3SDYH

Crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
224
structure length
221
Chain Sequence
EVQLQQSGAEVKTPGASVKVSCKASGYTFTSFGVSWIRQAPGQGLEWIGWISAYNGDTYYAQKFQARVTMTTDTSTTTAYMEMRSLRSDDTAVYYCAREPPLFYSSWSLDNWGQGTLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin HA1 chain
publication title A highly conserved neutralizing epitope on group 2 influenza A viruses.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
total genus 37
structure length 221
sequence length 224
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdyH01
1NC2A 1J1OL 1T2QH 4ZFFB 1KPRB 3ZDYE 3CFEA 5F1OB 4KKLC 3TCLA 4GAYB 5DEGA 3LQAH 1RZIB 3QQ4A 4FQPA 4LLWA 2BSSB 3HAEH 1SBSL 1WC7B 4Y4KC 5DD6B 9CGTA 4JDZA 1NMAH 5HHQA 5F71A 4LCWE 3MC0A 3K8MA 1JV5B 1QNZL 4X6CA 5DJ8B 1MCNA 2EYTA 3WFDL 1JWSA 2NX5D 3MACL 2EDJA 3DVGA 3I2CH 2KPNA 3A6BH 1MRCH 2LU3A 4YIQB 1T1XA 5IIEB 1ZOXA 43CAB 3BEWA 1ZS8A 1KJ2H 2WINA 1CXKA 4LOUC 3LH2L 4MA8L 4LKCB 5DHXB 2IBGA 3VXUB 4XH2A 3RVXD 1B6DA 1QG3A 4N9GA 4NT6A 3MLTB 3KYNB 4LVEA 4I0KA 1A7NL 2ZUXA 3TBWB 3REWA 4EBQL 3IXTA 4D3CL 1UXWB 2ZNWA 2EYRB 1DLFH 3RWIB 3RWGA 2ZCHH 2J4WH 3HE6A 3RY5A 4KTEH 2J88L 1QUNA 1YEHL 3BDYH 5GGTH 1KB5H 4ZUVA 1J86A 5SWQB 2BVPA 1KJVB 1ZSDA 3DXAE 1KACB 4HIEA 1GGTA 1KTLB 3NN8B 3ECBA 3MRGA 3DTXB 1M7DA 1VGEL 3MGTB 4ZD3L 3MLXH 3NABL 1Y6NR 2YPLD 4M03A 3WS3B 3CVHB 4F33A 4J7RA 5D96C 4YUEL 5C9JA 5EORL 5I1GH 2VDML 4ZAKC 1QR1B 1JN6A 2BVQB 3QDME 1T0MA 2WLZA 3SDYL 2DTMH 1FVDA 4P57A 1UB6A 2HKFH 4NHCL 1DSFL 2DM4A 3X11A 3QHTC 3HI6L 1VFUA 1YUHA 1NFIA 5FKPA 3LV3B 1T1YB 1F58H 4BK4A 5DD5L 1J5OL 5CFHA 5TDNA 1OAQH 4YX2L 4V2CB 1FIGH 4PB9H 1I75A 1N7MH 4PYHA 4YGAB 1JRHH 3VXMA 1WWWX 3UTSB 3NIDE 2IANA 3MOBH 4R7DA 1DN2A 3E3QE 3DYMA 1CDIA 1IAKA 5DK3A 3MJ9H 3BPLB 4PFEA 2PR4H 1MCSA 1UB5A 3QIBC 4L3EB 5DURB 3TIEB 4PRIE 5IJKC 3UO1L 4Y8AA 5LGHL 4HUUA 3TNMB 5IW6B 4ORGA 3TCXA 1PLGH 4ODBD 2D7OA 3VFOA 2MCPH 4H26B 1MCOH 3O45A 4PJCE 2MNUA 5KG9B 3ULUD 3WHE0 1NUGA 2WSKA 2AV7A 1TCRB 4OGYH 3VFRA 4PGBB 1MEXH 4WTZA 4D9RE 1HHKA 3GSUB 5IQ9B 3HNVL 4U6YA 5F7NC 4YH6A 1NL0L 2YBRB 2IFGA 4RMTA 1WTGT 4MGXA 4NGHH 4D9LL 5CJOH 5I1HL 3HUJB 3T0XA 3NMEA 1FP5A 2NNAA 5E5UB 4G42B 4GOSA 2IWGA 4JFDD 1ZLWH 3OKNB 1D5IH 4G6KH 3QFJE 4E0RB 1QRND 3VG9C 3MLWL 2BCKB 3EO0B 4X4XA 3QXAA 1WZ1L 1IEAA 3OKDA 2VL4A 4CN1A 2D7TH 1QFWL 1U8HB 4M7LL 1T7WA 4YBLC 3P11H 5CBEB 2P5WE 2BY3A 1MLCB 4X9BA 2A0LC 1GGBH 2KBGA 5JQHC 3HE6C 3SDAD 1FG2B 3ARFD 2VLRD 3IDXL 1BWMA 1JK8B 3BESR 4HS6B 2EIDA 4HT1H 4XVJL 2LE9A 5T3ZH 4NUGL 4XPHL 3S34H 2I9LB 2DLFL 3Q1SH 4WI8A 5JQ6L 4PY7B 1F02I 5ETUA 1SHMA 3ZSSA 1R3KA 2HJKA 3NIGE 3X13B 2FX9H 1NBYA 3PQYD 5AWNL 1JZ5A 4YAQA 1U8JA 4FQXA 4E42B 3L6FA 4UV7L 1ES0A 4OGAD 3VRIA 3H9ZA 4HS3A 3V5KB 4J2XA 1QSEB 1OAKH 4YZFE 1FH5L 3PWNB 3QRGH 3R1GH 4RA3A 1S7QA 1FNEB 5KVDH 4LL9A 5BOPA 5L2KD 4AK1A 5IV2B 1P4LA 5D7IA 3BD4A 1B0RA 5D5ME 3V4PL 4JPKH 4Z77B 4U1KA 5AG9A 1A7RH 2YXFA 1GAFH 1B2WL 3UTPD 2VABB 4LHJB 1DANT 4CMMB 4BSJA 2GTZA 1E6OL 1FFNA 3MGOB 5I1IL 3NPSC 1S7UB 4NZDA 3LRGA 4NKOA 3JXAA 5FGBA 3G6AB 4NNXA 1BBDH 5J1SC 2VXUH 1LO3L 2DLTA 4B7IA 2OL3L 1XGYH 2FJGB 5C6PB 3CXHJ 2F5AH 5E00B 1IC1A 5CZVH 3O4OB 4CKVX 4JFPA 4FQHA 5I18H 3H42L 4JM2D 2XWBB 1P6AB 5F93C 2JCCE 4JFDA 1JHKL 3QUYB 1FLRL 3RX5A 2QQNH 4JRYB 5B8CA 4OFVA 3IKKA 3SDDA 2UY7A 5IQ7L 2BMKA 2O5ZH 4JEGB 4CBPA 5I19L 3MSPA 1MIMH 3O11A 3GRWL 3P9MB 2QSVA 2NTFA 5EUOF 4U6VH 2OTUB 3MRJA 1OM3L 3Q6FB 4G8IB 5JIIA 5ALCL 3BXNB 4HZLB 1JFQL 5ESVA 1YEFH 2Y23A 2OS7A 3LKOB 4JFZH 2EO1A 2O61B 2R2EA 4NO2A 3ARWA 1HINH 5IG7B 4LEXL 2IH1B 3FFCB 3JV6B 2AEWA 1U8OB 3MNZB 4OD1L 2X7LB 5FHAL 2RFXB 4M93C 2B2XH 1E27B 4M02A 1CICA 4UIMB 5EIIA 3TO4A 5CEZL 4ZQKA 3ZKXC 1T21A 1WZKA 3JV4A 5DT1H 3VXUD 4ISVB 3QH3B 1T2QL 3LDBB 2GAZB 1Q0YH 4OFIA 5DJAB 1U0QA 2OR9H 3PABB 1GOHA 4JFQB 4KU1A 3LQAL 3MA7B 4HCRH 1AD9B 4UNVA 5K9OA 3F8UB 3QNYB 4YPGA 3BJ91 5GZND 5HI5C 5DD3H 3QWQB 1A0QH 2X4RB 5F1SA 4MDJA 1NMAL 5C0NC 4YFDB 3PL6B 4N5EC 2BY2A 1HSBB 3L5HA 3HS0B 5I74C 3I2CL 3A6BL 3VFUB 3BEVA 3VXRE 1MRCL 1A14H 2EDNA 3QWOA 1X5KA 4DZBA 1FIEA 2OI9B 5EFIB 1KJ2L 4OZIF 4FQXC 3MOAH 4LSTH 3KPPA 3D0LA 5EC2A 3EDKA 3LQMA 4LLQB 3CK0H 1TTFA 4PJFB 1S7TB 1ZT1A 1UEYA 3RBSA 3HAEB 4KGJA 1DLFL 2KQNA 4Z7WE 1EO5A 3P77B 2Y9RT 2ZCHL 2J4WL 1CGXA 4KTEL 3C8KB 3C9NA 3BDYL 5D1QA 1KB5L 4JHBA 4Y16A 5GGTL 4ZFFA 1KPRA 4NZUH 1Y6MR 3SGDI 1TZHB 2X4UA 1CFQB 3FONA 4OCLC 5EZOH 1CGYA 2VZSA 4WDIB 1CLCA 2ICEA 2WWMC 4HH8A 4XI5C 1BLNA 3UTSD 5KS9E 1L9NA 5FGBC 3IAGC 1AD0B 1IAIM 1R24B 2CUIA 3DUSA 3MLXL 5DJDA 2LFGA 4HV8B 4NCC1 1IGCL 2VLKB 2GJZB 5DHVB 1X4YA 3ZYJA 5EOQH 3T0EA 2X1XR 1JF6A 5I1GL 3ZTJH 2V5TA 3L3GA 3IDGA 5DJ8A 5D7LA 2DTML 4L3ED 2WANA 5DURD 3C87A 5FO8B 5KSVA 1EPFA 3WNLA 5L8JB 1N6UA 3JWNC 3WEXB 5BW7A 2H2SC 4NJAH 3TFKD 4P2RE 4ZYKB 3DV4B 5B8CC 3CMGA 1BP3B 1F58L 1KYOK 1KB5B 3QT2A 3SDDC 4AEFA 4OCWH 5DS8B 5ALBH 3MLTA 4OI8A 3D3VB 2PW1B 1J1XL 1FIGL 4PB9L 1N7ML 3AGVA 4OZHE 1JRHL 4GH7B 1HILB 4GT7A 4MJIE 3RGHA 2VAJA 3RWIA 3OGCB 2CKBB 1C7TA 3MOBL 4PJBA 4M3KB 2YD1A 1VEMA 3I6LE 4J23A 4KVCH 1NCWH 3MJ7A 3O3EA 1OP3K 4K7PY 3CFBB 4EN3A 4QNPE 3MJ9L 4WI7A 4U31A 2PR4L 3V6BR 4HGMA 3ZTJG 1CICC 3TO4C 3ESUF 3GSNB 1X3DA 2VLJB 5FK9A 4TUOB 1IJ9A 1RHFA 2PW2B 1PLGL 1K3ZA 4HEME 5C0IB 2OR8A 2MCPL 4ETQB 1MCOL 4ZSOA 1WVZA 3EOAA 3WNKA 3UJJH 4XBGB 1MCKA 4ZTPH 5EBLB 1HXMB 3BPNC 2V5YA 1BZ9B 2WNGA 4OGYL 1FZKA 4NNYA 4BFEA 4NN7B 3MQIA 4FFWC 1NCUA 1Q9LA 1MEXL 1YN6A 3TJEL 4JKPH 3LV3A 4K7PH 1UYWH 3REVA 5HVHC 1M05A 4RFNB 3U46A 3LKQA 3P0YH 4NGHL 3V52L 3U0WH 1GZPB 3G08B 5CJOL 5EOTA 2Q86A 3ESVF 1KULA 5C0CB 4GW1B 2H3NB 2C1OB 3H3KA 1CLZH 1HWGB 4Y19A 4EVNB 4F8QA 5B22A 1QSED 5E1AA 1UJ3B 1P2CB 4BH8B 4WENB 3KWWB 5FB8B 2HN7B 4LSSL 3D2UB 4YDKH 4X5WA 3BGMB 4X99B 3SOBH 4D2NA 4OV5A 4X4ZA 2AJVH 4X7DC 5L2JB 2FHBA 1K9TA 3RPKA 5D1QC 4Y16C 3K1DA 3V6ZA 1TJIH 3AU1A 5BS0B 4HT1L 2EKSA 2FIKA 5IMLA 5T3ZL 4YNYB 3Q1SL 3FCTA 2WBJA 5DFVC 1HCFX 1DDHB 2DL9A 3U4AA 2LTQB 4G9FB 2R0LH 2FX9L 1FL5B 1IRAY 3T0EC 2H2PD 5IQ9A 1G7LB 3IRPX 3LN9A 1HSAB 3OB8A 4R7NA 1OAKL 1NLDL 3ZDYF 3R1GL 2YR3A 3GJFH 3QRGL 4OD3H 5L0QC 1U92B 4XWOD 4JO4H 3GBLA 1EA9C 3WN5A 3QFJA 2R2BB 4R4ND 5TH2B 3P4MB 5BW7C 3QUYD 4JRYD 3OKNA 4HH9B 3KXFB 4NO3A 5HYEA 4JPKL 2BCKA 2ESVB 3LEVH 3UZQA 2Y72A 1A7RL 1GAFL 1A2YA 1DQQA 3BP6B 4UI2A 2C3WA 5GGVH 1JGVH 2VISB 4M7KH 4NM4H 3S5LG 1G6VK 1NMBH 3QAZB 4K8RH 4ELKA 5IVOA 3W5NA 1E0OB 1SJXA 3W9EA 2J2ZA 1JNJA 5I1DA 1BBDL 3OL2A 1G7HA 3PWPB 4K3JH 4I3SH 1EHXA 2VXUL 2DAVA 1LHZA 2UV3A 4XC1L 5IFHL 1CXHA 4G7YL 1VGKB 1XGYL 3MJ8A 1ETZA 4JFEB 2G2RA 3FFCD 2HVKA 2F5AL 3C8DA 4EN3C 2EDRA 4PGZA 3WL9A 1QFUH 5CZVL 1C5BH 3LKSB 1PG7X 3SGEH 4UBDC 3TLRA 1OF2A 5I18L 1J12A 4O2FA 1AO7A 2CIIA 4UINH 1CFNA 2A73A 3AMKA 3BKJH 5JHDB 5C92A 3QQ9D 1JRHI 1RJLA 2AJSH 2X4TB 3QO1B 2VC2L 3QG6A 1AGEA 2C4FT 3MV8E 1RU9H 4TSBH 1MIML 1HQ4A 2OTWB 1S9YA 4U6VL 2BHUA 4IJ3B 2FO1A 1AR1D 5T33H 1ZLSH 1RI8A 5T1MA 2ZJSH 2QKIB 3PL6D 1NGWB 4K9EL 4JFZL 1WAAE 1T6VN 2X9YA 3HR5B 5I30H 2NYYC 1D3CA 3U0PB 1HINL 3K46A 2NR6D 5A3IC 4RMVA 1S78D 3H6JA 1XF4B 3MGOA 1WGOA 5I76B 1ZA3B 1E4KA 2B2XL 3JWDC 2V5MA 3EO1B 3ARRA 4KTYA 1KOAA 1LP9B 2Z4QA 4YFLF 5BZWA 3M8OH 1M7IB 2FJGA 4ZUUA 5CEXB 2DJSA 4QRQA 1AIFA 2AJ3A 2IADA 4HCRL 4F8TA 1KCUH 5DD3L 2ERJC 4YDVA 1A0QL 5E6IA 4N0CD 2BY0A 3BZ4B 3BPCA 1FCGA 4K3HA 3RVTC 4B5EA 5FECB 4JRYA 2X4NA 3NIDF 1AHWC 1KCLA 1PD6A 5C09B 1JF1A 3E6FA 3JBG7 4JANA 5JDJA 3BWAA 3CH8A 4NIKB 3G04A 1I3RB 2D9QB 1MRDH 3ARBA 2WBJC 3UBXA 4RGNE 4S1QH 5ILTH 1PEWA 4GAJL 2OJZH 1EHAA 1A14L 2FECI 2VLKD 4JFFB 1EHLH 1PKOA 2ZUTA 1JE6A 4U1GC 1PEZA 2QSCH 1TQBC 4IOFD 3MOAL 3LKOA 3OX8A 2HT2C 4LSTL 2O61A 2OL3A 2CDGB 4IIQA 1PY9A 1E28B 3DVNA 3UJTH 1L4IA 2BSTA 2YD7A 5IG7A 1Z5LB 4TTDC 4OF0A 1CD8A 3RL1A 3WN5C 2X7LA 4PJCF 5ENWB 3QXUA 2A74B 3TVMA 3QWRA 4WWID 1QLFA 3MPCA 4NZUL 3D3VD 3IDYC 5DJAA 2LU7A 3C6LB 5J56B 5CEYB 4RDQF 3C5ZA 3GRWA 4MHHI 4F2MB 4LSVH 4JM4H 1KF9B 5CHNB 4GXVH 3WD5L 5GRXG 4IEFB 1FNGB 3BVNB 1A7BA 1R5VA 1CFVH 1NMCB 2PYFA 2OZ4L 3U6RB 3L9RB 1PKQA 4O2EA 4H1LH 2GFBB 4YHYC 3HS0A 4XNXL 2FATL 2GSIA 1U8LA 5DYOB 4OBSA 5HD8D 3WS6A 4BH7A 4HC1H 2GI7A 2VLJD 1N8ZA 4IDLA 3OB0H 4NJAL 7CGTA 2NY6C 5D7KD 6FABH 1ACYH 3OKMB 4YDJB 5AD0B 2JTDA 1QBLH 4OCWL 1NGYB 3KS0J 2DD8H 3OV6A 4I13B 4P48A 3OKEB 2ZWLT 2Y4SA 3D18B 5L7XH 4MB4A 1F42A 2VZ3A 1J18A 2YD8A 4UNUA 3G6DL 5H2BB 3MRLA 4J3UA 2NX5E 4CNIA 3S3SA 1AGDA 3O2VH 3C8KA 2BNUA 4MD4A 2W0LA 1RURH 4QHUB 3PWJB 4KVCL 3V7AG 3BP5A 4NQUA 1NCWL 5EPMA 4PJGE 5C0CD 5JOFA 4BM7A 5TFSH 3Q5TA 3HCVB 1CT8B 1E4KC 4I3GA 4TRPH 2DQFA 4YZFF 5DQ9A 2NY7H 3KYAA 4H1LG 1KJ2A 1HCVA 2NW2A 1JYWA 2VR4A 2VLKA 4RAVB 3S6CA 2BXYA 4Y5XA 3P4OB 4RFOL 5ERWB 2WUBL 1YY9C 3D2UD 1EJOH 1WEJH 4X0KA 4BFBD 2X4SB 5DRWB 1MHPH 3UJJL 3N1QC 3FN3A 4ZTPL 1U8NB 3PJSB 4XBEH 2Z0BA 5E6ZA 5FA3A 4DQOH 5E6IC 5EC1A 5EU4A 3NGBB 5CWSB 1ZHKA 3CH1A 4ZOEA 3GSQA 4JKPL 5BS0D 3HI1A 3DV4A 5E8DH 5CCKH 2BNRB 4K7PL 4ZPTA 1UYWL 2YPLE 1UCTA 3ARBC 3HB3C 3MODH 3P0YL 1T1WB 2XIDA 3L3DB 3QDJB 4OZHA 4X9GA 4G9FD 3U0WL 5DUPH 4ZS7H 1PX4A 2DICA 5D2NE 5AUMB 1OGAA 4FQJH 3VU2A 2QR0A 1F6LL 4R0LA 2BHZA 4XPFH 3OGCA 1C1EL 2D0FA 2V9TA 4G43B 2PTTB 4IIQC 2JCCF 3CC5B 4PGCB 5GRWA 2C3GA 2R69H 4YDKL 3QEQB 2BX5A 3GMLA 1V3JA 3E6HB 1R3HA 4M62H 2CDFA 3SOBL 5FGCE 5I9QB 3KXFD 3VI3E 2ESVD 5DMKA 3TEUA 2FEEL 4G8GA 1T3FA 3TVMC 4U0QB 5C0EA 2VLJA 4JRWA 4TUOA 4MD0A 1TJIL 1CFTB 2YKLH 2A83B 5C0IA 1IEHA 3S36H 2NY2B 1FL6A 3C5ZC 1EJ6A 5A1AA 2P46B 3WIFB 1P7KA 2VDOH 5EBLA 5F7DB 5EU3B 3QFDA 3PWPD 4CVZA 3RZWA 3G6JA 4UIKH 1ND0B 4DZ8A 1EBAA 2UWEE 4JFED 5HDOA 4L8DB 3VGAC 2ZOLA 2ATPB 2H8PA 3O41A 4F58H 1P7QA 4OD3L 1CXLA 3VD3A 4JO4L 3TF7C 1OQXA 3ZYZA 1DVFB 3BPOB 3Q0HA 4MQTB 3WS6C 2YXMA 5JHDD 5JW4N 5FGRA 2Q6WA 4S11A 4FXGA 1P1ZA 3CDCA 3O8XA 4KV5E 4LRNH 3S5LB 4J8RA 4ZMAT 5MP6H 5JR1H 1IKFH 2W0KA 5GGVL 2EDDA 1JGVL 4NM4L 3F7YA 4M7KL 3VFGH 2XRAL 1NMBL 4WUUA 3LQAC 2XY1A 4WW2A 2GW5A 4LLYB 4MAUH 5GZOC 5IMKB 5EO9B 4PP1C 3BOVA 2A6KB 3DOSA 1MLBA 4E41B 4I3SL 5K9QG 1FYTB 5L2JA 2VDPH 4U4BA 1MHHA 1QRNE 5CJQL 5F7WC 1C5BL 3GJFB 2VSDA 5D93C 4L9LB 4U3CA 1PBYA 5DK0B 4ZS6C 3WFHB 1AGCB 1AJ7H 2JJWA 1J0YA 1KLGA 4R9HA 1Q94A 5JPNB 3BKJL 1TETH 1Z9SA 4MXQC 4Y5XC 2AJSL 3Q5OA 2NY3C 3FQNB 2FEDD 4YHKH 4Z7WF 1OWRM 3R8BB 4CUCA 4TSBL 1RU9L 3RWFB 2VLRE 4X6DA 3HC3H 1S8DB 5FYKU 4PRBA 1DEEB 2VLMD 1TPXC 5T33L 5HYSB 1ROWA 1BFOA 1ZLSL 5C0DA 2ZJSL 2EDWA 1MRFH 5KS9F 2IC2A 4JO2H 3L95B 5C09D 3I50H 2UZXB 3VWJC 5I30L 3PQYE 3S37H 1QEWA 4JFFD 3HN3A 4HJJL 2JB6B 3OXSA 4GXUM 3B9KB 4MNQA 4Y1AA 3O4LB 2YD9A 4R0LC 4WUKH 4JKKA 4GRWE 4JFXA 4KMTH 1B0GB 5LXGH 4JE4B 4ZUTB 5L2KE 3M8OL 2CDEA 5H35B 1FNFA 4N90D 1Z0NA 1R5WA 3DMMA 1PSKL 1JP5A 1NCTA 3UTPE 2VERN 1KCUL 4I48B 3GMRA 1BWWA 3QDGB 1C8PA 1A1MB 4OZHF 1CF8H 4H88H 2JJVA 2YD5A 2Q87A 4TVSa 1G7IB 4HIJA 4IMLB 3C6LD 2D03H 1TZIB 2VDLL 3N9GL 3Q6GL 3ABZA 1KUMA 1MRDL 5ILTL 1G6RH 2OJZL 3HC0B 4N0YH 4LPTA 1QFOA 1FDLH 4XZUA 4XNMB 3VFNB 1EHLL 4XCFH 3CLFH 5IB1B 2CLRB 2QSCL 1MJUL 1NKRA 5C07A 4YHMH 3IAPA 3ISWA 2VDKL 4NQCA 3UJTL 4S1DC 4XNYH 3CFKA 4RNRB 3NIFE 3FOLB 3I6GA 1Q8MA 5IB2B 2Y7QB 1XF4A 1T66C 2LABA 1X5YA 5DUMH 3O8XC 2FB4L 3I75A 3V5HA 1UFUA 1AE6L 2VWEC 4PV8B 4TTGA 1LP9A 2QSQA 3LPGA 5C0RH 2X41A 4XC3H 5ESAB 4HKZA 4Z95L 1QR4A 1ZGLP 4ALAH 1MHCB 4WW2C 2FLRT 5FYJD 4LSVL 4JM4L 3PWUB 4GXVL 4G80A 1R3JA 3KPOA 4PJXA 1CFVL 1F4YH 3QUKB 2YPKB 1C5CH 1RIUH 1OAYL 1CBVH 5FECA 2H41A 3DX8B 3MRCA 2DS4A 3RWHA 1LO5A 3UC0H 3NA4A 1OAXH 4D94A 3IGAB 3K81A 3VXUE 5EO0B 3T1WA 2P43B 1KB9K 2WWKT 4K3DH 4U6XA 1WJ3A 4YXKH 3I3EA 3DGGB 4HC1L 1JZ3A 3D6GA 5IEHB 3BDXA 3FQTA 3RNKB 5I17A 3SCMA 2VQUA 4TSAH 1ACYL 5FOBA 3A67H 3T3ME 3WO3B 2DD8L 3MZTA 5F7YC 5CGMA 3SBWA 5GS3A 4GBXB 5JIPA 1N2RB 2VO5A 4XCYA 5FDWB 3EO9H 5C0BB 4Q9RH 5EBGA 2ZCLH 5L7XL 5DJYB 3W39A 3DIFA 5KSUA 5C08A 5ADPH 3BUYB 1WITA 2GJ6B 3AM8C 2BNRD 5A2LH 3SGEI 2J8HA 3T8XA 2A74A 4OM1H 3QUXA 4B7LA 1RURL 3QDJD 4Y4HA 4P23C 4PJEA 1E6JH 4H1LB 5GS1B 5TFSL 1P4IL 3GO1L 1U58A 3D39B 4OM0H 2Q20A 3HLAA 2NY7L 5EU5B 1A21A 4FNLH 1FZOB 5E2TL 3DROB 4N8VG 1IAOB 4MS8C 5GPRA 5JOEA 4C57C 4Y5VA 4UQ3B 3UTTB 5HYJB 4S1RH 3QEQD 1EJOL 1WEJL 2GT9A 3VXTA 3PGCA 3DMMC 1MHPL 1XGPB 3TBSA 5DYOA 3SE9H 3RWEA 2ATKA 4N9OB 2APVA 1UM6H 4XBEL 4DQOL 4H25A 2X05A 4JDTH 2HFFB 3BH8B 3OR7B 3UYRH 3UTSE 5CCKL 1XF3B 5E8DL 1KLUB 3FB7A 2CRZA 2NY2D 4QRUA 1Q9WB 1HQRB 4EIGB 3RTQA 4NQEB 4NBZB 3MODL 4YEFA 1JJUA 5DF0A 5DUPL 3FB6A 2RGSA 4ZS7L 3DSFH 1H8OA 1F2QA 3FQRB 4N0UB 2KUTA 4FQJL 3WIIH 1QQDB 3QISA 3VXQA 4L3EE 2E9JA 2G9HA 1G7PB 4JN2B 5F7KC 2OZ4A 4NDMB 1TJGH 1QFHA 1X4XA 4FZ8H 1GZQA 3WLWC 2R69L 1DVFD 4QF1A 4UQ2B 2OK0H 4M62L 3ZHLA 1WZLA 1ZHBA 3NZ8B 4QOKB 2R2HA 4HXBH 1BOGA 2JK5B 4PLOB 3HPLA 2XTJE 2IG2H 3SDCB 4X5XA 1BFTA 3FO2B 3EIFA 2IJ0C 2YKLL 3P4OA 4QCIA 5JO5B 3QYCA 5LGKA 4WVRA 1WAAF 3S36L 2DI8A 3Q5YA 1GVIA 2VDOL 5CJ8A 3HUJE 4E41D 1FYTD 1LGVA 1FNHA 4HSQA 1U8NA 4MJ2A 3KDMA 5I16A 4UIKL 3RL2A 4R4FH 3U2SA 4OCXH 4K9EC 2XICA 3L7EB 5HSFA 5E5MA 3SO3B 4F58L 5MENA 4Z7OE 3BMVA 1T04A 4N8PA 3U30C 1OSPL 1A4JA 1R3IH 4XCNB 2ITCA 1OTUD 2CR6A 2DBLH 3SCMC 4RAUB 1I7TB 3IJYA 5MP6L 3QEHA 1IKFL 2ICWI 4YEEA 3RDTA 1DFBL 2Y1VA 1INQA 3BP7B 1MCRA 3SBWC 5E2VH 4K8RD 4PJDA 3VFGL 5EZIH 2P8MB 4MAUL 5C6WH 3FRPG 2VZ1A 1CG9B 5I8CA 1OPGH 2L7UA 5AYUH 4F7PA 3QUXC 5IGXH 1N4XH 5BV7H 5BXFA 2VDPL 3UPRA 4P3DB 4Y4HC 5FDYA 4A2LA 2A83A 5CP7B 1UZ6E 4Y5YA 1RFDL 4XVUD 1K8DB 1QSEE 3B9KD 3RY6A 3RIFF 3O4LD 1HE7A 5FYLD 3C09C 1AJ7L 5EWIH 4Q6IB 5DJ6A 2X4QA 4U0RB 1CQKA 1TETL 3KYOA 4Y5VC 3UTQB 2XACC 2W91A 5LKNA 5I71C 5FO9A 1MJ7H 4YHKL 3MYJA 4ODWA 3ZTNH 1YNKH 2ICES 4DK3A 3MCLH 1MUJA 3ZMRA 3HC3L 3P0VH 4KK5D 3QDGD 2GHWB 2E9BA 5JW4M 2BNQA 1MRFL 3GSXB 4JO2L 5DO2D 4EI5B 3G5ZB 3I50L 1U6AH 4LDEB 1U3ZA 3RTQC 3D69A 3S37L 4P5KB 1JUFB 3HI5H 4DCQB 1FYHB 1DLHB 4QHKI 5IBTL 3WDJA 2VKWA 5DMGD 5EU7C 5IR1B 3FL7A 4X6BA 3G5VA 5IMKA 2W9EL 3TJHD 4WUKL 4KMTL 3FT4B 4WU7B 3TH3T 5LXGL 4HS8H 5I66A 3F12A 1RUKL 4UOW1 5CIPB 4QT5A 1M7XA 3U48A 5EB9A 4ELMB 4PTTB 1A6PA 1F6AA 1EMTH 2X89D 3MV7B 5DK0A 4U1JB 5FXCH 2ILLA 1C7SA 3IKCB 1U95B 1H9VA 1BQSA 1CF8L 4H88L 4RMRA 1LD9A 5IWLA 1ZLUK 5HBBA 2D03L 3VD5A 4LVOB 2C3XA 4JPIA 1CS6A 3AROA 3S3PA 3T0AA 3RWFA 1QSZA 4PJGF 2XTLA 3FFCE 4N0YL 1L7TH 2A2QT 1A6AB 1TNMA 3CLFL 4KRPC 2XXCB 4NQDA 1CE6B 5E4IA 4YHML 1EEQA 2OCFD 4G6MH 3TYFB 4UDTA 4XNYL 2CIKA 1FO0H 2AXFA 3KPRA 2ZUVA 5HI4D 3ULVH 4ODTH 4XAKD 4N0FA 2ID5A 2VMFA 4X6FA 3IDIB 4PIRF 5DUML 5FUOH 1BAFH 1YZZA 1RUQH 2HLFD 2R4SH 3RDTC 1IM9B 2YUZA 4X7FC 3PG2A 1RZJC 1FC2D 1MCWM 4GBXD 1NGZB 5C0BD 3UX9B 4AENB 1KPUB 5FUCC 4ALAL 4P2QA 2UZIH 5IW1A 3O6MH 2GJ6D 1G6RB 3KYMB 4U1HB 2FSEB 3MNVA 3DX7B 3UROR 4W6XB 5MEQA 1F4YL 2X4PB 1RIUL 1CBVL 4BSVA 2R39A 2PYEB 4HEPG 5HVWA 4Y5YC 1F4HA 3OWEA 3D39D 3WNPA 5DK2A 3RY6C 5E24E 4K3DL 3JUYA 4YXKL 4QWWD 1I1FA 1MY5A 5CZXD 1R3LB 2DMBA 3HC0A 4PJFE 3UTTD 5FF6B 5HYJD 2WWKO 1KYOJ 1QP1A 4TSAL 3T3PE 2YUVA 3VI3F 3A67L 3C5JB 4ZOAA 3SN6N 4LIQH 1AXIB 1JGEA 1G9MH 5DJ2B 2PXYB 3FT3A 5I75C 3MBXH 4HJ0C 4XRCA 5IVZA 2AK4B 3TNNA 2YRZA 3EO9L 4UT6H 4XMKH 4Q9RL 2ZCLL 4XAWL 4EIZC 2OJEB 4NFCA 5ADPL 4HBCH 2ZSWA 5DRNB 3C5SA 4QRRB 5GISH 4HWNA 2IQ9H 4OM1L 4PV8A 1IMHC 1MCPH 3PXJA 4HD9A 4NQED 4I2XA 4R4BB 1FN4B 4YQXH 3B6SB 2UWEF 3OAYH 5CLWA 1BQHG 4O51A 2R2CA 1T20A 2G60H 5J11C 1NGQH 1JZ6A 4HUWB 1KIQA 1SVCP 3B8SA 4OM0L 3ZKSD 3V9FA 3MUJA 1ZEAL 4JZNA 5KSBE 2HTLD 5HHOB 3DX8A 4S1RL 3QEUB 1X9QA 4JAMB 4KV5F 4ZOCA 5KW9H 2WK2A 1LE9B 3C60A 1LVEA 1MCFA 4N8CH 4JO3H 3MRHA 3LOWA 4QOKD 3KHQA 1F45A 2Z93B 3STLB 3HZMB 4HIIB 2GK2A 1AGBA 3D3VE 4U7MA 3SE9L 3VFTB 1I3UA 4MJ5A 3SDCD 5IB3A 1QACA 3PHSA 1UM6L 2Y6SD 4HIHB 4IOIB 3OAZK 5J6GB 4JDTL 3B8YA 1U8MB 3UYRL 5IWLC 5BZDB 1WIOA 4X8JA 1FZJA 2V7HB 5J9PB 2APXA 1QHOA 4IRZH 1KBGL 5GGSA 3Q3GA 3WIIL 4FABH 3GMOA 4HMEA 2MKWA 3ZKND 1T5XA 1KT2B 2EXYD 5TE4H 2H9GB 3QDAA 2DOCA 1AH1A 3WKMH 4R97C 3EBAA 4JGJA 5D7KE 1KIPA 3O3AB 4HMCA 4QTIL 3SEPA 2CKNA 4JRXB 5INDB 2HJFB 2OK0L 3C6SA 3CNKA 4WO4B 5FHBH 4A2MA 5LWYH 3PHQA 4HC1A 4HXBL 5JMOC 3O6FB 4O2CB 3WFCH 2IG2L 2AXGB 4C59B 1IAOA 3D87B 3MO1A 3R06B 4QY8A 1LK2B 2HLAA 1R5IA 1RJYB 2CMRH 2FYYA 5IB4B 1DQLH 3L3JB 1IAMA 4QRSB 3MV01 1U93B 1OLZA 4CU8A 1W0VB 5C0CE 1H5BA 1CE1L 4CJ1A 5DSCA 4FS0A 1OD7A 4PRPB 4OZFH 1LQSR 4M00A 3UYOD 3CFIC 2DF3A 4GRWF 1VHPA 2VE6A 3QRFM 1HQRA 3LB6D 3OJVC 3K3QA 3LPWA 3DX6A 5F88A 2R9HC 4N1HB 2DBLL 4X7TA 4UNTA 4H5SB 3WIHH 1IQWH 4BK5A 3ZYIA 1IEBB 4NDMA 3BN3B 4PRNA 4XGZA 5E2VL 1NEZB 3VMNA 5BS0E 5EZIL 1RZ8B 1OPGL 3SY0B 4EI5D 4G9FE 5AYUL 4OZGA 5IGXL 4ZO6A 3G5YA 5BV7L 3FO2A 4HGWA 4M7JL 2BVYA 3ZT6A 1MI5A 1BX2B 5GRZA 4JM2F 3IFPB 1QO3B 4OZFG 2XKNA 4KWUA 4XB7A 3NIFF 2HAZA 5TE6L 1WCBB 2WIIA 2EH7H 4L8SB 3EHBD 3KXFE 2V2WB 5CSZB 2ESVE 1MJ7L 3C60C 5EUKB 4WFGD 1FFRA 5JNYB 4MA3A 5KAQG 2ZNXA 3ZTNL 3IYLW 3MV7D 1YNKL 3RAJH 4DWHA 3MCLL 3QJHB 3S7GA 1DQDL 4TUJB 3P0VL 5IOPA 3FRUB 3FQWA 1WBXA 3ARVA 5T5FH 3X12A 1UQSA 3GSOA 4YHLH 2H6PA 3VD4A 5ICXA 5IF0B 4POYA 2R8SH 3EYVB 1U6AL 3PWPE 3EJYC 1XT5A 3LKRB 4PJ7B 2MQ0A 3P73B 5DZOA 4JFEE 4ZTOH 5CD3B 3K8KA 1CGTA 5JHLL 4UZGA 3S98A 2E7CA 4UTBH 3OSKA 4XHJD 5FA4B 3T0DA 4NKDB 4F80A 1RK1B 3ARDA 2JF1A 4YHOH 4DTGH 4B53A 5JHDE 1ZVHA 3FAXA 4HS8L 3RVUD 1BVLA 2PCPA 1WFNA 3T3MF 3ROLA 1MCDA 5F97E 2BC4A 1EMTL 1JPGA 4Y7MA 1DN0A 1UKSA 4EEEA 5ACLA 2AJUH 2E5EA 1IM9D 1GJIA 3RA7H 5DA4A 1A6TA 2A9NH 4LCUB 3VDBA 5KSAB 4M1CD 1CDYA 2YRPA 4S2SB 3NA9H 2I9TB 1QFPA 1IGFH 2GUOA 2NZ9D 2VR5A 3I6KB 2R1WB 3MZGB 3QIUC 5C0JB 5DZNA 4JHZA 3RU8H 4G5ZH 3DETC 4P5MB 1D6EA 1L7TL 3MV9B 1H5BC 1KFAL 2PYED 4WHDA 1A9BB 1MCQA 4YHPB 4G6ML 4Z76A 1NAMB 3SJVE 1FO0L 1SQ2N 1HOCB 4LCIH 4NZTH 3ULVL 4ODTL 2F54A 1B9ZA 2CXKA 2H32B 3BGFC 2BVTA 1FFPB 3NH7H 1RUQL 3RWJB 2R4SL 3GJEA 2PXYD 2VAAB 2VLME 1Y18A 4ZFGH 4NRXB 5ABDE 2PKDA 2W0PA 2AK4D 3UXFA 4PTTA 5C09E 4QRTA 2BOBB 4QRRD 2ZSVB 2GCYB 2XTJC 2VR9A 5F21B 5D6DA 3TH4T 3UAJC 2V7NA 1BD2B 1LDPH 4JFFE 4ZUWB 4DJMA 3IDJB 2FX7L 3PDGA 1YEEH 2EH8H 5F1NB 4LFHG 1F11A 2F19H 2ZUSA 3QNZB 3WUWB 4F7CB 2KH2B 1WBYA 1FO0B 1RJZA 3B2UD 4Z0BH 1WV7T 5HDBE 4N90E 1T89A 5D6CB 2C4XA 2XN9A 5HHOD 2W38A 2OYPA 5L8LB 5HPMA 3U9UB 3IT8D 3EDDA 4XP4H 1OT1A 4LIQL 4X4YA 5M94B 1VFBA 5E08H 2EDHA 3MBXL 3KS0H 5C2UB 1K3IA 3EYSH 4K55A 4UT6L 2P5EB 4XMKL 4YBHA 5IKCB 1L6ZA 5JA8B 3DI3B 3EYOB 4P4KB 3SKJH 4M8VA 3KPNA 5C3LD 5J1TC 1VERA 1X4ZA 4K23H 5GISL 12E8H 5DJXB 2IQ9L 3HUJF 1MCPL 4V1DB 2VN7A 2IPUG 1IM9A 4Y89A 3P9LA 4YQXL 3MRDA 2XWJB 1VEOA 4PJIA 3TYGH 2G60L 5E1HB 2XKUA 3MROA 1NGQL 2E6JA 3STBA 3IDMB 4Z7OF 5FV2A 3ARDC 2B5IC 5I8EB 5T3XH 2WQ8A 2HG5A 4M5YH 3NFPB 5FM8A 3W5MA 4IRSB 1K4CB 2DIJA 2BSRB 5KW9L 4JRXD 4EI6A 4N8CL 2HA1A 2VJXA 4JO3L 3AB0B 4WO4D 1HI6A 2EICA 2X4OB 4R3SB 2X6MA 4TSCH 2DQIH 3O6FD 3M1BB 3FB5B 3QUZA 4ZXBB 2XXMB 3T4YA 4ZO9A 1VACA 5F8RC 1U8KA 3VH8B 4OD2A 5FYJE 3WNNA 2AK1H 5FEBA 3RGVB 1CGSH 5DD0H 1BFSA 2NXYC 3RKPA 3P30H 4HUVB 1RVFL 2P8LB 5EBWA 3VFSA 4IRZL 1NC4B 4P2YA 1UZ6F 2OJEA 1B4JH 5HYQA 4MAYA 5M95B 4FABL 4PRPD 5DRNA 3D0VB 4MLSA 1TZGL 5AEAA 3BN9D 4F3FA 2EIZA 3HFML 2R0KL 1TIUA 4R4BA 1U8PB 4RBPH 1KEGH 3WKML 2C1PA 3HMXA 1MJ8H 4QKXB 1NBZA 2YC1B 4XHQA 4N8VA 5EBMB 5FHBL 5LWYL 4WY7H 4OCRH 2MQCA 1PYWA 3WFCL 4M7ZC 1Y0LB 4PRDB 2Q3ZA 1MCEA 4YR6A 4C4KT 3CFJB 1II4E 3DSNA 2CMRL 2BNRE 1LE9A 4WEUD 2OBGA 1DQLL 3EFFA 3MUZ1 4XP6H 3ZL4H 3TZVB 4XP5H 4YXHH 4Z7UB 3STLA 5BJTA 3QDJE 4U6HA 5D6DC 3KPMB 4HIXH 3MMEA 1WFOA 3QO0B 1K2DB 2JIXB 1FVEB 3QPQD 2EE6A 4RQQB 5HGAB 1I1AB 1EXUB 3KR3H 4LLMA 3FOMB 1D5ZA 5BZDA 1X5IA 3GM0A 2AV1B 5IBLC 3QEQE 1T89C 3PP4H 4NQXB 4MZ3A 2COQA 4XCEA 5HHNB 1CFSB 1IQWL 2B1HH 4L8BB 2H9GA 3PHOA 1I1YA 3FQXB 1JL8A 1H8SA 2YSSB 1OAUH 3O9WB 3IVKA 4J6RH 1XEDA 1XGQA 4NO5B 3C8HA 1IL1A 1SMAA 2YUXA 2JLLA 5IMMA 4FRWA 3CZFB 1S9KC 2UUDH 2Y5TA 1YYMH 1BBJB 4OF6A 3PE9A 3S96A 5JIHA 4G9DB 3NBNA 3MRFA 2IPKB 1S7XA 3QSKB 1DUZB 4KI5C 2DJ4A 5FUZH 3D1MC 1A4KA 4PP2A 2EH7L 4EDXB 1DE4B 2FJHB 1BVKA 1KCRH 2HMID 4AIZA 2V2TB 1QBBA 4OB5H 3QBTB 3SE3A 2BP3A 1UXSB 1OTSC 5LVEA 3O2WH 3RAJL 4OLEA 3AC0A 2J8UA 1FFQA 3QUZC 5T5FL 3WBDA 4BZ1L 4PV9B 2BOCA 1S3KH 5LGJB 4LMQI 1YEKH 4YHLL 1CZ8L 4X98A 4RRPG 5KSAD 3H7LA 1QLRA 1HHGB 2R8SL 4AL8H 3RI5K 1KTKE 2EC8A 2ZZUT 1XCQB 4E41E 1OW0A 4XXDB 1FYTE 1G1CA 4QGTA 4RAHA 4KZDH 1HYRC 3FRPA 3TBTA 2ZUQC 3OXRB 3T0WA 4ZTOL 4LLVB 3MV9D 5HHPA 3FO1A 4UTBL 1NSNH 1LK3L 2R1YB 4MAYC 3H9SE 3LN4B 4GW5B 2VITA 4EDWH 1U91B 5E9DB 1KCVH 2HYMA 4XPBL 3MBEA 1N59B 2FH6A 2DWDB 2X1QA 1T1ZA 4K7FA 4DTGL 4RCAA 4PJFF 3VE0B 1OP9A 3N1FC 2VQ1A 3HG1B 4ZUSA 3T3PF 5H94A 2P7TB 5GXBB 3ZYOA 5ITBL 3IFPA 3IU3B 2R23B 3GIVA 1QO3A 5DEZA 4C55A 1P7HL 1QVOA 2A6IA 3QUMA 3VD7A 3DRQB 2DLEA 1J8KA 5K9JH 3K2UH 3RA7L 1KN2H 5I2IA 3WXWL 2X9WA 3OF6D 5TDPA 5IT2H 3BJLA 3NAAH 5C0GA 1N5YH 3FQUA 5J13B 1CD1B 5E8EA 1G9EA 1IGFL 3WYRA 4TVPH 5IVNA 3FRUA 1NANH 1BD2D 4G5ZL 4LVNB 4MB5A 4LSQH 3ARGB 5IW3A 5DDHB 5C8JB 3EJZD 1UA6L 4KKAC 4MNHB 2YD4A 3O4LE 5IEKB 1BHGA 5FYLE 5BO1H 3KPQA 5C7XL 4U1MA 4MNGB 4FFZH 4Z7VB 2AJZA 2D0GA 3LKRA 4GW4B 4BZ2L 5KSBF 3ULVD 2IAMA 4LCIL 1E4XI 3M17A 1SYSB 4I18B 4XXCA 2W9DH 4ODXB 3BX7C 1JWMB 2XY2A 2E6QA 4PRHB 3RZCB 3CSYA 3NH7L 4MLIA 1ZT4A 4LNRA 3MCKB 4YXLL 3QDGE 4YC2B 2P24B 5EN2B 1WUNT 4G8FB 2R15A 1JNHB 2P5ED 2W1NA 4DGIH 1XF2B 3RRQA 3KJ4B 4P4KD 2F53E 2YMXH 3K4DA 5JW3H 4HQQH 2RQ8A 4JFYA 2E6PA 4V1DD 1LDPL 1NCNA 5TPWL 2BJMH 2B4CH 3LN5A 3VRJB 1YEEL 2EH8L 2F19L 1EEYA 4KRNA 4JDVB 5HY9A 4YBQC 4Z0BL 3LD8C 4IRSD 5IVXA 1OSZA 4J3SA 5DEFB 5GJTH 1I85A 3T2QA 4GRMA 2DQJH 4XP4L 1C16A 4KK8C 4N1CA 2NLJB 3SE3C 5IHUH 2DYPA 4HW6A 2D3VA 3H7BB 2IMNA 5E08L 4PGDA 4CRPA 1ZV5A 3EYSL 4AEIH 4ZXBD 1ZAGA 4S0SD 2I25N 4Y4KB 3SKJL 5CBAB 4K23L 4ONOA 4ZO8A 5DQDH 2IBZY 12E8L 1FE8H 3RGVD 4UUJA 3D85A 4FQCH 3DURB 1OW0C 5J3HD 4UB0H 3BD3A 4DEPC 1UVQB 3W11D 1ERNA 4KUZH 5J1AA 2XA3A 1NC4D 2W65B 4POZC 3DX9A 2CLVB 3F5WB 3K74B 1XF5B 4U1SB 3UCRA 5T3XL 1KC5H 3MBEC 4M5YL 2AEPH 4ZUWA 4BSWB 4XAKE 3BP4A 4TUKH 1Q9OB 1EEZA 4WFFE 1IBGL 4KPHL 4CVWA 1HXYB 3TN0C 3MLYL 4JFOA 1I7RB 1I7UB 4EUPH 1HEZB 4GFTB 1EGJH 4TSCL 2DQIL 5F6IC 5FYKH 4HK3J 5C0BE 4ZFZB 1AXSA 1BOYA 2AK1L 2GJ6E 25C8H 4XNUH 4NC1C 1PW3A 1CGSL 4WW1B 4IOSD 3TZVD 3RWDB 4O58H 5ISZA 1IGTB 5LAXB 1K5NB 2PTVA 5DJZA 2JIXD 1B4JL 3D39E 4ONHA 1I8KB 1I1AD 1BF8A 3DO7A 3G5XA 5D96B 1BQHA 5BV7C 4F7EA 4WRLA 3SHSA 3MRQA 3UTTE 1KEGL 5HYJE 2CPCA 4NYLA 1ZTXH 2IAMC 3BHBA 4LSDA 1MJ8L 5F9JA 4LGRB 4PJAE 3BKYH 4YFEA 3LEXA 1PZ5B 3LQZA 3V4UH 1A7PH 2NMSA 4WY7L 5FO7B 3TC9A 4OCRL 2FL5B 4EUPG 1HIMH 2BSRA 3D48R 5F1IB 3O9WD 1J0KA 3ZLQC 2QQLH 2FNBA 4HKBB 1X44A 4PY8I 5T1LB 4NQEE 4XP5L 4YXHL 2EIBA 2OP4H 1DQJB 2N7AA 1FL3B 3E2HC 3O3UN 4N0UE 4PJ8A 4LF3B 1YECH 2C9AA 3KR3L 3PGDA 4OUUA 4FG6D 2OQJB 4XVTH 3PNWA 2XG5A 3QQ3A 5CD5C 1CL7L 1NC4A 4LSPH 3QIBB 2M8XA 2NY0C 4NPYB 1CK0H 4WHTA 1NC2B 4QOKE 3D0VA 2B1HL 4L1DA 3SDXA 3OZ9H 3CFEB 2OSLA 1P69B 5DEGB 5T1DH 2HTKD 3NCJH 3QQ4B 3VGEA 1OAUL 2YC1A 2C26A 4M4RA 4LLWB 4Y8DC 3RVVD 4J6RL 1TCMA 4C56E 4AM0A 3WO4C 3L1OL 3NACH 4JDZB 5HHQB 2VZOA 4FHBD 4PRDA 2JB5H 2MOVA 1LEGA 2EYTB 1YYML 5F9OH 1JWSB 3DVGB 4TQEH 1MQKH 5F3HA 1QSFA 1T1XB 5E9DD 4PR5A 4KKNA 1ZS8B 2E8ZA 2HRPL 2WINB 1F00I 4WNQA 2DIBA 3VG9B 5FUZL 1RZKH 2FZ3A 1FVCA 3HG1D 1FVEA 4XH2B 3HRZA 4RQQA 1KCRL 4N9GB 4NT6B 3WLBA 4OB5L 2Z31A 4YBLB 3O2WL 3IXTB 2XWTB 1RUPH 3QEGH 1VENA 5DJ0A 3V6OA 3RWGB 4C58B 1S3KL 1W0WA 1YEKL 3HE6B 4W4OA 1A1OA 4ZUVB 4PJ9A 3VXNA 4AL8L 4XBPA 1JHLH 3MR9A 1AQDA 2BVPB 4D0DB 1ZSDB 4KZDL 4HIEB 3EYQD 1PZUB 1JTTA 3MRGB 2NY1C 1M7DB 3ARGD 1NSNL 1HH6A 4NO5A 4F33B 1KCVL 4DKAA 5C0FA 5HDBF 5C9JB 2EDTA 1EK3A 4OTXH 3AAZA 1NFDA 1JN6B 4OZFA 1T0MB 4PG2A 1FVDB 4RMWA 4P57B 1UB6B 3X11B 1F3JB 1H3GA 2F9BT 2CUHA 1QOKA 2EZ0C 4PRHD 3RZCD 2DI7A 1S7WB 1TNNA 4OKDA 1I3VA 3LRSA 1RV6X 5K9JL 1NFIB 5FKPB 3LH2H 2YOCA 2CO6B 1KXQE 4D9QD 1RQ5A 5IT2L 4WTWA 4ZPVA 3NAAL 1N5YL 5TDNB 3S97C 1MELA 1NEUA 4X8XA 5CJ5A 2RBLA 4RMSA 1IC4H 4TVPL 3NPSB 5E94A 4D3CH 4LFHD 4HULB 4W68A 2AW2A 3VXMB 2IANB 4LSQL 5KANG 5LGJA 4PJ8C 4R7DB 1YEHH 2V6HA 2BRQA 1VADA 5BO1L 2PO6A 5ID0A 3QXTA 4R8WL 1XCQA 2C3HA 1NGPL 4FFZL 1IAKB 3O0RH 3QULA 3T65B 4KJWD 4O4YH 2B8OT 5JLZA 4P59L 2IPUK 1VGEH 4ELME 1UB5B 1S7VA 2W9DL 2FGZA 1YN7A 3JWDH 4WFGE 1X5ZA 4K3GA 3T0BA 3MV7E 1IM3B 2D9CA 2ZPKL 4A6YH 4HUUB 4YUEH 4ORGB 2GITA 3QZWA 1W8NA 3VFOB 1AQKH 3P4NA 3O45B 3U4BH 3QHFH 4DGIL 1NCAH 4BZYA 3KPSA 1DSFH 2AV7B 4E5XA 4Y4KD 2YMXL 5JW3L 2HT3C 3VFRB 4DGYH 3HI6H 3X17A 2GJJA 4S0TD 3ARTA 3IJHB 4U6YB 5I1JH 2B4CL 1U3JA 4XTRC 1SEBA 4JVPA 1D5MA 4P5TA 2WIMA 5EU6B 2J6EH 2ZG1A 1ORSA 4GG6A 3HZKA 3LMJH 4OKVB 2NNAB 1UM5H 3QIWA 1G0YR 3IJSA 4RMQA 4L29A 4M93B 4GRLA 2YA0A 1H3VA 1JF5A 4LOUD 4WEBH 5GJTL 1MIEH 3ARGA 4X4XB 3ZKXB 2NY5C 3QXAB 1IEAB 3OKDB 4R26L 2YN3A 2N1KA 2Z31C 4X5LA 4XCCL 1U2CA 1JPTH 4UMGA 3RKDC 4AEIL 4L4VB 3V6OC 4F9PA 3BDBA 5ANMA 4MQXC 4W4OC 1VFOA 5D2LA 1FHGA 4PJ9C 1YPZA 1S9XA 1YC8A 4UB0L 4KROC 1IGYA 3TIDA 4KUZL 1JZ8A 5B4MC 1OP3H 3IAQA 3BQUA 2PYEE 5I74B 4FQIL 1R3KB 5KVFL 2HJKB 5T3XD 2DM7A 1NBYB 3TH2T 1G7JA 1XH3A 4YAQB 1KC5L 3HE7A 1U8JB 4DVRH 4FQXB 2AEPL 1T5WA 3OKKA 3HA0A 1ES0B 3VRIB 4QEGA 4TUKL 4HS3B 4PG2C 3MRNA 4RDQG 4D9LH 4LHUG 1S7QB 5TE7H 1I9RH 3PV7A 1EGJL 4LLAA 2AK4E 1EFQA 1P4LB 2I07A 1B0RB 4KXZH 3MLWH 4U1KB 1G7QB 5IB5A 3GKWH 4QRRE 3TESA 2YD3A 25C8L 4XNUL 3FTGA 4KJPC 1EBPA 2GTZB 5F3BA 5T1LD 1JPFA 2X1PA 1O5DT 4O58L 3S35X 1FFNB 3NCYS 3MUGA 1RD6A 4NKOB 4KAQH 1CDBA 1AC0A 3QB7C 4NNXB 4AYFA 5CGYC 3BSZH 1JMZA 4MJ4A 4UILH 2PO6C 2DRUA 2JJSA 1ZANH 2L4OA 3EAKA 4G6JH 4ZNEA 5HHOE 2DLFH 3MXWL 3PXHA 1ZTXL 4JFPB 1J0JA 1KLFA 3QIBD 2CLVA 5D7JA 3BKYL 2ADFH 1NC2D 4N68A 3V4UL 3UZEA 1A7PL 1X5HA 4U2YA 1B6UA 5TGBA 5HVFB 1XR9A 4Z18A 1I4FA 1NANI 5B8CB 4O9HH 3SDDB 3WHXA 2BMKB 4YWGH 2GYSA 2Y07H 3FZUC 5JUEH 1M71A 2Z92B 1CD0A 3NCBB 3O11B 5SWSA 1GCFA 2NTFB 3MRJB 1M6OA 2OP4L 2X70B 5EIVA 4M8QA 3STZA 4X83A 1KPVA 4NFDA 1H3PH 3TP4A 2EXWC 4HDIA 1B2WH 2R2EB 1A8JH 1P84K 2YN5A 4BFGA 4U1LA 5H8DA 4P5TC 5J13C 4AY0A 3OKLA 1EX0A 4P2OA 3QIWC 4CU7A 5TQ2L 5GSRA 4GRLC 1KG0A 4HFUH 4Q9CA 4LSPL 1CICB 4JRXE 3TO4B 4ZQKB 1T21B 3JV4B 1CK0L 1TLKA 2V17H 3JV5A 3M45A 2D4DA 5E2UH 3OZ9L 3Q2CA 3PWLA 5J6HA 1HHIA 4PS4H 3O3BA 5T1DL 2A0LD 5C9KA 3NCJL 4YPGB 4F9PC 4UOW0 3BPNB 5F1KC 3HE6D 2HKHH 8FABA 1DBKL 3SQOH 3ZKMC 3NACL 1I7ZA 2Q7YA 5HHVL 1O7VA 2JB5L 5F1IA 4G6AC 5HVHB 4PRPE 1R0AH 1LEIA 3BQUC 3GRWH 5ACZB 1S5HA 4TQEL 3BEVB 5FM5M 1MQKL 3TBYA 3QWOB 2XQYG 1G7MA 5ALCH 1Q9KB 3HE7C 1RZKL 3KPPB 3D0LB 1J0IA 5EC2B 3VFWA 3MJ6A 1J8HA 4LEXH 5ICZA 4QHNA 2OQJA 3AXLA 1ZT1B 2MKLC 1RUPL 3QEGL 4JKWA 5K59E 2NY4C 2VZUA 1JVKA 4R6UA 4DGVL 2EEDA 3T1FA 4J3TA 3C9NB 5D1QB 5C0AA 1A7OH 4Y16B 4X7CC 4FMKA 4NKIL 2X4UB 3FONB 3JWOH 5DC4B 1JHLL 2D0HA 3LRHA 2ICEB 4K3EH 5ID1A 4UDUB 3VXMD 2BZDA 1BLNB 1KCSH 2IAND 3CX5K 5DJDB 3DUSB 4OT1H 1T2JA 3GGWA 3LCYA 2DQHH 2LAGB 5K33A 1L0QA 5LJYH 4RGMC 4K71C 3T0EB 4JKLA 4P9HH 2JJSC 3SQBA 4L4TA 4OTXL 1TTUA 3VW3H 3VDAA 4OLYL 2E8YA 3L3GB 3IDGB 1BIHA 5D7LB 4DOHB 2WW8A 2IMMA 2XNAA 3SKUD 5L0QB 2KDGA 4BQ9A 5D7JC 3FN9A 2WMPA 5KSVB 2BDNH 3S4SA 2GSGA 2XT1B 3OJMB 2MPAL 5I15H 4URTB 4OCSL 5CILL 5J4MA 3AS3A 1DQTA 1RZ7H 5D4QA 1ULVA 4OLVH 1CXEA 4PG9B 4QHLA 4PJ7E 1IC4L 1QA9A 2XWTA 4RRPA 2P42B 1UH3A 3DUHA 4PYGA 1Q38A 1SJHA 4PJ5A 5E6YA 1MH5A 2CK2A 4PJBB 5EU6D 1WQVT 4U2ZA 3VA6A 3OR6A 3MJ7B 3O3EB 4D0DA 4O5LL 3O0RL 3GZKA 3UTZB 4EN3B 2N56A 4P2OC 5DTFA 2DKMA 4O4YL 1GGYA 2VLLA 4JQIH 4IM8A 3IFNH 2A9MH 4DFIA 1A6WH 3JWDL 3TPKA 4JZJC 2AQ1A 1IGCH 5FK9B 3DWTA 3QDMB 4A6YL 3Q48A 4I0CC 4M1GH 2YPVL 1AQKL 4ZSOB 2Q8BH 3U4BL 3QHFL 3TO2B 4L4VD 3EOAB 2XQBH 5F9WC 1NCAL 3I85A 1C08A 1F3JA 5HI5D 4GMTH 4CVUA 1N26A 2UYLA 4Q2ZA 1FZKB 4DGYL 1S7WA 4NNYB 5MEOA 1MY7A 1Q9LB 5C0ND 1YN6B 1IC7H 3MV9E 4N5ED 3REVB 5I1JL 1M05B 3U46B 3LKQB 4LPYA 3U36B 4PREA 2W0FA 5EOTB 2J6EL 2ITDA 2Q86B 1HWHB 5E4EC 4QHMB 3U4EA 1J1XH 3LMJL 4LPVA 1UM5L 5TDOA 4OFKA 4FQXD 3VFVA 4WEBL 4PJAF 1MIEL 1L0XA 3VGBA 4Y19B 4ODUA 3ROOA 5EUOA 5E1AB 4KDVA 3ES6A 1CCZA 5INCA 4X5WB 3KPTA 5DHYA 3T65A 3OMZA 1VEPA 1JPTL 4MWFA 1H3WM 1X5AA 4OV5B 4M61B 4MSWB 2ERJB 1IM3A 4D8PA 3W0WA 3V6ZB 3K0WA 3AU1B 1BD2E 4I9WD 2KZ1B 3FO9B 5F7FA 1IARB 1AHWB 2EKSB 2FIKB 2WWMD 5IMLB 3DRTA 1RK0A 4PTUA 1YC7A 4XI5D 1SJEA 3FCTB 5ACMA 2WBJB 3PWVB 4WFEE 4PGEA 3LAFA 1HHJB 3KG5A 2GEEA 3MREA 3EYFA 3TT3H 2EDYA 3TBVA 3DBXA 3B43A 4U1GB 3TJEH 4YHIA 4DVRL 1TQBB 3GB7A 5JPMA 3IJHA 3MFFA 3WV0A 1JPSH 4R7NB 1KENH 4JQVA 5DJCA 5EU6A 3V52H 1ZLVK 3GMPA 5TE7L 5FYKD 3WN5B 4OKVA 2H2SD 3QFJB 2ADJA 1I9RL 4OF8A 2J5LC 3U1SL 4ODSH 2P5EE 3CIQA 2W92A 4NO3B 4RA0C 2CLZB 3ZDXE 3SDDD 4YPJA 4YJZL 1A2YB 4GSDH 1DQQB 4F7TA 3GKWL 4CW1A 5HGGS 4J3XA 3IDYB 4P4RA 4LSSH 2L7JA 4V1DE 5F7LB 4OZIA 1CGWA 1T03H 3RQ3A 1UENA 3NCFB 3WFEH 4MA1C 4ELKB 1YMMA 5A2JH 5IM7A 4TYUA 2NPLX 4L4VA 3W9EB 4QXUL 4KAQL 5I1DB 4J12A 1CDCA 1G7HB 5IBUG 3BSZL 4FMFA 4UILL 2ZG2A 3MJ8B 1ETZB 4EXKA 2G2RB 1C5DA 5GS2H 1ZANL 2HVKB 4G6JL 3WL9B 3A0OA 4YHYB 4HZAA 1CICD 1OF2B 3TO4D 4O2FB 3SKNB 4M1DH 4RFEA 2ADFL 1AO7B 2CIIB 2A38A 2J7LA 5EZLA 2HT4C 1CFNB 2A73B 5D8JL 2F8VA 4PJHA 1N3NA 1RJLB 2NY6B 5KBNC 3KLDA 1OLLA 3E1F1 3L3OA 1QTYT 4O9HL 2A6DA 3QG6B 1AGEB 1CR9H 4YWGL 2Y07L 2VDQH 5JUEL 1JGDB 5JZ7C 1NLDH 1HQ4B 5HI3C 1S9YB 2AXHA 2PTUA 4Q9QH 4FFWD 4RISL 5T1MB 4LMQE 4NCC2 3JVGA 3ZHKA 1H3PL 2HVJA 4ZDHB 1G7QA 3MRBA 4Y4FA 4BFIA 4P3WA 2GK0A 1L7IH 3K7UA 3MUHL 3VG0H 2Q1EA 4QRPA 1ITCA 2XI9A 4W4NA 2H45A 3BYTA 5JXEA 3UZVB 5FYJU 3TGXA 4Q7DA 3FO0H 1U41A 3HZYA 4HFUL 4NNPH 4OQTH 1CIDA 2Z4QB 5BZWB 5A16A 2V17L 4XC1H 5IFHH 4G7YH 5HYFA 5E2UL 4ZUUB 3RPIB 4QRQB 1AIFB 2AJ3B 4PS4L 4N0RA 2JKXA 2IADB 2QADC 4Z8FL 1LO2H 1BJ1J 4S10A 1SY6H 3M07A 1X5XA 4IBLT 1VB9A 4EUPA 1EGJA 2HKHL 3B4NA 5SWZA 4Z7UE 1TVBA 4NO0B 4YDVB 5D1QD 4KJYA 4Y16D 5E6IB 3SQOL 3BPCB 1EV2E 3EOBA 4X4ME 4XX1G 2X4NB 4NFBA 2VC2H 3SE4A 3VXSA 4FQQA 5IMOA 4LCYA 3DGCR 2W9LA 3E6FB 1JF1B 3MOQA 1WWAX 2VTFA 3BWAB 4JANB 3G04B 1HHHA 3ARBB 5DFVD 1R0AL 4HKXA 2Z92A 3UBXB 4OAWA 4PBVC 1NUFA 4HX1A 5CGTA 3ARSA 1J11A 3V0VA 2X70A 3T0ED 2BVOA 4ELMF 4K9EH 3OX8B 2WV3A 4HHAA 1CXIA 2OL3B 2PN5A 4IIQB 5D7LD 3DVNB 3EUUA 4JQVC 2BSTB 1ED3B 3F62A 3ILQC 3RWCA 4FA8A 3O3DA 3RL1B 3TPUA 4CU6A 2AJXH 1Z3GH 1FCCA 3TVMB 4AJ0A 2IBZX 4DW2H 4KZEH 3GMQA 5D70H 1BMGA 1QLFB 1A7OL 3MYZA 1U8IA 3JWOL 3BYYA 3E8UH 3WE6A 4K3EL 3C5ZB 4P3CH 4XP9H 1KCSL 4B0MM 2O5XH 4C83A 4OT1L 1R5VB 2DQHL 1TDQA 5B39G 3CMOH 2BXZA 5BVJA 5KTEH 2PYFB 4P9HL 3VGAB 2B4CC 3DUUA 4EN3D 3VW3L 4O2EB 1PKQB 3SE8H 4UBDD 5C2BH 1JCKA 3UP1A 1T0NA 4KVNH 1QFWI 5CSGA 5ACZA 2GSIB 1U8LB 4GAJH 5AYQA 4BH7B 2BDNL 4L3CA 3FKUS 1DBAH 1N8ZB 3QDMD 1FQ9C 1Q9KA 5I15L 1S9WB 2Y5EA 3TWCL 3EGSA 1RZ7L 4OLVL 5F70A 2K7PA 4J4PA 1AP2A 1AGFA 4Z7WB 1ZKAA 3QI9A 3MRLB 1XGUA 3JVGC 4I5BA 4CNIB 1I1RA 1AGDB 4Y4FC 2NYYD 2BNUB 4MD4B 1RAMA 5E9DE 5KJRH 5A3ID 3BP5B 1T7ZA 5EPMB 2D2OA 4HKJB 5MERA 5JOFB 1GL4B 4PJHF 4PLJC 1J88A 1YEDA 4DN4H 1BQLH 2EE3A 5JXEC 3HG1E 4UDUA 5D93B 4RIRA 2NCMA 2DQFB 4JQIL 5DQ9B 3HZVA 2A9ML 3IFNL 3WD5H 1A6WL 5DA0B 2DQGL 4Y19D 5CMAA 1KJ2B 1S7RA 2NW2B 1YEGL 4LCWA 4Y5XB 5IROA 5K9KA 4P0DA 1JYXA 2OZ4H 2NY3B 4X0KB 1GHFH 1ZE3C 3FHAA 4M1GL 4ZO7A 1VPOH 1YQ2A 3DJ9A 2HP4A 2Q8BL 3PP3K 3I3BA 2XQBL 4XNXH 2FATH 3CU7A 4KK9C 1X5GA 1OB1A 4CADA 4GMTL 3UBXI 1TPXB 5FA3B 5GGUA 3RVTD 3UMTA 4Y2DA 5EC1B 5EU4B 1ZHKB 3CH1B 3KLHC 3GSQB 4U33A 1IC7L 3D25A 3HI1B 4ZPTB 2OX5A 3SE4C 3VWJB 2FO4A 2WBJD 5D1XC 5DXWA 3V0WH 2D31A 1UWEL 4OZHB 4MNGE 4PG9A 3X14A 3EDJA 3LS5H 1IFHH 4KTDL 4Z7VE 4L5FH 5IJVB 3LIZH 5HHXL 4MJIB 1OGAB 2Y36L 4V2BA 3G6DH 4UV4H 2QR0B 1ZHLA 4R0LB 4ZNCD 3DHJA 2HT2D 3ULSA 4PRHE 3KNBA 4MD5A 3DXAA 4TTDD 3QFJD 3GMLB 3UTZA 3LHPH 5C6TH 1R3HB 2CDFB 4L3AA 4TN9A 3B5TA 5DMKB 4NQTA 4G8GB 1T3FB 2EEAA 3WJLA 2ZKHH 5C0EB 1FGNH 4MD0B 3QDMA 4Z0XA 4FFVC 2VXTH 4RFOH 2WUBH 1RZJH 4IHOA 3GSWA 1FL6B 4X7EC 3TO2A 4FTVE 3MRIA 1A22B 1P7KB 3QFDB 4CVZB 3TT3L 3G6JB 1VFAB 1CGVA 4DZ8B 2ZOLB 1GGIH 3O41B 2H8PB 1EFXA 1JPSL 1T2XA 3QPXL 1KENL 2EDLA 1P7QB 4UAOC 1HH9B 3U36A 1AO7D 3WNMA 4M9OA 1VFMA 3JTSA 1HK6A 4QHMA 4M9PA 5GGRY 2Q6WB 2K1MA 2NY6D 3IFLH 2Z91A 4NRYA 4ODSL 4FXGB 2FBJH 1YJDL 1P1ZB 3MLZH 2XV6B 3O8XB 4QXTA 5DRZA 4W6WB 4J8RB 4P46A 1C1EH 4YE4H 1JHTA 4N5UA 8CGTA 4GSDL 4A6YA 4CJ0A 3F7YB 3VJ6A 3BZFA 4J4PC 1T03L 4WUUB 4WW2B 1ZGLA 3WFEL 4LASH 4PRIA 3SKMA 3QI9C 4AQOA 3KHOA 4M61A 4MSWA 4HWEL 1MLBB 2KKQA 2FDBP 1FPTH 4GAFB 4HWZA 3RNQA 1MHHB 4PJCA 3FO9A 1AHWA 1YQVL 1VSCA 5J12C 4JREC 2J6EA 3PWVA 3NCYP 5GGVY 1HHJA 2WBKA 4M1DL 1KLGB 1MCWW 3H3PH 1Q94B 2QV2A 2WZPD 5K59F 1YY9D 5IROC 1RZKC 1B0WA 4LHUA 1K4DA 2RB8A 2XQYK 1CR9L 4BUHA 1P4BL 3FB8A 2VDQL 4HAFA 5BCAA 1LO0H 4X6DB 3OKOA 2E9IA 4PRBB 3JTTA 4NO0D 4JLRA 4Q9QL 5E6ID 4QYOA 1BFOB 2HFGH 1H0DA 5C0DB 4Y2DC 3VRLE 2DTSA 2XG4A 2CLZA 2D4FA 4MZ2A 1E4WH 4LQ1A 3BMWA 3ARBD 5T3XE 1X7QA 3HB3D 4MCZA 1L7IL 2Z8VC 3VG0L 2P5WA 2XRAH 4P23B 1QEWB 4LRIA 1RMFH 5C1MB 3OXSB 3ILPB 4MNQB 1D5BA 3FO0L 4Y1AB 5J06A 4NNPL 4OQTL 1QBAA 4JFXB 2W60B 4HJGA 1MFEH 3ZKQD 1RSFA 4G6FB 1MCIA 2CDEB 5EO1A 1R5WB 3C2AH 3DMMB 5BRZE 5CJQH 1LNUA 1LO2L 1JWUA 4GRWH 1SY6L 3QWRD 1U9KA 4Q58C 3SKNA 3TVMD 1UG9A 2IH3A 1MWAH 3GMRB 3WJLC 4APQA 4PJ7F 4CDHA 2FWOA 5GRJH 2BSED 2VUYA 5DVOA 4HIJB 2X9XA 2APTA 4UTAL 3C5ZD 3VD9A 4P99A 3CDGA 1JGDA 4FP8H 1J10A 4CMHC 5FAAA 4XZUB 5D5MA 4TULH 1PVHA 2OXGA 4ZDHA 4KI1A 5C07B 3RFZC 3KLAA 3SO5A 4NQCB 3LKPB 3P4LA 3CFKB 3I6GB 1NGXA 1W8OA 4HJJH 2AJXL 1Z3GL 5KN5A 5CEZD 1WFUA 1MHEA 3I75B 3V5HB 5IHZA 3E3QC 4FQ1H 4P46C 1N6VA 1Z0MA 4DW2L 4KZEL 5D70L 2EDEA 4HKZB 3BT2H 1GGCH 1D6VL 3RPIA 3CXDH 3E8UL 4X6CE 1PSKH 5GZOD 1UJTA 4P3CL 4XP9L 4PP1D 1P6FA 1BVZA 2JCCA 2O5XL 2Q3AA 1GRWA 4G80B 1R3JB 5IESH 3KPOB 4NO0A 3PF2A 4PJXB 1ZVSB 3CMOL 4HUMB 3MRCB 3VCLA 5KTEL 3RWHB 5ESQA 5F9DC 1QYGH 1LO5B 2VDLH 3N9GH 3Q6GH 3SE8L 5C2BL 4U1IA 4ZS6D 4U6XB 3U30B 4KVNL 1S7SA 4QLRA 1AKJA 4TNVK 1DBAL 4MXQD 1BJMA 3FQTB 5I17B 3AY4C 5GGSY 2NY3D 3GMNA 3SCMB 1MJUH 5BVPL 5FOBB 4MDIA 4PB0H 1FFOA 3RVWC 3EZJB 4KKBC 5T5NF 3RUGE 4LBEB 3BKMH 3ZE0E 2VDKH 1QHPA 1ZLUH 4W6YB 1ED3A 4DN3L 4XCYB 1F8TH 2HFEA 3T04D 3W39B 3DIFB 2MTPA 1OTTC 4Z5RA 3GUTB 5KSUB 3PIQA 5C08B 3T77A 1PDKA 4ZFOL 2FB4H 3CPLA 1NDMA 3T8XB 1AE6H 3QUXB 3VWJD 4GKNB 1O7SA 1WT5A 5HGHA 3HPJA 5KJRL 3HMWH 4Y4HB 5CKAA 2BRRH 4Z95H 1IGMH 4PJEB 3EDFA 4LRIC 4MJID 1DJSA 1OGAD 4DN4L 4DUXA 1BQLL 1KCKA 4UU9A 4OZ4A 1U58B 4MMXC 3C09B 3HLAB 2DMKA 3QJFA 4G8EA 1GGUA 1XCTA 3CVHH 1H15A 1T22A 4ODHH 5ITFA 4JG0H 2X40A 1V8HA 4LLDA 4Y5VB 1OAYH 5DLMH 4NKMA 1FGVH 2GT9B 1TMCB 3O6KL 3TT1H 3VXTB 3W2DH 1GHFL 3ZDXF 5I71B 3PGCB 5L8KB 2EO9A 3L3KA 4WCYH 1VPOL 4LEOA 3VXRA 5CINH 1U8QA 1J0ZA 2XFXB 4Y2OA 5C86A 3TBSB 4G8GD 3RWEB 2M26A 4YHNB 2ATKB 4APQC 4H25B 1NCBL 4HLZH 5FGSA 3VXME 3MRRA 1HYSC 2IANE 1RZGA 3MFGB 1S9WA 4OV6F 3FB7B 2BY1A 4WJ5A 4QRUB 32C2A 3FT2B 5F9AC 3RTQB 3OJ2C 3UTOA 3V0WL 3H0TA 2YA2A 4OUOA 3LS5L 1IFHL 1I3GL 3FB6B 4L5FL 3QHZL 2ICWJ 3LIZL 4Z7WA 2UZYB 3CDYA 2A6JA 4UV4L 3UJIL 3VXQB 4HFWB 1EAPA 2G9HB 3B9AA 2HFTA 3NIGF 4XP1H 2ZG3A 1P7QD 4S1DD 1G0XA 4GQ9H 1GZQB 2AKRB 1I8IA 2JELH 4HKJA 1GC1H 2EKJA 4QF1B 1P4IH 1T66D 5KS9A 3LHPL 5C6TL 3GO1H 3AUVA 1ZHBB 3O8XD 5CJXA 2R2HB 3NCMA 1BOGB 4MQSB 3HPLB 3BIKA 5E2TH 2ZKHL 3TM6A 1FGNL 4X5XB 4U6TA 1UM4H 2VXTL 3MNWA 5HDLA 4QCIB 1RZJL 5D5MF 2QLVB 1KXTB 3RX8A 5E8NA 3T2OA 4WUUD 3MTRA 4HLZG 2EDXA 2PUQT 4YLQT 4RX4A 5A43C 2ARWA 3KDMB 4P2RA 3RL2B 5I16B 3U2SB 1FAKT 2X1OA 4KRPB 4Q9BA 1P5VA 3IXAA 5E5MB 3VWJA 1GGIL 1PG7H 4PLKC 5MENB 1T7XA 1T04B 1A4JB 5IJVA 4DVBA 5IK3A 1MAKA 4MJIA 2ITCB 4DKEH 3IFLL 5C0RL 2FBJL 3MLZL 5EULV 1V7MH 3V8OA 3OAZH 3IJYB 4YE4L 3F7RA 3QEHB 1EIBA 2MHAA 2R0ZH 3RDTB 1INQB 1ZA6A 1MJJA 4PJDB 1KGCD 4HG4K 1PQZB 4LAQH 1IC5H 1XIWA 2E27L 4LASL 4XPAL 5I8CB 2CXGA 4IRJA 3WKNA 4F7PB 5HGBA 5BXFB 1WT5C 5GS2D 4CVXA 1BPVA 5I1EH 3UPRB 4EOWH 1FPTL 1FSKB 5T3ZD 4P23D 5KZCB 4FTVA 5F7EH 1XGTA 4JY4A 4Y5YB 2NW3A 1EAJA 4PBXA 1CLYH 4MNQD 4Y1AD 5E5RB 2MQ3A 4WIQA 2HJLA 1K8IA 5DJ6B 3H3PL 2X4QB 4MS8D 1VFAA 1RY7B 1A6ZA 4G6FD 3KYOB 4D0BA 4Z7NE 3RY4A 2QHRH 5D7IE 5FO9B 3DMMD 3MYJB 4HMDA 4ODWB 2Z9TA 5I75B 1MUJB 1LO0L 1HH9A 1OSPH 2ZP0T 1TQCC 2XZZA 2O26U 5IHLB 1BECA 2HFGL 2BNQB 1B4RA 3ULUE 2PNDA 4Q6YA 1E4WL 4IS6A 3LS4L 1P84J 1DFBH 3JWOC 2YEZA 3D69B 4NUJA 1RHHA 3O2DH 5KAQF 1RMFL 5J11B 4KJQC 4X6BB 1ZWIB 3G5VB 3N0PB 5F8QC 5C07D 1FV1A 4R96A 2HH0H 1CTOA 2DJUA 2R1XA 3GI8H 5FYKE 4NQCD 1MFEL 3V6FA 3WLWD 1Q1JH 4JFDE 4P9HC 2YA1A 3F12B 4GKZA 5I66B 4QT5B 5MI0C 4LP4A 3C2AL 2OM5A 1CFBA 1RFDH 4UT9H 5HGDA 2AQ2A 1BREA 4JQXA 5CJXC 1F6AB 3B3IA 1YEJH 1K85A 3L3IA 5LCVL 1MWAL 5BQ7A 5L88H 5GRJL 1LD9B 4KUCF 2FGWH 2O5YH 2YRLA 4JPIB 5FCUH 4FP8L 3GMMB 4HXAH 5DVKA 2AEQH 3IU4H 4CL7A 3B83A 5FOJA 4TULL 3ZHDA 4OIIL 5I73C 3RIFK 2OTPA 4NQDB 3AM8A 1A6VH 4OCNC 5FIEA 1Z9OA 4UDTB 5JXAL 3NFNA 3VGFA 2CIKB 4R97B 2AXFB 4P23A 3KPRB 5IBTH 1IT9H 3AREA 4PRAA 4N0FB 2WP3O 4GRWB 3SCMD 1V3MA 3ILPA 2AS5M 4X6FB 4NN5C 2C3VA 2W9EH 4W81A 3VFMA 4OFDA 4FQ1L 1CIUA 2W60A 4OLXH 5TF1H 4BQ6A 1RUKH 3BT2L 1GGCL 2SEBA 3QNXA 3CXDL 4TNVF 3TA3A 2G75A 2FD6H 4P2QB 4J1UA 5C08D 1XIWC 3CX5J 5IW1B 4YGVA 4FXKB 4IRJC 3MNVB 1DTUA 1LWRA 3QUXD 3PV6B 4Z7VF 3K8LA 5IESL 2X42A 5MEQB 4Y4HD 4BSVB 4OLUL 1QYGL 1WISA 3MV8A 5GIRA 1CN4A 1UKTA 4GUPA 2L0DA 2F5BL 5DK2B 4NBXB 2VRAA 1BF2A 3MRPA 1I1FB 1AI1H 1DBJH 5I1CH 4QNPF 1Y6KR 3MUY1 4ETYA 1WAAA 1NDGA 4OQTA 1OWWA 2ZUYA 4PB0L 4Z78A 3R8QA 2FEEI 1JGEB 1IGJA 1CD9B 3BKML 3MV11 3FT3B 3LKPA 1NJ9A 3QA3A 4LARH 4XRCB 5IVZB 1ZK9A 2ADIA 2I27N 4G3YH 3TNNB 1F8TL 4OSUH 5T1KB 1SY6A 5CAYB 2ZSWB 4KH2A 3C5SB 4NQSA 1U3HA 3ET9F 3RTQD 3GDBA 4I2XB 3HMWL 2YWZA 1YEIL 2BRRL 3T0EE 4AH2A 3OTTA 1IGML 2R4RL 1D9KA 2AEIT 4O51B 1T20B 3MLSH 3BW9A 5B39A 5D7LE 4DOHE 1KIQB 2E7BA 4B41A 2UVEA 1QBML 3CVHL 4ODHL 5DHVH 1OP5K 2AGJH 4JG0L 1ZVSA 4JZNB 5DLML 1FGVL 3TT1L 3W2DL 1I8MA 3MXVL 2M2DA 3UYPA 1F3DJ 3C60B 5FKAA 1YNTA 3HMXH 1D5XA 4WCYL 5D1ZA 3U7WH 5GRUL 5CINL 3MRHB 4JQXC 1Q72L 2AJYH 4JB9H 4NWTH 1AGBB 4WI9A 1RPQA 4MJ5B 5IB3B 1YJDC 4H0HB 2Q76A 4LPXA 5HYIA 4I0PA 3RUGA 4YK4C 5SX5K 2H26A 2QBWA 3HAEG 5E7FA 2PETA 4PJBE 2X10A 4LBEA 4X8JB 3VWKA 1MSPA 1FZJB 3OJDA 1FG9C 4XAWH 5F44A 4QTHA 1NH6A 5D71H 1DUYA 5GGSB 3GUTA 3I02B 3Q3GB 4MVBC 4KRPD 4XMPH 3ZE2E 3GMOB 1T5XB 2CKBH 5HHMB 4LU5L 4GKNA 4XP1L 5D9SA 5MEND 4GQ9L 4LAJH 5E03A 2JELL 1IGIH 1GC1L 1KIPB 2C7UA 4ZSOE 1FZMA 3AREC 3C6SB 1FJ1A 1QFWM 3BH9A 3PHQB 5I1LA 2C5DC 3GSNH 5GSVA 3RDTD 1ZEAH 2X44D 1S9VA 1MAJA 3MO1B 3DYPA 1OCWH 1UM4L 2G5BA 3JSSA 3VRLF 2F74A 4QY8B 2HLAB 1R5IB 5IFJA 4U3HA 2FYYB 3TA3C 4RZCA 1X6NA 3QIUB 2XFXA 1U3YA 4YHNA 4POUB 3IS0X 4ZFOA 3HTLX 1H5BB 3GI9H 3AFLA 5DSCB 1ZT7B 5KZCD 1QPPA 4FXLA 4LDOB 1ADQA 3H9HA 2V2XA 2VE6B 3FT2A 4Y19E 1PG7L 4PD4K 1BZ7A 2ENSA 4KMLB 1BZQK 3DX6B 1MAMH 5F88B 1GH7A 1KBGH 2NX5A 3LEYH 5GQBA 1V3KA 2EDBA 4DKEL 1INDL 2HWZH 4X7TB 3BGFB 1V7ML 4HFWA 4PJGA 2R0ZL 4HJ0D 4PRNB 4XGZB 3MRKB 2AKRA 3CDFA 4MA7H 5J89A 2YWYA 3VXOA 4KKCC 1WWCA 4LAQL 4MQ7A 1A9EA 4QTIH 1IC5L 2BNQD 3CZJA 4HLJA 2IF7A 2XPGB 3BZDA 2CH8A 2XTJB 4ENEC 3X3GH 1ZHNA 4OZGB 5CP3H 1U3HC 3G5YB 1TVHA 4X6EA 5I1EL 4EOWL 1M1SA 4HGWB 4KK6C 1MI5B 2P8PA 1D9KC 5F7EL 1CLYL 2A77H 2XKNB 1N64H 1OGTA 4AG4L 1CU4H 1WK0A 4NRZA 3L5WA 1ONQA 1CE1H 2CRMA 1FAIL 2WIIB 5GS0C 3GSRA 2QHRL 3F7PC 3SPVA 2YPLA 1YY8A 4LVHC 4F15C 4RGNC 4MA3B 5D1ZC 1CI5A 43C9B 5I1AA 5D2NA 3GM8A 1KNOA 4JPWH 5IOPB 3QUMH 3FQWB 1WBXB 3X12B 3LSOA 2QSTA 4X6CF 1KJ3H 1CVRA 1UQSB 2V9RA 3GSOB 2H6PB 5J8OA 5ICXB 1HZHH 4LCCA 3X3FH 4I0PC 4ACPA 1Z6JT 2XYCA 2A1WH 1WIPA 3GBMH 3VWKC 1QKZH 4XNZC 3PUCA 3O2DL 1PQZA 4WHCA 3U83A 4NQDD 1KEMH 4BQCA 3ARDB 4WEMB 2B5IB 2GQHA 1AO7E 2HH0L 3GI8L 3BZEA 1NBVH 1Q1JL 4XNQA 4M7JH 1BVLB 3KPRD 1MFNA 2PCPB 4U7SA 3RJDA 1BEYH 5DWUL 4NHUA 1J0HA 1EZVY 3ROLB 3ZE0F 4UT9L 3RUGF 2YZ8A 2BC4B 1MQ8A 1JPGB 1YEJL 1DN0B 5I6XC 1BJ1H 2DQCH 2UWEA 5TE6H 4J3VA 1A6TB 5L88L 2ARJA 4P2QD 3A6CL 2FGWL 2O5YL 5FCUL 2GUOB 4AMKH 1DQDH 1MVUA 2NXYB 1LEKA 4ERSH 1FNAA 3HNSH 4LLUA 4HXAL 2AEQL 3IU4L 2D7NA 1D6EB 5E7BA 4JY6A 4NQVA 1KIRA 1A6VL 3V5DA 1KTDA 4Z76B 2F8XC 4K7PX 3FN0H 4IMKA 5JHLH 5GGRA 2R9HD 3MCG1 1IT9L 2F54B 5D72H 4MHHG 3QCUL 3VXPA 1ZWIA 3FFDA 2OMNA 1HKLH 3PDOA 4WGWB 1EH9A 4OLXL 3GJEB 1URLA 4TOYH 5TF1L 1QRNA 1Y18B 4M7ZB 5F6HI 4F15B 4JRYE 2MWCA 3RVXC 2FD6L 5T1KD 4QRTB 4NN6C 4JZOA 3GNMH 2V7NB 2EDFA 4XB8A 3N1MC 5DRXA 1CWVA 1SJVA 4MJ6A 3SDAA 1F11B 3F7VA 5SV3A 3ARFA 2VLRA 1WBYB 3QXDA 3L5XH 1DBBH 1RJZB 1MFDH 3GMMA 1SYVA 3KLSA 1AI1L 3U82B 1DBJL 1CQYA 4U1NA 5I1CL 1Z9MA 1T7VA 2XN9B 1TJHL 4JJ5A 4ORZC 5EOCJ 5HPMB 4KFZC 1KFAH 3C60D 1FBIH 3WCYA 5DUBA 3PQYA 4X4YB 1FC1A 2RAMA 1VFBB 5D2NC 4HK0B 1GXEA 4LARL 2QQQA 4G3YL 1A1NA 1F13A 3KPNB 4OSUL 1PJ9A 2VH5H 2FX8H 4AIOA 4U7KA 4LCCC 1MWAA 4JHWH 5K9QI 2VZVA 4OIAA 5L2KA 3EJYD 3K1KC 5EZJB 1DP0A 5TF0A 3P9LB 3MRDB 4HK3N 1XGRA 4GKSB 3WDHA 1PKQE 4PJIB 3MLSL 3MROB 2CGRH 2V9QA 2H1PH 4FXKA 1UH4A 5HHMD 3PV6A 4Z7QE 4JFHD 2HG5B 3IDNA 4K07A 1UZ8A 2AGJL 1A7QH 5JORA 2FX7H 1FSKC 5CEZE 1F4XH 5BOZG 4ZOBA 3HMXL 4EI6B 3U7WL 1UWXK 3KPLA 1WBZA 1HI6B 5E56A 2OMBA 1SMOA 2AJYL 4JB9L 4RWYH 4NWTL 2WQRA 3QUZB 4YDLC 1UGNA 1JNNH 3SKOA 2D7MA 3MRMA 5ECJE 3T4YB 1VACB 4LGSB 1U8KB 4JM2A 4C54A 4OD2B 2UY6A 4M6MH 3VGGA 3QIUD 4GAYA 3DETD 2ZUQB 2DL2A 5EBWB 1RZIA 1IZJA 3VFSB 2BSSA 3ULUC 5D71L 5HYQB 4XMPL 5FYJH 4MAYB 1WC7A 5T1KA 3WJJA 1UC6A 5DD6A 2CKBL