1RPUA

Crystal structure of cirv p19 bound to sirna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
138
Chain Sequence
DTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDENPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords 5'-R(P*CP*GP*UP*AP*CP*GP*CP*GP*UP*CP*AP*CP*GP*CP*GP*UP*AP*CP
publication title Size selective recognition of siRNA by an RNA silencing suppressor
pubmed doi rcsb
source organism Carnation italian ringspot virus
total genus 41
structure length 138
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03220 Tombus_P19 Tombusvirus P19 core protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1rpuA00
1RPUA 4JK0D 4J39A 4KQ0A 4J5VA 4KNQA 1R9FA 4JGNA 4JNXA 4KTGA
chains in the Genus database with same CATH superfamily
4DZ8B 1BD2A 1X5YA 5MERA 4L8SC 1YNLL 4EOWH 1QNIA 3GO1H 2BJMH 2VL5B 1A3LH 5A16B 4UYPA 2CLVB 5F7DA 1T1ZA 4CVWA 2DI8A 1LDPL 5DGQA 4G8FB 2IBGA 2H47C 1ZLDA 1YG9A 1HKFA 2X0UA 2YBGA 5LHDA 1JV2B 3QEHA 4DK6A 4L0YA 5J13B 5FYKE 2WVTA 1XR9A 25C8H 3T6ZA 3T2LA 2NNXA 3TBTA 1FI8C 2ZCKH 3VFWA 4N0FB 1JWMB 1G6RA 2BSEA 3JUYA 1QTPA 2CLRA 3LQMA 4GW1B 2BLFA 4P5MB 1EDYA 1QYGH 2VWEE 2WLHA 3PQYA 1DQIA 4NLHA 3VFRB 2P48B 2X4UA 2YPVA 3GSNB 3QUHA 4CGTA 3BN9C 3P3UA 5I71C 4U1MA 3O4LD 4OD1H 4RMTA 2GY5A 3L7EA 3G3LA 3KBFA 4NOBA 3V5KB 2J8OA 5LGJA 3UTTA 2Z4QA 2EABA 3V4VH 4G8GE 1N8ZA 4XMWA 1JXKA 2E27H 3C5ZA 3GXFA 5IR1B 5B3NA 4ZDHB 2UUDK 3IM1A 3DDGA 3EJPA 1QQDA 3KPSD 1IQDB 1S9YA 1GZQB 3P3SA 1CICD 3FT3A 3BPNC 1Q9LA 4NO3B 2DM3A 5C0GA 1AXSA 32C2A 3FUEA 4WIQA 3BJLA 4RGMB 3T2NH 4NRZA 3V0WH 5ALCH 1J0HA 3MA9H 4ENEC 4L3AA 3AM8A 3G6JE 4LASL 4U1GC 3MREB 1P0SE 3O3AB 5DUML 3WFCL 3TVMC 1UHVA 3WTTA 1LL1A 2V0AA 3DVIA 1VGKB 2ITFA 5AVTB 3RVUC 4NENA 3ZU8A 4KROB 4M3KB 1Y18A 5A7EA 3VD5A 3I3DA 1A4CA 4NNXA 4CDGC 1BGXL 2HVKB 2E9BA 5ISZD 4DUWA 1MW1A 5K59E 2X5PA 1D2OA 2X4TA 1T2JA 3HC4L 1KGCD 1T6BX 2OL3L 3I50H 4NJAH 1AGFA 3NJJA 4NQVA 4HS8H 1H3GA 3M8OH 4P2CG 4F7CB 3L45A 2ZAIA 5ALBH 1QRNE 3QQDB 4H20L 3V10A 3DURB 2V2XB 4XXDA 2NSQA 3ZPDA 1N59B 3G04A 5KYXA 2Y72A 5B1JC 1FZMB 3D3VA 3N2JA 3TH4T 1OAQL 3IMTA 3RVVC 3FN9A 4AQ8C 2BHYA 4ZODA 2Y6SD 3NCBB 1UZ6E 1HJBC 4PJBB 4BGDA 3LD8C 3L3JB 1NDMB 1KDJA 2XWRA 3HZYB 4QHUB 5E23A 1D6EA 4FCAA 2A4ZA 4PGEB 4XN1A 1XF5A 4AGOA 1UFUA 4Z7NF 1EJFA 2LFEA 5F93C 1GKEA 1OGPA 3RDTD 2BW4A 1T0OA 4UM8B 4J3VA 2KQMA 3F65A 5BPPA 4HOZA 3CSTA 1BZ9B 1DANT 4ZQKA 1ZGLA 5E5MB 3MV7D 3HE6B 4G6JL 1B9ZA 3V5HA 5EOQL 3V0HA 1N5AB 1JDAA 2GG1A 1NIBA 1PS3A 4P5SA 3GWJA 4J3UA 5I6MA 3MXWH 1KGIA 1QNZH 4N2MA 2PXYA 2EYRB 5ITBH 2J6WA 4X8JA 2NQ3A 2BFVL 4PJAE 4DVBB 1IKNC 4P2QA 5C9JB 1NMCC 4KRPD 2CDGB 4AIZA 1EAOA 1I1AA 4HCIA 4I87A 4B9YA 2JKNA 3U4BH 4C58B 3CE1A 1Z7JA 1YNLH 2CQVA 2FQEA 2XA3A 4PIRF 4HWEL 4K94L 5E2TL 2JVUA 1BXXA 3OB0K 4JFYA 2GBTA 4U3SB 4G43A 1UA3A 4ADIA 2QSTA 3WTVA 2EZ0C 3T2OA 4X0KA 4WTZG 4PR5A 4R8WL 2YAFA 1H8OA 1L6PA 4K4KA 4E5XA 4O51B 3RILA 5GHWL 3LKQB 2PYEB 4DETA 2W59A 4AQ1A 1ZTXE 1GGIH 1F02I 1QG3A 2BMKB 3APFA 5F70A 3D87B 2R4SH 2GJJA 3MBEB 4H0IA 4H1LG 4BQ6A 4FABL 5D7IA 1YUHA 2ALAA 3EJRA 4PV1C 2TSBA 3IN0A 3S5LB 3KS0H 3TNNB 2AKRB 3DVNB 4OZFA 1UOWA 3EO9H 4IRZH 4R7NA 4NWTL 3BIKA 1BD2B 2CK2A 2X28A 4X99A 1I8MA 4NAJA 5MERB 3ARUA 2CKBA 3K8MA 4U6XB 5DHDA 2DQCH 2NDFA 1UXMA 1MFUA 1U8PB 2BXZA 1IAKA 5DJ0B 3AACA 5AKVA 3W81A 3CN1A 4MD5A 1SJVA 1J9RA 1NPNA 2P5EE 4IKIA 5D5ME 5DC2A 5KSAA 5I15L 5G4OA 1OALA 4XMPL 4MA1B 2XBDA 4XC3L 5I74C 2A9NL 4F9PC 3TPUA 3H7BA 2V3FA 1FZOA 1VRSA 3QEHB 1MRFL 1TTFA 3BDYH 2R69A 4HJJH 5E51A 1IAIL 3T3MF 3UAJC 2SEBA 1RFDH 1NKOA 2BP0B 2YAPA 3D0LB 3Q9PA 5D96B 3TBTB 3VGEA 3N42F 1P53A 1KB5H 3VFWB 4FTVE 4I4WA 4V1DA 3WEBA 2VM3A 1AIZA 4GRLC 4LAJH 5CWSA 1IEAB 1G6RB 2HA1A 1NMAL 1Y07A 3U36A 1XX9C 1EXGA 3OWEA 4JLRA 1KENH 1E3FA 4FI8A 2X4UB 2R0KH 3PV6B 1DCLA 2P47B 1CFQA 1I1YA 2I60H 5FYKH 1UOKA 4U1MB 5GRWA 4RX4D 3DTXA 1SBBA 4U7SA 5CMAB 4MFHA 4MXQC 4EE2A 3UTTB 5LGJB 3JWOC 2Z4QB 3U7WL 3GJFK 1N8ZB 3MRFB 1N7MH 3C5ZB 4KROD 3HFFA 3MBXL 3GM0A 4J3OG 3WNIA 3L4YA 2Y2WA 1YEKL 2WUCH 4PS4L 4ZTEA 1ML0A 1QQDB 3HC4H 1K5WA 3BVNA 3FT3B 4G1EB 1Q9LB 1MW2A 1H3PL 1JK9B 4Z7QB 1ZANL 3DRTA 4H20H 1NKGA 1IGYB 4NRZB 3DDFA 1JXFA 3OPZL 2UXTA 1RSYA 1AACA 1IM3A 3LAFA 5CGYC 4Z95L 1OAQH 3MYZA 1XCTB 4LL1A 2V5MA 4MYWB 2NY6C 5AYUH 4NENB 3ZE0B 5LCVH 3NG5A 4NNXB 5L0QC 2E7CA 3AB0C 4KZEH 3PRZA 1UASA 4JRLA 4LGRB 3HRZA 3KYAA 4YHZL 1AGFB 1GTFA 5LN4A 3PHOA 1VFMA 5ID0A 2WLYA 1AQHA 2FRGP 2QGEA 3QEQD 5EOQH 4QYOA 4QLWA 3HE6D 3LKRA 2VRQA 4XXDB 3EOAA 2A0LC 3ZTJG 3ZUCA 1I4FA 4WWKD 2GBUA 5KYXB 4LOFA 5F7MC 2FUTA 4ZMVA 3D3VB 4PG2A 1FVCB 3ARFA 2BFVH 3EG9A 2CUIA 5A6LA 1WPCA 3FOMB 5DGRA 4KKCC 2FGWL 3KWWA 1YY8B 2ZSWA 1WZ1L 5JDSA 4HEPG 1D6EB 3TX4A 1U3HC 1XF5B 4HWEH 3D08A 1CGSL 4RWHA 3V8CA 2I9TA 4RFNB 2AVFA 3KLHD 1NEZG 4OFKA 4ZX6A 4Y19E 3VWKB 5DFVC 1FORH 4A67A 1F41A 2Z3FA 2P9RA 5GHWH 4PLOB 3GSUA 3V5HB 4Q8BA 3WBDA 4MNQB 1DJWA 4M6NL 5EF2A 3SKJL 5D7HA 4C56D 3E8VA 4UZUA 4QTIL 4AMKH 3GFUA 5IQMA 1A14L 2EO7A 4FABH 1G0DA 4MS8C 1D5XA 2D4DA 4U1LA 1ETJA 2R0WH 4LPVA 3KH3A 4X8JB 4YDIL 1ZVSB 2XPYA 1CBJA 1JF6A 3CQQA 4P2QB 3S8GB 5F7FA 3I9GL 5BO0D 5IMKB 1JBJA 4AIZB 4QMEA 3V0IA 3IDIB 1I1AB 2Y0SA 2NXZB 3PREA 2VMFA 2LAAA 3D85B 3DXAE 3NIGE 3N1FC 1CDCA 2IAAC 3OKKA 4B3EA 5I1EH 1A8JH 4JFYB 5LQBH 4L23A 1F6AA 1UB5B 2JJSA 4E5XB 1FZJB 4AW4A 4XMPH 4XC3H 2EINB 2J8UF 5E7BA 2QHRH 2O72A 5DJCA 1XXDC 5HGAA 2R51A 4P23C 2R27A 4GUCA 2FBOJ 2X0WA 4P04A 2XC8A 5IY5B 2CBQA 4OZFB 1F45A 5CP3A 3IJ7A 4UQ3B 2WIMA 3NIFE 4I0PB 1UCTA 5C0NC 4FA7B 4R7NB 2E75C 3TA3C 2VDRH 4N0YL 3MOBL 1E9QA 2WBXA 3GMOA 3QEGL 2CKBB 4YDLC 5E1HB 5FGRA 2WTPA 4R4NC 4C83B 4FNRA 4OM1L 1OP3K 4NGHL 2F18A 3ZJAA 4U1SA 5KWYC 1CXHA 3T0WA 5E9AA 2FAUA 4MD5B 5I5MA 1DQLL 7PCYA 3VDAA 1IC4H 1T1YA 1JNHA 3U7WH 3AY4A 3TPUB 1QSFA 4UOW1 3V9FA 3H7BB 4H40A 5HVHC 5I0WA 3UTTD 3NSJA 2Q8AH 1UOLA 2OZ4L 2SEBB 3DX6A 4FMVA 4OVVA 3KZ8A 5JHDA 1ZAGA 4WHYG 3LZOA 4GAGL 4PBWD 4V1DB 4I4WB 1FGNL 1BWWA 1MELA 1NBVL 1ZANH 3PU7A 4WGWB 5E8DH 3U36B 2AANA 4JLRB 5FCUH 3A6BL 5FDWB 1T21A 3LMJL 1OAYL 1P7HL 1I1YB 5T8IA 1M3JA 2D7OA 3ETTA 1UXSA 1A7RH 1CQYA 3BYYA 2GFBB 3VVVA 4BD4A 4XAKD 1C1EH 3IAQA 5I8KH 1QSEA 5FHAL 4XMKL 5IKCA 3P2BA 4UOW0 1PPIA 3TOPA 5GSVB 4Z76B 3F7LA 4KZDH 3S8FB 1T66C 2P8LA 2NY5C 4GQPH 3BVNB 3DMMA 4DK3A 4ZX4A 2X4QA 1QR1A 6PCYA 4MA8L 1YDPA 4B9FA 3D4YA 4OGQC 4M43H 5E00A 1RLWA 3DRTB 2WZAA 4PVMA 2HKFL 3WIIL 1JGLH 2AF2A 1JZDC 4AVIA 4H25A 4ATTA 1VADA 1B0RB 4G3YH 2MEJB 4L9DA 3UTZA 1Q1JL 1A3ZA 1OSPL 4KV5E 2XICA 3U7YL 4TN9A 1BEYL 1XEUA 4XWOD 3MRPB 1MY5A 2O6PA 2IWEA 2YAQA 1WZ1H 3IBEA 5MHSD 3QHFL 3N0PB 4X7SH 1A22B 3ML8A 1BVKA 3EKCA 5HGDA 1MFCH 2EICA 4UILH 4WI9A 3UTSB 1P9MA 3HRZB 1CICC 3RJQB 5T3ZD 1BOGB 4CAGA 4PTTA 4JCMA 2AEPH 3V6OC 3VWKD 1DVQA 3X3GH 4ZUSA 4G11A 1IKFL 4R4FL 3SKJH 1A7PL 3CUPB 3D48R 3WO3B 2COQA 4MNQD 1X5KA 4MKMA 2OZNA 1U4FA 3ARFB 4YDIH 4UINL 3D4ZA 4PJDB 5DC9B 3KWWB 1HL5A 2EIEA 5J11B 4NT6A 4C4BA 4H8PA 3QCTL 1QLFA 3GSWA 2DWTA 5D2LB 3VXUE 5KJ7E 2EEDA 2NXZD 4Z3TA 1BFOA 3D85D 1N9PA 4XTRD 3AJ7A 3IJ8A 3VQ1C 3F85A 4XCNA 4QI3A 2C9PA 1CL7I 5EEYA 2OW6A 3X14A 4YSUA 1M1XA 4LSVH 3GSUB 3TBYA 3P2TA 4PQXA 1HEHC 5JTWA 1WFUA 1MFAL 3ABZA 4C47A 3VTTA 4XXWA 1QI4A 5LBGA 5C07B 3SDAA 3UEZA 4TV3A 1I75A 3ASOB 4WZ9A 4IBWA 4J8QA 2ZCHL 3IT8D 4M8UA 5GSRB 5I26A 5CFHA 1G4MA 2Y6SC 4M7KH 1IC1A 3HNTH 4N0YH 2QFRA 5GZOA 1FO0B 2WM0A 3QRLA 1HNFA 4I0PD 3TO2A 5IREA 1SMAA 1UA6L 4MZIA 3OKKB 4PPTA 2AK1L 3RDTC 5D2NC 4PJIA 1F6AB 1RIHL 4NP9A 5FS5A 3QDMA 4N90E 1DQLH 3B9AA 3AGVA 5IFJA 1LE9A 4LL9A 1FH5L 4X4ME 4QYAA 3SBWA 2QL1A 1AQKL 4UBDD 2J71A 1ECZA 3NEOA 3UJTH 4JVWA 1RHHA 2LE9A 3ARGA 4ZTOH 2V5SA 3Q1EA 1R5IA 4NI6A 2EUXA 2LW3A 1SDAB 2VTFA 3R0MA 3S35L 1E9QB 3IDGA 1NLDH 4V1DD 1DUYA 1BLIA 4PS7A 3WG7B 3I3EA 4KI5F 4NHUB 3HMXH 3LMJH 4ZFZB 1EO8L 3OJ2C 1J5CA 2HPTA 3TF7C 4YUEL 1NCAL 4Y9EA 2ZX7A 3BVUA 4I48A 1ASOA 2Q2EB 2QSQA 4AC4A 1ORQA 2X4PA 1JNHB 5FHAH 3QFJE 3HAEG 1CDJA 1QSFB 2CGRL 4L1SA 3FB5A 4Y4HA 1JYWA 3VA6A 3BVXA 2E4TA 2QADB 3EXLA 4MQTB 2ICWI 1KWGA 1WE5A 3DX6B 2H32B 4O02A 3F5WA 3KEDA 5F0PB 5J13C 5JHDB 3MRDA 4MA8H 4HJEA 1NQBA 3FCSA 1T80A 5ADOH 1RV6X 4JFPA 4M02A 4MJJA 3L4VA 2O61A 4JFXA 4PRHB 4X4XB 4NRXA 3ISYA 3B1UA 4GIPD 1RZJH 1DN0B 5KW9H 5J1AA 2VDML 5ACMA 3OR6A 1OSPH 3CN3A 3WY4A 4D3CL 1EJ8A 3GSQA 2CBMA 3IF1B 5AVVB 2Z31D 1MG2C 4DKFL 4GG8A 4M3HA 3RGVB 4PEEA 5D7IF 4WFGD 3RQ3A 1EGJL 4H2AA 2I07A 1T6VN 4QRPA 4ALAC 5DJ2A 4KOBA 4XP4L 3LS5H 3TJEL 3QUML 4QXVA 3KPOA 4RGNE 3N85L 4WWNA 4QAMB 3S0PA 1YDPB 3UTSD 3FSVA 1TJHH 1IEBA 3UGXA 3I6LD 4Y2NA 1MWAA 1HHJB 3KPLA 1I9JH 3QPQD 2CRYA 3CDCA 3R18A 4RGMC 4B7IA 2JTYA 2A6JA 1VADB 2AC0A 2XN0A 3UBXI 5ID1A 3UTZB 3HFML 3FFCD 5FIEA 5JMOC 4BZ2A 3BKML 3H6JA 2HX9A 3M07A 5H37A 4DPCX 3GMPA 3KYNB 1AG6A 4JFDE 4A6YL 2APFA 3MRNB 3QCTH 4QUOA 1EZUA 2AXFA 2KBGA 4KROC 3UL4A 2ZWKA 4YWGL 1OM3H 5JLZB 5HGDB 2ZF8A 3S5ZA 5HGBA 3WE6A 1FNSH 2HH0H 5GIRB 3FT4A 3SYPA 4H26B 2YBRB 3C9NA 2X4SA 4YN3A 3IN2A 4IYKA 4PTTB 1E4KA 3IMSA 3MJGX 4KY1L 3BQUA 1OGAE 1S7QB 4ZUSB 4YSTA 4UQEA 2B1OA 2GUOA 3PGDA 5DI8A 5EZIH 5L88L 4QO1B 5D6DC 4NIYE 1FLTX 1DO6A 2AVGA 1SMDA 3IMWA 1DSFL 3HR6A 3T1FA 3F7VB 5C07D 3DARA 4KH9A 4RETB 2EXWD 3D69B 3ZKXB 4LBAA 1E5AA 3H42L 4NT6B 5F6HJ 3D30A 1MCLA 1S7WA 1TFPA 3HI5H 4LOVA 1QLFB 4TSAH 3UBXG 2WQSA 4M03A 2E9WA 1UA6H 2AW2A 4OJFL 4MNGA 3GMMA 2HKAA 3MHZA 5DD5L 1BFOB 1HCVA 2EXTA 4XO5A 4MAYA 1FYTE 5IFHL 1PLBA 2AJ3B 4X5WA 1DLHA 3TC9A 4XCNB 4NPJA 1BZQK 5E4EB 5HJBA 5LNGA 5E8OB 3QO1A 4CN1A 4WI4A 2XWCA 3UABA 2B08A 2XQYA 1YC7A 3I6GB 3TBYB 1FH5H 2ZWSA 1F90H 2VRAA 4YHNA 3HE6C 2AJZB 4HWNA 4WI6A 3ZDWA 4PG9B 5HHOB 4WWKC 2YQBA 5DJ6A 5I30H 3SDAB 4JJ5A 1X4XA 1RIVL 4V2CB 1V3MA 3P4MA 5JW4Q 4JUTA 1JZHA 4P2RA 3FU0A 4ZXBD 4BHUI 1AHWA 2YFNA 4AGLA 4EUPH 1BZDA 4FQQA 2N01B 1HH6A 1WA0X 1JERA 1IBBA 2EH7L 3FUHA 5JMRA 3S35H 1MIEH 4TRPH 5FYJD 4QOKD 4ZUTB 2F8IA 3T65A 1VEMA 3KLHC 3PAYA 2XA8H 1XCQA 2O5ZL 4M6ML 3BP6B 1SBSL 1NCAH 5KSVA 5CIPH 1BF5A 1KJ2H 3QDMB 5MEOB 3HG5A 1DUZB 5LBSL 2C7FA 3FMGL 4EI0A 4YS4A 5IFJB 1LE9B 4KQ3L 1AOHA 1PKQA 4QTFA 1XGUA 1TJXA 2VR4A 2Y5QA 2YS4A 3MBEC 3KBPA 4G70B 1ZK5A 1CZ8L 3ARGB 2WLZA 3TIEB 4WK4B 2XTJB 1TTCA 1IGJB 2EEBA 3U1PA 1MFMA 5D1ZD 3H9SE 2JJTA 3MA7B 1DBJL 2W38A 1U6AH 3SDCB 4PJ7A 1NUGA 4PRHD 4ZMXA 2E3VA 2ZOWA 5I2IB 4LBEB 4JRXB 5F7UA 3BH8A 2JI1A 2PO6B 4D3CH 1QO3A 2ZP9A 2VQTA 3MRKA 1MQKH 1TCRA 4I48B 2KLRA 3RZCD 2ATKB 4L29A 1OXYA 1YA5A 2C5DC 1ORQB 1RUML 5EZJB 3OHXA 1F1GA 4Y4HB 3SQBB 1JVOA 3RGVD 3HN8A 4LL4A 4MA1C 2QGCA 3LNHA 1Z9OA 3UZVA 4DCQA 4A37A 4UIMA 3IVKB 3F5WB 1FGVL 2WYTA 4Z3IA 2IDQA 5EN2A 5D96C 1JDDA 4DN3H 2O61B 5JIHA 1QLEB 4NRXB 1KC5L 3RGBA 5A1AA 1J9CT 2O6CA 5EIIG 2JKWA 2EIBA 4KXAA 3M17B 5J1AB 4NPYB 3OR6B 4QRSA 3LRLA 4PRIE 3BKMH 3N5AA 1WHPA 4PP2A 4F9LC 5EO1B 1B3IA 3GSQB 2FBJL 3KPPA 1XGTA 1D5ZA 3CPUA 4MQ7A 1YN6A 2VABA 3RJOA 3DTUB 4O5LH 2E7HA 5IVNA 4GG8B 1CFBA 4W6YB 3RA7L 2AGJH 2QQLH 4GG6A 2IOMA 2I07B 3LXBA 2OYLA 1JHKL 3SO5A 2NY3B 3C5ZC 5DJ2B 4M1CD 4DP6X 3KPOB 2GJZA 4J3WA 1VFAA 3FO0L 4J39A 1Q4NX 1NM9A 3VSQA 4JRYE 3VAEA 3OJMB 4F8TA 3BD5A 5L88H 2A6JB 3QUGA 1YAZA 2F5AH 5E2VL 5ID1B 3AM8C 3GXMA 1DSFH 3PJLA 2E9GA 3DTDA 2BVUA 4LMQE 3CD4A 3GMPB 3EJUA 5M94B 1W16A 4PVNA 1WA2X 4Y1SA 4OLVH 3J7HA 4Y4FA 3CFMA 1NCWH 3CZGA 3V7MA 3QYNA 4HEME 5BVPH 3WE6B 3T71A 3U82B 3GIZH 4U6YA 3BYTA 1F0LA 1Z5LB 5I75B 1E28A 2A83A 2HJKA 2X4SB 2YUXA 2DEXX 3ATBA 3HMWL 4KTEH 3SDXA 2DQEH 2DS4A 3WLBA 3D39D 2NT0A 3BQUB 1YQVL 2HUEA 3L5WB 3VG0H 1P7KB 4AEIH 4KHXL 5DI8B 1CWVA 4N6QA 4HS3B 3T4AA 5KAQF 4KWUA 3FUNA 5HHOD 2IIJA 3CAFA 3T1FB 2W9DL 5FKAA 2B5IB 3VFOA 1H3XA 4XWOC 3IDYB 3Q8AA 1KGJA 4BFJA 3MRMA 3S9DB 4R26L 4X7TA 2RQEA 3HS0A 1HZLA 4MNGB 1EFXD 5BRZE 3FH7A 2IH3A 4KXBA 4XCEA 3NJFA 4M6MH 2BVPA 1SBSH 4AENA 4FQLH 4RFNC 4PJFE 1QFWH 4F80A 2FIRT 2D0FA 2BSRB 3KR3L 3LVEA 3QO1B 4F20A 3EH3B 3VWKC 4OD3H 4AM0Q 5I6NA 3QDMD 3LQAH 5JO5A 5E9NA 2PPCA 4MD0B 2C26A 1BQHA 3PG2A 4JJ5B 4XNXL 1YRKA 3VI4A 5LUMA 5G2NA 3K91A 1OCCB 4P2RB 5ESAA 1RJZB 2YMOA 3VM7A 1AHWB 2BRRL 3KWUA 2X6VA 1RCYA 5LGYA 4FQQB 3BKYL 4KDWA 5FM4A 1GTNA 1DBJH 1PX8A 2XTJD 3FN0L 1QKZL 3FH8A 1I1AC 2NXZC 5C0CA 4JB9L 2WBKA 4WGVB 1I85A 2JIXA 2K4WA 2Q76A 4XTRC 4Y2DA 3RL2A 5C09E 3SDCD 2EDBA 1DYZA 1JZ2A 4JRXD 1KJ3H 1RJYB 2OJZH 1S4IA 2PO6D 5F0JB 4R5TA 1YYLH 4AIEA 5M7QA 2PWEA 3LB6D 3O3DA 4JO5A 4N0UE 4ZD3L 2CJUL 3ROLB 3UG3A 4FFWD 4UAOB 4W9ZA 5A2LH 3WFBH 3SOBH 4LLDB 5KOMC 4QRRA 1ES0A 1XSIA 1WUNT 2MH4A 2OL3B 1CE1L 2ZKHL 1RP9A 1A7BA 1HHIA 3LIZH 3LJ3A 2CDEA 5DF0A 2W9EL 2NUPA 4I0PC 1N5YL 3KGTA 2NMSA 4HIXH 4PJ7B 5CP7B 3GMRA 5L4IA 3TH3T 1GPOH 2WBJA 3W37A 3BH8B 4TYUA 1QO3B 1L9PA 4TUJA 3NJKA 4PY8I 4PUBL 1GKOA 4UNVA 3ZN6A 3RA7H 1INQB 4XPAL 2HT2D 5K9JL 1M7DB 1R33A 4OT1H 4QRTA 5TGBB 1CFSA 1RZKC 3H3KA 4AK1A 3QDJE 3CH1A 5HHXH 7TAAA 4TLKA 4DCQB 4UBDC 5BUAA 4UIMB 4XPGH 2NY3D 1M2OA 3FO0H 3GPEA 3CJJA 1CQKA 3G5XA 2A6DA 1KPRB 3N9GH 4TVPL 1IGTA 4RAVA 2DZEA 1N67A 1IJ9A 2G3ZA 1N10A 4PJIF 1LO5A 4ZOCA 1DANU 3K4DA 4WUUE 5E2VH 3SDDA 3V4PB 4QRSB 1K6QH 2GHWB 1F58L 1A6ZB 2YAMA 4JY5L 2ZCLL 3KPPB 1XGTB 1D5ZB 2I24N 3L7FA 4MQ7B 5H35A 4AOFA 4NBZB 1TYRA 1JV5A 5C86A 3IDXH 3KGSA 1KIRA 5BV7B 2EECA 3H0TA 3ULVF 2DIEA 1ADQA 3NTCL 5FO9A 1DVZA 1ZLSL 1N3NB 1TDQA 2FJHB 1TU2A 2B1AH 5C1MB 2ZUXA 3NA4A 2H3NB 5DFTA 3K8KA 3JXAA 4KHXH 4HX1A 1GSMA 3B3IA 4XNMA 1F1AA 6FABL 4OLEA 4XVSH 2CHZA 2NNRA 4W6WB 3NYKA 2CRMA 3JT0A 1UJ3A 1IAIM 1R3IL 2Z31C 2C9VA 3TT1L 4R26H 2V2WA 2CLZB 3QQXA 2ADJA 2KDGA 2J8UE 1HESA 1NBCA 4G5AA 4JJOA 2QQNL 1L0PA 1L5GA 1WIPA 2CDFA 4ODTH 3EHBD 2NTFB 4U6YB 1E28B 2HJKB 2OMWB 2DW5A 3FU7A 5ENWB 4ZNEE 2NQCA 4TTGA 1L6ZA 3SDXB 2YRBA 3HRZC 1W9XA 4ZT1A 5JHLL 2BSSB 3CMOL 2ZJSL 3QPQC 3T4AB 1FG9C 2CMRL 2G5BA 1J1XL 2CXGA 4KHTL 5DD0H 3NCMA 5B1KA 1KIPA 1TQWA 5CBEA 5C0JA 1YEDB 3WIFA 3WENA 3O4OB 5FKAB 2DQDH 3BMWA 2BRRH 5CJXC 3ARFC 1CDBA 3BKYH 3MLZH 5A40E 2EYTA 3OB0H 5DC0A 3BQVA 5I1CL 2Q6WB 3TT3L 1P2CA 5J11C 3EYUL 5CGMA 2OSLA 3MFGB 2H2SD 4XCEB 4Z5RB 4JB9H 3BWAB 3WIHA 2BVPB 1YO4A 3CZLA 4AENB 2NX5E 1V05A 2VMCA 3QJVB 1KV3A 2DWDB 3S3SA 3VXOA 1FRGH 2XXFA 5GRYA 2XKNB 5JO5B 1U58B 5GS2D 1HILA 1VENA 3QUKA 4OAWA 4NQDE 1BQHB 1T6WA 3NSCA 2ERJB 4P9HC 4HPOL 2EUZA 4Y9FA 3NJGA 1CE1H 5ESAB 4HETA 3W3BA 1CURA 1NIDA 1I3VA 2EXWC 3VXSE 4Y4KA 4WDIA 2WZPA 1SXZA 1AP2B 2FL5A 3UTOA 4FQ2L 3MOAH 3MLUH 1BXUA 4JL2A 4DFHA 1CGVA 3CQFA 2PR4L 4NCDA 4Y2DB 5F1SA 1P4LA 1QZ1A 3EYSL 4JKMA 4ODUA 4FG2A 4PUBH 1XQ4A 4EXPX 2GUYA 3RWCA 1OB1B 5GPRA 4WO0A 2CIIA 3LZLA 2QVFB 1ZLEA 1TSRA 3HBZA 3WY3A 4HXBL 4JKNA 4WV1A 1MVFA 1AD9A 5I5RA 2BS71 1Z0NA 2P28B 2FNWA 3CHXA 3DWTA 3L2NA 5E2UL 4O9HL 4ZXBC 2MKLC 2ZG3A 3C6LA 1ZJAA 5AKTA 2CDEB 2O1AA 1FV1B 1XIWD 4J27A 1JTTA 4K2UL 2DMKA 1X5IA 3GMRB 1FIGH 2WBJB 4YGAB 4A04A 3DSFL 4JHWH 2C9QA 1VF5C 3OTTA 1MFVA 4LSSL 3W0WB 3CFDB 4QPEA 5EEUA 2PN5A 1WFMA 4H8WL 3EOTH 3L3KA 5SV4A 3KNBA 4I2XA 3PQYE 1W6LA 4KK5C 3IPFA 5I66A 1CK0H 4X83A 3KS0J 1UKSA 5F9OL 5J0BA 4Q9CA 4P4RA 3S4SA 2Y7LA 3CH1B 3FF7A 4WU5B 4ZMLA 4ODVH 2QADC 4PV8B 4ZZFA 1KJMB 4YE4L 2ZG2A 4R90L 5F7EH 3ZQ9A 3SQOH 4TL5A 2H1PL 4S1QL 5F89B 2BNQA 3OKOA 1LO5B 2AITA 2PTTA 6FABH 2RACA 2YEQA 1W6WA 4G6KH 4EZKA 1MG3C 2X1WL 2F54E 5F1NB 2CO2A 4WCYL 5FGBA 1BDYA 2D3JA 1FPTH 1IBDA 5IQ7L 1DDHA 2CSPA 3DA0A 4Y1AA 5ANMA 3RZCC 3STLB 2B4CC 3L7FB 5IM7A 3TT1H 1VZIA 2ZQKA 3D51A 1ID5I 3G6DH 1JV5B 3AQYA 2R0LL 3FRUB 1QFUH 2CU9A 3O0RL 5J12C 4IHBA 3RGVC 2OPCA 3QG7H 1T4KA 4UTBH 3ASWA 4XPTH 3VYOA 3IVKA 3BAEL 2LU4A 1FA4A 4OJCA 5I0VA 5FO9B 3RTQD 3MRLA 3WTXA 4NZTH 5CEXB 1ID2A 4L0PB 35C8H 4PJ7F 3IFPA 3ATDA 3BJ91 1OO2A 2C9RA 2ZJSH 3QDAA 4N8VG 2MWCA 4NNPL 5FFGA 3T9WA 4S1SL 4HX1B 1FYHB 1L9RA 5KYUA 1YEFH 1J1XH 4NQXA 1CDGA 1U8MB 4HUUB 4KHTH 4Q9RH 4M4PA 5K1VA 4P59H 5CN3A 2G60L 5E6IB 1F4WL 2OXHA 5D7LA 3T2PA 1MVUB 2XWBA 1PLGL 2ADJB 4PJCB 4K8RL 1KXHA 3L4UA 2WPGA 1L5GB 1ONQA 3IJYA 4TNGA 2ZPKL 3MGAA 3EFOA 2XN9B 1OTTD 4YHIB 2XX0A 2XBTA 4IKLA 3IFLL 3UZEC 5LWYH 1ZLWK 1S2EA 1SLWA 3FF8A 2UX7A 2FJUB 2V9UA 3NEXA 4GSXA 5EWIL 1KIPB 1BIHA 1EZSA 3BAIA 4G9FD 3WIFB 5AD0A 3SBPA 3AXIA 4GG6F 1MHEB 4AQAA 3BUTA 2EYTB 3CQPA 4Q2ZB 4D9LL 1O5DT 4W1TA 3ZKXC 4I77L 2FR4B 2OSLB 5DRNB 4GXVH 2PR4H 2YC1A 5D1QE 3CPLB 4PJ5A 1A3RH 3TJPA 3DYOA 2MJWA 1NC2A 5IHUL 1KYOJ 5E4EC 5J57B 1HILB 3VWJB 3WJJA 1GC1H 1PG7X 4DP0X 3UCRA 2EVHA 2OTWA 1VFBB 4IHOA 3VXNB 3JWNC 5T1KD 5I1JL 3WNKA 3SDAC 5I1LA 3QRGL 2KPNA 3ALPA 1LD9A 4KKBC 1QBLL 1OB0A 4PREA 2EIJB 2FL5B 2ZP8A 1K2DB 5E9DD 4L9LB 3NZSA 5D7IE 5AVWB 1CTOA 1CGYA 3A4DA 3SDXF 4DQOH 1RH8A 2CO7A 3DSFH 1NWOA 1C7SA 4LCIL 3LYRA 4M29A 3V0JA 3ZKND 2Q8BL 4AEHL 2N7AA 1MI5E 4QKXB 5E1GA 5EUOA 3RWCB 4AE0A 1U3ZA 3C8DA 2D7NA 2CUHA 3W0WD 1J05A 2ESVE 3QNFA 4P9ML 4HOWA 1JL8A 2UWEB 4O00A 5F9OH 2F1AA 2BNRB 3FQRB 5C0BA 1AD9B 3LEXB 4XZUA 3SBWC 3MACL 4GSDH 1JK8A 2B16A 2AXGA 2OQJB 2Y06L 3W1ZA 3FONA 3TIDA 5DURB 4F58L 4JY4B 4GKNA 3ARGC 2WP3O 2X38A 3FTYA 2H1PH 4S1QH 3KGRA 1CF8H 2XTJC 3QUZD 3MVSA 1GZPA 3OGCB 4XP6H 1HI6A 1J1PH 5KZCB 2YPLE 3SDCC 3MFFB 3MRQB 1FVEB 2YR3A 4PFEA 2PO6C 1DHKA 4EBQH 3L3KB 2O30A 3AROA 3LB6C 3ZDXE 2FEEI 1KUMA 2R0LH 3KL0A 3VI4F 4FFWC 2H0FA 2BPBA 3DX7B 3O0RH 2NTSP 4OY9A 3CLEL 2X2HA 3QZBA 4P4RB 1MLCB 4P3CH 4Y4HC 2Y1AA 3DBSA 5JW4R 1N19A 4WEBL 1A9EB 1DQMH 1G7QA 2PNDA 5SWSB 5B3SB 4OI8A 3WOVA 4GRWB 5IUSA 5KTEL 3B2VL 4H1LH 2IANA 4P07A 4A7UA 3NJIA 1RK7A 3OKOB 2PTTB 2ZOLA 3OKEB 1KBVA 2IH1B 2MPAH 2NW2A 3P4NA 5HI4D 4HOXA 3DJRA 3RWDB 1G7LA 2J6EL 4IKNA 5DD6A 5HDWA 4JS7A 1Z9PA 2VXSH 2W0KA 1DDHB 4XHJD 4Y1AB 5ANMB 4P0DA 5IM7B 4GRMB 3RY4A 4POUB 4N2BA 4WW1B 1EPFA 5E6ID 5KN5A 2Y7MA 2HT2C 4PJ8D 4K8RH 3WKPA 1T4KB 3IU3B 2WQ8A 4W9KC 3RE0A 2VDPL 2XZCL 3LVTA 1X6NA 2NY3C 3MRLB 4JO3H 4E41A 1UM6H 3ZDZF 5C7XH 1AI1H 2XN9D 3LDBB 1RPQA 3V0VA 1B4LA 4NAQA 4XXCA 3C5JA 4LLWA 5KYUB 2QVKA 1CF1A 4DPRA 5JORA 2QTVA 2VRKA 3BZEB 1WZKA 1H6EA 4HXAL 2ZSVA 4JN2A 4NKIL 5ELIA 3TEXA 5D7LB 4Y88A 5IK3A 1WD8A 1WS8A 2XWJA 2XWBB 4I9XA 1QBML 4P49A 5J7CC 4H0GA 4LCCB 2XXMB 3L4CA 1ONQB 3IJYB 5MEQB 2Y07H 1MCJA 2WNWA 2EE2A 2OS7A 5E7FA 1B0GB 5GGQL 2VITA 1EXUA 3C6SA 5D7KE 5KVGE 5D71L 5IGXL 3NZHL 5I75C 4TVUA 2AEOA 2VLLB 4J3OH 2Y5EA 4AYGA 3DI2B 2D0GA 5BQ7A 3BQUC 1CLOL 4OI9A 1JG9A 4X6EB 4ZRGA 2FSEA 5GRVL 1A4AA 2WP3T 1BJMA 1DSYA 2GK2A 3GF8A 3VWJD 5AD0B 2FQGA 4JFFA 3WV0A 3QFGA 5DMGD 3WNJA 3WUWB 4CMMA 1GR7A 4NCC1 3WDJA 2B5IC 4IGBA 5ICXA 1JZ4A 5IWLA 3IDYC 2WLLA 2YRLA 3BZFA 3DPBA 3LXUX 1OAKH 4JO8A 2XETA 4L0ZA 4KKZA 3EHBC 1H0DA 1T2QL 1IIKA 2HXAA 4PB0H 3N44F 2YC1B 2D2OA 4PJ5B 4WO4D 2FJSA 4W93A 3MUGB 3O41A 4YFEA 4JL1A 3OWRA 5DVNA 5KVEE 1NC2B 1NUFA 2AQPA 1NFDA 2I26N 1MOEA 1S6NA 4XP9L 1WT5A 4YX2L 3EJSA 4ZYKA 1M71B 3GHPA 4U2YA 4X5LA 4YSDA 1GOHA 2OTWB 3OSKA 5DYOA 3RAJH 5D72H 3CDGA 3ILQD 4IHOB 4POZD 5DVKA 3D0VA 2BNRD 2P1YA 5IUCA 2YD3A 1BAWA 5TQ2H 3UTQB 2W60A 1LD9B 3ZTJH 2K8MA 3QARA 5EOCL 4PREB 4YL9A 1AHWC 5F7YC 1CYGA 2GVYA 3E9TA 4X6DA 4YR6B 4AQZA 3IDNA 3P3RA 2H2SC 3LNIA 4ZUWB 3CFBA 3OKLB 3MCKA 4Z7OF 4FI6A 4MAUL 1KB3A 2YA2A 3K0YA 4P2OA 4JM4H 5KZCD 4ZBJA 3NQIA 4JANA 1MJ8L 4NDMA 5EUOB 2EIKB 1QPPA 1ZV9A 3LKNB 3LQZB 3MSPA 4HJIA 1L9SA 4PS8A 4E9TA 4AG4L 4OCRH 2XTSA 3BW9A 4NUGL 3IMBA 4PJHE 1QEWA 4XZUB 1FJ1B 1R19A 4DP9X 4WEBH 2KUTA 4LEOA 2XN1A 4NC1E 1N0XL 3BPLC 3NCFB 1D5BB 3FONB 2FT7A 1HWGB 1E50A 4N2HA 3S48A 1GCYA 3N06B 2BIHA 4GKNB 2BZCA 4OQTA 2IG2H 4KH2A 1TQUA 5B38A 2YD6A 5SWSD 3MJ8B 2PYFB 5HYFA 1GZPB 4KKAD 4RCAA 1HI6B 3CXDH 1S5IH 4DUXA 2MCMA 1AR1D 2DJ4A 2F58H 2VT0A 1J8HB 5CEZL 4BK5A 3I84A 2KZBA 4XAWH 3O6ML 3BVDB 3FUFA 2CBPA 1Z6JT 5KOVC 3T1WA 2MKWA 4FQIL 5FK9A 3UMNA 3FN3A 1GAFH 3L3DB 3PDGA 4Q6YA 3C2AL 2VDPH 4I88A 4XVTH 3UJIL 4DTGL 5K1NA 1OE2A 1JF1B 2IPTH 3CCHB 3CZEA 2K78A 5CEYA 2DMHA 3LZNA 3NA9L 4WWOA 5GRJL 1I3GH 3RUGA 1E6JL 4QHKI 1QSEE 5HDLA 2VSDA 4JFHD 4JVPA 3TYGL 1QFPA 2IANB 4H8UA 2WVVA 1SYVB 3FB8A 4NEHB 4K3DL 1E9OB 1G9ML 4P3DB 1F6FB 4XOAA 2YD2A 4WJ5A 5KSBB 5AW5B 5DD6B 1UYWL 1A21A 3QIUB 4NKIH 4LCUA 1Q9KA 1H5BA 4BBWA 5CSZA 1U92A 4WFHD 4WHCA 2ENJA 5I19H 3SKNA 3TM6A 3ULUF 1QBMH 2GIYA 5JXED 1QLRA 4G42A 4YBHA 4FYSA 5E99L 3RPKA 4P5TA 4G83A 3VRJB 5BV7C 4K94C 2ITCA 3D4CA 1YLBB 1WG3A 3RFZC 3KD4A 1DP0A 4HUMB 1UH4A 3LSOB 4FP8L 2DYPD 3GSXA 3NCJL 2A3TA 1G6VK 3FQTA 1CL7L 1LVEA 3UYRL 4L4TA 2ED6A 4LESA 4F8PA 1K8DB 1OLZA 3JYCA 4WHYH 2ZSVB 3HE7A 3M45A 4CC1A 4EIZC 4JZJB 5FX3A 2IDUA 3QXWA 5HYJA 4L1LA 4RQQA 2P80A 4KITB 2D73A 1JPST 2XWJB 2DLGA 3JV6A 3V9CA 4GUQA 4C57C 2FWOA 1VEPA 4LNVA 4E9YA 5A2FA 4UQAA 4G6ML 1VACA 2A77L 2VITB 1XGPA 1TMCB 3C6SB 1HDMB 1UACH 1UZGA 3FO2B 4Z23A 3GXUB 4NFCA 4PJ5D 5EF0A 2XYCA 3P4LA 2WXRA 5BQ7B 2LT9A 3O6FB 1BJ1H 1B4RA 3CVHL 2P5PA 3GZQA 3B7TA 4OZIA 2AS5M 1Q72H 4GINA 3MXVL 1QEXA 4JFFB 5AZ2H 1XR8A 4K0OA 4UQ2A 3RGHA 4CMMB 3CZSA 5FUZL 4JFQB 5SWZE 2XXCB 5KVGH 3UTPE 3T0BA 4GS7C 2CIKB 2WLLB 4ZMYA 4ELDA 3BZFB 1KCSL 3DPBB 1LMIA 1QTYT 1I82A 1I9IL 1W0YT 5FKPA 4FFYL 2YD8A 3OKNA 3OAWA 3RTLA 5JOEA 5B3JE 5B1CA 3O41B 3IXTA 4OUOA 3GEFA 1PVHA 5C08E 2JI3A 3T3PE 1YN7A 1OF0A 2I9LA 3O3EB 1YMME 4PJIE 4WY7H 2EE9A 3D0VB 4R9HA 1VFOA 4JQIL 4KTDL 3IEAA 1YEWA 2ERJC 3E80A 4M7LL 3SB3A 2VLJB 1LP9A 3VD7A 1TNNA 1A6AA 1L7IL 3ZHLA 4NZRH 3QNXA 1UH2A 1S7XB 4X6DB 3V4UL 4DO6A 1JMZA 1FFOA 2FHBA 4QHNA 4S1DD 5IESH 3MCKB 4P2OB 2W81C 3TCXA 2XIBA 4N9GA 1KBGL 3DIFB 3MLWL 4F7PA 1RZIB 4ZFOA 5HPMB 4D8OA 1J8HD 4NDMB 3UJJH 1X7SA 3NJLA 3VU2A 3TEYA 3BXNA 1PG7L 2R2BA 3PUUA 1M6UA 1RIUH 5AENA 5KYYA 5D1ZI 2A5UA 4QRQB 5JZ7D 1QEWB 1N64H 1T1XA 3NA9H 4LEOB 1X5XA 3T6VA 2ADFL 3QQ9D 4DFIA 1EDQA 3N1QC 1SEQH 4JFZH 4PJXA 3V7AE 2H6PA 3SGKC 4PGDB 1YAIA 3VFMB 4NUQA 4FX5A 5B38B 1IGFH 1GOFA 3EJYD 4DO4A 1DQDL 3SO3C 4K7PL 3RG1C 2GTZB 1XDTT 3EF4A 1VSCA 3K80A 4CRPA 3AWGA 4XBPA 3V52L 3LZRA 2KZKA 3ZKNC 1KCRH 3ZW3A 1J8RA 3QIUD 4CADA 4OSUL 3L95B 4O2FB 1D9KD 5AWNH 1INDH 2VISA 3HW7A 3F01A 3UO8B 2DOCA 4N0RA 1T7YA 5LO7A 2DQUL 4LSRL 5F0MB 3HC3L 2AEQL 1FSKB 3NESA 1G5AA 4R3SB 4W70A 5IBLD 5HD8D 4OV5A 5AB1A 3DV4A 4FP8H 1M53A 3QJUB 3V4VA 2WXKA 4JHVA 4JKPH 2AABH 4M1DL 4BQ9A 1CL7H 3TU6A 4KKPA 3QUZC 2PW2A 3PV7A 1MDTA 1DFBL 4LU5H 4AQEA 1P7QB 2DWXA 4FG4A 1ZS2A 4FLQA 1R3JA 5EUOF 1G9NC 4MJ2A 4DOHE 2BX5A 3DV6A 1MRDL 2N0KA 3AAZA 4LCUB 1Q9KB 2JCCB 2O5XH 2VZ3A 5DLLA 4RMBA 1ZEAL 3KXFE 4QHPA 1JGIA 3SKNB 3GLAA 4BCYA 4OI7A 2J20A 2VDNH 4K15A 4D0DA 1QLRB 4G42B 4ABVA 3QUXB 4JDTH 5BS0B 2HFGL 4HD9A 3PUCA 2ITCB 3MMEA 5DJXA 2IF7A 3SE8L 3B9KA 1M6OB 1LO0L 3HAEH 4YSCA 1FVDA 1A6UL 1O7VA 2F19H 2XV0A 3GSXB 3RBGA 4KMTL 3VRLF 2WK2A 1RULL 1VGEL 3MQIA 4N3TA 3MV8B 4F7KA 5HI4C 2AMGA 4LT7A 2B8OT 5HP5A 2ED8A 5CBAA 1QP1A 1CN4A 5JQIB 3CBRA 3O6FD 3OAZK 4IOSA 4XNBA 1RUKL 3VD2A 1AGBA 1X44A 4XHJC 2OMZA 4UT6L 2R8SL 5HYJB 4I3SH 3MCLH 1IE4A 1QMUA 1RJLB 1UWEL 5E6IC 3JV6B 5F9WB 1LO2H 2UXGA 2VXVL 3KM2A 4UM9A 3M1BA 3ESMA 1HX0A 3OF6D 2OCFD 4FFYH 3T8XA 1VACB 4XWGH 4PJGE 1XGPB 3GSVA 5CLXA 5CU9A 1S7SA 4ZNCD 3LZPA 3ZSSA 3IETA 3Q9QA 4A7TA 1F56A 2YD0A 3T6WA 2WUBL 3OSVA 4CSZA 1XAKA 1TZGH 1EO7A 2ICCA 2X53A 3RWEA 1NSNH 3CFEB 4Y5VA 3ASNB 3MV9E 2HT4D 4FCHA 4FMFA 2EE6A 2HKHH 5CUSH 4YHML 3E2HB 4YQXL 3QWQB 4M7LH 1U2YA 4WVRA 1S7TA 1DBMH 3CC5A 2VLJD 4UANA 5T1DL 5IMLA 4H5SB 4CW1A 5IHBA 4OGYL 5HBBA 4GO6B 2P49B 3C75A 3MGOA 3OKNB 3MLWH 1OGSA 1OKEA 1DE4B 5F96L 3COOA 5DJZA 1MNUL 3EAKA 1DLFH 3GXNA 3H9YA 4NKMA 4GT7A 1SQ2N 1KNOA 1USQA 2EDMA 4TUOB 4WNQB 4RFOH 3PWNB 2WN3A 5GISL 4PJEB 2IH9A 1XGRA 1H3VA 2KC0A 1DBKH 1E6OL 3VWJC 2VN6A 1IFRA 3X1NA 3IB4A 2DQ6A 3GSOA 2ADFH 5DMGC 2LLNA 3LX9A 3QDGA 2IWFA 3PIQA 3L3OA 4WFFE 5CINL 2E76C 3SEPA 3PWPA 4I85A 3X3FL 1MFDL 4U3CA 5KBPA 3NRQA 3QXDA 4K7PH 2DQIL 5AKSA 5DRWA 1ZLVH 2FLMA 3FU9A 1ASPA 4HC1A 1AHMA 3DLQR 2AK4A 4FTDA 4L9LC 2C3XA 3RIKA 3V52H 4N9GB 2P45B 2VE6A 4ONHA 1MEXL 4IRZA 5FCSH 4YHOH 3GRWH 4OSUH 4LHUA 5KS9A 1JF5A 1G7MB 2AJVL 4AYFB 4E9XA 4OFYD 1CFVH 3BXNB 4L3EE 3WKQA 2AQSA 1SF5A 2VZUA 3Q44A 5KYYB 4JPIB 4LSRH 1SMOA 1RZFH 2AEQH 3ARWA 3HC3H 2K3TA 2J55A 4FQXA 3ILQC 3BLKA 4POZC 5DXWA 1T1XB 3SE3A 3NDZE 4J2XA 1CR9H 4XBEL 3AXHA 1HHGB 4PJXB 5DZJA 3FQNA 5INDB 4JFOA 5L4JA 2F7PA 3MRIA 4X7DC 1DVTA 3DX8A 5CZKA 2BS9A 1UT1A 2B9AA 2DYRB 1Q0XL 2BCKB 1D6VL 1NFDF 1MRDH 4XBPB 1KB5A 2DLTA 1FE8H 2XJKA 4R0LB 5CNHA 3VD4A 1P7QD 1SY6L 5BOJA 4CADB 4OGXL 4K9EC 5J8OA 1LLAA 1OP4A 3MLXL 43C9A 1ZE3C 5F7LB 2NR6A 4LF3B 4R7DB 5DUPL 3H56A 2J12B 3APDA 4G71B 2HFGH 5DEFB 1ZHBA 2TRHA 2X6AA 1NFAA 3H2PA 1QTSA 2MOVA 3K2UL 1KCVL 3QUXD 5DZPA 2AV7A 3WXWL 5BS0D 4OV5B 1LO0H 4X6DF 1A6UH 5CD5D 3DV4B 4AI7A 4KMTH 3GHBL 1RULH 3QJFA 3DGGB 4GG6E 1EHXA 3ZKQD 4DGIH 1OQOA 1GYWA 4KKAC 1BQLL 3GZKA 2Q7AA 4HDIA 2RH0A 2WCGA 2ZUVA 3MV8D 3DUHA 1AR1C 1R3JB 2Z1KA 3DNKA 2FD6L 4XVOA 5AQ0A 2CUAA 3AAZB 4LRNH 4KRLB 3EJZD 5JPMA 2DN7A 4WFED 5SX4H 2B59B 1UWEH 2BINA 3WXVL 2VLKB 4TTDD 5IMMA 4AE1A 4Q74A 4G8GA 5EU7E 5T1MA 3RRQA 1TQBB 4MASA 4WW2B 5DJXB 4LGSB 4X9HA 4J8RA 2E74C 2Z9TA 3B9KB 3WJLA 1CPUA 3TF4A 5LCVA 5F7NC 3VE0A 1OP5K 1CIUA 3APNA 4I0KA 4LPUA 3S7GA 7FABL 3QYMA 3O2DH 2VMEA 3BAJA 1QHOA 3LDBC 4XGZB 4MJID 3HUJF 3G6JA 3QXAA 5CBAB 5TE7L 3FQ2A 1KCWA 3AQZA 3ETBJ 1KN4H 3BE1L 1KXTB 4LEBA 1TQCB 5E70A 4UTAL 1AGBB 4YQXH 1JNLL 4KJWC 3U46A 2OMZB 1KFAL 4NZUH 4Q6IA 3E3QC 3HG0A 5E24E 5JXEC 5I16B 4R4BA 1AS6A 5T1DH 3JUZA 3GMQB 4TVPD 3L1EA 3RUGF 2AJUL 4LCCC 1WAEA 3RPIB 1P4IH 3JWOH 3GSVB 2ADIA 2VR6A 3IDJA 3V9EA 1S7SB 3WELA 1RP8A 4U1IA 1BHGA 3IETB 4YXKL 3M86A 3W9EA 1KTDA 2V7HA 3O4LE 1QRNA 5A6IA 2WNKA 5GISH 2P7TA 1RUPL 4GYBA 3RWEB 1M2VB 3DPDA 1BQUA 4LEXL 4E42B 1AE6L 4KK8D 4OJEH 5EB9A 3L9YA 4JHAL 3LZQA 3CVDA 3KPSE 4B5ZA 1S7TB 5DFWH 2YIHA 3TBBA 4AZ8A 1LTXA 3I75A 4G7RB 3V6OE 3OKMA 1M3IA 5I1IL 1A4BA 2HTKD 4HMCA 4YHLL 3FS9A 4U1HA 1DO5A 3ESPA 2WKGA 1HQ4B 1K9TA 1MEXH 4KJPD 2P5WD 4D9QD 1MLBA 1J7VR 4HIHB 3GXDA 5DJZB 2AJVH 1A7QH 4FFZH 4PLKD 4EDXA 2UY7A 5TFSL 3SDYH 1KNOB 2NY5L 3O2VL 3T77B 1EEZB 4ELME 2VDKL 1JZ8A 1VEOA 1PCSA 2FE0A 2EP6A 3WJJC 4Z8FL 4XT1C 2JELL 1KG0A 5ISZE 1J1OL 3UPRB 4XBEH 2OMTA 3WN6A 3Q3GB 2RALA 4P46A 2H7WA 3PIQB 2XJLA 4JK0D 1KGCE 1MH5A 4X9YA 3PWPB 4QRRE 2Q7YB 3QXDB 2K70A 3GXTA 3KCPA 3VFTA 2KKQA 1Q0XH 2A74A 2UZYA 1E67A 1CT8A 4NI3A 1F4HA 3VSTA 4JCWA 2BVEA 1UKQA 2VE6B 2QZ5A 3N55A 2WYZA 1W72B 1NH6A 1P5UA 3I2CH 1AMXA 3MC0A 1X5AA 4LHUB 5EU5A 3MLXH 4PW9A 2VM9A 4K9JA 4YHPB 4AYBA 4OZIF 5DUPH 1V7ML 2FYYB 5BXFB 1D5MA 1RZ7H 3P77A 3GTVA 1NAMH 3U0PA 1L6XA 4HBCL 1Z5HA 1NBQA 5I8OL 3IJ9A 3RNKA 3QZWB 3WXWH 4WKZA 4BYHA 4E9VA 4FQJH 5J5EA 2VR9A 4PRDA 4DKEL 4FHBD 3FQNB 5D2NE 1AAJA 1HIML 3MRIB 5AW9B 1E8YA 3UYOD 3N43B 5KJRH 3L48A 4FG0A 2DMBA 3SGJA 3MV7E 3BP4B 5T5NG 2H26A 4S1DC 3KPQA 1RU9H 1R5WA 3S34H 4M56A 1TYJA 3CZJA 1KB5B 2RMNA 4LKXB 4LCVA 1KOAA 4OBSA 4OM0L 1JWUA 3CBJB 3DGDA 2VDQH 2O6FA 3WXVH 1IV8A 2H3XC 43C9B 4OZGB 1ILSA 2OR9H 1KCUL 2DTSA 1L9TA 2W0FA 4W9CC 2VLKD 4U0QB 1BREA 4QAWA 1LP9F 1ZHBB 4LXFA 3ECVA 3AVEA 4AEEA 3ZZ1A 4JFUA 3DX1A 2QGDA 2Y3NA 5GQBA 3F62A 3QQ9C 2Q20A 1WBXA 5C70A 3QJFB 2Z92A 1XGQA 7FABH 3O81A 3EJYC 5AOLA 1QI5A 4A66A 3K71B 3FZUD 2I32A 4HDIB 5TE7H 1R3LA 1ZCRA 4FLSA 3ZMNA 4JKKA 3BE1H 1I7UA 3REVB 1X5GA 5JPMB 1KFAH 3EO0A 2XHNA 3FUJA 3QIUC 4X5QA 4DKAA 2KLTA 5F3HA 1D9KC 5L2JB 4G8GB 2E9JA 1X6LA 3NP3A 4DSYA 2YKKA 1KBPA 1MCPH 2OULB 3MLYH 3LRSA 3VH8A 3W9DA 3HJ0A 1VKXA 4PJXF 2AERT 5IBLC 2GK0B 4J8RB 5HD8C 1BX2A 3MUUA 3E6HB 1IAII 4TNFA 5H8DA 1KBWA 1IO4C 4HH8A 4BZ1L 1MWOA 1DJHA 1IX2A 2PTVA 4Y16B 1N2RB 5INCB 4QHMA 4A7SA 3QXAB 4XXCC 3GZOA 1AXTH 1BAFL 2E9IA 2IDCA 5EORL 3U46B 1OD9A 4PWHA 2X9YA 4FG6C 4Q6IB 4U1JA 2IADB 4XNQA 3QPXL 4JZJC 2F53E 1W2KT 4N8UA 1YEJH 1A6TA 3KGUA 4TULL 5TF1H 1WCBA 1CXLA 3HHMA 3L3HA 3S88L 1U8IA 4OIIL 1BV8A 3D0AA 1AGDB 1HNYA 2M2DA 2ADIB 3IDJB 1BXVA 4FC3E 2EIMB 2R56H 2VXQH 5HDQH 3L8QA 4U1IB 3W9EB 3HVDA 4NYLA 3L16A 2PW1A 3ZRFC 2V7HB 4HWZA 2NY5H 3O2VH 1QRNB 5IF0A 2VDKH 3D2UB 1C5DA 1I53A 2CGYA 4AWJC 1QUPA 1NCDH 1NGXB 3O6FC 4G1MA 3HJEA 2JELH 4LSUL 4YSAA 2OJEB 2GTWA 1J1OH 1PIGA 1RLBA 4EMZA 1GGUA 3TCLB 4UB0L 3H85A 4AZ8B 3OQRA 1SXCA 3NPSB 3I75B 2BVYA 3QPKA 3OKMB 3G08A 4HA1A 5E8EA 1OP9A 4AJVA 3GSNL 2EH8L 1AS8A 2LGNA 5IROA 5FHBH 1INEL 4KVCL 3EFDH 5JHMA 1PG7W 2R4RL 1MLBB 4M00A 1CD0A 3K2MC 1O9ZA 3T2QA 4V11A 2P8PB 1T5XA 4ALAL 4EDXB 4DERA 1ZHNA 3INUL 1YJDC 1V55B 1KF9B 2F8OA 3GMLA 4JDZA 3FBQA 1WT5C 4HBCH 5I8OH 1JXJA 4WHDA 2HT4C 3PHQA 1M7IA 4PJBE 1BQHG 4F8OA 3H8NA 2FQDA 6PAZA 4QGTA 4PJAB 1IC7L 4P46B 5B8CA 3ARBA 4MA7L 3ZOAA 4XOCA 4ZS7L 3W2DH 4TPRH 3QJRB 3S37H 5HJGA 1TNMA 2FX8L 5BO1L 1TJIH 3KCPB 5LGHH 3VFTB 3QEQE 2QKIC 1BLNB 2A74B 2AJSL 3KEHA 4FNSA 5FV2A 1AXIB 1OW0A 1MDAA 3AT9A 2VDRB 4P2OC 1BFVL 4J3XA 3IPBA 1PGRB 3QUYD 4E9WA 3H1ZA 5EU5B 5GGTL 4YC2B 5CKAA 3TN0A 4Y2OA 4UMSA 1RERA 3VO0A 5LN8A 3DJTA 1W8NA 2F1BA 3HMXA 3P77B 1X5ZA 5J6SA 5GJTH 5J6GB 1I1FB 4AKOA 5ESVA 2BOCA 4EAEA 5E1AA 2OMVA 4WKZB 2JWYA 1KEML 1E5CA 5DZNA 4I2XE 3AU1B 1IFHH 2Z0BA 2F8VA 4HH9A 4XVJL 1CD1A 4TSBL 5GGRA 3VXRB 1XB6A 3U6XS 1QW8A 2VDLB 5DA4A 3ZO9A 5AKRA 1XGYL 2YEZA 2VLRA 5H4YA 3GS0A 3ATEA 1FDLL 3QWRA 2BOLA 3MV11 4C56E 1A64A 1FZKA 4NERA 1EHLL 4WQOA 2FECL 2P5EB 5D5MB 3ZKMD 3FT0A 2BNQE 1FFNB 3QQ4B 2FLRT 3MRGA 4MDJA 3FQXA 2WXHA 4TSCH 2W0FB 4UT9H 4MLSA 4HIQA 5CLZA 3JTBA 1UQSA 1J5OL 4DWHA 2X3AA 2GSMB 1EH9A 5IHLB 1IU1A 4FE9A 2Z7YA 4B53A 2DM4A 1FSKC 1EUUA 1I31A 5IT2H 2VLMD 4FTVB 1WBXB 2XVLA 1A6VL 1ITBB 1XGQB 4FZ8H 1FNHA 2GSIA 3EO1B 3PABB 4HKBB 4X6BA 4CU8A 5DD1L 4Y16D 5KS9F 4AC2A 2WINA 3ES6A 5FECA 4KAQL 4H2CA 4ZO7A 2CD0A 4OF7A 1WBZA 1OCOB 5DT1H 1O7SA 4QY8B 1MJJA 1QUNB 2DQHL 1KACB 4LSTL 2VW6A 2WXGA 4TULH 2LFGA 4XBGA 5E08L 3PE9A 5C8JA 3O9WA 4N87A 3LRSB 3VH8B 3S88H 3S96A 3QUXC 4N5UA 1XH2A 1NUNB 1I8KB 5CD5C 3LRHA 3R7QA 5JYMA 2XVBA 4QRBA 1AFVL 5DQJA 3BT2L 3KDPB 4K23H 4OFVA 4ZTPH 5HHMD 8PAZA 4KZCA 5KUMA 3SE4A 4JHUA 4QHMB 3PHSA 4PY7B 5HDRA 1MXDA 3ZTDC 3D2UD 1E4JA 4Z3EA 3MAWA 1A6WL 3EJZC 4MRBA 4JO4H 2FQFA 4XNQB 4TTDC 5GS3A 3QJHB 3KLSA 1IL1A 1QD0A 1A6TB 4HU2A 1ZOXA 9PCYA 1WCBB 1YEIH 5F9WC 4XCFL 2XRAL 5IW1A 2X4NB 5E1IA 1PD0A 2BC4B 2EIZA 2F7QA 3CHSA 3TZVB 4I9WD 4NYLB 4ALAH 2YWYA 3BFQG 2OW7A 5DU7A 4HWZB 3INUH 1CJYA 3F7QA 2R7EA 1T03H 4P8QA 1C5DB 3EUUA 4HGMA 5DWPA 5FO2A 3U1SH 3GBNL 1OT2A 1YEHL 3TO4B 4EPSA 3GI8L 3ZE0E 5CD3A 4QTHB 2GTWB 2GC7C 1ZGLP 1XF3A 3U9PH 4GUPA 1BEXA 1G6RL 1IBFA 5AUMB 4OLUH 1PEZA 1C12B 1I7ZA 3E2HC 1M1SA 2FX8H 4XMLL 1IGMH 4YXLH 2R23B 5TE4H 4NUMA 2YPVL 3S3JA 2MOQA 3II3A 1NBYA 5E8EB 4CBZA 3O3BB 4F33A 3AG4B 2X7LA 4XN8A 4W9LC 2N56A 1KYOK 4Y19B 4EUPA 2LR4A 1BFVH 4N3UA 5IB4A 5GGTH 1BVOA 2MRYA 3G6JF 1T5XB 3ZRCC 1P1ZA 1TVBB 1HHKA 3DO4A 1MAMH 2OCCB 1E2VA 5EZOH 1H15A 1VHPA 4RLDA 5GGVL 4JPKH 4MCNA 1K8IA 1IAOA 2FEEL 5MHSE 5CIPA 5LB1A 1M7IB 1KJ2A 3I3BA 3PP3H 4K71C 4ZFFA 1ZSHA 2R2EB 1KFGA 4KQ4L 4ERSL 4KK8C 2ZX9A 2ARWA 3LHAA 1YSOA 4OU3A 5F8QC 1O7DE 5K59F 5FM5O 3A6OA 1COBA 2BH0A 2VN5A 1QX1A 1XGYH 3C8KA 3WNOA 3FU5A 2NNAA 1HSBB 1U91A 3NH7H 5C3IA 3T5WA 3DXAB 3VXRD 3NIGB 1HS6A 2HTKC 4XMTA 4DAGH 2E7LA 3QB7C 1P7BA 3MYJA 1NC4A 4KJPC 1D7BA 1GHFL 3R7RA 1KTKE 1CG9A 4LP5A 1G1OA 4K73A 3FT2A 1I8AA 2HG5B 3BUBA 2R15A 3TN0B 1A9BB 3OKDA 2P5ED 1Q0YL 4YIQA 4M4RA 3PWUA 4X4MA 5J4MA 3ABKB 4F7EA 3F2LA 1DFXA 2CA3A 5IVXE 5F72S 1J9SA 2BOCB 3P1VA 3QIWB 3LRGA 2X2UA 4XRCA 3RHWF 4OB5L 5DO2D 5HYQA 4DH2A 4MJ5A 3OX8A 1CD1B 1A6VH 5GGRB 3SCMA 4AVHA 4NSKA 4EI6B 4FTVD 1M7UA 2YEZB 3NJMA 4TUUA 1FZKB 3OZ9H 4JG1L 4XB3A 4W9EC 5C6TH 2G9KA 4R0LC 1TVDA 4XP1L 4LSTH 4MDJB 3FQXB 4QNPE 5AW0B 2K3HA 3MUJA 5T1LA 5T3ZL 2WO4A 3Q5TA 4N0CD 1V8HA 3BT0A 4A6YA 1CBVL 4JFSA 5DQ9A 3ZDYE 2ZYRA 1VPOH 2GJ6D 2NQDA 3IJEA 3M7FB 5JR1L 2ENSA 3WSQL 1GXEA 1TSHA 3PDOA 3TS8A 3BT2H 5E1QA 5JQ6L 3LKOA 1U93A 1WC7B 3MJ6A 5DEJA 4L8CA 1P1VA 1SVBA 4WI5A 1RZ8B 4F5CE 5CR1A 2YZ8A 5DQDH 4YSPA 3RNQB 3ES6B 4E41E 4LCWD 3VX0A 1S5HA 1A6WH 4F3FA 4MS6A 2GCYA 5E4AA 3U0TA 2H0JA 1WBZB 5J06A 3ZE1B 4A7VA 3WKNA 3DUSA 2QSCL 1WEJH 1MREL 4XBGB 4DEUA 1WWBX 4ORGA 3TV3L 5K9QI 5E8NA 4PCTA 4XCFH 3U6XA 4F8LA 3S96B 2HRLA 4NN5B 5IOPB 1TQBC 2EYSA 2CK0H 3FTGB 4O2CB 4XR8C 4JE4B 1LWRA 4OCSH 4WW2C 4QXGH 5CEZD 4PMFA 4PH8A 4QD2E 4FXGA 4W4OC 3ARDD 3IAGC 5DQJB 1TIUA 3QXUA 3TZVD 1W91A 4ZK8A 3IJSA 4OTXL 4PWFA 5I17B 3FZUC 3A5VA 3GBNH 2B77A 1U8OA 5LDUA 3VQMA 1J5DA 1UB6A 3PWVA 3TO4D 1MZZA 3FHQA 4NWUH 4LOUD 3QULB 4G7SB 4HLZG 5DHVB 5D7JB 4G8AC 5AL8A 2H0EA 5F6IB 3EOYG 3IDUA 2CKBL 2YUWA 4BSWB 4MDIA 4A1RA 4XNYH 4YFDB 5DDHB 1E5UI 2ZKMX 1B0IA 1MF2L 5TE6L 2BSTB 3P69A 4DNLA 3FO1B 2FEDD 2BDNH 2R83A 2EIZB 4NN6B 1BQRA 4NO2A 1NOFA 1NAKL 5K9QG 4Y19D 4OF6A 5L2KA 1NANI 1OGAA 2VZVA 3WFEL 1N6UA 3WEXA 1SRDA 1C5CL 3MCYA 5GGVH 1H8LA 3Q8FA 5L8JB 2VSMB 2OMXA 2PPFA 3B5HA 4WFGE 1KDIA 1QVOB 4KQ4H 4LIQL 5HYEA 3A24A 4TVSa 4GUPB 1NFDE 3GKZA 1HOCA 3OGOE 4RVBA 1SDYA 3WUWG 1I7ZB 4ENZA 3UTSE 4YDKL 4OCWL 4MBOA 3U6RA 1E8ZA 2D7TH 5CHNA 3HPLA 3VXUB 1P6WA 4HFWA 1NBYB 3CVIH 3I6LE 5FLUA 4F33B 2X7LB 1FYTA 3DXAD 2C9SA 15C8L 1OOWA 2GT9B 3Q2CA 4NLAA 3ECQA 4JQVA 5JQHC 1BJ1J 3FFCE 4QJ4B 1P1ZB 3FPYA 4NO5B 1JGUH 1Q0YH 1L4IA 2EAEA 4LSDA 3IBOA 1H15B 2WSKA 4GQQA 3B37A 5HYSA 2XN2A 2IPUG 3U1QA 2BVOB 1K8IB 1IAOB 3FTZA 3NDYE 4G72B 2CHXA 3MLRH 5DZAA 3H3BC 5CIPB 1KJ2B 4WEEA 2DTMH 4U05A 2J25A 3PHAA 5HHQA 2KI6A 3QIWD 3ZYOA 2YO3A 1JZEA 1U95A 4AJ0A 8FABA 3C8KB 4LRIC 1UXWA 1U91B 3E6FA 2EUVA 1SOKA 3HI1A 1QZNA 5KUKA 1QWUA 3MYJB 1II4E 2V6HA 3LIZA 4IOIA 4L37A 4Y8DC 4RNRB 3UG4A 3A4EA 1EHAA 4JGJA 5ACLA 4XP1H 1B4TA 1VCAA 2AZAA 5C07E 4XPFL 4AJYV 4M4RB 3ZE2F 5T3ZH 1T04A 1FAKT 4HZ1A 3HUJE 4PGZA 3UDWA 3B8SA 4ABUA 4LVNB 2AAAA 2K4AA 4U1NA 4WUKL 5HYQB 2OXGA 5JR1H 4MJ5B 3OX8B 4HUXA 4YAQB 3SKOB 1UD4A 5DVPA 2QZQA 1ZS8B 3SCMB 4NSKB 3H9SA 5AOKA 3I74A 4HG4K 2YPKB 5CCHE 4XZ4A 1MCBA 2APTA 4ZUUA 3ZHKA 1CI5A 4JPVL 5KBLA 4PRBA 2WZ0A 1ZHKA 3LEVL 1JTOA 4RESB 1D5IH 1C7TA 2QSCH 2WIIB 4ENED 3QFJB 3WKMH 1R47A 3ECBB 4HAKA 3ZL4H 5EU6D 5I8CA 3SKUD 3TV3H 2M8XA 3Q1SL 4JUSA 2YD1A 1DZBA 1K5NA 2NR6C 2OX5A 4LO9A 1K4DA 4GAJH 4GAAA 5FYJE 1BWMA 4QOKE 1YQ2A 1WZLA 5FWQA 5EUKA 1JYNA 4S0TD 3IJEB 4IMKA 3NIGF 3FCBA 4L4VD 4YFLI 5KG9A 4JM2B 1EJOL 2AQNA 2V9TA 4L8CB 4LAQH 3P0YH 4KI1A 1UM5H 4AZUA 2DAVA 4PRIA 3AS1A 3FSWA 1G0YR 1SEBA 2GCYB 2FCBA 4O2EA 5JPMC 3PY9A 4ANVA 3GBMH 3WS6C 1Y1UA 3QAQA 5D7JD 1NMBL 1OD7A 4GBXA 5J56B 1AQDA 3NIFF 4W9FC 5TE6H 4IJTA 5F9AC 5FB8A 4ZPTA 3KW8A 1SLXA 4PRHE 1IGCH 3FU3A 4RGNB 5AAMC 2KHAA 3DKHA 2DQJL 1WA1X 1YVLA 2D3VA 2JQAA 3ALWA 3MNDA 1RZKH 2KERA 2ZXAA 3EJJX 4OLWH 4JRYA 1LWHA 4RAUA 3VNZA 4H8VA 5I1KL 2V9RA 4IBLT 3AMKA 4XNAA 2DL9A 3EYVB 5IHZA 1JHTA 2CR3A 2O4EA 2QMKA 4DK5A 4Y16C 3S3PA 5JPNB 2ARJQ 1U8OB 1KYUA 1UB6B 2YSSB 4YHYB 4JFDB 1G84A 4FZEL 4OJAA 1U4EA 3BO8B 3K46A 3ALXA 4UNIA 3P02A 2QFPA 2DD8L 3MRJB 4BJLA 4YDKH 1UKTA 2ZUQB 3BRFA 5D9SA 4OZIE 1NEUA 4HV8A 1MXGA 2K0RA 2Z8RA 4HEMA 4M61B 3VXUD 1HWHB 15C8H 1LO3H 3CZFA 5GGRY 4BKSC 4J4PA 4EN3A 1AS7A 1NIEA 1T89A 3HI6L 5EHFA 2FWLB 3RWHB 4Z7UE 5B39A 5MENA 2NY4B 3LNEA 2A1WL 2XG5A 3CVBA 3KWVA 4YH6A 1L0QA 2OMXB 3IS0X 3M46A 1FNGB 4ZMZA 3NP4A 4C59B 1YEEL 1RZGA 2VQUA 3EW3B 2MQGA 3BFOA 2GJPA 1FAIL 4IM8A 1A7OL 5HHPA 3CVCA 3CLWA 4PV9A 1RURH 4N2GA 3UAFA 4YSQA 3MLTB 2VAJA 2W1NA 4YDZA 3M1OA 3U6RB 1J88A 3ILPA 4HFWB 3NPSC 5BRZA 1HJCA 2ZKYA 4QF1B 2B4CL 1Q9WA 1FYTB 1G7JB 2NYKA 1E4HA 4UDUB 4HKXA 1E5BA 1X5LA 1R3HB 3HNVL 2K9FB 2GQHA 1J48A 4PJFA 5KYWA 3MJ7A 1GS8A 4C4UA 3JBG7 3AQDA 3REWB 1OK0A 1EUTA 5KSUA 5IBTL 4HCFA 4XPHL 3DHJA 1THCA 4MHHI 1UADC 1T83A 3HG1B 3QZPA 2AQRA 2IV9A 1AKJA 2ICWJ 4R5VA 5HHQB 3MNWA 4P5KB 1X5HA 3UIYA 3QI9A 2XVGA 5J6HB 3J8F7 1NCBL 1U3JA 1U95B 3BWUC 4HKZA 3WFZA 4TM9A 5CLYA 1HEZA 2EEFA 1UXWB 3E6FB 3D39E 2J43A 2X09A 4DO5A 1KXQA 4G6FB 2XQBH 2VMDA 1VJSA 2N7BA 2FH6A 3KVPA 1TITA 3P40A 4DW2H 4NQSA 1W0WA 2CBOA 5C09A 4IOIB 4L37B 4MAZA 3LEVH 4Y5YA 4GRLD 4WRLA 5EEZA 3EGSA 1TENA 3QHTC 5G5DA 4DN4L 4Z77A 5HHOE 2CR0A 1S7RA 3AGWA 3Q1SH 4YC2C 4MSWA 3QFJD 5T33H 2Z4TA 5ESQA 2NW3B 1IT9H 4GI9A 5CJ5A 4MHHG 4MXQD 1Q90A 1U8LA 3ROOB 2NXYB 1FCCA 5E2JA 1EJOH 4P9HH 3DBXA 1ORSB 5B38G 5FYLL 5IVZA 4JM2D 1KCKA 1LO4L 1IRAY 2EVJA 2O5YH 3SGJC 5EF1A 4PRBB 1ZHKB 1SGKA 1FO0H 2CCVA 3ZYZA 4HLJA 3CFQA 5M95B 2D31A 5I8CB 1JNNL 1X9RA 2F5BH 2Z34A 1NMBH 3KH4A 5GS0L 2YAOA 2OX5B 5BVJB 1K4DB 3ECWA 1OP5H 3K0WA 3VFSA 3QDJA 2XTJE 2BIQA 4IW4C 4R97B 2QDWA 1KZYA 5DO2C 1PEWA 2DQJH 5T3XL 4HKJA 3FUMA 1WWCA 4RGND 4S2SA 4U4IA 4KTGA 5I1KH 4PI2A 3SPVA 3S6CA 1B2WH 4UTBA 4E9RA 4XNUL 1DVFA 4WUUA 2W95A 4KUCD 2FWSA 3DK2A 5JUEL 1KYAA 4PRIB 2YQGA 5FYJH 5IW6A 1SEBB 4BWUA 1S8DA 2OMYA 2VC2L 3FSZA 3QIBB 1A1MB 4FZEH 1LEIA 2IGFH 3BAWA 1M7XA 2DD8H 4TUKL 2IPKA 4JFDD 1TZIB 5I6KA 5I1DB 3V2AR 3B7YA 4GBXB 1AQDB 4N0CC 4KQ0A 2ATAA 4ZPTB 1FL6B 1BBDH 1BYOA 3F00A 4FYTA 3P9WB 4N28A 1NTDA 43CAB 3UGEA 1MHHA 4JRYB 2YUVA 1TZ8A 4RAUB 4YO0A 5IHZB 2NY4D 1JHTB 3O6KH 4GQZA 2H32H 1GSKA 1IBGL 1YEEH 4EVNA 1OQXA 3ULVL 3DROA 5E2WL 4GSQA 1A7OH 4HIJA 2PP9A 4M5ZL 5KVDE 1N26A 4M7ZC 2EXYD 3GBEA 3OJVC 4B9ZA 4WF7A 3SBQA 3NVQA 2PLTA 1OE1A 4L48A 1PNDA 2AJYL 2J8UA 2HX7A 2DDQL 4HCRA 4L5FL 2VL4A 4HV8B 4PJ9A 3NFSL 4R96A 4KDVA 1TEGA 4ZNEA 3VGGA 1MFBL 4PRPD 1SUJA 4EN3B 5FWRA 3IE9A 4IK6A 3TZVC 1N6VA 5BMFL 2XG5B 4PWKA 3E7JA 1G1YA 4ISVB 4NQCA 4YDVA 3QO0B 3EDKA 4O02L 3HG1D 4ZOEA 5C71A 1NGPL 1S3RA 4LZKA 4V33A 3TO4C 3MUZ1 2O6DA 3FHAA 2B0SL 3B9EA 4LOUC 4OH2A 4PHXA 1QLEL 4PB9H 4RFEA 2HZHA 4RISL 5EA0H 1CGUA 4PV9B 4AX3A 2ZKWA 3O3UN 1IKOP 3J07A 4KJYB 2MQCA 4ANXA 4CL7A 1GY2A 3ILPB 2QJDA 3ZO0A 5BRZB 5FW7A 1G9MC 2A9CA 4E9SA 3CLFL 4BWTA 5JXAL 4HKXB 2R1WB 4G6FD 4EDWH 3QDGE 4LHJB 3T3MB 2FEDC 2NX5A 4CNIA 3GBLA 1OANA 4PJFB 4YXHH 1SPDA 2HWZL 3MJ7B 5IROC 4DN4H 5H4ZA 2MTPA 3NUKA 4NUPA 2ENYA 1OAZL 4BFIA 1KYDA 3I9IA 5C0IB 3VTAA 3EYQD 3GXIA 1AZRA 2FX9L 3S36H 1JZJA 3LZFL 4NQDA 2UZXA 1AKJB 1SDDB 4HJUA 4FKKA 3OC5A 3S5YA 4R2GB 4NQEB 4APQB 3VXSA 4ZAKB 5CZVL 1BVLA 5DD3L 1R3KB 5D1XB 4HKZB 5EV7A 4ZO9A 1HEZB 4F93B 2NXYD 4GQ9H 2XU9A 1JPSL 1E27B 2OMUB 4ODHH 4UV4L 2WQXA 3BIBX 4KUZL 4BZ2L 2D3NA 1MPAH 5C09B 1KJVA 1VLXA 3B2DC 1ACYL 3KE0A 3HR5B 3RL1A 3EGSB 3BUIA 2AQ1A 4N0UB 1NPJA 1PY9A 4JREC 1ET7A 4G6AC 4HS6A 2A7BA 4KGLA 1OHQA 3B9VA 2PCXA 3AREB 5F0LB 3GJFB 3LN9A 1IM9A 4GY4A 2HFFB 3X12A 2X88A 4XC1L 1U8LB 1A2YB 3QIWC 1CXEA 2DBLH 4XCCL 3OD3A 2IXQB 5K1JA 1P4BH 1I9RL 2BHZA 2R1YB 2EILB 4L05A 4C4KO 3DBXB 3WHXA 5J89A 1O6VA 1Y0LA 1T66D 2YKLL 2X87A 5IMOA 2GITA 4OLXH 4ZW8A 1S9VA 3OBAA 5C92A 4EZLA 5C0EB 1AGEA 4JDVB 5AVSB 3ZZQA 1BAGA 4H1LA 3L08A 4XNZB 2Q2LA 3CX2A 3QIBD 3N1PC 3GB7A 1CLZL 4OFPA 3P0GB 4AVJA 2Y36L 2DBJA 3VFSB 1KXVC 1JGVL 3ARQA 1TVHA 4G80A 3PDDA 1K4CB 2L7UA 1D7CA 4AM0A 4NZFA 3HLKA 4HKJB 5FO7B 1E43A 4Z6AT 5IB2B 4JR9L 4OCXL 3BIAX 5E5UB 3MLPA 2XZQH 4DP8X 2A9BA 5MP6H 4S10A 2ZOKB 3QORA 4WSJA 4HVBA 2F54A 2H8PA 3AG2B 3KYOA 5AB0A 1KSRA 2NY7H 1WFJA 4Q0XH 3V0FA 4K55A 3VXPA 4M5ZH 5KVFL 1OCWH 5D6CB 4F57H 2IPKB 3ARYA 2Z1PA 3P0VH 5EBMB 3V95A 1IBZA 2C34A 3BCFA 1TT6A 2F61A 2N3JA 4GMSH 5I8EA 2CHDA 4PBVC 3E8UL 1OTUC 5G4MA 1PZ3A 3M88A 4OJYA 4IOFD 4FXKA 3WN5A 1T20A 1T0MA 3P9MB 4KTYA 1MHHB 5T5FH 4BFRA 3L5IA 3D18B 1JZFA 3W11C 4F2MA 3IRCA 4LQFL 4EVNB 3L6FB 3B2XA 3MRHA 4CKVX 1UOVA 4HIJB 1G1CA 1Z9MA 4RISH 1QLEH 3L5XL 1TZHA 5LXGH 2J5WA 3FTUA 3O8XB 2CJ3A 5ETUB 3QCUH 2V3EA 4L8BA 2D7MA 2J8UB 5D7JC 5F6IC 2AV1B 2XZZA 4KZ0A 1YZZA 4PJ9B 4R7LA 4YBLB 4R96B 3SJVA 1UCBH 4N8PA 4A7QA 1MHPL 5TDPA 2VKWA 4JFVA 1XL4A 2PABA 4X5XA 2O26U 4YMPA 2H1LM 5KVDH 4NN6C 1F11A 3MRBB 4M6OL 2FX9H 2VUYA 1GGBL 5DEGB 1BM7A 3GLZA 5K9KA 4YDVB 5A2IH 3D1MC 2DLFL 2BS8A 2P24A 5JW5A 4C4KT 2IAMA 1GIGL 2VZTA 1HCZA 5EULV 1AG0A 1W80A 3BX7C 1O0VA 1AKJD 5DSCA 3A6CL 4RFEB 4R2GD 1ZKAA 4NQED 4APQD 1WCQA 3DO7A 3EXJA 1DL7H 2BY0A 3B43A 4NO0D 4WHTA 4ZAKD 1N68A 4P57A 5F88A 3SKMA 2ODIA 2X9ZA 1CIDA 5D1XD 3V4PL 4JCLA 4JFED 4Y5XC 5D1QA 1ACYH 4CNIB 4PY8J 3FB7A 4LLQA 2MCPL 2W5PA 2Y69B 4BFIB 2J72A 1O9VA 2P52A 3EGXA 4OZ4B 5BV7L 1OL0A 4LPWA 3HG4A 3C5XA 4JDEA 4W9HC 4WU7A 3LNGA 2P44B 3ZHDA 1LYQA 2MNUA 4OUUA 2UZXB 3E1F1 4GFXA 2ZKXA 4K5OA 3ARED 2ZYSA 4W9DC 1LDPH 2AMUA 1BVLB 2ADGB 4XP5L 1ETZA 1NEZA 2J73A 1TTGA 5HJ3B 2X40A 4ZMOA 3UCQA 5C0DB 4XO4A 3SY6A 1XCXA 2YKLH 3QW9A 1OAUL 2GB2A 4MX7A 1BECA 1LK2A 1E9PB 4HW6A 4BSVA 1XBDA 3PXJA 3Q7JA 1KJVB 1SOQA 3ERXA 2FZ3A 3RL1B 5L7XL 3DOIA 4G9FE 1MI5A 4N85A 2ESVA 3IGAA 1WIUA 4L1BA 2OMNA 2Y36H 4GI6A 5F7DB 1T1ZB 4FERA 2X4OA 1A8ZA 3QZWG 1U8KA 3X12B 1D7DA 3FW6A 4ANKA 3O6LL 4LVNC 1HXMA 5GJSL 4JR9H 2A73A 1BSIA 2EUWA 1S3KL 4PJFF 3SCMC 5IMOB 5BZWA 1XR9B 1MCWW 1S9VB 2YPLA 3H2WA 4PTUA 4L18A 1AGEB 1SFDA 2QVMA 2Z7WA 4P99A 4Z7AA 1WBYA 2MTAA 2CLRB 4PD4J 5FR3A 4H1LB 1E4WL 1C08A 5K33A 5KVFH 2BFGA 2IQ9L 3BDXA 3PQYB 3GB7B 4LASH 1J0IA 3BLBA 5DUMH 3WFCH 4IDLA 3WEOA 4P4KA 3E8UH 5E9DE 5BZDA 3L7EB 4B9CA 3FSOA 4G80B 1TVHB 4D7PA 1SNRA 5GS2H 2DF3A 1JCVA 3DO3A 1KEGL 2WVSA 1BGXH 1TEFA 3PL6A 4JM2C 4QXUL 1CC3A 1S9YB 3QORB 3W0WE 2OL3H 1WVZA 2EC9T 3CG8A 4NKOA 2H8PB 3GGWA 4WWPA 5C0GB 1HHHA 4KKRA 1AXSB 2AP2A 32C2B 3NFNA 3VXPB 1D3CA 1RSFA 1FC2D 1WYJA 4UUJA 3L5XH 3KLAA 1YECL 4P5RA 1N12A 2XNAA 5EZPA 3A3YB 3WDIA 4X4ZA 3O8XD 3QYCA 5FO8A 4FA6A 1T22A 3AFLA 1MHPH 2BY1A 2E6PA 1IVLA 3F12A 1A5FL 1Y18B 5IJVA 1T20B 3GQFA 4NBYB 4RGNC 5AZUA 2XWTA 2C4FT 3V6BR 2J5LB 2MSPA 1G9EA 1UWXK 4GLRI 1NGQL 1OTSC 2X4TB 2F15A 1EEYA 3VDCA 5BW7A 2EDFA 4NQVB 4BINA 5JPNC 1L0XA 4G6JH 5AYTA 1WISA 3QGVA 4FN0A 4XO8A 1XL6A 1ZGLM 2ITDA 3UC2A 2E47A 5B7MA 4YHYC 3BRGC 4ACPA 3OL2A 2PUQT 3G04B 3LKSA 4S1RL 3V4PH 3LH2L 3ZE2E 2XFXA 2ZUQC 4H13C