1RPUA

Crystal structure of cirv p19 bound to sirna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
138
Chain Sequence
DTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDENPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP
publication title Size selective recognition of siRNA by an RNA silencing suppressor
pubmed doi rcsb
source organism Carnation italian ringspot virus
molecule tags Rna binding protein/rna
total genus 41
structure length 138
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03220 Tombus_P19 Tombusvirus P19 core protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1rpuA00
4J5VA 4J39A 4KQ0A 1R9FA 4JGNA 4KTGA 1RPUA 4KNQA 4JNXA 4JK0D
chains in the Genus database with same CATH superfamily
4K7FB 2VDNB 4AG4H 4OZGB 1FFRA 2OMXA 1E4WL 3BZFB 3IF1A 3QCVL 3QZBA 4UM8A 4ALAH 2P7TB 3FQ4A 2C26A 1YUHA 4OFDA 3MFFB 5FKPA 3F84A 2OYKA 1G9EA 1MREH 4JRXA 3VFWA 1LO0L 3L95B 1NIBA 4JKPL 1ZWIA 3CMOH 1PX4A 4LSUH 4KKAC 1XF5A 2Y36H 1H8OA 5DMIH 3D0AA 1PPIA 1AFVH 1JHLH 3HS8A 4V11A 5EC1B 1MQKH 4JG0H 2Q6WA 3V4VB 3G5XA 1LMKA 3TT3H 2ATPA 1PEWA 1TLKA 3KGRA 2X4RB 4OD3L 3EADA 4KKZA 5IHLB 1WF5A 1KTKE 1NZRA 1ZIAA 5EU3B 2E4TA 4NHUB 3IJEB 4EIBA 3BPNC 1X6NA 4G1EB 3VXOB 4X4MA 4AQEA 4NHCL 4FS0A 4DP8X 5LCVH 3KH3A 2JQAA 3ZU8A 4XC3L 4MNQE 2NY4B 4ZAKA 4JFHD 2YAMA 4AIEA 4FLHA 1AQKH 1FVEB 2DWDB 5GJTH 3VH8A 2WMPA 2XIBA 3EHBD 4FNLL 4GUQA 3IDNB 2DB8A 3AS3A 3ARWA 4UNUA 2CNZA 3ZRCC 4U1NB 3QEUA 4GQQA 1XSKA 2CUHA 1JNHA 3WNJA 4EDWL 1KDJA 1RUKH 5HVHB 4X50A 1XB8A 4HJJH 3VJ6A 1CGVA 3CXHJ 2J21A 1OF0A 4WLCA 1F45A 5I1AB 1GZPB 3GMMB 5IKCB 1OSZB 4ETQA 3BPNB 5DJ0B 1DL7L 2AXGB 3H9YA 4MX7A 4Q2ZB 4F9LA 5DUPH 5EZIL 4Y4FA 2FBRA 1YN6A 1SBSH 3PQYE 1JI1A 1KB9J 1YNTA 4FJYA 5HJGA 5HDQL 2VQ1A 3WTSA 5JORB 4I0PB 1DVTA 3DX1A 4FMKA 3V5DA 2WLLA 3AZUA 4Q9CA 2EUZA 5EOCL 4PGEB 4L4VB 3DX2A 2JH2A 3H9SE 5GS2D 5BZZA 3HFMH 2P44B 4R5VA 3EJSA 3H8NA 2VW7A 5IM7A 3SJVD 4OLYL 3WD5H 3RDTA 3RVUD 3ZT7A 1IIKA 4P2RE 5FIEA 4WENB 4XPBH 3TN0C 3VXSB 1KPUA 1RJLB 2ZP9A 3P4NB 4Y9BA 2OZ4H 2HTLD 5EF1A 5E6SB 1O5DT 4ZFFA 1A6VL 4MJIA 1UM4L 2NY7H 5J6SA 1MHCA 5KW9L 3NCWA 4NM4H 3RG1C 2WXJA 4Y19D 3UERA 4I88A 1TLMA 3LKNB 4MDJB 4G11A 2QSCH 2YBRB 1TZ8A 5C0FB 4FZ8L 1JZFA 4AENB 1QVOB 2H26A 1CGUA 3HAEH 3BAEL 2BNRE 1XCXA 2F19H 3WEBA 2VM9A 4A37A 1H3UA 4L4JA 4OLZH 1IJNA 4PV1C 4QHPA 5EPMB 1A1MB 4OCMC 4AJVA 4YJZL 1MLCA 2EH8H 1CVRA 3B5TA 1T7ZA 3S3PA 1YEHL 1L9QA 1T0OA 3AUWB 1G1CA 3U4BL 1FAKT 1F3DH 4F1ZA 5BV7B 4O9HH 2E7CA 1PX3A 1Z5LB 4DOHE 2Z1KA 2M83A 3MR9B 3Q2NA 3MRJA 5JIIA 1CMOA 2XA3A 1LLAA 4IIZA 4NRZA 5E6ID 4PVBA 1C08B 2YQ3A 4NM8L 2BMKA 3QDMD 5E95B 3HE6B 3WS6C 4P99A 5DEFA 1F1GA 4DP7X 1QYGL 2VLKE 4XODA 1P5UC 3ZGHA 2YD7A 4U6YA 3AB0C 4EE2A 1GYUA 5ACZA 2G4EA 4NSKB 3FCSB 3UZQB 3UTTA 4UB0H 2VLKD 4IJ3C 1CICD 5DJ2B 3AVEA 3Q8FA 3O4LA 4PJ5B 2ZCLH 4R0LA 4MDRA 1RIVL 4XVTL 3RBSA 4PJHA 2XRAH 3T71A 4QLWA 1F1DA 2OMZA 2VOTA 4WSGA 3NPZB 3BSZL 2HLAA 3RI5K 5GS1A 1R46A 1RUQL 4NNPH 4QHNA 3MLRL 4R26L 4N2DA 5CU9A 3FYIB 3HKFA 1IBYA 3DXAB 2VITA 4LVEA 4GAGH 4XOEA 4YX2L 1S9YB 5F7UA 2Y23A 4HHGA 2ED8A 3VWJA 1VGKA 4AITA 1JPEA 3ARYA 4PWEA 1XQ4A 4EN3D 1JIBA 2R1XB 1BVLA 4XMVA 3SQBB 3PWLB 5IBUB 2O5XH 1A0QL 2XPGA 4X4XB 3WUZA 2MRYA 4X7TA 5IB1B 3SPHA 4KXZI 5F7KC 1OAXH 4JJHA 1U8KA 3KYNA 3ATAA 3GWJA 5CZVH 5IR1A 3FTZA 3DIDA 2FX8H 2RQEA 2Z8WC 4FXGA 3RGVB 4TTGA 3NQIA 3G04B 3BAJA 3S3CB 4W9ZA 1GYVA 3FC8A 4BFGA 5MEQA 1L6XA 1U4EA 3WU1A 2J1WA 1XTLA 3T2PA 3PJLA 4NAJA 3MFGB 2D3VA 4HUUB 5AWNH 1VFAA 2F18A 3P0YL 1KGYE 4P4KD 1E5YA 2OX5B 3T4AA 1EX0A 1WA0X 2AK4E 3VYNA 4OF6A 4PYGA 4Z3EA 1QBLL 4HJ0D 1CDJA 5F93C 3EOTL 3MBEA 4GRWE 3VXNB 1JPTL 3QQ4B 3B9EA 4QRPB 3VD3A 4X6EB 1YVLA 3KLQA 2V2TB 1AJ7H 5EZJA 4X6DE 3O0RL 2DM4A 3CDGB 3D4YA 4N8VA 4BINA 1JGLL 2HWZL 4WDIB 4Y2LA 1I9RL 4FN0A 1AGEB 4MXWL 4RMVA 4GI6A 1LNUB 2FR4A 4JM4H 1EERB 4ZUUB 5C9KA 2RCSL 3HE7D 5FM4A 1MKFA 3R4DA 1YJDH 3BGFB 4QRRB 1V7NL 4N20A 2XYCA 3QB7C 1KLUB 4ZPVA 1CGTA 3SBWA 5GRJL 4W9DC 1BEYL 1SF5A 2ZKXA 4R4FH 3ZQ9A 4CSPA 1AG6A 4P5SA 2NSQA 5INDB 2CPUA 3BUTA 4UZSA 1LEGA 1D5BA 1N64L 1IBZA 4MRCA 4A2LA 5JQHC 2KBGA 2C1PA 3WNIA 4JO3L 4RBPH 1AKJA 1IAII 3BH8B 3MSPA 2VRAA 4FHJA 1WZKA 5D2NB 3IU3B 5JYMA 3PQYA 2H6PB 1OAYH 4HXAL 3VD0A 5I8KH 2AQQA 2AMUA 2YN5A 4GOSA 5I76A 4OCNC 5HGAB 3H9SA 2JFCA 3L5IA 1MIEH 3BQUB 3NCMA 3S8WA 5C0AB 3WG7B 3MCKA 4HUVA 1A4BA 5GGVH 4EIZC 3TV3H 5LLIC 5E2VL 1KIRA 3MC0A 4Z7WB 3MJWA 1OGAB 2QMKA 3O2DL 1QZ1A 2BZDA 2PMZA 4KUZL 1FL3B 2DJMA 4F8QA 3WI9A 1BF2A 3LEXA 2Z7ZA 2WYZA 3BUPA 1FUNA 3IMVA 4KKCD 3T2QA 4F57H 1SJHA 4X80H 5D70L 1OE2A 4W9KC 4JPKL 3KPMA 2M26A 3QNZA 2FL5B 3GSWA 5DJZB 2YKLH 4ZMPA 1E7VA 4S0SD 2BNRA 1IUZA 1AR2A 4TF4A 2VKXA 4M8QB 4KJYA 5IB5B 3B9AA 4PJ9D 2APFA 4U1GB 5HI5C 3NZHH 1A7PL 1MWAH 4ESKA 1F13A 2B0SH 2BNQB 2D2CC 4PJ8C 5EUOF 1VHPA 4M7LH 2JKLA 5KAQG 2FB4L 1YAIA 2AEQH 4DP1X 5E08H 5F1IB 1Z7JA 1KTRL 5IEKB 4RMBA 4HBCH 3R1GH 3QIBD 3IJYA 4D0DB 4OVUA 2UXFA 1N26A 1Q72L 3VFOB 2J5WA 3LRGA 2VLKA 3IVKB 2XG4A 1QABA 3QZNA 1QWNA 3I75B 4EI5D 4CL7A 1KDIA 3H2PA 4O4YL 3T0EB 5C0BB 4NC1C 4AVJA 1SOKA 3THML 1E50A 3PG2A 4WU5A 1FO0H 1T1XB 5CD3A 1RY7B 1H8NA 3S37L 3D4CA 2XETA 5E8OA 1FAIL 4G6AC 2A7BA 3T3ME 5CLXA 3ESOA 2V17L 2AK1L 3GM0A 4L4TE 3U9PL 2VERN 4BM7A 5I75C 4XX5A 4ABVA 1P4LB 3RB7A 2DKUA 1ZANH 1EEZB 5D6CB 2WVVB 5FYKH 1ZV5A 2V8MA 2BCKB 4JCWA 4OGQC 4JHUA 4Z3FA 2VR4A 2FEEI 4UV7L 3ZDZE 2RFXA 5D7JC 3IMRA 2EXWD 2W9DH 2PO6C 1INDL 4G9FE 5IVXA 3NSJA 2IGFH 3L54A 4K07A 4Y1AD 3S5LG 4KITB 1FNLA 3CIQA 3QHFL 3MOAL 4JO1H 4CUCA 2XQYK 4IU3B 3M17A 3VMOA 4I2XB 3JTTB 3FU9A 4BFNA 1FIEA 3EOBA 3MQIA 3NP4A 5F9OL 1K5NB 2F8VA 2JJWA 2OFQA 5FB8B 3DUSB 3FSWA 2A6DA 4HHWA 1FGNH 3GZPA 5DRZA 5BVJB 4FQLL 4L48A 4QRSB 4M7LT 2AC0A 4U2ZA 1C12A 3NGBB 4Z95L 4NPYB 2CCVA 4IBVA 2QR0B 5EFIB 2C9VA 3V0EA 3BP5B 2HJLB 3VTTA 1HIML 5I1CL 1FZOA 2XV0A 4F20A 5JLZA 1N67A 1LK3H 3IFOA 4XTRC 2AK4A 4ZFGH 4UINH 4B0MB 5SWSD 4AYFB 3HI6L 4RAVB 4AJWA 5IHHA 4KRNA 1XGQB 3IB4A 3TH3T 4CVZA 1J8RA 1E8XA 5FGCB 2WP3O 3GPSA 3TIEB 1I7RB 2L7QA 4X83A 4B53A 4X6DA 2D0GA 1BQHB 4JHBA 3T08A 2NT1A 1TTFA 1HEHC 2DQDL 5DSCA 3S98A 3V9EA 3OTTA 4YXHH 4IRSD 3HVDA 1U8LA 4EN2A 2GCYA 3MRDA 4W6WB 2ZSWA 3AQYA 3WJMB 2X4NB 2ZUQB 4GY4A 5AD0A 2A9MH 3HNSL 3LQMA 4XZ4A 3BRGC 1ZSHA 4TVPH 2VQUA 2QADB 3TN0A 3I6LD 1WWCA 2R23A 3QA3B 1OIOA 1A64A 1YEKH 1CU4H 4J12A 4PFEA 4FFZL 3B2VH 4TUOA 4Q9QL 5AB1A 3BVWA 3VGAC 1DQQA 1J8KA 4PSRA 4WTZA 3U6XS 1REIA 1GZQA 4KX8A 4WGKA 4XN1A 3TBYA 4V33A 4W9IC 4MS6A 3TBSB 5EB9A 1BPLB 4NRXA 5AVWB 3WJJA 4H8QA 5EDSA 3CHPA 4YLQT 2IQ9H 2BWQA 2IGTA 2H0FA 4HLJA 1JWMA 4QRTA 1CL7L 1O5PA 2X3CA 1LO5B 2PP9A 4FD0A 1R5VA 2IAMC 2ZXEB 1AXTH 4NX0A 2DQJL 4HWBA 3UTPE 3WCYA 4DAGH 1DCLA 4JHAL 4QHLA 3FF8A 1Z9PA 1NEZA 2R29H 3S35H 3VGFA 3SKOB 5JPNA 5IHWA 2Z31D 2P3YA 3BIBX 3MUGB 4PJIF 5I15H 3FSOA 4LIQE 2ICCA 2KLTA 4JPVL 3FOMA 1EEYB 3O45B 3S97C 5FUOL 3RWJB 4ADGA 4M1DL 2K1MA 1SFDA 1CR9L 4G7SB 2K9UA 3MRKA 4UV4L 3NA9H 1MIML 4O2CA 4RFOH 4G6FD 1JERA 5EO0A 3CSGA 4TNFA 2ODHA 3KCPA 4NQVA 1S2EA 2XBDA 3EJPA 1S5IH 3AAZA 3HNVL 4N0YL 5FDWB 1QFUL 1RIHL 1VZIA 3WKMH 3VW3H 4MYPA 5A7BA 2KDYA 4FTDA 1TSHA 3QCUL 2UWEA 4DP2X 4IRZH 3BSGA 5CSGA 4UOJA 4NC1E 4PJ9A 2C9PA 5HHOE 4M7ZC 3BAXA 4P5TB 5IT2H 3TP4A 3P73B 5EWIH 1BQKA 4WFFE 1JS4A 4XVSL 5E99H 1OF2B 2Y3AA 1OT1A 4G71B 5KSVB 2BZ7A 3HPJB 4ZW6A 4WGVB 3SBPA 4XP6L 4Y9GA 5HJ3A 3AM8C 3RTQB 3V4UL 3IMBA 3VFRB 5JO5A 3QIBA 1MDAA 2G4GA 4MJHA 3RWDA 1U8JB 2OMUA 4WGWB 5I1JH 4F33A 4EZMA 4OD2A 3EH4B 5ENWB 4HS8H 5F44A 2CR0A 2VUKA 4JFTA 4AYBA 4EI5A 2CNYA 5EOTB 2YA0A 2PR4L 4KZ0A 2R2HA 2WUCH 4A63A 3ZE0B 2GT9A 4LVNB 2EABA 2B1AH 2AGJH 4BFIA 1KCSL 1KEMH 1IEBB 2PN5A 4UDTB 5IGXL 3BKJH 4K8RL 4L4TA 1VESA 3D4ZA 2CBMA 4HUWB 5CEYB 4PRBA 1A4KA 2PXYC 3CX5K 3CFJB 3DX6B 4X7EC 2J7LA 1NLDH 1HHHB 1JGUH 4AGOA 4TSBL 2R9HC 3HZMA 3ZRSA 4W4OC 4U0RB 5DK2B 1TYJA 3AQZA 4Y1AA 5GPRA 2D4FA 1L0QA 2W38A 3O2VL 4F9PC 4QGYA 2BHUA 2J6EA 2W88A 3OX8A 4YHOH 2VGLM 3W11C 4N90E 3I6KB 1A47A 2CO4A 4YAQB 5T3ZL 1MJ7L 1XMWA 1MCSA 3GGWA 3P11L 4CVXA 4PRID 2XI9A 2WKGA 3K3QA 3CMGA 5AQ0A 1FNAA 2C7FA 4XNBA 1B4JH 5LBSH 3DHUA 5HHPA 3BHBA 5C2UB 1JXGA 4MNHA 4PJCF 1FNGA 1YECL 2Z8RA 1A5FL 1ZVSB 4NKOB 8PAZA 4FCHA 3OHMB 1WK0A 1NFAA 3LPFA 3NCEB 2WXMA 4NJAH 4LSSL 4NQCE 5I8CA 5IFHL 3GO1H 4U6VL 1W8OA 1J11A 4QNPF 1MW3A 3HHRB 3WHXA 1ZHBA 3WTVA 4HCFA 2OSLA 5CO1A 2EYSA 3GS4A 1BSIA 5GRXG 3P9LB 5F0MB 3UEZA 1YEJL 1J1OH 3GMLB 3TBTA 4D9QD 4IRSA 3LV3A 3E9UA 5D7SH 2F53E 3CD4A 5FM8A 5H2BA 1R6VA 4DFIA 1ADQA 4PG2A 2Y07L 1FE8L 2DKSA 4J8RA 1SZNA 2WGXA 1BYNA 2EDYA 3MV7E 5F1OB 3V4VL 4B9PA 4BCYA 2NY3D 1I1YA 3FB8A 2EINB 1JN6B 1N6VA 3RNKA 1E5UI 3VGBA 1HXYB 3BPCA 2KHAA 5A6IA 3SGJC 1YRKA 1FFTB 1UD2A 3NZ8A 4K2UH 4Q58C 4DEPB 2CBPA 2JK5B 3S4SB 2FJHB 1HVXA 1MFMA 1IGFH 25C8L 5B1CA 3BE1L 1JCVA 4L9LA 3N2JA 1CE6A 3KPSB 4PP1D 1S7SB 1NC4B 3WIHL 1ACYL 4FNUA 3ULVL 1HI6B 5ALBL 1U33A 4YZFF 3ZTEA 2P42B 4MJ5A 2TAAA 4ZS7H 2Y06H 2HG5B 5JA8B 4HIPA 3FQ1A 5LAXA 1ZMYA 2E6QA 4S2SA 2DLHA 5CFAA 4Z7IA 3GB7B 1CZ8L 2NX5B 4OGAD 4Z7VE 3ZE0E 3B8YA 6TAAA 3VFVA 4XVJL 3ETSA 3WFEL 1X4YA 1KCUH 1TQBC 3U9WA 3A67L 1SOQA 1CG9A 5E23A 1U21A 3DROB 2HSIA 3GSUA 4PJ8A 3I6GB 3O3BA 4NIKB 3Q06A 1AZBA 2UUDK 1E2ZA 2W95A 2DEYX 3LH9A 1VPOL 2V7NA 4G42A 2F68X 5KBDA 1MNUH 3IDYB 5T5FL 3DX8A 3HAEB 2ZSVA 2VH5H 1U2CA 4KJPC 4G8AC 3BVTA 2JCCE 3QS2A 4AL8H 5A1AA 1SDDB 4U1KA 1YY9D 4OZIE 4ODVH 3PDGA 3O9WB 4JFXB 3DSFH 4FLOA 3SEPA 5HHOA 3ESUF 5JR1L 3FPYA 5JNYA 2BJMH 4KMTL 3KPPB 2YMOA 1A6WL 1I7ZB 5DRWB 3CDCA 2BHFA 4UYQA 2WBXA 1L9RA 4MD4B 4M62L 4DP9X 4UT6H 1NCIA 3ES6A 2YXFA 3X1BA 4A66A 1T83C 3L5XH 3U2IA 1IGTB 4LXFA 4XPAH 1NBYB 3GSVB 1MCHA 4ELMF 3A23A 4PTUB 4MAUH 1TYEB 2OJ1A 2DWSA 5I1HH 4JKWA 4AIXA 1ECZA 3U0PB 1O9VA 5D7JA 3IKCB 4QDGA 3QO1B 2PO6A 1N0LA 1EDYA 2MCAA 2B1HH 3MO1A 4XOAA 3QRGL 5BV7L 4JO5A 3FQNA 1HKLH 5JOPE 4X4YB 3GMQB 3B2UC 2AMGA 4XBPB 3PYCA 4GRLC 4JLRB 3PHAA 4PWHA 3C75A 3F7PC 5DVKA 2DAVA 3GPEA 3MLSH 4WI0A 3REVA 2VJXA 3G6AA 1I9IL 3ME0A 4PR5B 4LHQB 1N59A 1YNLL 4GXUN 4NZ8A 3KHQA 2E47A 4E36A 1NPUA 1P4IH 1P7QB 2NY6D 3BPLC 3ALXA 3FQTA 5ID0A 1AC0A 1PGRB 3ECVA 1WA1X 1PD6A 3VWKB 3UX9B 1ZHLB 2Y7MA 3IDJB 2CZNA 4DUWA 4FRWA 1WTGT 2IO5A 1RJZA 1R0AH 1QLRA 4QRQB 2QVKA 3N1PC 4RFEB 4NUMA 4I89A 3IU4L 2APVA 1CT8A 4DGYL 4GAJH 4GO8A 1LWHA 3QIWB 2GPZA 4ZJ9A 4P59L 3TPUA 2AJZA 4KKLC 3ZSSA 1QO3A 4DQOH 1JPSH 2DY2A 2P1YA 3ZKMD 3Q05A 4Y2DD 3DJSA 5ICZB 2GJ6B 5TFSH 3VE0A 2I7SA 1XXDC 1BREA 1NFIB 2PYEB 2GK0B 4QO1B 4GQ9L 3MLYH 4KJWC 3NCYS 5FA3B 3KWXA 3QH3B 5CBEA 3BDYL 3CBJB 2VXVL 4XC1H 3WEAA 3T65A 3EDJA 2BINA 3O2WH 3Q2CA 3EH3B 3GMRA 2B77A 4NZFA 5DJDB 4NQCA 2Y2WA 3DSNA 4KWUA 1UURA 2CJUH 4Q74A 4RGOH 3SE3C 3NJFA 1N2RB 2Y25A 2AV1B 1HHGB 1S8DB 2Z34A 1MRDL 2X4PA 3LZQA 3OKDB 1OAUH 5D8JH 2QQLL 2ICWJ 5MERA 1NEUA 4HEPA 1WZMA 3GFUA 3K80A 2HVJB 2NYZA 4XNYH 4HJUA 2F53A 2DM2A 2NXYD 1DBMH 4BQ8A 5HHVL 2J20A 2MHAA 1RJYA 2HN7A 4J4PC 4N6RB 1BAWA 5CINH 3V52L 3CVCA 4U0QB 5HTSA 1D7BA 5BO1L 1JE6A 4DN3H 3TBWB 3CSBA 4Z7UB 3O6FB 1OB1B 3MV7A 1SM3L 2ADFL 5DDHA 3T6ZA 1EDQA 1UQSA 2A74B 5L7XL 2XTJC 4JKNA 2G30A 4CVWA 5LXVA 4IHBA 2R0KL 5JHDD 2VIRB 2DJ4A 2ZX7A 1T6VN 2K3HA 3BP7A 3SYAA 2YRPA 5MENE 4X8JA 5D5MA 3MV11 2JV6A 4ES8A 4N8CH 5F3BA 3AWGA 5EO9B 2V7HB 5AYTA 3TA4D 3TCTA 4EUPA 5AOKA 5E56A 1RUPL 3ZMNA 2Q76B 2AANA 1DQKA 5ANMB 5IOKA 1X5FA 1F6FB 2G2RB 4X7CC 1UEYA 2NDGA 3ESPA 1D5MB 1T5WB 1AXSA 3MMEA 5HI4C 3BX7C 1DSYA 4NUJA 1R3JA 1G7QA 1GPOL 4Z7VA 3CTTA 4UT9H 3VU2A 5LQBL 5CEZL 5IFJA 1SYSA 1TZIB 1OT2A 4UAOC 5DZNA 4E5XB 4L05A 5C9JB 3STBA 1MPAL 3OAZH 1EZLA 3LRSA 2YGOA 5DJCA 4YMPA 1U8MA 1QQDA 2DIBA 3QZWA 5DK3A 4X99B 1BZ7B 3D48R 1DQIA 5KSBB 3RJDA 1VDGA 2IPUK 2UYLB 3MRPB 2X10A 3RPBA 4D3CH 5AVQB 4R9HA 4WJKB 2R0WL 1UD3A 4PVMA 3QXAA 1HAWA 2JCCA 1PZ5B 5JHLH 5C3TA 2ORBL 4MVBC 1DLHB 2QSQA 1NGWB 3PREA 4OZIA 3ZY7A 1T20B 3MLVL 3QWOA 4AQOA 3HG0A 1E27A 2JVUA 5C07B 2WO2B 4JFYA 3QEQB 5DD3H 4XP1H 5EH1A 3HLAA 2G9KA 1DUZA 3QQNA 3QUKA 2OJZH 1MFBH 2VZSA 4GP5B 2VSCA 4L8SA 2W0FB 1A3ZA 4RSYA 1UT1A 2OMYA 4Z7OE 4EBQL 5BRZB 2ZXCA 1NMBH 2HJFA 2A38A 1RZQA 1UVQA 3F01A 2YC1A 2ICEC 3N85H 5EUKA 3S37X 3X13B 3LS5H 5J9PA 5LJYH 1JZ3A 4W4OA 3TO2A 3U0TB 3LJ3A 3TGXA 1PBYA 1DQDH 1KCWA 3KNBA 5F7LB 3KS0J 2BY2A 4MRBA 4F9PA 3VD1A 3G6DL 4FQJH 2H3NA 2ATAA 1FSKC 1KZYA 1FO0B 2CDGA 5E2JA 5T33H 4NQTA 1ZTXL 3GMPA 2HMIC 3P3UA 2HKHL 5FK9A 2Y7OA 3D2UB 2WTRA 4ELMB 4FFVC 5ANHA 4K23H 2I07A 4TLTA 3FUEA 3GIZH 3B9KC 5C3LD 1TEGA 2AQ1A 1KCVH 3HZKB 2CA4A 4WJG3 3CC5B 1TJHL 3WY2A 2VDOH 3NT0A 2DIJA 3P69A 4HJTA 1H3PL 4M3KB 1NJ9A 4GINA 2AVFA 2P24B 4WFED 3FH8A 4FI6A 3RWFB 2EJ1A 4EZLA 3NCJL 4HAGA 3GXDA 1DJSA 2J3SA 4GQPH 5TQ0L 3CBRA 4AQ1A 2YEZB 4HPYL 2Q87A 2CK2A 1NCHA 2IBBA 4KHTL 1UACL 2CALA 3RWEA 3MV8B 4NQXB 2WD0A 3RWGB 2IBGA 3PWNB 1EHLH 4TUKH 4UU9B 3K2UL 2FH8A 4Y2DA 4YNYB 3TF4A 3F7VB 3B9KB 1NOAA 1RZ8A 3K46A 3ZE2F 4J2QA 3GHEL 5CJQH 5I24A 4M4RB 2YPLE 2P8LB 1R47A 2JJSA 1IFRA 3UTZB 5IBTH 1Q8MA 1B2WL 1AE6H 3IJHB 5AUMB 2NW2A 3RTLA 4C55A 2XZQL 4P2QE 3FO0H 1YEFH 4J28A 4FAAB 1FG2B 1YQ2A 4FNPA 5DMJB 1JRHH 5FDYA 4JPIB 5B8CC 2P9RA 2XTJE 1WTLA 2D8KA 3MX0B 5AW6B 3SGJA 3A4DA 3BWUF 3U9UA 3SKUD 3HVNA 1AQDB 4OBRA 2WV3A 3WUWG 2W60B 1S6NA 5CCGE 3BGAA 3KJ6L 1LE5B 4WWKC 3JVFC 4EMZA 3SYOA 5GRUH 3L4TA 5JW4R 2WQUA 4R5XA 3KYOA 2DQEL 1CTMA 3SB3A 3TT1L 3GXFA 4NUGL 3UO1H 1ZA3A 2M8XA 4KVNH 2B4CH 5DURB 2DTSA 1DQVA 1SLXA 1IAKA 1JXJA 3BXNA 4DTGH 3NP3A 4Q4EA 1MRCL 4NZDA 5GGRY 5JHDA 2ADYA 3O81A 5E5MB 4GUOA 3QEQE 4H88H 1GGCH 2X9ZA 3HB3B 3SY0B 1NCCL 1IC1A 5ISZB 2GK2A 3UZEC 1XV8A 4PEEA 2BVYA 2BHZA 2SEBA 4NWUL 1BFOA 2BOBA 4RLDA 1OD9A 5T5NG 4OBSA 4J2XA 4H40A 1YEIH 3FO1A 1F02I 2IPKA 1G6RH 1K2DA 4IOIB 5SWQB 2AXWA 2ZPKL 1KENL 3RY6A 1EHAA 1JZ6A 1G7IA 1HYRC 5CMAA 2XWBB 4PPTA 3OL2A 3V2AR 4FKEA 4F2ME 4EKXA 4IGBB 2JB6A 4Z78B 3U7AA 3LH2L 2ARJB 3PIQA 5T1MB 3MRGB 1OB0A 3WL9A 3FQUB 4U3CA 3Q8EA 2BSSB 4HUCA 3HC4H 3ATDA 3D9AH 2AJVL 2G75B 2NY5L 1U3HD 1YCSA 1ZT7A 3F7YB 4FQ2L 1FDLH 4YLBA 2XQBH 4G59C 4LF3A 5AYQA 1T83A 3PNWB 1BFSA 3QI9B 2K7PA 3NTCL 2ZOLA 1MCRA 2UY6B 5J11C 4IOSA 3JVGC 4G8FB 3HG5A 5HDBB 3LNEA 4OCWH 5L4FA 1JZ5A 1C16A 1O9ZA 1OARL 4JFEB 4UNTA 1Z1WA 2EEBA 4RGNB 3KYMA 5IB3B 1E5AA 1S7RB 4CMHC 3PAYA 4BQ6A 2PCPB 5HI3C 3HMXH 3LCYA 2C4XA 4ZDHA 3D34A 5DQJB 1MI5D 5DTFA 4EZKA 4I4WB 3S5ZA 1NFDF 2WBJD 2Q9OA 4AJYV 4CADA 2EO1A 4WW2B 1OM3H 2YPKB 5C0CE 5FYLH 4LL1A 2JIXB 4FFVD 5F71A 1E9QA 1JF1B 1OCRB 4H44C 1BJMA 1KBGL 2B8OT 3L3GB 4JAMA 5J11B 3ZTNH 3BP6B 3MA7A 4GI8A 4HWZB 3LKSB 2IALB 2Q8BH 1A7QL 4ZNEE 1E28B 1QSFE 2EDXA 2V33A 5I5IA 4RFNB 3OKOB 4J5VA 3OGOE 3L3KB 3ZMRA 4M5ZH 3JQOB 4JZJB 4R96B 3QJXA 2E74C 1M2VB 2CRIA 2FX9L 3V5HB 3EGDA 1VEMA 5IB4B 4EXPX 1P1ZA 1TTAA 2PLTA 3RFZA 4WU7B 1PAMA 4BRVA 4HX1B 4Z7NF 1KGXA 1GIGH 1IGJB 3EO9H 1UD6A 5F7MC 1H5BB 3VH8G 1MRFH 3GSRA 5FS5A 3EH1A 3NACL 3T8XA 1IM3D 4G2AA 4U7KA 4JDEA 4C54A 4E41B 4UM9B 3FT2A 4WI9A 3QULA 4HF5H 1CLYL 5KVEH 1C5BH 2CIKA 4H1LA 3DHJA 1AI1H 3SE3A 3HEIB 4Y1SA 3LH8A 3V4PA 2Y69B 3L3DB 1BMWA 1T4WA 1WD8A 4NQDB 3NSDA 4BD4A 3P77B 4YDKH 4PJXB 5F6HJ 2P46B 3EG9A 4UZGA 1GCYA 3DBSA 5K1NA 4PI2A 2EIZB 4YHMH 3RYMA 2EH7H 4LPVA 3KPOA 1CF8L 1DBBL 2P8PA 1PS3A 3L6FB 2J88L 1OTSD 1H9DA 2EP6A 3L3HB 5JA9A 3ZHFA 4P2QA 4AM0A 1OGTB 5KG9B 3W0WB 1A7RH 3OF6D 2YD4A 1QFWM 1IKNC 1NAML 3E9TA 4TN9A 2X28A 4GSRA 2WXRA 2FGWH 1TCRB 2VMDA 2WK2A 3MJ7A 4AG4L 1BPVA 2VR8A 3NJGA 2KI6A 3PGFH 3W39A 4ALAL 3DOSB 5B38B 1FZMA 4HKBB 1KPVB 3G9AB 3MRCA 3PJSA 1LHZA 4WUUB 1NBVH 3VMPA 3D69A 1UXWB 4WNJA 3V7AG 1MREL 3KGSA 1I7UB 5I0XA 4HWUA 3CMOL 3DYMA 1UOWA 4GBXD 1YG9A 2Y36L 4LSUL 1VAHA 5DMIL 4IBTA 4ZMWA 3E1ZA 3FUKA 4P2YA 1AFVL 4CGUB 2UZYA 1JHLL 2J1ZA 3VXUE 4JG0L 4GAFB 1K4DA 3PWVB 3TT3L 3O2DA 1GHFH 1XDTT 3NG5A 4K3JH 5E9NA 5HSFA 4EXKA 2R2BA 4HH8A 2BRRH 3ILQC 5B39A 4BUGA 3UZVB 2FSEB 1CFNA 4JM2D 3HI1B 3AXHA 3MREA 4Z0XA 4JS7A 4ANWA 3VGDA 5I1LB 5LCVL 4X6BA 4M00A 1EK3A 1KYUA 2MTPA 3MRMB 2XZCH 1AQKL 4NQED 5GJTL 5GS2H 4AXWB 4XPGH 2LAGB 4QYOA 5G5DB 3DVGB 3WY3A 3HZYA 2K7QA 4GKNB 4QT5A 4PM1A 4UDUB 3GSNA 4OJEH 1ZPUA 2IIJA 3RILA 1QRNE 2D7TH 3DLQR 4YSQA 3MNVB 3QYMA 4IDJH 1RUKL 3VCLA 4J3WA 4HJJL 3RHWK 1U2YA 3FSAA 4JREC 4OFYD 4L37A 3D18A 4WHCA 2ED9A 3HS0C 1XCWA 1IBFA 3CCHA 2VLLB 5DUPL 2HKFH 3U82B 4XCEA 1SBSL 2FUTA 2FWUA 1IAIH 2BCMA 2OW7A 2WKOA 3LKRB 4PJAF 5FFLA 1MWOA 4BE6A 1OPGH 2CWRA 2RBLA 2WLMA 4OZ4B 1YQVH 4TL4A 1AZUA 5IHBA 5GGUA 1I4FA 2C3VA 5I73B 4KFMA 1ETB1 3HFML 2ICEA 3QJRB 2DZEA 2JELH 3BGMA 3CAFA 5CNHA 3MRRB 3O41B 4L0PB 1FL6B 3WD5L 4KROC 4L9DA 5KUKA 3WDIA 1J12A 2VDLH 3BKMH 4XPBL 5FGBA 1QNIA 4AMKH 5A3IC 1KYOK 2OZ4L 4UQCA 1TQWA 3K5SA 5GIRB 2YFOA 5IV2A 3R06A 4ELKB 2CKNA 5DD6B 2NY7L 4H8VA 1RZFH 1KJ2H 4NM4L 1UM6H 1KSRA 1KPRA 1E67A 5AZ2H 3QZMA 4K8RD 5HDWA 1J8HB 1FYHB 2Q10A 3FUNA 3ROOA 3K8MA 1U8IB 3CVHB 2WNGA 3K1KC 2K6YA 4B5EA 5KANI 3BC9A 3K6NA 4X2UA 2YD3A 2O5ZH 4OT1H 1KJ3L 32C2A 1E8YA 4KMQA 1XZWA 1MCJA 1MW1A 4MXQC 2O61B 3FUIA 2F19L 1DP0A 1UXLA 2XNAB 1BECA 1BQRA 2QKIA 4WHDA 4WI2A 4OLZL 1X5KA 5D2LA 3V8OA 5DZVA 1S9XB 4ZNEA 1QSFA 2F61A 2EH8L 3WFZA 4N1HB 4PJFF 4IHOB 5E00A 5T3ZE 1RZ7H 5F21B 4K73A 1DVZA 3B5HA 4O9HL 4PJDF 1ORSB 5KSUA 2NY0B 4YFEA 4F7EB 1QLEB 5K39A 5FF6A 1CK0H 1UM5H 3EJZC 5ESAB 2VLRB 2XWTB 1H15A 5CEXA 4FCAA 3GLEA 1ZT1A 3L3OB 4CSZA 1O7DC 1P84K 5E03A 1IVTA 3WFHA 4HHAB 4XXDB 2WO4A 5IVOA 4ETYA 2GTWA 4PTTA 5GGSY 4MCZA 4N8VG 4FQPA 3DETD 3MXWH 4XNQA 5D7HA 4CSTA 3VI3E 4ZFQA 5DS8A 2P8MB 1FG9C 1CQKA 5EBMB 4UB0L 4YHLH 4NZRH 2XKNA 3N5AA 2ZCLL 3QGVA 4PS8A 5AG9A 3BVUA 1XR9B 1BZOA 2XRAL 3W82A 3WTUA 3MLPA 1MCPH 3LQZA 43CAB 4NFDA 1JG9A 3A4EA 4GW5B 3BLKA 2D7MA 4BRJA 3STLB 3EYFB 4CNIA 4NNPL 2VDMB 4A6YH 3OG6B 2VMEA 4XO9A 1GOFA 1RCYA 2GBVA 3GDCA 4WWKA 4FQQB 1KTDB 4GAGL 1JZJA 1CL7I 2X2IA 4NUQA 1KTCA 2OMTB 3FAWA 4PJGF 3C5JB 2X3BA 1S7TB 5E0QA 3EJJX 3M46A 4TNGA 4HEME 2O5XL 1UUNA 4AQ8C 1IGYB 5AVXB 4KV5E 4N24A 5CJXC 1JPGA 1OAXL 3MHZA 4HIIB 5CZVL 1Z2KA 2J55A 4OKDA 1KT2A 3VXQB 2FX8L 2E59A 3SCMB 5HYJB 5K59F 4NDMA 3NIFB 3ZDXB 4P8QA 3LDBC 3A21A 3MRBA 3EBIA 2NY2B 4R7NA 2E76C 3OMNB 2NY4D 3ROLB 2QZQA 4LHUA 5E0FA 5AL8A 1VACA 1THCA 4JK0D 3SE6A 2CGRH 4MXVE 3X2QB 3ULVD 2BVUA 1HXMA 1NGXB 2ZWSA 3BUQA 2V2XA 4ANKA 5AWNL 4ES9A 4U3SB 4YDJB 3UGEA 4LOFA 4L1TA 4H0LC 5B7MA 1XCQA 2D7OA 2PWGA 4JDTH 4TMPA 1JYWA 1YZZA 1M3JA 5I6KA 3OB8A 1MY5A 2IWEA 2Q3ZA 4S1DD 1BA9A 4DKAA 3TWYA 5GRVL 1FV1B 4YHKH 1KXQA 3ESMA 5HY9B 3PDOA 4YO0B 2J8UB 2BOCB 3FMGH 4XBMA 5JHBA 1EZVY 3KAAA 3DBXB 4JR9L 1JFQH 3ALWA 1TKWB 3IN0A 1QUPA 3AY2A 4LT7A 1FYTB 4I0PD 1TU2B 3VAEA 3WIAA 4AMXA 1AZCA 4JM4L 5LWYH 3G5YB 3QQ3B 1LP9E 2EKSB 5DFAA 1E5ZA 3JVGA 2AW2A 1OTTD 4S11A 1JNLH 1YJDL 4U05A 2OR7A 4E9SA 1R3HA 4P48A 1HCFX 2ZXQA 2AXFB 2BFVH 3VXSD 5JIDA 3NZUA 4OFYA 4YK4C 4PJEF 2O30A 4R4FL 4J3OG 1EBPA 1GL4B 3RFRA 5ILTL 3GMNA 3L5WA 4ONGH 4FEMA 3PGDA 4ODUA 3VFPA 1JXDA 4JFWA 1RHHB 4G6MH 4FQCH 4WHTB 4F15B 4F7TB 1KMGA 3WFCH 1OAYL 4YR6B 5IOPB 4N0FB 5I8KL 3F5WA 3G5ZA 3QFJB 2FYYA 4N0CD 1DJZA 5IROD 1CLZH 1VERA 4B9GA 2LU3A 5GSVA 2EDDA 3TCXA 1OE1A 1N8ZA 4U2YA 4JFSA 4EVNA 3HR5B 5GGVL 3TV3L 1A65A 3R8QA 3TEUA 1J05B 1G1OA 1A4CA 3BDBA 3WN6A 1A8ZA 4XZUB 4ZMAT 2NLJA 5JXED 2W1NA 3GJFK 3KPNB 2AV7B 1O7DE 3D6GA 4NN6C 1F6LL 3S48A 1XCTB 4F57L 4UANA 4X80L 3N40P 3HE6D 4JNXA 3IFNH 3WSQH 5I17A 4PJ7B 4HK0B 1T03L 5SX4I 1QX1A 4FJ6A 2ITDB 3O11A 2IPUG 5KS9E 4DKFH 3JWOL 4LLWA 3DRQB 3MRIA 4LDOB 4PJ5D 4KI5C 2YS4A 4HU8A 4LLAA 5C3IA 3NZHL 4ATTA 5D1XC 3A3YB 2P5PA 1MWAL 1YMMB 3N04A 5BO0D 1MW0A 4M7LL 3UJTH 1F8TH 2AI0H 2D3JA 4XAWH 2B9BA 3R7QA 2AEQL 2HLFC 1FORH 1UC6A 3DXAD 5BW7A 5E08L 3N06B 4HBCL 2OTWA 3R1GL 3LB6C 1FN4B 2CXGA 1BOGB 3C87A 3F2LA 2VDOB 1J8SA 2B9AA 3GRGA 3H53A 3QR2A 1BX2A 2BXZA 3IJ7A 4NP9A 4BKLA 4XN5A 3D8MA 2NSMA 3VI3A 5LXGH 2IH1A 2QEJA 4LNRA 2MKLC 3ZYZA 1IKNA 1LJMA 3RGVD 1FO0L 2KPWA 4LSVH 3ARXA 3G7TA 2G5RA 3D3VB 4TS6A 1NCTA 3FCTB 1XF3A 2BWIA 3NN8A 5TDPB 1OP3H 2GY5A 4WTZG 4AW4A 2LOEA 3DURA 4ZO6A 1J48A 1ZANL 4NFBA 4PYHA 4HG4J 5L0QB 5FYKL 2AP2A 4XGZB 5EC1A 1ERNA 4YFLF 4OCYH 1M6OB 2W9DL 4PI0A 1GMIA 2IGFL 4TULH 4HEMA 2CAKA 1KBPA 1J0YA 3IJEA 5EZLA 4JO1L 4QRPD 2XV2A 3VXOA 1PX8A 1I8LA 3HTLX 1NCWH 5ICXA 2WZ6A 1WS7A 3PCYA 3QR0A 3K81A 1IEAA 1EHKB 2MNJB 3TA3D 4FYTA 4X5WB 3WIHA 2YOCA 1FVEA 2DWDA 4TNWK 1FGNL 1GGIH 3SDCC 3NESA 2J8OA 1FFPA 3FTYA 5DHVH 3SGEH 3QW9A 1PQZB 1T5XA 3FXIC 3G6JF 3IDIB 2JTYA 3JUZA 4MNGB 4QRRD 3T0XA 4ADIA 1G94A 5H37A 5JTWA 3S36X 1EGJL 2DQCH 3S7GA 3H0TB 5D7IE 4XNXH 3OKMA 2J72A 4YC2B 1LK3L 1OSZA 3BO8A 2FO4B 5DJ0A 3LXCA 4CBPA 4ZFGL 1GXEA 1Y1UA 5CEZD 1Z66A 5F96L 4N1EA 1S7WB 3Q44A 1HL8A 5B1JC 1JK8A 1TQTA 4DK6A 3WS3B 2K6WA 1KELH 2O26U 3ET9F 3FT9A 5T5FA 5INCB 4H2AA 4WI8A 2L04A 3QDGB 3IMWA 4YXHL 4LRNH 2MJWA 1NBQA 1LP9A 3BQUD 4OLXH 5C0AD 3PHQB 4O02H 3SO3C 3P4NA 2E8YA 4IEFB 1UYWH 3TEZA 2C9SA 3OWRA 4EQ3A 4DFHA 1L0PA 4TVPL 2Y6SC 2G3XA 4NERA 1YEKL 3ARTA 1CU4L 2MPVA 3B2VL 4PB0H 1OGAD 1R5WA 1T1YB 2NY5C 4PGJA 2GUOA 4CA4A 1PZUB 1OW0C 1BVZA 2R7EB 2CLVB 4MDJA 3ZDWA 1S7VA 4PRHB 2A9CA 2HJKA 4GIAA 5E1IA 1MHPH 4PW3A 1JXKA 4UF7C 3GMOA 5IROA 5GZNC 1TNNA 5DJ6B 2IQ9L 4OZFB 3CSFA 2NYYC 5ADOH 3W5MA 4GNKB 4Z1PA 2APBA 5DVPA 1NDTA 4JN1H 2EDBA 1JZ8A 3QPQC 1AXTL 4DAGL 4FHBD 2ZCKH 1LGVA 4KI5E 4Z9KB 2MIZA 2R29L 3LN5A 3S35L 2X4QA 4U6HA 1Q1PA 2UX6A 3N43B 5I15L 5D1XE 1USQA 3WE6B 1BZ9B 2YUVA 2FECL 3DK2A 4CBZA 2BSEA 2BNQD 2O5YH 1IQWH 1NWPA 2Y1VA 2B7DT 3NA9L 5DRNB 5I23A 2NXZC 3WGVB 4RFOL 5IJVA 3TFKC 2HT4D 5ETUA 4I8DA 3HE6A 3BN9C 4XO3A 3TZVC 4UCFA 4GRMA 3I3BA 1TVHB 4QUOA 2B59B 1S5IL 3WKML 2HVBA 3VW3L 1KJVB 4JANA 1BVKB 3FCSA 3FKUS 3G3LA 3R7RA 4QKTA 4UQ2B 1J9QA 4K7PL 4D9LL 5KBKA 2N7BA 4IRZL 3IJ8A 3NCFB 2BSRB 3VXPB 2GJRA 3T0ED 5C0BD 2CXKA 5KS9A 4N26A 4GP8B 3U36B 5IT2L 4ODWA 3EH5B 5EWIL 4AZ8A 2V9UA 5DA0B 3MCLH 4O00A 4FLQA 2X4SA 3BPOB 2D73A 2JXMA 4X6FA 3WMQA 1B3IA 4AT6A 4QHKJ 1YUKB 4CKVX 3DXAA 5C0GA 3KXFE 1OY3B 1UJ3B 4NYLA 4FZEH 1EJOH 3KLAA 1G4MA 1DSWA 1ZSDA 4ZFOB 3UTSE 3SOTA 3KM2A 1MCQA 4X42A 4X4XA 1XT5A 5IB1A 1ZLVK 4HS8L 4EQ2A 4U33A 4UNVA 4DGVH 1NWOA 4MHHI 3L7EB 1KYAA 2DQUL 2R0ZH 5T1KA 4AQ8A 4PS3A 5CJXA 2WUCL 1NCBH 3QJUB 1WUNT 4IOFC 2FSDA 1ND0B 5DFVC 3ZKNC 2B1AL 2AGJL 3ZL4H 3NRQA 3QJTB 5JHMA 2WLIA 1M57B 4PWJA 4ZMNA 3E2HB 1RZKC 4HGWB 2Y5EA 3BKJL 5AAWC 3RLSA 4Y8AA 1OZUA 1R3KA 2X5PA 5CSZA 5D93C 1RH8A 4GMTL 5HHXH 1N3NB 4HT1L 3KVQA 3PV6A 2WQXA 5FKAA 3L8QA 1JGUL 5D4JA 1IL1B 1YY8A 2AJSH 1NBZB 1M3IA 3MJ9H 3OKEB 1WHPA 3SKJH 2NUTB 4MWFA 1KLFB 3LXBA 4PBWD 5GRWA 4BCXA 4X6EA 5DEGB 3DGGB 3QXDB 4P07A 1Z0NA 2HAZA 2LVEA 2EIDA 2IG2L 3TA3A 1FIGH 5SX5H 4YHOL 2AJ3A 5IREA 1OAKH 1JV2B 1AGEA 3VI4B 3KR3H 1LNUA 1FP5A 4W4NA 5A2IH 3ECBA 1A3RH 3TS8A 3U30B 1G5GA 4X7SH 1O6TA 3SKNB 1FVDB 2ZWLT 2EIMB 3EJTA 3H85A 1ZVHA 4HS3B 4L2LA 3UTQB 1NKRA 1B4JL 5LBSL 1G84A 4XHJD 1DUYB 4JM2F 5EC2A 1W80A 5DC4B 3GI9H 5BRQA 1RJCA 2QADD 2H1PH 3RVWC 2F7IA 4N68A 5D7IA 3SQRA 1PFOA 4W9JC 5IMOB 3GO1L 1XSIA 1Y1DA 2N3JA 4OF7A 5KZCB 5IB2A 2KERA 2H6PA 5ERWA 2YEVB 4WKZA 3MLWH 4LBEA 2A6KB 3A4AA 3LKPA 3IXAA 2BSBA 2GJPA 1J1OL 4ZW5A 4KX9A 5HGAA 1A9EA 4WFGE 5D7SL 4AYGA 3BQUA 3M7OA 3WIFB 4HUKB 4M9PA 3D06A 3VRLE 2ISDA 1S78C 1XD0A 2OBGA 3JWDH 4R83A 4N4YB 3UYOD 3MBWB 4MQXD 1DZBA 4P46C 4Z7WA 4NP4H 2NUPB 5IQ9B 1ZGLA 1RU9H 1NDGB 3M1OA 3BVNB 2FBOJ 1FL3A 5DUBB 2X9WA 1SBBA 1TT6A 4H0IA 3U25A 4FQXC 1SYVA 4NQQA 5CP3H 5FA4A 1YPZE 4N9GB 1TTCA 4PG9B 3FB7B 4AV4A 1X5AA 3IETB 4FTVE 2Z91A 1ZS8A 4AKPA 3OAYK 3VXRB 4DZBA 2FL5A 1OHZA 3DRTB 2APSA 2F74A 1CB4A 1Y7VA 5L2JB 3BLBA 4UBDC 3K72A 1EVUA 5EA0H 5E1GA 1FL5B 4FTVD 4YDZA 5SWZB 1EJ6A 2Y06L 5CCKH 5IB5A 1QR1B 3QG6A 1Y6KR 3QIUC 3I02B 4NT6B 4N22A 2ZWZA 5E94B 1WWBX 2VDLB 3DTUB 4Y5VC 4P5TD 4QOKB 3ARPA 4HIEA 1KCUL 1JV5A 2Z7WA 4K94C 5PAZA 4MAYB 2CO1A 2Z0UA 5DD0H 3P3SA 4MKTA 5EEZA 4KQ3H 2VUYA 3RTQD 2ZQKA 3KM1A 1KGWA 1JZ7A 2H32B 4D0DA 3WXVH 5A2JH 1MNUL 2EDJA 2F1BA 4YBLC 2GSGB 3LSOA 2VH5L 1ZLWK 4AJ0A 3FHEA 5F1NB 4AL8L 1AZRA 2NTFB 4QXWA 1EHXA 4YHNA 1TPXB 3QHZH 4ODVL 4P9HH 2PYFB 2J2ZB 3DSFL 4O2FA 3DMMC 1ED3A 4K15A 3H3KA 2CKBH 2BJML 3VVWA 2XY2A 4N6QA 4NRYA 4ERSH 4MZIA 1JYXA 3QCVH 3KCWA 3KXFA 2HFFA 2BCKA 4XB3A 3MRFB 3MRHB 3ARBB 4UT6L 1CFSA 4MS8D 1L3WA 2BIPA 2XSKA 3KPRE 3L5XL 4JRYE 1N10A 4KAQH 5F7NC 2HX7A 5I0DA 2WHVA 4XPAL 4YBLB 3UTSA 4PP2A 4U1MA 1PD1A 1WHOA 4P9MH 4EI0A 4HEPG 2OMWA 4MAUL 4GS7C 2FT8A 5I1HL 4OZGF 3FW6A 4XNMB 1K3IA 3KPTA 3DECA 3C6LC 1TVDA 1QSEB 2B1HL 1OOWA 2HRPH 3MROA 2IADA 1D7CA 4ZXBB 2HUEA 1XZ0B 4GG6B 5FB8A 1A6AA 1HKLL 3NJJA 1GSKA 4JEGB 3HUJE 3RUGE 5KBLA 3C5ZB 3OQRA 2VMFA 5I8EB 3TVMD 4R8WH 4WI4A 3MLSL 2D4DA 1X5HA 3NIDE 4I0KA 4A6YB 2VAJA 1XF4B 3BZ5A 1WWWX 2I60H 2G9HB 5FYJL 1P4IL 5HHQB 2KC0A 2ZCHH 3O0LA 4PD4J 2EDFA 4H5SB 4EUPG 3Q6GH 4JJ5A 1OTUC 5F9JB 4H8HA 5ECGA 4OKVB 1G7LB 3V0WH 3D0LB 2EIBA 4EDWH 4RAVA 1R0AL 1LO3H 4RMRA 2CLRB 2OW6A 2EUWA 4Y5XC 3BJ91 3MNZA 4GAJL 5T1JA 4TUJA 4W70A 4I9WD 2MOQA 4ZRGA 3FU0A 1I7TA 5EU5B 5B3JF 3OHXC 1TTGA 3TONA 4J1UB 5HDQH 2G5BA 1U9KA 2WXFA 2Q7NA 1JPSL 3L1GA 4Y2NA 1Y0LB 5BXFA 3MLUH 3QP3A 3AREC 5EOCH 3GJFH 4URKA 5TFSL 5HGHB 3QZWG 4JY6B 1AZNA 2WZ5A 1KN4H 2Y7QA 3C60D 3MLYL 4G72B 4GSDH 1H3GA 4ZTPH 2QPSA 1UOVA 1QFHA 2N56A 5CCHE 4XC1L 4L3EB 1IAOB 1TETH 2X70A 3QDJE 2A9AA 5BZWB 4U1SB 5I8OH 3O2WL 4P2AA 1RK0B 4ZOCA 1BBDL 1G7PB 5J3HD 3HG1B 2CJUL 3SPGA 1M1XB 1QPPA 1OW0A 4RGOL 4UOQA 3D52A 2K6ZA 3DK0A 3L1EA 3VD5A 2KLRA 2QDVA 3KPSD 5C0JA 3SZKC 1NC4D 1OAUL 5DJXA 4Y89A 5GZNA 1QZNA 3IFPB 1WZLA 1JMXA 3ARGC 3IXTA 4UTAA 4JG5A 5DHMC 5F6IC 4ZUWA 3B7UX 4XNYL 1QRKA 1DBML 5I74C 2WAHA 3F85A 4BZ1L 3BAWA 3V6FA 2HKAA 1EZUA 2VLJB 4Z7QE 4ZZKA 3KDPB 5CINL 2NX5D 4JHWH 3X11B 4AUUA 4DN3L 2ROXA 3GK8H 4PU2A 4FHKA 4HKXB 3TESA 4B60A 1DDHB 4QIRA 1ZDSA 3BOVA 4AQZA 4FG6C 1S7QB 4V2BA 1YPZA 2QPEB 2NW3B 2MCMA 4DH2A 3CH1B 1J5OH 4YDVB 2HVKA 4N8CL 5DD1H 3TZVA 1IU1A 2CO7A 1KIQB 1QFOA 4FTVA 1MZYA 3AGWA 2YMTA 2ZIDA 3H4HA 3WYRA 2B15A 3OMZA 1NC2B 2A9DA 2CGYA 3PLYA 5J1AB 2W81C 2UVFA 3O9WD 4JFDB 3E8VA 3S8FB 3NPSB 5KSVA 1F58H 4UT9L 5FW7A 2WLZA 5E8EA 4GG6E 4G8IB 2QSVA 1S5HA 4HISA 1YN7A 2GJZA 3TC9A 8FABB 3ZDYE 4NO3A 5AAMA 3AU0A 3IJSB 4IKKA 1XHHA 3CVIH 4N2HA 5FX3A 4CC4C 4YX2H 1A4JB 4ZMLA 3K74B 1OK8A 4Y4HB 5F9WC 5EOTA 3QNYA 5A2BA 5C0IA 4I87A 4D3CL 1T0NA 3LKQB 1OCWH 5DJ8B 3TX4A 2NT0A 5JHLL 1IV8A 2CO6B 3RPIA 4BA8A 4GIPD 1BZDA 1UKSA 3CDZB 1WBYA 2NNFA 5DD3L 3U7YL 2J8HA 1DQLH 3VD7A 5JYLA 1C7TA 1XBDA 4H7VA 4P4RA 5CEYA 2FNBA 5CGYC 1SJEB 5AAWA 2UXTA 2OJZL 2VJ0A 3DX6A 1MFBL 5L6YL 2Z35B 3RIFK 5D1ZB 1P7QD 2VQTA 5K9OB 1NMBL 4MA3A 5A2LH 1QWHA 1WDAA 3FO9B 3N85L 3P0YH 3VWKD 5BS0E 3B3IB 2OLDA 2V0AA 3GF8A 3LQAC 1EXUB 4C4UA 1MY7A 1DQDL 1NAMA 4KJQC 3D33A 4Z6AT 5JQIB 3FZUD 4FQJL 3B7RL 4PB9H 1T66C 3QRBA 3QIWD 3TVMA 3C8HA 3V5KB 3POHA 4YAQA 5AG8A 5T33L 1G7JB 3WKQA 1AHWB 2JJUA 1MHEB 3HUJA 3RL1B 3RUGA 4K23L 3ZL2A 4RZCB 3GIZL 4QJ4B 1R4XA 3T4YA 5GZOC 3IDGB 2GJ6D 4UI2A 2HYMA 1KOAA 2WXNA 2ZTBA 2PYED 1WE5A 4LLMB 4NKOA 1SVZA 1SXBA 2VDOL 2VAAB 2AAAA 1MHHB 3NCYP 4X0KB 2WJ5A 1KIPB 2R83A 1GGBH 1BYOA 2ENPA 2E7MA 2W80C 1QA9A 4P2OC 1GGTA 3FT3A 3WNPA 1TF4A 2FIKB 1U95A 1EEUA 4GO6B 5KSAD 4PHZA 3GSXB 2ZG2A 5DS1A 3MRLB 5LCVA 3VO0A 1H3WM 5FHBH 2CLZB 1EHLL 5AZEH 4TUKL 4NLHA 1KJMA 5TF1H 4BE5A 3QUYB 4BK4A 2GTZA 1KB3A 3FQWA 5CJQL 5FLVA 4HIHB 5TQ2H 3OXSA 3C60A 4WWNA 3GZKA 4PY7A 5BZDB 3QPKA 1PVHA 5IBTL 4LSQL 2V37A 1EUTA 2QELA 1E6OH 5HYSA 3FO0L 4YVNA 5C0RH 4OZHB 1YEFL 1W15A 3H2QA 3FU7B 3K0YA 4P46A 3CFTA 4P2OB 3O6FD 3E7JA 3QDJA 2WINA 3SDDC 1XD1A 2B08A 2JK5A 1EAQA 3PWPB 2CUIA 1KLGB 5L4JA 5DD5H 1LWRA 4FQXA 4KUZH 5DJYB 3REWA 3FTVA 1IM9B 1HDMA 3CFDB 1IVLA 5GGTL 5I6XC 2N1KA 5GRUL 2HG5A 3OSKA 2BW4A 2VXSH 1KG0A 3LXUX 1FPTL 3ESNA 3GB7A 2NX5A 4KVNL 4O02B 3QIUA 4XO4A 5HHMB 2M1KA 2OZ4A 4BFBD 2YLHA 1NINA 1SXZA 4WHYG 4Y5VA 4MJ4A 2IANB 4MA7H 2A5UA 4DTGL 4Z8FH 4GG8A 3CIAA 4LCIH 3AY4A 1GZHA 4PCYA 3GIVB 4JY5L 2CCLA 2OZNA 1A7PH 2WYTA 4WNQA 5HGDB 4BHUA 1GGCL 4OD1L 2H2SC 4LKXB 4UTBL 3UDWC 1R3IH 1T7VA 3JV0A 4POYA 4PBDA 5L8LB 3HAEA 3L3JA 1YEIL 2OMVA 3DWTA 1OP9A 2E86A 3KVPA 4GUCA 1PSKH 4WSJA 1QEWA 4LLQA 3BCDA 1CXHA 3EYOA 3MJ6A 3O9WA 4HALA 2Q7YB 2EVGA 4N85A 5CHNB 4OJCA 2P5WE 3MLXL 4LMQE 4OJYA 3OGCA 5DRWA 3DMMA 1R19A 2Z93A 4Z77B 2WXHA 4I0CC 3HC4L 5C07D 5DQ9A 3RVVD 3D9AL 5DZPA 5KVFH 4MD4A 1M9SA 3GT6A 4X9HA 3AXLB 2GEQA 2R1WA 3EFOB 1J1PH 4H1LG 4UUJA 1FDLL 3DVNA 4KK6C 2XQBL 4Y2OB 4OGZA 2HZHA 2AQ3A 1TZHB 5BRZD 2IGLA 4NB7A 1BQUA 1C1EH 1QLFB 3QO1A 2VLME 2WJ7A 4OCWL 2A6JB 4U3HA 3I2CH 4BWUA 1HT6A 3MV01 3P2DA 3MKKA 4XI5D 4NO5B 4KZEH 1CDHA 4E9LA 4F1SA 4CDHA 5EEUA 3PFUA 3Q1SH 3C6LA 1CD1A 4X4YA 2WQSA 2XTSA 3HMXL 1T1ZB 4ZYKB 1AR1B 3GBDA 1S9WA 2BO0A 3FTGB 4OI7A 3D2UD 4LCCC 5ICYB 3IWUA 1WITA 5GSRB 1OM3L 5ITBH 5IMMA 5FYLL 1VENA 5CIPB 1HN1A 4FQLH 2VR9A 2WWKT 2G0KA 1JTOA 1ZHLA 3PABA 5FYKD 3CUPB 3VWKA 1T0MA 3ZTNL 2D0FA 3J27A 1OKEA 2ERJB 3UGUA 4A2HA 2GEEA 2Q8BL 3G5VB 4OZHE 1MUJA 2V9RA 3OMIB 4QRQA 5T1LB 4HBQA 5CLZA 5BS0A 1A6ZB 5MI0B 2DQIH 2KUTA 1SXNA 3HZVA 4TRPH 3SYPA 3PWPE 3EGSB 4Y5XA 1AZZC 2YXVA 4APQB 4BSVB 4S0TD 1CDBA 1CI5A 4M5ZL 4LLVB 1IC0A 3MV8D 5KYUB 3OHXA 3OMAB 1JK9A 5B39G 1JZ2A 1Q9WB 3DA0A 4OGYL 1N5YH 2AERT 4XCYA 4LQFH 4B27A 1M4KA 3AREA 2DQDH 3II1A 4ZMZA 4C4KT 1Q9KB 4HAFA 4YHIB 5CJOH 4OIIL 4Y7OC 1P6FA 4XMWA 4JZOB 1GIGL 4XVOA 3EO9L 2HP4A 4YH6A 1MRFL 3FT1A 5F89A 1Z9MA 5JZ7C 1WC7A 1MCWW 5IUCA 2L7EA 1T22A 1I1AB 2YGPA 5DRXA 4R3SB 5EBLB 3ZT5A 5KSAA 1WFNA 2QVIA 5IWLC 5KVEL 1C5BL 2VISB 2AV1A 2GABA 1HHGA 1DBKH 3SGKA 4AQAA 1X4ZA 3EFFA 2VXUH 5T3XH 1AI1L 4BH7A 2GITB 5C0NC 1G7HA 1MCEA 4YDKL 1LO4H 2YMXH 1ZV9A 2OKMA 4QPEA 1KY7A 3ARGA 1KFAH 4YHML 3BVXA 3EGXA 2EH7L 3JV6A 4V1DE 1CL7H 1ZTMA 2F54E 2FQFA 1JD9A 4TVPE 1G9NC 4X5LA 2WIIB 5DURD 2YN3A 3DX3A 1OB1A 5KYYB 2H41A 1BCIA 5M95B 4Q6IA 4OAWB 4RNRB 1ZLWH 3MODH 2XZAH 1A7RL 4FFYA 4ISVA 2AJXH 1DJHA 3LN9A 5AL0A 3B6SB 3HB3D 5FCUL 3KPQB 2NY1B 4RVBA 5ISZD 2FGWL 3BZEB 4P2CG 1MCCA 1HHJA 2YGVA 5EO9A 3J8F7 3C5SA 4JQXA 4N2EA 2Q76A 1C5DB 3W9EB 4XXWC 2G2RA 1NBVL 5AYUH 1G9MH 2WSPA 4PIRF 4QTIL 1H8SA 1N18A 4JGUA 1DO5A 3WO4C 3ZE1B 1KTBA 1NDMA 3BYYA 4IGBD 3X3FH 1MVYA 1F11B 4U1HB 1PZSA 1GHFL 1GGUA 4K3JL 2Z4QA 2H47C 5E9DB 2BRRL 5JW5A 3LAFA 3FT4B 3KDMB 1CFTA 5TE4L 4YHYC 4HCRH 3FHAA 5D1QC 4Q4IA 4X99A 1BZ7A 1P53A 4KO6A 1PDKB 4KH2A 5KVGE 4D0CB 1BVOA 1MFEH 3HRZC 4RAUA 4ZX6A 2XZCL 4CW1B 1OK0A 3CZFB 1A25A 3QI9D 1H6UA 3L17A 1WV7T 2R51A 1X7QA 2X12A 4XPGL 4Y16B 1PZ5A 5KANG 1FNEA 1BD2B 1K8DB 4JFED 2W94A 3QZPA 3UBXB 1W8EA 2D7TL 1HZLA 3CSYA 1LD9A 4IDJL 1W9XA 4PJAB 2OI9C 4RGND 5C07A 5CU5A 2VDQH 2P5WA 1MWAA 5CN3A 2VTFA 1ITBB 5D7EA 5F88A 2GFBB 2HKFL 4C56E 3HLKA 3BZ4B 1IAIL 4GMSH 5BRZA 2JIXD 3W57A 3ZE0F 4DK3A 1DR9A 1OPGL 2GUYA 4FQHB 4APXB 4IQHA 1YQVL 4H8UA 4M56A 2W91A 3U0TA 1QWUA 2I27N 1MVUB 4UTCA 1MCIA 1NICA 1V3JA 4POZD 4QY8A 5AVUB 2AQSA 4QHUB 5BJTB 2BM3A 3U6RA 4JFVA 3WIIH 1KBBA 3BKML 2VDLL 1CD0A 4NZTL 4AMKL 3SE8H 3PL6C 3QQ9C 4N9OB 4PGCA 1UD8A 2FJFB 3UPRB 1ZOXA 1RZFL 1KJ2L 2VE6B 3MV9E 3QUZB 1UM6L 2V5MA 5AZ2L 5EBWA 5AB0A 5GZOA 5L4MA 2JTDA 1CE1H 1FNHA 1B0GB 1P9MA 1HH6A 1AXIB 2OXHA 1ZHKB 4LHUG 2P24A 2O5ZL 3OJDB 3H6AA 3LKOB 4OT1L 4PJDB 1CN4A 4GEJA 3SDXB 1A1OB 2CUMA 1A5FH 1IZKA 4XP4L 4DO5A 3ATEA 3GSOB 1CC3A 1D9KB 2WXOA 3AC0A 4E41D 1M71B 1TCMA 4I5BB 3IN2A 5DVOA 4G6JH 4JVUA 4NQXA 2KZWA 1HQRB 2C9UA 4LLUA 3C9NA 4UU9A 4PJBE 5L88H 1FJ1A 2VDNH 5GQBA 4WO4C 1MJUH 1SVBA 2JI2A 3EW3B 4NQDD 1XR8B 4DO6A 1CK0L 3LEVH 1UM5L 1S7XA 3JYCA 4RAHA 1L9TA 1XGYH 2FJSA 3INUH 1S9VA 4D9RE 1ZK5A 4H26B 4MZ2A 4E42A 3EYVA 1K3ZA 3V9FA 4R97B 4WW1B 3BI9X 4L29A 3TU6A 1U8OA 1SEBA 5CBAB 1Q0XH 1F41A 2Z8SA 2ZKYA 3VFUA 4TXVB 4OI8A 2V2WA 4LZKA 5E1AB 1XVSA 4YHLL 4NZRL 3SDDA 3HJ0A 4ANVA 2WVSA 3QJHB 3B2PA 4GPVA 3FUJA 4LVHB 2L0DA 2VR7A 4N2CA 4PJGB 1MCPL 1ML0A 4RA3A 4WAFA 1LE5A 5F3FA 4YPJA 4QXTA 1PW3A 3RURA 4LSPH 1LDPL 5IMLB 4A6YL 1WBXA 3F6IA 4WUUD 4F91B 2CHWA 2J71A 4J3VA 3WMSA 3OR6B 4V1DA 3WN5C 1B0IA 1BLNB 2G60H 3EO0A 3PPEA 3U4EB 1DN0A 5IF0B 2FEEL 4QCIB 5AALA 1NUNB 3VSQA 3BFOA 4NFCA 3KWUA 4ZOBA 4Q9BA 5E6YA 3ARFB 5ESVB 3A67H 5D1QE 2FECI 3CFKB 3SDYL 4A7GF 1B2YA 4P57B 5EU6E 3UDWA 2IXQB 1CURA 3DV6A 1E43A 3CZLA 4N5EC 4R2GC 2R15A 4ZUSA 2ZAHA 3LHAA 3JSSA 3HNTL 3U0WH 4JRLA 3GTTA 2CGRL 4WWOA 1BWMA 4IGBA 4K3GA 2XFGB 1ADWA 3D09A 4Z78A 4APQD 4KY1H 3SDAD 4JVPA 3FQUA 4DCQA 2ZUUA 2Y22A 4JDTL 3CC1A 4JFUA 3ZXAC 3K6SA 2E9IA 4YVUA 2G75A 2DW5A 4GRWH 3DHPA 3SD2A 4OV5A 1UA6H 2G2PA 4YHKL 1QD0A 3BN3B 3FMGL 4IIQB 4R2GB 1N6QH 1JFQL 3TCLB 3PNWA 4G8GB 5CILH 3GHBL 1TZAA 1PZAA 1UB6A 2Z65C 4PJEB 2VM3A 2APXA 2UY7B 5LWYL 2XFXB 1NM4A 4G80A 5IBLD 3OR7B 3IDMA 1JNLL 4IRZA 1U92B 1W2KT 5F8QC 1IGMH 1PNDA 1P7HL 2LU5A 3CZNA 1V10A 2WSKA 2BFVL 3FFCB 3A6OA 1QUNA 1IFGA 1KNOB 4M1CD 3OM3B 4H20H 2WQRA 5DQJA 3ZSTA 5HPOA 1A6PA 5BV7H 2XVLA 1NMAH 3OVUB 4KGLA 4ONGL 2YPKA 3COOA 2N01B 4LCCA 3C8KB 1J8HD 4G6ML 3SD5A 4FQCL 3QUMB 4X6CB 4C56A 1T89C 3WFCL 2GG1A 3EYSH 3L4UA 3LKSA 1MXDA 1PZDA 1CFMA 1CLZL 1U3NA 3PV7A 4RX4A 4DESA 1G1YA 5EV7A 5L2KE 5TK2A 4BWWA 1CLCA 3L3KA 3R8BB 3RPKA 3CFBB 4P5KB 1KBVA 1RFDL 2K3TA 4DGYH 3WUWB 1R5IB 5C08E 2B3IA 5PCYA 1I3GH 2EACA 2NY0D 3LRMA 3DTXB 4HIXL 2ZUXA 3MV9A 3LD8C 2VLRD 2XN9E 3JTBA 4KRPD 4YDLB 1JP5A 1JHKH 5FYJD 2DYRB 1H5BA 4XPTH 3IFNL 2EDKA 2P5EB 3WSQL 3DUUA 4FULA 4AGMA 4ZW3A 1AO7B 4HJGA 3AS1A 2VXVH 3RVTD 1M05B 3DV4A 3VXME 2AQRA 1J7VR 1T6BX 1VFBA 3ZO9A 4FLRA 4DKFL 4JDVB 2YPVL 5LGJB 3D87B 5H37G 3DNKA 3N6YA 3H3BC 2QQKH 4QAWA 5IWLA 3D5OF 1UWFA 2EZ0C 1FFOA 2F08A 1MXGA 4NQDA 1Q90A 3BW9B 1BAFH 4AGNA 1XGRA 4PJBA 5AZUA 1WBZA 1G9HA 1P2CB 3PY9A 3LD8B 2Y7LA 1L3NA 3UJTL 4ACTA 1F8TL 2AI0L 1ASPA 3PAVA 3RX7A 2QQLH 1M7DA 2KQMA 4DVBA 1FORL 1CVSC 2OM5A 5JQ6H 3G08B 2RH0A 1JGIA 1I8IB 1LXMA 1F6AB 2YFNA 3KLHD 5B21A 5HHVH 1NM9A 2X1WL 1EFXA 1I85C 4NPKA 5HD8D 2RTTA 1PZ3A 5LXGL 3FQRB 4KXCA 3GS0A 4PBVC 3A4FA 2OP4H 2DYPB 5HYJD 1DJXA 3SCMD 3RIAF 4LSVL 4WI5A 3TO4C 3DGDA 4TTDD 3ZZLA 2CIIB 4QD2E 3WLBB 4LSTH 2NY2D 4Z76B 1MN4A 3BEVA 4WUUA 3QJOA 4G8GE 2ICWB 1I9JH 4Z7UF 4FMFA 3LN4B 1DSFL 1GOGA 2ZXBA 5IEHA 4XXWA 2GIMA 1ZA6B 2VNCA 3FUFA 1NCOA 1DVFB 1GKOA 4OVVA 1J0IA 3PE9A 5IW1A 4MJ6B 4QWWC 3FFDB 3M1CA 4JUTA 5C09E 4LDCA 2NR6C 4TULL 3NFNA 5A16B 4KTYA 4FFWD 2PCYA 4A2EA 3N91A 3MTRA 4EOWH 3IK2A 4Y4KB 3TBBA 2BS8A 3L9RA 4LCWE 1NCWL 4LFHD 2IDCA 5IQLA 4P06A 3OKKA 3WTYA 2ZZUT 3DJ9A 2COQA 3UAJC 3OAUH 4YDIH 2OMXB 2IQAB 3IF1B 1FYTD 2K4WA 4OI9A 1QPXA 4ZAKC 4F2EA 4XNZC 4UOZA 4AXWA 1GGIL 2EXYD 5FKPB 4WFHD 1TMCB 4UDUA 5KOVC 2B4CC 1ZWIB 1F2XK 3SDAA 3CH8A 1XF5B 4DIXA 4JJOA 4E68A 4EO5A 2Z92A 4A2MA 4LVOB 4E0RA 5CD5C 2ZD0A 4TNEA 3G5XB 2X2UA 4HUXB 2ATPB 2PPDA 3NIGB 2AJYH 4XNXL 1AHKA 1DEDA 4HLZH 1J5DA 3C2SA 3S34H 5KSBF 1X3DA 2Y24A 4M29A 2VLLA 5ACLA 3T3PB 3RZWA 1ZJAA 5DWUH 5IFAH 2BIMA 5FO7B 4IRJC 1AY1L 4AQEB 4Y4FC 1KELL 2WXPA 3Q13A 4OZ4A 4XB7A 5I9QB 3NJNA 1WJ3A 4PD4K 3X3GH 5BQ7B 2EDQA 1URZA 2DMBA 3T2NH 1SOXA 1AQMA 1JZGA 2VZTA 3QFJD 1HYSC 2C8NA 3CPUA 2WMPB 3VH8B 1V54B 4MMXA 3MRRA 4PRAB 5CWSA 4HZLB 4LRNL 4TQIA 4OLXL 3CFEB 2CBTA 4O02L 5BNXD 1UYWL 5AVYB 4TYUA 1UCBH 5IBUG 1K72A 3ZPDA 3KBEA 5GRVK 3VJ6B 4OUOA 3GRWL 5DD6A 3PL6A 5FHAH 5HHNA 4PB0L 1RVFH 3ASWA 5IW6B 1YYCA 4ETQB 4AEEA 4KC3B 5MEOA 4MX7B 4KTDH 1YN6B 4FNTA 1YNTB 4L3CA 4JN2A 1U8IA 4WEUD 1MHPL 4UT6A 1E9PA 1SUHA 3APDA 2JSFA 1ETJA 3O8XC 1NLBH 4MCNA 4XNAA 3RIAK 2WLLB 3QORC 1UZ8A 2ICES 5EUOE 1TJHH 4FOMA 4IK7A 2Y5QA 5ADOL 4OFIA 1KXTB 3BDXA 5IM7B 4JN1L 1U41A 5D7LE 2OK0H 5L2KA 5ELIA 3QWNA 4HKJA 4LGPB 3RDTB 1NMCB 2FTAA 1SXCA 2ZCKL 1KPUB 2NSXA 2MNWA 4MHHG 3LS4H 1ORSA 4ZFFB 4I48A 4MJIB 3FN0H 4LIQH 1U58A 4RBPK 1J1XL 5DMGD 4HPYH 1KGCD 1I31A 3HMWH 3KYKH 4L0ZA 1YMMD 4MASA 5ESAA 1F0LA 4YBQD 2O5YL 4WO4A 4DQAA 3E1F1 1IQWL 3B37A 5B22A 2COVD 2OAAA 4PGBA 1WGVA 1S4IA 2IH3A 2XN9A 3P4LA 5K5YA 2ZYIA 2H26B 5I2IA 1OEZW 2CUAA 1WCBA 2VUOA 1E6JL 4NUPA 3C6EA 1XH3A 5B4MC 1DCEA 3BWZA 4W81A 1Y18A 1ZT4B 3SSGA 1X9QA 3VXMA 3CBKB 1VB9A 4MD0A 1MLCB 1Q94A 1XR9A 4URTB 1DVSA 5DK0A 1HWGB 2MCPH 1Z32X 1WVZA 4B97A 5KVDE 4HOXA 1WFOA 3MCLL 3V8CA 4OFQA 3D3VD 3OJ2C 5K9KA 3UG3A 4XE0A 4XN8A 2OMTA 4FZEL 5EBGA 4YSUA 1EJOL 1HSBB 4NRZB 3ZGIA 4JRXE 2GI7A 2BMKB 3IBOA 3L08A 4PGDA 1MJJA 1TXKA 2AQPA 2DH2A 5DEFB 3W9DB 3WN5A 5KOMC 2CU9A 2FVNA 1G7MA 5ABDE 2I9TB 4JFQB 4DGVL 2VDPH 4H4NA 1UZGA 3CQQA 5ACZB 2R0ZL 4XVUD 5HYJA 3C09C 3RVXD 3O4LB 3N55A 1NCBL 3LIZH 4R0LB 3K0WA 5J13C 4PJHB 2EDMA 1UXSA 4FXGC 2A9NH 4I3SH 3ROLA 2AABH 3ZL4L 2OMZB 1D6EB 2HLAB 3CN3A 3GUFA 2ENQA 4LL9A 4UWQB 5GS1B 1Y6NR 4QHNB 4M5YH 3QJFA 2QJDA 4ZQKA 4NWUH 3NAAH 3KWVA 2VITB 3GBNH 2V4LA 2LTQC 1A6TA 2APTA 3FB5B 5HHXL 2BS71 3VWJB 1VGKB 4HIJA 4F58H 1XXFC 3WBDA 4O58H 1BVLB 2AJSL 2DLFH 5BZXA 4R6UA 2XQ0A 2XPGB 3MJ9L 2EO7A 4X7TB 4EDXA 4N0UE 3TJEH 1RLWA 1U8KB 3K91A 3EXJA 3KYNB 5IR1B 1I1CA 1FIGL 1IQDA 2AJVH 4L23A 1TKWA 4HC1H 4FF9A 1KFGA 4LCWA 1IBGH 1FYTA 1OAKL 4XX1E 6PAZA 2YO3A 4XH2B 1TU2A 1ZPLA 3DX4A 1AYRA 3KR3L 5MEQB 5HYFA 3US0A 2PR9A 1MLBB 1SHMA 1A3RL 2LTQB 3EHBC 3KBFA 1W0YT 3INOA 4HPHA 4X7SL 5I6NA 4ODXA 3VQLA 1HEZB 5B1AB 1ZAGA 1YMHA 4TLUA 3QFDA 5D7KE 2DWEA 2Y5TB 4H13C 4QRUA 1NBCA 3PGCA 3ZQXA 3T4AB 1ZD6A 3GI9L 4M5SA 3SBWC 4UT9A 2H1PL 4UNIA 3LRHA 4Z18A 3MBEB 3V0IA 3BD4A 1WSST 5DHYA 4TVUA 2EDNA 2XWJA 5HDBF 2XQYA 4PRHD 4F7TA 3SE4C 4PJIE 4YR6A 3V7AE 4GW1A 4N0FA 3MLWL 1O7SA 4N8VB 4JRFA 5LVEA 4MNQB 4A2FA 2FR4B 1KBGH 4LQ1A 4EI6B 4ONHA 4ZBJA 3T0VA 4PVNA 2Y2YA 4HSQA 3RVUC 3NJHA 1G6VK 3CZKA 4ZPVB 5JHLA 3JWDL 2I32A 1HJBC 4CILA 2HTLC 4P23D 1J05A 4LARH 3O3EB 4NP4L 4F8NA 1RU9L 2J4WH 3QQXA 5JW4N 2P48B 1LEGB 1D5BB 4K5PA 4XZUA 5GRZA 3WFDH 1IC5H 2KKQA 2C1PB 2WW8A 5FYLE 2WWMD 2AV7A 5CKGA 1JGDA 1AKJB 4UIMA 1ZCRA 3NSFA 4CKQA 1G0XA 2WTOA 3PQYB 3GHPA 4MMZC 1HOCA 1SXSA 2ITEA 5D72H 4JPQA 3TBVA 5I76B 1CGXA 5EUOA 2RACA 5EA0L 1O9WA 3H9SB 1CGSH 3CQPA 2ADJA 4KTEH 3AS2A 3BP4B 2X89A 5CCKL 1HCVA 1ESOA 3MCKB 1R75A 5D7LA 3UTTE 4HUVB 2H8PB 5JIKA 2JKSA 3KL3A 4P2RB 1GSMA 5E4EC 1KIRB 4MQ7A 4R4BA 3F3HA 5AW9B 3FQXB 1TQCC 4N8PA 2OMNA 4WQOA 3LRLA 1WIPA 3P2BA 4C8XA 3H42H 3UYPA 5DD0L 3LEXB 4LEOB 3I9PA 1RULH 3ZVVA 1UWYA 2B5IB 5E6IC 4LOUD 3DKHA 1FN4A 1U8NA 2EE2A 1X5ZA 2A4EA 1SJHB 2EADA 2O6EA 3E6FA 3RZCB 3WXVL 4JFFE 4IYKA 5GISH 1WEJH 3QNZB 3GSWB 5TE6H 4BKSC 2P26A 2Y7NA 2BNRB 1CICC 6PCYA 1PKOA 2X7LB 4KJYB 4PJXF 2YK1H 3QHZL 4L5FH 4GT0A 3QAZC 3D3VA 3ZKXC 1GJWA 3GC3A 1D5XA 2QBWA 1BBJA 1ASQA 3TO4A 3N1FC 2CK0H 3TV8A 4DOHB 4ERSL 2KL6A 1F4XH 3QEHA 4MLSA 4LP5A 4FKKA 3N3EA 2WN3A 3ZHNA 1EAPA 4AEHH 4D8PA 2IOIA 3QNXA 5IK3B 4FL4C 4EN3C 3MYJA 4KAQL 1R17A 2IF7A 3DO7A 5JDSA 1AGBA 1TQSA 4P9ML 1PY0A 2VLKB 2ID5A 2A73B 2NR6A 1V5JA 1GS6X 3HBPA 1SNRA 4E9VA 2QVMA 4K7PY 1A1NA 1BV8A 4PJCE 1WWAX 1CTOA 2HRPL 5CD3B 4LO9A 2OCFD 1BDYA 4JFHE 5E8OB 1AG0A 1CYGA 1E9OA 3UAJA 4JCLA 4R8WL 3AT8A 1IJ9A 4QNPE 1R24A 4AIZA 4LKCA 3C8DA 1F97A 4RMWA 2MH4A 4MNGA 4P4KC 1B0RA 2I60L 2X0UA 5F1SA 4GSQA 2XPYA 4G83A 5FWQA 3H0TA 2ZCHL 4L18A 2RFXB 3H4FA 3Q6GL 3Q5YA 2FO4A 4HJ0C 4NC0B 3V0WL 5B3SB 3DJTA 2CBOA 1N12A 1LO3L 4N0UA 4U1LA 1WFJA 4KZDH 4OJFH 3JV5A 4YBHA 3QDHA 3M17B 1YEEH 2D2OA 3ISWA 4FNSA 5KZCD 2NZ9D 1BHGA 1RUAH 4IRJA 5EZOH 3EOBB 5INCA 1EEQA 5D4IA 3ARDD 5C2BH 3NOIA 3W5NA 1C8QA 2A6DB 5DRZB 1G6RA 3MLUL 1DHKA 3SJVE 3HE7C 2WYIA 4WVRA 3WOVA 1C12B 3UEQA 4IEFA 2EEFA 1KBKA 1E30A 1KN4L 3ELQA 3R4RA 1K85A 1F2QA 2UXGA 5TJWK 4GSDL 1TEFA 4ZTPL 1FZOB 1EBAA 2E3VA 2FEDD 4HYTB 5JLZB 1T1YA 3IFOB 4GXVH 1TETL 4YZFE 4WIQA 3RX9A 2AK4B 5HGBA 5I8OL 5CKAA 2LT9A 2CLVA 4Y19E 4D7PA 3BYTA 4GRWB 2JKXA 4KK8D 3U6XA 2EDOA 4CVZB 1TFPA 2DWXA 1XX9C 3U4KA 2VZ3A 4M8UA 4X6DB 4PJIA 1Q0YH 3WJJC 3O8XA 3P2TA 3QORA 5FFGA 2JB5H 5EMYA 4XAKD 1B6DA 2GCYB 3MRDB 5SWZD 1KJ3H 2ZSWB 1WP6A 2R27A 4P23A 5J06A 4B9CA 2ZOOA 3LX9A 2EVJA 4W93A 3TN0B 2R23B 2XDHA 3CPLA 4JHWL 5JPNC 1BZ9A 3GK8L 4QOKD 3HMXA 3VRJA 5TH2A 3P0VH 4TUOB 1P6AB 1DQQB 4DPBX 1L7TL 1RK7A 1C9SA 4MAYD 2CBQA 5DRNA 4WEBL 1GZQB 3TBYB 2ZUYA 3S96A 4KKCC 2XN0A 3UACA 3UAFA 3QDME 3WV0A 4NRXB 4ZX3A 2XXMB 5I0ZA 3KMDA 1J5OL 1EAJA 2O6FA 5DD1L 4ZQTA 1BVKA 3KH4A 1JWMB 2QTVA 1XIWD 5EEXA 2XLLA 3TJPA 1J87A 2QL1A 4NI3A 1R5VB 1RK1A 4IKJA 4WRLA 2BVOB 4QHLB 4G5AA 1PZBA 1ZEAH 1HILB 1NEZB 4E9QA 3N0AA 4ELME 3LIUA 3QT2A 4PJ9C 5AVTB 1A7OH 5EORH 3MJGX 2ZNXA 1L9NA 1F58L 3FOMB 1DQJA 1OCZB 3TEXA 1ZLDA 1W0VA 3N40F 3DC0A 3MRKB 4O2CB 1LO2L 5LNEA 3BVDB 5HBBA 5EO0B 3ARBD 3QIBC 3KCPB 2LE9A 2ZUTA 3MA9H 3CVIL 3MXVH 3RU8H 2K0RA 3A24A 3AAZB 3FULA 1HJCA 1V3KA 3NMEA 4G43B 3L7EA 3MAWA 4JFFA 5E4OA 2NQ3A 2ZXWB 1P5UB 2D7NA 4L1LA 4EI5C 5E7FA 1KV3A 5IVXE 1OCWL 3AB0B 1ZIBA 1XGUB 4YEFA 4IJ3B 4QRFA 2Q1EA 5HYSG 3IGLA 2XXCB 1MDTA 4U1JB 4ZXBD 2KT6A 4R4ND 4HGWA 2FO8A 2GBUA 2WP3T 3C5ZD 1DQLL 3OZ9H 5HJ3B 5JO5B 4I3RH 1AH1A 1DBJH 1TR7A 5CN1A 1E40A 2ZUVA 3QIBB 2A4CA 3RWDB 3VX0A 1IL1A 2OMUB 2J1XA 4F33B 3OC5A 4WHYH 1CDYA 4OD2B 1UB5B 4PUBH 2EXWC 4G70B 4LCUA 3NIFF 3ZDXF 2VZ1A 1XSOA 1RZGA 1G0YR 2PW2A 2I7OA 4HIQA 1SVCP 4OQTH 2R2HB 3K4ZA 5C0EA 1CF1A 4G1MA 4ADJA 2GT9B 4PJCA 4PB9L 4MD5B 3TNMA 4K5OA 4TOYH 4HU2A 1K8IB 1QI3A 5GGQH 4JR9H 5HVFB 3U2SB 1AD0A 4JQIH 4OM1H 3T3MB 4L4TB 1FVCA 2YZ8A 3SKNA 1FVDA 2E27H 4F92B 2XZZA 3WJLC 3EF4A 1A4KB 4OR1A 2ZKMX 3E8UL 2J8UF 2B14A 3HZMB 1OLLA 3HAEG 2F9BT 3UFIA 3ZDZB 1GGBL 5EOQH 2OJEA 4L3ED 2Q0ZX 4CU8A 3D85B 2K4AA 4ZMXA 4G9FB 4J6IA 5IMOA 1ID5I 3MBXH 1ES0B 3MPCA 3OX8B 3B7YA 5K59E 5ILTH