 4HUKB 3KWWA 5CEYB 4NIKB 1DVFD 4X8XA 4WW1A 1F4YH 5IJKC 1QBMH 5C6PB 3O41B 2X1WL 3LQMA 3AB0B 4QWWD 4RMTA 3KYNB 2I5YH 5BXFA 1OTSD 1CLZH 4HJ0C 2IG2H 4CVXA 4FRWA 4RQQB 1ZLSH 3H2WA 2HFFB 4WW2C 2OTWA 1AHWB 4KGLA 5ID0B 3DGGA 2N1KA 3GSWB 3GRWL 4P9HC 4WCYH 4K3EL 4OGYH 1RUML 3SOBL 5FEBA 3FT4A 1BQLH 5DJAA 4PJXE 2NY6C 4YBLB 2DQJL 4LU5H 5CBAB 4G9DA 4LVHB 2VXQH 3GZKA 4MJIB 1BJ1J 1UACL 3MRIA 4P2OD 4XBPA 3CXHJ 4HWBA 6CGTA 4HXBH 1CZ8L 5IW1A 4LLUA 4RFNB 2R0WH 4M6OH 4MZ2A 3V5KA 3VWKC 1LP9A 3EOAA 1U8HA 3P4MA 3MV8B 5EO1A 3OKDB 2HWZL 4NGHH 5AD0A 1IAOA 2APVA 1CLCA 2JELL 4UNTA 4TSAL 1XF3B 4R8WL 3VWKB 4KVCL 2GAZA 4PJCF 1TQCC 2D0FA 1JZ4A 1D5ZB 1D9KA 4X6EA 3S34H 3NVQA 3WFHB 1CF8H 1VEPA 1ND0B 4HJ0D 1YNLL 2Q86A 2XNAA 2IBZX 4PG2A 3UMTA 1EPFA 4Z6AT 1AXSB 1KTLA 3O3BB 1FL3B 2EIBA 4HJGA 5KVEL 1S7UA 3DMMD 3IDYB 3PWPD 3O3AA 1KGCD 1RJCA 3VRJA 4CBPA 2IBGA 1FFNB 5IQ9B 1KBGL 1B0GA 3H6JA 3BKMH 2YC1A 3C2AL 4J2XA 4NZTH 3VFRB 1CBVH 1OW0A 2IQAA 1KCRH 4JM2D 4Z8FH 1C7SA 1VCAA 1GYAA 1P4BH 3TWCH 1S3KL 2CDGA 4LFHG 3IS1X 4TOYH 3O2VL 3DV6B 4GQ9L 4OI9A 1TIUA 2CXKA 4HWEH 4ZAKD 5E5RB 2GUOA 1D5XA 2ZJSL 2NMSA 2LU3A 1U3JA 2AGJH 2R4RH 2A9ML 4PRPE 5HSFA 4LL9A 2ADIB 4JAMA 5L88H 2NY0D 5DK3A 2C3XA 2F5BL 4HK0B 1BF8A 5DJXB 2F74A 3BZFA 5F9JA 3WXWH 4YBHA 2EIEA 4G7YH 4LK4A 3EFFB 4N1EA 3CFKB 3LKRB 1FAIL 3H9SA 4OIIH 4E41A 3IJHB 4NJ9L 4TNVK 2PF6A 4JFQB 1WZ1H 3DURB 4M1GH 4CADA 1WBXA 4NBYB 1JUFB 5HY9B 1UGNA 3C6LA 1NDMB 3O3UN 5JDJA 4V2CB 1G7PB 3LPGA 4XPFH 4RGOH 3D2UA 1AXIB 5LGKA 1IMHC 2UZIH 1NSNH 4LCCC 1D5MB 2A9NH 1CFQB 1RZKC 2DD8H 2OSLA 4R6UA 5ISZD 3FKUS 5E8PA 4WY7H 5JHDE 2FZ3A 4QCIB 3V2AR 4XGZA 1QYGH 3G5YB 3LS4H 4OUOA 4WTWA 4L3EE 5DSCB 1TVDA 3MLUH 4UT7L 3JWOC 4UILL 5DD0H 4J7RA 5FIEA 3HC0B 5SX5K 2EH7L 4Q0XH 3U2SB 2D4FA 3LH2L 32C2A 1FG2B 2SEBB 2VKXA 2XZCH 4K07A 35C8H 3RI5K 2V2XB 4I5BB 4FFVC 1JRHL 3IFNL 4PTUA 2EDDA 3IFPB 1B4RA 4MJIA 3MRNB 2X70B 4GW1B 3EYFA 4KPHL 4MD4B 2BRRH 1BD2E 2BVTA 5DMYA 2L7JA 5GSRB 2A74A 2FR4B 5C8JA 3MRDA 2VLME 1SVZA 2XA8L 4NC1E 2P49B 1G7JB 1LDPH 3BOVA 4XH2B 1JYWA 2JB6A 4DZBA 3OKOB 4Z95L 1ZVYA 1WV7T 2OTWB 4YBQD 2UVEA 3Q6GL 3S5LA 3FQXB 2FEDD 3G5YA 5DSCA 4HT1L 4K23H 1IGIL 1FPTL 5A3IC 1KLGA 4MNQA 4IMLA 4UMGA 5DURD 3SKOA 1U2HA 4WWKD 4EN3A 2AJ3B 5J6HA 1JL8A 5CSGA 5F7KC 5HVHC 2DLEA 4UIKL 2PYEA 1FNEB 1I8LA 1Q38A 5EC1B 3TCXA 2AEWA 4Y5VC 3GSRA 2AJSL 4KK6C 5I1CH 1KB9K 1AD9B 3CFIC 1S5IH 5KAQF 4EEEA 5HVHB 1E4KC 2DMCA 4GS7C 1BQSA 5EBLA 3SKUD 1CQKA 1XR9B 1OD7A 4YDIH 1A21A 2B7DT 3L3JA 1OP3K 3MLSL 1DQQA 1KYOK 1NDGA 3JVGA 1FVCA 3QDJB 1UCTA 4LGSB 2ESVB 3P4LA 5HHOD 2V9RA 1I9IL 3EYUL 4H0HB 3D25A 1H0DA 1I3GL 4HS3A 3IRZA 5GSVB 3KPLA 5FM4A 4ODHL 1QFOA 2DWEA 5CZKA 1XIWA 4Z7WF 1D5IL 4XHQA 1BP3B 4Y4HD 4ZTPL 4KKAD 5FCSH 3FQUB 2A6DA 1XF1A 3CFKA 1VFMA 2GI7A 3LD8B 4ZQKB 2BSRA 1MELA 2Q7NA 3LPWA 5A3ID 2DQEL 4Y2DD 3UJJL 3KGRA 4JJHA 3LKPA 4Y16B 3NCEB 3MRCB 4NFDA 1U58A 2GEEA 4TNWK 1A3LL 2GUOB 3NH7H 3QEQD 3TVMC 4XP6H 2VC2H 1F4XL 4G5ZH 3QUYC 3L3OB 5F1NA 1RZGB 5E2VL 5EU5B 3U0TB 4FQ2H 4JR9L 3SQOH 2GJJA 3F7YA 3FONA 4HKZA 3AAZB 3HS0B 5GGTH 4PLNC 3QDME 3ARED 4K3JL 4X6DB 5LXGL 1ZHLA 1TZHB 4FABL 3WXVL 1KPUB 1T5WA 2WMPA 4YHPA 2ARJA 2H2SC 1X7QB 5KS9F 3BAEH 3A6CL 5L9DH 2JIXD 3ARDA 5DQJA 1YYLH 2NY7H 5KVDL 1QLRA 1A2YB 2IGFH 4MDJB 4YXKH 4MYWB 4TPRL 3QSKB 3W9EB 1WEJH 3DHJA 5IBLD 3VE0A 4F3FB 1KULA 3BKJH 5DDHB 5J4MA 1B4JL 2EYSA 2GFBB 2VABB 1Z9SA 2A38A 2LV4A 3SCMC 1GGIH 1WQVT 1I3UA 2YZ1A 1R5IA 1NGWA 4D3CL 3AREA 1CFNB 4JFZL 3CSPA 1T66D 3SJVB 3ARFC 5HJ3A 3CU1A 4LCWE 1A1MA 2Q8BH 4OV5A 1R0AH 1TCRB 4CMHB 1AQDA 1INQA 5IMOB 1AP2B 1BJ8A 3THML 4UNUA 5D6DC 2IANB 4NUGH 4QY8A 3ARWA 2MPAL 5MEPA 4P5MA 2Y36H 2B8OT 3QI9B 1JZ7A 1VFAA 3GSNL 1LVEA 3QDJA 4OGXH 5A2JH 3NFPB 5DD6B 1ORSB 4JRWA 1QFWH 1ZK9A 2VDLL 4XCFH 2XWBA 2VKWA 3VFVA 3GM8A 2QQLH 3RU8L 3B83A 3V6OC 4QHLB 4XAWL 2ZUTA 3U0PB 3E6FA 3TJEH 3BP5B 1KT2A 5I1IL 2CXGA 2WAHA 4AH2B 5E2TH 4PIRF 2A6DB 4YDKH 3IU3A 4QRQA 4HBCH 3KPSD 1HXYB 1X5AA 3F12A 4DGIL 2XACC 1K3IA 4FQXC 5DJ2A 1T7VA 3FOLB 4PJCB 1NJ9A 4IOFC 3OTTA 4QHNA 1MWAL 2VXTL 1I1AD 1TZGL 3P77B 1Z2KA 1U8NA 1TNMA 2IALB 2P43B 4FQ1L 3HZKA 5I1LA 1AQKL 4APQD 1EJOL 2H6PB 2ZG1A 3V7AE 4JREB 3E2HB 3FFCA 4J6RL 3ROOB 4OZGB 3GMPA 5DD5H 5E5MA 4M93C 2CQVA 4XVJH 2XQBH 1CFSA 1DLHB 5BVPL 3OR6A 4YQXH 3VXUD 4MDIB 3QFDB 4XVTL 5MEOA 5FECA 1CR9L 4RAUB 5DQJB 3SDYL 4N9GB 5K9QI 4EUPA 4U6YA 1DVFB 5EN2A 1NC4D 1F2XK 1ZT7A 2GSIA 3WIFA 3QXDA 4PJAE 3H0TA 3VFNB 4OZHA 4TSBL 1U3HA 3FB7A 1YMMA 4R97C 2Q7YA 1F11B 5GGSB 5J1AA 2F53D 1IAII 1CVSC 1RUKH 5T1KA 5JW3L 4D94A 4I3RH 3RGVD 1DBMH 4LSTH 4FQIL 4JVWA 4YHMH 2ENSA 4KI5C 4RIRA 3VXUA 1JYVA 1S7XB 2X70A 4QF1B 1OL0A 3NGBC 4QHKI 3O9WC 3TH2T 2W0FB 2MQ0A 1AGFA 1WIUA 2EDWA 4WI3A 2VLRD 4APQC 2DIAA 2Y5TA 4ODTH 3H9SB 2VXVL 4Y19E 5GRUH 4NN6C 4XCEB 5EZIH 1PZUB 1YEKL 4NUJB 3QUMA 4V1DB 2XKSA 3LB6D 1CD1A 3QUKA 4LSSH 2J8UF 1T6WA 4NQXA 1KIQB 1MFCH 1N6QH 1JPGA 5EZJB 3C09C 4Y0GA 5CWSA 5HD8C 5IVXB 4OFPA 1YPZB 1KN4H 4HAFA 2V2TB 1FZKB 3O9WA 1KACB 2ZG2A 3T3ME 1XGQB 3RVXD 3TZVA 4E41E 1FNSH 2YMXL 4QCIA 4MAYC 3PGFL 2VLRA 1L7TL 3MRLA 2E7HA 1AY1H 2EDEA 4PY7B 1S7UB 4JQIL 5E4EB 1TTGA 4H20L 1JWUB 2Z31B 1SBSH 4S1QH 5IQ9A 2AV7B 1UB6A 4TVPL 5C0DA 2CRZA 3QUZB 1HI6B 4S11A 4LLQB 4IHOB 4UUJA 4LVNB 5MHSE 2DLFL 3UXFA 1QRNA 1P5VA 1I1YB 1A6UH 3OKYA 3QXWA 4PY8J 3PWPB 1AJ7L 1KTLB 3UTQB 3PQYD 3WFCH 3A0OA 2AABL 4ELME 5I19H 1NCCL 2CLZA 3M1BB 3WNKA 3R8BB 4NQVB 3MLRH 4JO4L 3ZL4H 1CL7H 1QRKA 4WDIA 4I2XA 4HS8H 2JE8A 2DWDA 2FJFA 2LABA 4OF5A 2F9BT 1J18A 1EUUA 3UJIL 1IGYB 5CEZL 1TVHB 5D7IB 1RVFH 4R4BA 1DANU 3BZEA 4N8VB 3LDBC 2H8PA 3WDJA 1KPRA 5C09B 1YN7B 5HYIA 1NFDB 3MRFB 3QFJD 5E6IA 1Q0YH 1KLFA 3LDBB 3PIQB 5E8OA 4X4YA 4MA8L 5ALBH 1T89A 5CJXA 1KCSH 1I8MA 3LVEA 2HTLC 4G3YH 5CHNA 1FFPA 4GUPA 4HD9A 4MSWB 4ZXBD 3GSOB 1JV5B 3B3IA 3X12B 4AIXA 3P73B 5JZ7C 4P5TB 3RQ3A 4BQ6A 1S7WA 1FYTB 1J7VR 3S36X 3PG2A 1MLCB 4LSUH 2R1XB 5DUBB 1CICC 4LIQH 4XBGB 5ABDE 4N0UA 5C3LD 3DJ9A 4IBLT 3L5WA 5FYJD 4ZDHA 4HW6A 5CZVL 4FQQB 4OCWL 4UV4L 1QEWB 5DJYA 2X5PA 5EO9B 5D71H 3O8XA 2MCPH 3LS5L 2D31A 1HWGB 2HJKA 1AHWA 1UQSA 4MAUL 5DJ0A 1ZWIB 4G6KL 2AKRA 3MODH 2GJ6B 3FFCD 4PJBB 5JOFB 4JZJA 1WTLA 3DGGB 3HAEA 2Y9RT 4D8PA 5MI0C 5JR1L 2J2ZA 1EFXA 1KN2H 5TDNA 3ZTNH 3BGMB 4EOWL 2VUYA 1AO7E 3DSNA 3M17B 4X6BB 3ESVF 3WJJA 5IJVA 5CJBA 4DN4H 5FGBC 3NFNB 1DDHA 3HZYB 1AR1C 1IC4H 3VG0L 3CZJA 4LEXH 4MXWL 3GUTB 4DKEH 1I7RB 1LD9A 4PB9H 3G08A 4TULL 3T08A 5DMGC 4HK3J 3FT3B 3RIAK 1NEUA 1U92A 1CQYA 4GRLB 3OR7A 1H8OA 5HPMA 3IXAB 5T5FL 1I4FB 2AV1A 1I8KA 3VDCA 4B41A 2J8OA 3C08L 4UIMB 5DI8A 4LLWB 3QPXH 4DUWA 4RA3A 3OMZA 5DFVD 3X3FH 2NYYD 2GAZB 1XIWC 5GS3A 3P0YH 2J12B 5F7DB 3DO7A 1GH7A 2OTUA 2QQKH 3C60C 5FYKL 1IAIL 1OT2A 5GGRY 3TPUA 5IR1A 3MXVL 3O3AB 3I02A 1MRCH 2FNBA 3DBXA 1ULVA 5CLTA 1CLZL 3TBWA 3OKMB 3AROA 4X9GA 3G6AB 4ZSOA 4CVZB 3STLA 2MJWA 2Z92A 4WFGE 1G0YR 4O9HL 5JO5A 1U58B 4HHAB 3MRKB 4X9FA 5DJCB 3ZSTA 3MLXL 4GG8A 2OI9B 1B0WA 2HVKB 4B0MM 3LHPH 4JRYE 1ITBB 1NLDL 2HN7A 1FGVH 1N0XL 2H45A 1BQLL 5JPNB 1JI1A 4X7EC 4WUUB 2CR3A 2HMIC 3OB0H 4DW2H 4NKDB 4ZPTA 1G84A 3P9LB 3O3EA 4NQEA 4LF3B 4P23D 5CJQH 5HGDB 4M7LH 1SY6H 4KDWA 1OAQL 5FOJA 2R0WL 4M6OL 1NCWH 4PLKC 4TVPD 4YIQB 3WUWG 1FYTA 3A6OA 5BV7L 2E7BA 2LU7A 1KOAA 3TBTA 3RDTC 1TETL 4M7JL 1IQWL 4PRAA 4GG6A 3G6AA 4ZSOB 5LGJB 4RA0C 3ARPA 2J6EA 4P46A 1CE1H 4BZ1H 1S7SB 3T65B 4TRPH 2P5WB 3MLYH 2FRGP 5E00A 4X4YB 5T1KB 1MHEB 4PJHF 2DM3A 1RZKH 2F58H 4N0YH 4OQTH 5A16A 2CLRB 4XP1L 2BC4A 4XWOC 4UQ3B 1WIOA 4JO2H 5I8EB 1KXTB 3RZCB 3CSYB 3DHMA 3S3SA 4JGMA 4EUPB 2V7NB 3ZKNC 2D7MA 2W91A 3ZKMD 2Y5TB 3PGCB 1GCFA 5I1EH 3MRQA 3EDDA 2PR4L 3FT2B 3QI9D 4L8CA 1I1AC 1OB1A 3BEWB 3TYGL 3EO9L 3V79C 3BKML 3G08B 2AI0H 3V6OA 4DVRL 1EAJA 1HOCB 2R1WB 2YKLL 3ZT7A 1S7XA 3HC3L 1GZPB 3TWCL 5FYLH 1LK2A 3I6LD 4P9HL 1FVEA 1LK3L 4NP4H 3QA3B 1BFVL 1A14H 1Q1JH 3MFFA 3MNWA 1LWRA 4H5SA 1FFRA 1N4XH 3NCJH 3FFDB 3ZT5A 4ZNEA 3ZHDA 1H3WM 1OGAB 1HHGA 2F5BH 5L2KA 2D2OA 4JFEE 4LLQA 1PLGH 4I3GA 3WKML 4OIIL 3EO1B 1IBGL 2BOCA 4JG0L 3C5JA 2H32B 2VJXA 3PL6A 1AGEB 4KZDL 3G9AB 3QDGE 1DQLH 4ZFOB 2WK2A 4MMXC 2HLFC 1X5ZA 2R0LH 3WD5H 2QHRH 4NN7C 1GGCH 5HGGS 3TZVB 4BK5A 5CUSL 4AJ0A 4NO0B 3QHFH 4GRWB 2GT9A 3IDMA 4D9QD 4HG4K 4JFDA 4P3CH 2VZVA 4UT7H 4TUOB 4UILH 2HFGL 4KRNA 1L9NA 3GMLB 2NY5C 2ZWLT 2XXMB 3HUJB 1GOGA 4B53A 5IMKB 4IRJC 1HHHB 5IB5A 3VXMD 4MWFB 4ODXB 1YQVL 1SEBB 1PD6A 3T4AA 1A9EB 1XFPA 5FKPB 4KPHH 5JO5B 4OIBA 1FV1B 4PJEF 1EV2E 4HSQA 2XYCA 1K85A 4P2QA 1MJ7L 3MJGX 5IGXH 4Y7MA 2D03H 3D5OF 1S7RA 2FLRT 5B38G 5DWUH 2IEPA 1UJ3C 4PJ5B 1GIGL 3WJLC 4ISVB 1RURL 3JTTA 1I9RH 2BOBB 3U36B 5EU5A 2J5LB 3X14B 1OLLA 4NNPH 1B9ZA 1R24A 1ZHLB 2XZAL 1JHLH 1Z9LA 3O4LA 4UIKH 2VTFA 3FN3A 4Y4HB 4X6DA 3VGHA 1U6AL 2OL3A 2AJSH 4YUEL 3OPZL 3TBSB 1K6QH 4OZFG 1KB5A 4PJ9D 4S1RL 4FFZL 3VA6A 2FIKB 1U3ZA 1JK8B 3SKJL 1J8HA 4U2YA 2R0KL 5BZDA 2AEIT 3GJFH 1MF2H 4P2QB 4BUGA 1AGDA 4P2OB 4F7PA 1Q72L 5D7LD 3KLDA 4J4PD 1BZQK 3O11A 5DD1H 2BFVL 3T4YA 3B6SB 5I1GH 4R4FH 1FE8L 2DM4A 3RWIB 1TJHL 3VW3H 2WWMD 1WZKA 2VISB 3PHQB 1DQJB 5F7YC 4WI2A 5C08E 1CK0H 1JFQL 1NKOA 4TTDD 3SDCA 5JOFA 3H9ZA 3HNTL 4PY7A 4KJYA 1A6ZB 4R7DB 2E7LA 3DOSA 4W6YB 2XWTB 1RULL 2IMMA 4HC1A 4NQDE 2CGRL 3CX5J 2JF1A 4N1CA 4PG2C 1RK0B 3UJJH 4XPHL 5T1MA 3FT3A 3SKNA 5TF1L 1F90L 3UX9B 3MX0A 2DDQH 1FSKC 3AM8A 3TJHC 2BOCB 1M7DA 5LAXA 5DJ6B 3EOBB 4X6FA 5DMIH 1S8DA 1RK1A 4GMSL 4ZXBC 4FMFA 4BSJA 3HI6L 3IB4A 3NFPA 5DD6A 3SQOL 3GMMA 1MEXL 1YEFL 2WQRA 1J0YA 2H2SD 1PY9A 4FFYL 3ARBA 4JDTH 5MEPB 5BW7A 3BX7C 2P8MB 1DSFH 1U93A 4ODVH 5IBTL 3VH8A 4Y4KC 4BZ2H 5IFHH 4JFEB 1X5IA 2QQNH 3EHBD 1C5BH 1W2KT 1R3IH 3PWNB 1S78D 2L0DA 3BAEL 2X4PB 5EUOE 5JHLH 3VG9B 5L9DL 4YAQB 1MCIA 2EKSA 5KVDH 4Y4KB 4GXVH 1K4DA 4M6NH 5IB1B 4HWBL 4Y16C 3FCTB 3INUL 3GSVA 1U8IB 5JOPD 3H0TB 5CJOH 3UTTA 2WLZA 1VPOH 4ZYKB 4N9GA 4URTB 1BVLB 5E8NB 3WDHA 4OGAD 4ZDHB 5TFSH 2H3NB 2NY4B 4Q6IB 5HHNA 4HWNA 4Y4FD 4M8VA 1R0AL 1J88A 2ZCKL 2A77H 1A0QL 4HV8B 3QNXB 2W0LA 4F15C 4U1SB 1HNFA 1K4CA 3ZZ1A 2QSVA 4ZOCA 3OJVC 3RUGA 3GSNH 3GHBL 3V9FA 1OW0C 4AEIL 3NN8B 4G6AC 4GBXC 2ICWA 3IDXL 1A7RH 2HA1A 3TNNB 2AK4D 3FQXA 1G9NL 4N90D 1NLBL 3ARSA 3LEYL 5CAYB 1MRFH 5DMGD 3GBML 3S37X 1E28B 3RU8H 2WBJB 2NY2C 2I9TA 2MKLC 1NANI 2YRLA 3CJJA 4KJQD 3MRDB 5I1IH 3TH3T 2XTJE 4MCYB 5ENWA 3CLEH 3C6LB 3QZWA 2VDNL 2PO6B 5IB4B 2Z4QA 1M1SA 2CD0A 1MI5A 4Y5YB 4YE4L 5GJTH 4OD1L 3ULVE 1QLEL 2V2XA 2AJVH 4G7VH 1YPZE 4P4RA 3WV0A 1H8SA 1MWAH 3BQUD 4LPVA 4H1LG 3KPQA 4MHHG 4CU6A 1UB6B 1G9EA 5DLML 3RGVC 3IVKA 2XZQL 2PNDA 1NGYB 5C0JB 3MV7E 5H35A 2VERN 1AQKH 1DUZB 5LCVL 3C87A 5J6GA 4ZNEE 3LN5A 5I1HL 4OZGF 4JN2A 1DQQB 1BX2A 3B9AA 4FTVB 2DKSA 2XQBL 5CBEA 4Z7VE 4YHNA 4JM2A 4QHKJ 4RFOH 4LLAA 5F9WC 3T4YB 2WIIA 4Z0BH 1AI1H 3QUZA 3GMRB 1OM3H 3WEXA 3BMWA 3NIGE 3RA7L 3VWJC 4QRUB 1JWUA 5I71B 5HI5D 1J5OL 3KLAA 2GFBA 5EDXA 1KIPA 2OQJB 2XN9E 1GC1H 2YPVH 3MBXL 3PE9A 1I1FB 3QQ4A 3F8UB 1J1XH 1KTKE 1N26A 1TMCB 1X5JA 4NRXA 4AM0B 3QIUD 3KPNB 4JREC 1N6UA 4Z78B 1DBML 2LTQC 3BP4B 5CWSB 5IVXA 3SDAA 4LLUB 1VDGA 5DHVA 3NBNA 3OBAA 4HDIB 3ISWA 4LNRB 2X4PA 3C6LD 4HV8A 2NCMA 5CD5D 3OKNA 1JBJA 5JA8B 4OLZL 3GO1H 1Q8MA 1ODAA 1R6VA 1I8IB 5LQBH 5C9KA 5I2IB 3DRTB 3VD5A 4OLXL 5IFJA 3LB6C 2VMFA 4P99A 5IVZB 1EDQA 4GKNA 4LLYA 2XY2A 1NAKL 4LGPB 4HJGB 4KUZL 1DVFC 1JGVH 4XPAL 4MNQE 5M94B 2AJUH 1XGRB 1P6FA 3O3BA 3HFMH 4PV9A 2FX8L 1NEZB 2AJYH 2LVCA 1K4DB 2VR5A 2J8UB 2ICWJ 4KKCD 3EDJA 2E6QA 2ICWB 4LSRH 1I7UB 5GRVL 3PWNA 5J1TC 4ZQKA 5CILH 4OFYA 1CFQA 3UPRA 3IAQA 1W72H 2GJ6E 1QNZL 3W5NA 2YUWA 2IJ0C 3SGKA 2CJUH 4JQIH 4Z7UB 5C6WH 1WF5A 1DVFA 4HKJB 1T3FB 2OK0H 4CADB 2AEQL 5GSVA 3N50A 1QRNE 2VZUA 2DI8A 4ONGH 2UYLB 4GAGL 4PS4L 2OTPA 5DMKB 1ED3A 3P73A 3BZFB 1WC7B 2GTWA 2X10A 4R9HA 1DBAH 5C0BB 1WT5C 3NCFB 3ARFA 3BPOC 3ZE1E 5F1OB 3SN6N 5JQ6L 4KJPD 4F7CA 1EVTC 3BSZH 4HKBA 1WBYA 3CLFH 3VFGH 5EG6C 3OX8A 1BAFL 2NXZB 5E2UH 1DFBH 3NCYS 3QZWG 4D9RE 4UT6H 3QUYA 2DQHH 3HLAB 1LGVA 1V3LA 5B4MD 4GT7A 4M43H 3CNKA 5SWZD 5CMAB 3VFVB 2FECI 3C8KB 4NZRL 3BRDA 5KANG 1BM3L 5MP6H 5B8CC 1S9VA 1NL0H 4U6HA 4C54A 4QHNB 3GNML 5J57B 3SKOB 2L4OA 4K9EC 3WFEH 4AEHH 1KENH 2M2DA 2NW3A 2JJTA 2QL1A 3CVHL 5DJ6A 1RVFL 1BWWA 3FB8B 2WBWB 5JW4R 1N6VA 4CDGC 1V7MH 1BJ1H 5IMOA 1KT2B 3KYMB 1HYSC 1RZ8A 1RU9H 2NTSP 2F8OA 1J8HB 4KV5F 4L3EA 3HI1A 3RKDD 1V8HA 3KDMB 4HWZB 4E0RB 1CDYA 1HKFA 2EEAA 2WLYA 4F37F 2GHWB 2NY4C 3DX8B 2BNQD 3N85H 3UDWC 3O4LE 3KPSB 4OD3H 3MLVL 4JQXA 1U8KA 1TXKA 1H5BA 4OM1H 2ZUVA 3JWNC 4LNRA 3BW9B 3L95B 2F53B