1XGRA

Structure for antibody hyhel-63 y33i mutant complexed with hen egg lysozyme
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
215
structure length
215
Chain Sequence
MDIVLTQSPATLSVTPGDSVSLSCRASQSISNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody kappa light chain
publication title Magnitude of the hydrophobic effect at central versus peripheral sites in protein-protein interfaces
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2004-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xgrA01
3JWNC 4NT6A 4NN5C 1SM3H 1Z9SA 5F1IB 2AGJL 4DZ8A 1CGSL 2XPGB 2C5DC 1FPTL 4RQQB 3V6OA 3OKEB 3TN0B 1EPFA 3RWCB 2RGSA 4K9EC 1GIGH 2H2SD 1UEYA 4PJEA 5AZEL 1FCGA 4K3GA 1KTDA 1QD0A 4UILL 3B9VA 4PP1D 3MNWA 5DJ2A 1F8TL 4PP2B 1N3NA 3V6FA 3CPLB 4QRQA 3WJLA 5MEPA 2Y07H 3UZEA 2DL2A 3FQUB 1M71B 4LFHG 4A2MA 5FHBL 2YPKA 4HWNA 1JN6B 3TYGL 4AEEA 4HGKC 2QQKL 2GY5A 5DRXA 2FHFA 3MLTA 4NO0D 5CHNA 2I24N 1MJUH 4KMTH 4UB0L 1CDUA 5D7SH 4KXZH 1VGKB 1I7ZA 4ZFOA 4AENB 1WWBX 5DJ8A 3QZWB 4P2OA 4PRIA 3QFJA 2P24A 3RVVD 4BELD 2MQ3A 4G7VH 1Z9OA 3DSFH 3OPZH 3V9FA 4J3TA 3P77B 3KPOB 3KPLA 2RIKA 1S7UA 3K80A 2EEDA 5D7LA 4KDTC 5T33H 1BF2A 4K71B 4LDLB 5KBNC 4GG6A 3IDIA 4X6DF 5BMFH 1JZ5A 2A73A 3VFPA 3DETC 4GKZB 3QXDB 2IAMA 2X9WA 1BZQK 2DTMH 3TWCL 5IVZB 4JQIH 4JO1L 1FNGB 2HWZH 4EIGB 7CGTA 4FZEH 3EFFA 3TESA 2XA8L 5JQHC 5JXEC 1N6VA 4ZOAA 3VRJA 3VXQA 1U8KA 3HE7B 3KJ4B 4I2XE 4RGNB 4Y1AE 3EJYC 4Y8AA 3IFPB 1LE5B 1EO8H 2UV3A 2XWJB 4LPXA 4QHLA 5FYLH 4WW1B 3VWKB 4OTXL 5C0JB 3O2DA 1WCBB 4ODUA 3UXFA 1IEBB 2DLIA 2E9IA 2XI9A 3FONB 4NQDB 3VXPB 2HVJB 5DJAB 4A2LA 1T80A 4XAWH 5E8PA 3ZTNH 3IAPA 1B2WH 3GJFB 3LKPB 4PGCB 1U8PA 2AI0H 2XY2A 4OM1L 2J12B 4J8RB 5DK2B 2J2ZA 4PJBE 1YQ2A 3SDXB 2VLKA 4Y2DA 4F33A 2ED7A 3BD4A 1DBML 4G8FB 5CJXC 3UP1A 5D5ME 2PN5A 1P53A 2WWKO 4P46B 5ESVB 4X4YA 3TBTA 4TQEL 4CN4A 1WAAE 2AV7A 4R4BB 1VESA 5E2WH 4NO3A 4P99A 4YGVA 5TF1L 3HC3L 4O2CB 3GBLA 4XP1H 3RPIB 4X4MA 3RJDA 1R0AH 4IRSA 4DKEH 2VLLA 4MA3A 2B1HL 3QEUB 4NNYB 3MRDA 1OAQL 3FRUA 2PYFA 5JHDA 4IRZL 5HYSA 4YHYB 1HDMA 3MV8A 4PRHD 3H9SE 3OJ2C 2IBBA 5JQ6L 3B2UC 1FFOB 3BD5A 4U3CA 4MXQC 4M7KL 1HH9B 1WQVT 5ICXB 2APFA 5ID0B 4X98A 3U9UB 1QLFB 4NNPH 2F8VA 4Z7WE 5FAAA 4HUWA 5EU7C 2UY6A 4PY7A 4WU5A 5D2LB 4TVPD 1PG7W 3AROA 3BPOC 2HN7B 2LABA 3TFKD 5JPMB 3SGEH 3JV6B 4QRUB 1ZT7A 3ULUF 4UBDD 3AUVA 4O4YL 1DUYB 2DD8L 4Q9RL 1FORH 1EUTA 2DBLL 4G43A 5IK3A 1JNNH 4HKXA 3GKWL 5I0DA 1BX2B 4NHUB 3LH2L 3C6LA 1KN4L 2DWEA 3PJSB 4JE4B 1QSEB 1OAXH 4DW2L 3LKSB 2JLLA 3OWEA 3VXOA 2CRYA 4U3XA 4FQXB 1I8MB 3BESR 3TNMA 3MOAH 4L5FH 5D1ZA 1JPGB 1QYGL 3O0RH 1NBYB 5K93A 4HJ0D 1RZKH 4ZPVA 5DD6B 5H94B 2CSPA 3TA3A 1YA5A 4LKXB 5J12C 3AM8C 4EI6A 4U1LB 4TVPL 3HAEH 1T1XB 1K4CA 3UX9B 1JPSH 4H25A 4GW5B 15C8H 2E5EA 1JGUH 3RUGE 3MLPA 1YMMD 1IC5L 2XY1A 3B9KB 3WEXB 4KK5C 4D9LH 3DHJA 1FE8L 4JFEB 5B8CC 5CUSL 1AFVL 1ZSDB 2KPNA 4HUKB 3NGBC 4MGXA 1T6WA 2VL5B 3MXWL 2X4SA 3HUJE 5BO1L 4WW2C 3MX0A 1EH9A 1NBZA 4EUPG 3MNVB 3ZKNC 1FP5A 2JKXA 1FO0L 2BHYA 4OLVH 5EORH 1MLCA 4PGBB 5KVGH 1NCAL 3FQWB 5BS0A 3QEGL 1BM3L 1OF2A 1PQZB 2YPLB 3OKMA 4IIQB 5H35B 2A77H 5IBLD 4DVRH 4ELKB 4PRHE 1U36A 5EOTA 5TFSL 43C9B 4AYFA 3FB6A 5CSZB 1UXWB 3VFMB 5C7XH 5JIKA 4X6FA 3TYFB 5HDLA 3RWHB 4G6KL 2DQGH 3LKNB 5HI3D 4LCWA 3CMGA 3QQ3A 3VRLF 12E8L 4FQHB 4HS3B 4Z0BL 3ZL4H 1XGQA 1E28A 3BW9A 4XCCL 1G6RL 4KDVA 4HGWB 1MVUA 4S1DC 2BNRE 2L7JA 2ZUQB 4NUGL 4PRPD 4TVSa 1E27A 4W68A 4G9FA 5MEQB 3PWLB 1X6LA 3QXVA 1AJ7H 4HT1L 3ZTJG 5E8EB 1NGQL 2VDML 4RIRB 4E41A 3AMLA 5L7XH 3MQIA 5F7KC 4K3JL 3VFTB 1G7PA 3IVKB 5KW9H 5I76B 3M8OL 3OG4B 3VRIB 3QDAA 5I1AB 3DVNA 1U3ZA 5D8JL 3RTQB 3V4UH 2P49B 4R7NA 5T1LA 2E27H 1ZOXA 4ZS7H 4LDOB 3CNKA 4JFQB 1NCNA 1JF6A 1LEKB 4Y4KB 1ND0A 4YX2L 3T65B 2VN4A 3HTLX 4JZJB 4DCQB 3EYVB 3CLFH 1PG7X 3B4NA 2G2RB 1RV6X 1D5XA 4DZBA 1JNHB 5GGRB 4FQPA 3SDAB 5A43C 1JF1A 4MJID 1NDGB 1UJTA 1J8HE 3MGOB 4TUKL 1NDMA 5CMAB 5HGHA 3GIZH 2K1MA 4LARH 4BSVA 4ELMF 3C8DA 3T3PF 3MSPA 2QKIB 2F19H 4HZLA 4IOSD 4HUVB 1FCCA 1KBGH 2FO4B 3L3OA 5HVHB 2ZKHH 2ATPB 4GUPB 1JTOA 1CLOL 3QULA 5E8DL 4PLNC 4C57C 2OI9B 1ITBB 1I85A 4Y5VA 2YD7A 1TZIB 4M7JH 3VXRA 1NC4A 1KEGL 5JMRA 2YRLA 3MLSL 3K4AA 1T2XA 2X09A 2HKHH 3EYUL 3WUWG 1IKFL 4LP5A 4RCAA 1CTNA 3NIDE 1RZ7H 2X6MA 5DI8A 1RVFH 3GJFH 1O5DT 3GI9L 2VC2L 4HK0B 4FABH 1U8LA 3CVIH 5E5UB 4HIIB 2YPVL 3WFHA 4IMKC 5T1KD 5LJYH 4LVEA 5K9KA 2WBJB 1PJ9A 4Q6IB 3SPVA 4Y2OA 5E4EB 4KRMB 3WHXA 3VGGA 2Y5TB 3H3PH 4PLJC 3P9WB 4O51B 3D6GA 5DD0L 3IS0X 2BVPA 5TDPB 3T2NH 3OJDA 3V7AE 3ZE2F 1RMFH 4Z7NE 3MBED 5D2NC 1K6QH 4X6CE 1OGAA 3B2VH 4YIQB 4XWOC 1KXQE 5DHVB 3GSXB 1EJ6A 3MA7B 2B39A 1CFSB 4NQEA 1QNZH 4KH2A 2EO9A 1CICB 3G04A 4XP4H 1EFXD 4OCWH 4XXDB 4PJFA 1JZ3A 2IWGA 1U8MB 4ODWA 2J8UF 1JUFB 3V6ZA 3SE4C 3LHPH 2GJJA 1IAMA 5BV7B 2YBRA 5C0CD 1P4BL 1A9BA 3E3QE 4FFZH 4KQ3H 4RDQG 4GW1B 5C0FA 2ZOLA 3MBXH 5IGXL 4YFDB 2AAVA 3Q3GA 3D0VA 3Q6FB 4NGHL 4HULB 3GMQB 4Z7OE 5ADOL 4NP4H 1RZKC 2X4QB 3ZE0F 2FX7L 1VFAA 4KRPD 1LWRA 1KPVB 5A3IC 2QSCL 3PP4H 1IAOA 3W2DH 3HC4L 3ZT6A 1NGPL 3FQNB 3QIWB 4YDKL 2Q7YB 4YDVB 4OAWA 1MCLA 2EH8H 5FO8B 3QISA 5IG7A 2GITA 3MZGB 1NJ9A 2MQCA 4I13B 4FXLA 4UQ3B 1U8JA 1MHPH 4N0UA 2MMXA 2YKLH 3KDMB 2V7NB 5IF0B 2WV3A 1U3HD 4K8RD 4WWKD 3BUTA 3DMMB 2CMRL 3FQTB 3MRCB 3RIAF 4NZDA 1QQDB 4JVWA 4RA3A 2DYPA 2IJ0C 1HQ4A 3I85A 5LGJA 4BZYA 5FUOH 4HK3J 2EDEA 4MNGB 3IKKA 1U93A 3WD5H 4NFBA 1IARB 4M1CC 1PZ5B 2E6PA 3QFDB 3TN0C 3CLEH 3ULVF 5IB1B 3DUSB 3CDGB 5E2VH 1T89C 3DNKA 3BMWA 3QIUC 3KVQA 3RWEA 2WSKA 1QBMH 4M9OA 3F8UB 5B22A 4X5XA 2HT3C 4Y5XB 1EV2E 1H3XA 5J6HA 2B1AL 1Q38A 4CVXB 4LPTA 5ID1B 3L3GB 3PE9A 5FOBB 3MV9B 4GO6B 5TPWL 1DE4B 1ZTXH 1QP1A 1RUAH 3FKUS 3D5OF 4M43L 4WWID 3NFNA 3IDNA 3F7YB 1CL7H 4HC1A 1H15A 1DFBL 1IC7L 2E9WA 1RJCA 2QHLA 3KLSA 1V5JA 3VFVB 1OQXA 5MERA 2AKRA 2X1PA 2E3VA 1JHLL 1L7TL 1IAIL 1IM3B 3V0WL 4ONOA 4QO1A 3FO2B 3JWOL 5E8NB 2VDRL 5C0CE 1WBZA 4PRDA 5CINL 3MLZL 3ARSA 1D3CA 3PDGA 4M7LH 3E1F1 5FO9B 4JY5L 5ECJE 4K71C 1XZ0B 4W6XB 1S5HB 3EOBA 5E6IB 2AW2A 5EIQA 2BNQA 2EDFA 3CMOH 2E7BA 4NCDA 4CBPA 2A6IA 4JHAL 1ZLSL 4PGDA 4PRNB 1GGUA 5IHBA 2YRPA 1DVFD 4M61B 2LV4A 4IS6B 3MUHL 2NY0B 4XMKL 4OQTL 3QUZB 5I17B 4M4PA 3UROR 1B9ZA 5KVDL 3HE7C 2CD0A 1KC5H 2OTUA 3KJ4C 2VQ1A 4RGNC 2X7LA 3N1PC 2IQ9L 2FJGA 5JIPA 5CILL 1MHCB 5F1SA 3U4BL 1QLRB 3K4ZA 2GIYA 2OTWA 2J6EL 3UCRA 4NQXB 3VWKC 3V8CA 1MRDH 3ARYA 5IBTH 1R3JB 1YPZE 5DHYA 2DF3A 2DL9A 4PV9A 1IC1A 3TPUB 3IF1B 4WO4A 4C56D 1J7VR 2Y72A 5I18H 3BOVA 3AS2A 1KLFA 4YDLB 3BZ4B 4ZSOB 1W2KT 1MCCA 1OAYL 3DTXA 5J13B 3EHBC 3FB5B 3NTCH 4MNHB 1RZIA 4L4VB 5IV2B 4XMLH 2PYED 2G5BA 3ORJA 3S96B 3HS0B 4EQ3A 1W8OA 3K8MA 5TDNA 1XGPB 3NN8A 1P5UA 4U0RB 1S7TA 1OSZA 5AYUH 1AXIB 1INQB 4JN1L 5EUOF 1JGVH 3U7WH 4YXKH 4P46C 1LD9B 4AMKH 4BFBD 2L4OA 4IDJL 1Q0XH 1KIQA 2NZIA 3TVMA 3EFDL 2JB6B 2VRAA 4EIZC 1FO0B 2F5BL 3QB7C 2EDWA 2R1YB 5ETUB 2GI7A 5LVEA 2DI8A 3ZE1E 4ZUTA 2R4RH 2JJWA 2X9XA 4Y19A 4APQD 3H9ZA 3AMKA 5F8RC 4YHYC 4D0CB 2OJZL 4X7SL 4LSPL 2I25N 5CD3A 1HHGB 3MRRA 3LQZB 4GRLB 3QUXA 1GOGA 1J05A 1YJDL 3B83A 5K9JL 4UU9A 1MFDH 1W0WA 5LWYL 2BNUA 1SMAA 3VFSA 5DK0A 1LK2A 4ELMB 4XRCB 3RGVA 1W72L 3HE6D 5K33A 4MWFA 1DQTA 4PD4K 4NO2A 1XGRB 4PJ8B 2Z92A 4WUUB 3MMEA 4TSCH 4LLUB 4F9LA 2NY2D 4MQ7B 1K5NB 2AK4D 4WCYL 2HP4A 4MX7A 5ELIA 3GUTB 5I8EA 3BP7B 4L3EA 1UG9A 1ZHBA 3CAFA 3VMNA 1EEQA 4BZ2H 4UNTA 1BVZA 3REWB 3L5IA 1M7DB 3FB8A 3PWUA 4EDXA 3TT1L 2DIAA 3HG1B 1WFOA 2Q87A 5K9QI 4FQXC 5DEFA 4JRYD 4LCCB 3T08A 1ETZB 1KIUA 2NY4B 1JHKH 3LN5A 5CJ8A 4B7LA 2R2CA 1S3KL 3QG7H 4XP5L 1D9KB 5JOPE 3U46A 1QG3A 4HXBH 2ZUWA 4LSUH 5IJVB 2PYEE 4P2QD 3MRPA 5FYKE 2RAMA 5LQBH 2HJFA 2L7UA 1HZHL 4D0BA 4EJ1C 3MR9A 5IJKA 3B9KC 4OLUL 2A6KA 3K2UL 3QNZB 1GGIL 4YDJA 4P9HC 3OSKA 2FEEI 2Y06H 4DTGH 3CZFA 4XXCC 4M9PA 4QCIB 1V7NH 4M6NL 1YEEH 4AQOA 4YHZH 3IAQA 2R56L 1INDL 3UTTE 4G7YH 4M1DH 4YHKH 1LO3H 2QLVB 5TDOA 1DN0A 5L8KB 4PJIA 3PGDA 5EC2A 3VXUB 4EZMA 2HLAA 2J8UB 5D7JD 1Z6JT 1FLRH 2VZ1A 1N6QL 1W0YT 4XC1L 3TIEA 4XHJD 1A4JA 1XF5B 4YUEH 5FDWA 1JI2A 3B9DA 1NCUA 3GSQA 4IIQC 1ZANL 5GJSL 2GSIB 5C09B 3DYMA 5F7FA 1F3JB 2CIKA 4JFHD 4U7SA 4YWGL 3LN4A 5ICZB 4XI5C 1QRNA 4UDUA 2XZZA 3RHWF 3Q48A 2E7CA 3U0WL 2MFNA 2QADD 3BRGC 2I60H 4CDHA 1CFNA 3G6DL 4WY7L 3G6AA 3RDTA 2JK5B 1BBJB 2ICEA 4MMZC 3SO3B 3WIIH 2OR9H 5IR1B 5JORA 3STZB 4HEME 4X0KA 5KSBE 4WW2A 5CBEB 1KYOK 5DR5L 1T66C 4Y4FB 3DYPA 2XXMB 2ZUQC 1GGBH 1NUNB 1G9MC 1ACZA 4QXWA 5F7HA 3BKYL 1HCVA 1EEUA 4X8JA 2GJ6B 3O4LB 4JAMA 2AK4E 1FL5B 5GRVK 2LVEA 3O6MH 5DJXB 1E6OL 3RAJH 1ZKAA 2IPKB 5ICYA 1S5IH 2IH1A 5EU6A 1QFWL 4HH9A 2FZ3B 4U6YA 3T4AA 3RTQC 4KDWA 2V6HA 5D6CA 3UAJC 4FA8A 3EOTL 1B0RA 4MA1B 2FECL 1UM5H 1BWWA 2FHCA 4JRYE 4N5UA 4NDMA 5T3XD 2CR3A 4ZUVA 5E9DB 4YLQT 3NZ8A 2XG4A 3OAUH 3QUKA 4Y4KC 1I75A 2WK2A 5JNYA 2ORBL 3HNSL 3V5HA 3V6BR 2P42B 3I3BA 1Z3GL 5BQ7A 1QSFE 2MJWA 1A7PH 3T04D 1E4JA 2MSPA 4H26B 4O2EA 3SDAC 1TMCB 5T1DH 4LSQH 1F3DJ 2A2QT 5SWSB 4YAQA 4UOW1 3PXJA 1P7HL 1P9MA 1RJLB 2IG2L 3HZVB 2EDYA 1CR9L 2BVYA 4NYLB 4AEFA 2XZCL 4OT1H 3C8KB 2BVOA 3EUUA 5KSAA 4IHOB 1RJZB 4Y16D 1RFDH 5D1QB 2P5WE 5HVHC 3ARFB 3MJ6A 5BW7A 5C0BB 2OI9C 3MCLL 3IJSA 3GHEL 3SCMD 3LKRA 2VOTA 4L8DA 3DGCR 5JXAH 4FMFA 2HMIC 2OXHA 1FBIH 1TZGL 4H8WC 2WIIB 2IGFH 1IKNA 4KRLB 4JFHE 1MIEL 5KVFL 3GJFK 3SKOA 4CMMB 2NY6B 2VWEC 3KPPB 1DQJA 3GMOA 1JGEB 3C08L 1CLYL 5DDHA 4UV7L 1VDGA 1BFSA 4BSJA 3MRBA 1EAPA 1G7QB 4XVSH 2RHEA 1RIHL 4WTZG 4WI3A 3L3KB 3MJ9A 4Q6IC 1XAUA 2XV6B 1JYWA 5F3HA 1VCAA 1I9RH 1F2XK 5E4EC 4LHUB 1C5DB 3TBSB 4PY8J 2UWEE 4XBPB 4G8EB 2BVQB 3CK0H 3TV3H 2QL1A 1XF3B 3MA9H 5CKAA 4R3SB 3LZFH 3U6RB 1KUMA 5FYLD 4B7IA 1P7KA 1WC7B 5E8OA 3G6JA 1INEL 5CZXC 5SX4I 4OKVA 4GMSH 4OF5A 3UC0H 3H7BB 5CZVL 2IPTL 1X5JA 3O3UN 3QI9A 4ORGB 2XFXA 2A6JA 1IM9D 3HNVH 3QH3B 1CICC 3ROOB 3QDGA 4ZAKB 5TQ0H 2J7LA 5E70A 4BA8A 5HDQH 1DBJL 4HWBL 1JPTH 1S9XA 5BV7C 4YHLL 2CJUL 3E2HB 4JZNA 4QOKD 5ITFB 3TC9A 4PJXE 5FGSA 2EDRA 5DUMH 5ERWA 3W82A 5C6WH 4R0LA 2GUOB 5DTFB 4X6EB 3D18B 2DI7A 1N59B 1FG9C 4PJHF 1UYWL 1F90L 4BKLB 1FVCA 4LDEB 2K7PA 3EZ8A 3VXSD 5ANME 4DUXA 4JKPL 5EUOB 4KVCH 1KNOB 1FJ1A 2P5EA 3HR5A 3PL6B 5J1TC 1PW3A 1ULVA 2MPAL 3QIWC 4AEIH 4EXKA 5IB3A 4P23D 3SBWC 2YSSB 2HTKC 4U1HB 2Z4QA 4EN3A 3AB0B 1F4XL 4MQSB 4OZIE 2E9JA 5AAMA 5D7KD 2EXWC 4PTUB 2YWZA 1K2DA 4NQTA 4X4ZA 5E00B 5CJQH 3EIFA 3DMMC 4RFNB 1Q9KB 3PHSA 8CGTA 3BAEH 4HCRL 1IGFH 3D85D 4Z7UE 3CDCA 2LE9A 3KPQB 3KJ6L 2XKSA 2GTWB 4LFHD 4DN4H 4OCYH 3FFCB 3W0WD 4CU6A 4K94L 1CFTA 1XGUA 5I8CA 1FZMB 2RQ8A 5TH2B 4OZHB 4FQJL 5HHXH 4OJFL 1I7TA 3QDMD 4NRXA 4PJAE 3GJEA 3WSQH 4YGAB 4E5XA 1QUNA 1X5IA 3VXMA 3GSNL 2YOCA 5I8OH 1MREL 1GVIA 4GXUN 1A8JH 1BPVA 4LLYA 3D39A 3NZHL 4Y5XC 4KXZI 5INCA 1A3RH 5CGYC 3O6FD 4QF1B 1MI5B 4GSDL 2WUCL 1R3LB 5HHOD 3ULUC 4I5BB 4GQPH 4P4KA 4NO5B 5FYLE 2BSRA 3QAZC 4FQ1L 3FT4A 3I2CL 1YNKL 4N0YL 1FYTB 1H3GA 4FXGA 5F1IA 2J8OA 3CFJA 1CU4L 1FZOB 2P7TA 4I77H 5GZOD 2JJUA 5C2BL 3WYRA 2X4TB 4HUMB 1KIPA 1T89A 2HFGL 4X6BB 4OSUL 3C9NB 4MD0B 4KHXH 2DLFL 4U1SA 3X12A 2F8XC 5KAQG 2ITDA 4PTTA 3VGHA 4HQQL 5FECB 1FL3A 4G3YL 2X2YA 1WFTA 1MCEA 2YD1A 3AFLA 1EHXA 3BWAA 4UDTA 1EEYA 1E4WH 1NCWH 5E6IC 1WZ1L 4UAOB 2NY3B 3FN3A 4XMPL 3VXSE 1YDPB 1U95B 1UWEH 5F89B 3VFWB 1UWGH 1PG7L 4JRWA 3HAEG 1FGVL 5KS9E 2HRPH 1FLTX 1G7HB 1T21B 4KZDL 3QNXA 4GBXA 1XF2B 3T1FB 4JFYB 1J5OL 3FT3A 2NY0C 1IRAY 4JANA 1YECL 4G6JL 1EMTL 3QUZC 3OB8A 4P2OD 4PRID 1JFQH 3QFJD 3EYOA 5EZOH 4R4FL 1ZHLB 3BO8A 3N1QC 5D7KE 1T20B 3RU8H 1N5YH 1HXYB 3LEVL 5I30H 4LCUA 5D93B 4NRYB 3BGMB 1HE7A 3ULVH 3N9GL 4J3UA 5D7LD 2VAJA 2FATH 1WLHA 1ZHNB 4C55A 2YD5A 3O2VH 4B5EA 2VLRD 3CC5A 1DANT 4XTRC 1X5YA 2A1WL 4Z5RB 4P57A 3CSGA 4YDLC 3ES6A 2VUOA 3RL2B 5J13C 1N2RB 5H8DA 5TE7H 4G8GE 4M5YL 3RIFF 5D2NE 4FS0A 4XNZB 5HYJB 4ERSH 3MV7B 1L7IH 2ZCKL 5D5MF 5EG6C 2ZOKA 2VDPL 3MJ9H 3R0MA 5F93C 4OIIH 4M7ZB 3HPJB 4RAVA 3RWDB 2PCPB 4U0RC 4YNYA 4JRXE 3N1FC 1FG2B 2EE6A 2A6DB 2H6PB 2AJ3B 4RZCB 3ARDA 3MXVL 4AEHL 3Q6GL 3PWVA 5LXGL 1A1MB 2JB5L 1X4XA 1FZKA 3NCBB 1TQBB 4JM4H 1IEBA 1EFQA 4F7MB 3CSPA 2P43B 3NABL 2DQFB 3QRFM 1DUZA 3QZWG 1QO3A 1N5AA 4B41A 3MRFA 2EDLA 1A6AA 3ZHDA 1J1OH 3ARPA 5C3LD 3CCHB 3FO9A 3MLWH 1YEKH 4OGXH 1FC1A 1J0IA 4R26L 5JOFA 4KAQH 2VDOH 1AGCB 1RK1A 3OGOE 3MJGX 4PJ9C 4Z7WF 3KPNA 2VLKD 4Y2DD 2BSED 5CAYB 3P11H 3MLXH 3HZYB 4G8FA 5CEYA 4XPBH 1H0DB 1AXTL 2J88L 4PV8B 5EU4B 5HJ3A 3SGEI 4F8TA 4PIRF 3LS5L 4Z95H 3HI1B 4L8CA 5DLMH 5LCVH 5C0AD 1SY6A 1REIA 3QHTC 5EOCL 1ZLWH 2BDNL 5LAXB 5E6ZA 3V79C 4O00A 5TJWK 5IUSA 4N8VB 4PJ8C 5DA4A 3QFJE 3RI5F 3FZUD 4UI2A 3ARGB 4HKBA 1XMWA 3QEUA 4IRSD 1LEIA 3L9RA 1EHNA 2A83B 5JHDD 2ZG3A 1MOEA 3ARWA 1N64L 3WBDA 3UZVB 5D70L 2H8PA 4MCYB 3PGCB 1FGNL 3H0TB 2R0WH 1KENH 3MV8D 4WEBH 5JDSB 3LV3A 4XVUD 3BZFB 1MCQA 1F4WH 2FHBA 2V2XB 4QRSB 4GG6E 1P6AB 2M26A 3HNTL 3HMXL 4YE4L 1N8ZB 1JMXA 1DLHB 3QCUH 5HHVH 4UNVA 4LCCC 3S4SA 1T7WA 2AEPL 2AQ1A 4OUUB 1U58A 1J1XL 4S1SH 2NY4C 4IOIA 3RUGF 3QPXH 1S9YB 5D6DC 3EO0B 3BP5A 3AXLB 2BOBB 3JV6A 3KR3L 5AUMA 2MCPL 4NC1C 2W91A 3BT2L 2NTSP 2EXYD 1UZ8A 3HUJF 1B4JH 5C08A 3JWDH 2R2EA 3MOBL 3P0YH 3C60A 4PRAA 3O3AA 2Q8AH 3EW3B 1HSBA 3C6LD 3S36X 5L2KB 1EX0A 1FVDA 4DKFH 3G5YB 2DRUA 3QDJD 4X7DC 1C12B 3T4YA 5I1HH 5IQ7H 1BFTA 1RUML 2APVA 2GEEA 5DJ0B 2CK0H 4NKOB 1FC2D 4WUKL 4NQCB 1ZS8B 1QPPA 2RFXB 4BQBA 3LDBB 3RVUC 1BHGA 3FAXA 4F57H 4LEOB 4P3DB 3DV4B 4LCIL 3CVHL 1X5FA 4LQFL 4NKDB 5ESAB 1XCTB 4YJZL 3QUML 3PIQB 5IFJA 3SKJL 3L3HB 4QY8B 1DQDH 1MJ7L 1FNLA 3I75B 1UZ6E 1ZSDA 3QQ4B 4K7PH 2GAZA 3SO3C 3LRHA 1PZUB 4GXUM 1R3HA 5T3ZL 4MAYB 2FYYA 1PEWA 3GK8H 4RMTA 3K1KC 2NX5B 1BFOB 4Y4FC 1A7QL 4KK8C 4DAGL 3BP4A 3GSUA 4J4PC 4X4ME 3U4EB 4PD4J 6FABH 4ODBD 1AGEB 2AERT 2GK0A 4JN2A 1CLCA 4MA7L 3HI5H 5BS0D 5DRNB 2YPLA 1NAKL 2XIDA 4YR6A 4ALAH 1NEZA 4Z18A 3QWOA 5B39A 3BP6A 4I3SH 5CSZA 1UXWA 3HC0B 1Q72L 1R5IA 2FIKB 2CXGA 3RZCB 3VJ6A 2AJYL 4MA1C 1A6ZB 3ULVC 4PJHA 4LCWD 2WBWB 3UYRL 1P7QA 2PXYA 3QEQD 5FYKU 4JQXA 5F7WC 2F8OA 1MLBA 2EDDA 2OSLB 1NLDL 1LDPL 1MF2L 2CRIA 5ISZA 1JZ8A 3IU3A 3HZKB 2B5IB 3CFDB 3PWLA 4G9FD 3MUZ1 4I1NB 1FIGL 4S0SD 4CMHB 3UYOD 3HRZB 3D3VA 1ORSA 1TJGH 2H32A 1A7OL 1QBAA 1HK6A 1I7RB 4L9LA 4E41D 4MAUL 4PS4H 3RA7L 1KFAL 3SHSA 1P4IL 2YD3A 2IFFH 3ARZA 2BCKB 4OGAD 3B6SA 1U8OA 3KPMA 1I9IL 5GS0D 3BSZH 4A6YA 2XRAL 3ARFC 3IDXH 5GJTL 1QFUH 5T1LD 3EYSH 4OB5H 4AG4L 3EOAA 2Y7QA 4F7PA 3T65A 1EUUA 1DCLA 4LVHB 3ILPA 3RWJB 1XR9B 4JZJA 4DCQA 1HCFX 4OFYA 1OB1B 4DQOH 3SKNA 2LU3A 3ECBA 4GW4A 4RWYL 3I02B 4HXAL 4PB9H 2NY6C 4Q9BA 4G6AD 5I1EH 4JO4H 1MFCL 2ICCA 1HQRB 1HEZB 8FABB 3O3BA 2VIRA 2HRLA 2ZPKL 4QT5A 1JWSA 5JW3L 1AY1H 4W4NA 5IMOA 1OAKL 1I1AB 1SY6H 2LU7A 4PR5B 4M4RA 4HUVA 1AI1L 4KK9C 4I2XB 4Y1AB 4Z7NF 3QIBB 4X6CF 1EXUA 1UA6H 5I73C 4TYUA 1L0YA 1TPXB 2DDQH 5HGAA 5DD3L 1OQOA 3KLAA 4XP9H 1KYOJ 3LAFA 1NFKA 5L8LB 2O61B 4RX4A 1SYSA 3FQXB 4XAKD 3IDMA 5BS0E 2NXZD 1J0ZA 4HWEH 2OZ4L 2VDNH 1D6EB 1CE1H 4R2GD 1YEGH 3MACH 4GLRH 2R1XA 4JKWA 2ZSWB 2DQDL 3VXNB 1H3PH 3KYOA 4FFVC 4LPWA 3PABB 2DWDA 2HJLB 4ONGH 4ZAKC 4HIIA 3WE6B 3KXFE 4HV8B 4AK1A 5C0RH 4Z7OF 3E2HC 4PJBB 2WBJA 4LOUC 4NWUL 2BVTA 1HYRC 4G80B 1Z2KA 2R0ZH 3O6KL 5D5MB 2B4CH 4NM8H 5EZLB 4NO0B 3UDWC 2C3VA 4O51A 1SEQH 4G9FE 3BXNB 4NM4L 3L6FB 2X4OB 3MRGB 1MCPH 4PGZA 3V2AR 1YY9D 3QXAB 3P4NA 3HI6H 3V7MA 4J12A 1OGAD 1BGXH 4ZYKA 4LMQE 3NFSH 1JBJA 5DXWA 2HFFA 4XB7A 4QTHB 3NIFE 4P5TA 4NJAL 1QLEL 4YPJA 3CJJA 2AEWA 1NCDH 3IDJB 4FQQB 4U6HA 3A6OA 4X99B 3V5KA 1YNLH 3AB0C 3W39A 4MJ5B 4Z7QE 4KJQC 2OK0L 2FL5A 1KB5L 3O6LH 4Z8FH 1IGYB 3I50L 4EOWL 3H9SB 1LMKA 4HLZH 4JFDA 4RFNC 1I1YA 4WGWB 1LVEA 1S7VB 3NACH 1DQQA 3GMQA 3JUYA 4Z7WB 1HIMH 4KJWD 3QO1B 2HT4C 4QYOA 3RBGA 3CFEB 3SGJC 4FTVE 4QRRA 3OJVC 3DV6B 5KSUA 4V1DA 4BFEA 2H2PD 3KPRA 1EBPA 4ZUWB 1NC2A 3WFBH 4LMQI 4LP4A 5FGCE 3L3DB 4ZXBC 4N8CL 1CL7I 4PBVC 5I0ZA 5E56A 4C4KO 5F1KC 5IB5B 1OWRM 5KANG 3VXRE 4LF3A 5FM5O 4NZUL 2WWMC 1MWAL 2DYPD 1WWCA 2JJSA 2GFBA 4OFPA 5GGTH 1MFBH 6CGTA 3IXTA 3QFDA 5D1XD 4TUOA 3DUSA 5JIHA 3LMJL 5KG9B 1BLNB 4H1LB 5JOEA 4MDJB 2FSEA 5FYJH 3SE8L 1A3LH 3H42L 3SDCC 2XXCB 3LPGA 4JDZA 1G84A 2PW1A 4IBLT 2DM4A 2QR0A 3OF6D 1CQYA 4K23L 1V3MA 3RUGB 2ADJB 3I9GH 1S7QB 4XBGB 4AL8L 1UB5B 1EO7A 2B2XH 2CH8A 1BFVH 5HHME 2M2DA 3P73A 4RAHA 2V5TA 3VH8A 3P4OB 3L3GA 1Y6MR 2FGWH 4JM2B 4UAOC 1L0XA 2NY3C 4XP6H 3SY0A 2H32H 2UY7A 3HUJB 3GDBA 1H8SA 1OGAE 4P3CL 3JTSB 2EZ0C 3F7YA 4XPHH 2ERJB 4TRPH 4A6YH 4NQEE 2AXGA 1I4FB 3H3BC 3RIAK 2C3XA 4JGJA 5HYQA 1P4LB 4IDLA 5IFHL 3FO2A 5E8NA 4X6DE 4PRHB 5F7MC 3CX5K 1OPGL 1C16B 5D93C 3HKFA 4FXKB 3RP1A 3FO0H 2I5YH 3H2WA 5FO9A 2O5ZH 1XZ0A 5HD8C 5I16B 2I27N 1K8IB 2BSTB 4YHML 1V7ML 5E6IA 4KKBD 4S1QH 3BIKB 4AM0B 2H41A 4DGVH 3IJYB 2BNQD 1ACYH 4HKJB 4PRNA 5DRZB 3FT2B 3LIZL 5F7EH 3HZMA 3O45A 4XNUL 1LO2L 2BNRB 2OL3L 4KV5F 4MD4A 1FFQA 3KYMB 3MPCA 1CD9B 3A6CL 5DJYB 1Q9WA 1ONQA 4XNZC 2R1WA 1RHHB 3GRWL 5DMGD 5ADPL 1WFUA 3RL1B 2R4SH 1NCBH 4K9EL 4M7ZC 1JWUB 5A16A 1WIPA 3PWNB 4N0UE 4AIXA 2BMKB 3I6KB 1T2QL 1MHCA 3MRMB 2H9GA 2EYTB 4LLMB 3U82B 3TJEL 1AHWB 2QBWA 2NY5H 5DS8B 1PFCA 1TQBC 4HX1B 1R3JA 1CGSH 3MROB 4XCNB 1QHPA 5D9SB 3ZE1F 5JPNB 2NYYC 4KKCD 3E6HB 4MQTB 3RVXC 4JFZL 3DETD 5FHAH 5AZEH 2R2BB 3WLWC 3LS4L 3BKJL 4N1HB 4XNYL 3ZKXB 1F8TH 3U1SH 1QR1A 2V17H 5FYKL 3BWUC 3DX8B 1HHHB 3S96A 1J8HB 2EDHA 5HDOA 3X3FL 5FUZL 3TLRA 3TYGH 3EJYD 2DQIL 2QQKH 4WEUD 4LK4A 1FN4A 4XBEH 4KTEH 5DEGA 1FNFA 1KJ2L 4XGZB 2WINA 3LPFA 3TVMD 4FP8L 2JB6A 5CEXA 1ZLWK 4ZUUB 1AQDB 1FO0A 3D25B 2D7OA 4XVJL 3GBNH 4AH2A 2F58L 1H3UA 2BRRL 3DSNA 3ARGC 5IBUB 3WS3A 2ATKB 1CWVA 4J3SA 1NBVL 4QRPA 1A14L 4Y19D 1HSAA 4PRBB 5FA3B 3VD5A 3ESVF 2Q8BL 3DURA 1VGEL 1M7XA 1KG0A 2C9AA 4OM0H 1UKQA 2GT9A 5EA0H 4GRLA 3FMGL 4NQSA 4Z6AT 1YMMA 3U36B 4U31A 1HWGB 5DMKA 1B6UA 4OLXL 1R5WA 1P2CA 1PD6A 4KQ4L 5EPMB 1KXTB 3TWCH 3IKCA 5I1CL 1G6RA 1J87A 1IGIH 4JO1H 3WJJA 4R97C 1VEOA 5D71L 1KPRB 1S7RA 2PTTB 4GRMB 5A2KH 1GCFA 2C4FT 1C1EL 4X6CB 1WBYA 3P30L 4I9WD 5DT1L 5J11B 1G0DA 2YZ8A 1IGML 2FJHB 4GAGL 4PJGF 3WN5A 1MHHB 4NWTL 2EDXA 1S7WB 4OTXH 2IALA 3PDDA 4L3ED 3LB6C 3TO4A 5GSRB 5JLZA 2WP3T 3OX8B 1D6VH 4F2MB 2UUDH 3OKNB 3U4AA 1LEGB 3GI8H 5DO2D 1FFPA 1GHFL 3HG1A 4MXQD 3BIAX 4YQXL 5DYOB 4OBRA 3TIDB 2EDNA 2F53A 1CTOA 5BRZE 2ESVE 1IZJA 1XF4B 3NCYP 4RNRA 4LLVB 4R90L 3AGVA 3LDBC 3QUYA 5EB9A 1D9KA 1DBBL 5I1GH 4WHTB 3S34L 1AD9A 3HA0A 3ME0A 2A74A 4JREC 1VACA 4HS8H 1KCRL 4WIQA 4I18A 1DQLH 4PRPA 3SE9H 1TLKA 4IM8A 4FNLL 2VDKL 1PYWB 1WWWX 4ZTOH 1HH6A 3GSOA 4QGYA 3GMNB 4AQ1B 2CDFB 5KSBF 1OL0A 2O5XL 3HB3D 2OQJB 1OWWA 4TQEH 4I48B 4LASH 3PWPA 4R96A 5J6GA 1QKZH 1UFUA 4PJDF 4QCIA 1N6UA 5CP3A 3NCYS 1DEEB 4MAYC 1Q0YH 4MXWH 1S9VA 2BRQA 2MKLC 2YMXL 3B8SA 1I8IB 1I3RA 5L0QB 3ARTA 2EKSB 5EBGA 1UJ3B 3FOMA 1VADA 1S9WA 4ZNEE 3P4MA 1G7MB 2OCFD 5CBAB 5C0EA 1PVHA 1U8HB 2EH7H 3MC0A 4JY6A 3T2PA 3MYJA 1GL4B 3VRLE 1BAFL 1E4KC 1QRND 1T22A 1WIOA 5JQ6H 1IGJB 3LPWA 4K07A 4MJIA 3HPLA 4L8SB 4M7KH 3TZVB 2DQTL 3RZCC 5TE6H 4LKCA 3AS1A 2VH5H 4MA8L 3QQNA 2NZ9D 3RDTD 5F9JA 5E2UH 3CFBA 2F5AL 5IR1A 4NBYB 1YY8B 4OV6F 5DD1L 1S7XB 5CBEA 2FBJL 3CH1B 2H3NB 3DVIA 5I1JH 5FO7A 2CQVA 3T77B 5BXFA 5HHPB 4YBHA 3DRQA 5FKPB 5F70A 4ONHB 3O8XB 4QNPE 2J5LB 3MBEB 4ODSL 4F7CB 1I8LA 2P44B 4I9WE 4Z78B 2DD8H 1TQCB 4Q9RH 2DBLH 3U0TA 2VB5A 3L5WB 1SM3L 2GJ6A 3GKWH 1FQ9C 2EE3A 1KTLA 4M48H 3LH2H 1KN4H 3NA9H 4I3GA 4J3XA 5IB4A 1KJ3H 4LAQH 1EFXB 1PAMA 4L3EE 1CCZA 1GIGL 5EU6D 4RAUB 3FB7B 1A4KB 1UH2A 3QQ9C 5EOQL 5C0CB 1RK0B 2APXA 4N0FB 2NW3A 5JA9A 4Y7MA 1QYGH 4JFXB 2Y07L 2NY5C 2JIXB 2X41A 4G8IA 4LPUA 1KEML 5E1HB 5F6HJ 3QJFA 4LVHC 2HFEA 2CLRB 2AEQH 1RUKH 2X70B 2WM0A 4F3FB 4TVPH 5CEZD 4K94C 4GMTH 5BOZG 3WFEL 2QQLL 3H9YA 4JFOA 1J1PH 2VKXA 4YEEA 2AABL 4KMTL 4MCZA 4KC3B 5CP7A 5DFTA 3U7AA 5SWSA 5GHWL 4WJ5B 5J1AB 2BOCB 3X11A 1SYVB 3S97C 4HJGA 1AKJA 1NGWB 4QXTB 4D2NA 1I1AC 1RJZA 5KSAD 5D1QA 3V52H 1MCNA 3LCYA 3S35X 5IOPA 2D0HA 4G7VL 5IIEA 3QIBC 1T83A 3C5ZC 3DSFL 1WT5C 3OPZL 1HI6A 3KLHD 4U6XB 4JHWL 4WWKB 5TGBB 1TPXC 3UTOA 4NZTH 5C0NC 1R3KA 2W65B 4PJIE 5GPRA 4OD2B 4BFIB 2XICA 1KTRL 5EBMA 4UIKH 1X7QA 2WW8A 1IGCH 1XIWA 5JW4R 2EC9T 3C87A 1FRGH 2ZNWA 3IJHA 5ALCH 1GGYA 1KLGB 5TFSH 3S37H 2OR8A 4UTBH 5E95B 2CKBB 3UBXB 3DBXA 1KIRB 2DKUA 4JVUA 4MB5A 4PP1C 2DLTA 4JQIL 5DMIH 3X17A 1UM4H 4CVUA 1JRHH 2FJFA 1AGDA 12E8H 4DUVA 5GQBA 2ADFL 4OZGF 2XWTA 4XCCH 3L3KA 1U8NA 4NUGH 3HCVB 2HA1A 4JVPA 3MJ8B 4G8EA 5C0IA 1XF3A 1NGQH 5CS7A 1AR1D 3ZYZA 2JE8A 1ZA6A 4ZTPH 1WC7A 4K3JH 3VGBA 2YWYA 3DXAD 1JJUA 3SDDB 3VXUE 3VDBA 5C9KA 4OZIF 3M8OH 5AYQA 1F2QA 2VXTH 3U0PB 3O3EB 3TBWA 5D8JH 3WNNA 5EU6E 3QI9D 3GIVB 1BIIB 1HN1A 2IQAA 3UTQA 1B2WL 4HUUB 4DGIL 4Z7UF 3S36L 4NHCH 4QWWC 5KVEL 3W9DA 3BPLB 2JCCA 3L3IB 3ZE0E 3WCYA 4LCYB 1CG9A 2UZIH 4X6EA 4KHTH 3WIHH 4PJAF 2R0LL 4PLJD 5CEZE 3JVGC 3IGAB 4BZ1H 4Y4HB 1K8DA 3LKOA 5ACZB 3BKCH 3OXRB 4TUKH 1RU9L 1DVFB 1LILA 3PL6A 2P5ED 5CSGA 3RRQA 1J8KA 4NN6B 4N8PA 1ERNA 1V3LA 4XWOD 3F6IA 5D7IA 1M05A 1FNEB 5AWNH 2D4DA 4CDGC 4OQTA 4JPIB 4P4RA 2YSSA 2OJEA 2I9TA 4ZPTB 2BHZA 1JWMB 2Y9RT 4U1HA 4DKEL 1CLOH 2APTA 5E8DH 1MJJB 4EN3D 4LHUG 2G75B 4X7TB 4FRWA 4QHMA 1T0MB 4HWUA 1T1WA 1KEGH 3VFNB 4D8PA 1C08B 1MY5A 3OKYA 4UTAL 4P2RE 2H26A 5I1LA 2J6EA 3EYUH 4FFWD 3ULVE 1IKFH 2HH0L 5I66A 5EIVA 3KPQA 1VENA 1G7JB 4WFFD 2X4NA 4JDVA 1WIUA 5B38B 1TVHA 4YZFE 4NNPL 4OZHA 2VC2H 1OTTC 5KTEH 1YEFL 5IROC 4MVBC 5A3ID 2PYEB 2YPVH 3N85H 3W5MA 3WL9A 3CIQA 1OSPH 3GMLA 4FQ2L 4OZFB 2F74A 1SBSH 3VXMD 5E5MB 1NH6A 4ZFGH 5D4QA 1U92B 3S8WA 5F6IB 1FV1A 5KSVB 2VQUA 1FORL 3D39D 5KS9F 5IFAL 1CXEA 2AXHA 3H9HA 5J8OA 5H2BB 3BGAA 4JM2C 5B4MD 4L4JA 3F7VB 4ZOCA 4P4KD 3MRQA 3UTTB 1OAXL 3G6JE 1ORQA 5IVXF 4CADB 1A2YA 4HFWA 3MGTB 4YO0A 3MNZB 2DQCL 3TN0D 3BZEB 3O0RL 5FKAB 1ZT4B 1RZKL 3X14B 2IANE 4XCFH 2XZAH 5DFVC 2VXQL 3QDGE 4DN3H 1WZKA 1P4BH 1JGDB 1MHEA 15C8L 4ETQA 1JZ2A 4MJ6B 2DMBA 4N9GB 3C2AH 5IQ9B 5FM5M 4NGHH 1KLUA 3DX9A 4G6MH 4U0QB 4O9HL 2FX7H 1F6AB 3SJVA 3VFWA 4XCEA 5DQ9A 1EA9C 5KSBB 1GJIA 3DVGB 3R06B 2VXUL 4G9DB 5IMMA 4BUGA 3HE6B 2VDLH 2P5EE 4OZ4B 1NGPH 3DX7B 1W72A 2DS4A 3WV0A 1QZ1A 4GBXD 4PJGA 3TFKC 4OLVL 5AAWA 1K4DB 2VTFA 4Q2ZA 3K3QA 5EORL 1QBLL 4Z0XA 5HGGS 1LO5A 1R5VA 4UBDC 1MFNA 2NY2B 4FFYH 2AK4B 3C8HA 5F9AC 3UTPE 2BVEA 3ZSSA 5HVGB 3QG6B 3W9EA 3EZJB 4YHIA 4DVRL 4P0DA 3DO3A 4OI7A 1PLGH 2YD9A 3VI3E 5C7XL 2XN9A 1AHWC 3N0PB 5AZ2H 2Q20A 5C0GA 4LIQL 4LNRA 4PJEF 1S7SB 3RBSA 4JRYB 3K74B 4F15B 5IHUL 2HKFL 3UJIL 3OB0H 3RKPA 4I0PA 4LSTL 4L8BB 3RWFB 1SMOA 5EC1B 2Q6WB 3RWIB 4EI5A 3F12A 3ZKXC 1QSFB 1BZ9A 5EBWB 2V2WB 3OBAA 3VXME 1FNHA 2VISB 2Z93B 3WS6C 1NFIA 1IQWH 1QA9B 1FFNB 1GGTA 3D39E 3RWDA 2JJTA 4HWZA 3WXWH 1U91A 2CRZA 5C9JB 2P8PA 5EO1B 5TPWH 2H6PA 4MLIA 3PHQA 5KW9L 3ARDD 4K8RH 4M43H 1FDLL 3D69B 2X1OA 3VWKD 3V4UL 1IEAA 2NR6C 5C6PB 5EFIB 3VDCA 3ZYIA 1OCWH 5T1MB 3FN0H 2E27L 3BE1L 2V5SA 3VCLB 3NCCB 4NQDD 2VE6B 2G9HA 2HVKB 4IEFB 4DVBA 5C6TL 4Q7DA 4PGEA 3EHBD 1L7TH 1IAIH 3IFOB 5IBLC 2CKBH 1BVLB 3JWOH 3MO1B 3NCMA 5HI4D 3CLFL 3MJ7A 2VDRH 1G7LB 3OR7B 3SE3C 5CINH 3MLZH 4GG6F 1EERB 1AGCA 3INUL 1JK8A 2NXYD 5DUPH 3WHE0 1MH5B 3MFFB 2QADB 3BEWB 3CX5J 3GSWB 3ISWA 3GIZL 2YEZB 2VXVH 3HZYA 5HI3C 1H0DA 1QEWA 3MREB 1KN2L 1OM3H 1UC6A 4P46D 2E7HA 2AJZA 1ZLSH 3CDYA 5C0DA 1KBGL 2QQNL 3RWGA 2AJVH 4GH7B 4Q6YA 1A6TB 5DQDL 3DUHA 2UWEB 1Y6NR 4ONFL 4L3CA 4XMKH 3MUY1 4DGYL 5IMLA 4OQTH 4HAGA 4YDIH 2DIBA 4U1IB 5E1AA 1JHTB 2QJDA 5IW6A 1S8DB 1VA9A 2D2OA 5KVDH 2HKHL 2NNAB 1F4YL 2WNGA 1WWAX 5J11C 3IFNH 5D7JA 2A83A 5CILH 1RZ7L 4WHYH 1RVFL 1BJ1H 4Z9KB 1Z0MA 2UUDK 1P6FA 1N0XH 1ZGLB 4CN6A 1FSKB 3CVIL 3V0VA 2ID5A 4EVNA 5B8CB 3E3QC 4PJXB 3K81A 1DLHA 5JW5A 3EYFA 4LVOB 4AT6B 5KN5A 3NGBB 4LPYA 4IRJB 4BYHA 4M5ZL 2WUBH 2D7TL 2CDEB 3VD4A 5JW4N 3H3PL 2F15A 4KWUA 2BSSB 1T3FA 3CFKB 3EO0A 3EJJX 5ANMB 3L7FB 1A7RH 3OTTA 2DB8A 1LGVA 3B2VL 2XTJD 2VR4A 5FB8A 1D5IL 4JN1H 3WFCL 4LLWA 3MRLB 5IM7A 5C08D 2QSQA 4W6WB 1I8KA 3IDYC 2ARWA 3C60D 4IDJH 1QNZL 3MCKB 5HHNA 3WKNA 1X9QA 3EFDH 3O3DA 4LQ1A 2N7AA 3RI5K 4R7DB 2IADA 4OCWL 5CIPA 4C4KT 4OZIB 2B20A 1T1YA 1YUHA 1UH3A 3SCMB 4JQVC 3FCTA 1I9JH 3QEHB 4N8VG 5DJ0A 5L0QC 4FFZL 4KQ3L 1AD0B 2Z91A 3MRIB 4Z7UB 1UJ3C 4J23A 3MBXL 5ILTH 25C8L 4U7MA 4KI5D 2DQJL 5FK9B 4NP4L 2OJZH 4X7SH 2CIIA 1XCTA 4LSPH 5T5NG 4PJAB 1CXLA 4OZFH 1MPAH 4DUWA 1GZPB 4KU1A 1RZ8A 1A22B 3B9KD 2P46B 1C5BL 3PP4L 4RWHA 4L8SC 5K9JH 1FNSL 3I75A 3TZVC 4E42B 2EEAA 2CPCA 1EDQA 2EH8L 1IFHH 4HMCA 5LWYH 3L5XL 4MSWA 5EO9A 4XNXH 1YMHA 2X1WL 1MCHA 4O5LH 4MAYA 5GS1A 1W72H 1XCQA 2PUQT 4U05A 1LNUA 2YKLL 5GGSY 3MV11 4QHUA 3STLB 3O8XC 2J5LC 3MBEC 4O02H 1JV5B 1CDBA 3A6BH 3JV4B 3E8UL 1TQCC 4O2FB 4PJ7F 4NCC2 5FUOL 2YPLD 4WCYH 2O5YL 1AR2A 5I1DB 2FWOA 3TBVB 3WD5L 1UM6H 3HLAB 3SN6N 3WDJA 1IM9B 4YXHL 1AQKL 3BH8B 3CLEL 5E2VL 2ADGB 4X83A 5AD0A 2FIKA 1FZJB 4H0HB 2EDKA 3QHZH 3JTTB 1ZA3A 4GRWE 4PYHA 5FYJD 3S9DB 5ENWA 1D5ZA 1QBML 4OFIA 4HWBA 4S2SB 4NKMA 5IVOA 4P9HL 1GZQA 2PXYD 5M7QA 4UOJA 3CXHK 3DIFB 4GFTB 2Y23A 4I3RH 3TO2A 4HS6A 3AS0A 1OGTB 5ISZD 3VXSB 4X7EC 1A6PA 1HZHH 5IHZA 3O2WH 1Q1JH 5TE4H 1TZHA 5KS9B 2XTJE 3P9MB 3D3VD 4OLUH 2APWA 1BQHB 4GG8A 5ESQB 1GGIH 3LRGA 4UT6H 4CW1A 4R4ND 5C08E 5SX5K 5K9OB 1CL7L 4OF8A 4P23B 1DP0A 2BCKA 4GAJL 4P2YA 3VFRA 1UB6B 5DURD 4M6NH 3QO0B 1INDH 4PGJA 1XR8B 2GCYA 1X44A 1Q9OA 4ISVB 4N5EC 1HILA 4U1JA 4J6RL 3ZZ1A 1U3HC 2XWBB 4K8RC 4NPYB 4WWKC 5IP4A 4X5LA 4BH7A 4NIKB 7FABL 4GLRI 4JG0H 2Q3ZA 1N6QH 1UXSB 3IT8D 4HCRA 4DKDC 3VWJA 4YK4B 4QOKA 5GJSH 5C8JA 3H3KA 4KI5E 4PG9B 2QHRL 4I0KA 2SEBA 4OFYD 3PHOA 2XKNA 4TUJA 4ZO6A 3CMOL 3ROLB 1A9EA 1AIFB 2FX9H 2W60A 4NOBA 4I0CC 3U0WH 2Z31A 1G9ML 3V5DB 4HKZA 4G8GB 2C1PA 1P1ZA 2RR3A 3KAAA 3UJTH 4UIMA 4D0DA 4F9PC 2YA0A 3GSNA 3JXAA 4JZOB 2G60H 3FOLA 4MDIA 1CE6B 4ENED 5DR5H 1EZVX 1YNTA 4JRXB 5HYIA 3WNPA 1DLFL 3O6FB 5C70A 5C86A 2Q86B 1JE6A 2J1KA 3BN3B 2A0LD 3NIFF 4RX4D 3T09A 1MRDL 1IJ9A 3G08A 3QCTL 5IBTL 2A9ML 5CWSA 4X80H 4DZ8B 1MCIA 4K7FA 3D85A 1D6EA 4KTDL 1QFWH 3PXHA 3VXTA 4PJEB 5DMJB 1KTDB 3MODH 3EOTH 3NTCL 5DJ2B 3VXNA 3MNWB 3FTGA 3QDMA 4F7EB 5FYJE 1ZGLM 1TCRB 2HJLA 5DVOA 1N3NB 3V6FB 4QRQB 5DQJA 5IMKA 4HV8A 5MEPB 4PJHE 5EUKA 4LHQB 5I9QB 3FJTA 4S1RH 3PWJA 3BPLC 4HIEB 2WBJD 3HNSH 1RULH 1J88A 4DWHA 4G80A 2YPKB 1CLZH 3SGKC 5J89A 1NANH 1Z3GH 4NSKA 4U4BA 4LLDA 5ISZE 2EIZB 1JGVL 2X4UA 3MLTB 5CHNB 5DRXB 3U7WL 4YXKL 1FH5L 2NX5E 4WI2A 3D3VE 3OKLB 3RVTD 2ICES 1DVFC 2IG2H 1I7ZB 1KELL 4ZFOB 4H8WL 4NN6C 3S6CA 2LU4A 1VPOH 3QFJB 1Y0LA 4P5TD 2P24B 3IDJA 5CIPH 4FQQA 5E08H 2EIBA 3REVA 2DJSA 1DSFL 2R4RL 2ZP0T 4RDQF 5A2FA 4HF5H 3KPLB 4ETYA 1S7UB 3QIUB 2R0KH 1AH1A 3AU1A 3H9SA 1KCUL 5DSCA 5IW1B 5T3XH 4JFDD 2GJZA 5SWQA 4GG6B 1F3RB 3GB7A 1CXKA 1WK0A 4ZNCD 3DECA 1MIEH 5KVFH 1A3QA 3RY6C 2A73B 3DI2B 2IAMB 3WLBB 3KS0H 4RFEA 3MLRL 3C08H 3CFEA 3T8XA 3C09B 4F7TA 3G5XB 1KB9K 4QRRD 2YHGA 4V1DD 4HUXA 3EFFB 2PO6A 3GBMH 3KPRD 2Q76A 3G9VA 3MRNB 4BM7A 2DIJA 2QQQA 2Y6SD 1RJYA 4Q0XH 3VRJB 1U8KB 3IU4H 1NC2D 3BHBA 3OHXA 5F6IC 3CZJA 1IZKA 4HK3N 1CXHA 4JFPA 3VFUA 4QHLB 5BV7L 4WNQA 3EAKA 3CUPA 4G42A 1HOCA 1R3IH 4PJFF 4GKNB 1WF5A 4CRPA 1ADQL 4S11A 1BOYA 2VZTA 1GOFA 2VLRA 4Z76B 2Z8SA 5E8PB 2EDBA 1JHKL 1ODAA 4MDJA 1WBXA 3QG7L 1JTPA 4WI8A 4RA0C 1U8PB 2ZUTA 4LSUL 4APQC 3FAWA 4DEPB 3SGDH 1OAUL 2ADJA 4RMSA 3MOQA 1UB5A 1XEDA 3AY4A 2BX5A 3L1OH 4HG4K 4N90D 5CGYD 3G5ZB 1UYWH 3N1MC 1MQ8A 3P4OA 1MIML 1PSKL 4FQLL 3TBTB 3MLVH 4WDIA 2AV7B 4JKPH 2Y06L 4DTGL 3F7RA 1V7NL 4NO3B 2F54A 3HE6C 4Z7VA 4YGVB 3OZ9L 1RZGA 2MPAH 2BY1A 2GQHA 5F71A 5GZND 4UQ2B 4YHKL 4KKAD 3Q1SH 1YEHL 4IRSB 2VLLB 4MA3B 2NY2C 1FLRL 3HR6A 3MRDB 3FRUB 2PYFB 4YUEL 1P4LA 2GW5A 5LG1A 4HFUH 5HYSB 4JFFA 1HDMB 3S3JA 3VD7A 5J0BA 3S35L 5IT2H 4JFDE 1Y18A 2C7UA 2Z35A 4YHPA 1NBQA 4UT9H 4ZFFA 3KJ6H 3BPNB 5E6ID 4X98B 3HMXA 4G5ZH 1NFDF 1TVDA 4F15C 2GKIA 3TEUA 3CXDL 3WIIL 1M6OA 4OJFH 5EO0A 1IEHA 4HUWB 1ED3A 3OB0K 4PY7B 4LBEA 4WU5B 2VITB 3ULUL 1BOGA 4H1LG 4KUZH 1T7XA 4DKAA 4QRRE 5C0AA 4V1DE 3BX7C 5FIEA 4C83A 5DJYA 3R8BB 3KPRE 1IQDA 2NY7L 4NBZB 3SQBA 5E2TL 1GGBL 1MREH 1VKXB 1V05A 4FG6D 3B9EA 1I1CA 4IOFD 3NZHH 1I3GL 5IK3B 2DAVA 5J9PA 1AC6A 5FM4A 4GSDH 3RAJL 1F11A 4FQCH 1RSFA 4UINL 3IAGC 4LLMA 4FQ1H 1AHWA 3I2CH 1YNKH 4N1EA 4N0YH 4GQ9H 5DJ6A 3VXOB 4W4OA 3TNMB 5D9SA 1UM5L 1JP5A 1NEUA 3G9AB 4XX1E 5C2BH 5D1ZB 4KRNA 3RJQB 2HFGH 4KK6C 4OSUH 43CAA 4ZPVB 1LE9A 4XHJC 1ROWA 5MENA 2NY1D 3TA3B 2DLFH 4ZFZA 1TETL 3DRTA 4EI6B 2CGRL 2X42A 4Y89A 1K4CB 2ILLA 1A7PL 4HQQH 3CVHA 4G3YH 4H25B 1WTGT 4EUPA 3QUMA 3L5HA 4LSQL 4N90E 2QADC 4HD9A 2IBZX 2DJUA 1NMCB 4OT1L 4NRZB 2X4SB 2EDQA 1PG7H 4KZDH 1MY7A 3NCEB 4ODTL 4PJ7A 2Q3AA 3QDJA 1MLCB 1YECH 1DJSA 1EMTH 1Z5LA 5BS0B 2MHAA 3E6FB 5JXAL 3A0OA 1OF2B 3OKMB 1FBIL 1ZLVH 1CIUA 4OCSH 4J1UA 3KHOA 4PJCF 4QRPD 5EOTB 5FA3A 1N7MH 5FGRA 3WFDH 3F62A 4X6FB 1Q9LA 4F37F 5C2UB 5LGHL 1QVOA 1E0OB 1YYLL 4GRLD 3W11D 3KXFB 1FSKC 2A1WH 3QQ3B 5GGRY 3BUYA 1YN7A 2HTLD 3QXWA 1ZWIA 4M00A 3UTSA 2IFGA 1XGQB 1E28B 3BW9B 3QNYA 4LVOC 4XVSL 3HN3A 4U1MA 5EPMA 1CFVL 3Q5OA 3AAZA 1F5WA 3LKQA 4IRJC 1MVUB 3IYLW 4ZDHA 4WENB 3BEVA 4R8WH 3VE0A 1E27B 4G9FB 3X13A 1QBBA 3CK0L 3TV3L 2XT1B 4RBPH 3IRPX 3MA9L 3LZFL 4WUUD 1TVBB 5SV4A 2NLJA 3MXVH 1S7WA 2UZYB 3UC0L 2JB5H 3DVNB 3ZYOA 3HNVL 3L7EA 5GSRA 3TO4D 2C1OA 2X10A 4UV4H 1X5AA 4R7NB 5T1LB 3ZKQD 2D7QA 3HHRB 3NABH 5TQ0L 3HG1D 5HDQL 3SCMC 1OW0C 4YHNA 4LSSL 1ND0B 2F53D 2DM2A 1XF4A 3O9WA 4LLVA 2NY4D 1FHGA 5IBUG 2BJMH 4ODXA 1H5BC 3QEQA 3QUYD 4WEMB 1D9KD 3T0WA 4GJTB 1D5XB 4R26H 5TF0A 4DZBB 1IE5A 4TVPE 5FGBA 1JF1B 1KCSL 4KVCL 4JO2L 1NDMB 4FTVB 4PREA 5HVFB 4UUJA 2LAAA 5HGHB 4BSVB 1AXTH 2J88H 4TSAL 3TT3H 3KYKH 3S5LA 3DO7A 3WUWA 5BVPH 3BI9X 4HZLB 3EOYG 4N0RA 5EN2A 5ACMA 1FYHB 2R39A 3KNBB 3PWPD 3L3OB 4QNPF 5EOCH 2BDNH 5FGCB 1CBVH 1U0QA 3B5HA 3ULSA 1CF8L 3QULB 3BYYA 3O2DH 4Y5VB 3IDUA 4QHNA 4L4TA 5DGQA 3V7AG 1SVZA 1I8IA 3VXRB 4WV1C 1NC4B 4KVNH 3V95A 1U8QA 5CJQL 1GGCH 3GMPA 2EKSA 1UACL 1A1NA 1UJ3A 1IGFL 3UPAA 4M62H 4JHZA 2X4PB 4OCYL 2OZ4A 1UENA 4ODHH 5I8KH 1N64H 1L0QA 1KGCD 1FGNH 1U8HA 4JHBA 5HHXL 4MNQA 4XCYA 3WSQL 1OVZA 4XNQA 5E0QA 3R0NA 2YN5A 3HNTH 1XGYH 4HIJA 1YMME 4LRNH 1WCQA 4YE4H 3X3GL 3WFHB 3CU1A 3U9PH 2E7LA 2WQ8A 5K9KB 1WSST 5I8OL 4YPGA 3ARBA 5HHMB 3SPVB 5F96L 3T0EA 1PEZA 2YD8A 3WHXB 5L6YH 2VYRE 2VLJA 5ACLA 5M94B 1A3RL 1AP2A 4Y4FD 4M6OH 5HHPA 4ZOEA 3DUUA 4H88L 2BVPB 3KR3H 3OJDB 2MCPH 3BDBA 4J4PD 4U1GB 3VMOA 1G1YA 2ARJQ 1T5WA 3MFGB 1OGAB 1HHJA 2HYMA 1KF9B 2GJ6D 2ZSVA 3O4LD 1JIBA 3B5TA 3MOBH 3S5LG 5FF6A 3B3IA 5F1NA 3DJ9A 4NQEB 4I77L 4P23C 3KYNA 4QLRA 4OD3H 4JKLA 3G04B 4PB0H 3VFGL 1IGTB 4PJIF 1VFBA 4ODWB 4KHXL 1A4KA 1RUMH 3V6ZB 4X6DB 3D2UB 4KZEL 3VMPA 4IJ3B 1LP9A 5CD5D 4N0FA 1KB5A 1A9BB 1QOKA 1CK0L 2F53E 2HFTA 1GOHA 5C0FB 3RY4A 3UPRA 1MQKH 2J4WL 2V2TA 5IWLC 1JVKA 4YK4C 3Q3GB 3ZT5A 3D0VB 1E4WL 1NCWL 1JRHI 2FD6H 3CVHH 3TH4T 4EUPH 1YYMH 1DBAL 3QUMH 4WU7A 1CDCA 1RIUL 4PRPE 4X5WA 1VFAB 1NL0L 3CD4A 3PV7A 4LRIA 1MJ7H 2HRPL 1IAOB 3MUGA 5SWSD 1U8IA 4OAWB 4WW2F 1A0QL 3ZKSD 1UQSA 3MUJA 5DC4B 5J1AA 1AGBA 2BOCA 4MHHI 2I9LA 3K8KA 2WAHA 1AKJD 3T0VA 4YHOH 3NIGF 2VDQL 3P4LA 2GITB 5T3ZH 2Z8VC 1NJ9B 5EZOL 5D1QD 1U8JB 4N0UB 4OIAA 4PJ5A 3O6FC 3ARVA 4LSRH 5I30L 2D3VA 1I7UA 1IAKB 4GAYA 5E7BA 2B0SL 2BY0A 5HGBA 3ULVL 4MA7H 3WNKA 3NPSB 1HQ4B 5LGJB 1MWAA 1YPZA 4OD2A 2FATL 4OF3A 4AIZB 1U93B 1NKRA 4OGYL 5GZOC 3V6OC 4TOYH 1XIWD 2EYSA 2VSCA 1IBGL 3DWTA 5GGUA 3RWEB 5F88A 3ZTJH 4MJIE 2AJYH 2FDBP 5TE7L 1G7IA 3CDFA 4YBQD 3EGSA 2H1PH 3WJLC 1HKFA 1L7IL 4X5XB 5I9QC 1HXMA 1SJHA 1T5XA 5J6HB 1NLDH 4WI7A 2ZG2A 4JLRB 3JBG7 3F5WA 3CXHJ 2FR4A 4O58H 1CD8A 2R9HC 4ZD3H 4MAUH 5JW4Q 3DOSA 1AGFA 1RD6A 5D96B 3RA7H 4KGLA 1P4IH 1H15B 3SDDA 3BGFB 3SKUD 1I9IH 3EJZD 1UH4A 4P2OC 5I19H 1JMZA 2KL6A 2AKRB 3LY6A 3GIVA 4PG2A 1FAIH 4OGZA 1PKQA 2ZNXA 1J1OL 5D1XA 3FFDA 3SQOH 3RNKA 3BQUB 3MYZA 5DUBA 3MLWL 4PRDB 1J18A 3RZWA 3RKDD 4ZO8A 3U30C 1NFDA 4KAQL 2VDOL 4LOUD 3I6GA 4YZFF 4LCYA 3VG9B 3OF6A 4OLZH 5EBLA 3WO4B 1KJMA 3EOBB 5BVJA 3P11L 1UT9A 4XPBL 4Y4HA 1GC1H 2A6IB 4Z95L 4PGDB 3U2SA 5DLML 2IAMC 1R24B 1MFCH 3AREA 3C09C 4QHKI 1SJEA 3F7QA 3PL6D 1CGWA 2OL3A 3ZDZE 2ZPKH 3QAZB 1U3JA 4TPRL 5EZJA 3QBTB 1ZV5A 4NJ9H 3VG0L 3F7PC 3GRWA 1AXSA 4ODVH 4ZPTA 5GS0H 4BJLA 3D48R 4PPTA 2OTUB 5DJCB 3S37X 2VQ1B 2X7LB 5F7DA 5DD3H 4KJQD 3RX5A 3ZHLA 3G6JF 4Q9QL 1D5BA 5EIIB 1T04A 1NCCL 2QEJA 4I4WA 4YC2B 2R0WL 4LPCA 2OZ4H 5DHYB 1F4WL 4PV9B 3FL7A 4WO4B 1DL7L 3FFCD 1SHMA 2D4FA 5BRZB 2ESVB 5B38A 5HHVL 2GTZB 3F58L 3RVWD 3DTXB 4NNXA 4EDWL 2DQDH 1RZIB 4J3OC 2KZWA 2G5BB 4M6MH 4DEPC 5K9QG 3M1BA 4WI5A 3O41A 5TDNB 4C59B 1J11A 5JHLL 3NN8B 1G9NH 1OSZB 2M1KA 4Y2DC 2MKWA 1PDKA 3IDGB 4NKIH 4Y5YB 1MNUL 1B4JL 3KPSA 1XT5A 5H37G 3P0YL 1MI5D 1KIQB 3TVMB 2WWMD 3LRSB 4FN0A 1KJ2A 1X5XA 4DKFL 2FX8H 4RMVA 4KDTA 5I1HL 5IQ7L 4P49A 1T0PB 2VQTA 1HINH 3W5NA 1BVKA 1HKLH 1KCLA 4GXVH 4PJCA 4WI4A 1M1SA 2AQ2A 2VL4A 3NAAL 3F6LA 3FZUC 5FKAA 1ZT4A 2VABA 3TNNA 4IRSC 4WRLA 2KUTA 1CQKA 3VI3F 4QTIH 2OK0H 5JDJA 4EOWH 3QYCA 2UYLA 2ICWI 2ZUYA 2VAAA 2ZZUT 2JCCE 5CD3B 5JXEA 3MRRB 4KFZC 3QUXB 3BPNC 5E4IA 5C07A 1MCDA 4NFDA 4KV5E 4UU9B 5B38G 3DX6A 5GRYA 1FIEA 3SJVD 2BNUB 4OFVA 4CNIA 4KMLB 3VFSB 5DK0B 5HI5D 1LK2B 1QFOA 2CDGB 4LLQA 3RGVB 1KT2A 4MWFB 4OZFG 5D7IE 5I15H 4OD1L 2GSGA 4NO2B 1ZHKA 4WI6A 3QA3A 4OLEA 1KB9J 4HPYL 5I1IH 2NW2B 3FO1A 5FA4A 3MMEB 4LL9A 6FABL 2EXYC 3EO1A 1X4ZA 3RQ3A 4N8CH 3V0AC 3HI5L 2AXJA 5HY9A 1URLA 4MX7B 4P9ML 1QFPA 5I8EB 4ZQKA 4NZUH 4L3EB 1ZHBB 1T4KA 4E0RA 3O11A 1W8NA 4M8QA 5HSFA 1IAII 2XN9D 3FB8B 5F21B 3UBXI 4EDXB 4X9HA 1TTFA 4PJ9B 1ZVSA 4YH6A 4BQCA 1O7VA 5D1ZC 3WDHA 2R23A 5CJXA 3UTZB 4QRTB 1OP3H 4B53A 3LN5B 4I0PD 3SE8H 4JY4A 4WGVB 3RWIA 1OARL 3BVNA 3U46B 4AJ0A 3TA3C 4MJ2A 4EI5D 1SBBA 1J9CT 5EBWA 3MRPB 4NN7B 4K23H 2HT2C 5K59F 3MV7D 4P5KA 1NUFA 4P5MA 3MR9B 4QXGH 3QJHA 1QTYT 5EU5B 5DK3A 1TJGL 4ZUSA 1CVRA 5I2IA 2A6KB 4PS4L 3MRKA 4YDJB 5IVNA 4OCXH 3CSYA 4L1HA 1BF8A 1NMCC 2WBKA 4HG4J 2BFVH 3OKOA 3D69A 5IB2A 1T1ZA 2P5WA 2A38A 4XPAH 5EFIA 3MRHA 4POYA 3IDXL 3QWRA 5SWZA 3EYSL 4OB5L 3C5JA 5TDOB 1DN0B 2VE6A 4PJIB 3PGDB 32C2A 4BH8B 2HLAB 4C56E 3WLWD 3TIEB 1A4JB 5FDWB 2ZJSH 2LTQB 3GSQB 5IFHH 3T2OA 1ZLVK 1B3JA 3PQYA 1H3WM 3ZKMC 2E9BA 2D31A 5BCAA 4DQOL 2CIKB 3H6JA 3LN4B 4QKXB 4AZ8A 4CAGA 4UDUB 1UVQA 4PB9L 4XPTH 5IEHA 4YHMH 4JO4L 3P0VH 4K2UH 4P59L 4CVZA 3G6AB 3RDTB 1A6UH 4F8QA 1G0XA 2ICEB 1AY1L 1AO7A 3HFML 5JORB 5I75B 4X0KB 1NGZA 3LIZH 2R2HB 4XNUH 1LO2H 4KJYA 2OL3H 2UWEA 1GC1C 4HZAA 2UZXB 2ICWJ 3BH9A 3D0LA 4PJGE 4XP9L 1SJXA 3GRWH 4HC1H 5ADPH 4RBPK 4D9RD 1A5FL 2DKMA 5JZ7C 4X8JB 4K9EH 3LQAH 1HHIA 2FB4H 1T2QH 1XFPA 5GS0C 4M02A 2IH1B 2R8SH 3AM8A 5EU6B 4HH9B 3MACL 4U6YB 4LEXH 2XN9E 5D6CB 2W0FA 4XPGL 1B0RB 1H3PL 1N4XH 5JO5B 3M17B 5FCUL 4ONGL 3VDAA 1MEXL 4H5SA 4NDMB 5B8CA 4JFZH 4ZUVB 5FOJA 3NZ8B 5C0RL 5DJDA 3QUKB 5JNYB 3LS4H 3V5HB 2R0ZL 1F13A 4JJHA 4MD5A 1EVUA 2MWCA 5BQ7B 4OQ1A 3PNWA 5GRJH 3GHBH 3M45A 1NMBL 4O2EB 1NAMA 1MCPL 3GMRA 3L7FA 2P4AB 4G6AC 3X3FH 3WNMA 3HI6L 4YAQB 4PJDE 1UADC 4KTYA 1H9VA 2ADIA 1BGXL 4NC0B 4XC3H 3K1DA 2HLFC 2W9EH 2P8MA 1TNNA 2BVOB 1KJ2H 2OMNA 5KSAB 1G9NC 3A67L 5F7UA 3ARQA 1NCDL 1T7YA 3WXVL 3BKML 3HMWH 1IT9L 1NLBL 3PDOA 3K7UA 1JGLL 1I85C 4Y5VC 5GSVA 3IJSB 4XVJH 1GRWA 2W0LA 2F58H 3O6LL 3LKRB 3VA6A 3DARA 3G5VA 3QEHA 4P2RB 4L8DB 1AD0A 3MRIA 4DK3A 2W1NA 1NBVH 4HIXL 4WTZA 5EZIL 4GRWF 3SKOB 1HIML 3CFCL 5DJZA 5B21A 3OGCB 2Q8BH 2XNAA 1DQJB 1QR4A 3GMOB 1GZPA 2E6QA 2J8HA 4HHAA 4P2QE 5DDHB 3NOIA 1MCWM 1BJ1J 1A6WH 1ZAGA 3OKDA 5D2LF 2CLZA 5HHQA 5KOVC 4E42A 4OLXH 3MRBB 1EAPB 4KQ4H 2BK8A 5MEOA 2B8OT 1BECA 4XVTH 5F3HB 5HYEA 4LHJB 4MAYD 4GKSB 5D71H 3UPCA 3WIFA 1BD2A 1C1EH 4RFOL 1YY9C 4U1GC 5DT1H 5GIRB 4D9RE 3QHFL 5HBBA 5E8OB 1HNGA 1IGMH 3G6JB 5DZLA 3RNQA 5GGTL 4H20H 3QI9B 1CFQA 2XFXB 2A6JB 3BH8A 1XGTB 2IANB 2NTFA 2XACC 3FQRA 3QDGB 1A3LL 4POZD 4X4XA 3RZCD 4YQXH 1KPUA 1S9XB 4U6VL 2FNBA 2FH6A 4IJ3C 1RUPH 4JZNB 4KI5F 4HUNB 5ERWB 5J7CC 4JGMA 4R90H 2B2XL 1BIHA 2VZ3A 5B3NA 1DBBH 4FQIH 3UO1H 5AG8A 4XZUB 1KCRH 1OGTA 1MRCL 1YEDA 2WWKT 2FGWL 4KJWC 2RCSL 5I73B 4XP6L 4JKKA 2XYCA 4FNLH 2GHWB 5E99H 3ZMRA 5L2JA 1FJ1B 2L0DA 2P5EB 3HR5B 4NFCA 2H2PC 5I1KH 4XPHL 4WHCA 1CN4A 5IB3B 4TRPL 5LKNA 4U1KA 2ZCLL 2Z9TA 3DXAA 2Z4QB 2PKDA 4EN3B 5MHSD 1CD1B 3C6SA 4N0CD 3QQ9D 4HH8A 3LEYH 1K2DB 4NZRH 2C3GA 3VW3H 1QFWI 2BC4A 3DGGA 2PETA 3V4VL 4JPVH 3FO0L 3NPSC 4IMKA 5T3XE 3VWJD 1A64A 4LGPB 1CFTB 1XGUB 5I8CB 5DWUL 2OTPA 4PG9A 4JJ5A 3UMTA 3VA2C 1MFAL 5FUCE 1I7TB 2P8LA 3KWWA 4PLKD 4NRXB 4BSWA 5CFHA 4PUBH 1RZFH 4OZGE 1CZ8L 2Z31D 1NANI 2DQTH 3GGWB 4E5XB 5D2NA 3VXMB 5ITBL 2V7HA 5SV3A 3E0GA 2K7QA 5DD1H 3C5SA 1LK3H 1A47A 4LLYB 3D39B 1BBDH 2FBJH 2W9DL 3MRJA 5INCB 5GGSA 1NCBL 4Y1AD 3QIBD 3GSRA 1TJIH 3UYPA 5HGDA 2GY7B 3SE4A 4P4KB 1OTUD 2BSRB 1RIVL 1BQHG 4MQXD 3FT4B 2NY5L 4FXGB 5KJRL 5D96C 3U79A 3CFJB 2P7TB 3BGFC 1KIPB 5DA0B 2ZCHL 1BZ7A 1C5CH 5FHAL 3LQAC 2PW2A 4B0MM 1CGYA 3GSVA 5EOQH 1WJ3A 4F7EA 4U1SB 3OR6A 1CT8B 3BQUC 1V3KA 1TCRA 2ITDB 3IXAA 4PTTB 3U1SL 3X12B 2KDGA 2V17L 3HAEA 1EHLL 1FL3B 1KEMH 4JCMA 4LSVH 1OAZH 4HIEA 1ITCA 3BWAB 3LEXA 3VG9C 1EHAA 5IKCB 4UDTB 1EEYB 3WO4C 4KKBC 1A7NH 2EIZA 3WFEH 1WGOA 4ZXBB 2QQLH 2VZSA 1YN6B 1NAMH 4XBEL 4KY1L 4DOHE 3GEWB 4KTEL 2DI9A 2AABH 2O93L 4ZMAT 4XNMA 5E7FA 3OKLA 3QNXB 5GHWH 4GBXB 1U41A 4MJ4A 1EEZB 3FT3B 2B7DT 1PX3A 4JANB 3GBNL 4JG1L 5DMGC 2XPGA 3EYOB 4RQQA 3L3JB 5MHSE 3OKEA 3TN0A 4LU5H 1MCKA 3BO8B 3RWCA 4JR9H 4JHWH 2FCBA 1RZJH 2UVEA 4LCUB 2LQRA 2OM5A 3QIUA 4QWWD 5I74B 3SDCB 5MP6H 1E6JL 3H9SD 4YC2C 3VGEA 2QTEA 4PP2A 5IW1A 3CPLA 4OM0L 4QOKE 5EA0L 4JDTH 2DN7A 1O7SA 3RX8A 3FQUA 1M71A 2JF1A 3CC5B 4WO4C 4KKCC 3SGDI 2Q7NA 4P57B 5CEZH 1CDIA 4JPKL 1JN6A 3ES6B 3WLBA 5A2IH 3G5XA 1IVLA 1IGIL 1Q94B 2PO6D 3BZDA 2ADFH 2ZOKB 3MRNA 4D9QD 1VGKA 4RAVB 4AENA 2VZVA 4K3DL 3QZWA 4YNYB 4Y5YC 5DEZA 5IVXE 3ARDB 3PWVB 1L9NA 1MAMH 4HEPG 3P77A 3LVEA 1FZKB 3KPOA 3TVMC 2CO7B 1D6VL 4Q74A 3BDYH 1QSZA 3GI8L 3BDXA 2X4RB 1DUZB 1QO3B 4GKNA 2W07A 1N5AB 3W0WE 3GKZA 1OTTD 3MRFB 1ZT1B 4Z76A 1A6AB 1RURL 1F45A 3GM0A 2APBA 4MVBD 2XQBH 4DGIH 3FO9B 4GKZA 3QXDA 5I1GL 3T0DA 2P48B 3QDME 3S36H 5KVEH 4HS8L 5GGVL 5JOFB 5IVZA 1B90A 1DQLL 1RK1B 2NXYB 3SE9L 5J3HC 1FNGA 3KPNB 4ZTOL 3WNLA 1J10A 2PR4L 2R0LH 1CGXA 3QUXC 3G5ZA 5GRUH 5CEYB 5ALBH 5F44A 5HJ3B 3HE7A 4L8CB 1C8PA 4JM2D 4LASL 1MCOL 1QKZL 2D7MA 3NCJL 1RU9H 5HHOE 4KPHH 3IFPA 1LE5A 2XWJA 3CFIC 2F54D 3RGVC 1Q0YL 2OLDA 4MXWL 4WW1A 3VWKA 5C0JA 3KS0J 4UQ2A 1WCBA 3PGFL 2FEDC 4HKBB 3FONA 4NQDA 3VXPA 3V6OE 4F9LC 3D9AH 2D03H 2HVJA 1LEIB 3L9RB 5DJAA 5DFVD 4PJEE 2H8PB 4JFFD 2M8XA 2EH7L 3GJFA 3MLYH 3LKPA 5D72H 4UTAH 1ZVYA 2AP2A 4PGCA 2HH0H 3DROB 3LV3B 1NMAL 1A6VH 2CLVB 5DO2C 4GRWB 2AJXH 4J8RA 5DK2A 1MFEH 3BN9C 5TE6L 2VH5L 3SDXA 2FGZA 2YUVA 2W0KA 1WUNT 3Q5YA 4X9BA 2MCG1 5E2UL 3S4SB 2V5YA 1YEFH 1U58B 1OP3K 2VITA 4IOIB 4P46A 5ESVA 2ED9A 2EIEA 5EWIH 5I1JL 2BNRD 4FQ2H 4R4BA 3H7LA 3BP5B 3OQ3B 3V4PH 4PFEA 5T5FL 3JUZA 5AUMB 4NN7C 4D9QE 1VKXA 5JIIA 3TM6A 2XTJB 4O2CA 5IJKC 1UZ8B 3RPIA 1TDQA 4PRIE 5IFAH 5C08B 4MXVF 3M07A 3HB3C 1K3IA 2R2EB 4JO3H 4M48L 1KULA 3C60B 4NNYA 4PRAB 3O3AB 3NA9L 1HSBB 1OOAA 1FVDB 1KJ3L 4LAQL 3IRZA 2YZ1A 3WO3B 3T4YB 5D7LE 1GSMA 2IBZY 3BPCB 3NFPB 4RGOH 1FFOA 2DQCH 4OCRL 2VLRE 1HH9A 1A21A 5ICXA 5ID0A 4HMDA 3U9UA 5F9OL 1QLFA 5GISH 5MEND 2VXQH 2LTQC 3TPKA 2AEQL 1RUKL 5HYSG 1DQML 5D2LA 4GMTL 1X5KA 4F58H 4R97B 1J1PL 5IFJB 1EJOL 1KCVH 2HN7A 4WFHD 3ALXA 1J8HD 4KUCD 5GGQH 5JPMA 2XTLA 4QRUA 4NC2B 1G0YR 3QRGL 4OF7A 2NZ9C 4O9HH 1DUYA 2WQRA 3RDTC 2ZUUA 2GAZB 3TH3T 1S9KC 4NRZA 2VXUH 4W70A 1QPXA 1BX2A 1R3HB 4TNVF 5I75C 2FYYB 3V52L 2NR6D 4NHUA 2F54E 5T3ZD 4Z7VE 4JPWH 1U6AH 3PJSA 4NZTL 5GS2D 3BP4B 1QBLH 1QSEA 3GSUB 3OL2A 3LKSA 1OTSC 4FQXA 1I8MA 2GK0B 3E6FA 4JN2B 2PTUA 4YR6B 1JPGA 1NBYA 4UIKL 1IGCL 4HBCL 5DC9B 1NEZB 1OP9A 4JFFE 3Q2CA 1BQLH 1FRGL 1P84K 3QWOB 5DD6A 5ALCL 5H94A 4LKXA 5B39B 3BP6B 3S37L 4JREB 4UTBL 3NA4A 4JKMA 4U1LA 1R5IB 1RZJC 4WTWA 1T1XA 4LIQH 3UJJL 3I84A 3VJ6B 4GW5A 3WKMH 5DMIL 1Y6KR 4BQ9A 1UM4L 3KXFA 5IHUH 3WEXA 3B9KA 4I8DA 2HKFH 1JRHL 4PJHB 3UJIH 2VLKE 2OR7A 4JFEA 1P7QB 4JB9L 2PXYB 4LSTH 3OXSB 3UTSD 5C71A 1MLBB 3ILQD 2KQMA 1NGXB 4TN9A 4XXCA 4BUHA 5ISZB 2VL5A 2R69H 3IU3B 5C0AE 3SDYL 4X7FC 3MNVA 1EAJA 1CIDA 3D3VB 1ORSB 2H32B 2MNUA 4L9LB 4PGBA 4ZTPL 3AC0A 4TNWF 4RGMB 3EYQD 1TVBA 1NGYB 1P9MC 3FQWA 3B6SB 5H35A 1PQZA 4IIQA 1U8OB 3KPMB 5DURB 2VXTL 4OUOA 4A6YB 3T1WA 1FDLH 5JHDE 5KSAC 1WFNA 3RY5A 1V8HA 4ELKA 5DVNA 3KLHC 3MV8E 5BW7C 3BE1H 43C9A 5J06A 1BJMA 3VFMA 3TYFA 4NHCL 3RWHA 3QCVH 3EOAB 1DTUA 2Y7QB 4F7PB 1AE6H 2AXFB 2EEBA 3LKNA 3ILPB 5C6TH 2OS7A 3O9WD 2UZIL 5MENE 3P40A 4KHTL 4F37K 4FQHA 2HG5B 2XZQL 4HS3A 1ZEAH 3WIHL 3SKNB 1LO0H 3RX7A 1IKNC 4BZ1L 3ECBB 1JZ4A 4GW4B 4JGUA 4HGWA 2FRGP 3INUH 1X4YA 4WFHE 1YEJH 2PNDA 3BKCL 4FTVA 5MEQA 5E8EA 3O3BB 2VIRB 2N7BA 4RIRA 1KN2H 4QT5B 1JWSB 5IMOB 5AWNL 3VFTA 3KNBA 4YXLH 2QQNH 5DQDH 1E4XH 3IVKA 1EXUB 5T3ZE 5I76A 4ONFH 4PJ7E 3VRIA 4DGYH 5I1AA 4OLYH 5HGAB 3KLAB 4L4TD 3RTQA 3QDJE 2NQCA 1AR1C 1SYSB 4LNVA 1CXFA 3STBA 3IDMB 4KMQA 1F4YH 4JFQA 3RFZC 4QXUH 4OCMC 2X4PA 4Y4KA 1LEKA 3TH2T 3IFLH 3EYVA 1S78C 4KROD 1YQVL 3QI9C 5KTEL 1DDHB 2R1XB 2VNCA 2AK1L