3SDYH

Crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
224
structure length
221
Chain Sequence
EVQLQQSGAEVKTPGASVKVSCKASGYTFTSFGVSWIRQAPGQGLEWIGWISAYNGDTYYAQKFQARVTMTTDTSTTTAYMEMRSLRSDDTAVYYCAREPPLFYSSWSLDNWGQGTLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1 chain
publication title A highly conserved neutralizing epitope on group 2 influenza A viruses.
pubmed doi rcsb
source organism Influenza a virus
total genus 37
structure length 221
sequence length 224
ec nomenclature
pdb deposition date 2011-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdyH01
1IE5A 4DKEH 1KEML 2B0SH 1AD9A 5DXWA 2HRPL 4WGVB 2DDQL 3B3IA 3RDTA 4P3DA 3RWGB 2AABL 3KXFA 2Z35A 1JK8A 2BNQB 2YK1H 1R3JB 3D69B 4AQOA 4FTVA 1Q9LA 1VCAA 3G6JE 1RU9L 2DIJA 2VZOA 4G7VL 2H26B 4IBLT 5DYOA 1OW0C 1MFNA 3QI9A 4X5XB 1RJZA 5C0CB 1RJCA 2EECA 4DAGH 3QQ3B 4O2EA 4JHAL 3C2AH 3RJDA 4E42A 5AD0B 2EE9A 1BEYL 3FO2B 1K2DA 4HUMB 3QO0A 1S7TB 2ADIA 4FQCL 4GMTH 5GS1B 1TITA 2H3NA 4RA0C 2NW2A 1FNFA 5IESH 3N9GL 3K8LA 4PB9H 1ITBB 2DWDB 5SV4A 2V2TA 3PGDB 2PR4H 3OB0K 4ZXBD 2NY4C 5E8EA 4PJCF 3FQXA 4RMWA 5MENE 1Y6MR 3PDDA 3ALXA 5DLML 4X4XA 1AD9B 2N1KA 3HPLB 1EO8H 3ZLQC 3RDTB 1MOEA 4P3DB 1DZBA 2Z35B 3T2PA 4PY7A 3C09C 2X2YA 1LO0H 2NTFB 3IFLL 1C7SA 3ZDYF 5D93B 5DC0A 5DYOB 43CAB 1F4AA 2CQVA 3QI9B 4NQCA 1RJZB 4ZQKA 5TQ2H 1CF8L 1E28A 3FO0L 1WWAX 1KPUA 3Q6GH 4E42B 3I6KA 1B4JH 3MRCA 1U6AH 2VH5L 4LHUG 5EO9A 1AC0A 4FZ8L 3QO0B 4AY0A 2GQHA 2ADIB 4CJ1A 5HHME 5F7UA 1ORQA 5F93C 4ZOCA 1QSFE 4P9HC 1OY3B 2X41A 1M6OA 1MWAH 1WFUA 1ES0A 2L7JA 2H3NB 2NW2B 4MGXA 4YBHA 5F72S 5F9DC 1S8DA 2VXUH 4MA7H 1AR1C 4FQJH 3C5JA 4I0KA 4LLUA 2V2TB 4ETQA 4G7YH 2HG5A 3P4LA 4OD1L 5E8EB 1NUFA 3FQXB 3AREC 4P9HH 1VA9A 3HUJE 1I7TA 4P5TD 3VFMA 4X4XB 5IMLA 4PGBA 3HKFA 2P5WA 3JUZA 4UIKH 4G8GA 3P11L 2J88L 3SJVE 4NNPL 2ITDB 4PY7B 5C0AD 3LKRA 2VNCA 5I9QC 1HHGA 3E2HC 5IHLB 2LAGB 2X1XR 3RFZC 3M07A 1ZXQA 1RUAL 3ZHLA 3QJFA 3ZYIA 4ZQKB 4YXLH 1E28B 3OPZH 4LAJH 4IJ3B 4K55A 1KPUB 3RWIA 2W0KA 5JHDE 1CS6A 2HKFH 3MRCB 4Y4KC 1GL4B 2H1PL 1ORQB 3P9LB 1U42A 4FQXA 2EIZA 3WFCH 3QIUC 4JKLA 1MHPL 1ES0B 1NBQA 3DIFA 3BMVA 4N5ED 2VLRE 5I30H 4OLZL 3ULUD 3I50H 1S8DB 1PY9A 3GJFK 2P4AB 3GHBH 1JZ2A 2V9RA 3ARGA 4LLUB 3C5JB 3GIZH 4ETQB 1JTOA 3BZ4A 2DQJH 3MLRL 2HG5B 3CXDL 2XZCH 1S9KC 4KY1L 1HYSD 1I7TB 3VFMB 3ARDC 3IFNH 5IMLB 4JFPA 4PGBB 2P5WB 1CL7H 1IGCH 5ENWA 3NTCL 4G8GB 2H32A 1JI2A 1O7VA 5FA4A 3D39E 2MCPL 1GYAA 3H0TA 2NY3B 2Y7QB 3LKRB 1HHGB 4ZPVA 5B8CB 3D0LA 3CLEL 4WCYL 3BWUC 5A1AA 1B3JA 5I1IL 1BWWA 3QJFB 4Z7NF 4UQ3A 4F3FB 1Q9WA 4DN4L 4YHKL 4RBPH 4DVRL 3B4NA 4YZFF 3MJ6A 3EOBA 1CDCA 1DVFC 2UV3A 3LKSA 3PL6C 4FQXB 5BRZD 3D2UD 1A4KB 4RX4A 2J6EA 4V1DD 1K8IA 1HWHB 1XGUA 1T5WA 4R4FL 4LFHG 3L3HB 1CD9B 3VXSA 2BXYA 1F45A 4Y0GA 3ARGB 2A74A 5J3HD 3GMNA 1BQHG 1KJ3H 1E4WH 1YJDL 3BZ4B 1M71A 1O7SA 2UY7A 4PJAF 3KHOA 5IFHH 4Z76A 4H25A 3JWDC 3LEYH 4Q9BA 1RZIA 5H8DA 2C1PA 1Y0LA 4JFPB 3FZUC 5D1ZD 5CEYA 5FA4B 3AFLA 1TVDA 2A9NH 2BVUA 5E6ID 4XVJL 4RGOH 4WWKC 1PZ5A 3H0TB 4ZPVB 1AGDA 3S4SG 3JWDH 2CKBH 4G43A 4TNWK 4WI8A 3V2AR 4L4TA 4PTTB 4HWNA 1DBKH 4AIXA 1QP1A 1Q9WB 4AEHH 3EDKA 3INUL 4OLYL 5FYJU 4KRNA 3F7RA 3EOBB 5KSVA 2YS4A 3BXNA 2X4OA 3LKSB 5BV7L 4KROB 3H3PL 4XMLH 3UXFA 4C4KO 4XBEH 1K8IB 1X6LA 1XGUB 2VXQL 1OTUC 3G04A 3CXHK 1WSST 3VXSB 1VPOL 3KPRD 3QG7H 4XNUL 4WY7H 5E8OA 1H15B 2PYFA 4XI5D 4D2NA 3BAEH 4H25B 4XVTH 2VQTA 3W82A 4U05A 5C0IA 2YPLB 2HWZL 1RZIB 4POZC 3LQZB 1PW3A 2C1PB 1Y0LB 3OV6A 5GGTL 5I74C 1J11A 3SDCC 2GHWB 2EE6A 3GI8L 5IJVA 4MNQD 5C6TL 3QWRD 2BJMH 5C0EA 1KSRA 1PZ5B 3FONB 5DO2C 5EO0A 4YWGL 1DL7L 3C8DA 5TE7H 4Q0XL 1E0OB 3DARA 3A0OA 1JPSL 4HDIA 3HS0A 1CFSA 4G43B 5SV3A 4L4TB 1GGUA 3QIWA 3ULVL 1KCLA 3TCXA 2ED8A 1I8IA 3TZVC 3BXNB 5DEZA 2X1PA 4PJ5E 4JO4H 2X4OB 4XCYA 1UWGH 4PRAB 3L5JA 3PWPE 1NFDA 5GQBA 3B8SA 1IC4L 2XNAB 3G04B 3HG1D 3U9UA 1TJGL 2R8SL 4AL8L 5DC9B 5E8OB 2PYFB 5CZVH 4XMPH 4TOYH 2GSIA 4P2OA 3C2SA 4FFVD 4HT1H 1OSPH 3VXTA 4B53A 1RZGB 1FC2D 1EVUA 2IBZY 1OCWH 3KLSA 3DNKA 4LSDA 1GH7A 2EDEA 3F58L 3UTPD 5CHNA 3V5DA 1ONQA 4YE4L 5IJVB 5JIIA 25C8H 1UCBH 2VN7A 5C0EB 2AJUH 2HH0H 3G9AB 3PV7A 2Z31C 3WJJC 1RZKC 5EO0B 1OAYL 1XGRA 5CJQH 2WM0A 3MZGB 3BDBA 4HDIB 3QNXA 1RUPL 2FX7H 3HAEA 2CRYA 3GHEH 4PJDF 3QIWB 4L1HA 4UINH 4ENED 1F4XL 1MFDL 4LVHB 4KTDL 1U8NA 2QSQA 1OAZL 5FUZL 5ISZE 3QUMH 4W4OC 2P1YA 1NFKA 1X9QA 4XCYB 2V17H 3EJYD 5CINL 1NFDB 2ORBH 4J3OC 3A6CL 4NKQB 1J5OH 4HGMA 32C2A 3U9UB 1FE8H 4LDEB 3S98A 3BYTA 4GFTB 1GC1L 2HT3C 3U9PL 4XMKH 2HMIC 1C12A 2GSIB 4P2OB 3QEQD 3B6SB 5DJCB 3HMWH 4M6NL 3VXTB 5JDJA 4NQTA 5CHNB 5EORL 4YHYC 2KKQA 2BY2A 2IPTL 5MP6H 4NWUL 3VE0A 4J6RH 1F3DJ 4F8QA 4BZ2L 1QNZH 4LIQH 4P23D 2YPVL 5A43C 5HVHB 3FT3A 2ZCHH 1LEKA 1F2QA 2IMMA 3QDMB 4ALAL 2ZPKL 3QNXB 1QLFB 3BDXA 4LSUH 2NCMA 3HAEB 4Y4HA 4QHMA 5C92A 5E2VH 1UEYA 2VR5A 4HEME 2FGWH 4MB4A 4R96A 1OARL 2BDNL 3FMGL 1N6QH 4BH7A 1U8NB 4XPTL 4UUJA 5DHYB 3TH2T 1IKNC 1CDIA 2BHZA 3IDIB 3DX9B 1R3LB 2PCPA 3VXUA 2V7NB 1Q0XL 4KJWC 4OZHE 3BT2H 1KLUA 1FZOA 32C2B 5LQBL 1BZ9A 1ZGLB 4FFZH 5DK2A 3B9EA 5HXMA 2VABA 4AH2A 2UUDH 2FWOB 3G5VB 1CXEA 4YUEH 1C12B 4J4PC 1CXHA 4ZXBC 2XZAH 1FO0A 1AHWC 5H37H 2DJ4A 5D5MA 2EDQA 3VE0B 5DMIH 3GZKA 1GOFA 4ZUWA 1LEKB 5FO8A 3IXTA 4WI6A 3D3VD 3GKZA 3TV3H 3PIQA 5SWSD 4HLZG 1VB9A 3VFNB 1U36A 4Y2DD 5EU6E 2DM7A 5JO5B 1ORSA 4HKBA 5BOZG 4R96B 4BH7B 4UAOB 5CD5D 5EZLA 4UUJB 5I1CH 3L5XL 2HKHL 1UH2A 4TVPL 4WFHD 3GI9L 3U48A 4OZFH 2PCPB 2D0GA 4JRYA 1KLUB 3TT3H 1FZOB 4XWOD 2BOBA 4K23L 4TVSa 1BZ9B 3TNMA 4DJMA 4NWTH 4RSVA 4AH2B 2BSRA 3MJ9H 2NY0D 2CDGA 1QO3A 1KEGH 2HJLB 3WUWG 5JQ6H 3VG9C 2VLMD 3U36B 4DKDC 4OBSA 5GRUL 5D5MB 1HHJA 3MLZH 1T66D 4IMKA 4ZUWB 4ZFGH 1U8HA 3LDBC 2VLLA 4OFYD 5FO8B 3X11B 3ZT6A 3KLAA 3CFCL 3PIQB 3QIBA 4YO0B 4EEEA 3LN5B 1OAKL 5JXED 1UB5B 5ACZA 1DR9A 5KG9B 3JSSA 4LCIL 2VL5A 3U1SL 4PJEA 2NX5D 2DYPB 2PXYB 3F6LA 1FYTA 4KV5F 3MRGA 5I1DB 2F9BT 5B21A 1OAXH 4ONFH 1P9MA 4KXZH 4OZGF 1J8HE 4E41E 4LK4A 4JRYB 5K33A 1YYLL 1AQKH 5DK0A 4NRYB 1YEKH 5IBLC 4U1LB 2YD8A 1UC6A 5CP3A 5D72H 4ZUUA 1BAFH 2CDGB 1LP9A 2EDJA 4X7FC 3DROA 3RKPA 4WEUD 1OP5H 1FGNL 4MZ2A 2P44B 4JHWL 2PYEB 1KB5A 1WVZA 4POUB 1MY7A 5FXCH 2ICWA 1HHJB 3MV8B 5KTEH 3K2MC 2YPKB 1T7VA 3ULUH 1WAAF 2NMSA 4NZJA 4ELME 2P49B 3NAAH 3SDDB 5DD0L 2VLLB 4AEFA 4GBXD 3EOYG 3DHMA 5ACZB 2AJVL 4ZS7H 4I3RH 5D1XB 1YECL 1DLHA 2VL5B 4R4BA 5FCUL 1UXSB 3BFOA 1FYTB 1QRKA 1LK3H 3L5WA 4NKIL 4HJJL 5L88H 5F7HA 2OR7A 5GS3A 3RP1A 3FFCA 4CN1A 5T1MA 1F02I 3MLSH 4MJ6A 5GZOC 5DJ8A 4ZUUB 4OLEA 4GKNA 1TETL 5J3HC 1B0GB 3KYOA 3VXPA 2CRIA 3RWFB 3L9RA 3NIDF 4Q6YA 1KB5B 3X3FH 5CKGA 2E7HA 4R3SA 2ICWB 5D7JD 3IVKB 3V6OA 1I1FB 1AI1L 2XQBL 2XTJD 1QTYT 3IAQA 4FQPA 2QADB 3U6RA 2Z8RA 3IRZA 1VKXA 5TF1L 3SGEI 1WZ1H 4LP4A 4PY8I 2DMBA 4LLWA 1I7ZA 5JNYA 5DURD 1DLHB 4XCCH 3QXDA 4R4BB 1U3HC 5SWSE 3SPVA 4PJIB 1IL1B 3MACL 3L5WB 4P9MH 3V5KA 2CK0H 3VFVA 1MCPL 4EUPH 3B83A 1MEXH 1WCQA 1YC7A 4NJ9H 3FFCB 5T1MB 1Z3GH 3KS0H 1T2JA 4O5LL 5KVMC 1MLBA 1MCWM 1WZKA 1HXMB 4MXQD 5DFWH 3RTQA 1N0XH 4D9LH 4J3VA 4GKNB 2MWCA 3VXPB 3KYOB 1YEFH 1WC7A 4XI5C 3VWKA 4N8CL 2R56L 4DGIH 2PETA 4PRHE 4OD1H 4R3SB 2GSGA 4PLJD 3V5HA 1A8JH 5EU4A 3U6RB 3KJ6H 4NNPH 1VKXB 1VGEL 4L3EE 1LMKA 4L8BA 4LLWB 1I7ZB 3X3GH 5JNYB 3ARSA 2BNRD 3QXDB 5D71H 3SPVB 4DEPB 5MEPA 4LDLB 1MCFA 2EC9U 1MFBH 2EDYA 2R0LL 1I1AD 4KQ3H 3V5KB 2JJWA 3VFVB 1AXTL 4MAYB 4YC2C 4I9WE 1AY1L 3FT4A 1P7HL 2O61A 5F9OH 4NT6A 3UBXI 2ID5A 1A6WL 2NY1D 1NLBL 3MOBH 1MLBB 1GXEA 4NQDE 4RZCA 2NY7L 1S7RA 1SEBB 2MSPA 3MV7E 1TDQA 1MIEH 1AE6L 3VWKB 4IRSD 1KTDA 1GHFL 1DDHA 4QHKI 1U3YA 2QSTA 1FGVL 2EH7L 5LXGH 1AP2A 1CYGA 3PGCB 3MA7A 4ODTL 3UTSE 1OQXA 1IM9A 4GG6A 4HWEL 3T77A 1Y18A 4DKAA 2DMCA 2WBJA 5J89A 4F33A 4TPRL 4JZNA 5IHUH 2GSGB 1I85C 2FGZA 5EU4B 4NN7C 1BFVL 4F7EA 2OJEA 1U8QB 3OKMA 4X6CF 5I1HL 3BEWA 2C7UA 4GUPA 3SDAD 4K7PX 1KTRL 5MEPB 2WLZA 3FN0H 1CBVL 4CJ0A 2C1OB 1BOGA 5C0JA 5EU7E 4GAGH 4DVRH 4KKNA 5JMOC 1BIIB 3WO4C 3MV11 3FT4B 4MD0A 3MFGB 3LV3A 2O61B 2J4WL 1LO3L 4LHUA 3N06B 3FOLA 4ODHL 4U0RB 2VQ1A 1S7RB 5IHBA 3VFTA 3TA3C 4OLUH 1KTDB 2HJKA 4D0BB 3P4NA 3N85L 1K6QH 3MA7B 2KQNA 1IM9B 4GG6B 1YEGL 3T77B 1YC8A 2ZUSA 1Y18B 2CSPA 2WBJB 2ZZUT 1OSZA 4XP5H 2Q87A 4GKSB 1QOKA 2E6PA 3EO1B 4JZNB 4MXWH 4Y5XC 3LSOB 4F7EB 4CU8A 5ITBL 5C08D 2HTLD 1T03L 3P77B 4ZAKC 3S6CA 4YGVA 3MJ7A 5BV7C 3MZTA 3F7YA 2C7UB 4DGYH 1R5IA 4GUPB 4GT7A 1T7XA 3TN0D 1H3UA 3T0BA 4O02L 1MAKA 1JPST 3MXWL 1EIBA 3O4LD 2WBKA 3H7BA 1BOGB 3QEUA 5C0JB 4HSQA 5M7QA 1BVZA 3G08B 4LVEA 4WUUD 1VENA 2VDLH 3LV3B 4NCDA 4RGND 4KMTL 2GJ6B 3V52L 3BH8B 1GZPA 5E5UB 2Q7NA 1HHIA 4NHCH 5HDOA 4IOFD 3FOLB 4JY5H 4YK4C 5C0NC 4U1HB 3DXAD 1CD1A 3GBNL 3QYCA 3VFTB 4G6KL 5C07D 1VPOH 1XGQA 4GG8A 3D1MC 3CVIH 2HJKB 3P4NB 5D2NC 4XHJD 4QXUH 4PRIE 4F7CA 5I1GH 2KZ1B 1ZLSL 1OSZB 1CG9B 1F3JA 1OP3K 4C83A 5IW1A 4KKBC 4Y7MA 2AXHA 2X4TA 4MX7B 4D94A 5E9DE 4HK3J 3G9VA 2P5EB 5F7EH 4YGVB 4DCQA 1MPAH 4K8RC 1JYWA 3F7YB 1R5IB 1PQZB 3O6KH 3QHFL 4TYUA 3LZFL 3FKUS 3QEUB 4JQXC 1X6NA 3QCVL 2Z8VC 1S3KL 1H3PH 4RIRA 1CTOA 4K3JH 2B2XL 1GZPB 4K8RH 3IT8D 4WJ5A 1MFCL 3A6BH 2FATL 5EIQA 4XVUC 1ZGLP 2YRPA 4DN3L 4YEFA 1XGQB 3F12A 5CIPH 4EI5C 3BKYL 1YYML 4ZNEE 4ZOEA 3ZYZA 1LHZA 4HK3N 2EE2A 5C0BB 5E08H 4PIRF 1JPTL 3QNYA 4WIQA 1JGLH 1NAMH 4F7CB 5CSGA 4NN6B 1F3JB 2YD5A 1MNUH 4NZRH 4C83B 5IW1B 3S97C 5D2LE 3JV4A 2X4TB 1N8ZB 2AEPL 4DGVL 4E9LA 1G9NL 2OZ4A 4DCQB 2APTA 4G6FD 3I6LD 5EB9A 3BPNB 3MRPA 1XIWA 5HGBA 5JXEC 4LU5L 1M7DB 3MREA 3BPCA 5F9WB 3IJHB 4XZUA 5GJTL 4Z7OE 3S4SA 5I1EL 3KPSD 3S34L 5FM5M 4RIRB 2F19H 4QXGL 2XXMB 1OAZH 1NUDA 1OM3L 1L6XA 2JKXA 4WJ5B 5I71B 5SX4H 3VRLF 2K3TA 5D7LD 4BSVB 4XCEA 5IF0A 3EDEA 3TWCL 1DBML 4FA8A 1NCCH 3V8CA 3F12B 1BGXL 4ELKB 4HX1A 1WK0A 2XN9A 3U9PH 1F4WH 4GJTB 4A6YL 1ZLVK 4JM4L 1EV2E 4R4ND 3QNYB 2WINA 3I84A 4QRRA 1BQHB 5EULV 1WT5C 2GKIA 1S7QA 3P0VH 3S35X 2FBOJ 1R3IH 1YNTA 3L3JB 5AYUL 5IHZA 1YMME 2ZOKB 3EKCA 4H20L 1RK1B 4E0RA 4F37F 4OZIA 1RULH 3PP3H 4OSUL 5I76A 1L9NA 3MRPB 2YD4A 1XIWB 1BQLL 5HGBB 1IQWH 2ZPKH 4U49A 4S0TD 5HHPB 4QHLA 4XZUB 4KI1A 3V6FA 4TNWF 3S4SB 5HPMB 2E9JA 1WJ3A 3NFSL 1Z2KA 4MD5A 4NQED 4OLVH 2H6PA 3TYGH 5CSZA 3WD5H 1ZV5A 3K8MA 5GGVH 5J9PA 4Y5VC 4YXKL 4KVNL 2AJZA 2VWEC 4X99A 5CJBA 2CR6A 5IF0B 1AGFA 2ZJSH 5C09E 1MJ8L 5IVXA 3BO8A 2NXYD 4LLMB 4HX1B 4WTXA 3DXAE 3RUGE 1G6RA 1KGCD 4GRWB 5I8KL 1F4YH 3EJJX 2WINB 3FQUA 1VFUA 2XQYK 1F11A 4QRRB 1H5BC 1Z9OA 5EZOH 2XV6B 1PSKH 3SKUD 2AJXH 4JFDE 1CL7I 3SCMD 3O3BA 3BPLB 4L29A 3CMOH 3DMMB 1EK3A 1NMAL 2DL9A 2B1HL 3AAZB 3F8UB 1YNTB 4G6JH 1NCBL 1E27A 1FFPA 4CMHC 5IHZB 3RZWA 1SQ2N 2XKUA 2NYYD 1QSEA 4E0RB 4OZIB 2N7AA 5I76B 4TUOA 4AK1A 3GSNL 4NJAL 3UTTA 4O9HL 1YPZE 2EDLA 5L7XH 4HKXA 4N68A 4QHLB 4ZD3H 3V6FB 1JNLL 1HIMH 1PYWA 3GBLA 4NZTH 4MD5B 5DDHA 3ARDA 3BH9A 1CLZL 4K3DL 4W81A 2H6PB 2HKHH 3M8OL 2YOCA 5CSZB 4JG0L 2UWEE 4MLIA 4BH8B 5IMMA 5IP4A 4X99B 3RIFK 5TDNA 2ZUUA 3K1KC 2X4PA 1AGFB 2YN5A 5DMKA 1CU4H 4MAUL 5IVXB 1CQYA 4UILH 1G6RB 3BRDA 5C3LD 3RKDD 3JTTA 4X6DE 3RQ3A 1NDGB 1PDKA 5I1KL 3FQUB 3JXAA 4J3WA 1F11B 1UJ3A 2YXMA 5GRUH 1TTGA 1DANU 3QT2A 3QRFM 1G1YA 3O3BB 3BZFA 3WXVH 4PLJC 1E27B 1FFPB 4OFVA 4X9IA 5ANMA 2VDKH 4FQ2H 1ED3A 4M1DL 3PF2A 5GHWH 4TUJA 4Z7WE 1QRNB 4TUOB 1FN4A 1X5JA 1RZ8A 3UTTB 1SYSA 4PJ8A 2VZUA 3P40A 5HJ3B 3S8WA 2VL4A 4S0SD 4XAWH 4HKXB 1YUHA 5LGJA 1QLEH 3IDJA 5FGRA 3LOWA 1PYWB 4YQXL 1U8OB 2D4FA 3TO2B 1I1AC 2X5PA 2EC8A 5DDHB 4IEFB 3WNKA 4QHUA 4JPVL 4MA8L 3LS4L 4APQD 5IMMB 2JB6B 3HE7D 3MYZA 5TDNB 1F58H 3G6JA 1U3ZA 4HIHA 2X4PB 3HZVA 3KPPA 1INEH 3DWTA 4OB5H 2K7QA 1H0DA 3IDYC 4PTUA 4IRSC 2Q76B 3FCTB 2B1AH 3JTTB 1TZGL 4UOW0 3MC0A 4HV8B 1SJEA 1A3RH 3QEGL 4OM0L 1FGNH 1UJ3B 1L6ZA 2B8OT 3MRJB 3WFEH 4FQLH 1P69B 1N7ML 4PBWD 4LGPB 3BZFB 4ZO6A 3HC4H 1EEYA 5DWUL 5ANMB 4MMXC 2MQ0A 3QQ9D 4TUJB 4DVBB 4N90D 3SDYH 1FN4B 2QKIA 3UJJL 1RZ8B 1HHKB 3PUCA 4ZFOA 1SYSB 3OKDA 4PJ8B 4YHOH 4F7PA 4RQQA 3SDAC 4XNMA 1YUHB 4M6OL 1MCEA 5HYEA 5LGJB 4D0CA 3IDJB 3OKKA 5TDPA 2EZ0C 5FCUH 4P4RB 1CICC 4B7LA 5LWYL 1I3RA 4HS8L 1RZ7L 4M48H 4QHUB 5D7IF 3RGVB 4DUXA 2GEEA 4OD3L 4N0CC 2EDKA 4P2QA 4S10A 3WIHH 3K80A 1RJYA 2QSVA 3DGCR 3G6JB 4NM4L 5E2TL 4HIHB 2PO6D 4NRXA 4XCNA 2I07A 5HHNA 3UDWA 3HZVB 3KPPB 1HQ4A 4LPWA 5A2KH 1OVZA 4JKWA 4PTUB 1SJEB 3H3BC 3QDGA 3QUXC 3T0DA 3FQNA 4L5FL 2IGFL 3AY4C 4XTRD 2FJFA 1QSFA 2CH8A 1A4JA 5FHAL 1WZLA 2DQTH 2IAMD 4I0PD 4X7DC 5C8JA 4PJXF 1EEYB 3CX5J 3T04D 3WUWA 1EO5A 5EC2A 2FEDC 3EIFA 4P46A 3HPJA 2GI7A 3EYUH 1NBVL 2JCCF 5KS9F 2QKIB 5IB4B 3B9KA 4ZFOB 3ARBA 3C5SB 3OKDB 4UDUA 4F7PB 4RQQB 5LCVL 5SWQA 4XNMB 2Y07H 3TN0C 3HUJA 5MENB 1WBXA 2DLFL 4XT1C 4D0CB 4K2UL 4M7ZB 4I77L 5TDPB 3SOBL 5A2IH 2HFEA 2O5XH 3VXOA 3T2QA 2EKSA 1I3RB 5EN2B 5E00A 2Q7YA 2PW1A 3ZKXC 4RGNC 2YUVA 4U1IB 1SY6A 1QBML 1RJYB 4O4YH 1ODAA 2LQRA 4XCNB 5AG9A 1R0AL 2I07B 3GMLA 5HHNB 1H8OA 4O5LH 1HQ4B 1NCWL 4U1JA 3IDGA 5E2JA 3LPGA 4PJ7F 1AJ7L 2C3VB 2DQUH 4BUGA 3AGVA 3GKWH 3FQNB 5ILTH 5HHMB 3LKPB 2FJFB 4TSBH 1QSFB 2R2CA 4XGZA 1A4JB 5C8JB 3WUWB 4XP6L 5EC2B 2ZG1A 1UG9A 4P46B 3IDMA 5E8PB 3REVA 3HPJB 3FL7A 3GJEB 1T6WA 2I9LA 3C5ZD 3F65A 4F57L 1T2QH 2J8HA 4OIIH 3ARBB 3MV9A 4UDUB 4HPOH 5SWQB 4LSQL 3QCTL 1KCRL 3HUJB 1WBXB 5HY9A 2HFEB 3VXOB 2KQMA 2EKSB 4M9PA 4CGTA 4OGZA 2UZXB 4NOFA 4HMEA 3SJVB 2Q7YB 3L7EB 3D39A 2PW1B 1AXTH 1IGIH 1WWBX 2E9WA 3KPTA 3MJ8A 4KRPC 3GMLB 3JUYA 4U1JB 4XP9H 3IDGB 4RCAA 4NN5C 2GW5A 1FGVH 5CGYC 4R6UA 4XGZB 4KHTH 4JFFE 5T1DH 5J13C 2Z91A 1KG0B 5J7CC 4HUXA 3Q0HA 3REVB 1GAFL 1FLRL 1XR9A 5FFLA 2I9LB 4NKDA 4JE4B 4CN4A 3VD9A 5B39G 2C3WA 3MV9B 3NIGE 1FG2A 3WEXA 2YUXA 4RMQA 5HY9B 2BX5A 4HAFA 1S5IH 4QCIB 5HHQA 4U4BA 4H1LG 1NLDL 3T3MF 4L4VE 3D39B 4ORGA 5A40E 4NYLA 1J0ZA 1RMFL 1IAOB 3P73A 3MJ8B 4NP4L 5T3XD 5FEBA 1QBAA 5C0CD 4CUCA 3UPRB 2O5ZH 5ALBL 3QXAB 1WGOA 4XC1H 1P84J 4PJCE 2HLFC 2B20A 3MBXL 4BYHA 4YHLL 4F7TA 2GJJA 5SWZE 3THML 3HZYA 4KK6D 1HK6A 4JQIL 2Z91B 1N59B 4HUXB 5F88A 3L95A 1RIUL 4XBPA 2A38A 2NLJA 2VSDA 3ZDYE 1XR9B 1T03H 3V7AE 5DHVH 1FG2B 3WEXB 3JZ7A 1I7UA 1TPXC 2BFVH 4AYFA 1KIUA 3Q3GB 3RVTC 4KGJA 2HT4D 4S1QH 3ARPA 4P5TA 5HDBF 1DCLA 3EO9L 4MB3A 5D70H 3TCLA 2MNUA 3GJFH 4GSDL 1S7VA 4KXZI 4ORGB 3ZL4L 4TUKL 5GGRY 2DF3A 2P45B 3OF6D 3CPLB 4OM1L 2E8ZA 4QLRA 1AGBB 5C0AA 3VI4F 1TJHL 3OJVC 3O8XD 1FCGA 1W8NA 3HB3D 3PQYE 2ZUVA 1IKFL 2X4UA 4G6KH 1S9YA 4F7TB 4PJ5A 4N1HB 4OTXH 3VGFA 4OLXH 3HZYB 4LNRA 3QRGH 2P47B 3O3UN 3SKMA 3VA6A 4QRPE 4ODXB 3L95B 3DX7A 3EGSA 1KIPA 5DUML 1BECA 5EUKA 1BFOA 5AG8A 1KIRB 1I7UB 1KPRA 5KVEH 3OAZH 2J6EL 2X6MA 4MQXD 4LPYA 2ATKA 4UNTA 3W9EA 4RMRA 5HYSG 4OIAA 1A1NA 1XEDA 4EBQH 1S5HA 4LQFH 4P5TB 3R1GL 3NPSC 1GRWA 2J3SA 3TCLB 4LKCA 3SE4A 3W11D 2B2XH 4ONGH 3AM8C 1HKLL 4LEXL 4LSPH 1FNSH 1DBAL 1RHHA 1DFBH 3G5XA 5J6HA 3HI5H 4M6MH 3PGFH 5FYKD 1TZHA 2X4UB 3C8KA 3RKDC 1BVLB 3BKYH 4MA1B 3RWHA 1S9YB 4PJ5B 1ZTXL 3KR3H 3WFDH 3PWPB 5I18L 2OMNA 2R0WH 5GRXG 4WFED 5I8EA 3KJ4B 5C0DB 1MELA 3EYQC 1PLGL 5BRZA 4OCYH 3D2UA 5IB3B 5I6XB 1RK0A 5I17A 2F53D 3DX7B 5EBLA 4GXVL 4WUKL 1BFOB 4IIQA 3U7YL 3HNTL 1KPRB 4Y19E 1PAMA 4L9LA 5EH1A 4BQBA 4YDJA 3W9EB 3JVGC 2HTKC 3FHAA 3X14A 2DQEL 3MOAH 1R3KA 1EHNA 3FB5A 3CX2A 4LKCB 1JRHL 5D1ZA 2D7OA 2A0LD 1X44A 5E4EC 2OJZH 4APQC 4B41A 2NY3D 4GW5A 1OM3H 1EAJA 5E6IA 1SVZA 2UYLA 1IAIH 1PFCA 4U6XA 3G5XB 3UYRL 2E3VA 1MJ7L 5J6HB 3OMZA 4K7PH 4YHNB 1ND0A 1TZHB 3QDJE 3C8KB 4KJQC 1IGMH 2DQHH 5ESQA 1GPOH 2NZIA 5ISZB 4C59B 1CFVH 4A6YH 1HN1A 3NH7H 2C3HA 1XAUA 3PDOA 4O58H 5I8EB 1J18A 4ZTOL 5BRZB 3D2UB 2ARJA 4AEIL 5TJWK 1RK0B 4JFHE 5I17B 3LD8B 5EBLB 3DV6A 3KPMA 4MS8D 1U9KA 2BNUA 4URTB 3EUUA 5D9SA 2DS4A 4IIQB 3KPRA 5D7KE 2JB5H 5A3ID 5CCKL 1CGYA 4FN0A 2CLRA 4K94L 1OGAE 4L9LB 3U0TA 3SE3C 4KK5C 1KB9J 3IJYA 2VDPH 3IDUA 2VERN 5ICXA 3X14B 3RNQA 3HNVL 1R3KB 4G9FD 5FYJL 4NO3A 5D1ZB 1ZLUH 2YZ1A 5KZCD 1NAKH 3W39B 4I2XE 5E6IB 3QWRA 5ID1B 2CIIA 3D6GA 2YMXH 3RVUC 2UYLB 4U6XB 2PO6C 4XPFH 4PJAA 2IQAA 2HRLA 2FECI 3KYKL 5T5FL 2E9IA 5AZEL 3D5OF 5ESQB 2VLJD 4PD4J 5DJ2B 5BS0E 4WI3A 1NANH 3A67L 3LY6A 3PDOB 4KROD 3DGGB 3EDFA 3U7WL 2O26U 4HH9B 3GSOA 2IAMC 2EIEA 1BJ8A 3UMTA 3ZKMD 1CLYH 4AENA 4O00A 1UWEH 4KVCL 3DV6B 3VXSD 3RHWK 3VJ6B 3HG1A 5D9SB 2CK2A 5IWLA 4X9GA 2CLRB 4NPYA 4LP5A 1NCAL 3U0TB 2WQRA 2YPLD 5E0QA 4LPTA 5ICXB 3RNQB 1K85A 1AIFA 2Y6SD 1A21A 4UDTB 2H2PD 3UROR 5CEZL 5ELIA 1CD0A 1ADQL 1ZS8A 1C08A 2CIIB 4EOWL 4RGMC 5EU5A 4B5EA 5T3ZL 5D7SL 1NFDF 2IQAB 4EDWL 4UV7H 4GS7C 4L8SA 4LVNC 5F71A 9CGTA 2AXFB 5T5NF 4PLOB 4TULL 3LN9A 4YBLB 2Q1EA 4UI2A 4XNZC 1EERB 2AKRA 3EYOA 5EOQL 1J8HA 2WUBH 3GNMH 1MCIA 4MNGE 4E41A 3B2VH 3DO7B 2VYRE 3CDCA 2QHRL 1D6EA 3ECBA 1BBDL 5I15H 4HG4J 5C0FA 3KPOA 4WFEE 4I5BA 4AENB 1EMTH 5B3JF 1UADC 2ADJA 4TRPL 1JWSA 2WP3O 3HG1B 1J10A 1UGNA 3FQWA 2F53E 1PJ9A 2H45A 4JO1H 1QKZH 3FO9B 1JF5A 4NPYB 1AXSB 4WFGE 4KJPD 3QEQA 1KJMB 5F44A 2WIIB 3VG0L 4J2XA 3WDJA 1PG7L 5JORA 3PNWA 2YD1A 4XWGH 4ELMA 2MCG1 3IS1X 2GFBB 4WEBL 3MODL 5FUCE 1FLTX 1UWXK 1EEZA 1WV7T 1C08B 1ZS8B 2I60L 4Y16D 1FO0L 4P23A 2NXZB 4Y1AE 5IMOA 4MQSB 5EU5B 1XGYL 3T0ED 3ULVE 3MLXL 1ZVSA 1QQDA 4OGXL 4L4JA 3FRUB 5ALCL 4L8SB 1X4YA 2GUOA 3LN4A 2FR4A 3HMXH 1DQJA 2HJFA 3EYOB 4PFEA 4Q6IC 1J8HB 3FOMA 3VD5A 4IDJL 2BSTA 4E41B 4OCNC 3O9WD 1D6EB 4I4WA 3ECBB 3QHZL 5DRWA 3W0WE 5C0FB 3BEVA 3KPOB 3B2UC 5LBSL 3QUYC 3HZKA 3MRNA 2ADJB 5FHBH 1E6OH 3VD4A 4PJDA 1MCKA 3DYOA 3FQWB 3QUKA 1UH3A 4BFEA 5BO1H 5KSBE 4UU9A 1VGKA 4X8XA 1DUZA 3QEQB 35C8L 4U1SB 1MI5E 43C9A 4DFIA 2E7LC 1SYVB 1A5FH 3S35H 5JORB 5CJOH 4ELMB 4YDKH 2R23A 5F9JA 2V2XA 1EFXA 1YEHH 1EEZB 1I3GH 4LRIA 4P23B 5IMOB 3QDMD 4NFBA 5CLTA 3AS2A 2VITB 3GMOB 3WL9A 1ZVSB 1QQDB 2JTDA 4JZJA 4RAVA 3D3VA 3TFKD 1B90A 2VDRH 2M1KA 3IU3A 2ZCLL 5SWSA 3DYMA 2NZ9D 3LN4B 4WWID 4Y2DA 5E5MA 2XA3A 1JNNH 2FL5B 4MYWB 4EVNA 4CDGC 2BY1A 4H5SB 1G0DA 2G5BB 2HJFB 3HNSH 1Q38A 2BSTB 3I9GH 1P5VA 1J9CT 3GM8A 1HQRA 4P49A 5GS1C 4I4WB 4BSWA 5DRWB 2VIRB 5T3XH 5JW3L 4DOHE 5D5MF 1CGXA 1FRGL 3IDNA 4NQXA 3HZKB 3MRNB 4X0KA 4XVSL 4RFOH 5DEFB 1GGYA 1NJ9A 3S36L 1QA9A 2E27H 3PHOA 2OYPA 4FNLH 4YBQD 4MMZC 3RWJB 1DUZB 3WLWD 4MXVF 5HI3C 43C9B 2XZQL 4QTIH 3SQOH 4GKZA 1RFDL 2IBBA 2R23B 2V2XB 3RDTC 1EFXB 3P4OA 5CEXA 1I9RL 2BY3A 12E8H 3I02B 4P3WA 5SX4I 2CMRH 4KZDH 2X1OA 3ZTNH 3WL9B 5D93C 4OFYA 4JZJB 4RAVB 3D3VB 3QI9C 4Y4FD 4NC1C 5SWSB 3IU3B 3HB3C 4EZMA 2YXFA 3P2TA 1D6VL 4Y2DB 5E5MB 3CU1A 3OJDA 2NX5A 4OT1L 2A1WH 1ZHKB 1HQRB 3MLUH 5C2BH 1CE1L 2XACC 3MMEA 4I1NB 6FABH 4BSWB 3P30L 1YMHA 4UB0L 4HKJA 3IDNB 4NQDA 4Z7QF 5AYQA 3L6FA 3DVGA 4OKVA 4LVOC 5FO7A 1IC1A 1NJ9B 3IAGC 4QYOA 4M02A 2VWEE 3TO4B 1BF2A 2NY0B 3G6DL 1BPVA 3VXME 3PXHA 1DUYA 4GAJH 1P7QD 4GKZB 4OZGE 5DD5L 4HJGA 1TNMA 2BSSA 1FFOA 4HIJA 3W11C 4TSCH 3P4OB 4BFBD 4L3EB 1P53A 1KF9B 1JTPA 5DZOA 1Q1JL 2WW8A 5IMKA 4NZUL 3DETC 4GBXA 5JQHC 4TVPE 4GW4A 4IJ3C 2LU3A 4G8FA 1ETZA 2DYPD 5IROA 2PXYD 2IPUK 5LAXA 3QULA 3O6ML 1MF2L 3NOIA 3RPKA 4XXDA 3MMEB 1F8TL 4P4KB 1V7NL 1DSFL 2D03H 1YMHB 4HFWA 4RMVA 4HKJB 1A7OL 4NQDB 3IFPB 4LCYA 5FYKH 3ROOA 3L6FB 3DVGB 5L2KD 4OKVB 2VN4A 3IS0X 5FO7B 5IQ9A 4X80L 3ARZA 3F6IA 3AB0B 4RNRA 4G8IA 4P59H 4S1SL 3EOAB 4U6VL 1Q0YL 4QHKJ 1EJOH 3GUTA 3FB6A 5TE6L 1UZ6F 2PYED 3VFOA 1SBSH 4UT7H 1DQLL 1T2XA 4S2SB 3MV8D 3TBYA 4PJIF 4X98A 1GGBH 1ULVA 1FFOB 2BSSB 2FB4H 5D7JA 1T5XA 3H9ZA 3H42L 1NL0H 4HIJB 2A0LC 8FABA 3SDDD 1CGWA 1VFBA 3PWVB 1YEJH 4CADA 2QQLH 5IMKB 5D1XD 3OB8A 4GW4B 3IKCA 4MA3A 5DFVD 3MRQA 4G8FB 1ETZB 3NIDE 4LCWD 5LAXB 1FYTD 1A6UL 1BD2D 3QULB 3NGBB 1MCOH 4XXDB 2C4FT 2O5YH 1RUMH 4FQXC 2ZUTA 1I1YA 3OKLB 3V79C 1KTKE 1CXIA 2RB8A 5ESAA 1XZ0B 4HFWB 4JQIH 4LCYB 4OF6A 5E94B 3ROOB 3L3DA 2YA1A 2IH3A 2DLTA 1FVDA 5IQ9B 3ARGC 5IBTL 2OTWA 4RNRB 5DUPL 5A3IC 4G8IB 2MFNA 4KGLA 2G75A 1D9KB 4BSJA 3GUTB 3FB6B 5LGHH 1U93A 3HE6A 3MA9H 4JFZL 2L0DA 2JELH 4EXPX 1JGVL 4LF3A 2EEBA 1FIEA 4UV4H 2BVYA 3KYMA 5E9DA 4S1DD 3GFUA 3TGXA 4LSSL 1VFBB 4CADB 2WQ8A 3H9HA 2Z8WC 4LPUA 5J11B 4PBVC 3VW3H 1NGQL 4PV9A 3IKCB 4MA3B 5CILH 5DURB 1Q8MA 1X5AA 4R26H 5HYQA 5IVZA 4OLWH 1MJUL 3ARQA 3TT1L 5MEOB 5C2UB 1I1YB 1VFAB 3GSWB 5ESAB 1U95A 3ZKMC 4GAYA 4XB8A 3TJHD 1K3ZA 1KN4L 2IH3B 1FVDB 3NN8A 4ZNEA 3NVQA 4LSTL 1P1ZA 4XPBL 5K9QG 4M43H 1T04A 2G75B 1C1EH 4PLKD 1U93B 3HE6B 3ALWA 2AK4E 2ZUWA 4FZEL 3SGJA 5B39A 5C0GB 1NUGA 4UTAL 3N1MC 4LF3B 4M5YH 4D3CH 1AO7E 3CLFH 3KYMB 2ZNXA 5E9DB 4MHHG 1K5NA 5JR1L 4H1LA 5ADOL 1MFAL 1N64L 3H9HB 4ZNCD 1H9VA 2QQKH 2I27N 5FYLD 2NR6D 3BP4A 1BZQK 1U2HA 4XPGH 2F5BL 4PV9B 2L7UA 3WIHA 2Y5EA 1NEUA 2GAZB 3L5IA 4M93B 3U0WH 1ERNA 4W68A 5F1NA 4N8VB 2IH1A 4MAYD 3GSXB 4HUVB 4G8EA 4GG6F 4NO5A 4PD4K 5F7NC 1WQVT 1JVKA 2G5RA 1U95B 3WE6A 4GAYB 1DBJL 3VDBA 3S37X 1BM3L 3NA9H 4Q58C 5L6YH 4Z0BL 5EG6C 5J12B 3C09B 2FBJL 3NN8B 5E8NB 3H9SE 2WWKT 4BK5A 1T04B 2VKWA 3ZHKA 1SM3H 5L2KE 3QNZA 2OL3A 3V7MA 1C7TA 5CLWA 1JMXA 1NMBH 3AC0A 3Q6FA 1RZFL 5B39B 4IHOA 4NM8H 3C08H 5AWNL 5D2LB 1KENL 4LAQL 3D25A 1K5NB 3U4BL 5A2LH 1JRHH 4YHIA 1WTLA 1N6VA 4H1LB 5D96B 2AJYH 1OF2B 3BP4B 3MRFB 3QIWC 1XCQA 5DVMA 3WLBA 4PRBA 1QBLL 3EO0A 4LVHC 1KNOA 1MCSA 4KUZH 4W4NA 5F1NB 4DKEL 1S9VA 2B0SL 3O4LA 1NGWA 1YNLH 4K94C 3M45A 5HVWA 1BD2E 4NO5B 4WUUA 1D5MB 3WE6B 2YK1L 2Y5TB 4AEIH 2JJUA 4ISVB 1FH5H 3E2HB 3O4OB 3RUGA 1G9ML 4C55A 3OXSA 3DXAA 3DX6B 4U7MA 4HG4K 3OR6A 4DAGL 4P2OC 5EIVA 3QNZB 4JFQA 1N5YH 2OL3B 3C2AL 3MUJA 4Z7VA 3BVNA 1DBBH 1IM9D 3Q6FB 4ODVH 4IHOB 4Y4KB 3CSBA 4GMTL 1XGPB 3N1QC 3D0VA 1A7PH 3BGFB 1I3UA 5MI0B 5HHOE 4FXKB 1YMMB 4XH2A 3D25B 3EYSH 2GT9A 4YHIB 1LE5A 5HYSA 1RAMA 5IESL 2JIXA 5L9DH 5I66B 3QQ4A 1VACA 4PB9L 2Y72A 5TPWL 1QUNA 3VGGA 2W38A 2PR4L 1XCQB 2NZ9C 3BUYA 4PRBB 1J0JA 3UTQA 3EO0B 4CMMA 3K2UH 1KNOB 5JOFA 1S9VB 1NGWB 1T6VN 4A2LA 2IANE 1M05A 1EO8L 2GJ6D 4WUUB 4FP8H 4OI9A 5DA4A 5C9KA 3HAEH 1LO0L 4K9EH 4JJ5A 2VUYA 2Y4SA 2P8MA 2UVEA 3S3PA 3O41B 5C09B 4KVCH 3CFIC 3RUGB 4J3TA 3OXSB 3DXAB 2J7LA 5TQ2L 2DMKA 1F3RB 3OR6B 2YBRA 5FCSH 2BERA 3H8NA 5DMGC 3TIEB 1WFNA 4JFQB 5DQ9A 3Q6GL 3HRZA 1U92A 2Q8BH 1B4JL 4Z7VB 2B5IB 1FNLA 2W0FA 3CCHA 1SHMA 3QA3A 2F8XC 5F1OB 5KOVC 2DWEA 3PL6B 3TPUA 4XH2B 3V4UH 1LE5B 2P5ED 4Z7WA 1JPGA 2IBZX 2JIXB 3ISWA 4PG9B 2VZ3A 2CLVA 1VACB 2VXUL 3QQ4B 4MA7L 1UXWB 4KRMB 1YPZB 4FQJL 4Y4HC 1UEMA 2YSSB 3MRBB 3TJEH 1JWMA 3O45A 4G7YL 5HYJE 2Q6WA 3BUYB 4RRPG 3UTQB 4P9HL 1NGXB 1TQCC 1EA9C 5GGRA 5ICZA 4UAOC 1Q72L 4OGYH 4U6HB 4UIKL 5D1QA 1XCTA 4KI5F 1M05B 3NBNA 4IOIB 2KBGA 4HJ0D 4Y8DC 1CD8A 5BQ7B 2C26A 4PGDA 2P8MB 4Z95H 5D7LA 1OTSD 5LKNA 1HZHH 5K59F 4OUOA 2YBRB 4YXLL 3K4DA 3OPZL 5DQ9B 5D6CA 2VDNH 1U92B 5E8DH 5C0BD 2HKFL 2QQQA 5INDA 3CCHB 3QA3B 1OWWA 1JWUB 1Q94B 4HGWA 3VG0H 1Q9KA 1II4E 4WENB 4EN3B 2LTQB 2DWEB 2RCSH 3EYFA 2OK0H 5I30L 4Z7WB 3I50L 3ZSSA 2YKLH 3T1FA 4V2CB 2CLVB 3GHBL 4G6ML 3GJFA 3GIZL 1JWMB 4G6FB 2VXSH 3O45B 1AGEA 1WF5A 2DQJL 1MQ8A 1ACYH 4RISH 2XZCL 2MKWA 2Q6WB 4JFYA 5ICZB 5GGRB 3VFPB 3IFNL 5D1QB 1NKOA 1CL7L 1IGCL 4JR9H 3L3KA 1XCTB 5B22A 4GRWF 3U46A 5CJ8A 3GM0A 3SDCB 4OQTA 2R39A 4UQ2A 3FB8A 4NO2A 4F9PA 3L1OH 1FORH 5LBSH 1Y6KR 4LASH 1I9JH 5D7LB 3ARXA 3ORJA 4U31A 5I8CA 3HLAB 2MMXA 4HZLA 5EOTA 4CVZA 1MCLA 4K71B 5I1JH 4WEMB 4KI5D 4OZIF 2CGRH 5D6CB 4LFHD 5HPOA 4N0RA 2EE3A 5ICYA 4OCXH 4HGWB 5DGRA 2MKLC 3SQBA 1KELH 5IK3A 1Q9KB 2LABA 4MCZA 1B4RA 3SCMA 5E1AA 4IMKC 2DQCH 3JV5A 4HWBH 1RIHH 3QIBC 1XIWD 1E4WL 2Y1VA 3SO5A 3D48R 5IFHL 3MROA 1A3QA 2EDFA 4N0UA 1OT1A 4R7DB 5IOPB 3LEYL 4JFYB 4MJIE 1AC6A 2AQ1A 5IVXF 4JM2D 4KKAC 2GK2A 3L3KB 1JF1A 3Q2CA 3U46B 1P9MC 3VGHA 2A9NL 4JQVA 4RGOL 4D9QD 3AS3A 4PUBH 2ESVD 4NO2B 3O3AA 1H8SA 3JWDL 3I2CH 2ICEA 2CKBL 5TH2B 2VLKE 3CVHB 3QPXH 5I8CB 4TTDD 4WVRA 2GYSA 1DBKL 3RHWF 4CVZB 1KT2A 4AEHL 3MBED 3WNPA 4XPHL 4UBDD 1ZE3C 2BVQA 3MOQA 1NBYA 5ICYB 1EH9A 4ACPA 5GRZA 1R24A 3OXRA 5IEHA 5IK3B 3DMMD 4MCZB 4XBEL 3T4AB 5E2UH 4S1DC 4JG1H 2QADC 3HTLX 2BOCA 5MHSE 3QG7L 4WY7L 4LSRH 1XR8A 2ZCKH 1L7IH 4JB9H 4HUNB 1KB5H 5JIKA 2K7PA 3SE8L 3BAEL 4XVTL 1QPXA 4N0UB 5EFIA 5TQ0H 4C4KT 4HAGA 3R06A 4DWHA 1KTLB 1NKRA 2AXGA 1JF1B 1N5AA 1BOYA 1LO2L 1KYOK 1NSNH 2V5RA 1J0YA 4KPHL 4P2CG 3O3AB 4APQA 4Q9RH 1D3CA 3RL1A 5CJ5A 1S7UA 3P30H 4BFIB 3HE7A 5TE7L 8CGTA 1UA6H 1A6PA 2ICEB 5KW9H 3MUY1 3CDGA 4HS6A 3RVXD 4PLKC 4AIOA 1NBYB 1BREA 1RUKH 4N1EA 2GY7B 1R24B 4JO4L 2IG2H 3OXRB 1UWGL 3V6OC 3MXVL 5IEHB 3AS0A 4LARH 1JMZA 4FFWC 4N9GB 3W9DA 3O6LH 2BOCB 4EIGB 2CLZA 1F6LL 1QRND 1XR8B 5CZVL 4XMPL 2XQYG 4TOYL 3P9WB 3G6JF 3BKMH 2HFGH 3CAFA 4HT1L 5EFIB 5JW4R 1OSPL 3V95A 3WFZA 5GSRA 4G42A 1OCWL 4KUCF 2RBLA 3R06B 4C57C 2AXGB 1N5AB 5FUOH 4UZGA 4JDTH 1NANI 3RU8H 1BFTA 4WI2A 3BDYH 25C8L 1UCBL 1VHPA 5FDYA 1MHHA 3CU7A 2HH0L 5CZXD 1X4XA 3NCMA 5FYLH 1CDJA 5CJQL 1HHHA 3HE7B 2QSCH 4QOKE 3QEHA 3BPOB 2ARWA 4MJ2A 5E70A 3RTQC 4X8JA 3CDGB 4KH2A 1EHLH 2FX7L 2PO6A 1G7HA 3GHEL 3VWKC 4UINL 1FPTH 2EDBA 3S96A 5SWZA 3QUML 3ULSA 4X4YA 3GMRA 4XCFH 4JFFB 4IRZH 2V17L 4O2FA 1RSFA 5D7IE 3T65B 3S5LG 1LILA 4OI7A 5JHLH 5KANI 2ORBL 3W9DB 2EICA 1JGEA 4QRQA 4I0PA 1J5OL 3A6OA 1FE8L 1IVLA 2CLZB 4R0LA 2MJWA 4XMKL 1JHTA 3PABA 4PJ8D 3U4EA 2EDRA 5F7YC 3TBTA 2AEWA 1NCNA 5GSRB 3WIIH 1YEEH 1N26A 3NABH 4FMFA 4L4VB 1TENA 5F9AC 2JJTA 5MP6L 4PGCB 4J6RL 3SBWA 4PJXE 3RGVD 4X6BA 5BJTB 4AEEA 1QNZL 4LIQL 4U7SA 4WHTB 2ZCHL 2CJUH 1INDH 3IKKA 1HHHB 4U0RC 3QEHB 5KS9E 3BD4A 3PQYA 4LSUL 3LDBB 2XXCB 5E2VL 2B4CL 3IRPX 1RY7B 4XNQA 2FGWL 1N6QL 3LRSA 2PW2A 3S96B 5SWZB 1UQSA 2DQGH 2MQCA 4R90H 4X4YB 3GMRB 2RFXA 2WBJC 3HUJF 2IPKA 4N0FB 3NCYP 1JGEB 4QRQB 1R5VA 5EZIH 4AM0A 4L8CA 1NEZB 1UCTA 3UAJD 3QISA 2G60H 3DRTA 4R0LB 1F90H 4L1DA 1JHTB 3PABB 4YUEL 1T1XB 2EDHA 4M7LH 3C5ZA 3MLWH 3AMLA 2DQFB 3CNKA 2XZAL 5MEND 1EBPA 4QT5A 1QFWH 3VFUA 2W9DH 4N0YH 5F8RC 2BP3A 2JJSA 2I26N 5DMIL 4X6BB 3VFWB 1T1ZB 3RWCA 4LGSB 2GJZB 1X5XA 3WO3B 2LE9A 2NY2B 2JJVA 1LD9A 3TV3L 1C16B 3PQYB 3T3PE 4AG4H 2BNQE 3D9AH 3IFOB 4Q9CA 1KBGH 4XNQB 4DZ8A 3LRSB 2QEJA 2PW2B 1VSCA 2HAZA 1UQSB 5I1CL 2ZUQB 2YHGA 1QSFD 1IILE 1IEBA 4OQ1A 1PG7W 3QFJE 4QRPB 4LLQA 3HC3L 15C8H 1R5VB 3Q1SH 3TT3L 5IJKA 4AM0B 3OX8A 4L8CB 4NWTL 3DRTB 2VDOH 4Q2ZA 4KWUA 3KLHD 2F8OA 2D7NA 3MJ9L 4ZUSB 3C5ZB 2I9TA 3F7VA 1KEGL 3CFDB 4QT5B 1S7SB 3VFUB 3EFDH 5F7DA 5JUEH 1DP0A 2VXVH 1CR9H 5EIIA 1G9EA 3SJVD 3MLZL 2EYSB 4X5LA 3RWCB 1JI1A 4ZFGL 2FZ3B 3RWGA 2AEQH 4KK9D 1L0QA 4JO2H 1LD9B 3D69A 4J23A 3VH8B 1JBJA 1A22B 1KIQA 3KXFE 1QZ1A 1NC4A 2P42B 3NMEA 1T22A 4DK3A 2AJ3B 4FTVE 4X5XA 5JHDD 1BMGA 4OCSH 5C0CA 1BFSA 5AD0A 4HF5H 1TZIA 4HUUA 1OAXL 4ONFL 4NN6C 3VGBA 1IEBB 3T3ME 5GZND 1IGTA 1S7TA 1TLKA 3TYFB 4LLQB 5I8OH 5GS2H 1AQKL 2VLRD 5AWNH 5F3HA 3AROA 2IFFH 3OGCA 5D72L 5ID0B 4Q2ZB 4S1RH 3BPNC 2D9CA 1BAFL 1OGAA 4NUGH 3F7VB 3PGDA 1CFQA 3ZDXE 3LQMA 1YEIH 5F7DB 1CVSC 1V3KA 1ZAGA 3ARFD 3OG4B 5EIIB 2RAMA 1G9MC 1B0WA 4XNXH 5JTWA 5KTEL 3D39D 3ULUL 1HNFA 5FYKU 5L8LB 4I2XA 1D5ZA 3EJZC 3NAAL 3HPLA 3WNLA 1P4BL 1OTTC 2VR4A 5H2BA 4QRUA 3OF6A 4YPJA 3KS0J 2NTFA 1KIQB 2APFA 4HFUH 1NC4B 1FVCA 2W59A 3QDJB 43CAA 4ZS7L 3MRDB 4I3RL 1T22B 2EEAA 3LH2H 4FG6C 1G9MH 5K93A 1HNGA 3O8XA 4KI5C 1P5UA 2G2RB 2F58H 4J3UA 4NQCE 3B9VA 2FH6A 5E1HB 1LK3L 5L88L 1TZIB 4HUUB 5HDBE 3BQUD 1LE9B 1IGTB 2OXHA 4ZO9A 2MPAH 2DB8A 2F74A 3MLSL 3GBML 4PR5B 5F3HB 4HPYH 3OGCB 4OFKA 3TESA 1F97A 4DQOH 1XIWC 3WXWH 3GMQA 1OGAB 5IR1A 3IB4A 3RGHA 4CW1A 2X05A 5TPWH 4IRJD 1CFQB 2R69H 3X3FL 3UP1A 2EYRA 1NCTA 4D9RE 1RZJH 5DQDH 2OZ4H 3LKQA 1D5ZB 3KPQA 4I2XB 2P5WE 4G8GE 2Z9TA 2ITDA 5H2BB 4QRUB 3QHTC 1WZ1L 5EBMB 5JIHA 1DQDH 1J7VR 3V4VH 1A6VH 1FVCB 4XCCL 3O8XB 3VFGH 4OJFH 5GISH 3ULUF 1KCKA 1XH3A 2EXWD 4MNGA 4P9ML 1EX0A 2CK0L 1MEXL 3P9LA 3UJTH 4NJ9L 2DRUA 3BPLC 5HDQH 1Z3GL 2F74B 1A0QH 3ZTJH 4KKLC 5GRWA 1HSBB 2YEZA 2F53A 1N0XL 4GRWH 4D9LL 4L8DA 4WTZG 5IR1B 3GMQB 2A2QT 1YEFL 4CW1B 5IFJA 4KDWA 2C4FU 3SGKA 4DGIL 1G7IA 3PE9A 3U7AA 1HWGB 3IETA 2CUHA 5DT1H 2EYRB 1TVHA 1BWMA 1Q72H 3OZ9L 3LKQB 3KPQB 3KJ6L 3LS5H 1VEOA 1KJVA 2Y7QA 1MCWW 5B8CA 1MAJA 3X3GL 3ARVA 1QEWA 1JNHA 5T1LB 3RJQB 5BV7B 2DKUA 5D71L 3KLDA 4F3FA 2AV7A 1XH3B 1MFBL 4PJ5D 4KQ3L 4MNGB 3ET9F 3DSNA 3PWPD 1EJ6A 1W0YT 5F9OL 3S37H 1MCHA 3ESUF 1A4KA 5HD8D 3MOBL 3ZHDA 5BMFH 3QDAA 1G6RH 1YN6A 2YEZB 2F53B 4QRSA 2FECL 3L3HA 2YD6A 4L8DB 3VXNA 5J1SC 1MIEL 5IFJB 4G6MH 4I13B 2MHAB 3MNZA 1G7IB 1MI5A 3LHPH 5LXGL 4UT9H 4ODSH 3RAJH 3IETB 1FAIH 1TVHB 2D7PA 4WI9A 4G9FA 5IHUL 1C5DA 1JYXA 3T0AA 5HHXH 2X4RA 3BZEB 2R29H 5F1IB 1HEZB 1KJVB 2GTWA 4LEOB 3WHXA 1QEWB 1JNHB 3BSZH 5KVGH 5F7FA 1I7RA 2PTTA 5C9JA 5BW7A 4PTTA 2BRQA 3FN0L 5DZLA 5ISZD 2AV7B 1LDPH 2J8UA 2VLJA 2H41A 4GAGL 4AT6B 2OTPA 5EUOA 1QFUH 1UJ3C 5LJYH 1JZ3A 3JWOH 3W0WB 1G7MA 1NMCB 4TN9A 4BKLB 1YN6B 2XICA 3RNKA 1DQMH 4QRSB 3VXNB 5KSBB 4P57A 4OLUL 1H15A 1V5JA 4PJ8C 3MNZB 2UY6A 3I6GB 4JHBA 4PP1D 1MI5B 4EI5B 1K6QL 3WIFA 3T8XB 2YPLA 1JGDA 3CC5A 3MR9B 3LQZA 3QAZB 4TTGA 4XP5L 4G9FB 3QQNA 1C5DB 4MXWL 4RRPA 2X4RB 2E7MA 2A6JA 1B88A 3CMGA 4JO3H 2HN7A 3FONA 4C54A 5KZCB 2GTWB 3SKJH 5I0ZA 3SKOA 4DGYL 1GGCH 3WHXB 1DANT 4WGWB 1I7RB 2PTTB 5C9JB 3U79A 1P6FA 4R8WH 2J8UB 2VLJB 3ME0A 4XPHH 1CDGA 3ZE2E 3FHQA 5EUOB 4UT6H 2AERT 2VDLL 2UUDK 1I9IH 1G7MB 4DOHB 2FD6H 5KVDL 1CGSH 3BGMB 4X6EB 4PRAA 3BOVA 3DHJA 4M1GH 4NHCL 4PJBA 4JY5L 3ZTJG 1EDQA 1JRHI 1NCDL 2XNAA 3RNKB 1SMAA 1NFDE 1PVHA 4P57B 2FCBA 3CVIL 2ED9A 4U1NA 5FYJE 3SE8H 3WIFB 4WNQB 3NZHH 4M7ZC 4QXUL 4FQQA 1RZGA 1JGDB 3CC5B 3UTOA 5FDWA 5I1GL 5ADPH 3STLB 4JAMA 3LRGA 1WEJH 1UZ8A 4YDLB 2A6JB 3B5TA 1LO2H 2OSLB 2HN7B 2IC2A 5F7EL 4KPHH 4Y8AA 4NKOA 1MPAL 4Y16A 3E6HB 3UDWC 4Q74A 5EU6D 3SKOB 2FIKA 1NGYA 3T0EA 3ZE0F 3K4ZA 3O6KL 3WKNA 4HLZH 2CO7B 3IJSB 3JV6A 3MCLH 3CSYA 3RZCD 1G7JA 2AJSH 5C7XH 2BVOA 1H3PL 1IC5H 4K3JL 3T09A 4HS3A 4X7CC 4KK8C 4K8RL 3LIZH 4ZS6C 3MXVH 3A6BL 3NCFB 3O9WA 4PJBB 4P46C 2E7BA 3BN9C 2D0FA 1EEQA 1J0KA 4Y5VB 3UZQA 4ELMF 1MUJB 4CKVX 2EDXA 3B9KC 5HDLA 3ARBC 5DJDA 4OKDA 4HXAH 5B38G 4U1NB 1IRAY 3TBSA 4B50A 2DLHA 5GXBB 3B6SA 5E08L 2E6JA 2VC2H 5DJCA 1JGLL 1NAML 4FQQB 1T20A 5FDWB 5CEZE 3VWJA 4FOMA 3OKYA 4JAMB 1MNUL 4NZRL 5IG7B 1DEDA 1H5BB 4JKPL 1UZ8B 5T3ZE 2Z8SA 2Q8AH 1A3LH 2NXZD 1OPGH 4NKOB 4Y16B 4CMHB 1PEWA 1ZANH 3QDMA 1FQ9C 2FIKB 1NGYB 3T0EB 1MVUA 5FA3A 1QLFA 3JV6B 3UC0H 3CSYB 1L9MA 5E7BA 1E6JH 1G7JB 1SY6H 2BVOB 1J8HD 4HS3B 2F19L 4E41D 3HZMA 1C5BL 5DHYA 2VE6A 3IDIA 2A6IA 4YR6A 3DX9A 3O9WB 5DVNA 2YWYA 5DJAA 2YUZA 1R3LA 2V7NA 4OCRH 2FIRT 3VXUE 4XP1H 5KJRH 2G9HA 1P4IH 1ZGLA 1NCCL 5DJDB 4W70A 3T4YB 3TBSB 2FWOA 1F4WL 3G5VA 4ZTPL 5DS8B 3DVNA 4NGHH 1T20B 2KL6A 1ZHLA 3VWJB 2AVGA 5BZDB 2EDTA 1ZOXA 1RHFA 2B4CC 5A2JH 3P0VL 2QBWA 1JHKH 1Z5LA 1R3IL 1E4XH 1TJIH 1MRDH 1QG3A 5FOJA 3CDYA 3U83A 5IV2A 1RULL 5K9OA 5T33H 1FC1A 4JY4A 2XWJA 4I48B 1IQWL 3EZ8A 1MVUB 5FA3B 4Y4FA 3VFNA 5JO5A 5JDSA 2B4CH 4PS4H 4BQCA 1TCRB 3OHXA 5FKAA 3HZMB 1KCVH 4OLVL 2VE6B 4PJHA 3TYGL 1EO7A 3KG5A 3WD5L 5GGVL 2A6IB 4YR6B 2DBLH 5DJAB 5AZ2H 3QUZD 4W6YB 3ETBF 3OSKA 4F58H 1J1XH 2Z93A 2G9HB 2ZJSL 1L7TL 3IDYB 4XBGA 2EYTB 2HJLA 2AK4A 3DVNB 1F4YL 5EZOL 1ZHLB 4I3GA 3U36A 2CPCA 1PSKL 4HCRH 2AJXL 4J7RA 1P7QA 5K9JH 2OM5A 3CMOL 1Z5LB 2OR9H 1EFXD 4G6JL 2GTZA 5GS0D 4Z7QE 1FNHA 1A6ZA 5IV2B 5K9OB 2HLAA 4P99A 1WICA 4JY4B 2XWJB 3X11A 3LCYA 5HSFA 2DQDH 4YO0A 2R4RH 3LN5A 5L7XL 4DTGH 4Y4FB 1KXQE 1UB5A 2EO1A 3GB7A 4ZD3L 1WIOA 5JDSB 5KG9A 5F7WC 1HIML 2E5EA 3CH8A 4NZTL 3OHXB 2ZSWA 2DYPA 3BW9B 2PXYA 5DD3L 2BVPA 3O6FD 4PJEE 5FKAB 5JW5A 5I1DA 4PJHB 5CMAB 1XF3B 2K9UA 1XGTB 4LRNH 3HC3H 2R1YA 1IZKA 4NRYA 5F6IC 4OIBA 4RDQG 2Z93B 4U1LA 4OF0A 1JGUH 1CU4L 3O3EA 5DRZA 3S5LA 4E5XB 1CXKA 1JTTA 1IFHH 2YZ8A 4UILL 2DLGA 3TO4D 5L2KA 1LEIA 4BJLA 4OD2B 1X4ZA 3BJ91 4R2GB 4PRHD 4XBGB 4FQIH 2AK4B 4O51A 1A6AA 4HWBA 1PX4A 2IF7A 2Z0BA 1HINH 1LP9E 3V4PH 3FAWA 2PYEA 4P5TC 4M00A 1AO7B 1P7QB 4ZUTB 1N0LA 4X7SH 3WXVL 2UZYB 3MV8A 1CFTA 5TF0A 1U58B 2YPKA 2GTZB 4G5ZH 4L3ED 2VDKL 4FQ2L 3L7FA 1N3NA 1A6ZB 5GHWL 3PDGA 3U4AA 2HLAB 3SDDA 5KAQG 1QSVA 2VAAB 4XAWL 3GB7B 5D1XA 4MA1C 1QLEL 1UZ6E 1UXSA 2ZSWB 3QWOA 1HCVA 4I9WD 4C56E 4LCWA 2BVPB 4XXCA 5JW5B 1BD2A 5DJ0A 2RR3A 4P4KD 3KJ4C 2CRZA 3WFHA 5I6XC 2UZIH 4NQDD 3CFBA 3ZKXB 4JN2A 1F58L 2VJXA 2R1YB 4N5EC 3H9SB 3MV7D 1FZMA 1INEL 3FFCE 3S5LB 3O3EB 4OB5L 5DRZB 3GRWH 3ULUC 5L2KB 2VB5A 1LEIB 1D7FA 2B1AL 1B0GA 3HI6L 3UTSD 1FV1A 1A3RL 4PJ9A 3NCBB 2ICWI 3RWFA 4O51B 1A6AB 2APXA 4OFDA 3AVEA 1HYSC 4P2RE 5EBWA 2RQ8A 3MUGA 2W65A 3WFEL 4FQLL 5IVNA 5HHOA 2FHBA 1A7NH 3HC4L 1CFTB 3SE4C 3IVKA 3MCKA 1I1FA 3IU4H 5J57B 1BJ1H 3L7FB 3AXLA 1N3NB 1AFVH 1X5ZA 2XRAH 4M1CD 3TLRA 3SDYL 1P4BH 1UVQA 4YHOL 2AI0H 1OLLA 1ZVYA 4TQEH 4U6YA 4OFPA 4ODWA 1RURH 2IALA 1A47A 4PJIA 2IANA 3QWOB 1IL1A 2LFGA 4LCWB 4ERSH 3CSPA 4M48L 1BD2B 5DJ0B 4WW2A 3BIAX 2HVJA 1CGUA 3WFHB 5IT2H 3IF1B 3CFBB 3WIHL 2HFFA 4JN2B 3CFKA 1WUNT 1PD6A 3GBMH 1FZMB 1YNKH 2IPUG 4KRPB 1HXMA 4IIQC 4GMSH 1D9KD 5SX5K 3WHE1 1FV1B 4L9LC 4PJ9B 1QVOA 1V8HA 3EBAA 1ZT4B 5JOPE 3GSUA 5EBWB 3MUGB 2W65B 4FQHA 1RD6A 2DQTL 5HHOB 4UTBH 5D1ZC 1HDMA 3MCKB 4TNVK 3DYPA 5E6IC 4YX2H 3AXLB 4IS6B 4CL7A 3EYUL 3VD3A 1UVQB 5EO1A 7CGTA 4BQ6A 4ESKA 5HYJA 1A14H 2ZG3A 2Y07L 5LG1A 4WI5A 4U6YB 4ODWB 4MQTB 3U30B 2IALB 4P48A 5IW3A 2IANB 2O5XL 3WFBH 4HHAB 1TQBB 1FFRA 3WV0A 4RMTA 1TNNA 4WW2B 2HVJB 4MAYA 1GGIH 2C9AA 4Q7DA 4YDVA 2HFFB 3VXRD 4O4YL 3CFKB 2A73A 1FBIH 1KCSH 5DF0A 4NHUA 2A6DB 1SEBA 4CVUA 3S3SA 1IZJA 4HGKC 3VI3E 2DQUL 1QVOB 4PRID 3GKWL 3HE6D 5ILTL 1EUUA 2VXTH 4EXKA 1UM4H 5IB5A 3PGCA 1RVFH 3GSUB 4TSBL 4Z7OF 4FQHB 1HXYB 4AMKH 5E9DD 3BE1H 3RI5F 3UPAA 1HDMB 4BZ1H 3OZ9H 5E56A 4L3AA 1B2WH 4PJGE 5BZWB 4QNPE 1X5FA 1U8QA 1T2QL 4OIIL 5EO1B 2DJSA 5HYJB 4HPOL 1BBJB 3RX8A 1JE6A 3B43A 2QJDA 4YBLC 1TPXB 4JFXB 2C1OA 1MRCH 1SBBA 2IQ9H 1BIIA 3AMKA 3WJLA 4KRLB 1UM6H 1IGIL 3C9NB 4YDVB 1J05A 4JN1H 2A73B 1CXFA 4XP9L 4YXHH 3DLQR 4NHUB 1TTFA 5IWLC 2PNDA 4ODBD 5EA0H 5I19H 4YJZL 1KC5H 2PKDA 4FFVC 4D0BA 2FHCA 5IB5B 3F7QA 1QFWI 3Q5TA 3BYYA 3IYLW 5FIEA 5F1SA 4KHTL 5T1DL 5CAYB 4GKSA 3V0WH 3EO1A 3HI1A 1CWVA 4WFFD 3LSOA 1AGCB 4KQ4H 5DD1H 3P77A 1Z0NA 2P43B 1TTUA 1FDLH 4FQ1H 2V2WA 4L8SC 1AR1D 3NFPA 2XWBA 1S5IL 3RUGF 3QXUA 4ENEC 4GRLA 3ZT5A 4JLRA 3ARED 5GPRA 4Y5YA 3G08A 4Z7VF 1SJHA 4QY8A 2GJ6A 1J05B 3BH8A 3EJYC 4JZOA 3UO1H 4M03A 1F6AB 5DJZA 4CNIB 1CGVA 2OCFD 4U1HA 1YEDA 2O5ZL 3O0RH 2VO5A 4XC1L 1YPZF 4JREB 5L8KB 1QPPA 2H9GA 4WTZA 4Y4KD 1Z9LA 2R1XB 3RVWD 1CG9A 1YMMD 2OQJA 4D8PA 3HI1B 4HUWA 1ZLWK 5I73C 3QIUD 4MX7A 4P23C 4WI7A 2P5EA 4MDJA 4NUJA 3MCG1 3DJ9A 1OLZA 2V2WB 5D6DC 4MJIB 1JZ8A 2BFVL 3GSVA 3NFPB 1PQZA 2XWBB 5IFAH 1T1YB 3VA2C 4FABH 4GRLB 3VFRA 4JLRB 4S1QL 1FAKT 1GIGH 5E7FA 4Y5YB 5D70L 5FGBA 1GZQB 3JWNC 1SJHB 5KVDH 4QY8B 1FG9C 2FX8H 1IC7H 4JZOB 2WIMA 3O3DA 3GMMA 2VLKB 2KZWA 3V0VA 5DJZB 1EZVY 3GGWA 4H26B 5C09D 3QPQD 4TSAH 2VZSA 3SGEH 1NCDH 3VXRE 1YEDB 3UPCA 4Z7WF 5F3BA 1I75A 1L0YA 1MREH 4EDXA 3DBXA 3NCEB 2H9GB 5C0BA 4OTXL 4JFDD 4OLXL 3MRRA 1EFQA 3R8BB 1HOCA 3VFSA 3QRGL 4PB0H 3CXHJ 4POYA 1LO4H 1DVFD 3PL6D 2OQJB 4D8PB 2R0KH 4HUWB 2YRZA 5JA9A 5GS0C 4YIQA 1N8ZA 4H0GA 4LRIC 2JIXD 2ZOLA 2OI9B 4MDJB 5DA0B 4NUJB 1NGZA 5JXAH 2F15A 4JZJC 2A6KA 4U1KA 5KVEL 1YY8A 3QP3A 3GSVB 4Y2DC 3SE9H 3W2DH 2ZNWA 1M7DA 1D5BA 2FH8A 3IJHA 3VFRB 4EBQL 4LQFL 5CD5C 5GS0H 4PJFA 4ONGL 4NO0B 3MPCA 4LSPL 1FNSL 3O3DB 3GMMB 4WWKD 1DFBL 3V0VB 3GGWB 2DD8H 4XWOC 1SEQH 1QSZA 3HI5L 4BSVA 4M6ML 3PGFL 3TO4C 3K0WA 5F3BB 4ELKA 1YQ2A 4I18A 2NY0C 5BVPH 4EDXB 1T80A 3DBXB 3KR3L 2VZVA 4CRPA 3S88H 1PZUB 2XN9E 5F97E 1OAUH 3WFDL 3MRRB 2R0WL 4M7KL 5DSCA 4GRWE 4OCWL 1A7BA 1HOCB 1U8JB 4M61B 3UEZA 3VFSB 1BQHA 1ZK9A 3GSNB 5C0RH 4EN3D 4OCYL 5LGKA 4JKPH 4U0QB 4YIQB 1T66C 1G1CA 2ZOLB 3L3JA 4YHZH 2ZOKA 4HW6A 4UOJA 1NGZB 1RK1A 1T1WA 5DRXA 2A6KB 3CFJB 4U1KB 4WFFE 5TE4H 4HIXL 4XRCA 1YY8B 4OZIE 2DICA 1R5WA 3QXWA 5HHPA 3VXQB 1D5BB 1MCJA 3NACH 4UMGA 5D1QD 1UKQA 2W9EH 3GK8H 5HPMA 3MOAL 4POZD 4JM2A 4X6FA 4P4KC 4PJFB 3SDXE 3SDCD 1C5BH 2OJZL 4QOKB 3MQIA 4OF8A 1JHLH 3TC9A 1IAIL 5DO2D 2ESVA 5IB2A 4RGMB 4K7PL 5FB8B 3HN3A 2B7DT 3WN5A 3PG2A 2R2BA 1IGML 2DQHL 2WBWB 4I18B 4LLMA 3C6SA 1GPOL 4GS7B 1CFVL 1M1SA 3MBEA 4ZTPH 3NH7L 5DSCB 4O58L 4DKFH 3TZVD 4DW2L 5T1KA 4LLVB 5CS7A 3DMMA 4HQQH 3AAZA 1CN4A 1G7LA 2APBA 1T1WB 5DRXB 2C3XA 2BCKA 2JB5L 4GBXC 1QD0A 4XRCB 1QSEE 4JVWA 5CD3A 1R5WB 5IROC 3UTTE 4YAQA 1QHOA 3OG6B 3NFNA 2VDPL 3NGBC 4JM2B 1A7RH 4X6FB 1EHAA 1MCRA 3PP4H 2NPLX 3WDIA 1CCZA 3LMJH 5DVOA 4KTYA 1NAKL 1U8KA 2XA8H 4WHYH 3E6FA 2YMXL 4BH8A 5AAMA 3P0YL 1SMOA 1N2RB 2ESVB 4Z18A 2Z31D 2XKNB 4XPFL 5IB2B 4ZSOA 1M7IA 3NCJH 3CUPA 3WN5B 1WBYB 2R2BB 1L7TH 2BY0A 3OTTA 3C6SB 4YLQT 4MCYB 2BZDA 4OF3A 3MBEB 2IWGA 3C6LB 1NDGA 4WDIA 5B38A 3CK0H 1VEPA 5D7JC 5T1KB 1LNUA 1CLYL 1UWEL 2XTJC 1G7LB 3K3QA 4J12A 1DQQA 4KZEH 1CGTA 2BCKB 5ANME 1QRNA 2HT3D 2OX5A 3VDCA 5CD3B 1KFAH 3VGAC 2HMID 5HJ3A 5EWIH 1C5CH 4YAQB 3NFNB 4YH6A 1U8OA 2KH2B 3TO2A 2CO6B 5E99L 5DD3H 1B9ZA 1IQDA 1U8KB 3E6FB 5FV1L 2JB6A 2ADFH 4P5KA 1RQ5A 1OGTA 4ZSOB 1M7IB 3BD5A 3CUPB 4UV7L 1CFNA 4MXQC 1U41A 3NIGF 2Q76A 3FCTA 1W0VA 3HE6C 4HV8A 1PKQE 2WUBL 3GNML 2P8PA 3B2VL 4WDIB 3QFJB 4X5WA 5B38B 1IM3B 3MRJA 1YDPB 5I15L 1KUMA 1LNUB 3WS3A 4CVXA 3UBXG 5J6GA 1EMTL 1P6AB 4JPWH 1PGRB 4KJWD 4KTEH 4YNYA 1DQQB 3ZE1E 4KAQH 4DVBA 1J8KA 2J1KA 3BIKA 4JO1L 4FHBD 2YA0A 1QKZL 1HHKA 1KULA 1CDBA 4P2YA 4Z8FH 4M93C 4J4PD 4HK0B 1CI5A 4M5ZL 2ZSVA 1JYNA 4P4RA 4XWGL 1V7MH 3MV01 2WP3T 1IQDB 2Z92A 2I24N 1IEAA 3RGVA 5IM7A 3WKMH 3B3IB 4P5KB 2NY1C 3KXFB 1OGTB 5J12C 1JK8B 1RUQH 2F54E 4P2QE 2CIKA 4Z5RA 1MQKH 4FTVB 1CFNB 3ZKND 1Q9LB 4DUWA 1NH6A 6CGTA 5FGCE 1GOGA 1W0VB 3HI6H 4O2EB 3KDMA 3HMXL 5HHVH 3SGJC 2P8PB 4JFFD 7FABH 1K2DB 4X5WB 4Z7UE 3QDGE 5I16A 2O93L 3B9AA 5GGQH 2ATPA 5ECJE 3WS3B 1T7ZA 4CVXB 5J6GB 4N9OB 5FHBL 1E6OL 4YNYB 5D96C 2X1QA 4KHXH 4HC1H 2A9MH 4HUKB 3BIKB 5BO1L 3QG6A 2XYCA 1FFQA 5IB4A 4LVOB 3C5SA 4LQ1A 3BD3A 4LCCA 5MENA 2R4SH 2ZSVB 4OUUA 1A5FL 4L4VD 3S35L 2F5AH 2FEEI 5CJOL 1DLFH 1Z9SA 2DTSA 5IBUG 5EN2A 4YDKL 4H1LH 2X44D 1GSMA 2DQIH 1H3TA 1YEHL 2Z92B 4WHYG 1IEAB 4U1IA 5IM7B 1I3GL 2W07A 3LB6D 1FL5A 4Z5RB 3O4OC 2CIKB 1V3MA 2VDRL 1UM5H 1OOAA 4NQCB 1JNNL 5CWSA 2C3VA 4JCLA 3K8KA 3BKJH 2FX9H 3KDMB 3KWWA 5SWZD 3HNSL 3ROLA 4NNXA 3I6KB 2DTMH 3I9GL 5I16B 3LKPA 1CLOH 2XOTA 5EO9B 1UACH 2ATPB 3BGFC 5T3XL 3RVWC 5MI0C 4ZMAT 4ZODA 1M6OB 2OL3H 4NIKB 4RFOL 5E8PA 3UJIH 5IBLD 3OAYK 2HTLC 3GJEA 3QG6B 2X9WA 2E27L 2Q3AA 4FNLL 2VDQH 3MV9E 1CZ8H 4LCCB 4OUUB 4LIQE 1EVTC 4QTIL 3SQOL 4RAHA 4UNVA 2EH8L 2ENSA 2YD9A 4XC3H 3SJVA 3L7EA 3CH1A 1CDHA 12E8L 2CMRL 3QCUH 4KZDL 2NY2D 4IOFC 1FL5B 3ZTNL 1U8PA 3QPQC 4K07A 3PQYD 4GAFB 4MVBD 1X5YA 5F96H 5CWSB 2JK5A 5JHDA 2DBJA 2B5IC 3KWWB 3FRPG 3ROLB 3V8OA 1HILA 4NNXB 3RWIB 2QQNH 2A1WL 3LKNA 4XHJC 1ZEAH 2D7TH 2WSKA 3MLUL 3T08A 4K3HA 5C2BL 6FABL 3UYPA 3ZDZF 3NIFE 4QRPD 4JGUA 3GO1H 1ACZA 3OAZK 1REIA 2EIZB 2AGJH 3KYNA 2VLRA 1KG0A 1E4XI 3DIFB 4QGTA 5IGXH 5A16A 4M62H 5GZOD 3E8UH 3WYRA 2AK1H 1RIVH 4I0CC 4GAJL 4EI6A 3ARFA 4QCIA 2YRLA 3TF7C 5ENWB 1QR4A 2H32B 4TSCL 5FM8A 3CH1B 4WRLA 1MIMH 4X4ZA 4F37K 1NGPH 3SEPA 2BK8A 3ZYJA 1IAOA 2Q86A 1U8PB 3OB0H 4G3YH 2KUTA 3D0LB 4N8VG 3DSFH 3UPRA 3QDHA 2CKNA 2JK5B 4UQ3B 5JHDB 1I1CA 3QXAA 1HILB 1U3HD 1QHPA 2A77H 3TVMA 3DECA 3LKNB 3MO1A 2DI7A 3RBSA 3BQUA 3H7LA 2D03L 5EPMA 4EN3C 2LTQC 1Y6NR 4F80A 4Q9QH 1K9TA 3KYNB 2VLRB 5FYKL 1X7QA 1N59A 1MAMH 4HCRA 1T5WB 5A16B 3VCLA 1MH5A 5KVFH 3BP5A 4P59L 4Y19D 2D0HA 4F7MA 5CFHA 1EJOL 2A74B 3GMNB 1M71B 2IJ0C 1I9EA 4IRJA 4Z76B 4NQVA 3Q3GA 1SBSL 4UT7L 1EGJA 5D1QC 4EI6B 3ARFB 4LSVH 1J0HA 1GGBL 2FB4L 1NL0L 3TP4A 5CEYB 4JPIA 3IAPA 2CRMA 1YEJL 4H8WC 3ZO0A 3WMSA 2QQLL 3CPLA 2Q86B 1AGBA 2K1MA 1NC4D 3QDJD 1AGDB 4OBRA 3LAFA 5C0AE 2L4OA 4K71C 4WU5A 3GIVA 4P3CH 1MCOL 5DR5H 3TVMB 3MO1B 4FFYH 5C86A 1IGJA 4R4NC 2O5YL 1RUML 5F8QC 3K81A 4H8WH 5KSVB 3BQUB 5EPMB 4JFHD 1AQDA 1K3IA 4NQUA 1X7QB 4ODXA 3WSQH 2MTPA 4JRWA 5D7KD 1LK2A 4TNVF 3VCLB 1MH5B 1H3GA 3BP5B 1OGAD 2BMKA 4F7MB 4ZFFA 3SN6N 1ZLUK 5LGHL 1MRFH 5AUMA 1KIRA 3ULUE 4J3XA 3MA9L 2YWZA 4IRJB 2JELL 4NQVB 5C0IB 1I3VA 1I8LA 1EBAA 4UV4L 3VMOA 4KDTA 2NY5C 4JPIB 1IBGH 5L0QB 4F9PC 1WISA 2EXYD 3RX5A 4K3GA 2NNAA 1CDYA 5C70A 1JFQH 4YEEA 3VW3L 1U0QA 2OS7A 5CILL 3HS0B 1CFSB 5BS0D 1QYGH 2NXYC 4WU5B 4R26L 3LPFA 4G9DA 1BVLA 4JFOA 3GIVB 4OLWL 4OQTH 2NY5H 3GRWA 1IGJB 3G6AA 4PYHA 1FSKB 1I8IB 2XG4A 3PWPA 3SGDH 4GQ9H 5KSAA 1RZKH 1AQDB 1MFEH 3CVHH 5C0DA 3SCMC 5IB3A 3MRLA 4CU6A 3OJ2C 4NBYB 1LK2B 5BRZE 5J0BA 3MFFA 2NYYC 3R0NA 4M43L 2BMKB 4V1DE 5HVGB 4ZFFB 1GCFA 3ULVF 1C1EL 3WS6A 4U7KA 3G5YA 4CVWA 3TA3D 5AUMB 3EOTH 1ADQA 2M2DA 3FB7A 1IT9H 2HT2D 3VGDA 3AS1A 4GKOA 4M5YL 4D3CL 3CLFL 4JQVC 3V5DB 1ONQB 1P4LA 2J12B 2CDEA 2WK2A 3R0MA 4MWFA 1KJ2H 4WV1A 4YGAB 1FNAA 1DEEA 2NNAB 3CSGA 1PY4A 1ZHBA 1IGYA 5IQ7H 2QQKL 2BRRH 1XGRB 4ZAKD 2XKSA 4RFNB 4JKKA 4XPGL 5T1LD 1J1OH 1MLCA 4YHNA 1KCUH 2W91A 3U0WL 4WO4A 4QF1A 5KSBF 4G9DB 4JFOB 2BSED 3NPZB 2AS5M 5ISZA 1QACA 2ARJQ 2X89D 3G6AB 3O2DH 4M7KH 5KSAB 1KV3A 4OCWH 1WWCA 4YHMH 2X10A 1KN2H 1AKJA 3MRLB 3NA9L 3OAUH 5L6YL 2ERJB 5C0ND 5H35A 4F9LA 3MFFB 4WFGD 1SM3L 4Z78A 4Z7NE 3G5YB 4HIXH 1OAQH 4LBEA 1NMBL 3KPRE 4U1MA 3FB7B 4YZFE 1D5IH 2X9YA 4NM8L 5MEQA 3C08L 3V9FA 1ZMYA 2J8UF 1P4LB 2CDEB 5EUOF 4Y1AD 3O2VH 4KKBD 4MWFB 1HCFX 3ULVD 4WV1B 3W39A 3HE7C 1DEEB 4JPKH 1ZHBB 3BPOC 4WU7A 5ID1A 1IGYB 3FT3B 4KU1A 2AJYL 4MNQE 3HHRB 1ZVHA 3ARYA 3MLYH 4K8RD 1MLCB 3ZKNC