3SDYH

Crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
224
structure length
221
Chain Sequence
b'EVQLQQSGAEVKTPGASVKVSCKASGYTFTSFGVSWIRQAPGQGLEWIGWISAYNGDTYYAQKFQARVTMTTDTSTTTAYMEMRSLRSDDTAVYYCAREPPLFYSSWSLDNWGQGTLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title A highly conserved neutralizing epitope on group 2 influenza A viruses.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 37
structure length 221
sequence length 224
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdyH01
1BQUA 2A83A 3ESVF 3MRRA 1XGQB 2CO7B 2ZOKA 4GSDL 4UV4H 2F15A 4AH2A 1K4CA 5DMIL 3B9AA 2F74A 3TO2B 1UA6H 1KG0B 1CL7I 3VA2C 4H25A 3MRPA 1YMMB 1JHKH 2MHAB 2R0LL 2QQLL 3OV6A 5D6DA 4G8EA 2YBRB 3W0WE 1WUNT 5IHZB 3MV9E 4HJGA 4PRNB 5IW1A 4P2RB 1NANH 4QRRA 5HI4D 5C09B 4OM0L 2DN7A 4L4JA 4NRYA 2EICA 1FNSH 2J8HA 2FJGB 3O2VL 5DURD 4XCYB 1QP1A 1ZV5A 4ONHB 3G5XB 4QRQA 1LO3H 2COQA 3SGJC 6FABH 4CW1B 1S7SB 5ISZD 1QLRA 3BPLB 4UT9L 3ULUF 2LE9A 1HH9B 4KH2A 1GPOH 1P7KA 4GS7B 3ZZ1A 2YEZA 4L29A 4DUVA 2NTSP 3HHRB 4OCYH 2VAAB 1U3HD 2Q8BH 2B1HH 3QP3A 3V79C 4KZEL 4BFGA 3UTQA 1JCKA 1ETZB 1C5DA 3ZKXC 1F5WA 5E8NB 4X80L 4HWUA 5ID1A 5IJVA 5JO5A 2ZUWA 4JDTH 5HDLA 3DURB 1G7QB 2EIDA 4QHLA 3DI3B 4TQEL 2VISB 3S3PA 4HIXH 5DK0A 3LH2H 4JVPA 5DTFA 2BK8A 1R5WA 1NGQL 5I8OL 3TO4B 4ZFGH 2J4WH 1ITCA 5IG7A 3EHBC 4HS6B 3LEYH 4N1HB 4Z7VA 5C6WH 3GNML 2VB5A 5J12C 5E94B 5EU4B 1EEUA 1CK0L 2BNRE 2VABA 1I9IL 4Z0BH 1OGTA 3QUKB 1U6AL 5EC1B 2NY6C 2AJSH 5I76B 1T3FA 3S5LG 2EXWC 2XKSA 5DDHA 1D5IH 4JR9H 3M17A 3SDYL 3TNNA 2R2CA 1J8HA 5INDB 2ZOKB 3W39B 5C2BL 1NGPH 4X4YA 3RU8L 3G5ZB 1K4CB 1F45A 4JREB 4LLUA 5EH1A 4JO2L 1S7TA 5M94B 4H25B 1U8KB 3IGAB 1QHPA 1NKOA 1MFCH 2A6JA 4G8EB 1NBVH 3GSNH 2HFGL 4JPWH 1SEBA 4APQC 1NAML 4HDIA 4HJGB 3HNSL 5IW1B 1KJ3L 2XWJA 2OJZL 5EOTA 2PCPA 3PDOA 1UCTA 4MA1B 4X6CB 5I1HH 4MD4A 5JQHC 5I74B 1U3ZA 2YS4A 3IF1A 4NRYB 3X17A 4R3SA 4DN4H 4MD5A 4I1NB 2YK1L 3MTRA 3V6BR 5I71B 3RQ3A 5DHVA 4RMQA 4HUVB 4IHOA 4KVCH 2BVQB 1RULL 5KG9A 4MDJA 4GXUM 1NKRA 4JZNA 5IT2L 4R4BA 3T3ME 2F19L 1YJDL 2A73A 4L29B 3MJ8B 2C3XA 2HRPL 1K5NA 5GGQH 4YHZL 3C9NB 1C08A 1GGTA 3ORJA 2HKFH 4NPYA 7FABL 2FX9L 5H35A 3RDTC 5TQ0H 3T1FA 2YD5A 1FFPA 3S35L 5ABDE 3TM6A 5IJVB 1FHGA 2V5TA 2Z8WC 1R0AH 2ZKHH 4QHLB 1CD9B 1YJDC 4TVPL 1NC2A 3OKNB 5CZXD 3SE8L 3P73A 3JTSB 2E9IA 3GKWL 4QGYA 4YAQA 4WHYG 1R5WB 1IM9A 4HG4J 4PTTA 4RFEB 2B20A 5FGSA 1F3JB 4IRZL 1BX2B 4KK9C 2E9BA 4NM8H 3U9PH 4YPGA 4Z7VB 4WUKH 5IF0A 2J8UF 3MLRH 1YDPA 3GHBH 4Z7NF 1QPPA 4M3KB 3QEGH 1OGTB 1ERNA 5A2JH 2NXZD 2ARJQ 2O5XL 5B38B 2C1OA 1WTLA 5KVMC 3FQUB 1J8HB 3L5XL 2BY3A 1ZLVH 4JDZA 1KB5H 1T7WA 5ICXA 1U36A 4H0IA 3RWGA 3N1PC 4QRRE 2IG2H 1S7TB 2V2TA 4KTEL 1A7OH 5C71A 5EZOL 1XH3A 2A6JB 1B88A 3TYFA 4RGNB 1JGDA 4WI7A 1G1CA 4GW5A 1AFVL 4JY6A 4QXUH 2O26U 2XWJB 5EOTB 2PCPB 3PDOB 4HG4K 1FVEB 1R5IA 1ZHKA 4HBCL 4NNYB 5F8QC 2Q87A 1E6OH 2NTFA 5JUEL 1RIHL 3T0ED 1B90A 1ZT4A 4MDJB 1KPUA 3U6RB 4ZUSA 1KPVB 4JZNB 1JPGB 3MYZA 5GPRA 3VE0A 4X5XA 1KJMA 1DVFA 3E8UL 4LVHC 1FV1B 1SY6H 5LAXA 1UJ3A 5DFWH 3L3HA 4R0LA 4LLMA 4WW2F 3MGTB 3GK8L 2P1YA 3BP6A 4KI5F 4XP1L 1G7LA 1Q9OB 1C08B 3WSQH 4RGMB 5DRZA 2PKDA 5D7SL 4NPYB 5TH2A 1YEEH 3GO1L 1QBLL 4EJ1C 4P23C 4XB8A 3CFBA 1XF2A 4BJLA 4Z7VE 1VACB 2FYYA 2A77L 1NC2B 1CT8A 1FLRL 4JKPL 3P0VH 1IM9B 4XNQB 4PTTB 1E4WH 3BPNC 3VG9B 2QHRH 2D7OA 1LEKA 5IW3A 2XIDA 4QHUA 3WXVL 2R56H 2Y5TB 5TE7L 3UJTH 1TPXC 1J8HE 1YDPB 2R8SL 4FFWC 4OCWH 2NPLX 4Y1AB 1SJXA 3NTCH 5D71H 3V6ZA 3ARBC 1O7VA 1V05A 4XGZA 4S1QH 4N8CH 5JW3L 1YYML 1E6JL 4M3JA 1MHCA 4ZOAA 1ZT7B 2VZ1A 3FFCB 2C1OB 2CLZA 3WIIH 5KN5B 5GRUH 4JFYB 3DECA 1BAFH 4CL7A 4OD3L 1NCDH 5I8CA 3RKDD 1YEKH 3PF2A 2LABA 3ULUL 5B8CC 5T5FL 1GGBH 2EDKA 3D48R 5KOMC 3LHPL 4TSCL 3MJ7B 3CDCA 2AJYH 1MOEA 1XH3B 1J18A 3GB7A 4P2OC 3TYFB 3WHXB 3UP1A 3BW9B 4NUGL 4GW5B 5FO7B 4U1GC 1EHXA 3FT3B 3WO4B 4LLWB 5T5NF 3D6GA 5J8OA 1R5IB 1ZHKB 4OQTH 3RNQB 1P1ZB 3ULUC 5IQ7H 5JOPD 1HDMB 5ILTH 1KSRA 2R29H 4GRLB 3A67H 3C2AL 2EIZA 1DLFH 3HMWH 4PRIA 3I9GH 1EGJL 4X5XB 4EUPG 2WBWB 2X10A 4PGZA 4EQ3A 5B39G 1ES0A 4QHNA 1F42A 3L3HB 5LVEA 4LLMB 4XX1G 4IMKC 3KXFD 2EH7H 3C8HA 3BP6B 3V4VL 3ZO0A 5I16B 1G7LB 4MQXC 1FL5B 1MPAH 5DRZB 1B4JL 4MQ7A 2VDOH 3KLHD 3BI9X 1ZANH 5CEZE 2HLFC 3S7GA 5AWNH 1JMZA 3CFBB 5CUSH 1L0XA 3GSQB 1A4JB 2DD8L 2FYYB 3LSOB 4QHMA 3UTTA 2V7NA 5TDPB 4DW2L 1ND0A 3T2NH 3PNWB 3QUXD 2H2SD 2JJTC 4Q9CA 4XPBL 3LEXA 4HMCA 4OUOA 1T66D 3LIZL 4FQXC 1ZHLA 3L5IA 1WEJL 1KJVA 1LEKB 2Y07L 1W72L 1P6FA 3OPZH 4QHUB 2GHWB 4WW1A 5E6ZA 2RFXA 1ADQH 2ADGB 3OMZA 5DQ9A 3JV4B 1M71B 5KSUA 4L9LC 2AABH 4XTRD 2O61A 1IC1A 1SM3H 3RA7L 4X7FC 4MX7B 3STLA 1DQML 2R0ZL 1KCSH 3C6SB 3LKQA 2IADA 3OAUH 4TPRH 3OR6B 5CEZL 1A9EA 3MRQA 3ZDZE 2IANB 2VE6B 3CMOH 4WU7A 3RTQD 2R23B 4JFXA 4JVUA 1K9TA 1D5MB 3P4NB 5EPMB 3RHWF 1IGIL 2IH1A 4U4BA 2BP3A 3H9HA 3SJVD 4LLQA 2QLVB 4G6FD 3OL2A 4KAQL 2CPCA 1A6TA 4AEIH 3RZWA 3WKNA 1S5IL 1NL0L 4Z7UA 1WZMA 2C3GA 2XKNB 3NPSC 3QBTB 4OZGF 4PJEA 1YEIL 4LAJH 1IL1A 4L4VD 2XA8H 1CGSL 3HNTH 4LPYA 4O00A 4UIKH 3V9FA 4OLVH 4NQSA 4QGTA 2BY1A 3CDGB 2Z31C 4OV6F 3VFTB 3VXRD 4CGTA 1EFQA 3G9VA 1QVOA 3NGBC 5GS1C 4Z78A 3HE7A 5FYJD 1OTSD 1A3LH 4OF8A 1UZ8A 3S9DB 3F7QA 2IBGA 5IMOA 2UZIH 4MNGA 1LNUA 2X1QA 1ORQA 1YEHL 3QZWA 4MQ7B 5FGBA 2N56A 4M7LL 2CO6B 4ODUA 2P47B 1NH6A 1CICD 1AGDA 3NFPB 4KJQD 5DJ8A 1L0QA 3VWJC 1CFQA 1XCQA 4QHMB 3QEUB 2V7NB 3AU1A 5FO9A 1ND0B 1V7ML 4D9QE 5EC2A 3MA7B 1HH6A 3LEXB 1L9MA 1N7MH 3P9LA 5I0ZA 5EOQH 2PXYA 4V2BA 3VMNA 1ZHLB 2JELL 4AMKH 1ZA6B 1BJ1J 3PXJA 4KI5E 4NOBA 1IT9H 3GMPA 4FXKA 2HRLA 3HE6B 5DQ9B 4OZFH 1IAIL 4OBRA 3EYUH 1I9RH 2OXGA 1MAMH 1H0DA 1E28A 3HZKA 5JW4Q 4ODXA 3RKPA 1XR8A 4KRMB 4P59L 2IADB 4FOMA 4I2XA 4KXZH 1Q9LB 4WU5A 1G7MB 3L3IA 5HVWA 3WFBH 4R2GB 4M5YH 4WU7B 2AK4D 5JQ6L 1KULA 4M7KL 4P4KC 2CKBA 1A6UL 4NN5B 3WUWA 1ZOXA 2IH1B 5KSAD 3U4EA 3HAEA 4PP2A 5LJYH 3H9HB 4N0UA 4LLQB 3K2UH 4BFIB 1S8DA 1UM5H 4P5KB 1A6TB 5GRJL 4ZO9A 5IR1B 3QXAA 5FYJH 1HXYA 4M6NH 1CF8L 4L1HA 4PRIE 4PJEB 1EEZA 1IL1B 3PWPA 2WINB 2BSED 2AJ3A 5DD5L 3T2PA 3WV0A 3MMEA 3SEPA 4NWUH 1J1XH 2DQEL 3W5NA 5C0RH 4WW2C 5F7NC 5DUML 4F7CA 2EDYA 2EIBA 3NACH 4PJ8C 1JZ8A 2XQYG 3S96A 4Z9KB 1QVOB 5CIPB 1EZVY 1MQ8A 1BFVL 3L5HA 2XPGA 4DOHE 1QR4A 3HE7B 1XCTA 1UZ8B 2X2YA 5CFHA 3BZFA 1P4BL 2OZ4H 1A8JH 3OXRA 3V5HA 4P5TD 4MNGB 3UTTE 1JTTA 3HUJB 2BERA 1GXEA 1U9KA 3QZWB 4TUKL 1PVHA 3IFNH 3L6FA 3P9MB 1N5YH 1X3DA 1FFNB 1QRNB 4IRSD 4PY8I 5EORH 4YZFE 3K1KC 5DJ8B 1MRFH 3WNLA 2R69H 1A7BA 4XWGH 4PJ9C 4OFVA 5FO9B 2BVEA 3SKOA 1JGUH 3QCTL 1DCLA 1MCBA 4PJ5D 5JXED 1HH6B 2AERT 4LSPL 2PXYB 5D6CB 4NQDA 1FAKT 4JHWL 1FNAA 2IAMB 3GMPB 4FXKB 1OT1A 4OLWL 3EKCA 4OGYL 3FB7B 1MQKH 1Q94A 1E28B 2Q76B 5F6IB 4YGAB 4G6AD 4NQEA 4LHJB 3IT8D 3WFDL 1INEH 3G5VB 1E4JA 4MB4A 3CCHA 4I2XB 1J8KA 4ALAL 3LRGA 2W9LA 4OGAD 3REVB 4NQTA 1QLEH 4Z7UE 2E9JA 4FXLA 5BZWB 3ZSTA 2CH8A 2CIKA 2CKBB 1X5JA 4PJEE 2EKJA 4O58H 4Y5YA 1BQHB 4GG8A 5FDWA 3HAEB 3LAFA 3O45A 4PP2B 4N0UB 3QG7L 3IDJB 4X7SL 4MA7H 5DJ0A 1OQOA 2GW5A 4KTDL 5I9QB 3QIUB 3QXAB 4PGEA 3VD7A 2BDNH 1HXYB 3QG6A 1EEZB 4R8WL 4ZSOB 4BZ1L 3CFEA 3GJFA 3NVQA 4DKAA 1ZWIA 2E7HA 1J86A 4NC1E 2AJ3B 2XZQH 3MLSH 1AR1C 3ETBF 1TIUA 5FUOL 3D2UD 1BOYA 3NCBB 4HCRA 3UYPA 4F7CB 4R6UA 4MNGE 5ISZA 3P3YA 1EV2E 2OYPA 1OM3L 1C5CL 2EKSA 4O5LL 4DKFL 4H1LH 4PJHF 2XPGB 1F11A 2H26B 3DO7B 3RGVC 1XCTB 5FHBL 3BZFB 4MJIB 2NNAA 4NOFA 1N2RA 4D9RE 5TJWK 3PQYA 4PLJD 2H1PL 4FQLH 1EEYB 2OR9L 2LVEA 3RWEA 1NDMA 1Q72L 3ALXA 4OGZA 5HHXH 3L6FB 3IKCA 4YPJA 3IETA 2BSRA 3VFNB 1R6VA 4HPOL 5D1XA 5GISL 4XMKH 3TT1H 3A6CL 1R3IL 4GAGL 1MEXH 1U8PB 4Z95H 1MY7A 3NIDE 4YHLL 1FO0H 2C3VB 5J7CC 4NN7C 5ALBL 5KVDH 4I2XE 3CU1A 1OWWA 4LSQL 4AEFA 3B9KA 2W0KA 1MF2L 3LEVH 4FZ8L 3MRGA 5L2KD 1DBAH 5DD0L 2E5EA 1TFHA 3TJHD 1OY3B 2OJEA 1EFXA 4XC1H 3Q5TA 1UJTA 1HOCB 1PAMA 1I1CA 4BSJA 1OP3H 4KK6C 5DD3L 5FYKE 2AVGA 4N5EC 4FNLL 4ZAKC 5T33L 2YD9A 2CIKB 1T7YA 2FDBP 5ADOL 3ZE2E 1VKXB 5FDWB 3PWPE 4R7DA 3O45B 2OTWA 5EBWA 3TESA 1NFDA 3WN5B 1J10A 5DJ0B 5C08A 1OD9A 2HYMA 2BHYA 4MXWL 5BJTB 3RY4A 3E6HB 4PGEB 5LXGH 1I1YB 3QG6B 1ZGLB 2VQTA 5DI8A 1KB5A 1RURH 2C7UA 4TTDC 4OT1L 1ODAA 1ZWIB 2OTPA 5DURB 1A6VH 1S3KL 1UCBL 5CHNA 3S8WA 3MRKB 3LKNB 5FYKL 1VFOA 1F4WH 1FVCA 5ISZB 5M7QA 1FNGA 3GSNB 3V8CA 3X13A 4NKIH 2NY5H 3DJ9A 2EKSB 4UINL 5CINH 1FGNL 1OAXH 1Q1JL 2V2XB 3DUUB 1G7PA 4K3DH 4LSUL 2GSGA 3KDMA 2R4SH 1YUHA 3G5YA 5AYUL 3VRLE 1H8NA 1U3HB 4MGXA 2NNAB 1RFDL 4KROD 5CJOL 5KS9F 2CMRL 3INUH 5CGMA 1VSCA 3W2DH 1F58L 1NDMB 5D93C 3M1BB 3T08A 2RHEA 3IKCB 4XH2A 4NQDE 5B3JE 2AI0L 1SY6A 3IETB 3V0AC 4HJ0D 4CDHA 3DVFA 3FO1A 2VO5A 1NLDL 5EBMA 3OKYA 1P9MA 1I1FA 3Q1SH 3OX8B 1HHGA 3BGFC 2IJ0C 2AAVA 4R9HA 5CKAA 4NQEE 2R4RH 1G9EA 1AQKL 4ZS7L 3D85A 1N5AB 3GBML 3QNZB 3V7MA 3N50A 5K59F 3MRGB 2EDDA 3FT2A 3EYQD 2OJEB 1K6QL 1A6WL 4KK5C 1YPZF 4LGRB 4XBGA 3MPCA 2QKIB 3IAQA 2A9NL 3WS6A 1KTLA 1FZJB 5GGTL 4MSWB 5D7LD 4RAVA 1T5XA 2NY1C 5EZIH 5J13C 4UZGA 3BH9B 1NUNB 3CLFL 4OB5L 4ZO8A 4HSQA 5ERWB 4R7DB 3VXUA 2OTWB 3NIFF 4IRJA 3SO3C 4BKLA 1NFDB 3T1WA 1KIQA 2MQ3A 3O9WC 5SWSA 1KN4L 3PWLA 4G42B 4BQBA 5ISZE 4YHNB 2FSEA 4F7MB 4BQ9A 2OM5A 1KB5B 3RJDA 4WTXA 2ERJC 4RMWA 4JZOA 4FN0A 3QO0A 4IOFC 2RAMA 1UM4L 3T0EA 4LNVA 1EEQA 5T5NG 1IEBA 3PQYE 3GMMA 3QPXH 2QADC 1EHAA 1TZGL 2DQUL 2IBZX 4ZUTA 3X11A 4UILH 3ESUF 3CXHJ 4ODWB 2J1KA 3VFMA 2I60H 1RQ5A 1JGEA 2GSGB 5D8JH 3MA9L 1YUHB 3G5YB 4QXWA 4C56A 4OQTA 4JB9H 5DLMH 4FTVA 5T1KD 4UB0L 4M8QA 3GBNH 5T3XE 1FORL 1PJ9A 4UMGA 4WO4A 1TQCB 4D9LH 4P3DA 3PWVB 3UZQA 3NAAL 4GLRI 1BZ9B 1PKQA 3LPFA 4XH2B 5HVHC 2L4OA 1EH9A 1KEGH 5CMAB 4Z76A 1CFSA 2IALA 1DLHA 3FO1B 2XZAH 1FG2A 4CNIB 5K9JL 1ZHNB 3N1MC 2FO1A 4H88H 4PRDB 4Y2DD 2OL3H 1YC8A 1MSPA 3OKMA 4NC0B 3RZCD 4IS6B 5J89A 4KKBD 4PG2C 2H2PC 1T2JA 4BM7A 1WJ3A 1RUQL 1YEGL 3F7RA 3MFFB 5KJRH 2VDMH 2NXZB 1OAUH 3FT2B 5T3XL 4U1KB 4D0BA 1RPQA 2P8MA 3L5JA 5C08E 5F71A 2QBWA 1KTLB 2W60B 3CH8A 1EO8H 3DMMD 4K3JH 2X4OA 4LDEB 2EIEA 5I1DA 4MHHG 1YEDB 4LASH 4MXQD 5J1SC 3GSRB 3IKKA 4YBQD 2H8PA 4X0KB 2XQYK 4X9HA 1NFIA 3V7AE 4TNVF 3PWLB 1A7QH 5JDSB 3FQNB 4HPYH 5HI3C 2WUCH 3MRCA 3V4UH 1OLZA 2WWMD 4JZOB 2BVUA 4OTXH 2VLRA 2D03H 2H45A 3T0EB 5GS2H 2FR4A 1IEBB 4X7CC 4S1RH 4DCQB 1AE6H 2XI9A 3X3GH 1KJ2H 3G6DH 2NY0C 2CDEA 2UV3A 2X9YA 2HLAB 4KU1A 4ZUTB 4XVUD 5TPWL 5F7EH 1DBMH 1FJ1A 1NLBH 3KXFA 3X11B 4I3SH 3TN0D 2D7TH 1JGEB 1TLKA 3THML 1EZVX 3D39A 4L3ED 5GJSH 4EN3A 4GW1A 4XVTH 3DGGB 4O2FB 3VRIB 3NH7L 3FN9A 5FCSH 4P9ML 4HS8L 5DJZB 5BOZG 1KENL 2ZJSH 4NFBA 3B2UD 3ZKMD 4P3DB 1E27B 3MROB 4JKLA 2HJKA 1EHLL 5T1MA 1KFAH 3RWDA 3RWFA 3W11D 2IALB 1FDLL 3QA3A 4X6CF 3WUWG 4C55A 4ORGB 1J1OL 4HIHA 1EMTL 3MJ9H 4FP8H 1DBBL 1K8IA 4C58B 3VXSA 2YKLH 4KKAD 3OKMB 1RSFA 5HTSA 1WC7B 4JFDD 4FG6D 4HJJL 2HWZL 3G6AA 5IW6B 3FONA 3O3UN 4G80B 4M6ML 1NCCL 2KH2B 3N06B 3MBEC 1UWEL 3BP5A 1KUMA 4U7KA 4WWKD 2WWKT 3O6FD 2HFFA 4D0BB 2YWYA 3VXUE 1U2CA 3S4SG 5HHMD 5BO1H 3VXQA 3QRGH 4LPCA 4NZDA 5SWSE 4Z8FL 3VFOB 4PLKD 3U4BH 4ZTOH 3QR2A 4H8WL 4JANB 2M1KA 4AIOA 2BNQA 3ME0A 5GJTH 1B6DA 4K94L 4OZFA 5I1DB 2IGFH 4LQFL 2VXSL 2H8PB 3AUVA 4GQPH 2ATKB 3TH4T 2X4SA 3UJIH 1HINH 3VXOA 1GOGA 4B50A 5IHUL 2EDOA 4DKEL 1HHJA 3DRQA 3ZKNC 3MRCB 4H8WC 4ODTL 1I3GH 4NJAL 2VWEC 4C56E 2DLGA 4EI6B 2AJZA 2FR4B 4FTVE 5GRVK 5E2UH 5GIRA 1OTTD 3C09B 2CDEB 4Q9RH 1A21A 3KXFB 4KV5F 4P4RB 4NZRH 3VGGA 1PKQE 1OSPL 3BDXA 4M7ZC 3QWRD 2X89D 4PRHA 4LCUB 4ZXBA 2JTDA 3FO2A 3MGOB 5D1QC 3F5WB 3WHE0 4TTGA 4M7JL 2J6EH 4N9GB 4ETYA 5C0EB 4JKMA 15C8H 4GMSL 1OPGL 1LO5B 4F7PB 2VXUL 3ULVF 2I27N 2HJKB 3EUUA 3L9RA 4GBXC 2NW2A 1OAQH 5T1MB 3CXDL 1XGRA 4HKXB 3QUXB 3FT4B 4ZS6D 3RUGB 3QA3B 5BVPH 1A2YB 1ED3B 1K8IB 2Y1VA 3UAJC 1FE8H 4L8BB 1N3NB 4Z18A 1OP9A 4XPFL 3G6AB 2EE9A 4P9HH 4LSRH 5JXAL 2FRGP 2E7CA 3TA3A 3PL6A 1RZIA 1RUPH 3NZHH 2YSSA 3GSXA 4JQXC 5E4EC 3RTQB 3ECBA 4XXCA 1EBAA 4G43B 4UT7H 4HWBL 5L8JB 3OB0H 1GL4B 5D7IA 3QUYC 4HWEH 3CSBA 2OXHA 2VH5H 3TCXA 3SJVB 4PG9A 3ARDC 4G6FB 5DR5H 4OZFB 5IGXL 5I1IL 5FAAA 4LMQI 2VLRE 2JIXA 1BQLL 2CRZA 4F9PA 2D9CA 4TSAH 5C7XL 1Z9MA 4EBQH 3GMOA 4M5ZL 1CL7H 3T0VA 2V17H 4L4VB 5D1ZC 5GGRY 5J3HC 2J5LB 4KQ3H 4OZIA 1HHJB 3DRQB 3KXFE 3UZEA 4TOYL 4OFKA 5HSFA 2VQUA 4PJBA 1KTKE 2K1MA 3D39E 5C8JA 1DJSA 2AJZB 1PYWB 1MFAL 5GIRB 5IROA 1YYLH 3WLWC 3NN8B 5JIIA 3O6KH 1WFUA 2DL2A 1UADC 4JQIH 4P5TA 5CD3B 4UNUA 4K23L 1DBJL 2RCSH 3ZTNH 1G9ML 3ARGA 3RPIA 1X7QA 3ARXA 2ATPA 1MREL 2E3VA 5DJDA 1WZ1L 3VXSE 2DKSA 2HVKA 2IPUK 4H1LA 4ZDHB 3NCYS 5I2IB 1BM3H 1FYTD 4JQVC 5F88A 1D5ZB 1WV7T 5FGCB 2VLMD 3TPUB 3BPLC 4KZDH 1G9MC 1MFEL 2WANA 1NGYA 1OW0C 1S9WA 4GS7C 1UGNA 3PP4L 1FZKA 2ZNXA 1O5DT 2DLTA 5GGRB 4NO5B 3IAPA 1Y18A 2B0SL 4OJFL 1MJUL 1QYGH 2BNQE 2FNBA 3EJZC 5EIIB 2H32A 4CAGA 3ZT5A 3V7AG 1FO0A 2YSSB 3UYOD 1B2WH 2AK4B 4P2QA 4KDTC 2YZ8A 3T8XB 4Y8DC 5D7IB 3R1GL 5KSAB 1C8PA 4RAHA 2A2QT 4PG9B 4OI7A 3HI6H 4Y88A 3KHOA 2VL4A 3TO4C 4CVXA 3B2VH 3U1SL 3SDAC 1CGWA 4X6EA 1U8OA 1EDQA 1UQSB 1UB6A 1NGZA 3ZL4H 3LS5L 3I6GA 1LO0H 5FYJE 5HYIA 4HAGA 3TVMD 2BVOB 4OZIB 5IB5B 2F53D 4HK3J 3TYGL 4F37K 3PDGA 4KKCD 4G5ZL 4NGHL 5C8JB 4PRHE 4UT6H 4PGCA 1T7XA 3HMXL 4HS3B 5I8KH 4KI1A 3H3PH 2W1NA 1CLOH 5C70A 1Z0MA 3O8XA 3VXMD 1BBDL 4QWWD 4U1NA 4WV1B 5HHQA 5GZNC 4P5TB 4LLYB 1KV3A 4HUMB 3PG2A 4GAJL 1EJOH 2MCG1 4X7DC 5K9OB 1X7QB 2ICWB 1F4HA 5CEYA 4LEXH 4XCNA 4MA1C 4IRSB 1J9CT 4HH9B 3FMGL 3TH2T 1GSMA 4Y19A 3A6BH 1BVKA 1KTDA 1YC7A 3J8F7 4XP4L 5I71C 4WFFD 4PJ5B 5BV7H 3LKSB 5F88B 1DDHA 3WEXA 1ZSDB 4KKNA 4KV5E 3TWCL 1INDH 4ZPTA 1J1PH 5KZCB 2CUHA 2X9XA 4OAWA 5I1AA 1MCOL 3QUZD 4EOWL 1C12A 1RU9H 5D7IE 1Y18B 3BD4A 1A9BA 3O6LH 4KMTL 5DWUH 1XIWC 3RHWK 1KACB 3ULVE 2DRUA 1PG7H 3PGFL 1FO0B 1ZEAH 2Q7YB 5CBEA 4P2QB 4HX1A 3QHZH 3HG1D 1C5BH 3C60C 4YFLF 3TH3T 2WUBL 3BE1L 4P46D 3DSFL 4XHQA 4QEGA 4OZIE 1PX4A 4CVXB 3KYMA 3MRMB 4N0FB 3DBXA 1WITA 4PJBE 1PGRB 5D7JC 1U8OB 3PJSA 2BC4B 1NGZB 2DQHL 3C5JA 4M62H 5AD0B 3C5ZC 2FX7L 2BXZA 4LSDA 3BH8B 5T3ZL 3ULVL 5HGDA 3CLEL 4DZBA 1I9JH 3MBXH 3D2UB 1TNNA 5I15L 5F1IA 4YE4H 5AZ2L 3CFJB 3IAGC 2ADIB 4JFHD 4FFYH 4L4TA 3MJGX 2D7NA 3H0TA 3MRHB 1SVCP 3EYVB 1PLGH 4YHOL 3WNNA 3WE6A 5E99L 2EYTB 4RGNC 4YUEL 3WL9B 1LMKA 3VFVA 4WGWB 1MCLA 1HYSD 4XCNB 1I1AC 1IC4L 5E08L 1QSED 1UYWL 4HGWB 2D9QB 2A6DB 3IFLL 2G75B 5E5UB 3L3JB 5I1GL 3Q48A 1N0XH 3VWKC 1O0VA 1MVFA 1SQ2N 4JFEA 4MJ2A 4CJ1A 3IXTA 2B4CL 3IU3B 2YA2A 4ZPTB 3RY6C 2DBJA 1GH7A 3CDYA 2DQTL 4HKBA 1JFQL 5C6PB 4P2QE 5L2KB 2R2BA 3BZ4A 5F1NB 5CJXC 3WYRA 5FUZL 5A3IC 1C12B 3VDCA 1HN1A 4RGMC 1A9BB 4LCWA 5A43C 2CJUH 3SQOL 2ZZUT 2J12B 5HGHA 1GZPA 2NXYD 4LOUD 1FNEB 3P30L 4NHCH 2DQFA 2B4CC 4XI5C 3KNBA 1AKJA 4Y0GA 3HUJF 4HX1B 1MCNA 3FQTB 3NPZB 3TT3H 2X44D 5DS8A 4PJGA 3UYRL 5TGBB 2FD6H 3BYYA 3KYMB 4M43L 1SVZA 3DBXB 3QDHA 1JRHL 3KHQA 4AEEA 3WS3A 4FQQB 4KHXH 4M48L 1WISA 5DFTA 2HKHL 5IIEA 1A1NA 1S78C 4POZC 4WI4A 4BH7A 1MHHA 3FN0H 5HGDB 2D31A 5HHVL 4DZBB 5GGUA 1GC1H 1L9NA 1HSAB 1EJ6A 2X4TB 3BGMB 2X4UB 3LZFH 3QUMA 1GOFA 3BMWA 5EUKA 4JZJA 1SBBA 1FIGL 4BFEA 5LGHL 1KB9J 3PHSA 5E8DL 2ZCLH 1OAKH 5E5MB 2D7PA 2IC2A 2HT3D 4KROB 4OLZL 4Y19E 2ICCA 4JLRA 4X6FB 5DMGD 1OTUC 4LFHG 3BN3B 3QCVL 1CIUA 3VFVB 1BPVA 5DHXB 1FAIL 3HC3H 3RWIB 4ODHL 2VR5A 4HK0A 1NC4A 3D87B 4GRLC 5DRXA 5F9WB 1UWGL 2GJ6D 4YXKH 3HNVL 1H3PH 3F6IA 5IBTL 1W8NA 2XTLA 2AGJL 1DN0B 1I3VA 3MODL 1T1XA 4HKBB 4ODSL 3LKPA 4DVRL 3M8OH 1FZMB 3PGDA 2Y9RT 3MLVH 1I7TA 4CMMA 1JN6B 2EECA 4OCXH 1X6NA 5HGHB 1KB9K 4A2LA 2OL3B 5HHOD 2BNUB 1X44A 1JF1A 5D7LB 3VD5A 3KNBB 4KRNA 43C9A 2QJDA 1IAKA 3DMMA 1ZKAA 4Y4HD 2DB8A 1FCCA 4WI9A 4PJGB 2A6IA 4G6ML 2GAZA 2ADFL 3C6LD 3QHFH 4YJZL 4CVZB 5ICYB 1JK8B 1VGEL 4W70A 1NCAL 4C54A 4HBQA 3WS3B 4B0MM 2CXGA 4YO0A 4L4TE 1R3JA 4GMTL 4KJPD 1U8HA 4MZ3A 1LEIB 4X7TA 4UTAL 1OF2A 1FH5H 5DMKA 4Z0XB 5E8PA 5JW5A 5MHSE 3VRJB 3BKMH 3E3QC 2FJFA 3BIKA 3QWOA 2ZCHL 2VIRA 1UM6H 4JPVL 1ITBB 2DLFH 3LN4A 1JNHB 4K8RD 4G3YH 1UWXK 4WIQA 2Z9TA 5EUKB 4JZJB 1OARH 3TN0A 2Q86A 3KPPB 3B6SA 5HI5D 4KJYB 4L3EA 3LN9A 4CU6A 3GBLA 4OLUH 4K07A 4EZMA 2F54D 2P44B 4PB0L 5F1KC 2DOCA 5T1KB 3LPGA 4DFHA 2FH8A 4DGIH 4X9GA 4JFEE 5D7KD 3L1OH 4DGYL 1A7PH 4HC1H 4NRZA 4PYHA 5DYOA 2BRRL 2VDNH 4DVBA 2ED7A 1KJ2B 4O2CA 5C0GA 3H42L 3AY4C 4UV7L 3BRDA 2A9MH 4P49A 5JOFB 5DRXB 5I18L 4JAMB 2X1OA 3UO1H 1D9KD 4LCWE 4LSSL 4XC3H 3RZCB 4LAQL 3W9EB 4I9WD 3H8NA 3JV5A 4C57C 4I0PA 2J6EA 2JCCF 2RJMA 2GY5A 2V5SA 5DJ6A 1KCUH 4WWKA 4X9BA 2NY7H 1S9VA 2ZSVB 2O93L 1I85A 3O6FA 1I7TB 5EWIH 4CMMB 4XPAH 4HLJA 4FFZL 8FABB 1L0YA 4FMFA 2VXTL 4JHAH 4PJGE 1F4XL 3MLZH 5GGVY 1MVUA 5IM7B 4Q0XH 2V2WA 1KN2L 5FYLL 3Q3GA 4MS8D 5J11C 3H7BB 1MY5A 4KY1L 4LCIH 1AXTH 3DMMB 4GT7A 2BJML 1TVBB 1RZFL 4AIZB 3OG6B 3P11L 1XF4A 1UXWA 1ZLWK 1PG7W 4OUUA 1D6EA 2A6IB 4K8RH 5IVNA 2X1WL 5C0FA 5F3HA 2GAZB 1QHOA 2DMBA 1LDPH 3QXUA 3HE6C 2RQ8A 4UDUA 4HWZA 2NY2C 3FB6A 4UBDD 4R90L 4X7TB 4YIQA 2JCCA 3O4OB 4GRWH 2C5DC 5IWLA 3LB6D 5DMKB 5EZLA 3BIKB 1L7IL 4EKXA 4R2GC 2VIRB 3BSZL 2IPTL 4LHUA 3O2DL 1PKOA 4UOW1 4EI5D 3PIQA 1LO2L 3RAJL 3TN0B 4ZOEA 3B6SB 4R4NC 2W9DL 4L3EB 2BVPA 4KRPD 3TBSA 3NCEB 5IESL 3DX8A 2FLRT 4NYLA 1DP0A 3Q2CA 4P2CG 1Z3GH 2Z8VC 1RHHB 3QUML 5EO9B 1TCMA 4HUXB 2DQCL 2EO9A 3U0TA 4M1CD 5C07A 5DYOB 4F33A 4Y16C 4PJXA 5IUSA 4W4NA 4O2CB 3GGWB 4OCMC 4YR6A 4XBEL 5E2VH 4YC2B 1JMXA 5KSVA 3QIBA 4XMPL 4DK3A 2ZUYA 3GRWL 1TQBB 1VPOH 4JDVA 2FZ3A 2B8OT 3O11A 3JV6A 2G60H 1AI1L 4JFDB 2B2XH 1HKLL 3RL1B 2ORBL 1LD9B 4QXTA 1YNKH 2GUOA 2R0WH 3V4PH 5IMLA 1SYVA 1QR1A 4PJFB 4OZHA 4LEOA 4WWKB 1Y0LA 1S9VB 4HHAA 3O6FB 1X4YA 3QI9D 2ARJB 5HHMB 3KYKL 1YY8A 1NEZA 2DQIL 4XP6H 1XGYL 3MOAH 5FA4A 3KPSD 2V2WB 4U1LB 3Q3GB 1U58A 3F65A 1ORSB 4PJ7A 1CS6A 3PWJB 1UXWB 1A64A 1LK3H 4TULH 4WHYH 1ZLSH 5C0FB 4MXVF 4WEMB 1B0RA 4XHJD 1LQSR 1T0NB 2HJFA 5ALCL 4Y5VA 2NZIA 2IAMC 4WI3A 3MCG1 1S7VA 1F6AA 1U8JB 3S88L 1JZ2A 4I3RH 1V3KA 4HWZB 4POUB 4OZ4A 4YIQB 5F6IC 4B5EA 4L3EE 4PPTA 1TVHA 5EZLB 2E27H 2DQDH 3LN5B 4ONGH 1KELL 1JF6A 3GFUA 4YDIH 5DEFA 2GTZB 1CG9B 4LSVH 4YQXL 1T04A 3PIQB 5F7KC 3VH8A 3ARQA 1UZ6F 2HH0L 2X40A 1ACYH 3SGKA 5C0BA 2EC9T 3UDWC 3B5HA 5HJ3A 3DROA 1HKFA 1NMAH 5IBUG 5KOVC 3P77A 3T0BA 3TBSB 2L7UA 3OAZH 3U30B 4LARH 3KS0H 4HXBH 3QIUC 3UBXA 1PD6A 1QPXA 4JG1L 1BWWA 2HT2C 2YC1B 4HLZG 3N1QC 2CRMA 3U0TB 3IJHA 4MJ5A 4X4XB 3MV9D 4N0RA 1LO4L 5CGTA 4F33B 2ZPKH 4J2XA 5T1DL 2HJLA 3EHBD 2YMXH 1FYTA 3SDCA 3P4OB 4TRPL 3D0LA 2FZ3B 5CJQL 1RV6X 5E6IA 5IFHL 3STZB 1LE9A 4GUPA 3WIHL 4NO0A 2FIKA 4D2NA 2GFBB 4LRNH 2I24N 3V95A 2YUWA 3CSYA 4GSDH 4NO3B 4NQCA 2OTUB 4QXTB 4NWTL 3UTPD 1VA9A 2CDFA 2PUQT 5D70L 5DMIH 3SBWA 4OZHB 3QB7C 5IMKB 5KVFL 1Y0LB 3BHBB 1MLCA 1V5JA 1G6RL 2R0LH 4X6DB 1T80A 2QQLH 4TUJA 5JORB 3VFSB 3EJJX 3G9AB 2R2HB 3D69A 2E8ZA 5FA4B 3QXTA 4NIKB 5ETUB 5EOCJ 3FZUD 4I0KA 4TNVK 4Y4KD 2G5RA 4PJ7B 5E8EA 4EXKA 4OM0H 4PGBA 1R5VB 4LCYA 4GJTB 3V0VB 5E8OA 2JCCE 2VQ1A 5FKAA 4Z7OF 2XFXA 3GSOA 4JFQA 3O2VH 3LEYL 5HYJA 3SE4A 1B0RB 1K4DA 2XY1A 5DJ2B 2HJFB 2DQGL 3MRIA 4Y5VB 4YBLB 1S7VB 1WK0A 1EX0A 3LQAL 3SHSA 4UT9H 3BMVA 1Q0XH 1YA5A 3RVTC 3NCJL 4R26H 1VFBA 2R0KL 2VUYA 2BNRD 1TVHB 2PN5A 5CILL 3BVNA 3I84A 4IOIA 4OD1L 4KZEH 3HS0A 1T04B 2WSKA 4MA3A 1U8QA 3NA9L 4ZFOB 3VXMA 3VH8B 3WMSA 3VFWB 4X80H 1ZS8B 5C07E 1H8OA 5IVXB 3LQAC 4PJXE 4NBYB 3RPKA 3TP4A 3WN5C 4TQEH 2P43B 3GSNL 3VI3E 3SKMB 3C5SA 3H7LA 1JPFA 3UBXB 5HI4C 4RISL 4HIJA 1EERB 3I02B 4K2UL 2XZCH 4EIGB 1NGQH 5I1HL 2Z35B 3Q6GH 5I8OH 1I8KA 3IJHB 3BWUC 4L8DA 4YK4B 2VDPL 4DN4L 4KK9D 2HJLB 1FYTB 3GNMH 3WFZA 3U4AA 3B3IA 1CK0H 4OZHE 1I9IH 3CH1A 5MEND 1T4KB 1U6AH 3BJLA 3ZTJG 1AIFA 4TVPD 1JZ6A 5LCVL 4HKZA 3SDYH 1QO3A 3UPRB 3EDKA 3QFJA 1YZZA 2VKWA 1MCDA 1U3HC 4JM2A 3RU8H 2Y36L 3IFOA 1WT5A 1X5XA 5J57B 1MLCB 4PJ7E 2CK0L 1PEZA 1I8LA 5BV7B 3BQUD 5TQ0L 5L7XH 2I9TA 4I77L 2BVYA 4TUJB 4NKOA 2HFGH 4G7YL 3K7UA 1NAMH 1WFTA 1GAFL 3HNSH 1N8ZB 3OJDB 1ONQB 1KJ3H 1J0YA 2OJZH 3MACL 3O3AA 2DKUA 2EDQA 1QFPA 3ALWA 4K3GA 1IAOA 3I6LD 4X6BA 5E8OB 5FKAB 5C0DA 1BLNB 3GSOB 4XPHL 2YK1H 2AW2A 3RUGF 3MLRL 1PQZB 1RULH 2P24B 1NBYB 1X5GA 3S35X 3RVWC 5FA3A 5HHNA 5IT2H 2EDEA 3TVMB 1YN6B 2F19H 1YJDH 2F53B 2GJZA 5C0BE 3SDDA 5DA4A 5E0QA 2FBOJ 1GGIL 2HRPH 3GSUA 2YD7A 4YHZH 2VN4A 3ILQD 4LVOB 4Y5XA 1KIPA 4ELKA 4PP1D 4YGVA 2YPLA 1S5HB 4IOIB 4OF7A 7FABH 2FX9H 4MA3B 1U8QB 3MV01 3VXMB 3NMEA 1CE6A 2LV4A 4ZO7A 3H3BC 1FYTE 3ARFA 4QRRD 4TVPH 4J8RA 3SE8H 3WJLC 3MRJA 3FO0L 5D5MB 2VLME 1F6LL 3WKML 1N59A 2DLIA 2X1XR 3GKWH 3N1FC 4BK5A 1HXMA 1QSEA 1L7TL 5SV4A 1S7UA 1I8KB 4L8DB 4IRZH 1DZBA 1X5YA 3MLWL 3VCLB 5F7HA 5HPMB 1AR2A 1BQHG 5J56B 3SDXA 5ESAA 1VHPA 1VEMA 2W0FA 4NQCE 3FFDA 1JWUA 3MX0A 3CH1B 1UZ6E 4QT5A 3WDHA 1AIFB 2O5XH 1YN7A 3X14B 3QUZB 3IJYA 4D94A 3L5XH 1ZXQA 3AM8C 4RNRB 3CFCL 2BMKA 4NDMB 2WQRA 5IB2A 5GS3A 1T1YA 2BZDA 2AV1A 3ZYIA 4KTEH 2OCFD 4NKOB 5EZOH 5E1AA 5IV2A 3LQZA 4WJ5A 5HYJE 4M9OA 2G5BB 5CZXC 2HFEA 3L3DB 3G6JA 3RWHB 1AFVH 2VRAA 4A6YL 4WGVB 4M93C 3ZE0F 4NKDA 3O3AB 4M61B 4UTBL 1IAOB 2F5AL 3HN3A 2YUVA 4HBCH 1M4KA 2AP2A 2ITCB 2R56L 3MNVA 4E0RB 2ZG3A 1DSFL 4PJCA 1RIHH 4OLEA 1FZOA 5CP7A 1AXSA 4BZ2L 1HSBB 4OCWL 4EEEA 5FA3B 1YMHB 1VDGA 3E8UH 2FB4H 3VXME 3U36B 4PBXA 4HWNA 4K9EL 3GK8H 2BHZA 1IARB 1NCDL 2BVTA 4ELKB 4YGVB 3F58H 5D7SH 3GO1H 4Z7OE 1CE6B 1QBLH 3BRFA 3B5GA 1TCRB 1AO7A 2HLFD 3AAZB 2A77H 5EU3B 4K9EC 1IGTA 4J8RB 5DEZA 1FLRH 3PDDA 4PS4L 4JKPH 1U3JA 4XT1C 1HXMB 1I7UB 1QSZA 2B39A 1QSEB 2Q3ZA 4U1JB 3RBSA 1MRCL 5SWQA 1PBYA 1S7UB 4FQXD 3WXVH 4WEBL 3QFJE 5TE7H 3SDXB 2GJ6A 4U6XB 4O51A 4JG0L 5F21B 2R8SH 4YDJA 1MJ8L 3RX7A 4CU7A 1JWUB 4FA8A 2M2DA 1P4LA 2LTQB 5CKGA 1RZGA 1F3DJ 4W4OA 1H3TA 5JW3H 3KJ6L 1YYMH 4Q6IA 5CLWA 1E6JH 4HZLB 2JJSC 1T6VN 2LAAA 4OIIL 2EH7L 1XGPA 4OD3H 4QF1B 1HNGA 3OAYH 3JVGC 4F2MB 4O2EA 3ULUH 3RX8A 2NXYB 1FRGL 2AV1B 4CADA 3LHPH 4TSCH 5KANI 5GZOD 3O0RL 5E1AB 5BRZD 4WJ5B 3OKLA 3UTZA 1NFKA 1HI6A 4NUGH 2HFEB 3G6JB 3PHQA 4KQ4L 3F7VA 5CEZD 5HYQB 3I75B 5JNYB 4NKDB 2AQ1A 3T3PE 2ENSA 1ZHBA 3C6LA 3BP4B 1DQLL 5E6YA 2QHLA 1LP9A 3MNVB 1BVLA 4XNXH 3C2AH 4PJCB 4ORZC 4DAGL 1ADQL 5CP7B 1RK0A 2YPLE 3LV3A 3VXPB 4XVJL 2MCPL 2Z31D 1TJGH 3F7YA 1EGJH 3RVXD 4I4WA 4HUKB 5SV3A 1WQVT 4TPRL 3F62A 3QXVA 3QSKB 5IQ9A 5C0AA 3BJ91 3U46B 5JA9A 3RKDC 3V4VH 3EOYG 5DHVH 1UACH 5C0IA 4I18A 4Z7WF 1B4JH 1HQRB 2CLVA 2M26A 2VUOA 3QULA 3KPLB 5HYFA 1QSEE 2W9EL 3VGDA 5ANMB 4HUWA 4OLYH 2F54A 5IK3A 3CNKA 3FOLA 2DD8H 3SDXE 2BOCB 2GK2A 3V6FA 1F6FB 1IGTB 3VWJD 3AB0B 5E56A 3S5LA 1J12A 4XPBH 2VLKD 5L0QB 5L2JB 1KXQE 3LIZH 2NMSA 3CSGA 1R3LB 1NEZG 1WEJH 4ETQB 2Y07H 3LVEA 5JR1L 4FFVD 2GJ6B 4ZQKA 4O51B 1DVFD 4YDJB 3PV7A 2N7AA 3BPCB 3R4DA 3ZE1F 4LNRA 3O3EA 1RZGB 2H6PA 3C09C 3RA7H 3PWUA 3V6OC 2YN5A 1DQMH 2R0ZH 4Q6IB 5CEZH 3OKKB 4C83A 2VC2L 2Z0BA 3VFPB 1DUZB 3G6JE 3VXNA 1EAPA 1RZJL 12E8L 5ESQA 3REWA 1IGIH 4OI8A 3Q6FB 3EO0B 1UVQB 2OP4L 3KLHC 1MRDL 5HHOB 1P2CB 4DN3L 1BVZA 4KAQH 4LRIA 4L3CA 3FQXA 2R1WB 1H5BA 32C2B 1A1MA 1S5IH 3OKLB 4PJDA 1HI6B 1NL0H 2EE6A 3IRPX 4PJCE 4Y4HB 3PHQB 4MAYC 3QUXC 5DUBA 4J3VA 1YEIH 4HK3N 1T66C 4KJWD 1L6XA 1ZHBB 1CGSH 3C6LB 1RZJC 1ZLUH 1AC6A 5DJXB 5HY9B 3O81A 4D9QD 2JKXA 1IT9L 2ED8A 1JWMA 3DXAA 2C4FT 5TDNA 1RK0B 3LV3B 2XG4A 2AS5M 1RI8A 4XTRC 4KI5D 1MAML 4DKDC 4X83A 1QLFA 3NABL 3ABZA 2MQCA 4WTZG 1MJ7L 2G9HA 2R1XB 1AO7E 3RTQC 1QFWM 3MJ6A 4RA3A 5C0ND 5C0IB 4I18B 1N64L 1Z5LA 2XWBA 3WNPA 3QULB 4M7LH 1IM3A 1KIUA 4B7LA 3Q5YA 4MNHA 1GGYA 2F54B 2NY3D 3FB8B 4K7PY 3KJ4B 4L8SB 3BPOB 3ARPA 4GRWB 2RGSA 2GJ6E 4UIMA 3V6FB 4P99A 1II4E 1E4KA 1V7MH 3S5LB 3VFUB 1FL6B 2RR3A 2AKRA 2F5BL 3MCKA 1VFUA 3D0VB 3QXDA 1OT2A 2JELH 1HE7A 2NY4B 3FJTA 4PRID 3DX7B 4H0GA 4ZQKB 3QIWA 1T2QL 1D9KB 1IAIH 1PZ5B 2CLRA 4JM4L 3GM0A 2H6PB 4NSKB 2MTPA 5IB4B 3EOAB 2XACC 1OTSC 4P59H 1SBSL 4WHTA 1NJ9A 2EZ0D 3ES6A 4TUOA 3CPLB 2UWEF 4J3WA 3HA0A 4QRSA 1TVDA 3WFCL 5JQ6H 5CGYC 4M7KH 4HUUA 1A6UH 2KDGA 4PJAB 5E2WH 5CP3H 5EUOA 2CKNA 2JB5L 3DVGA 3VFGL 1TZHB 3KPSA 3UTTD 1CICC 1T7ZA 1OL0A 5GRJH 1LP9E 1A1MB 4PJDB 5BVJA 1TMCB 2P5WA 2YA0A 1CLCA 5MEOA 2ZUUA 3IDMB 1G9NL 5DUBB 3RIAK 5F9OH 3EFDH 1RZ7L 2SEBA 5HGBA 1CXLA 3HLAA 3MUGB 4E5XA 2D0HA 3EOBA 2NLJA 5GGSY 2OK0L 4UI2A 2DQEH 5E7BA 4C59B 1BFOA 3FAWA 5K33A 5C0AE 5DMJB 5DUMH 4XNMA 3SGJA 1FNHA 3DXAB 1AR1D 2DI7A 1N6QL 4NZUL 3KPMA 5INCA 3WIFA 4KUZL 1FFRA 3V52L 4CDGC 1BFVH 5FHAL 1QLFB 3QQ3A 4NP4L 2F54E 2G9HB 2I07B 1P4BH 5FO8B 3W9DA 1FGVL 1DANU 1AP2B 1JTOA 1NUFA 4EI5B 5F9JA 3QDJA 1JWSA 5KSAC 1Z5LB 1XEDA 5F3BB 4TUKH 1IM3B 4KRPB 3WLBA 2ZUSA 3DRTB 4HFWA 1NDGA 2DICA 1MI5A 1DFBL 1T20B 4RAUA 4MA8L 2MPAL 5BW7C 5IEHA 2VYRE 2FGWL 4U0RB 3X12A 1ZVSA 2KZWA 1BFTA 1NEUA 4GW4B 4LSPH 1DL7L 1JPSL 2N4IA 3IDYB 1IFHL 4JHWH 2EDXA 4OFDA 1I7ZA 1DBKL 4HXAL 3NCMA 2DS4A 4OLWH 1XR9A 4OGYH 5GGSB 4HW6A 2VLLA 1DE4A 3VDBA 3I6KA 3MXWL 3QNYA 1IGCL 3PP3H 5IFAL 1HHKA 4WHTB 3U7WL 1IQWL 1NJ9B 3MV11 4WV1C 4ALAH 3TF7C 3I3EA 1IGJB 5EN2A 1NQBA 4PJDE 4Y8AA 3FOMB 4GG6F 4N5ED 1G7HA 3QI9B 2XTJE 4QTIL 5KSBF 4HUUB 5KW9L 5EUOB 4IRSC 4X7SH 4D9RD 4IDLA 3CZFA 3OR7B 3KPSB 4S1SH 4RBPH 4KTDH 3MSPA 4APQA 2W0PA 3U0PA 1TDQA 1NCTA 4P3CL 3OKDB 4EUPA 2JE8A 3DXAE 5B39A 1F8TL 1MEXL 3K3QA 2AJXL 5IB1A 4Z77A 2PXYD 5JXEC 4Z95L 3IDUA 3P4MA 1VEOA 4M4PA 2SEBB 1Q9WA 2NX5A 4BZ1H 1JJUA 2NLJB 4XZUB 4M7LT 2B1AH 1RMFL 1BFOB 2UZXB 5FUOH 4H5SA 1OM3H 1NAMA 1C5CH 3WIFB 4LBEB 3ULSB 4O5LH 4DKFH 4F7EB 3P4LA 3UJJL 3QQ3B 1JHLL 3ROOA 1JHTA 4OGAC 5FOBA 5FHBH 4M6OL 3N1GC 3VD9A 4CN1A 1AGEA 2HVJB 2ADJA 2H1PH 2K3TA 5F9JB 2OR9H 3CFDB 3ZT7A 5DZOA 4PGJA 3RDTA 1MWAA 1Q72H 5FYKD 3O3DB 4RDQF 2DQJL 1W2KT 4JGJA 5GHWL 3T77A 1CLZL 1CR9L 1NDGB 1S7RA 4HPOH 1U8LB 5GISH 4BSVB 3A6CH 1R3IH 4GAGH 4RAUB 3S36X 2Z4QA 4RMRA 3PWPD 3FQWA 3O2WH 5E2TL 4E42A 4YHLH 3L5WA 5IEHB 3KLDA 2OX5A 3X12B 1HHHB 5FF6A 1ZVSB 4RIRA 43CAA 3S3JA 4HQQL 4BQCA 4HV8A 3SGDH 4NKMA 1WIPA 3EDEA 4LSQH 5HGAA 3AXLA 1I7ZB 4X8JA 5MENA 1MF2H 3CVHA 4FZ8H 5DD0H 1XR9B 3GI8L 1A5FL 3DTXA 5EUOE 3QNYB 4LKXB 5EU6A 1IE5A 1WBYA 1OAXL 1HHKB 4KK5D 3KPSE 4MB3A 4U1IA 1I8IA 5DD3H 4KWUA 2R4SL 3H9ZA 1F02I 4PLJC 1M1SA 2P5WE 4FNLH 2XNAA 1G7HB 3INUL 5T33H 3JWOL 5TF1L 5SX4H 5ADOH 1A4KA 3T04D 3BKCL 3GMQA 1QBML 1S7WA 3CZFB 3ISWA 1JUFB 3QPQD 2DLHA 1TITA 2XT1B 4MXWH 1XF5B 1QNZL 5DT1L 2PYFA 5F7LB 4QXGH 5B39B 5LGJB 1RK1B 5IB1B 4NQDD 4EIZC 4MD0B 5DD6A 1CTNA 4OT1H 2GY7B 4FQIL 1IC7H 4MAUL 3JWOC 1D5XA 5I1LB 1S3KH 1UCBH 1D3CA 4QY8B 5FUCC 5FYKH 3LD8B 4IOFD 4GOSA 3A6OA 4H5SB 1BIHA 4JO1H 5HBBA 1YNLL 4NQED 5JPNA 3QDJE 3B8SA 3TJHC 1NAMB 2R2EA 5DVLA 4UINH 2UY7A 2YPVH 1FGNH 3S37L 2BNRB 5FCUL 5MERA 3UC0L 1Q1JH 1RIUH 4LSUH 2ITDB 1LK2A 3WDIA 5FOBB 5AYUH 4PJFF 1MI5E 1RFDH 5CJOH 2ADJB 2CMRH 1HQ4A 1F58H 4JY4A 4QNPF 5I75B 2R1YB 1GZQA 1X5KA 4TNWK 2DTML 5F1OB 4P23A 4X9IA 4F8TA 3T77B 2AI0H 3MRLB 2OQJA 2GIYA 4M02A 1NLDH 2Z4QB 3KYNB 1MFNA 3BP7B 4PTUB 3L5WB 2CXKA 1MCPH 1T0MB 1ZLVK 4JPIA 5FYJU 1F4YH 3CFKA 1H15A 3P0YH 4ONFL 1KGCE 5JZ7D 3UTPE 1AQKH 4ZS7H 4NKMB 3GBMH 3AXLB 4UQ3A 4ERSL 4X8JB 5MENB 5DC0A 3ARBA 1IGML 3PXHA 2FWOB 2F58L 4UILL 3TBTB 3PQYD 1WBYB 3ZYOA 2FO4B 5CBAA 2C3HA 4X7EC 4U1IB 3LY6A 4KROC 1EVTC 2A9NH 3IDIA 4MNQE 1DEEA 3JTTA 1MHPL 2NZ9D 3DHMA 5FM5O 5GGTH 2ESVD 4X4MA 1JV5B 4RFOL 2XNAB 1V7NH 3D9AL 5B8CA 3BQUB 4XX1E 5ITBL 1FC2D 4QOKA 1A4KB 4OB5H 1JYVA 2NX5E 5D1XD 4Q97A 1S7WB 3WFHA 4HJ0C 5DEGB 3RWCA 4P2OA 1KN4H 5T3XD 4HIEA 2PYFB 2UVEA 4EDWL 4GKNA 4NHUB 2IH3B 3U48A 3F12A 4JCMA 2WBKA 1XZ0B 4PD4J 3MCLL 3B9KD 4P48A 2GCYA 2A83B 1JGLL 4GG6E 2Z92A 1MJJA 1MFBH 1EFXD 5KSBE 3MRRB 3IDNA 5IEKA 5KJRL 3EYQC 1TZGH 5F9AC 2DQUH 4PREA 4FQ1L 5F44A 4AH2B 1WZKA 1C1EL 3GJFH 2E8YA 2YD6A 2F74B 4IMKA 1SJEA 2DJUA 1RZ8A 4JRXA 3MA9H 4CRPA 3MRPB 3C8DA 3SGEH 4YX2L 4F58L 5IP4A 4HCRH 2Z8SA 4AQOA 3ARTA 1HQ4B 4UB0H 4JY4B 5C08D 1FORH 5ECJE 2WM0A 3TZVC 3NAAH 2CD0A 1EGJA 4QRRB 4BUGA 4FQJL 4B7IA 5MENE 5H8DA 2APVA 1NAKL 5K9JH 1J0ZA 2JJTA 4TVPE 4QRQB 1MWAL 2MQ0A 4FQXA 4JPIB 5EU6E 2O5ZL 1H15B 4PD4K 1QLRB 4OTXL 1XF3A 1TPXB 5CSGA 1UEYA 1RUQH 1P7KB 3TBWA 2YEZB 5F7WC 1YEGH 4U6VL 4L9LA 4OFYD 1NPUA 3G6DL 5T3XH 1M7XA 3OHXA 4GAYA 1DBML 1RUML 2VDQL 1NSNL 1SEQL 3UTQB 4JPKL 4HIIA 4ZTPL 1C5DB 3IDIB 1DEEB 5DZLA 4XVTL 3DHJA 1W72A 5ID1B 5JO5B 3U79A 5DC9B 4LF3A 3CVHL 3KWWA 3I6LE 3RNKA 5B8CB 5DK0B 5IVXF 5DGRA 2K9UA 2HN7A 1KC5H 5DTFB 5BRZA 5FEBA 1FLTX 4X98A 3RI5F 3WFHB 1JYWA 2WIMA 3O41A 2A38A 3VGFA 3BXNA 1JBJA 5IG7B 4HIEB 2FL5A 4Y2DC 4GKNB 4OCRH 3MJ9L 3D85D 3RVVD 3RZCC 5JHLL 4LLDA 3TBVA 2VABB 3MLTA 3ZKND 3SKJL 1Z2KA 3OGCA 5E7FA 1IEAA 4PRBA 1T3FB 4XPTL 5DDHB 2Z31A 1JIBA 3LMJL 3SPVA 3M17B 3SOBL 4ESKA 3TNNB 3MRNA 5GRZA 3IDNB 5DUPL 1JYXA 5GS1A 4PREB 4XNZC 3F7PC 5TPWH 4X4YB 1WBXA 3AFLA 5IVOA 2AXFA 2AV7A 4NJ9L 2DYPA 4LLUB 1SJEB 3THMH 4XWOD 2FEDD 3NH7H 2PW1A 5TDOA 4P9MH 2L0DA 4HS8H 2QR0A 4LHQB 1IKNC 3VXUD 1X6LA 4IRJD 1SEBB 1KENH 4HDIB 1OHQA 1G7IA 3QO1A 1I75A 2IPKA 5SWSD 4YBQC 1X5HA 4WVRA 3VWJA 1EHLH 4MD4B 2OSLA 3IF1B 4UUJA 4R3SB 2PYEA 4MD5B 1FDLH 2J8UA 5CCKL 2VLKA 4KPHL 5LG1A 2X05A 1J1OH 1CDUA 3OZ9H 5DHVB 1DBBH 4IHOB 5C0CA 5I30L 4FQXB 2WWMC 5KG9B 3O4OC 4PUBL 2ICEA 4I48A 4HJJH 4R4BB 2HWZH 1XF3B 5GGVL 1HZHL 2A73B 4M6MH 3TBWB 1I4FA 2EDWA 4LK4A 4X4ME 1ZT1A 2DKMA 4YWGL 5E2UL 1UWEH 2ZUQB 1K5NB 4L9LB 3RRQA 4XBPA 5LWYL 3OHXB 2P7TA 1M6OA 4GAYB 4QOKE 4C56D 4FTVD 1A14L 5H35B 4M1DH 1L4IA 3T1FB 4Z8FH 1FFPB 4WO4D 4P4KA 4MDIA 5I17A 4YHML 2VN7A 4UOW0 1I3RA 3KWWB 4XNUL 3RNKB 3B2UC 4N8PA 5A2KH 3ZKMC 25C8L 4FS0A 4K94H 2FBJL 3GMLA 3P73B 5BRZB 1AXIB 1FN4A 4LQFH 2VXSH 3ULUE 4YAQB 3ARZA 5J6GA 3W11C 2QTEA 3O41B 4YC2C 1KCVL 1N6UA 3L7EA 2LVCA 5KVEH 1EO5A 4ZOBA 3CC5A 2Y25A 3T2QA 4YPGB 1TQBC 4FMKA 2DM7A 5IF0B 5IHUH 3MXVL 4KKAC 3MLUL 1MCFA 1MCIA 3MLXL 1LGVA 3MV8A 1CFVL 5CP3A 4JRXE 3OGCB 1FBIL 4ODTH 4WW2A 4NJAH 1MIEL 4WI6A 4PRBB 2Z31B 4P9HL 2VXVL 4PJ8A 3SPVB 5A16A 3ZLQC 1UENA 2BSTA 1OOAA 3NGBB 5GS1B 4JDZB 3HFML 5ICXB 1OSPH 2AV7B 3RWGB 4OKDA 3GIVA 2V2TB 4PLKC 5F72S 5TDOB 2PW1B 1MUJA 4O02L 3NA4A 5FECA 2RIKA 5E4IA 4M7JH 1JGDB 3UCRA 4P9HC 1CIDA 1G7IB 1AH1A 4JY6B 1OPGH 3QDGD 2E6PA 1WCQA 4QHKJ 3VWJB 4GXVL 4PJ9A 2OSLB 3S34L 2VLKB 2VDRL 5HHPA 2NTFB 2VLRD 4Q58C 3TIDA 5C0CB 1U8IA 1LWRA 1ZT4B 1I1RA 1KPUB 4ISVA 5IWLC 4ZUSB 3KLAA 2ICEB 4I48B 3VE0B 1KJMB 1DVFB 4XPFH 4F37F 3RJQB 5LAXB 1UJ3B 4R0LB 4XVSL 5JXAH 1J7VR 1OTTC 4MCYA 5GS0L 1YYLL 4XBPB 1WIUA 3X3FL 3D39D 4U31A 4EN3D 1T0PB 2Z93A 2APXA 3EJZD 5BRZE 5TH2B 2GTWA 2X70A 3AMKA 4L3AA 3U30C 5I17B 4MDIB 5E24E 1I3RB 1XF2B 1CT8B 5F7FA 2HMID 5TE4L 5IGXH 5I1IH 2DDQL 3IFPA 5GS0C 2XA3A 1ZTXH 3GZKA 1BQLH 1QEWA 4KXZI 4ZS6C 3SDAD 3L7EB 3VXSD 3K4DA 4AYFA 1KT2A 3B4NA 4S0SD 3MO1A 4TOYH 5EIQA 3V6ZB 5GRYA 3QNXA 1BOGA 4XGZB 3KPRA 5J4MA 1F97A 4LFHD 2PW2A 3I50L 1MHCB 3BEVA 4PJ8B 3LKRA 1MFAH 5A16B 2CLZB 2K7QA 3HPLA 1YQVL 3E2HB 1BGXL 5I8CB 3K4AA 3BKYH 5E00A 1KOAA 3RGVA 4LMQE 4K23H 4NM4L 2BNQD 1G9MH 4ZFZA 35C8L 3WBDA 2PYEE 4PBVC 2J8UE 3DARA 1MUJB 2ICWJ 1Q9KA 2VLKE 2X4QA 5GRVL 5FECB 3GB7B 4O4YL 1MREH 4Z7NE 2NY3B 3QH3A 1WZ1H 5JLZA 5C0CE 4N90E 5I1KH 4QHKI 2VITA 1U8NA 3QCUL 5HYSG 4HF5L 4F57L 1YNTA 4RDQG 4BH8A 2BCKA 1FFQA 1MFEH 4K71B 3QISA 3BRGC 4LPTA 2EIZB 5J6HA 4DGVH 4PRIB 1MCWW 4ISVB 3V5DA 3PP4H 3KLAB 4HGMA 2EEAA 5EU7C 2I9LA 5D2NE 4RMVA 4IDJL 1ES0B 4QHNB 4CKVX 5DMYA 3QDMA 1QFUL 2B0SH 1T89C 1CGUA 1DQJA 2W92A 1MJUH 4OJFH 3TIEA 1XIWD 3FKUS 2FHBA 1RHFA 4G8IA 4PRHD 3RBGA 2Z93B 4ZXBD 3ZT6A 2YD4A 1CBVL 2GTWB 3ZDYF 4L1DA 2AJUH 4DOHB 5MI0B 5HD8C 4ZAKA 4XCEA 3R1GH 2VXQL 3C60D 1OLLA 4LLAA 4OZGA 1MFDL 4OIBA 3UTTB 1F90L 2CDGA 3MV8E 3VU2A 2LU4A 3U1SH 4ZODA 4YHYB 3H9SD 3T65A 2DF3A 3NBNA 2WP3O 1KJVB 1DEDA 3LS5H 5D7JD 5E5RB 4WW1B 2V9RA 2RFXB 4GRMA 3C5ZD 1INDL 3TYGH 4J6RL 2Y06L 2CSPA 1J1PL 4LDLB 1BOGB 5KSUB 3KPRB 2O61B 4NGHH 3STLB 4G5ZH 3TA3D 3PL6D 3AREC 3EOTL 4NCDA 3LKQB 3HMXH 4OFPA 1A9EB 3LKRB 3MRQB 4I0CC 2ZG2A 4H0HB 3O6LL 4YDKL 1VB9A 5D2NC 5IFJA 4JFXB 5EU5A 3TV3L 1MCHA 2ED9A 5BV7C 1TJIL 1LEGA 4PY7A 2X09A 3O6ML 5CSZA 5IBLC 2VTFA 5D96C 4WNQA 1BECA 3QHZL 2ICWI 3OF6A 5DRNA 3ULVD 3D25A 2P8LA 3IJSA 3DETD 1BEYL 2JIXD 4Z7UB 4Z7QF 1H9VA 3P40A 5JLZB 4OF0A 3FMGH 4G6KL 1OAZL 1TXKA 4PB9H 1WAAF 4G8GA 1Q8MA 1U8NB 1NCNA 1CGYA 2X4NA 3LKOA 4XP4H 4NNPH 1OP3K 1RJLA 1R3HA 5EBGA 4NQSB 3IS1X 3S4SA 4NZTL 3VWKD 2HTLD 5L6YL 3TVMC 4QRPA 3DV4A 5J6HB 3GM8A 3BX7C 4CUCA 4EXPX 1LILA 2XXCB 3V5DB 1QA9A 3OJVC 4KKCC 5IVZA 1AGFA 4Z78B 1MCOH 1R24A 4EOWH 1DQTA 2VL5A 3FL7A 5E95B 5A1AA 4KMTH 4FFYL 1DQJB 3NIGF 1F13A 2PTVA 4LL9A 5IMOB 1LNUB 1BIIA 4G8IB 5I19L 3PGFH 3WJJC 5D2LF 1ORQB 3ARGD 4PJIF 5IJKC 4XCEB 4ODUB 3PUCA 2WUBH 3BE1H 3UTSA 5CJ5A 3DSFH 1AGDB 1CFQB 4WCYL 4OZGB 5GRXG 4K3EL 1XCQB 3AU1B 1P7QA 1RY7B 3CSPA 2CDGB 4GRWF 2QSCL 5EC2B 3O9WA 3KPRE 3P9LB 1T21A 3T65B 4ELMF 3I85A 1RJYA 2DQHH 1A3RL 5GGTA 5KZCD 4JE4B 5LQBL 1UB5A 2RBLA 3N9GH 3ULVH 1M05A 1H3UA 3MV7A 4POZD 3HCVA 1KLGA 4XNYL 5I15H 1H0DB 1WBZA 3HZKB 3QUZC 4ODXB 4Y4FC 1XR8B 2J88H 3BT2H 4OD2A 5AZ2H 4WDIA 4ZUVA 2KZ1B 2CR6A 1T1ZA 4WU5B 1HYRC 3L3IB 4S2SA 5IFJB 5D2LA 1AGBA 4P2QD 5EU5B 3VMPA 4PY7B 4YHOH 2P49B 3WUWB 2I5YL 3U4EB 5CSZB 5E99H 2D4DA 4YUEH 4PJAF 4P46C 1S8DB 5DRNB 3D25B 1KCLA 4U2ZA 2P8LB 4IIQC 4M9PA 1IC4H 2EH8L 5E08H 4LU5H 1UYWH 4G8FA 3EO1A 5SX5H 1W8OA 3IFLH 4PBWD 1VERA 3PWPB 3LKOB 3BZEA 4OLXH 3IDGA 3MMEB 3QDME 1SJHA 1TTGA 1R3HB 3S4SB 3IU4L 3MNWA 4D0CA 3DV4B 5B21A 4MLIA 1IILE 5JHDA 4UDTA 4WFHD 4PG2A 3S96B 2DQTH 3JWDL 1JFQH 1A22B 5FUZH 3T0WA 1R24B 3K74B 5M95B 5L88L 2VL5B 3DLQR 3O8XD 5I73C 2C1PA 3SQOH 3OXRB 2B7DT 4JHBA 4OZGE 3V5HB 3WXWL 4DUXA 3MZTA 4HFUL 1BIIB 2AQ3A 3EYFA 3P30H 4JO4H 3PV6A 2ESVA 2VR9A 1D5BA 2A6KA 1HYSC 3JWDC 3IRZA 2NY1B 1GC1C 4Q7DA 4PGDA 4Y19D 5FIEA 3UYRH 1HEZA 2H32H 3SKOB 4DUWA 1L6ZA 3HRZA 4M43H 1J5OL 1JRHH 3EDJA 1WWWX 3WO3B 1QKZL 4NQDB 2E7LC 2V9TA 4JN2A 4M48H 2X7LA 1C16A 2LTQC 2HKHH 5E70A 3HC0A 2ARWA 3EDDA 1M05B 2GKIA 3ZDYE 4NRXA 4PJHA 5HHVH 4MB5A 1CGVA 2PTTA 3S36L 1Q94B 1FPTL 1WBZB 4NQEB 5LKNA 2AJVL 4WDIB 3CCHB 1T1ZB 4MMZC 3V5KA 4AG4L 1FIGH 2H3NA 3KPQA 5LGHH 2NXYC 1K8DA 4OCXL 5E8DH 1QUNA 2P4AB 3QJHA 3LRSA 4OLZH 4Y5YB 5F7MC 1W0WA 4G8GE 1UG9A 4GG8B 2J8OA 2UY6A 4KVNL 3QCVH 3TBYA 4KHTL 3GDBA 5F7UA 4Q9BA 4QRPE 5CZVL 5HVHB 1FAIH 3ILPA 4G8FB 3EO1B 4V2CB 3AVEA 3CFEB 3GJFB 3FCTA 3U2SA 1UWGH 3HNVH 3MNWB 4WI2A 1KCRH 5IBTH 2XZZA 3RIFF 2W38A 1CD1A 3MODH 1XF1A 4YEEA 5DRWA 3RL2A 3TCLA 1HCVA 4L4TD 4ODSH 3JXAA 4DVRH 4OFYA 1F11B 3VJ6A 3SCMD 4G6JL 4RQQA 3UTSE 5MHSD 3DVNA 1N2RB 3PQYB 3T4YA 1CFBA 3D1MC 1KLUA 3RWEB 2GJJA 4OLUL 2ESVB 1T22A 4JY5L 4XRCA 1D5BB 2D0GA 2ZCKL 4QYOA 1X9QA 4YFDB 3AB0C 3KPOA 3QHTC 2A6KB 2BSRB 1F4AA 5D1XB 4HC1L 4RWHA 4F3FA 4G6MH 2ADFH 4HLZH 4Q2ZA 5TE6L 3MV7E 1U2HA 1VGEH 4JFED 1WIOA 1IAMA 1NCAH 1IMHC 3IDXH 3NIGE 4JN2B 4GMTH 2X7LB 4X8XA 1C16B 1HK6A 5FYLD 3UO1L 4UTAH 3B9KB 2IPUG 1HIML 2NY2D 5D2LE 2DBLL 4NRXB 1EFXB 3FRPG 2ZCHH 4LCWD 1KCKA 4JPVH 1WF5A 2NY7L 2AEQL 1OP5H 5KS9A 1CI5A 3V5KB 5EZJA 1K8DB 1AKJD 3L95A 4MWFA 4K7FA 3QJHB 2CRIA 3LRSB 2PETA 5ADPL 5IOPA 1W0WB 3DX6A 1YECL 4PB0H 1T03L 3GMRA 5D1QA 5EBWB 4Y4HC 5C08B 1AXTL 1BMGA 2APWA 4DGYH 4AK1A 1G0XA 5DXWA 2BRRH 4NN6B 3TNMA 5JHDE 4GBXA 3H42H 1I3UA 4Y16D 3ILPB 3EJYC 5DI8B 2C7UB 4UV7H 1OGAA 1KBGL 5KAQF 1OB1A 1LDPL 1CFTA 5CHNB 3R06A 4KJPC 4I3GA 5DQJA 4MQSB 8CGTA 1JI1A 3CK0L 4LAQH 1FVCB 2WBJC 1FNGB 4PV8A 1CD1B 1FYHB 3X13B 5DRWB 1B0GA 1JPTL 1YPZA 3TCLB 2ESVE 1N26A 1JNJA 3ZYZA 4K8RC 1H8SA 3VGAB 5LBSL 3VJ6B 1G7PB 3KDMB 4RQQB 1WCBA 4V1DA 4FFZH 3DVNB 3BEWA 5HI5C 2VXTH 1F4XH 1FL3A 4JQXA 1BREA 1KLUB 1PDKA 2V5RA 5FYLH 4IMLA 4L8SC 1T22B 3BPOC 3HI5H 4RX4D 5GS2D 3QUYA 4MQTB 2BJMH 4DQOL 1RZFH 3ARDA 3P11H 1GGCL 3O4LA 5EBMB 4YHPA 4F3FB 1NC4D 2UUDH 1I1FB 4Q2ZB 3SE3C 5F96L 4PJHE 5H2BA 3PHOA 1HHGB 4O9HL 5E2VL 2AEPL 5H94A 1WWCA 1NMBH 3ZHDA 1D9KC 1MAJA 4HWBA 5D1ZA 2EDRA 3D85B 2YPKA 5DK3A 2KL6A 3ZTJH 3MLPA 3DIFA 4R96A 4TYUA 1O7SA 1IAIM 4OF6A 5EA0L 5HDQL 1L7IH 3M45A 1YNKL 4D0DA 3V4PL 4K7PL 1WWBX 3CXHK 3BSZH 4XBGB 2IPTH 3O2DH 3TO2A 1LO2H 3RAJH 3WHE1 1KG0A 3LOWA 4OCSL 1YMMA 5JW4R 3T3MF 5DFVD 2MHAA 2W9DH 4S1DD 4RAVB 1T5XB 4MS8C 3MOAL 5IHZA 5IOPB 3CDFA 5IESH 3VXUB 4N0CD 4IRJB 4FZEL 4PRNA 2Q8AH 5CIPH 4P2RA 2EDBA 4BKLB 4U6HA 2FIRT 3QUMH 1KIQB 5C09A 3QDGA 2WAHA 5SWSB 2DQCH 4WY7L 2HT2D 4QTHA 4MVBC 1ZLSL 3QQ9C 4GBXB 4XBEH 3UZVB 2FSEB 5LGKA 4ONHA 3G5XA 1OB1B 4XMPH 4JQVA 4CW1A 1S7SA 1RJZA 1CFTB 3EYOA 3QO0B 4H20L 1MHEA 3R06B 3OB0K 4U3CA 5H37G 2VZVA 1HH9A 1AI1H 1OW0A 1HKLH 4GKZA 2C3WA 2ORBH 3GMMB 5C1MB 2FATL 1BJ8A 1B0GB 4G9FE 1RIVL 2VAAA 3VFMB 1QQDA 1ZMYA 4EI5C 1WCBB 4JFZL 2D0FA 4LCCC 4V1DB 4C56B 1ETZA 5L9DL 4FTVB 2ZG1A 1FL3B 3JUYA 5GRWA 3KYKH 1IBGL 5CD5D 4KRPC 2DQIH 3CGTA 5FV1L 1XGYH 4M8QB 4F8QA 2VISA 4WO4B 4KDTA 4LARL 1U92A 3FAXA 4LPWA 1PKQB 4HT1L 5D4QA 3ARDB 4M1CC 4Z76B 1CFSB 4U0RC 1DLHB 2FECI 3RVUC 1EVUA 3TO4A 1FG2B 3BD5A 1F3RB 1M7DA 5I1EL 4FQCL 3SDAA 5H2BB 1VCAA 2YMXL 1QTYT 2VWEE 5ALCH 5E94A 5D72H 3DSNA 2XN9D 2V9QA 5KTEL 3S88H 4I0PD 4N8VG 3ZKQD 5KS9E 2YPKB 5EC1A 5I76A 3RVTD 5JPMA 3DIFB 4LRNL 4R96B 1P5UA 3FQRA 1CDIA 5CLTA 4BSWA 5INDA 1KELH 3W39A 4D0DB 4LQ1A 4HGKC 2P8MB 3G5ZA 4YQXH 3QI9C 1MLBA 1EPFA 2HH0H 3U0WL 4ZG1A 2C9AA 1U8KA 4KKLD 3IGAA 2BOBA 5CZKA 2XRAL 2X4OB 2E7MA 3K8LA 1OGAE 4XCFL 2DJ4A 2A74A 3CIQA 4U6HB 4EDXA 4JG1H 1NFIB 1VGKA 4X6CA 3QDGB 5K59E 3HMXA 1SJVA 4QTHB 3VW3L 1LO4H 4XHJC 5T1DH 5E9DA 1YPZE 4HUVA 1AD0A 4TRPH 2NW3A 2BVQA 4Z7VF 2ZSWA 3CX2A 1RJZB 2VLRB 3EYOB 1MHEB 4XXDA 5CJQH 1NMCB 5IFHH 5K9QI 4V1DE 1Q0XL 3WIHH 5CWSA 4R26L 4GKZB 5F6HJ 2A0LD 3MJ8A 4LHUD 3NIFE 3FO9A 4NWTH 3C9NA 1FJ1B 5D70H 4L5FL 3MOBL 1QQDB 2NR6D 5KVFH 1XIWA 3D39B 4EN3B 2YD8A 4GW1B 3O4LE 2CK2A 1G6RH 1Q0YL 1A0QL 4RFNB 3OKNA 4G7VL 4R97B 3RI5K 1CLYL 1U92B 3C60A 3B9VA 5C9KA 4CBPA 3JTSA 2FLBT 5C07D 1WFNA 4F9LC 1JF5A 4NFCA 3IXAA 3RWFB 2XZCL 3RWDB 4RFEA 3S98A 3Q6GL 4XPGH 1F3JA 5TQ2L 1BX2A 1M7DB 1MNUH 3QIBD 3H9SA 3SDAB 4NNXA 4HIHB 3VXSB 1A47A 2EDNA 5D7JA 2WQ8A 2DQGH 5DD1L 1CGTA 1MIML 1XMWA 1RAMA 1U0QA 2WIIA 4GKSA 3LQAH 3RVWD 3C5ZA 2PO6C 3FONB 3NCJH 1YMME 4ZPVA 3FTGA 1AC0A 5JPMB 1WGOA 2R0KH 1QFWH 2X41A 3BP5B 1RZKL 5B38A 2EC9U 3FQRB 3FQUA 1OCWL 2HFFB 4BSWB 4OGXL 4NCC1 1E4XL 5CILH 4JRYD 5B4MD 3OQ3B 4OD1H 4P2RE 2M8XA 3NA9H 3VXQB 1MLBB 5C09E 3QDGE 3HC4L 3BZDA 5L7XL 2BOBB 2BNQB 5DSCA 3SY0A 2MOVA 3UBXI 2APBA 3FZUC 1XT5A 4Y4KC 1RZKC 1DQDH 2A74B 4RISH 5MP6L 4K2UH 4EDXB 3B5TA 2Y4SA 1B0WA 1I1AA 1VGKB 3PGCA 4ZUUA 1OSZA 1FVEA 2X4SB 2VDPH 4F15C 4NNYA 1G6VK 3NFSL 3VXOB 1B6UA 1I9EA 3UXFA 5E9DB 4OM1H 3QDAA 3JUZA 3LD8C 1AD0B 3CFIC 2NW3B 4U1SA 3VWKA 2ZSWB 3U6RA 1KPVA 3BAEL 1JPGA 4XXDB 4RGOL 1WTGT 3RP1A 1FV1A 4PRAA 1HHIA 3H6JA 5LCVH 5F6HI 5CWSB 3RY6A 3MGTA 1QOKA 5CJXA 3FO9B 1GHFL 1Q9OA 2Y36H 5C0BD 4U6YA 1XIWB 5F1SA 2CK0H 4PRHB 4ZXBB 5I75C 3FO2B 3KPTA 4I77H 2DIJA 1QZ1A 3U82B 4G7YH 3BWAA 1VACA 4DZ8A 1GAFH 3ZDZF 3C60B 3WFEL 3L9RB 2J7LA 3MACH 2NW2B 4XNQA 3IXAB 3I3DA 1P4IL 1XGRB 3SDCD 3E1F1 3H9SB 4XPHH 3VA6A 2Y5TA 4NNXB 1GRWA 5E6ID 1JP5A 2EEDA 5D7JB 1TENA 4ZOCA 4NO0D 3DYMA 2WIIB 4Y1AA 4GKSB 1V3LA 3GUTA 3C5ZB 3GMNA 2QQNL 3HB3D 4NQCD 4ZPVB 3FTGB 1GGIH 1PSKL 3ARSA 1ZT7A 4JN1L 4KMLB 5I1CL 3FFCA 3TA3B 3PL6B 1E0OB 5KN5A 4JFYA 1RZIB 4DEPB 4XP9L 3GKZA 3WCYA 3GSXB 1MCKA 1SMAA 3R8BB 1N0LA 4M8VA 3ECBB 3BQUC 4X6CE 2AQ2A 3MJ7A 1JE6A 3QJFA 5DSCB 1JNLL 3SY0B 3WHXA 5E9DE 3BW9A 4TSBL 2H41A 3OJMB 3FO0H 5FO7A 3WKMH 2AK1L 4WENB 3FT3A 2JIXB 2FX8H 4LLWA 1I1AB 1L7TH 1FQ9C 5HYJD 3PGCB 4ZUUB 1J0KA 1OSZB 3GMOB 5T1LD 2ZUVA 1FP5A 2A1WL 3MLWH 3RNQA 1P1ZA 1G1YA 1HDMA 4D8PA 4GRLA 1K85A 1TTFA 4U1SB 3VWKB 5EOCL 4PJBB 2XICA 2FB4L 4PRAB 1HHIB 4WWID 4TVSa 4JREC 3H9YA 4JJ5A 3ILQC 4PP1C 5I16A 4XAKE 1FL5A 3CFCH 4U6YB 3F58L 1V3JA 5D6DC 4N68A 4MJ6A 1QACA 1MCQA 4KUCD 1T7VA 3ARGB 1JNNH 3RPIB 5FFLA 3F6LA 3H9SE 2ATPB 4OIAA 2X4RA 5DJDB 4LVNB 3GSQA 1A4JA 3BWAB 3LSOA 3IVKA 4DZ8B 5I74C 3V0WL 4A6YH 5TDPA 2HVKB 4H1LB 3PNWA 4AEHL 1KXTB 4UTBH 1BF2A 1CE1L 3TEUA 2F5AH 1WZLA 1YEFL 1MCWM 1Q38A 4AQ1B 4BELD 1DSFH 1RVFL 1JGVL 5FGRA 1NGYB 1S9WB 2ADGA 4BZ2H 4R7NA 3JV4A 3SE9L 1M71A 3OXSA 1FZKB 1IGFH 3GUTB 2O5YL 1IJ9A 3GMNB 3QFJD 4MX7A 5C6TL 4K9EH 3C6SA 4JM2D 3OR6A 3EO9L 4GQ9L 2IANA 2VE6A 4RGNE 2H32B 5T3ZE 2R23A 1D5MA 3P4NA 2EXYD 2XXMB 5EPMA 1NCBL 2BFVL 3VI4F 1AQDA 2Q7NA 4F7TA 2E6QA 1U41A 3QJFB 3LPWA 4R4FL 3QAZB 3UMTA 4PS4H 2XKNA 1JVKA 2LU7A 4Y2OA 3TFKC 4X6EB 1MRCH 5EIVA 1UB6B 5EFIA 3I6GB 5HDOA 3AY4A 2X5PA 4WEBH 4D8PB 2UZYB 4JG0H 4XNXL 4KDVA 4YZFF 1MJ8H 3CDGA 3EGSA 3SDDD 3VFTA 1JL8A 3DWTA 1TJGL 1RUKH 3LS4H 3DO3A 3MGAA 3KJ6H 3U83A 4PGCB 4KRLB 4XMLL 5KAQG 3RY5A 2YPLD 2AEWA 2HTKC 1Z0NA 2GI7A 4JJ5B 2HP4A 4QCIA 4OIIH 3SCMA 3O8XB 3EYSL 1UACL 1ULVA 4U1NB 5HHQB 2ZOLA 2QQQA 4PLOB 5BMFL 4MJ6B 1FRGH 1I8MA 3ARFD 3CVIL 4OLYL 1N4XH 1Y6KR 3O0RH 5CEYB 1AD9A 3NFPA 1J0JA 2X4RB 3C08H 1CZ8L 3IVKB 1FNLA 4KQ4H 3QEUA 4FABL 4Y1AE 4IM8A 4Z7UF 4MAYD 4Y19B 1NCWL 4YXLH 4DTGL 1BVKB 3MA7A 1KTDB 1FSKB 4PJEF 4XCCL 5TFSH 1DQLH 2LU3A 1G0DA 1ZA6A 4X5WA 1DDHB 3WEXB 4U6TA 3FFCE 5C2UB 2F9BT 4DAGH 3HE6A 4XAWL 3K4ZA 4R7NB 2MCPH 4XVJH 4W6YB 1QSFD 4KK8D 4OAWB 2ZUQC 5C3LD 2Y6SD 3OXSB 5IBUB 5I1AB 5GQBA 3GHEL 5DC4B 1MCJA 4H26A 1Q9LA 1G7MA 1BZQK 5HVFB 1CXIA 4YXHL 5CBEB 2VDLL 4JEGB 2W9EH 3DV6A 1AQDB 5GZOC 4BFIA 4F7TB 4P5KA 2IEPA 3WDJA 2VDKL 3BKJL 2DLEA 5C9JA 4IOSD 3MFGB 5IR1A 1Z9OA 3VG9C 5F97E