1RPUA

Crystal structure of cirv p19 bound to sirna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
138
Chain Sequence
DTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDENPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Size selective recognition of siRNA by an RNA silencing suppressor
pubmed doi rcsb
source organism Carnation italian ringspot virus
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP
total genus 41
structure length 138
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03220 Tombus_P19 Tombusvirus P19 core protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1rpuA00
4JGNA 4KTGA 4KNQA 1R9FA 4J5VA 4J39A 1RPUA 4JNXA 4KQ0A 4JK0D
chains in the Genus database with same CATH superfamily
3OR7A 4LCUB 4Y2DA 3JV5A 4YPGA 3B2VH 1ZT4A 4U6VL 4X5LA 2WCPA 4NQCB 1AANA 1CICD 3VI4A 4UQIM 5C0GB 4ANWA 3FSZA 1AI1H 3LIZA 3OWEA 1OO2A 4RESB 5T1JA 1FVEA 3C12A 3LZRA 4NN5B 4OGZA 2CO2A 4ZX3A 1BV8A 4WI5A 4DUWA 3CDFA 5BZWB 4HAFA 1J8HE 3LKRA 5DUMH 3LPFA 1EUTA 5AOZA 3VQ2C 3QFJA 2BP5M 1KJ2B 2HP4A 3WE1A 3LPOA 4PJDB 3E6FB 1CXIA 5KYYB 3VW3H 4GSUA 2MFNA 2HT2C 1N2RB 5F44A 1P2CB 3H54A 3FCUB 4XVTL 4Y4HD 3NCEB 2DL9A 3S3JA 3UTSE 3V4PL 4YDKH 1NGYB 4TPRH 4WO4D 1ETZA 1KIPA 2XWZA 4XR8C 1UC6A 4R96A 4FP8L 2EC9T 5HHOB 4TUKH 3UYPA 2DQHH 1QZNA 3P4LA 4XXWA 3VFUB 2YRBA 5L2JB 1KPRA 1UT1A 2BHFA 5IR1A 1MJJA 3FQTB 3C5JA 2PETA 5FFLA 2HLFC 2F74A 1FQ9C 4JUTA 4LCWB 2BW5A 4OJYA 2CUMA 2Q9OA 3BD4A 4F8TA 1MREH 3QAZC 2LVCA 3NJHA 1AQMA 4KNQA 3D3VA 2PCFA 1GS7A 3QG7L 4X5WA 3IDUA 3ZL4H 3TWCH 3NJXA 3Q2CA 1R3HA 2VRQA 3GLZA 3K46A 3PGDA 2XPGA 1FH5H 4BZ2L 1BVNT 5I6XB 1NLDH 3MUGA 2X0VA 4U1JA 2MJWA 1C16B 5CN3A 2BCMA 3DVNB 1F4XH 4LLUB 1PFCA 1FL5A 1CMOA 2VDPH 4X6BA 2ARJQ 4WKZA 3DWTA 1ZD6A 1PKQE 2N4IA 3N44F 4HIXL 1ZLSH 1G7HB 1UWYA 3KPSD 4OB5H 4P57B 4OCSH 1IT9L 2XA3A 3LPPA 1KYOK 3TN0C 3V4PH 3ARBD 4R8WL 3L5JA 1K4DB 5J1AB 2CDEA 4LZKA 1JFHA 5E56A 4W1TA 3BW9B 1MWAH 4MCMA 5T3ZH 1AJ7H 1QNZL 4PGDB 4XOEA 3HIZA 2YZ1A 4BA0A 5E5LA 1KXVA 4X7DC 4FA6A 2BK8A 2VCOA 3DUSA 1YCSA 4Y19D 4BXVA 5JPNA 2PXYC 2FQDA 2H1PL 5A43C 4ZX4A 1TEYA 2X4SA 3BVUA 2E7CA 3HG1E 4IJTA 4K94L 4HIJB 4Y5YA 4BZ1H 3BKJL 1H0DB 3GMLB 1F41A 3L6FB 5F96L 1S78D 2OQJB 1OT1A 5E4AA 3FUHA 4BFIA 4XOBA 3RZCD 4IU2A 2P5WE 4X6FB 4XWGL 1SGKA 1RK1A 5H8DA 1HXMB 5EU7E 1PG7W 4WO4A 4HJEA 4JFFA 5D1QB 4YSEA 2B7DT 3FUEA 3IU4L 1X5KA 4MNGB 4NP4H 3M1CA 3SQRA 4PJAF 1IILE 1YUKB 3TP4A 1CF8H 5BO0D 5KJRH 3B34A 4OZHA 3QEUB 4UILL 5BVJA 3EO0A 2ZAHA 2VLLB 1R33A 1BLNB 2R29L 5C09B 4OTXL 2VR9A 4K7PL 2FBOJ 3LZFH 5CJ8A 1BMGA 2JKLA 3RZCB 5JOEA 2A83A 2GT9B 4ODVH 2H3NB 2YBGA 3FZUD 4ZX5A 4JM2A 4OCYL 2Y5TA 4OZIF 5C07B 1XBRA 1WAAF 2UWEE 3FTGB 4MNQA 1WK0A 2B15A 3UABA 1SEBA 4LVNB 4ODTL 2ZUVA 3NCCB 5BJTA 5KYUB 5E0FA 4OF6A 4W4OA 2DLFH 3CX5J 2B59A 4IDLA 2WQRA 3LS4H 1JZ5A 1QSFB 1KBKA 1S9VB 4XGZB 3IJHB 3BP5A 4U1SA 3CXDH 4I0CC 1XH0A 2DTML 1RUMH 1F8TL 2HUHA 4JREB 1OM3L 4WKZB 1ILUA 3BKJH 1IGJA 1UUSA 2JXMA 5JMRA 5L0QB 3MBWA 4NN6B 3MLTA 1PEZA 5LN8A 5GISL 4P46B 2JQZA 5KBPA 2WXMA 4YE4L 3HR5A 1HCVA 1Z9SB 4YVNA 2BWIA 1ZDSA 5KYXA 3WCYA 4FEMA 4I89A 4XNYL 3IDXH 4XXCA 5I82A 3EJCA 4NUJB 1S9WA 3FTYA 1H3XA 4AIXA 4F37F 1TJIH 2SODB 1QVOA 4XBPB 3P2BA 1E6OH 2BVUA 1NBVH 4X8GA 1I8AA 3EJRA 1RULH 1TFPA 1WYJA 1A1MA 3S5YA 1OF2B 2CO4A 4MYWB 4KZCA 2EUZA 4HW6A 1OAXL 3FRPA 1I9RL 3QRGL 2YAPA 1BIHA 3AWGA 5H37H 4GSQA 3MGTB 3DROA 3X17A 5IR1B 4RMVA 2BIIA 2EH7H 1JYVA 4GW5A 3VYNA 2FYYB 1WD9A 2VDMH 2WLLB 2VLKD 2YKLL 4MZ3A 5JPMB 1KIUB 1T4KA 5E5MB 2Q5BA 5AL8A 1G9MH 1DE4A 4M8UA 2IJ0C 4PJCA 1A4CA 3ZQWA 3RX5A 4YMPA 3K8MA 1F86A 3ARTA 4KJYA 5FGBA 2VDNH 1DEEB 2N59A 5A16B 2ADJA 4QT5A 3EO0B 3FQUA 2FLMA 1KTLB 1WZMA 4L23A 4E9TA 5CS7A 3TEYA 3BPLC 5D4JA 4XCEA 1WIPA 4N8VB 3WI9A 1BD2D 2BIPA 3A23A 3COOA 3PHOB 2MHAA 4XPAH 2XTJB 3FHAA 3C8HA 3DOSB 4Y19A 2ZSWB 3LRMA 5I1KL 1A7RL 3NPSB 3SEPA 2FWUA 2FECL 3GSNH 4Y88A 1P5UB 4JDVB 4MJIA 4BYHA 3M1OA 3RL2A 1RCYA 5AAWA 2ZG2A 3TCLB 2FR4A 1LP9E 1KB5B 1JTOA 4YDKL 1T7VA 1G7LA 3BQUB 2WUBH 1UOLA 4P5KA 4BV1A 4BM7A 3R8BB 1CC3A 2RB8A 2W9EH 4I18C 2WSKA 3RI5F 1BM7A 3X1NA 2APXA 3C5SA 2GC7C 5C08A 2BLFA 3V6FB 3GM0A 4Z6AT 5LGHH 1Y1DA 1XO8A 2KDYA 4Y5XA 5KYXB 4YBLB 2IBBA 3IAGC 1SJHA 4FXGA 5I18H 4Y16A 2CMRL 3G3LA 5CN1A 4HJJH 5LG6A 3HN5A 3EG9B 5CINH 4N2MA 3HHMA 4JLRA 3L1OH 5C7XH 1JCVA 3ILQC 1R9FA 4MMZA 1U3HA 4TQHA 3V95A 1AZZC 4MJ6B 4JFYA 2BNUA 2Z4QB 4HS3B 2CBQA 3LOWA 4XMTA 4WO4B 4XN1A 3IWUA 1PZ5B 3MNDA 5C0FB 3S34L 1NSNL 1UADC 3D51A 3D39B 3SBRA 5ETUB 2IGFH 2KKQA 2PO6A 4WV1A 5LAXA 4KK9D 1XQ4A 3L5HA 4JDTH 4QRQB 4XO4A 3EW3B 1E8YA 1DQML 2QVIA 3FH5A 3RIFF 5C3TA 3VXPA 4MNQB 4KRPC 2FATL 4ELMF 1PYWB 2CALA 2IQ9H 3VSVA 2WYTA 5AAMC 4JPSA 4G5ZH 4TUOA 1W0WB 1WF5A 5D2NE 2PPDA 4R8WH 1HH6B 5I6KA 1EGJA 4NBZB 4NYLA 4PSPA 3BIKA 2YUZA 2NY4C 1YEWA 2HG0A 2Q7YA 3LN5B 3SE8H 3M86A 2XRAH 3W9EB 2NR6C 1FF5A 1QWUA 3D33A 4HJUA 3V0EA 1A4JA 5IBUG 1G4MA 3O9WC 2E76C 3G6AA 3WIIL 3G9AB 5CAYB 1IM9D 5DYOA 2J5LC 4ATWA 5A7BA 5ITFA 3IF1A 1GGCL 2HG5B 5CCHE 5DEFA 3UAJC 4GQ9H 3TM6A 4WUKH 5FYJH 3BWAA 5C0IA 2TSAA 4Y9EA 1TMQA 4RBPH 3ESVF 2F7QA 4TXVB 1NEZG 4QRTA 2ZXEB 5TD4A 4Z3FA 3UCRA 1P9MC 1F11A 4S11A 3O2WL 5JXAL 4F80A 3CFKA 2AJVL 2BFGA 5D7IF 3GSRA 2BOCB 2FSEB 5CJXA 2F7OA 3ZIYA 5D2NA 2QSTA 3FCGA 5C0AE 1SFDA 3IBOA 5DRXA 2DDQH 4QXGH 1XTMA 2NZ1A 5MI0B 3D06A 1INEH 1F45A 5DJCB 1A64A 2FBJH 4B0MB 3PWPB 3D2UB 5HYJB 1DLFH 4QOKE 1WGVA 3ARYA 4AQOA 4WJKB 2C3HA 3CZUB 3MLVL 5KSAD 1JP5A 2V5SA 4YSRA 4ETQB 2J8UB 5AENA 4X99B 1OEZW 1UXWB 2WBKA 4HCRH 1RQ5A 4OCYH 3RJDA 3V8CA 1V7NH 3WXVL 4EJ1C 2Z4QA 5KVEH 5GGVH 2BJMH 3RVXD 1QLEB 4CJ1A 5CFHA 1C12B 1XAUA 3GMPB 3U6RA 1E4KC 5IVXA 3ARBA 4OCMC 2PO6B 3MRBB 3KPQB 4FQLH 4JCWA 1Z3GH 4Y4FB 2J1WA 1BFOB 1J8HA 2QADC 2NT0A 4H5SB 3LZFL 2EEAA 5LJYH 4HLZH 3PWPD 4UAHA 3DX9B 3HHSA 3TBWB 3TEZA 2WK2A 3SO5A 1R6VA 2D4FA 4ODSL 4EZJA 4FHJA 4JB9L 1IC7H 3W39A 2YPLE 4HMDA 2EYRA 2VDKL 4GRLA 6PAZA 3N85H 3CC1A 4YXLL 1KMGA 3LZQA 1ZLDA 2C4XA 1R0AL 4YBQD 4J3TA 3ZYJA 4L3ED 2A73A 4GO6B 4UZUA 1HHJB 3OKLA 4ZMYA 2NXZB 5I5JA 2P8MA 1RZIB 5B38G 3QQ3B 1XMWA 4ZMZA 4M6NH 2PTVA 1HWHB 1HSAA 3QQ4A 4Y1TA 4AMWA 1D5ZB 1X5AA 3ZSSA 4N26A 4X6DA 1GR7A 3OGOE 4I1RA 3S96B 3NP3A 4M7LL 1L0XA 2DJSA 3Q6FB 4K23H 2QV4A 3WO4C 1IBBA 4JFEE 2OMWA 2X1QA 4X6BB 5FPIA 3E6HA 3D85B 1ANUA 3PHAA 3CDYA 5EC1B 2CLRB 2GK0A 2J6EH 2WAQA 3D08A 3DO7A 1M7DB 1HKLH 1V05A 3Q1SH 3UEQA 1M6OA 2QPFA 5L2KA 3UTQA 3TA4D 1F1AA 1IKNC 1PZ5A 1KV3A 2PXYA 1UD6A 3SGKC 5T1KA 2NUPB 5I73B 1VFUA 2X44D 4QR7A 4ZZFA 4ZNEE 4LGPB 3MRGA 2VL5A 4GBXD 1M6UA 4A66A 2BPBA 5A3ID 4M56A 4MTMA 4B5EA 1HI6A 4XP9L 1T83C 3TBSA 4JO1L 4QRUA 2EZ0D 5E2WH 3ZGHA 4QY8A 3RTQB 3HG5A 2RMNA 2PN5A 3BEVB 1A6ZA 4ANUA 5EUOF 1YEKH 3PNRB 3MLZL 2R39A 4LQFL 2DWEA 3PXLA 4XI5D 4ZS6C 5KJ7E 3O2VH 3BH9B 3JWDC 1F02I 3PWUA 2XZAL 4MHHI 3VD7A 4EDWH 2VXQA 4Z7OE 4X6EB 2BS8A 5BXFB 2WP3T 3MBXH 3ZGIA 2MOGA 1J1PH 4JFZL 2VDLL 4L4VB 3RWEA 3V0JA 1HEZB 3DXAD 4HFUH 3VJ6A 1YNTB 3S9DB 4UYQA 1Q90A 3OG4B 3QDJA 3FO9B 4BWWA 2CJ3A 5IQNA 5T3ZD 2ZPKL 1A7NH 2HWZH 3U82B 1KGCE 2EDHA 3CVBA 5ICZB 2FE0A 3RFZC 4A2EA 4OLYL 5FCUL 1N5YH 1A1OB 4Y8DC 1NFIA 2OZ4A 1UZ8B 2H6OA 3VMNA 4WWKD 2CM5A 1U95A 2XG4A 3FXIC 1J5CA 1UJ3C 5KSBE 1SXAA 1QR1A 4WCYL 4KRPB 4LSSH 3M1BB 3QUXA 1AXIB 3KLAB 5IFAL 3C9NA 1PCSA 1E8ZA 2NZIA 4KK5D 2FHCA 1MNUH 2EYSA 5CCKL 3R18A 4WI2A 4NKMB 4XN2A 3S8WA 1IEBB 5AYUH 4KY1L 4R4BA 3D9AH 5I1GH 2ITFA 1CGTA 1VENA 3WUWA 3IEAA 4OGAC 3S34H 3HE7D 1M7IB 1CDJA 1LE5A 4R0LA 1J7VR 2GJ6A 4M7LT 5DUJA 5BQDA 3LXBA 5TPWH 3MAWA 3SCMB 4Z3JA 1HN1A 4AZ8B 4MMXB 2HUEA 1OSPL 1JZIA 3WUWG 4AEFA 3N2JA 3QXAB 4D8PA 1U58A 4QKXB 1Z2KA 1IBGH 3SKMA 1BSIA 2P8LA 1F6AB 2KQMA 1UUNA 2BOBB 1M1XB 3RY4A 1H3GA 1JK8B 3FUFA 5DZOA 3NSCA 2VLRB 2X6MA 4PN6A 3UC2A 2J8UA 2YLHA 3AQDA 4S0TD 4QXUH 1BFOA 1J8HB 1OE3A 1BZOA 3Q0HA 4OKVA 5JO5B 4B95C 3MOBL 4PH8A 4OLZH 1XCWA 5FGRA 1PLAA 3KD4A 2WLZA 3VRIA 2QZQA 1I4FB 2OMYB 1LO3H 3PABA 3EOTH 3APMA 3LVTA 4FXKB 5FLUA 4F7MA 3MBEB 3P3RA 3QA3B 1E9QB 2EE2A 4JY5H 3U1SL 3I6KB 1P4LA 4OVVA 2J6EA 1YMME 4GG8A 1AG0A 1JGVL 1ZS2A 2R2HA 3AMKA 3K2UL 5GGTL 4LSPL 3JSSA 5JXED 4NHCH 2EKJA 4LLWB 4PTUB 4FQ1L 2PWEA 4OW6A 3K1DA 1YNLH 3WN5B 1T83A 3P40A 4IRSB 2F5AH 5T5FH 1JGIA 3MGOB 2XIBA 3D52A 1AR1D 3H3PL 5D7IE 1KG0A 3QDJB 4HXAL 3MNZB 5IFHL 1LEGB 2A73B 4F9PC 4YIQB 3CIAA 1IUZA 1I9IH 3SDDC 2W07B 2QVTA 5EPMA 2E9JA 3LZNA 1S7SB 5I16A 1UACL 3BN9C 4N6RA 4E9LA 4WUKL 2R4SH 4G6FB 2WVVB 4U1MB 2IDUA 1M53A 2ZOLB 2WXKA 2X2HA 4WY7H 4W9FC 3HI1B 1AOZA 3L3DA 4PJBF 1AXSB 1P84K 4PS4H 4ZS7H 5I8CB 3ZL4L 4DEPB 3CK0H 1A7QH 3ABMB 1FG9C 2RQ8A 2QHRH 3R06A 1TZGH 4PLKC 2D7NA 5LNGA 2X89D 1NH6A 1KULA 4BD4A 1M7IA 2MRYA 1M2VB 3SBPA 2LTQB 4OZ4B 5D7IA 1ZLWK 5IB1A 3FB7A 4UB0L 1M71B 3GSWA 4NLAA 1AYRA 1EZLA 5D6DC 1CDBA 3FQWA 4JM4H 4BQ8A 4NQSB 3V5DA 3NIGE 2PR9A 2WIMA 4M03A 1TITA 4DGYL 3U0PA 1LP9B 1W8OA 2ZUUA 3MRMB 4NKDA 1ZTXH 4D9LL 4HC1L 1KJ2A 5CEZL 3LKQA 2B1AH 4TUJA 3MRRA 2V5TA 1T1XB 4ZXBB 4ANVA 2AF2A 3PDOA 5A6IA 5HDWA 3FU9A 3BAYA 2IQAA 1MHHB 4GS7B 2BNUB 2A38A 1GGBH 4G83A 4BH8B 3NABL 5DFAA 1VADB 5EFIB 1ZK5A 2A6JA 2C3WA 3LKRB 1MFUA 3QFJB 4UINH 3UYPB 1HOCB 2QSVA 3C09C 3MI6A 1E3XA 1SEQH 4S2SB 3F7QA 4PWIA 5DR5L 4JFFE 4OGYH 4HIHA 1HX0A 1OP5H 1CGSL 1IQDB 1NFDE 3QWOA 4XMPH 4YR6A 3UJTL 1DLHB 1XZWA 1XFPA 1UA3A 2EIJB 5TF1L 3S5ZA 1HC1A 3VXTB 3PWJA 2XQYG 2BVPA 2ZKMX 3B2MA 1I1YA 1VACA 4NNPL 2NY1B 5F71A 4Z3GA 4KTDH 4YAQB 4HF5L 4ELMB 4A7GA 5EEWA 4LOUC 2XY2A 2WV3A 4GQRA 3QZWG 3SDCB 4ZW3A 3HG0A 4QPEA 3HR6A 4C57C 2WWNA 3GMNA 1OAYL 1VRSA 3VXQB 2BNRA 2AQ2A 5ABZA 2PCPA 4MJIE 3O8XC 4M8QB 2F19H 2X4TB 3I50L 3R0NA 1I9EA 4PJ8B 4MB5A 3O6ML 4CKVX 2VLME 2LLLA 3BZ4B 3ZZLA 4Y4KD 4YUEL 5I8CA 5F96H 1RZGA 1ITCA 4S1SL 5B7FA 1SF5A 4QAWA 5DTFB 4AQ8C 4Z5RB 3ABKB 4JG1L 1MAJA 4ENEC 3RVVD 4RFEB 3U0WH 3KLDA 2EE6A 1ZJBA 3JVGC 3QPKA 2YK1L 3II3A 3EO1A 4MJ2A 2GJ6D 5IB1B 4PBDA 3NG5A 1JNNL 3L5XH 3O41B 5AB9A 3HE7B 3CVCA 4M3HA 3WTVA 4D9RD 4ABUA 1KT2B 1Y6KR 2KHAA 2D0GA 4HEPA 1L5GA 1PZ2A 3QUKB 4M6AA 3PV6A 3QZPA 4PQXA 4R97B 2FJSA 3RI5K 4OR1A 1H0DA 3L6FA 2OA9A 2DLTA 1R5WA 2WKOF 3DMMB 1ZV5A 1I4FA 3M17A 2A1WL 2CE6A 3N43F 1YECL 1Z9MA 3QUXD 4XCYA 3MHZA 3D87B 4ZMXA 3V5KA 3CDGB 3QC6X 5FHAH 3NJVA 5C0AA 5T1DL 1ZHLA 4TVUA 2CKNA 4U2YA 1QRND 2DD8L 2IADA 2ZCLL 2NY5C 3TGXA 1Q9OB 3SKUD 1QA9B 4WWID 5HYSB 3KLKA 3CZGA 5DJ2B 3EJUA 4XH2A 2IALA 1U93B 3MNZA 1P7KB 1OP9A 5JQHC 3GHBL 3JV0A 3QUZD 3MO1B 5EN3A 1PZ3A 2OXHB 1YMHB 4RDQG 4ZPTB 3MBEC 4FNSA 4Z76B 5KAQG 3HPJB 2NY6C 4U6XA 3SY0B 1R3IL 3BVNB 4LAQH 4ZYKB 3AC0A 3BMVA 4WI3A 4X7EC 3EJJX 4ZDHA 3VRJB 5D96B 3T0ED 2EACA 5KW9L 2J21A 1MCJA 3CSFA 3VXRD 2F7RA 4MJID 5F7AA 5EO9B 3VE0B 5DA0B 4PVMA 4IQHA 3UACA 3RKDD 2FL5A 5LLIC 3ZTCC 3OF6D 4FQ2H 3BSZL 1LP9A 1NKOA 3MRMA 4NKDB 3ZTNL 1HEJC 4OD2A 5E6SB 4HHAB 5D1XA 4RSVA 5CBEB 3QEHB 4JPKH 5DZPA 2O6EA 1W0YT 3O9WD 5FYJU 4GXVL 4U1GB 3U6XA 4AQAA 3K91A 2JSFA 2OR9L 4G7SB 1AKPA 3ZHDA 4KRPD 1K6QL 3TA3D 1RFDH 1TOXA 4M61B 1TTBA 3VRLF 4AMKH 3OKEB 1DFBL 4M48L 2E9GA 3U1PA 15C8H 4TUJB 4IJ3C 4YL4A 2APFA 3SE9H 1K9TA 4MYPA 4JRYE 4KRLB 1HZKA 3T6WA 3L3OA 2DQEL 1CK0L 4CSPA 2C5DC 4P5SA 2PPFA 1OK8A 2A9DA 4UNIA 2Y06H 4YS4A 4U0RB 4W9LC 5CLZA 4DPRA 3GXDA 5IG7A 1MELA 4KC3B 2FQFA 1Y6MR 1N0LA 1BQKA 2XQYA 3V5KB 2P26A 4DCQB 1OWRM 3D39E 3DURB 2DZEA 3AQYA 4PGBB 1WTGT 1XCQB 5SX4H 3NESA 5D2LA 1OCWH 3WKQA 4ZUSA 4L4TA 4JX0A 3ARGD 4ZSOB 4UUJA 1EZVY 1HILB 5C2BH 4H25B 1LJMA 1TENA 3STZB 1NL0H 1A9VA 4QHUA 3Q13A 4NRXA 5AVSB 1WBYA 4UBDC 3V9FA 1L6XA 1E30A 5INDB 1A2YB 4PJCE 2VRKA 3FRPG 4XC1H 1HWWA 1E5BA 4JPQA 4WY7L 1BBDH 3MV7D 4PJ9D 4N8VA 3DLQR 3KYAA 3CTTA 3QNZB 5DTFA 3ASWA 3D1MC 4UIMB 2PCPB 1Q9LB 1P4IH 2D7PA 3ROLA 5ADOH 2GKIA 2Y69B 1DDTA 1S4IA 4G5ZL 7FABL 3VFTB 1T0PB 3BPNB 3QFDB 4GG6B 4NIKB 4XPGH 4XHJD 4X7FC 4I5BA 1KZYA 4PJ7F 4XNUH 4GMTH 5D55A 5BO1L 2QVMA 3CWGA 1JAEA 1OT2A 3MRHB 3N0AA 4O02L 3V8OA 1ORQB 1HSBB 5C7XL 3ENEA 3LQAL 1MCWM 4HT1H 2COQA 4C47A 3SZ6A 3FN3A 4K7FB 4R4FH 5G4OA 4GQPH 1PY4A 3HJEA 3DETC 5FV1L 5CLTA 1ZS8A 3NFSH 4ZAKC 2FIRT 4YOKA 4IBQA 5EBLA 2P9RA 4R9HA 4PWKA 4RFNB 5C86A 4YSOA 3BFWA 4N2AA 1A6PA 1GA2A 1JPSL 2OSXA 2YPLA 3T2PA 4JFQB 3LRGA 1E43A 4DZ8B 1F3RB 3V4VL 2UWEF 2XTJE 4ZPVA 3RWDA 5KS9F 1F2XK 4NAJA 3AROA 4OFDA 5D71H 2WMPB 5MEQA 3KLHD 1UENA 3FL7A 1CLOH 3DUHA 5EBMB 2Y6SD 1AC0A 3WSQH 2FD6H 3VFOA 1SQ2N 2X6UA 4Y4FC 3N50A 3L48A 5E9DE 5F9JB 4RGNB 4B9GA 4J3XA 1RJLB 5AOLA 2E3VA 1XB6A 3BP4A 5H37G 1U8JB 5B1AB 4DZBB 3UG4A 3OX8B 1U8PA 5CWSB 5HI3C 3T5WA 2AV1B 3BJLA 1BREA 5I19H 3TZVA 1CXHA 5AQ0A 3VFVB 2CLZB 2L7EA 1COBA 1RZJH 1F00I 1OW0C 2ODHA 4Q9RL 1EDYA 3SDDA 4QRSA 2W88A 4NCC2 1KB9J 3GMRB 4WNSA 3UADA 4KUCF 2IAMC 3AFLA 3LQAH 1J18A 4YSDA 1KB3A 1ODAA 2HLEB 5MENE 4RIRB 4ZYKA 4TUUA 3V5HB 1FZKB 2G75B 2X9WA 3UCQA 5E00A 1KWGA 1WA0X 3LYRA 1TO5A 4L3AA 3TT1H 3SPJA 1RHHB 2H2PD 1ZANL 3QO1B 4ZO6A 2B3RA 3BKCH 2VKWA 2W1NA 3I9GH 4HWBH 3VXUD 4KITB 3RPKA 2A6DA 1YEGL 3L1FA 1KDJA 5E1AA 1YMMD 5C0CA 1FFTB 5IB4A 1MVFA 4Q8BA 2VZ1A 3OSKA 4IKKA 1UG9A 2R69A 1LK2A 2CJUL 2DQ6A 5ITFB 4TS6A 4HCRL 4ILDA 1E27B 1JNNH 3L5XL 4MXVF 4NP9A 3T08A 5I1CL 4FI8A 4JRXA 3ES6A 1XD1A 3ARXA 3I3EA 1KXTB 4X7TA 4YL9A 3UC0L 4BZYA 1YEDB 5D4IA 3ATBA 3SKNB 4AENB 4J2XA 4HJSA 1LK3H 3LN9A 4Z7WF 5JQIB 1M7XA 3O4LA 4ODUA 4HZ1A 4N86A 2IDFA 4N8PA 4P4KC 1JN6A 1WE5A 1KBVA 5HGAA 2A1WH 3IJ7A 4UT9A 3EHBB 1OHZA 3L9YA 5C8JB 1JZFA 1VERA 4XVJH 1T1YA 4L9LB 5T1DH 3DETD 5F1KC 3LIZH 2ZXQA 3U4EA 1J5OL 3FAXA 3MV9A 3RZCC 4A1RA 1CFBA 5CINL 2WAHA 1X4YA 3IDNB 3CE1A 1FL5B 1QFWH 2X5PA 4DGUA 4K8RD 4M4PA 3WS6C 4OV5B 2YFOA 4TRPH 1PD6A 2YD5A 1NKGA 1W8NA 4JQVC 5C09D 4D0CB 1SMOA 4QJ4B 1EXHA 5K9OB 1NM9A 4PV9B 4BSWA 3CU7A 2IGFL 3ZTJH 1V3KA 1FO0L 3GJEA 3HLKA 3SE3C 1X4XA 4XPBL 3O3BA 2GCYB 2XQYK 2CUIA 3EGDA 3UJIH 4JFEA 4EN3D 4Y0GA 4IGBA 3TBVB 3GO1L 1NAMH 3GB7B 3V79C 4K7PX 1RZPA 1L7IH 4WUUE 1IAIH 3RJOA 2J8UE 3OD3A 3N41B 2R1WA 1EAOA 5K1JA 3NCJH 5E2VL 5AW8B 1D5ZA 4WEBL 3EOBB 1O5DT 4DKTA 3FB6B 1RIUH 3QJQB 4FLQA 2HJKB 2P5WA 4MMXC 4OJEH 3IFPA 2YQ3A 1JNLH 3LX9A 1MI5B 3CXFA 1IZKA 4ELME 1BQHG 4PLKD 3DO7B 4FQIH 3IJYB 1GGTA 3MMEB 4PRHE 4U7KA 4W70A 4NUGH 2I9TB 4O5LH 2YPLB 4GAAA 4BBWA 1E27A 5CEYB 5E6IB 3V4PA 3KLQA 1PL3A 3SDXF 2DQFA 3UYOD 1N5AA 3FO1A 3NCMA 3N1FC 1CICA 1QEXA 4NZJA 5GRYA 1F6LL 3FT1A 4AXWA 3E8VA 4AC2A 4JDZB 1NCBH 4NOBA 4JN2B 1C1EL 2JJUA 1E4HA 3OR6B 3BQUA 1FO0A 3UAFA 5C0BA 4J3OD 4G6AC 1NIAA 5F3BA 1KDIA 5EOCJ 1SOQA 3RTQA 4XC1L 3LRHA 3NTCL 1XF1A 4FFZL 2QTEA 3TYGL 4B9KC 4UTAL 2CKBA 3QNYA 4LEXL 4LRNL 5GIRB 4UYPA 4OZIB 5IROC 4DH2A 4AIOA 4EZMA 1DL7L 3DBXB 4DP1X 2WUCL 4UNUA 4O2FA 2Q6WA 5HHME 3SB3A 3VSUA 3X11A 4IRZH 4BELD 3EYFB 3C60D 5A7EA 4QIRA 3QVAA 4LHUB 5JQ6H 1TTAA 3M7OA 1GZHC 1G5GA 3BEVA 4WW2B 3WIFA 2X4NA 3U4BL 4HJGA 3U7YH 5L2JA 1RHHA 3MOQA 4XAWH 4NO2B 3X3GH 4Y7OC 3C60C 3L95B 2F74B 5F7EL 3V5HA 1TJXA 4K4KA 4N0FA 1FIEA 5L2KE 5F7UA 3AXLA 1JGVH 4CVZA 5IMLB 2HT3C 1RMFL 3GXFA 3ZK0A 3NP4A 1Q72L 2ZAGA 1G4RA 2NSQA 3DMMD 1XGQB 3HHRB 4MZ2A 5FUZH 4R4ND 5KUKA 5EF2A 1KLGA 2ESVB 3QJTB 3ECVA 4LNRA 1ID5I 4J3SA 1TVHA 3MOAH 4EI6A 1N18A 4ZFFB 1INQB 4NUMA 1U42A 2X2IA 1N59A 1FZJA 2GY5A 1SYVA 3MLPA 3R7RA 3TWCL 5BZDA 5IW1A 4KQ0A 1V7MH 3V0IA 3H9ZA 5DDHB 4KZ0A 3RVUC 4NM4L 2EVHA 5IQLA 4PGZA 3SSGA 9CGTA 1XF2B 2IWFA 4N2DA 1AD0B 3BYYA 3SBWA 4ZD3L 1ZT4B 3A6BL 1PDKA 4K23L 4RGOH 4HSCX 5D9SA 2C34A 3LD8C 1EZSA 5BS0A 4LL4A 3U4EB 2HCZX 4BQBA 4YXHL 4XO5A 4NJAH 1H8NA 5FO2A 1PKQA 3FU7A 3MROA 2BXYA 4XMLH 1Z1WA 1IGCH 3O6LH 3P4OB 2BNQE 3G04A 3BWAB 4YDIL 3FTGA 4I0PC 5D71L 5DS2A 5C0IB 4X4YA 3TH2T 3GSQA 3DECA 4GS7C 4AGLA 5HDQL 5MEPB 3NCYP 5KSBB 4XNDA 2OS7A 3OKEA 3SY6A 4XCEB 2EJ1A 1T5WB 3CN3A 3FT3A 5GRUL 1JWUB 4J8QA 1DVUA 3H9SD 4QTFA 1EDQA 5FF6B 4IRJA 1NANI 4DO6A 1BVZA 4U1LA 1OAKL 2W9EL 3IJHA 3AADB 3ME0B 1G9NH 1HJBC 3WHXB 3WGUB 1W0VB 3MODH 3PFUA 4XBGA 2B8OT 3ZL2A 2YRPA 3IAQA 3PV7A 4IU2B 5A2JH 1J5HA 1OM3H 1P84J 4PJXF 5HHPA 3FH7A 4WNQB 1JHKH 3EAKA 2Q3ZA 3BUBA 4JUSA 4ABVA 4M1GL 4XP6L 4PRNA 5E5UB 3PUCA 5DD6A 2H0EA 1AH1A 2EIKB 3KPNA 4IYKA 4LVHC 3VXUE 4DUVA 1R5VB 2HKHL 5MI0C 3I6GA 2R2BB 2BHUA 4M93B 4NO5A 1BPLB 1ZJAA 3GIVB 3B1TA 1EEZB 3WMQA 4NENB 4GUCA 4PR5B 3WJMA 1U2HA 4BSJA 4NQDD 5FKPA 1THCA 4AQEB 4LIQH 1IGTB 4JO4H 3QIWA 5C7ZA 1IZJA 4UQBA 5JORA 5JIIA 4K0OA 4PCTA 3NAAH 4GBXC 1B4JL 2BP8A 3IGLA 4OU3A 5EOTA 5TDNB 1KEGL 2BMKB 2GJJA 2H0JA 2IV8A 3SJVE 3VYPA 1NQBA 2EKSB 4MD4B 2HRLA 4GAJL 3QRGH 4Z77B 1UTDA 1MG2C 2OZ4H 2BZ7A 3GBMH 3US0A 4P99A 5IY5B 1DZ0A 2EDJA 4O02B 3FUKA 3GK8H 2ZWYA 2A74B 1FFNB 1L0YA 4BCYA 3C60B 5DDHA 2YSSB 2WNGA 2ALWA 2JCCA 1E6OL 2P80A 3A21A 5FA3B 4OBRA 4KU1A 3WD5L 4D9QE 1K4DA 1T7XA 2CBOA 3Q6GH 2IANE 4IOIB 2DJMA 1KB5H 3F7PC 4NZDA 5FOBA 3QQ9D 1PNDA 4ZFZA 3TJEH 1GGCH 2OZNA 1AS7A 2VDQL 2ZCHH 3B9KB 2XFXA 1AGFB 1DBBH 4ZFOA 1LO2H 1MI5D 4K2UH 3BN3B 4IIQA 1OTUC 4Y2OB 2QPDB 4OI7A 1DQIA 4RMWA 1T0OA 4XNQA 2XUWA 1I1AB 1HOEA 3L2MA 5B8CC 4L5FE 1RSFA 3DYOA 3KPMA 4HX1B 1CFVL 5IK3B 4L0YA 3WIFB 4B9FA 2Y22A 4UWQB 5CIPH 2PWDA 1MH5A 3SYCA 4L1DA 5IB3B 1NMBH 1WGOA 3FQWB 1GPOH 5AVYB 1I7RB 1PLGL 4ZQKB 3SDCD 5SWSE 4C4KO 3GSXB 4U49A 3W81A 5I6OA 3D6GA 3L95A 4NI6A 1P5VB 1BQHB 5J13B 3LHPL 5EB9A 4TLKA 2HXAA 2R9HD 5GS1B 5T1KB 2RBLA 4X6CE 4ABQA 4WUUD 4U2ZA 2NXZC 1R3JB 4YN3A 4WNQA 4H88L 5CWSA 2WD0A 4JHUA 3V6FA 4HWNA 2M2DA 4UM9B 4D8OA 2UXTA 2MEJB 2Y07H 2Z92B 4HLEA 5IMOA 1BLNA 3K6NA 1MUJB 1L4IA 4FJYA 2X1OA 4LVOB 4YUEH 4ODBD 2ZJSL 4IK7A 4LLQA 1JTTA 2J55A 4S2SA 5CZRA 2O5YH 4BCXA 2HLFD 2FX7L 2DJ4A 4EIGB 2HTLC 3HMWL 4WJ5A 3KPTA 3POHA 4G1EA 4E0RB 1IGTA 5JORB 2BSTA 2GVYA 5AZUA 4U05A 2V9UA 4P5TC 4MRBA 3ISWA 3N40F 3RIKA 1WO2A 3ZO9A 4Z7VE 5F9DC 5BOPA 1QUNA 2NX5D 1S7RA 5K69A 3D05A 1UEMA 1NCBL 2DQCH 1U41A 2PWGA 2Z1KA 1HIML 1P4UA 3MFGB 4FNUA 2VDKH 3F58H 3OKKB 1Z3RA 1DUZB 3IRPX 3H3BC 3F05A 3D3VD 1UOWA 3DUUB 4GIOA 4Q2ZA 4NWUL 3QH3B 5GS2H 4JO3L 4HUVB 5I30L 1QBLL 4V2BA 4IBSA 5DJYA 3K72A 5AZEH 3O8XA 3TO2B 2NW3B 4LB8A 3QS2A 5BV7B 2J20A 4UDTA 4Y8AA 4G8EA 3MCKB 4OT1L 4BDVA 3RY6A 2EUXA 1HE7A 1WFJA 2PF6A 5F9AC 2C1OB 4HGWA 5GGRB 4PV1C 3OQRA 1PD1A 3TFKC 2E7BA 1BQLH 4AW7A 4IIQB 1EA9C 3P9LB 2I60L 2ZOOA 4QRPD 5BZZA 1ECZA 3TTSA 1EAJA 3H9HB 4JK0D 1OF2A 3H6JA 4CA4A 2ICWJ 3RX7A 4W9HC 3SPVA 3CMOH 3ULVF 3KPRA 4G9DA 2Q7NA 1MFAH 3QXAA 4PSRA 2DEWX 3DROB 2AHIA 2E27H 3T0EE 1IVTA 4Y5YB 2GI7A 2B77A 2I24N 3ARQA 5GGQH 1RURH 5JPMA 4KK5C 3MRPA 5EOQH 1CDGA 1M1SA 4TNVK 4TQEL 2R27A 2GY7B 4MB1A 3Q06A 4XCYB 2ATKB 2H9GA 3HI5H 2YQ2A 4F92B 1ORSA 4MD5A 2WXQA 3WIHH 1OE1A 4D0DA 4F2EA 4LPXA 1QOKA 3GKZA 4IOFC 1SBSH 1CFTA 1WJ3A 4YDJB 4OD3L 3FOMB 3EFDH 4XPFL 3SOBL 4H20L 5FHBL 4L8SC 3GPEA 3Q44A 1DQTA 3VRIB 1DJWA 3S8FB 2WNWA 1TQWA 2M1KA 3W11D 3O2WH 5EU6D 4YE4H 5TGBA 2JCCB 1SOXA 5CKGA 1OVZA 2X42A 1K4CB 4URTB 4PI0A 3MO1A 1DQQA 5DJZB 2LU4A 1GXEA 1DN2A 1X5IA 4LVHB 2RTTA 2MQ3A 3PGFH 4NCC1 3WDHA 5IKCB 4IMLB 3G6AB 2A74A 2OLDA 5HHVH 5CBAA 2V4LA 2X28A 2DQTH 4CW1B 4KVNL 4FD0A 2F53D 2YGPA 4FABL 3MX0A 1LNUB 5C0CE 3QZOA 1AGDB 1DBMH 3N5AA 1SN0A 1RLWA 1X6LA 4YSSA 4F9LA 3QXVA 2OP4H 3K4ZA 1SEBB 3HUJA 1NIFA 3FN0L 4RLDA 5KSAB 3GXUB 1XIWD 4M8VA 1PVHA 3QJRB 4M3KB 3NFPA 3VW3L 1JHKL 1QSFA 1S9VA 4RZCB 1EH9A 3G7TA 3NPSC 5HHXL 2FX9H 1N8ZA 4MDJA 4LP5A 1OAKH 2H6UA 1JHTB 1G9NL 3SDYH 2FB4H 1GVIA 4W4OC 1MH5B 4AXWB 4JPWH 4U1KB 1CTNA 3LKNA 3K4AA 2J8HA 4JO4L 3S3SA 4F7CB 1NGXB 4DEPC 4I18B 4FFYL 1IJNA 3GEWB 2I27N 2G2RB 3KL5A 3VH8A 1MCPL 4CADA 4Y4KB 3RA7H 4PV8A 1HT6A 3QORD 2VDPB 5HHOE 4FFTA 4FA8A 1NPNA 2FIKB 4JFWA 2KBGA 1MAKA 4RA3A 5K9KA 1VPOL 1FH2A 4R90H 4LLDA 3CQFA 3PGFL 3QIBC 1QEWB 2FHFA 2C7UA 4NQEB 2RR3A 4TTGA 12E8H 4Z8FH 5C0GA 3ZT5A 1VAHA 2NXYB 2V9TA 1QZ1A 5EBWB 3ZE0F 2JIXD 3K0WA 4CN4A 1OTTC 2ZYSA 4YX2L 1EXUA 4QRUB 3P3UA 3F6LA 2F54A 4P3CH 3F7YB 2N0KA 2PYFA 3E6FA 1MQKL 2OJZL 4XP1L 1QUNB 2BY2A 1S7TB 1N10A 5LCVA 3EH1A 3DX2A 1TQUA 4RVBA 3GBNH 2FJFA 3FQUB 2P49B 3BOVA 5EEUA 5L7XL 1ERNA 1NPUA 5DWUL 3B2PA 5E1GA 2C9AA 5BRZB 5KOVC 5HGDB 1DANT 1UOVA 2WINA 3S7GA 4WZ9A 1LEIA 3QA3A 1ORQA 2P7TB 2P1YA 4PRIE 4X0KA 4BKLA 3F7KA 4PRHD 5J8OA 1QTPA 4DFIA 2G5BB 3AUVA 4C54A 5F7FA 5TE4H 3NACL 3S2CA 3E6HB 1A5FL 3RVVC 4F24A 1KPUA 4MAYA 3RVUD 4WWKA 5HHMD 2JI1A 1OAUL 4KKLD 3ZZQA 1X4ZA 1RD6A 2R4RL 2D0FA 1IGML 4RZCA 1OGAA 4BA8A 2YGOA 3GTVA 3UTQB 3CLFL 3KCPA 4EVNA 3IFNL 4X5WB 2H26B 5HI3D 5HJGA 1MW0A 5AUMA 1N3NB 4G1MA 3GI8L 2WN3A 2H32A 2R69H 2VDKB 4HIPA 2G4EA 2OR9H 2VXQH 2J1ZA 2BVQA 1MCOL 1R24A 2DQUH 1AY1H 4R6UA 2C3GA 2NY2D 1UOKA 4PJ8C 2E9WA 4KI5D 4LDCA 2GEQA 2HMIC 4N20A 1JHLH 2HH0L 3D4ZA 1AXSA 2XX1A 3M6DA 3MNWA 3JWOC 3I02B 3O6FD 1D3CA 3UBXA 2EE0A 4G6KH 1CGXA 4QRRA 2CIIB 4NZFA 2EEFA 2G9HA 2IWEA 4XP1H 3OQ3B 1ADQA 3PJNA 1H3UA 4ANXA 4L05A 5TGBB 3OAZH 4QKTA 3PQYA 5CIPB 3VMOA 5J56B 1TQBC 4WWPA 3QO0B 3D34A 1V5JA 2VXUL 2WWMD 4AJVA 4TNWF 1AQ8A 2XXMB 3EYQC 5DHXB 4OSUH 5C09E 3QYCA 3EYOA 2EQDA 2NY4D 3KBEA 2AV1A 4H2AA 1CG9B 4N0UA 4QHMA 1BQSA 4XNMA 3KPLA 3OKMB 3QDJD 3DTXA 2OMUB 2YA1A 1U6AH 4UAOB 3VD3A 1ASQA 4HAKA 1A6AB 1P53A 3LKQB 4FLHA 2YN5A 5I66A 1RH8A 2UWEB 4WUUB 3PABB 3OG6B 2AJZB 4QHKI 5J6HB 3S3CB 1L6PA 3SN6N 1HH6A 2LVEA 4DN3H 4TKWA 2EP6A 4OLYH 1YG9A 3HE7C 4HU2A 4GSXA 2A77L 4Y1AB 3ZHFA 3IMRA 2C9XA 3ULVE 1KY7A 2VITA 3NIDB 4P59L 3RY5A 2NY7H 3MLXH 4BGLA 2VN6A 4MWFA 3UTZB 1FC2D 1QRNB 1VFBA 5JHMA 1V7NL 3ZUNC 5F6HJ 1CB4A 3PIQA 4KKAC 3WXWL 5KVGH 4G3YL 5CHNA 4K71C 2BRRH 4OZHB 5KVGE 1FL6B 3W11C 5C6WH 4P9HH 1RUPL 5C09A 4KKAD 5FS5A 3PWNA 4FN0A 5MENB 4RQQA 4NQDE 5FA4B 2G2NA 2CLVB 1M57B 4ZFOB 1H6FA 4LF3B 3EH5B 2WNXA 2K4AA 5LGKA 2HSIA 3TBTA 1XCTA 1SY6H 2YBRA 2XT1B 4CMHC 4XPFH 3NCYS 1ASPA 3L3GB 4I48A 2D73A 3GSOB 1HQRA 4ZAKA 4KV5E 3OKDB 1XR9A 3HG1D 3QFGA 1FFOB 2F5AL 5T5FL 1Y07A 2KDGA 3MV9B 4WW2C 1XAKA 5ANME 2IDTA 4YDVA 3V0HA 1JRHL 1D5MB 1F1DA 1CU4H 5LO7A 1BYPA 5E2UH 5IJCC 3QHZL 1H15A 1L7TH 5F7MC 2IXQA 4TMPA 5MEND 2C7FA 2FZ3B 4JG0H 4KHXH 3VM7A 4EDXB 1SBSL 5EF1A 4U0QB 3I9AA 4L3CA 4LBEB 4KDTC 3UBHA 2YWZA 4XX1E 1TCRB 5I1HH 5IHWA 2C9PA 1CD0A 2K45A 4GKZA 2P47B 4LEXH 4RFEA 5E8EB 5A2LH 5C0ND 3QZLA 2FATH 3FQRB 2ZX8A 4GAYA 4DP4X 4HLJA 5JR1L 5EWIH 3VFNB 3ORJA 2OCCB 3QZWB 5EN2B 1KCBA 4GI9A 5J6GA 1LYQA 4M6ML 3V4VA 5DJAA 5T1LB 1KJMA 1XEDA 2L3BA 5K93A 3DXAB 1FSKC 1SVCP 2KERA 3P9WB 4IGBB 3GIZH 2Y1ZA 4WVRA 4LSDA 2WO3B 4P23A 2FHBA 3VU1A 3TPKA 5E08L 1V10A 1QBML 1R3HB 1AO7A 4LAJH 2F1BA 3B8SA 4JQXC 3MBED 1N4XH 5D72L 3I85A 2C3VB 1LE5B 2HPOA 2AKRA 5F9OH 3NK3A 3L9EA 3DUUA 2AJUH 3VTAA 2VL4A 5B38A 1QLRB 3HG1B 4AYFA 3ZJAA 4J7RA 3U7AA 1GYVA 4Z7OF 1TTCA 4PYGA 2ZOKA 3V9CA 2B5IC 1QHQA 4D3CH 1BIIB 3TU6A 3PL6A 3P0YL 4F57L 2WQVA 1NSNH 4TM9A 3QG6A 3NCXA 4FTVB 2HFGL 4GLRH 5HI5D 3GEFA 4HWEL 2C1OA 3DNKA 4HGWB 4OFIA 1GZPA 3U83A 3FFCA 1R34A 2OMZB 4FFYH 4PJ5A 4LEBA 4QGTA 4H0GA 3VH8G 5C0EA 5HBBA 1FNFA 4OV6F 1DLFL 2HWZL 3UGUA 1MLBA 5GRZA 1EMTL 5JW4M 1K2DA 3WFCH 2QADD 4QRRB 4KXZH 1LO5A 2ARJB 3MJ7B 5AKTA 4G8GA 3KYNA 3WO3B 2I07B 5CILL 2JELL 2NPLX 1UFGA 4LCUA 4Y2DB 1LHZA 4O51A 1JOIA 4BH8A 5I1LA 3DRTB 5EFIA 3GMLA 4DKAA 1TO4A 1NDGA 2BY0A 3FSOA 4ZPVB 1VJSA 4CC4A 3SE4C 2GYSA 2YD1A 5ECJE 2D2OA 3GHPA 4KPHL 4PJIB 2V3FA 3CSPA 4DPCX 3LSOA 5D7SH 3CFQA 4U3CA 2E47A 4KKCD 5KVFL 1QWHA 1XGRB 4TULH 2ENPA 3VXUA 2ROYA 3ZPDA 3NACH 1GSKA 5DVOA 3QI9B 5EZIL 1CT8B 5I71B 2CG9X 2JNZA 4NO2A 3NRPA 1IIIA 4S1DD 1CGUA 3G6JA 1RK0A 3P1VA 4LLYB 3DHMA 4KFZC 1I8LA 2CXGA 3IPEA 2J56A 4G7QB 3QCTH 3F7VB 1PF3A 2F7PA 2R0WL 1EO8H 1G7QB 3BQUC 2KZKA 2PO6D 4GRWF 43CAA 4ODHH 5T33H 5J4MA 3LH9A 5ISZB 4XZUB 2ORBH 2IGLA 2EICA 4XVUC 4O4YL 4PJHE 5LNEA 2FNBA 2NXYD 3AB0C 3TH4T 1HCFX 3QULB 4K8RH 2YUVA 4WTXA 4NO0A 4G82A 1QX1A 3UAJD 2BS71 3CLFH 2I7SA 3LXUX 5BRQA 3QHFL 1AHMA 3DV6A 3EYSL 4GUQA 3V52H 2AJSH 3NSXA 1YPZE 5KAQF 3L3IB 1PKQB 3FU7B 3VXOB 3RTLA 4XOCA 1FFPA 3EJYC 1AY1L 1FWXA 4L8CA 4G8FB 1ZLEA 2KI6A 2YO3A 2G2PA 4NHCL 4RWYL 3O3EA 4WHTA 3AACA 3QRFM 2OSYA 2J8UF 4LKCB 4V1DB 3TASA 1GC1C 2ESVE 3MJGX 5B3JE 4FTVD 1T22A 4OUUB 4L3CB 4LBEA 1FFOA 5D7SL 3RDTA 1C7TA 1NJ9B 5F88A 3OAYK 2OMZA 1Z9SA 1FVDA 5AVQB 2QGCA 1KC5H 2CUAA 1VGEH 4GQQA 5DHYA 5FCSH 4Q0XL 4DGWC 3PWVB 3X13B 3QR0A 3UAEA 5CJQH 2EO1A 4ONFH 2NY0D 4JHZA 2ENQA 2DMGA 4ZTOH 3VWJC 4FFZA 3QUGA 3K5SA 4AGPA 2DF3A 4LCWD 1ZV2A 1KELL 4X6CB 1ND0B 3MACH 4WDIA 4MKMA 3QCTL 3RVTC 3PJLA 4TVPE 3GSNL 3SE4A 1U4EA 2C7UB 3I6GB 5KEZA 4L4VD 3U2IA 4X5PA 1JVKA 3IGAA 1Z9OA 4GSDL 4JPIB 4EI5B 4DUXA 4XCCH 4P23B 3RLSA 2WTRB 4W6WB 3N55A 1CI3M 1GMIA 4FXTA 4TOYL 4AQEA 3OXRB 3BSZH 1RHFA 4BJLA 2OQJA 3WTYA 1PZBA 3MZGB 2WP3O 4NHUA 2BZDA 3QWNA 5ABAA 1J1XL 3T3PF 4XAKE 4GJTB 3N3EA 5HDBF 2RACA 3O2DH 2OMTA 4AJ0A 4DP6X 3VFUA 1ZHBB 2X9ZA 2Y5EA 1M3JA 3T1WA 2PCYA 2OKMA 1DVFB 1G94A 4FTDA 4Z7VB 1CXKA 5K1VA 4PRPA 5JIDA 4I4WB 2W07A 4JHWH 3ARGB 4MNGA 1XMEB 3CHPA 4N2CA 1T89A 3OX8A 1PQZB 1A9EB 1JF1A 1QABA 1K72A 2NCMA 5B1JA 3FPYA 3L3HB 5IQ9A 1PLBA 2CCVA 3QI9C 1ILSA 5ECGA 2HT2D 2I9LB 2VLLA 4MLSA 3T2QA 3FAWA 1QSFE 2VNCA 3CUPA 3LHPH 4MMZC 3PL6C 4YHIA 2YSSA 1W72L 4N8CH 3NZUA 4FYRA 2I7OA 1KN4L 5GGSY 3FFCB 1XH2A 4RGOL 1RI8A 3I75A 2OL3L 2NOYA 2X4QB 2AW2A 3P11H 4OLUH 4OZIE 5IESL 2GITB 3ESPA 5EWIL 5EUOB 1I31A 3VYOA 4KROD 1NDMA 2Y3AA 3QPXL 4HKJA 5DQDL 4DW2H 4JRXD 5C92A 1DYZA 3BCDA 1M71A 3D69B 3GSNB 3VSQA 1NL0L 2PW1A 4JO8A 3C5ZC 4FQCH 5IJKC 4PJ5D 5BO1H 2DS4A 1FZMB 4KRMB 4UU9B 3HB3B 2E6JA 1PZAA 5I75C 3PYCA 4PIBA 2UX7A 4YXKH 35C8L 3OHXC 3TYFB 4EIBA 5ALBH 5A1AA 5IVXF 2BINA 1N6VA 4PW4A 4CC4C 3W82A 5IB4B 3VD1A 2WQXA 5JOPD 3EYUH 5J11C 5GZNC 5EOCL 5HVGB 3UXFA 1I8MA 2C9UA 1LMIA 5E4OA 1G6RA 1IT9H 3JWNE 5C0FA 5G55A 5SWQB 3LKSB 1MHCA 3D39A 5EDSA 5T5FA 3KAAA 4J3OF 1B0GA 1HL8A 3V0GA 3Q8CA 2ADFL 1E4JA 4LKXA 2NUPA 2X6VA 1X3DA 4JMNA 4OIFA 1JUFA 4GI6A 5FYKD 3QQNA 1YVLA 2AXJA 2VZTA 2FJGA 3UIZA 4KXAA 2LE9A 4NGHL 3DJRA 2YK1H 2AZAA 3T09A 2C8NA 5L9DL 1PAZA 3VQLA 3OLDA 3FRPB 3MRGB 4HJGB 1B9ZA 1T20B 1NCNA 2UZPA 4UIMA 3GINA 1D9KA 3T2OA 2VERA 4PRID 1JDDA 2WOYA 3NAAL 2OYPA 3N85L 3DX3A 4AE1A 2HLAB 3L5WA 1GZQB 2D03L 3RHWK 1KCVL 4EI5C 3MJ8B 1CIUA 4XMKH 1KCUL 4UMGA 3VWJD 2D7OA 4MJJA 5ERWA 3L3HA 3VJ6B 4PJBB 1IC0A 2QKIB 4NLHA 4PJ8A 5JOPE 3CBKB 5HHQB 3QORA 5AW6B 1BVLB 3UL4A 1ESOA 1RZ8A 3WLBB 3L7EA 1BD2E 3OZ9L 3KWVA 4JANB 1A25A 1U8NB 2IAAC 4JFQA 1E9PB 2Y36H 1T2XA 4OQTA 4XPTH 2CBTA 1DUYB 2EADA 1S5HA 1OARL 3X1FA 1P5UA 4Q9QL 3B9EA 3F83A 4Z7NE 4XN5A 2QADB 3N6YA 4P49A 4NNXA 1SYSA 1J05A 3IGAB 4GEIA 4OKDA 1RV6X 2ROXA 1LP9F 1ZTMA 2OMXB 1MWAL 4M8RA 2ZUQC 1Q38A 3SGDH 1AE6L 1QTSA 5DD0L 3V0WH 2VT0A 1NKRA 2ZKYA 3KXFE 4OZFA 2P28B 1B4LA 3VI4B 4F9PA 1UXWA 2GBUA 2XV2A 3RWCA 4AM0B 5HHVL 4PW9A 3STZA 2F18A 2QVKA 4KI5C 1FRGL 4PJ8D 4Y9GA 2XKNA 1CUOA 1A1MB 3FQRA 4GAYB 1E2VA 4F3FB 3UX9B 1T1YB 1G6RH 1QACA 1D5RA 5J0BA 1GSMA 1YEHH 4JFOA 5D7LB 4M7KL 5B39B 1T21B 5JHLH 3LV3A 2HX8A 2G0KA 4UCFA 1MFVA 1SM3L 5E7FA 4K3EL 5AVRB 1BOGB 5KVDE 4X80L 1N7ML 1HHGB 1ZSDA 2FDBP 1T5XA 3VXMB 5AFAA 5KYYA 3G08A 4JG9A 4Z76A 2H5UA 4QMEA 5ITBH 3I6KA 4KMTH 1OAXH 4ICWA 3MNMA 1DQQB 5DJZA 3OAUH 3FQ4A 2VLJE 5IKCA 4ZW5A 1UT2A 2O6PA 3MNVB 4FNRA 3BKCL 3CSYA 4HWBL 2EIEA 4TUOB 5FB8B 5CZVL 4YHIB 5E1IA 1BPVA 1NDMB 1XTLA 3AABA 1LK2B 3AT8A 3T65A 3O6FA 3BIKB 1YEEH 4ORGB 2AEPL 1G1KA 2JF1A 2H0FA 3OKOB 2GHZA 1FORL 2YUXA 4HKZA 2CAKA 3NN8B 3W57A 2Z8VC 4PVLA 2LR4A 4MDJB 4LLWA 4N0FB 2NNAB 4KJPD 3WFEH 3H7BB 3DVFA 1IFHL 4ZOEA 2VSMB 4HK0A 4Z3TA 3R4RA 3WN5A 2H41A 4GSRA 5DJ0A 5C2BL 1NCJA 1DQVA 5E99H 1H3PH 2IFFL 1E4XI 4PEEA 5IEHB 4PJCF 4KBPA 2ZX9A 4QF1A 5GZND 4L8DB 4Q6IB 3MV8B 4XMUA 5JW3H 2EDQA 4JREC 4QHLA 1IVLA 4JL2A 3VDCA 1KCWA 4KQ4L 1XGPA 4LLVB 3V6OA 4Q6YA 5C9JB 1FCGA 3TVMA 3CVHH 4Y16C 3WNPA 3MPCA 5B1CA 5IVZB 3BD5A 3DSNB 1W15A 2VLJA 3NZ8A 3QORC 4J2QA 1II4E 1QYGH 3UOAB 1FLRL 1MY5A 3V4PB 1RUAH 4I18A 3HNSH 3S8GB 1F3JA 2WQ8A 1JPST 4V1DD 5IHBA 3IYLW 1D2PA 1X6NA 2FWLB 3D12B 3SDDB 1RY7B 3SO3C 1MAML 2QPEB 4AM0A 1N26A 2IG2H 1R47A 1KJVB 4LL1A 3SKOA 2XTLA 4G8GE 4NZTL 5B8CB 1E5CA 4RIRA 1EANA 4NBYB 4G6FD 3O3BB 2C9SA 5CN2A 3RL1B 2WKGA 1RAMA 4X9BA 4JQXA 4PYHA 2DIBA 4XPAL 1PD0A 2NZ9C 1VFOA 1JGUH 2GJ6E 1HXMA 1NCDL 3OPZL 4S0SD 4J12A 2NNXA 2HKHH 4Y5VB 3CHSA 3GMMA 4WW2F 4OJFL 4IRSD 5IVNA 3BPOC 5GHWH 3ZMEA 5E6ZA 1HHGA 1NFIB 1URLA 1ZSDB 4JDEA 3RU8L 3VXMA 2XWEA 1MCRA 2UXGA 2YMOA 2AFNA 5BMFH 3BT0A 5IHZB 2Q1EA 3L7EB 5AB2A 2A9BA 1F58L 4NRYB 1CQKA 3B37A 3HZVB 4X8JB 1WTLA 4P2RB 4U3HA 1YYMH 1G1YA 2L04A 35C8H 1OW0A 1KIRA 3U9UB 5CD3B 4CMMB 5HPMB 1P6WA 2DJUA 2XPYA 3ZHKA 3VFWB 2YD8A 2O5XH 4QJ3B 4XB8A 3MMEA 4AK2A 3MRHA 4POZD 2PWHA 2OL3B 4JM4L 1UZ6E 2O4EA 3WL9B 2XN2A 4XE0A 4Z0BH 4PG2A 3ULUF 1KLGB 3W0WD 2YWYA 1ZTXL 1LM8V 2IH1B 3ABLB 3K2MC 3VFMA 2AK1L 4FQQB 2XN0A 4U1HB 4GKSA 1BG1A 1I53A 4B5ZA 1LWRA 3B6SA 1UH4A 3OPUA 2EC8A 2XWBB 5DJYB 4KK6D 4BH7A 3KNBB 4OLXL 3WIIH 1A6WH 1G0YR 1N3NA 3PAVA 3Q5TA 2B20A 3C2SA 3I02A 3QDHA 2NW2B 2Y06L 3D3VE 3ISYA 3ILDA 1QPPA 4J8RB 4TF4A 3SJVA 1NCHA 1C1EH 4N2GA 5JIPA 5AOJA 1NBZB 4M8QA 3QEQA 1FV1B 4A38A 5KN5B 4F7TA 4F7KA 1ZVNA 3MLUL 4PBWD 4GAFB 2Q6WB 4A2FA 3B9VA 1EJ6A 1L3NA 3BXNA 4LPCA 3EHBC 2ARWA 4FL4B 4JFUA 2F08A 3CZJA 1BF2A 2E7HA 2IQ9L 3P77A 4PRAA 2X4NB 3QJUB 4YSQA 3S97C 1SQMA 1AGFA 3PU7A 2CJUH 1E9OB 1P0SE 2RJMA 4KTDL 4P3DA 3VACA 4BRVA 1HI6B 2Q7AA 1NCCH 1BGXH 3IK2A 1A1NB 1YYML 4PJEE 4Y16B 5LG1A 5DUBB 5KVMC 3MNVA 3BRDA 3DA0A 3DOIA 3IJSA 4YK4C 4HXBL 5FO9A 3ZE1B 1CG9A 1ORSB 1URIA 1QMUA 2F19L 1RIHL 3DRQA 4MD5B 4PCSA 5ACZB 2X38A 1LO0H 1LDSA 4FZ8L 3CVIH 4LHUG 1F2QA 4NQDA 2ZXAA 3TN0A 1U8MB 4XN7A 3BKML 5GS1A 2PO6C 2AK1H 1OF0A 1OCRB 4RFOL 2CNYA 4XMZA 2X87A 4ICXA 3N1MC 4YHKH 3OJDB 4ZRGA 2Y6TE 3EUDA 3ALXA 4TPRL 4DSYA 1HEZA 4L1SA 4Y89A 2ODIA 1KTCA 4OI9A 1XGUA 5M7QA 3QO1A 3SE9L 1F13A 5TDPB 4UM9A 1H8SA 2JI2A 4TNGA 5LQBH 2YA2A 4IBUA 4P2RA 3CXHK 4TTDD 1HHJA 1JPTL 4CNIA 4ZXBC 3NABH 3TO4A 3RX8A 4OLVL 1CDUA 4MXQC 2HMID 4LCCB 3PNWA 4M43L 5IWLA 4D2NA 3Q2NA 5KG9A 4YSPA 3TVMB 2NY2C 1UASA 3MRKB 3EDDA 2Y25A 4QRQA 4Z7NB 1WDAA 3FCBA 3OR7B 3X12A 1P4BL 1ADQH 3MLWL 3FYIB 3ATDA 4XPBH 4LNVA 2F68X 3LNHA 3QUYC 4RBPK 1A7RH 1T5WA 5E4EC 5HSFA 1B2WH 1S9XA 3HPJA 3N42B 5FF6A 5K59F 5TK2A 3ARFB 4LF3A 4RMRA 1ROWA 1QSED 1Y18A 4DN4H 3WUWB 3NH7L 3WHXA 1RVFH 3VI4E 4ZFGH 3VD9A 4XBGB 4M4RB 1EJOH 5DFTA 3RPBA 1UKTA 2TRYA 2VDLB 1G43A 1TEFA 3RE0A 4B7IA 4YHLL 3HKFA 2ZUXA 4U1KA 4AZ8A 1Z3GL 3LNGA 5ESVB 4D9RE 2DICA 4A2HA 1UXSB 3IDNA 4IKIA 5I71C 2DM4A 4OB5L 1XZ0A 3MJ6A 5KYNA 4PBVC 2CO7A 2WC7A 3O4LD 5CCGE 3KYOB 5I17A 3L9RA 1TVBA 5D72H 4NJ9H 4PB9L 2CHZA 1AGEA 1Q94A 1YMMB 2Y9RT 1NFDA 4Z3HA 4EDXA 5C97A 5KVEL 2EUVA 3AM8C 1O9VA 4KDVA 3IS0X 4HUUA 5JIKA 1JPEA 1CN4A 3RWGB 5D96C 1J8SA 2VMEA 2YEVB 3FN9A 5LDSA 1K5NA 2RFXB 2Q76B 1HEHC 2UZXB 5EOQL 5FR3A 2ESVA 4LNRB 3QIUD 1EFXA 4YNYB 4C83B 3U0WL 3O3DA 3RGVA 5I6PA 3D8MA 4EI6B 1G9MC 4UT6L 1EZVX 4ZUUB 5I6NA 5LBSA 4ODXA 3P73A 4EQ2A 3F84A 3NCFB 5FFGA 5HPOA 1A6UL 2E6PA 5CJOL 5ACZA 1JGEB 4FKKA 4XODA 3QUMB 1V3LA 2JWYA 2XLLA 4BK8A 2NDFA 5H4YA 3BI9X 2RGSA 5LCVH 4N90E 3AS1A 2BCKA 1E5YA 3WMSA 4BSVB 5B4MD 1SY6A 3KDMA 3LEXA 3DJTA 1FHGA 3KPSA 4ZXBD 3VXQA 4X5XB 2MMXA 1NMBL 1C5DB 4H40A 4OFKA 2W94A 1TFHA 2VAAB 3VTTA 1DL7H 4PTTB 4FNQA 3VX0A 3T6XA 2EDMA 3WS3B 5INCA 3GUTA 4ZUSB 2N56A 1E65A 2XQBH 3VM5A 1UHVA 1PYWA 4BK5C 4M7ZB 3C8KB 1DVTA 5KVGL 5I9QC 1Q1JH 1IGYA 3GT6A 4P4RA 2VDOB 3SDAB 4RNRA 2OPCA 3WNLA 3B6SB 1WQVT 1NTDA 1FV1A 2D3NA 4NKMA 3LH8A 5DGQA 4V1DE 2FGWL 1N12A 3FH8A 4HU8A 2JKTM 3NQIA 2J6EL 3P30H 4GG6A 2VWEC 5DZNA 4EXKA 5J9PB 2VYRE 1AGBB 1AKJD 4LL9A 1HIMH 2EEDA 1G1OA 4AV5A 4BFJA 3UBXG 1HNFA 5FDYA 2WB1A 4CSZA 1CFQA 4RGNE 5DD1H 32C2B 4CW1A 4GKNB 4HSQA 2MPAH 3UYRL 4OLWH 4NFCA 5EORL 1K8DB 2ZXDA 3W2DL 5JMOC 2OMWB 15C8L 2APBA 1BZDA 1AMYA 1I9JL 1SLUA 1QLFA 3L2LA 2NY2B 3RAJH 3FT4A 5AG8A 1CTOA 1IBYA 4A37A 2FJHB 5HHNB 2E6QA 4G8GB 1RUML 1F11B 1NAKH 3WTTA 1X5YA 4HQQL 2YEZA 3BLBA 4L1BA 1NUFA 5CEZE 1HH9A 1BFVH 2EDBA 1JXJA 2UZIL 2CHWA 4RSYA 4X98B 5AW7B 5C71A 1HHHA 1U92A 3BGAA 3MUZ1 4FFVD 1JMXA 3II2A 3F7RA 3ZTNH 5CJBA 1NFDB 4IU3B 5D6DA 2G9HB 2VZVA 2BNQA 3G9VA 4MMYB 4LGRB 3TCXA 4F27A 3ARVA 3KW7A 3ULUE 3RB5A 3PP3K 4NJAL 4AK1A 5I5IA 4L3EB 3PQYB 2JK5A 5CIPA 5DJDB 2ZJSH 4LESA 4B96A 4DZ8A 2P5EB 2X4OB 2VW4A 2BSSB 3ESOA 3S5LB 3VWKB 3B2VL 4OI8A 4AG4H 4A6YA 4S1QL 5IUSA 3ZBMA 2W60B 5DI8A 2X1WL 4X6DF 4M93C 1KB9K 2V7HA 5I28A 2QSCL 4R7DA 2K8QA 4JM2B 1G9HA 3G6JB 1BBDL 4XXCC 5L0QC 4JN1H 3N41F 4MRCA 3RDJA 3ESNA 2X4UB 4R5TA 4Q0XH 4QY8B 3QEQD 3UERA 5E08H 2WYIA 1R3LB 4X5XA 5D70L 4N6RB 1FIGL 4NQUA 1YN7A 1EK3A 2WJ5A 3O0RH 4XT1C 4XNUL 3PQYD 2OSWA 5FLVA 1V27A 3BAXA 3DDGA 4JL1A 3DVGB 3SPGA 2L7UA 3MV9D 5KSVB 1L9PA 3VNYA 1RZKH 3K80A 3S2AA 4UZSA 4F7PA 5GS0C 1ZGLB 3B7TA 4RGNC 4LRIC 4MAYD 2O30A 3BGFC 4WFGD 3EKCA 3ZE2B 2JKSA 5A2IH 3AY4A 4ZOCA 4X6DB 2R29A 1DO6A 3F64A 1IEAA 1Z5HA 2FJFB 2ZXGA 3HNTH 2X7LA 4QI3A 3G6JF 5C6PB 5CEXA 4WFED 5JDSB 4AX3A 1TVDA 2Z9TA 5HGDA 5GQBA 4MA8H 2BFVH 1LEIB 1E3FA 1X5LA 2M8XA 4LLAA 3FT9A 1ZHKA 2GK2A 3STBA 1FN4B 4NXKA 2V7NB 2WQAA 2D7TL 4MDIB 3H1ZA 3S3PA 4C83A 4JRXB 3CLEH 4JM0A 4S1QH 4POYA 3L9RB 4H8WC 5I0ZA 5C0JB 2W8CA 2MKLC 1CL7L 1KCSH 4K3GA 4NUQA 3SKNA 1ZE3C 1UD8A 1FUNA 1KT2A 3TJPA 2EDRA 3X3GL 3MRQB 5TE7H 5ICYA 4I1PA 1F6AA 3C2AL 2JKNA 2K7PA 3H56A 3IFOB 4F33A 1H15B 3X2QB 3HNVL 3NCBB 3EZ8A 4NAMA 4AC4A 4F7CA 1GZHA 5K9QG 4D9QD 4B9ZA 2WBXA 4QDGA 2X3BA 2VW6A 4H8WL 5HVWA 5KTEL 1JNHB 4NO0D 3IGFA 4FX5A 4NERA 1WS8A 5EZIH 3RWHA 4H1LG 3TWYA 4YSUA 5JIQA 2FEDC 4ODTH 3PS6A 1W91A 1ZCRA 2QKIC 4A6YB 4E2OA 2CHNA 2DQMA 5B39G 4E9YA 5B1KA 2F54D 4FXKA 3HPLB 3OJVC 1NC2D 3WN5C 2GTZA 1JV5A 3HAEB 3D07A 3I3BA 4ZG1A 1RP9A 1TZOA 4OFVA 5GZOD 12E8L 4FTVE 1G1CA 5L6YL 3F85A 4I4WA 1BEYH 2L0DA 3WEXB 3NSFA 4X6CF 5EULV 1JD9A 4PHZA 4J3OG 4L2YA 5EU5A 4XBEL 3TV3L 3UJTH 2YKKA 3ZHLA 1L9MA 5KSAA 3NJIA 4OAWA 3G5XA 3EYOB 2HTKD 3QUZA 1O7VA 1G5AA 5BQ7A 1UA6H 4XWGH 4HISA 4WK4B 1UB6A 2AXWA 2E7DA 1QR1B 3FO9A 3FCSA 3QUXB 5IOPA 5DUML 1A6AA 3IMVA 4MCZA 2X4RB 4UQ2A 3H9HA 4UDUB 5DQJB 4N3TA 2ITCA 4W9ZA 2Z0BA 3SIKA 1XIWA 4ZOBA 2ATPA 4P3WA 5FOJA 4PM1A 3UZVB 5KJRL 3T8VA 5GGRY 1BJ1J 4QXVA 3V4LA 1VZIA 1SJHB 4FXGB 4PWEA 4J3UA 3QCVL 2GIYA 2XQ0A 5HHMB 1KC5L 2X12A 1U8QB 5LAPA 3FQNA 4DK6A 1NBZA 1R4XA 1RMFH 4IIQC 2LU7A 2VR7A 1Q72H 3B5GA 2OR7A 2JQAA 4KQ3H 2XY1A 3TESA 2AGJH 1M2VA 1OZTG 2W0LA 2BIOA 2YRLA 2JB6A 1OGAE 5KSUB 1R5WB 2BSEA 1G7HA 3WS6A 3HBGA 2NQDA 3MACL 2Z3FA 3FTXA 2WANA 1T0NA 3HN8A 4P2QA 3G5ZB 4LCWE 1GIGL 4NM4H 1MCOH 3WNIA 5JPNB 3FF8A 2YQBA 4JG0L 3HI6L 5DK3A 4ACTA 1T0MA 2XQBL 1A1NA 1MZYA 2F61A 1LMKA 2KC0A 2QLYA 2ICES 2QMJA 5FK9B 1OPGH 2BDNL 1R3LA 2VO8A 3HZYA 4ONGL 4JE0A 4OZIA 3TBCA 1IC4H 4OZFH 4YH6A 4ZJ9A 2IBGA 2Q8AL 3HFMH 2GUOA 5GS3A 5SWSB 4ZSOA 3QNYB 5GIRA 3APCA 2K78A 4JHVA 1ZVHA 5GS0L 3ECUA 4UBDD 1TCRA 1SPDA 4JG1H 4XC3H 2EIMB 3RWIB 2FAUA 5CGYD 3EF7A 5GS2D 3DSFL 1IKFL 3MCLH 4AIEA 5D1QA 4H4NA 3HRZA 1CO1A 2Z35A 4Y2DC 3IWVA 1AE6H 3QZWA 4Q2ZB 4B0MM 2Q8BL 4E41A 4DOHE 3ARRA 3QH3A 2YS4A 1XGTA 2E5EA 3FB8B 2RA1A 4OBSA 4HQQH 3ULUL 5D5MF 4ELMA 4Y1SA 3O8XB 2QJDA 3VFGL 1CS6A 2PYED 3CSBA 4KXZI 3CU1A 4MAZA 4HKXA 1IE5A 2SEBB 1IGIL 4O5LL 5IGXL 1DR9A 3QRBA 1ZT7B 1JF6A 4FG2A 3U2SB 5IW1B 5BZDB 1YEHL 1BCIA 4NM8H 1QHOA 1MRDL 1H6EA 2N7SA 4O00A 3VXSB 2HFGH 2OTWA 2I5YL 3H9SB 4LIQL 1IAIL 1UXMA 2KZBA 3HVDA 1ZWIB 1NBYB 2C26A 3NJJA 2WIIB 4AL8C 3QZNA 3FSAA 1BFVL 5DJXA 1YNKH 3TA3C 5GGUA 3KEDA 2QR0A 4JY4B 3HG2A 4K9EH 4XXDA 3IRZA 1HAUA 1TYEB 1E4XH 1LGVA 2JXMB 5TFSL 3SQBB 3DGGA 4YGVB 4PAZA 3RWDB 2NMSA 1UJ3A 4FQXB 4KXCA 2CKBL 3PQYE 4FGMA 3V0AC 1CGWA 5TDOA 1GAFH 2D3JA 2YUWA 3EFFB 5DMGC 1AYOA 3HMWH 3EGXA 2NY3D 1JV5B 3HAEA 1CD9B 4NQEE 2FQGA 2IQAB 3LRLA 2IF7A 2XCMC 5AAPA 2AI0H 2FX9L 3ARUA 1DQJB 4KROC 4FS0A 4J39A 4MXVE 3C5ZA 5BRZA 4ZQTA 4JFEB 2GTQA 3HE6A 4B3EA 4ES9A 3RGVD 3OLIA 5E6IC 3D39D 3V6ZB 3MA9H 2GTZB 2WLMA 2CR0A 1A7OL 1MCLA 3QBTB 4TSBL 4ADJA 1CGVA 5AALA 4GKZB 2D2CC 4YEEA 4CRPA 3H85A 3B7RL 3WNJA 3ECWA 2IPKA 2W92A 1UYWH 1A47A 2AQQA 1YDPA 2WXOA 3OMIB 1O0VA 2OTUB 4XHJC 3AZUA 2NDGA 4GRLC 5D7KE 4NM8L 2AK4E 4HWZA 2VQ1A 5FYKU 3CX2A 4KOBA 3WS3A 2XKSA 3B3BA 4G6AD 4G42A 4PRDA 4UDUA 5DQJA 3QFJD 2IAMA 1CGYA 5CZXD 5DJ2A 4G8GD 1VA9A 1HL9A 4KVCH 3T65B 2EAEA 3L1EA 5C70A 4XH2B 5EOTB 2V2TA 4ZMPA 4KJPC 4V11A 1UWFA 2VMDA 4P2QE 3ELAT 4I2XB 3ARGC 2P80D 2NYYC 7FABH 2AEWA 1ZT7A 4FL4C 4GQ9L 3VFNA 4Z7OB 1DP0A 1IBFA 1SOKA 5IQOA 1WCBA 3ALPA 4CILA 1KYFA 1Q9KA 4N4YB 4MD4A 4U1GC 4Y2DD 4L4VE 5DD5H 4WQOA 1NEZB 2V3EA 5L7XH 5GGQL 1BBJB 4I88A 3PL6B 4FG6D 3SQOL 1BP3B 5FUCC 5ESAA 2Q87A 4ODUB 3RWFA 1N64L 1A0QH 4UT6A 3DV4B 5HJ3A 1FLTX 2ZWSA 1BQUA 4Y5XB 4KHXL 1U36A 1ZRUA 4X6EA 2JMRA 2KH2B 5EU7C 3UTSA 3EG9A 3T9WA 1TU2A 2HKFH 3VFSA 2VJ0A 3HC0A 4EN3C 3I9PA 2R0ZL 5DFVC 3WJLA 2JE8A 4APQD 1QBLH 2VXVL 1C5BH 3SKOB 4DP5X 2C1PB 1AZUA 1XF5A 1GY2A 2YC1A 5TF1H 5I75B 2WYZA 1DQJA 1FYTE 2P42B 1P7QB 3PCYA 3KGTA 4CU6A 1TR7A 3U4KA 3WFBH 2XZCH 3RKDC 3ZKSD 1AIFA 4JFTA 2V7HB 5KUMA 3WKML 1REIA 2XZQL 1X7QB 4X8JA 1NGWB 4LGSB 3PE9A 3T04D 2Z31C 3OB0H 5L4IA 1OSZA 3U7WL 3T2NH 4IRJD 4JAMA 1LO0L 2GIMA 3IJ9A 2UYLB 4Y1AE 2PWFA 2FWOA 2EIZB 4W9EC 3BUPA 5LGHL 1TQCB 1U95B 2XG4B 4XNAA 5IW3A 5IJVA 2BX5A 1YJDH 4PGBA 3DHPA 5F9OL 1W9XA 5DQ9B 3ARFC 5IMOB 1OGTB 3HAEH 1Z9PA 4E0RA 5DF0A 1EERB 1S7XB 3U9UA 2VR3A 1MFNA 2FT6A 4GH7B 1GHFH 4OZHE 3WIAA 4A63A 1ASOA 3BPLB 4JPWL 1GZPB 1A0QL 2Y7LA 2YR3A 3JZYA 4FQJH 1C16A 4BUGA 4QHPA 5D7JD 2ZWNA 1QSZA 4YQXL 5AYQA 1HCZA 3VG0H 1CLYL 5G2NA 2OR8A 3R0MA 1G87A 1P5UC 2A99A 1YUHA 4M5SA 2DQIL 2P24B 4P2OD 1I7UB 3IE4A 2XICA 5J7CC 2EDTA 2YPVH 4XHQA 1XDTT 5T3XL 3GSRB 5C0DB 3HZMA 2EDLA 3SJVB 1DCEA 2PTTB 5EF3A 2XTJC 4G7YL 5I1CH 1B6DA 2FRGP 4FYSA 2JCCF 4BFGA 3V0VB 4N68A 5GS0H 4JFDA 1LQSR 5ALBL 1VZGA 1OPGL 1ONQA 4ZI8A 4XP4L 5D2NB 4R96B 5JW4R 1KB5L 2ALAA 4JGMA 1QI5A 2IAMD 5I74B 4Z18A 2CKBB 4HKJB 3U9WA 3WMPA 5AEAA 4B27A 4G6JL 2UY7B 4EUPB 2FLBT 3ZE0B 1DBBL 3B43A 4A7QA 1XF5B 3UFIA 3C5JB 2F8XC 2EVJA 3EYFA 4JGJA 3TZVD 3QNXA 5DWUH 5ENWB 4Y4HB 4JMXA 4AEIL 4XVOA 3FOLB 1QSEE 1JFQH 2XZAH 5EBMA 4KAQL 3DXAE 3N91A 4U1MA 1B2WL 1YYLH 4LHUD 1H19A 2IV9A 2L4OA 4QHUB 1NANH 2WWOA 4DOHB 3MXVH 4CBPA 1LEGA 5T33L 1MW2A 3VG0L 3SYQA 1A2YA 2A6IB 4OT1H 2X3AA 5JXEC 3K5RA 2FWOB 5K39A 2XACC 4MX7A 5BUGA 2HT4C 1BQLL 2DWSA 3KLHC 5GISH 1FJ1B 1HL4A 3EOBA 5BQ7B 2YQGA 4LBAA 1G0DA 1Z0NA 1YY9D 2WKLA 4NZ8A 3P3TA 1SLWA 5D1XE 4JO3H 3H55A 3VTMA 5E5RB 3F8UB 5D7LD 1KZQA 5E00B 6FABL 1PS3A 2OI9C 3W3BA 3EZJB 3ZYIA 1AO7E 3Q3GB 1D5IL 2IOOA 2AABL 2H3NA 3T8XA 2Z31D 4Z8FL 3PL6D 4XVTH 2J5LB 2GEEA 2ZXCA 3KXFD 3NCJL 4U6TA 5E2VH 4AGOA 5FYLD 4BHUA 1MNUL 4JHAH 4M4RA 3VFTA 4X0NA 1DJXA 2VR6A 3AU0A 3T0WA 4N8VG 4YX2H 2ZQKA 3PGCA 5I1GL 1TZIA 2DAVA 3WN6A 3ARFA 1A6VL 1QFHA 4XZ4A 4G80B 1TDQA 3VI3A 5DA4A 2WTPA 5DWPA 1UZ6F 5E24E 2VLRE 4BKTC 1GRWA 2Z7ZA 3O9WB 3F58L 5CCJA 2NSMA 3RHWF 4XX5A 3W2DH 1UGKA 4IRZA 1YAZA 3FYEB 5I8KH 1R19A 1TSRA 2XV6B 2O72A 1SXCA 4P5MB 2VSKB 4FKHA 4BEIA 3PPSA 3B7YA 1NAML 1XL6A 3G5ZA 1K5NB 2RFXA 2UZXA 3H53A 1S7WB 2CA4A 1MVUB 4PJIE 3FTUA 4X2UA 2IDCA 2D9QB 3VGFA 1A9BA 3Q05A 3JWNG 3P0GB 3GS4A 5DO2D 1Q94B 4L3EE 4Z0XB 4BWUA 1J5IA 4XCCL 1XGZA 1BGXL 3MA7A 3O11A 3QJXA 1FO0H 3T4YA 1I8IA 3B1UA 1MFBL 2I32A 4M6OL 3FBKA 1DTUA 1OD7A 3N42F 5H94B 3RZWA 4FFVC 5DZJA 4E5XG 4YAQA 3CGTA 2H2SD 4NKOB 3V7AG 4PGCB 4IBTA 3MRLA 3KPOB 4MS8C 1W16A 4Y4HA 4M9PA 5IEKA 1U8CB 3GI8H 3P4NA 5E51A 3VI3E 2GBAA 5FHAL 5FYJD 3T3MF 2GIXA 3HRZC 3EXJA 5ELIA 2UY6B 2DWYA 4RRPA 2CDFA 4ZMOA 3L3IA 2MPAL 3ETSA 4L1HA 4GMTL 4GW5B 2DQDL 5IMMB 5ISZE 1TVHB 1O7DE 1WZKA 3CUPB 3SQOH 4AYID 4F2ME 1Z5LB 4F8NA 3NUKA 3RWEB 4TYUA 2MQ0A 5BVPL 1N64H 4HAGA 1T22B 4OUUA 3RDTB 2BMKA 3E3QE 4OCWH 3GQFA 4UM9D 2WNKA 2X4TA 1KTDA 3TT1L 4MNHB 3SO3B 2AERT 1BOGA 1LEKB 4H26A 5E03A 3HFFA 4A7SA 1CWVA 4JRFA 3V6OC 2J1YA 4K8RC 5TQ0L 5GGRA 1CFQB 2JCWA 4WSJA 1YQVL 4FNLH 1EFXD 1IBZA 2IPTH 3EDFA 2ZXBA 5F93C 2HVKB 1WPCA 2WZ5A 1PIGA 2BM3A 3QUKA 5E6ID 2X89A 2W59A 3VXSD 5F1NA 3C6LA 4LHJB 3QISA 1ZLUK 1RJYB 2NXYC 2XJKA 4R7VA 5D93C 1FL3B 4IBZA 2A9ML 2K9UA 4FQCL 2OW7A 1MCHA 2JKWA 3HNTL 1RVFL 1GW0A 2QDVA 2XYCA 2P7TA 2ORBL 2I07A 3D4CA 1X5XA 4JRXE 5DD3H 3UEZA 3QQDA 1N19A 2QSCH 4R4BB 1L9RA 1Z0MA 1U30A 3LY6A 1S8DA 3R1GH 3B83A 5F2FA 8PAZA 2BSBA 1DN0A 1WD8A 2R29H 2R83A 2XV0A 4HPOH 4L29B 5JZ7D 2F53A 1WLHA 2X4PA 1JK8A 2NY6B 2Y36L 3QDAA 1YQ2A 3LZPA 4JLRB 1FZOB 2DQJL 3EFFA 3H9SE 3LSOB 4JN2A 4W6XB 5AD0B 2C9RA 5E6IA 1N6UA 1YN6B 2AAVA 3GI9H 3O3AA 3VI4F 1WFIA 4KKCC 4IS6B 4PJDA 1IM3B 5CU9A 8FABB 5CCKH 4ZMVA 4ZUVB 3TF4A 3SKJH 4BFEA 1J0HA 4YHPA 1JK9B 5GJSL 5CF3A 1USZA 4UINL 2DM7A 4TRPL 3LH2H 1AZBA 1XR8A 1EDHA 5IHLB 1NC2A 4QEGA 2VE6B 1NWPA 3US1A 1J0KA 4D9LH 2XWRA 2EYTB 3MJ8A 1YJDL 3HA0A 3L3OC 1WWWX 2EE9A 3TXAA 5JXEA 4TSCH 5MEOB 3GXTA 4LT7A 2MHAB 1KIQA 4WJ5B 1TZ8A 3CVHB 2H3XC 2XIDA 3VG9B 4L0PB 5I0XA 2Q2LA 3V10A 5KSVA 3QQXA 4N0UE 5A2AA 2JJSA 3GRWH 3S48A 5L6YH 1LLAA 2GAZB 3FB5B 3UP6A 5DRWB 3NSJA 1IEAB 3P2DA 2CXKA 4TNEA 4UM8B 4X4XB 4JNXA 1LEKA 3UZEC 3WOVA 4HPOL 3RPIA 3G5VA 4K5MA 4AQ1A 4Y9CA 5I16B 4KMTL 3RQ3A 2FGWH 1FZJB 3IFNH 2C9VA 4FEIA 4XMLL 5DSCA 4K9JA 5I6MA 1SN2A 2YAQA 1JZHA 4G6JH 1SJEB 2OJEB 3TX4A 4JFHE 3FONB 2CNZA 2VXQL 3CFMA 2D8KA 5F1NB 3JTBA 5HGHB 4HKZB 1AS8A 3LEYL 4LCCC 1FL3A 1L6ZA 2YKLH 4IMKA 3TJHD 2AEPH 2OMVB 4PWFA 5E95B 5JHDA 1FORH 3BWZA 3O0LA 3R06B 4HHWA 3VFWA 3T0EB 1DJYA 1A6WL 4UAOC 4MZRA 5AKVA 3ZMNA 5IB3A 3GIZL 3GSWB 3H3PH 3KPPB 3MZTA 1MDTA 3K8LA 3P4OA 1MCQA 5A3IC