3DI2B

Crystal structure of the complex of human interleukin-7 with unglycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
195
structure length
195
Chain Sequence
DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
molecule keywords Interleukin-7
total genus 34
structure length 195
sequence length 195
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di2B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di2B01
1LK3H 4S1SH 5ESQB 1V7ML 4I48A 4J3UA 3GMNA 3CVHH 4HC1A 1AR1C 3UTQA 2VSDA 5B38A 3VGAB 3MV8E 3MRMA 3DIFB 4PJBE 1RZJL 4FFVD 1I85C 2FYYA 1JPSH 5GZND 3FFDA 5BO1H 1TVBA 4MCZB 4WU7A 4Z77B 4JJ5B 1LO5B 3MRHB 2KQMA 2Y1VA 3I9GL 4PG2C 3D0VA 2CLZA 2IFFH 4FN0A 2ITDB 3WMSA 2Y07H 3BFOA 4JLRB 3QXUA 3O0RL 5CZXC 3MRLB 5H94A 5E6YA 3RTQB 4EDXB 4XBEL 3OAYK 1H15A 1LEKA 4KDVA 4D8PB 4NP4L 5EBWA 3C2SA 2QKIA 2X4OB 3PHOB 4XCYB 1BJ1J 4R2GD 4MA1C 3B6SA 4Y1AA 4L9LB 2OTUA 3C8KB 4TVPH 5TJWK 1BD2B 3WN5A 5F9OL 3SDYH 3U4BH 4CVZA 4RA0C 2VITA 2EDYA 3ES6A 4K94L 4JFYB 3LVEA 3GMOB 1J9CT 5EU5A 3K46A 4EI5C 4X8JA 4Q0XL 1UQSA 1MCNA 2BRRH 4WW2F 4X7SH 4AY0A 4KI5E 2NY6B 4KJYB 1YNTA 2G5BB 2V7HA 4I77L 1JZ5A 2ED7A 2VDLL 1N6UA 4OJFH 5DMGC 3S88H 4M02A 3V5HA 3G6JA 1CD8A 4UDTA 5DJCA 4NO3A 2ERJC 5F44A 3ILQC 4HC1L 4NFBA 3WL9A 4KUZL 4AJ0A 2LABA 5JO5A 1N59B 2B20A 5LGKA 1U8KB 4EUPA 1VEOA 2X1QA 1NGWA 4TSAH 4RWYH 2J2ZA 3T0BA 3BPNB 2R1WB 1NQBA 4BUHA 3UDWC 5JXAL 4YDVA 4PJHF 3CFBB 4RX4D 1S9XB 3QG6B 1Q94A 5EO1B 4QXGH 5EWIH 3MNZB 2R29H 4GRLB 1NCDH 1L7IL 2GI7A 4KI5F 3DOSA 1DP0A 1WK0A 1PKQB 3HUJA 2J5LB 1T7XA 4BSWB 2ZSWA 3T77A 8FABB 5SWZD 1CD1B 1VEPA 2MPAL 4TNVK 5IIEA 1EH9A 4M8QB 1LILA 3WXWH 5DJ0A 1A6UH 5L2KE 3VFGL 5I2IB 4OZHA 5D7IB 5I6XB 3EYFB 1ZT7B 3DVFA 3BH8B 4QXTA 1MSPA 3VXQB 2EE3A 3IJHA 2DI7A 1R3KA 4GW1B 5DJYA 1FIEA 2E8YA 4U1GC 4LSVH 3U30C 3ARBA 5HHME 1NL0L 1V3LA 4WUUD 1UA6L 4ZFFB 1A3RH 5HHXH 4P2OD 2X4SB 4MA7H 1PQZA 1I3RB 5C6TL 1J0HA 4U2ZA 2QADB 2OZ4L 3UCRA 4M48H 3QUYD 3UTTD 1UM6H 2X40A 4HMDA 4JPIB 2JJWA 3BPCA 2FJFA 3EYSL 4XP4H 4M62L 4F7PB 1FAIH 3QXDA 2J6EA 4HWEH 1WTLA 1OD9A 4M9OA 2XQYK 1CICC 1EFXD 1DL7H 4WW2B 1MCOH 3DPBA 2GCYA 1YEJL 3V5KA 2Z4QA 4JAMA 3TIEB 4HXAH 2X44D 4WFFE 3ALPA 1LEIA 3MGAA 4JDZA 4ORGA 4GKOA 3BWUC 3ROOA 5IHZA 1W0YT 2P8MB 4YXLL 4XNYH 5B39A 2FH8A 3O9WA 1UKTA 4AMKL 5F7EH 4FZEL 5E99H 1FRGH 3D48R 3VDAA 5HI3C 4Y2OA 3TN0D 4XPTH 4YXKL 3HRPA 3AXLA 5F6IC 4R8WL 1FV1B 2E5EA 3QI9B 4LQFL 4PLNC 1BFTA 1SJEA 3U0TB 3KPOB 1JHLL 1NANI 3VXTA 1YECL 1P53A 2VAJA 5KVGH 4M4RA 4Z0BL 3GSVA 4NZTL 3LD8B 1ZHLA 4S0SD 3PDOA 5F96L 1RUKH 4HIEB 3SQOL 4O58L 3C09B 3I75A 4UZGA 3ZDXE 4F58H 4N8PA 4OZFA 3S37X 1X4XA 5DD6B 1AH1A 1Z9OA 2J3SA 2ZG2A 5ETUB 1YNLL 2NX5E 3G6JB 3CZFA 3OKMB 2MQ3A 3SDDC 4BK4A 5C08B 4LLYB 5E8EA 1F3DJ 4U1JB 3ARVA 3QO0B 3EO0A 3W2DL 4XWOC 2EYRB 3C6LB 3Q6FB 5HHPA 4HX1A 1RUAH 5HHMB 4P46B 3TVMB 5DJZA 3GMOA 3LEYL 3BWAB 1RZIB 3MODL 1EFQA 4YDLC 2C1OA 2CH8A 3PL6D 1MCHA 1IM9B 4U1SA 2BHYA 4P2RE 4PTUA 1G6RH 1MHHA 4I9WD 3REVA 5DS8B 4KRNA 1F6AA 4Z7WB 1U8LB 3QEGH 4U1KA 4R8WH 1ZK9A 1IGCH 2YZ1A 3K7UA 1P6FA 2N4IA 3ZDZF 4QY8B 3UJJH 3L5XH 4MQ7A 1C8PA 4G8GB 3NCJL 3PWJB 5CJ5A 3QEUA 5D1QC 1G7PB 1VFAB 3AS2A 3QQNA 4U6XA 4IIQA 2WZPD 4X6EB 3IDXL 5ADOL 5I1GL 1F11B 1S7SA 2CIKA 4H5SA 4QYOA 4L8CB 3VDCA 5GHWL 4X9FA 1DVFC 1U58B 2I07B 3FQUA 3G5VB 3LZFL 4XPGH 1SM3L 1JN6A 1K4CB 4AEHL 3MV8D 1QHOA 1MELA 3MA9H 2VXTL 4BZ2L 3K2UH 4PJDE 1RMFL 2C1PA 2ZCHL 4JFPB 3KYMA 4LMQI 3VA2C 3CCHA 1U91B 2J7LA 3LS5L 1UM6L 4R0LA 1IEBB 4HC1H 5DGQA 1G7JB 4PRHB 4Q6IB 4U1IA 1AXIB 2J8UA 3PV6B 3DYOA 3O2DH 2FIKB 5I1LB 3IETA 4ONHB 2ADJB 4JJHA 2FWOA 5BZDB 5FHBL 2EO1A 4WTWA 1JZ3A 3DX6B 4PG9A 1Z2KA 4Y16C 4KJPD 1OB1A 1T80A 5E9DE 1A6VH 1L6ZA 2YXFA 4ZFOL 4E9LA 5IVXB 3QWQB 3QHZL 2VABB 3VXUA 1NLBH 3NH7H 3O6FC 5CJQH 1KBGL 5D4QA 1XGQA 2X4QB 2LU7A 4UBDD 4BQ9A 4GRLA 4RBPK 3L3JA 1UQSB 3WE6A 2HTKD 1JCKA 4GKZB 3RBSA 2GTWB 4OF0A 1Y18A 1QNZH 1W72A 1ADQA 3HAEA 5EUOF 2G75B 2WUBH 1ZSDA 3SDAD 3EHBD 3HZMA 4FOMA 2BCKB 1HSBB 3CC5B 4V1DB 3TZVA 2F15A 3ARDC 3EOBB 3VXTB 4MAYA 2GJ6D 3QXAA 1ONQB 1G0YR 3ARXA 2ICWB 3SKNA 3P11H 1CYGA 1LQSR 3U6RA 2XTJC 1FNSL 2B4CC 1CZ8L 3GJEB 2I27N 1CD9B 1TETL 1U8JA 4ZUTA 3HE6C 3VRIA 2FECI 3OKLA 4TSAL 3W2DH 3L3HB 3O3BA 3LS5H 1RUQL 1IC7L 2VDPL 2CDEA 4NCC2 4PV9B 3KPSA 3UTZA 2CJUL 4R4NC 1YNLH 3DARA 2W65B 5I0DA 1IVLA 5IVZB 5HY9B 3F5WB 1FYTA 3TJEL 2Z8SA 2W59A 3RY6A 3HZYB 4OUUA 3L6FA 5DRZA 3BD4A 4PJ9C 3IJYA 1J88A 1XF4B 2XRAL 1Y0LB 4L3EE 3V52H 4PP2A 4JRWA 3D3VA 4JGJA 4WEMB 1VACB 1AFVL 3RBGA 1T5WB 5T33H 1HH6B 4V2BA 2DQGH 1YJDC 1BZ7B 3OKOB 2AK4E 5D1ZA 1UCBL 3QB7C 1YMHB 4C56B 3GRWH 2H26A 3LDBC 1KYOJ 2HN7A 4KKNA 3R06A 1MPAH 4EVNB 2ZCLL 1DLHA 3L3DA 25C8H 2VC2H 5IJVA 2JJTA 4X0KA 2XZQL 3DWTA 15C8L 1ZGLP 5JUEL 1IAII 4IDJL 1PSKL 2E27L 4FQHA 1KIPA 4TUJA 1H3TA 5ISZD 1IJ9A 3QDGA 5D70L 3ZTNL 5GS0L 1O5DT 4G6FD 4GAYA 3RIFF 1PEZA 2HFFB 4HD9A 4R97B 1QSED 1NGYB 3AU1A 1RZKH 3OR7A 3OKEA 4LVOB 4P5TD 5SWZB 4RGNB 5F1NB 1J1OL 4L5FL 3NPZB 2RAMA 4Q58C 1JNNL 4OFDA 4OCMC 1QACA 5CP7A 4POUB 4Z7WA 4PLOB 1K8IA 3NIDE 1S78D 3NFNA 5DS8A 2R9HC 1MIML 3VD3A 4L3CA 2J8UF 1KJ2B 1QQDB 6FABH 1VSCA 3VWJB 2AW2A 4NZTH 1HI6B 1J0KA 3NFSH 5BMFL 5C1MB 3EDJA 1U58A 4QTHB 4WUKL 1LE9B 1F13A 5HHXL 5IROC 3ZSTA 4N8VA 1L9MA 3N9GL 3NIFE 4UIMA 5D9SB 5FK9B 4YWGL 3IAPA 5AYUH 5B4MC 3E2HC 1J8HE 1ZHLB 1KELL 4P59H 5HHMD 4YLQT 1CGTA 5T5NG 4FNLH 3BP4B 3ULUC 1CU4H 1VGEL 1ZMYA 3DO3A 4HHAB 3L5HA 4WI9A 2A0LD 4I18C 3AREA 3BP6B 4ISVB 3LRHA 1AD9A 4JPKL 1W0VB 3KNBA 3DRTA 4OD3H 4PJAE 2IBBA 2VKWA 2ESVE 3IDXH 4JM2F 3G6AA 4TVPD 2X4RB 4LRNL 5DUBA 2ICWA 3QULA 1P5UA 1DQQA 2MCPL 1DE4B 1QFWM 2GUOB 3S97C 1GJIA 1OP5K 4ELME 4P9HL 4ZSOE 4JAMB 3TIEA 1KENL 4J8RA 5T1KB 4QOKD 4U33A 2B5IC 3MACL 3DX9B 3HPJA 5KG9A 5LXGL 2CLVB 3T09A 3OAZK 1SYVB 3KLAA 1OAKL 2QSQA 3DLQR 2OL3A 4OFPA 2GSIB 3A67L 3FQUB 2X4NB 4J3SA 1T03L 2FSEB 3HMXA 1DFBL 1H3PL 2IG2L 3RL2A 1V7NL 1MFDL 1INQB 3L3GB 1LNUB 3RDTA 3THML 1HXMB 4RFOL 1PVHA 2LAGB 2QHLA 3EO9L 5FO8B 3SCMA 2VB5A 1VEMA 3GZKA 3WXVL 1CCZA 3MXVL 2G60H 4IOFD 4X6CF 5SX5H 1GHFL 3GIVB 3VE0A 2A6JB 4NSKA 3EDKA 4RNRB 1ZLSL 1D6EA 3HE7D 3ULVC 5SWSE 1TQBC 5KSBA 3A6CL 5I1JL 1F4XH 4OUOA 2VN4A 2NY2B 2VDOL 4L4VA 3DETD 3MMEB 4PJDB 1KN2L 3NN8A 5E4EB 3QUYA 3UTTA 2BNUB 3HC0A 1RHHA 5JOEA 3HR5A 4BA8A 1RZKC 2QQNH 4HBQA 3NA4A 1Z5LB 3GSNH 4G6KH 4G9DA 2XWTA 5KVDL 1H3XA 4NKDB 4NZRL 1G0DA 3ARRA 4JRYE 1TQCB 2R2CA 3RZCB 4WU5B 4U2YA 1S3KL 1KLUB 4P2CG 4R9HA 2GITB 5EO9B 2HT2C 4MB5A 4UV4H 3RWGA 3GMRA 2AEIT 4IMKC 2Y06L 43CAA 2ZUWA 1KPUB 5C0DA 3O3UN 2HH0H 3WO4B 4J6RL 5F7EL 5F7HA 1KACB 2HFEA 1RU9L 4PRAA 3NIGE 2VDKL 5E8PB 3QDGE 1KG0A 4XHJD 5BMFH 4LVHB 4LKCA 5BS0D 2H8PA 4BELD 4NT6A 1KB5H 2NR6D 3K8MA 4U1LA 5L8LB 1DN0B 4C59B 4KMQA 5D7LD 1A7RL 4NQVA 1FE8L 3S35X 3DTXA 3VRJB 2A9NH 1FHGA 3KPLB 4PRNA 2Z8WC 1Q9OA 3PP3K 3BZDA 4EOWH 3PGDB 3SDCB 4F58L 2VIRA 2VZ3A 4TVSa 4WIQA 1FYTB 5FO7B 4YHZH 3RWFA 3UO1L 1NCCH 4N8VB 4MXWL 5DFTA 3CD4A 4RMUA 4O9HL 4NGHL 3IU4H 4F37F 1FDLH 3B9KB 3TYGH 2QQKL 5HPMA 2OK0H 1UZ6F 5C0GB 3LEVL 4NIKB 5C09D 1RZFH 3DURB 4IRJC 3QQ4B 3PIQB 2IBZX 4ZUUB 5HHQB 4U6TA 1U3HA 4LSVL 5C0JB 3Q1SH 5LWYH 4P2QB 3RI5K 5E8NA 2CO6B 3QEQD 3EYUH 4KK8C 4ZPVB 3PWPB 4GJTB 5EBWB 2HN7B 3QDGD 4N1HB 3VI4E 3VFUB 1P1ZA 4JM2A 4PJFF 5DRNA 4PFEA 3LAFA 4G80B 3HLAA 3VXPB 1TVHB 4RMQA 5D7JB 3KPSE 3FQXA 2ZG3A 1BM3L 2R1XA 2GK0A 4LF3A 4OFYA 4JFXB 2ED8A 4Z7UF 4Y4KB 3R0MA 1I7ZB 5HGAB 3KR3H 1NGWB 2R0KL 1BD2E 3QIWA 3BSZH 3D3VB 1JHKH 5DC9B 1LE9A 2H2PD 4TUJB 4OGXH 1CN4A 1P7QA 4R90L 1HYRC 3MOAH 5JW4M 2BFVL 2HT4D 2FD6L 3FONA 1FNAA 1F4HA 5T5NF 4J3OC 3DIFA 4K8RL 3CXHJ 4B50A 2MTPA 4K3DH 1ZA6B 3MRLA 3VFMA 1IRAY 3BW9B 2PN5A 1K8IB 1ZANL 3NFNB 3O81A 3ZDYF 3D0VB 1KLFA 1WAAF 5EBLA 2H26B 4XNQA 4M3KB 1P7HL 2WWKO 1ND0B 5HYEA 1I3VA 4QRPA 5IHBA 4H0GA 5D7KD 4G6JH 2VQ1B 4UUJB 1C16A 2IQ9L 4NZJA 4WI7A 1IILE 5I1KH 2ZOKB 2IH1A 4APQD 1SMAA 1Q94B 2BRRL 4J3VA 1OHQA 2R39A 3SDXF 1OAUH 4CNIB 4ZFGL 4QHMB 3HZYA 2OL3B 5J6HA 2XXMB 3FOMB 1J8HA 5MHSE 2X1WL 4LBEA 1U0QA 4K23H 4QWWC 2D7OA 5I1HL 3O3AA 3KWWA 2R4SH 4KWUA 4M93C 3T1FB 1LNUA 2HT3D 3QHZH 3GKWL 4NO2B 5HI4C 3MJ9A 2VRAA 1IQWL 4KKLD 4M1DL 8FABA 3VG9C 4PJXA 2ZWLT 5CKGA 3EGSB 5TF1H 5EC2B 4K9EC 1EHLH 1EUTA 5CGYC 2YD1A 3CFJB 3RNQB 1M05A 5IVXF 2CLVA 2LV4A 1J05B 3P0YH 1YC8A 5LG1A 4E41E 2NTFB 5CGTA 1D6VL 1XGUA 5HGDB 1CGUA 3Q3GA 3QG6A 3C5JB 5GSVA 2QV2A 2MOVA 3AVEA 3VFWB 3WUWA 2MKWA 1R3IL 1T2JA 1QBAA 4P3DB 4JDVA 4PGCB 5FHAH 3SGDI 1W0VA 3ULUF 4OGYL 1KTDA 2VDLH 3O11A 4EQ2A 5EZIL 2WINA 1X9QA 4HUMB 4NO0D 4FZ8L 1FPTL 2CDFB 5DEFA 1ADQH 3HAEH 5ICXB 4MD0B 4ZTPL 2GFBB 1NUNB 4S10A 1D5XB 4L3ED 2XQBL 4ZFZA 5HI5C 2JK5B 5E08L 4F9PA 1S8DB 4XC3L 2P5WA 2XTJD 3VXSD 4JZOA 4PRIA 2V17L 2H32H 4YQXH 1FGVH 1AXSA 4PRHE 3ZKXB 2GUOA 4YBHA 3GSOA 3LKOB 3ULSB 2HVKB 4LLDA 2YUZA 2HLAA 3D39E 4J12A 2H2SC 3QEQE 5JW4Q 4ZOEA 4G9FB 2OLDA 2ESVA 3I6KA 4PJCB 2FX9H 3HC4H 2ZCKH 4WNQA 3EO1B 1TITA 5D1XD 4J1UA 4L8SA 3AS3A 3JVGC 5E6ID 2NQCA 1CT8B 1IFHL 1JGEA 5EBMB 2W91A 4Z7UA 4XNMA 4LNRA 4HZLB 1WLHA 5DJ2A 3X3FL 3QUXA 4NKMB 4NQEE 5CAYB 5F9WC 2R2EA 5IMLB 4HF5L 1S7TA 2R69H 5FYKL 2EDRA 2WMPA 5CD3B 3RUGF 2AS5M 4KZDL 1A5FL 1P4IH 3LKQA 4F7MB 4UAOC 4ZYKB 1DANU 3DX7A 4APQC 4ESKA 5TQ2H 2HTLD 2VLJE 3SE4C 4DTGH 2VAAA 4JY6B 2K7PA 5CWSB 5FAAA 1U8NA 5F3BA 5I0ZA 3K4DA 1MQKH 5I1KL 3KPQA 3BKCL 1G9NH 3UTPD 4YAQB 1G0XA 1YYLH 5I1AB 3PGFH 4ACPA 1O0VA 4O4YH 1V5JA 1CQYA 3RAJH 3D69B 3S96B 1SVCP 3NN8B 3HPLA 1WISA 4JQXC 1IEHA 4PYHA 1A7PH 4G80A 2YD3A 3QP3A 1JPTH 3MLSH 1AJ7H 3K2MC 4DKFL 1QFUL 1XAUA 2P8PB 2VLRD 4X99A 3I2CL 1N8ZA 5MENB 3PQYD 1I9JL 3P4LA 3ARGA 4XVUC 1A8JH 2A6DA 5C0DB 5JOPD 1FV1A 3QI9A 5TH2B 1GOHA 3DRQA 4FABH 2P7TB 2NY5L 3X17A 1MAMH 2ARJB 2W0KA 3MGTA 1I3UA 1NDGB 2VQTA 1IGJA 4R26H 1X5HA 3O0RH 1NAKH 2X41A 1VFUA 4XNUL 5B8CA 2XFXA 4PLJD 1BAFH 2V6HA 3MFFA 4Y5XA 2NY2D 2Q6WB 1N4XH 1MVUA 3HR6A 1ZLUH 2DF3A 3LPGA 4XXCC 3N1PC 4LLQA 4KKBC 4JN1L 5TQ2L 1EEYB 4CW1B 1TZGH 4MA8L 3GNMH 1T1WA 1ND0A 3K1DA 3V79C 3WEXB 5FYKE 2WWMD 3VRJA 1UWXK 4YXHH 2JIXB 2VLRA 2WV3A 3FT4B 3Q6FA 5HDOA 4LLWA 3QO0A 3FB6B 3TBVA 4OZFH 4AIZA 1FIGH 1I3RA 4YO0A 1UG9A 2DQFA 3CFIC 4B53A 4HIXL 5DTFB 5AD0A 1GGCL 1IM3B 4JRXE 1K3ZA 1DTUA 1M7DB 3CSBA 4X6FA 2ICWI 5J1TC 1CFTB 3DVNA 4OFVA 2PTTB 4R96B 4S2SA 3ARFB 3QZWA 3D87B 3HZMB 4K7PX 2DKSA 2DB8A 3O3EB 2DS4A 5EU7E 4FABL 2ARWA 2WUCH 3UTSB 4LAQH 1VCAA 3AB0B 5GGVY 3T2NH 5ACLA 2ADJA 2EIDA 3GK8L 5C07D 1AJ7L 4O5LH 3QJHB 2BXZA 4YHNA 4RRPG 7FABL 1B88A 3VD4A 4JM2B 1ZVYA 1MCKA 3CMGA 1ZANH 2VH5H 3I6KB 4PJCA 4XCNA 2VQ1A 5J1SC 3MLVL 2GK0B 1NMCB 3MGOA 4PRPD 5D5MA 2FD6H 4BM7A 1S7WA 3FQRA 4J6RH 4JANB 3IVKB 5CJXA 5B39G 1CDCA 3VG0L 5DT1L 3GUTA 1N4XL 4PRHA 4U1IB 3V4PL 3T1FA 1INEL 1NCAH 2P45B 1W72B 3A6BL 4Z9KB 1JHTB 4JFPA 3VFOA 1KB9K 4JVUA 1KIRB 2H1PL 3UBXI 1CQKA 1Z9SA 2JELL 2QL1A 5JHLH 2P8LB 3QIBA 2CPCA 4M8VA 2DQJL 1RJZB 4Y5YB 4G8FB 1DBAL 4MZ2A 1GC1C 3EOAB 2Q7NA 2UWEE 3DJ9A 4NKOB 1FG9C 4KK8D 4H1LH 4YHIA 3M17A 1A3QA 5J6GB 4ZS6C 1OGTA 1P7KB 3T0EA 1J5OH 4JKLA 1U3HD 5I71B 4D9LH 1A6AA 5GS0C 1FAKT 2V17H 3S35H 1FC2D 2XKSA 3MUGB 3RAJL 7FABH 1GIGH 1I75A 4NQCD 4O5LL 2DBLL 1SJEB 3U0TA 2YHGA 1WCBB 4GQ9L 4N5ED 5ADPH 1V3KA 5T1LD 4PRPE 2D7TH 3MQIA 4WO4D 5IFJA 4HK0B 3DV6B 1A1OA 1FP5A 1T5XB 3KYKH 5FUZH 4GS7C 3QIUC 2NLJA 1RIVL 1JK8B 4P23A 5FKPA 4DKEL 1FZKA 1S5IL 1NC2A 4Q9QL 4QHLB 1FVDB 1PZUB 2OXHA 2W07A 3KPQB 5IFAL 1QRNA 4DFIA 4H25B 3E6FB 5FUOH 2NPLX 1ZLWK 3R8QA 5C07E 4HJ0C 3EJYD 3WKNA 5I8KH 3QFDA 1R24B 4P2QD 1X5YA 5F7UA 4R4BA 3OQ3B 2FEDD 4RGNC 4CMMA 3NAAH 3D25B 4LVOC 5KSVA 4PJBA 2CDEB 4AEIH 3G5XA 3B9KD 2N1KA 4ZAKB 3RZCC 1PG7H 1BFOA 1JGDB 1BX2A 3RVWC 1FO0B 4FQIL 2CMRH 4LSSL 3SDCD 4KK5C 3LSOB 4XPBH 1IGML 5DZOA 4NZRH 4WI3A 1BEYH 4R7NA 5TQ0L 2C1OB 3IDIA 1RSFA 1S7XB 1QSFE 2YPLA 4RCAA 4PP2B 2VTFA 4QRPD 2YEZB 3NIFF 1ZT4B 1A1MB 2FZ3A 3KWWB 3RIAK 2Z35B 2ATKA 1IGJB 2YA1A 4GMTH 2BNQE 2IPKB 4ENED 3HNSL 4IBLT 3DV4B 2R0WL 2YS4A 3B5GA 3GHEL 5F71A 4LSPH 3UTSA 2KBGA 1KNOB 2Q6WA 5E2UH 5ITBH 3ZHDA 4CJ1A 1FNEB 4UT9H 5JXEA 1Q72H 1I9RH 3G5ZB 3JTSB 3VXNA 3ALXA 4X4ZA 1HK6A 3ESVF 4PV8B 5E00A 4KVCH 4JM4L 5EUKB 4YHML 4YO0B 1BGXL 1XCTB 4OCXL 5JLZA 4LHUD 5D2LB 2AEWA 4OZGE 1S9XA 3WNLA 1TVDA 5BV7L 1KIUA 4JVPA 1KUMA 4HJGA 1MIEH 5I19H 3ZYOA 5JIPA 3MFGB 2VDRL 3ORJA 1W8OA 1FIGL 1TZGL 3QR2A 5GS0H 4LGSB 3H7LA 5GS0D 2A74A 4TTGA 2WAHA 2FHBA 3OAZH 2VLJA 3G04B 5FDYA 3ZT7A 4APQB 2VZSA 4CVXA 4K3JH 1N0XL 3V8OA 4UAOB 5JUEH 5HYJB 1EBPA 3ZDXF 3GGWB 1GGTA 5F7KC 3BE1H 1DDHA 3BKYL 1RJZA 3NTCL 2R1YA 4JREB 2QADD 2OTWB 1QQDA 2PYEB 4HGMA 1RHFA 2FB4L 1YQVH 1A7NH 3WHXA 4I0PA 4JPWH 3WJLC 5ESQA 2FHFA 5HYSB 2WANA 1P5VA 4XNZB 1KXVC 3GUTB 3DROB 1BVZA 4GSDL 3MRDB 4MNQB 4ZUVB 4M7LH 3GMMB 4QTIL 5DQ9A 2DLFH 1YEKH 3MA7B 3PNWA 5I16A 5IMMA 4Y16B 5F7MC 3BP6A 4ISVA 5C86A 1AIFB 2I25N 4KROD 4TSBL 5EU4A 4HUWA 2Q86A 4K8RH 4NQSB 3MBEC 4H26B 4LRIC 1U93A 1AFVH 4YHNB 4ODSH 2ZKHH 4NHCH 4TTDD 4PTTA 4ZDHB 4P23C 3W9DA 3WFEH 2EH7L 4XAKD 5EZIH 3Q2CA 2AXHA 3GDBA 3KPSB 4R97C 1EMTH 1FORL 3VXOA 2X4PB 3CZJA 4XP1H 1VENA 3GIZH 2R69L 4P5TC 5FYKH 4JO4L 2DM3A 2WBJB 2Q87A 4YR6B 1MY5A 4PJ7A 5E4IA 4Z18A 5JHDD 1WBYB 3NIDF 1WCBA 4I48B 2AI0H 5TE6L 4OGZA 3NAAL 4N0CD 4I3GA 5E8DH 5KANG 1A4KB 1ES0B 15C8H 4MCYB 3W0WA 5L6YH 4LU5H 4XPAH 5CUSL 1BIIA 1PYWA 5DQJB 5LGHL 3TCLA 1FBIH 5EFIB 4Y2DD 3QPQC 3M17B 3FTGA 1W8NA 4OD1L 3MRHA 1I7RB 3TFKC 4F7EB 4XWGH 2X4UA 2XZAH 5E56A 2YA0A 1IKFH 4JFEE 2DL9A 3MJ7B 1KNOA 2GHWB 3ROOB 2MSPA 5AYQA 5IB3A 4G6FB 3MRJA 1KV3A 4YGVB 3RWHB 1A7RH 5BV7B 4X4ME 1CFQA 1HOCB 3U46B 3V5DA 4YJZL 1CE1H 3JZ7A 1OL0A 3M8OL 2V2WB 4HJGB 5GGSA 1HDMA 3G08A 5E2TL 5CBAB 2Z91B 4RAHA 5EU5B 3P73A 5E6IB 3SDDB 2Z31A 3BMVA 4YZFE 3H9SD 5J89A 4MDJB 2AEQL 4CVZB 5FO8A 4E5XA 1YDPB 4HCRL 1UB5A 2AV7A 2D2OA 2CK0H 4MNGB 3MRKB 2WQ8A 1LO3L 2Q76A 3FT3B 4KJQD 1U6AL 5GRXG 2FECL 5DK0A 1FNEA 3V6OC 2JLLA 1YPZA 3C09C 3VXRB 3MUHL 5J1AA 1RAMA 3H9SB 4HXBH 4PJBB 1MNUH 4P2YA 1TETH 4DGVH 1JPST 4YHLH 1WV7T 3QIUA 2EKSA 2EXYC 3ZKNC 5HGAA 5I15L 3IDYC 5INDB 4GAGL 2V2XA 4XWOD 1MCWM 3D3VE 1UM4L 4M7KL 4MJ6B 4ONFL 4OCSH 5F8RC 3O6FB 2PTUA 4HEPG 5EUOB 3RGVB 3MBXL 5F93C 1NUDA 3B9VA 3MCLL 1QPPA 4ZPTA 3H0TB 4YHPA 1JE6A 1JWSB 2NY0C 2ORBH 5IMOA 2X1OA 3CH1A 5JLZB 2FYYB 1NAKL 3SE9H 4N8CL 5I18H 1A9BB 2XPGB 4K9EL 1IM9A 4JO2H 2CKBB 1QVOB 1FLRH 1QG3A 1IT9L 3DI3B 1XR8A 3QRGL 2XN9E 4PGJA 2OJEB 1I8LC 4TTDC 4WW2C 3TPUA 3NZ8A 3OJVC 2BY3A 1HILA 1MRFH 4Y88A 4P9MH 3MRRB 8CGTA 4Z7WF 1MWAA 3BZEB 5CEYA 1B3JA 4BSVB 4WFHD 5F7DB 4R4BB 1R3JB 3JV0A 4I1NB 1CXFA 3ABZA 4XZUB 3OKMA 5D7SL 3SDAB 3D85D 5HI3D 4PRNB 3TN0C 1TJHL 3EJZC 3B8SA 5IMKB 3RGVD 1I8MB 1OAZL 3GI8L 2X4TB 5CSBA 5C0CB 3P4OB 3O6LL 4JY5L 5H35B 4MVBC 4NCC1 1CBVH 4S1QH 4PJIE 3U30B 1PLGH 2O5XH 4NN7B 3EJJX 4Y8AA 3DV4A 3GSVB 1J1OH 3H7BA 3I6GB 5L2KD 2VNCA 1HSBA 4V1DA 3TZVB 2EXWC 2I9LB 1T21B 5JW3L 2AJSL 2JJTC 1TZIA 4NDMB 3UEZA 2X09A 4POZC 3FMGL 4JFHD 4X6DA 3TC9A 1BM3H 3C9NB 4HG4J 3P4NA 3LKPA 5JO5B 3BGAA 1X5FA 1XGPB 2I07A 4PJGF 5ETUA 4K9EH 1DQLH 1MUJA 4OQTA 5DHXB 3QNYA 2GAZA 1JYVA 2UUDH 3EO0B 4P46C 2W65A 4DOHE 2FHCA 3WHXB 3LB6D 1NEZA 5DMIH 5IVNA 2WM0A 4QEGA 2GW5A 1N2RB 1KLUA 1HH9B 4WJ5B 5J6HB 4G6AD 3LN5A 3OPZL 5E4EC 5GS2D 1GHFH 5JZ7D 1TCMA 3V7AE 5EORH 4BFIA 2P43B 1I1RA 3REVB 4ORZC 1G9NL 4KTEL 4PTUB 3PWNA 4L29B 4HXBL 4JKWA 2FH6A 3SY0A 3RWIA 5KJRH 1LO4H 2AJZA 4A6YL 1ZA3B 2ICEB 3NCCB 5C0IB 2IPUK 3JXAA 1I8KA 5JW5B 2BOBB 2BSTB 1MCCA 3INUL 3HI1A 1NH6A 1EPFA 2JJSA 3VFUA 1EHXA 1QHPA 4JDZB 4ORGB 2BVPB 4I2XE 4YDIL 5EIQA 4UILL 1T7VA 4JGMA 1C5DB 1R3KB 4EI5B 2HH0L 4MJ6A 3SPVA 1G7IA 1HHJB 4YGVA 3OXSA 2P44B 2HVJA 3QI9C 4JFED 3MV11 3X14A 4UV4L 4LEXL 3VXUE 3MV9D 5FDWB 1FCGA 2E6QA 3OZ9L 3T1WA 3V6FA 4XPGL 3GKWH 3WNNA 4L8SB 4HS6B 3KLHC 4QGTA 4JDVB 4JQXA 2Z9TA 4E42B 1OAXL 3CX5K 4K7PY 3UBXA 1H3GA 3QPXL 4MNGA 1BQLL 1LEGB 3AAZB 3CSYB 3VWKB 4DWHA 4MAYB 4MDJA 1OTUD 1KJVA 4HFWA 5J11C 3MLRL 4HUUA 4HDIB 1K2DA 4IMLB 5C70A 1XR8B 3QDJE 4ZPVA 1FVEB 2PETA 1WFNA 4HJ0D 2IBGA 2JK5A 2XRAH 2DMCA 3ARUA 3QUZB 4XPHL 4JFFD 1ED3A 1T1YA 2CGRH 2CUIA 3KVQA 4YR6A 1AGFB 3AROA 4Y19E 3U79A 1J1XL 1FO0L 1A6VL 1Q0YL 2HAZA 4PGEA 3L5WA 3MV8A 1NSNH 4LLUB 5C7XL 1QEWA 4OJFL 2UY6A 5JPMB 4GXUN 1NDGA 4YHOL 3QZWG 4U1GB 4P3DA 5CJOH 5IW1B 4OLEA 4EZMA 2BNRA 3LS4L 4H8WC 3LPWA 5FGRA 3AM8C 4RQQB 2XWBA 1JGLH 2WBJD 4HH9B 2W9EL 1U8LA 5KAQG 2MHAB 3QUZC 2XI9A 4N0FA 5HYIA 3P30L 3C08L 3IF1A 4WFGE 4LCUB 4D0BA 2C1PB 3C9NA 4ODSL 5DMKB 3C60C 3FB8A 3B5TA 4GH7B 2C3WA 4PGBA 1RY7B 3UPRB 3KPNA 5SWQA 4F3FB 4LPTA 1OP9A 1AGDB 3VWKC 4MQSB 1U42A 3C2AL 1RZKL 1U8QA 4NFDA 3NH7L 4GMSH 4JZJA 4FQQA 4ELMB 3D18A 1MCWW 4ZS6D 2V2WA 4AL8L 4XZUA 1T1XA 3DX8A 5H35A 2IFFL 1UWXH 4G6AC 5ID1B 2R29L 2KL6A 2QJDA 3FMGH 1HINH 2DLGA 5MENA 2VABA 3VXUB 5KSUB 3QEGL 1N0LA 3KAAA 3KDMA 1XIWA 4TNWF 4IRSD 5E99L 1KSRA 4LSTH 2NXYD 1URLA 4P57B 1A22B 1EO7A 3EJYC 1HH6A 2F58L 2XTLA 4OB5H 1A7OL 5DVMA 4FQXD 1KJ2A 5BCAA 4S1QL 4DKAA 5IF0B 4NUJA 3MRRA 5T3XE 3HB3C 1VGKB 2NY6C 1JWMB 4Z6AT 4PY7B 4Q9RL 3RHWK 4NJAH 1B4JL 5MEQB 1H15B 1J05A 3N85H 1R5IA 4NC0B 4XMPL 4RA3A 1S7WB 5FYLL 2BC4A 2YD5A 4QXUH 4XP4L 5IW6B 3HKFA 4GRMA 2WIMA 3P4OA 4PJ9B 5IFHL 3CH1B 2ADIB 2J6EL 3L3IA 2GTZB 5BW7A 1CF8H 2DAVA 3VGFA 2E7MA 4JM4H 3ZTNH 1EHNA 1PKQE 4B7LA 3RKDD 2DQFB 3ZKMC 2YK1L 4M1GL 1X5LA 3UP1A 1PX3A 1CLCA 1QLEH 1SEQH 3NCYP 5GGQL 1TTFA 3H9HB 3P40A 3RU8H 4NWTH 1JHTA 1R3HA 1T22B 4IMLA 2I9TB 4PB9L 2XTJB 2B1AL 4HKXA 1F2XK 3MRBB 1JF5A 5C0BD 1E0OB 1QTYT 4P48A 5KW9H 4QRRE 3LKSA 4LPUA 1NFDB 3ARDB 2DI9A 3MLWH 1GGUA 1V3JA 1G9MC 4FZEH 4OSUH 2RFXA 1UM5L 5IVXA 4NGHH 2OCFD 3BE1L 2MWCA 2HLAB 3VGAC 4KK9D 2LQRA 1G9MH 5D7LB 3ZTJH 1DUYB 1HYSC 4OZHF 4PUBH 5H37G 1U6AH 4OCRH 1HHKB 4Y19B 5EOCH 1ZLSH 2GTWA 2YN5A 4JVWA 4OZGB 4UT6L 5GGUA 3RWFB 5ILTH 3OF6D 4FFZL 3P9LA 1KIRA 4JKPH 4K8RC 4LIQH 4WFHE 3SDAC 5JXEC 1KJ2L 3O6LH 3AMKA 4H25A 4Z77A 4NNPH 3OB8A 2GYSA 3H3KA 3ULVL 1MCDA 2VLLB 4U1MB 2VZVA 3JBG7 4KFZC 3SGEI 1MRFL 3MRNB 1CE1L 5GGRY 2X4RA 4L3CB 4KVCL 1VKXA 4ERSH 4FFZH 1ETZB 4LCCA 5BVJA 1DZBA 1MWAB 4BFEA 5CP7B 3HS0B 1MRDL 1KIQA 3HCVA 3MX0A 3BIKA 2C4FT 3NCYS 2QSTA 5CHNA 1HYSD 4OZ4A 4PJXE 2HT4C 1KEML 4OV5B 4OUUB 5DRZB 2R0WH 3BH8A 4OCWL 4JO2L 5JTWA 1A6UL 2NY6D 1A9EB 4X6DE 3L5XL 2Y72A 4WU5A 1D9KB 3SGDH 1MCJA 1DBKH 3BPOB 4O2CA 4X4XA 4IRJD 5HYQB 3BP5B 4GAGH 3QNZB 4OT1L 4I2XB 3B9DA 3VD5A 3HRZB 2UY7A 3T4AA 2F53E 4LLAA 3GM0A 4ONFH 1T3FA 5CZKA 5L2JB 4CUCA 3ARWA 3FQWA 3VFPB 4PJIA 5H8DA 3HFML 4Y4FA 3OGCB 1I3GH 4QXWA 5ESVA 5JHLL 4M48L 2KZWA 4I3SL 3RWDA 1MJUH 4HH8A 4YDLB 1I7UA 4JFDD 4P23D 5CJOL 1T1WB 1CDHA 3VH8A 3UPRA 2F74B 1FL3A 3FO1A 1UWGH 3HC3H 1C16B 2AJSH 4TPRL 4P9HC 2E9BA 1RUAL 3AC0A 1WZ1L 3O2DL 3QSKB 1JGDA 3WIHA 4XXDB 3WN5C 3IXAB 1X5JA 3CVHB 3OKNA 1FGNL 1XF3A 5J3HC 3GMRB 4HGWB 3M8OH 4OKVB 2XZAL 3LN4A 2D7TL 2AXFA 5HHNB 1NCUA 2GJJA 1BFVH 5FKAB 4ZUWA 4OZIF 4ZAKD 4TSBH 5F89A 1RZGA 4D94A 3OPZH 5B8CC 2KDGA 1LWRA 1A4JA 2E6JA 2IAMA 1MI5D 3SHSA 3LD8C 4RFNC 5DFVD 2NYYC 3BQUD 5FA3B 3P4MA 3IKKA 4XPFL 5ALBH 3QG7L 4X9GA 2BY2A 4N9OB 1B0RB 1D9KC 4XCNB 4OSUL 4P59L 3FHAA 4D0CA 3QWRA 1MPAL 2ENSA 4TULL 1XEDA 2P24B 3CFCH 4P46A 4IOIA 4NQED 4RQQA 2JELH 5L88L 3JV6B 2AI0L 5FYKU 3V7AG 3RWGB 4TQEH 1MFCL 4LSQL 1HXMA 3MTRA 1H9VA 4YFDB 1WBYA 4L4TD 2YBRA 3NFSL 5F9AC 4XX1G 3K0WA 4X9HA 2VN7A 3FHQA 5J56B 1EDQA 2CKNA 4P4KA 4XP6L 1YEJH 2CDFA 5DEFB 1HQRA 1RZJH 2JCCB 1CICB 4OTXH 3FQTA 1AIFA 4PRIE 3W81A 4U1HA 3JWOC 2ZNXA 1MFBH 4L4TB 3ZYJA 4H1LA 4MQ7B 3HMXL 3MOQA 4PREA 4PRBB 2N7AA 4I18A 4OCYL 1E6OL 5IEKA 1ZTXL 3QO1A 4UOW0 2WP3T 3QPQD 4NZDA 2G2RB 5DMIL 2QADC 2APFA 4HCRH 5GISH 4K7PL 3CSGA 4ALAH 4C4KO 5DD5H 3RZCD 4LAQL 4LSTL 1XGQB 2X4QA 1FNSH 5I74C 5ECJE 1RUKL 2EDFA 5DDHA 4ZUSB 5EG6C 5DVNA 1OSZB 1MLBB 2W0FA 4H0IA 4URTB 3L5IA 4YXKH 5KS9A 2DQIL 4FQ1L 3R8BB 1A7QL 3F7VB 3ILPB 3KDMB 3ULUL 1NGXA 5I6XC 2XACC 1QBBA 3PGFL 3BUYA 1FNFA 4XNYL 3U4EA 5IUSA 1I8LA 4OLWH 1EEQA 4WW2A 3TCXA 1OF2B 1OGAD 1ES0A 5ALCL 2PO6D 4WCYL 2ITCA 3SE3A 1BWWA 1Y6NR 4OLZL 3ARPA 2SEBA 5HYSG 5DR5L 4OZGF 3HI5L 4MAYC 1AE6H 4LCCB 5BVJB 5GZOD 3O4OB 2ZOKA 1CGVA 1RJLA 4PJ7B 3HPLB 3BHBB 4AH2A 4FG6C 4ZD3H 3MBED 2IANE 4WWKD 5I8KL 1MWAL 1TVHA 3PWPE 4MNHB 5D7JA 1CTNA 3BWAA 2HMIC 5GRYA 3W11D 4P3CL 3VDBA 2RGSA 2Q7YA 1IC7H 3CVIH 1T0MB 1UB6B 3QUZD 3W5NA 2UWEA 3PUCA 3V6OA 1FFNB 4U3CA 3HA0A 1J1PL 4U7KA 2X10A 4UIKL 4PJFE 3VD9A 4MJ5B 2ATKB 5LAXB 2Q86B 1IT9H 3OJDA 4M3JA 1SBSH 4XVSL 4CMHC 3D6GA 2MJWA 1MHEA 2Z93A 3WV0A 2WBWB 1UVQA 5BOPA 4F7EA 2MPAH 1Q0YH 2ZKHL 4NHCL 2YPKA 1WWWX 3OXRB 5K9JL 4ODTH 3IFNH 3HNSH 1K9TA 1GIGL 4J4PA 4LKXA 5DJ6A 5B38G 4BFBD 3CLEL 1LO0L 4UT7H 2V2TA 2CKBL 2AJYL 2XZCL 3FB5B 1IGCL 2DLFL 2QSCH 5IJKC 4TUOB 2Y36L 3C6LA 2C3VB 2O5ZH 5J57B 3SKMA 4EI5D 4ZAKC 1VACA 5E8OA 1KB5B 1T4KB 5E94B 3T2PA 3QXTA 4OIBA 3V0VB 5GSRB 2GT9A 5HYFA 4U49A 4M7ZB 1TLKA 3ARFD 2YC1A 1LHZA 3OZ9H 3HC4L 3CH8A 4RZCA 1BPVA 5FKAA 3O3AB 2FEEI 1P2CA 1BBDH 3PWJA 1TDQA 2C7UB 1U8IB 4MXQD 3QIUB 4GG8B 2ZCHH 4JPVH 3CXDH 3TZVC 2JIXD 2P8PA 5DEGA 5M95B 1X5IA 3KXFA 4G5ZH 1KIQB 3HCVB 2DMKA 1K4DB 4HKBB 4TN9A 1YN7A 1J86A 1G7LB 5J0BA 5I76B 1MLCB 2D4DA 3QDJB 5JHDA 3D0LB 5KOMC 1BQHB 4ZUSA 1IAKA 3LKRB 3PXHA 4PJ7E 2LVEA 4Z7OF 3KPMA 1VFOA 4F2MA 1XR9B 1QBMH 4U6VH 1Z3GH 3S37H 1UCTA 3G5VA 2A77H 2ADFL 3TEUA 3GMNB 1FN4A 1NCWH 2EZ0D 3MZTA 2J4WL 1K85A 5C0AA 5C0RL 4M6NH 4XHJC 5J4MA 2L4OA 1R0AH 1BVLA 4WV1B 4J3WA 4D2NA 2VXUL 1HZHL 5ITBL 4HGKC 3O3BB 3MJGX 2Z8VC 4Z95L 3L3HA 3T0EE 1LP9E 4FQJL 3MNWA 1K8DB 3REWB 1I8KB 4BZ1H 2DICA 2X4UB 3I3DA 4YXLH 1D5ZA 2YD2A 2ICCA 3MCLH 1N3NA 4G42A 1T0NA 3RUGE 2O5YH 4RFEB 3TBWB 5I1IH 3LH2L 3CLFH 3WHE1 5M7QA 3KLAB 4JFDA 4OGXL 3T4YB 3WJLA 3FT4A 2AK4B 4D9RE 4DGYL 3I9GH 1N8ZB 3GSOB 3LKOA 2YZ8A 3RGVC 3E8UH 2EXYD 3GNML 1ZSDB 2FL5A 1JWSA 4JFYA 4K3JL 5D6DC 3L7FA 1U91A 2Z91A 1ACYL 2HKHH 2IADB 3VU2A 1BD2A 2C3HA 2XPGA 2HT2D 3WIHH 1WC7B 3AFLA 3O45A 1MCRA 4G8GD 5EPMB 2DWDA 3C5ZD 1OP5H 2PR4L 5FYJU 5IR1B 5CCKH 2IBZY 1A6TB 3W9EA 1MHEB 2Z93B 5HXMA 5ACZB 5D93C 1CICA 4AEEA 4MVBD 3VGBA 2ICWJ 3VW3H 3HNTH 5I75B 1YPZB 5CZXD 5SWSD 5T3ZE 2JKXA 3TF7C 4ODUA 5F7WC 3P4NB 1RZFL 1E4WL 2AEPL 4XH2A 3UZVB 5C0RH 3TYGL 2D0FA 3CPLB 5ESAB 1C5DA 1QFUH 5E6IC 4HIXH 1YECH 1T89C 1UZ6E 1HHGB 4NQDA 4K8RD 3VW3L 3SE9L 4B5EA 1S78C 1NGYA 1CR9L 3G08B 1QRNE 2E9JA 1E27A 1EFXB 12E8L 5C0NC 5C6PB 4NC2B 5C08D 5C0FA 5AAMA 3WSQL 4BK5A 2H32B 3VI3F 1AD9B 3IDMA 1F45A 4PRAB 4JM2D 5KSAA 4IEFB 4OGAC 3RL2B 5GIRA 5B22A 1QZ1A 4JY6A 1IFHH 4F33A 2SEBB 4RDQF 1E6JH 5SWZA 2CRMA 3CDGB 4MJ5A 1GZPB 4MA8H 1FVCA 1OF2A 5DUPH 4XNUH 3MV7D 1A2YB 4OCNC 1C08A 4HLJA 1X7QB 4M6MH 3NCFB 1OARL 4NQXB 2W9DH 4NZUH 1AHWA 2HFTA 2VKXA 4Y5XB 3MREA 4NN7C 4UB0H 3T0DA 2BOCA 1ZWIB 4HK3J 5HJ3A 3DBXA 4PPTA 3RKDC 1M6OA 2W0FB 3EO1A 5D5MB 2DQCH 2KKQA 3MGOB 1E4WH 4NNXA 2EYTA 2R0ZH 2XQBH 1I9IL 2EH7H 1KLGA 2P7TA 4JO1L 3TN0B 3UTQB 1MHPH 2HKFL 4N0FB 1NCNA 1SYSB 1F6LL 4AT6B 2I5YL 5JOFA 1QKZH 3GMPB 5ANMB 3S6CA 3W5MA 1NC4A 2COQA 3BIBX 3S5LG 4HMCA 4JHBA 3OR7B 1YMMD 3S35L 3ZMRA 1MVFA 2B39A 5IB4A 5JPNA 5HDQH 5I2IA 2XY1A 1CL7I 1CL7H 4KRPB 4LK4A 2IPTH 4QF1B 3GBMH 3TIDA 1U8PB 1FFQA 2AK1H 4NO3B 1Q8MA 4DGYH 2XN9D 1GZQA 1MCLA 3RPIB 3Q5OA 1NCDL 4I0CC 5SWQB 3BP7A 4GG6B 2GCYB 2NXZC 5F9WB 3JV4A 1WF5A 3VWJA 1RK1B 1RIHH 3DX9A 1C5CL 3DMMA 1T1XB 4WDIA 3CIQA 2VDKH 1GC1L 1SVZA 5DUPL 1IQWH 2EDQA 2V2TB 1ZT4A 2OMNA 4ENEC 4TVPE 1IKNC 5IOPB 2W9DL 4NZUL 2B1HL 4CADB 5L0QC 1GOGA 3I3EA 4R7NB 3LIZL 5D2NE 2BSRA 1UENA 1K3IA 4ELKB 3V2AR 1NEZG 1VGKA 4P49A 5TDNB 2LU3A 1GXEA 2FDBP 4OLYH 4DN4L 9CGTA 4WGVB 1P2CB 4YHYB 4K7FB 4OT1H 1INEH 5FOJA 5EOTA 4LCUA 3VXNB 2R23B 2NY5C 2DD8H 1G1YA 1CICD 1S7QA 1C5BH 1XH3A 2AP2A 2VUYA 4HKXB 2QQNL 4PG2A 4XX1E 5IBLD 2IEPA 4Z7VE 3M45A 4RMWA 3QH3A 4OZFB 3D39B 4H1LG 4OF3A 1ED3B 5DJDA 4ZDHA 2BSSA 1YEEH 5D7IA 3SPVB 4K94H 2PYEA 3VRLF 5T3ZH 4LF3B 5GRUL 4U6HA 1CGWA 1OAUL 5T1KA 3BYTA 4NKDA 1QYGL 5BV7C 5JPMA 3B2VL 5F70A 4BSJA 1Q72L 1U95A 2GTZA 1DBML 2GKIA 5KVFL 1AQKH 4ERSL 4F2MB 3C8KA 4UMGA 2PYED 3QDMD 5D6CB 2QQQA 5I1CL 4V2CB 3VFVB 3MA7A 4DVRH 4KROC 5IGXL 2DQDH 1BQUA 1CG9B 1MFEH 3V95A 1T03H 1RJYA 5D96C 3VJ6B 1WWCA 2VLLA 2J1KA 2HKHL 3U9UA 2BZDA 3RVTC 3FO2A 4HUXB 4MXVE 1A47A 1ZHKB 1U8KA 3LQAC 4YBLB 4EUPB 3N06B 5FA4A 4PJ7F 4Z7OE 5TF1L 4RFEA 2PXYC 3TBWA 3X3GH 4DGIH 5F6HI 1OCWL 3KHOA 4A2MA 5C8JB 4KJWD 1JZ7A 1QEWB 5GS1A 3RQ3A 3NPSC 4QRTB 4DZ8A 4NRXA 2WBJC 1YMME 3HR5B 2YD8A 3W11C 4X6EA 1NBYA 1IAKB 2QQLL 2EECA 4HK0A 2VXVL 5KW9L 4U7MA 1JWUA 4MA3B 5DQ9B 3NA9L 1F4AA 4TSCL 1OY3B 5GJTH 2X7LB 3TVMA 4P2RA 1FZMB 2FX8H 1YN6A 3MCKA 2ZCLH 3HE6A 1LDPL 3MLSL 4DKFH 2J4WH 4ODWB 3SOBL 5LKNA 4U1LB 1KB9J 4ZTOH 1ZT7A 4MNGE 1EERB 2YK1H 1QYGH 2PO6C 3KGRA 3E0GA 5DJ0B 4QRPB 1XGTA 2RB8A 3QEQB 35C8H 3RVVD 4O9HH 2CSPA 3QWOB 3VGHA 3C8DA 1MFBL 3G5XB 4K2UL 4U6YB 2DLIA 4GS7B 3PWUA 5JMRA 3QDAA 3RIFK 2AJ3A 1MCBA 5DJAA 3DX6A 3F12A 3RY4A 4IIQB 3FRPA 2X70B 3CUPA 3DNKA 3QJFB 2AKRB 4W4OC 2JB5L 1YNKH 5CD5D 1CLYH 4U0QB 1LP9A 5F88A 3QUXB 4NKMA 1O7VA 1CVSC 1N64H 3BYYA 4PY8I 4BQCA 3QFJA 4PRDA 5IKCA 1P84K 2P49B 2XYCA 4MB3A 3MRGA 1EXUB 4N0UE 3K1KC 1L0YA 1MJJB 3ULUH 5DMKA 3BXNA 4MAUL 2DYPA 1AKJA 3O3DB 4MJIA 5E7FA 3RVVC 4BZYA 4PLKC 4S1DC 5DRNB 1MJ7H 2CDGB 3VD7A 3DUUA 4LLVA 1HINL 4PD4K 3W9DB 2P1YA 5T3ZD 4JN2A 1IC4H 4QRUB 3P9MA 3AXLB 3B9KC 3TESA 5F1IA 1ITBB 3D39A 1KFAH 4KJQC 5E24E 2QSCL 2HJLA 4OZFG 3BP7B 3OKNB 2APBA 1FGVL 3SBWC 3ROLA 5I1HH 4D9QD 5EN2A 1NCBL 3F8UB 2PW2B 3SDCC 2H41A 3GSXB 3OG6B 1NLDL 2UYLB 5E08H 4LOUD 3NGBC 1D5BA 1QFPA 2ARJA 3S34L 3B3IA 3IFOB 4LHUG 4WNQB 1XF5A 3GSNA 3I75B 3CX5J 1XGRB 5DHVA 1MF2H 1KCVL 1XZ0A 4XI5C 4ONHA 3NACL 3U9UB 1WIOA 1QFWL 1I7TA 5EBLB 3QQ3A 3RA7L 3CVIL 4MJ4A 3K81A 3RWDB 2BXYA 2BCKA 1I9IH 3OGOE 5JIKA 4KRMB 1Q0XH 4JG1L 2VQUA 3BW9A 1BZ7A 3OKOA 4Y5VC 1VKXB 4DW2H 4G8GE 3U1SL 4MJ2A 4LLQB 4MMXC 4QOKE 3WKMH 4ZSOB 3S36L 3F6LA 1T2QL 4JEGB 4HWZA 3QH3B 4N90E 1EHLL 1VFBA 3OKKB 5C7XH 5BVPL 5FGCB 4C56D 2BNRE 1I1AC 3IJSB 5IMKA 1G9NC 3CDFA 4LSUL 3J8F7 1TQCC 3O6FA 1LMKA 4BFGA 4K3EL 1DQDH 4GT7A 1HSAA 1NBVL 3ZL4L 4D3CH 2BVOB 4EXPX 1EJOL 3SDDA 1HEZB 2WIIA 3TO2A 1JTTA 5I1LA 1ERNA 3WIIH 1MH5A 1H0DA 1ORQB 3MBEA 2AJYH 2XZCH 4X5WA 1TQBB 1KXTB 5FXCH 4XVTL 3L95A 4QRSB 1CTOA 1GH7A 4PJCE 4PJDF 3HNVL 1UH2A 3DXAD 1UZ8A 3WS3B 4RGNE 3IS1X 3E3QC 2BHZA 1IAOA 4WW1A 2PXYD 3MOBL 1T0PB 3CDYA 2QHRH 3DMMB 2FJHA 2C26A 3FTGB 1JMZA 3TNMA 1JZ6A 3NGBB 3IGAA 2HVJB 2R0ZL 4X0KB 3PWPD 2A73A 1MIMH 4P3CH 2IAND 4OQTL 1YJDL 2RR3A 1F8TL 4NJ9H 1BMGA 3SKJL 2OZ4A 3BQUC 4LPYA 3FFCD 2HJKB 2CRZA 1YEGH 3GMQB 1CFTA 4JRXA 2DQUL 2X2YA 3ZHKA 5HGBA 5D1QA 2RIKA 2C5DC 5HDBE 4R90H 1BZQK 4YH6A 4M03A 4YXHL 2Y7QB 4WVRA 5FECA 4OLXL 1JFQH 4Y5YC 3QXAB 4O2FA 5JDJA 4ZXBB 3PV6A 2J8UB 3BD3A 1ZGLA 2DLEA 1N7MH 4U31A 3HAEG 4UDUA 4Y2DC 2YA2A 3C87A 4N0RA 4TULH 5D1XA 4I18B 1S8DA 4PREB 1CU4L 2WWKT 4X6CA 1JNJA 4U1NA 4NM4L 2DTML 1AGBB 4YPGA 1N59A 4L3AA 4U6YA 4JPKH 5LWYL 4F7TA 2MMXA 4IDJH 1FYTE 4HWBH 3H0TA 3DYPA 1NMCC 4FQHB 1S5HB 4YIQA 1G7MA 1DEEB 3MXWL 4BZ1L 3GRWA 3BP4A 3PGCB 4UQ2A 2H9GA 3UPAA 3QEHA 25C8L 4GW4B 4JM2C 3N1MC 1BFVL 2NNAB 5LCVL 4ELKA 3ZKXC 1T0MA 2Q8AH 4AK1A 1XMWA 2D7QA 1FZMA 2X6MA 5DO2D 1G7QB 4W68A 5HYJE 2NY4B 2OR9H 4X4YB 1GPOH 4NRYB 2NW2A 2BVEA 1EVTC 1JZ8A 1SY6L 1QVOA 4MXWH 3PDDA 1EEYA 2YUVA 4Y4FD 4CW1A 4PGBB 4MQXC 1FE8H 1UGNA 2D31A 1II4E 4AH2B 3OHXA 4NRXB 4QHKI 4DTGL 3VH8B 4K94C 1G9ML 1JV5A 5J9PA 3V6FB 3EOAA 2BRQA 2HWZL 4D8PA 4JHZA 3MLTB 1KXQE 1QSFA 2YPLE 3B8YA 3RKPA 4G9FD 2AQ1A 5FGCE 3QJFA 3L7EB 3VI3E 1PSKH 3WCYA 2I60H 3NPSB 3P11L 4ZO8A 2BNQA 1UC6A 4A6YB 1A7OH 3EFFA 4PS4L 2Q7YB 5SWZE 5D70H 1PG7X 5EBGA 1NGXB 4NRZB 4KUCF 4LSRL 3ZDYE 2IPUG 3JWOH 1IM3A 3TH4T 5FIEA 3BPCB 5GGVL 1XGRA 2F54E 4JFZH 4YBLC 5FYLE 2R0LH 3HUJB 1CGYA 4G6KL 3MCG1 4NUJB 4PJ9D 1C7SA 3DRTB 4HLZH 3HE6D 2AGJL 1NGPL 1LO0H 3VG9B 4PJIF 2OMBA 4K23L 4NO0B 1R3LB 1BVKA 5D96B 2ID5A 1BJMA 5HHOE 4PBWD 1DBKL 5GRVK 3QRFM 2HJLB 3RJDA 3NVQA 4KROB 3QJHA 2OR7A 3EDDA 2APWA 4TNVF 3P9MB 5CJBA 3MJ6A 5FM8A 1I1YB 2AVGA 1XCTA 1BLNB 5H2BB 1MCIA 1UJ3B 4LVEA 2F8OA 3EYOA 5FHAL 3FN3A 4AIXA 3RDTB 2A6IB 1QFHA 4QWWD 3IDIB 2NW3B 4DAGH 1DFBH 1H3PH 1CD1A 3ISWA 2B0SL 3WYRA 3EHBC 3GJFK 1HHHB 2VZTA 3GI9H 4AZ8A 3G5YA 3BISA 3IT8D 1FJ1A 3ZO0A 4KC3B 1A3LL 3V6ZB 4AEHH 4NNYB 1RUPL 4X5WB 4UT6H 2BOBA 2BSTA 1FL5B 4BH7B 4L8BA 2DI8A 1K4DA 3C5ZA 4YHYC 1LO4L 4GW5A 3O8XB 4EEEA 3GEWB 2AJUL 1KJ2H 1Y6KR 3PQYB 3QFJE 3QBTB 1DN0A 2NX5D 1SM3H 4KQ4L 4IDLA 5EORL 3VWJD 1CGSH 3KPPA 4YHIB 5L0QB 3PWUB 1YPZE 2VDQH 1G7LA 3O9WB 4P9HH 2AGJH 1JPGB 4U3XA 3JTSA 3LKNA 3V4UL 2WSKA 3OV6A 5I8CB 3WD5H 3ZKQD 3BDYH 5CLTA 3RZWA 2DQHH 4NM8H 2FBJL 4LQ1A 3MLZL 2GSIA 4C57C 1QFWI 2V7HB 3TPKA 5ANME 3UJTH 3RIAF 1A6WL 1S7UA 3QHFL 4XP9L 5KVEL 1EIBA 1UXWA 2XKUA 4PP1D 2H6PA 3G9AB 1JGLL 2YPLD 1WT5C 2A1WH 4XNXH 1MFNA 4OCWH 4H26A 4UDUB 3DSFH 4ODHL 5C0BE 3LKPB 3IFLL 4ZXBA 1KPRB 2ADIA 4FQXA 1QLFB 3OXRA 3FQXB 4Q74A 3SGEH 4HIHB 3GRWL 3KS0J 5GGRB 4POZD 1KC5H 4A2LA 3SJVD 3U7WL 4K3DL 1XF1A 3KLHD 1CS6A 1CBVL 1GPOL 4U1JA 2BNQB 4NOFA 5TE4H 5GHWH 2WW8A 2PNDA 3H42L 4Y1AD 3M1BA 3OX8A 1RMFH 2W60B 5KJRL 1QRND 3DVGB 3PV7A 2BX5A 4QHKJ 3PGCA 5KS9F 1OTTD 4QO1A 4Y5XC 1UM5H 3GJFB 2IQAB 4OTXL 4OLZH 1JGVH 2ATPA 2ZSVB 3HE7B 1KCUL 2VLJB 1UKSA 4MLIA 4P5KA 1B9ZA 1JK8A 2D31B 1ZHNB 5CZVH 3K4AA 3QUYB 3UTTB 2VZUA 1OAQL 1BOGA 1OGAA 5HD8C 3FB7B 1XF2A 2F53D 1MFCH 4M93B 3CK0H 1EEZA 1S3KH 2YSSA 4EIGB 1DN2A 1ZKAA 5HGDA 4LPWA 4FQQB 1AD0A 1R3LA 3MODH 3MLYH 3G6JE 3O4LD 4HXAL 4HKJB 5C2UB 4JFDB 3LEYH 5E8EB 3TVMC 1EJ6A 5K9OA 3I6LE 4U4BA 3BGFC 3N1QC 4K7PH 3RU8L 5E5UB 2FGZA 2ARJQ 4I5BB 3LQMA 2B2XH 3DURA 4EKXA 4P57A 4RGND 3EYOB 3FFCE 3T8XB 1W2KT 1HCVA 3T04D 4LHUA 4PGCA 4FMKA 1MREH 4NQCE 1AO7B 5SV4A 1JP5A 1KT2A 4S0TD 3FAWA 3S3PA 4PGDB 1ZS8B 2OZ4H 5BRZA 4NBYB 1PYWB 5HSFA 1JBJA 4HKZB 1F4WL 5IQ9B 2FO4B 1KTLA 4PJEA 1QO3B 4KK6C 5D93B 2LU4A 1FYHB 4XMPH 5FYLH 3C8HA 4TUKH 1A0QH 2DQTH 3RP1A 1OLZA 3PWPA 3IDJB 3X12A 2QHRL 3H3PL 3MRQA 5C6TH 3HI6L 4OLUL 5FOBB 2HMID 1QSZA 2CR3A 2F8VA 3O8XD 4LIQE 3IDGB 3FJTA 3WNKA 3TNNB 3WNMA 2WBJA 5IB5B 4F7CA 4QGYA 2CIKB 5E1AB 1A6WH 3TP4A 2DTMH 1QD0A 3L9RB 3QUKB 4RGMC 5CS7A 3L3JB 3NZHL 2DIJA 3LQAL 3TA3B 3BVNB 3JUYA 4OKVA 5DMGD 1PW3A 1Q38A 4I13B 1RK0B 1UM4H 1UXSA 4M7KH 5DVKA 1KEGH 1WZKA 5HYJA 1N26A 1ZT1B 3U4AA 4HUVA 2W9LA 1PFCA 5E95B 3WD5L 5L7XL 5IB1A 3RGHA 1BD2D 4FQLL 1HIML 1FZJA 3LQZA 1ZHKA 3ILQD 4HV8B 5TE4L 2DRUA 3JWDC 5C3TA 2DQEL 1J8KA 5KBNC 4DGVL 4PJBF 5D7SH 1M71B 1HNGA 3HG1D 2EYRA 5HHPB 4XB7A 1V3MA 4NWUH 3LEXA 1A0QL 2DQTL 4OIIL 2VSCA 1WFTA 1RUPH 5IWLA 4QHNA 4D0DA 4Z78B 1JI2A 1Z9MA 5T1LA 5B3JF 3HRZA 4MA7L 3SO3C 1DUZA 1MJUL 1KYOK 3EOYG 5CEZE 2DQEH 4OV6F 3VWJC 2XFXB 2R4RH 4OZHE 3TO4A 5LGJB 1I1FA 4XMLH 5FFLA 1A1NA 3A67H 3TVMD 4K7FA 3GSWB 4R6UA 1WBZA 4ZYKA 5CEXA 4N0CC 3PQYA 1QR1A 3WO4C 2XNAA 3C6LD 4GQ9H 5ADPL 3UTZB 3QAZB 3CSPA 1ROWA 1U93B 2Y23A 5AUMA 5DRWB 5ISZA 2P24A 4ODXA 2LVCA 5IEKB 1O7SA 4ZFOA 4XWGL 3F65A 1S7RA 4NN6B 4KY1H 3BHBA 3VFNB 5K93A 4W6WB 2FCBA 1D5IH 2VXSL 4MAUH 5EZLA 3BPNC 4NWTL 1KGCD 2V9QA 3IDUA 2JIXA 2VLRB 4UB0L 3AY4C 1XF4A 1M1SA 1LO3H 1A7NL 5IEHB 1FNGA 5KVMC 4LDEB 2NY2C 4FNLL 1NANH 3AU1B 4PRPA 3WUWG 1S7UB 3VCLA 3T0WA 3VFRB 4CRPA 3BKYH 4DUXA 4F7MA 3MRCA 4H88H 1AO7D 3CDGA 4CMHB 5AZEL 3O3EA 2OQJA 3TM6A 2FIRT 2KUTA 3TH2T 2MCG1 2A6KA 3MJ8B 3O3DA 1AKJB 4MJIB 1N5AA 3WSQH 2ESVD 1MUJB 4HT1H 5SX4H 3S8WA 4PG9B 2K1MA 4HBCL 4LCWD 5TGBB 4HG4K 4GOSA 3JV5A 4RAVA 5ILTL 4FRWA 4X9BA 4Q9RH 4OM0H 3FB6A 3TBVB 1FNHA 5I1GH 1QP1A 3ARGB 4XCCH 4HFUL 3FB5A 5T5FH 1A6PA 2P5WE 3WLWD 1A14L 1RULH 4O51A 5E1HB 5HVHC 1D5MA 2FATH 2B5IB 3RUGA 1CFQB 1HOCA 4G3YL 4OQTH 2ADGB 3GB7A 3KPRB 4NP4H 5J12B 1N6VA 3UYOD 4LL9A 3CSYA 1U8HB 2ITDA 4LCCC 2V5SA 1EO8L 5INCA 4CL7A 4EIZC 3KJ6H 4LHUB 5F3HB 4PJ5E 4JJ5A 3VXRA 1A6ZB 4OI8A 3MR9B 2R23A 4R4ND 3VXSB 3I85A 3STZB 1YEHH 1WGOA 3QIBB 2P8LA 3CFEA 3O2DA 4GKNB 3WIHL 4HQQL 3FOLB 5H94B 2FB4H 4JO4H 1N7ML 1HHJA 2Y9RT 1N64L 3OWEA 1OP3H 3BZEA 4DN3H 1VFMA 4HKBA 1F5WA 3U7YH 3DYMA 3GBLA 3E2HB 4HIJA 2Y5TA 5DHVH 4XNMB 3WIIL 4HWEL 4OLXH 1HDMB 3ZE1F 2DL2A 3MNVA 3F7RA 3TNNA 1T89A 3MRIB 1MCOL 1EXUA 4MX7A 4QLRA 4KK5D 1CGSL 3VXME 5C0EA 1YDPA 3T4AB 5A43C 3CDCA 4Q2ZB 4DCQB 3KG5A 4JB9L 3TBTA 1MNUL 1HXYB 4ZUWB 1HE7A 2CJUH 1AQKL 4FFWD 1MH5B 4WI6A 3BKMH 4JFQB 4Y5YA 4QRRB 2AXGA 1G6RA 4ZNCD 1YNTB 1AP2B 5HPOA 4LPVA 5I73C 4AG4H 4WI5A 1KPVA 2GJZB 2LE9A 3IFPB 4MXQC 1KJ3H 2ZUSA 4EVNA 4RAUB 3OAUL 3GSQB 4DKEH 4ZO7A 5DUML 5D8JL 1MFAH 2HJFB 5IB5A 4IS6B 4X7SL 3FQRB 5TPWL 1IAMA 3B6SB 5MEND 1QFOA 1RUMH 2P5ED 4AM0B 3ARBC 3NCJH 1EBAA 1MI5A 4GUPB 4TUOA 4FQPA 2H2PC 1MCPL 3L7FB 3MYZA 4IM8A 3S5LB 4NBZB 2AJXH 3KXFD 1DQDL 2DIAA 3SEPA 4ZQKA 1FFNA 1AR1D 3KPRE 4GAJL 5DHVB 4GFTB 4XMKL 3LDBB 2Y7QA 5D2NA 4LASL 4M7LT 1U3HB 1I1FB 2NX5A 1ZT1A 5L8KB 5MP6H 3TO4D 2A83A 3L3OB 3DTXB 5CJ8A 4MNQD 4LSRH 3LPFA 3SGKC 2CRYA 3BAEL 5IQ7L 1FO0A 1LP9F 5DD0L 4KGJA 4TYUA 1I1AA 4E0RB 5EU6D 3QWRD 4O00A 2E9IA 1JJUA 1AY1L 5FUOL 5MI0B 3C6LC 3OB0H 1JWUB 4FQ2L 4MA3A 3C6SA 2UWEF 3SBWA 3HNVH 4JPIA 3VWKA 3WJJC 3BKJH 3KYKL 2APVA 2ZNWA 4JZNA 3VXMB 5L2KB 3QYCA 4D0BB 4OKDA 5I73B 3MR9A 2VLKB 1F90H 5BOZG 4KKAC 1SY6H 1CIDA 4C58B 3LZFH 5I1EL 4MHHG 5IQ9A 2DQCL 2OR9L 4M6OL 1WEJH 2HKFH 1SYVA 2Q8BL 1IM9D 1KTKE 1JHLH 1AGBA 4MWFB 3LIZH 1H5BB 3ULUE 3DSNA 4JFEB 4QRQB 4K3EH 5EU3B 4J8RB 3KYAA 3MUJA 3E6HA 2AJ3B 3JWOL 5D7LA 2FJHB 4AEFA 1MCSA 5IROA 3WIFA 3QDHA 1OP3K 3P77B 1YEFL 1S7VB 3LSOA 4J4PC 2WP3O 5F6IB 1DUZB 1MLBA 5KS9B 1G6VK 1OQXA 3QIWB 1IQDA 5JW3H 3QDMA 1LEGA 2H3NA 1E27B 1EFXA 5ICZB 3P9WB 4L29A 3IKCB 4OAWA 3L3GA 4PS4H 3INUH 5CILL 2MHAA 3GMMA 1A64A 1CXKA 2P47B 1ORQA 1ORSB 3T65B 1CL7L 5T1KD 5IB2B 3OJDB 43C9A 1CFSA 1E4KC 2Y4SA 2XQYG 3MV7B 3SN6N 1FH5H 3ZT5A 2C7UA 3EYVA 5E8NB 1JZ4A 1HHIB 4LDOB 4H20L 1BGXH 4OCXH 4WENB 3EYQC 5JNYA 1B4RA 3VWKD 5JIHA 3STZA 5KN5A 4TVPL 5IHZB 5JR1L 3D5OF 1JF1A 2G9HB 3FL7A 5FYJE 4YPGB 5CINL 5C0FB 2EH8H 5I30L 5IFJB 2WWMC 4Y4KA 1TIUA 2DIBA 3CJJA 2OJZL 2AEPH 2Q1EA 2ZPKH 2WLYA 5GJTL 7CGTA 3QDJA 2E8ZA 4LQFH 3MRPA 1WCQA 1P7QD 3HAEB 1SBBA 3SKOA 2NR6C 1IC5H 1QBLH 4LDLB 5J06A 4KV5F 1R5WB 4P2OC 5GGTH 1INDH 4D9RD 3Q5TA 5TQ0H 4U0RC 2AERT 1ZA6A 3KYNB 4I3RL 2XXCB 3R0NA 4P2QA 3LMJH 4TRPL 2YXMA 3DVIA 1QRNB 1XH3B 4N9GB 4WO4C 3F7PC 1WT5A 4X5LA 1NUGA 1LEIB 5ICYB 4PGEB 4Z7VB 1F42A 4RAUA 3WJJA 5CEZL 4FXKA 4PJ9A 3FO1B 2PW1B 1T6VN 4YNYA 1KCSL 4M62H 1J8HB 1AC6A 5GS1C 4HIIB 4ELMA 1MFEL 3MO1B 3LMJL 4RMTA 1DL7L 2EC9U 3ULUD 3CX2A 3GMPA 1YEGL 5TE7L 4Z7VF 3WKML 4DVRL 5IGXH 1IEBA 4O2EB 3ZSSA 3VXSE 1EVUA 4J1UB 1DQJB 3RFZC 1CR9H 5E7BA 4Z95H 2RCSL 4KHTL 2AK4A 4JZNB 5I30H 5BVPH 4XPFH 1R5VA 1U9KA 2AABH 4Y1AE 1HKLH 3QAZC 5D2LF 3HG1E 1I9RL 4GRWE 1ZXQA 3RWCB 3QA3B 3BZ4A 3U1SH 4ZUUA 5HHQA 1QBML 4MD5B 1BZ9B 3RPIA 1BECA 5AAWA 4IRZL 4NO2A 2XA8H 3DSFL 4QF1A 1NCCL 1UEMA 5T3XH 1X7QA 3NA9H 3OR6A 1A2YA 3FZUC 1PX4A 3QEUB 1TJGL 4LFHG 5C09B 3EW3B 5LBSL 1FPTH 4FZ8H 1JPFA 2OTWA 3CMOH 4JG0H 2O61B 5I8CA 1ACZA 2A9NL 4HUNB 2BY1A 1QKZL 5EBMA 1T1ZA 4L9LC 4XAWH 1YMMB 4MA1B 4OAWB 5BJTA 4Y16A 2DQJH 5C92A 3C5ZC 4OD1H 3BO8B 1A9BA 5IQ7H 1J0ZA 1NMAH 5E2VH 4ZS7L 1L7TH 2HLFD 4HULB 2ADGA 3C6SB 4YBQD 2EEDA 1VHPA 4N5UA 3NZ8B 4KUCD 2R2BB 3BEVB 4HCRA 4NUGL 5CSZA 3T3ME 2H6PB 1RZGB 3DETC 5B3JE 4XC1L 3H9ZA 5DURD 4NUGH 5BO1L 4C56A 4YQXL 3C60B 2V9RA 4Z8FL 3W39B 2FX9L 1H5BA 2ZCKL 3STBA 3ULVD 4JHWH 1I1CA 2YD7A 3ZHLA 5K59E 3MFFB 1C5CH 4IS6A 4G42B 3A6BH 5GRWA 3CZFB 1XIWD 4LGPB 2G9HA 1FNLA 4AQOA 1GGBH 2P8MA 2R1YB 1LO2H 1TPXB 1ZOXA 3BT2H 4JO3H 4RGMB 4UTAL 3H9SA 3CU1A 5HJ3B 1Q1JH 4FXGA 1VPOH 3IJYB 1LK3L 3DUSB 3U0WH 5ACMA 4NQXA 5ABDE 1OGAE 4MD4B 1QSEB 1S5IH 3P9LB 4RBPH 1NCWL 1KEMH 3BKCH 4IRZH 2HLFC 3FN9A 5IOPA 4UIKH 4QKXB 1AXTL 3PHQB 4Z7QF 4FS0A 2I9LA 2G75A 1J5OL 4JO3L 4UTAH 5HGHB 5IHLB 1SBSL 4XVSH 1QA9B 1KFAL 5DYOA 5ICZA 3V4VL 1M05B 2BHUA 2BVYA 3RX8A 2AJVH 4OLYL 4DN4H 4E5XB 4L4JA 3U6RB 1AY1H 3HMWH 4YAQA 1MEXL 2ZSVA 1CDUA 4L4TA 2NW2B 2EDHA 4ODBD 5C0AE 2J5LC 2E7LA 5IP4A 2QQLH 2V7NA 2JCCA 3L3OA 1OB1B 3RVUD 5ESVB 2RHEA 4JB9H 4JFEA 4ZS7H 2Y36H 3F5WA 1S9VA 4HMEA 4OBRA 4GLRI 3BEWB 3ECBB 5F7FA 1RIUL 4M1CC 1FFOA 1JIBA 3X3GL 5DJXB 4GG6A 4QHMA 5DRXB 3T8XA 1F58H 4XC3H 4YZFF 2XG5A 1NCAL 1BIHA 4XXDA 4ELMF 2D9QB 2JJVA 4EDWH 2EDOA 2HG5A 1OCWH 1MRCH 2FR4A 4XTRC 1WICA 2DJ4A 1E4JA 5KSBF 1PBYA 2EYSA 4Q9BA 2XKNA 3MUY1 2IJ0C 2IMMA 3ARZA 3HZKA 1X5XA 2KH2B 4CAGA 3EOBA 4ALAL 4GRLD 2EH8L 4FQ1H 1KTLB 4TOYH 1YEDA 4GXVH 3FB7A 5DMJB 2X70A 1EGJH 3VXUD 2IGFL 3JUZA 2Z31D 2QEJA 2BK8A 2HRPH 2VWEC 4HZLA 5GZNC 3PWLA 1DQTA 2HRPL 2UV3A 3MXWH 1YEEL 5CBEA 4OF8A 2J8HA 4G9DB 1LDSA 4DEPC 4P5TA 3LOWA 1F3RB 2CLRA 4I5BA 3MRMB 5DO2C 1C5BL 1U2HA 5FO9A 4MDIB 5BW7C 1AE6L 1U3YA 1MWAH 1OW0C 1TZIB 4NDMA 1JNNH 3RTQC 1YN6B 5DD1L 3FZUD 4M7JL 4PB0H 2VITB 4X6BA 1I7TB 3I50L 3A0OA 2M1KA 4M7JH 4PB0L 3BT2L 4MD5A 1CE6A 4RMVA 3QA3A 4H1LB 1J18A 5E9DD 3QDJD 3W0WD 1KGCE 3RL1B 4Z7QE 2AJZB 1WBZB 4RMSA 4TQEL 1RU9H 3NFPB 1AKJD 4MJID 4PRHD 1P4BL 5EUOA 3RGVA 4R26L 5F9DC 3U36A 1NBQA 1T1YB 2IANA 2A73B 1IGFL 4YBQC 3EYUL 4I0PC 4OZIB 3M1BB 3OX8B 3K74B 1NPUA 5FUCC 4G43B 3L1OL 4KTDL 1V8HA 3TO4B 5LGJA 3L9RA 3QUKA 1S7TB 2QR0A 1MEXH 2JCCF 1YY8A 3FFDB 5KSAD 3O8XC 2CO7B 1OSZA 2NXYC 5MERB 1RJYB 2VMFA 32C2B 3I2CH 1XZ0B 2DDQH 3PXJA 1MJJA 1ZE3C 5DJ8B 2V5YA 5K9JH 1F97A 4HBCH 3GBML 3QDME 4XGZA 1CVRA 4XCCL 4Y5VA 4M5YL 5BRZD 1Z3GL 5IV2A 1ADQL 3BESR 5FYJD 4JFDE 1UWGL 3HC3L 4TPRH 3UTOA 3PP4H 1A6AB 4HT1L 5DSCA 1P7KA 2D9CA 5C71A 5I17A 1N5YL 1NBYB 1RZ7L 2NY0B 3SDCA 2LAAA 5IBUB 5AWNL 5IJKA 1NMBH 4QTHA 3HN3A 1EZVY 5FDWA 2GY7B 1SY6A 2ED9A 3K4ZA 4WHYG 3ZKMD 1M7DA 4X6FB 2L0DA 5DVLA 1E6JL 4D0DB 3KPMB 3B2UD 3IDYB 2YRLA 1CXLA 3O45B 1A1OB 1T5XA 4NT6B 1PQZB 4ODWA 4BFIB 1HIMH 3C60A 5K9QG 3OR6B 2OP4L 3MRFB 2YD9A 5CSGA 1ZLVH 2DLTA 3QG7H 4HW6A 4ODTL 1D6EB 2FO1A 2VDOH 1WJ3A 1U8IA 2A77L 2ADFH 2AJXL 2CIIB 1OQOA 4YC2C 4QXTB 2VISA 3CFDA 1OSPH 4I3RH 5T3XL 5CD5C 4IHOA 3ZE2E 1OWWA 3MXVH 3QCTL 1KN4H 2BDNL 3D0LA 3LY6A 1IAIM 4MHHI 3DUSA 5LJYH 3WBDA 4H8WH 1IC5L 1QBLL 1X3DA 2Y6SD 5KSUA 4TNWK 1MAKA 1FFOB 5F1IB 1KB5A 1T4KA 2BY0A 3IXTB 4LCYB 2OXGA 3T0XA 1FCCA 3RVWD 3OAUH 2IPKA 3SGJA 1FNGB 1WZ1H 5GISL 4NN5B 4NQTA 4EQ3A 3NABL 4AENA 2IG2H 2B4CH 2DYPD 2OL3H 2XOTA 4Y4HC 3VE0B 5IIEB 4O2FB 4PY7A 3RHWF 4N5EC 3BKML 4Q97A 4IRSA 3KPNB 3V0WL 3KPRD 2ICEA 2YPKB 3SCMB 2H8PB 1D6VH 2PR4H 3GSUB 1SHMA 3E8UL 3KYOA 3OJMB 3KR3L 4IOFC 3MRQB 2X4OA 2Z92A 3QQ9D 2CRIA 5CMAA 1MREL 2BFVH 1N5AB 4X6DF 3OMZA 4W4OA 1P9MC 2XY2A 3FQNB 5HYSA 4LVNB 3WS6C 4KZEL 3B83A 3LHPH 2DLHA 5L7XH 2P5EE 4XMKH 4C56E 4HS8L 1J12A 3X14B 2B1AH 3O4LA 3R4DA 4MD4A 5GGTA 1EZVX 1DJSA 4JFHE 3L3KB 5I1JH 2IANB 2ZJSL 1DSFH 4P5TB 5E03A 1KCKA 1TJGH 4R2GB 5EU4B 4WGWB 3NIGF 1KJMB 5DHYA 4HS3A 5C0GA 1JVKA 3CAFA 3SE3C 1X44A 4G6JL 4FTVB 4P23B 2PXYA 3GK8H 4ZO9A 3BJ91 1S9YB 5IMMB 3RVTD 2QTEA 3G6AB 1NAMA 4L3EA 4ZXBC 4KI5D 1RULL 1WQVT 5C07A 5DJ8A 5IESL 1LK2A 3MBEB 3LV3A 4NHUB 1R5IB 2VE6A 5GRJL 3C5SB 2WBKA 5D1XB 1BFOB 3FN0L 3WHE0 2EDJA 5DJ6B 5KSVB 1PLGL 2O5XL 3BQUB 5ENWB 4D9QE 5JQ6H 3PP3H 3T0EB 1NCTA 4OM0L 4PP1C 4XNZC 4GBXC 1IGIH 3HG1A 1T6WA 4O2CB 4X4XB 5BRZE 5CP3H 5HYQA 5DRXA 4NJAL 5CIPH 1IBGH 1F11A 1A5FH 5F97E 2XA3A 5C0EB 5C2BH 1ZVHA 2VERN 1KC5L 3VXRD 1U8HA 5IR1A 2HFGH 2APXA 4JREC 1QSVA 1B6UA 1RVFL 3OTTA 2AXGB 2F54A 5MEQA 4DN3L 4ZUTB 4R0LB 3MRFA 3QXWA 3HUJF 3U48A 3JTTB 3OGCA 1I3GL 1AC0A 1MAML 3RNKB 3MV9A 4FQXB 1OM3H 4LHQB 3HMWL 2IH3A 5EA0H 4DZBB 4N1EA 2CLRB 3ULSA 1OWRM 1G7HB 1KN2H 4WI8A 1IKNA 2M8XA 3ESUF 5T5FL 4HEME 3F7YA 4X5XA 5B39B 1QSFD 1YY9D 4GXUM 1D9KA 4JRYD 2APTA 3IAGC 1I1AB 5CIPA 3V52L 2Q8BH 3H9HA 1CK0H 5K9QI 1L0XA 5GGUB 2MFNA 1RJCA 2IAMC 3W0WB 4RWHA 4DVBB 1RZ8A 5GQBA 1T3FB 1ZEAH 5CD3A 3O6FD 4HFUH 4XXCA 1G1CA 1P9MA 5BS0E 4CBPA 1MFDH 3IDMB 5C6WH 4ZODA 2VLKA 3J7HA 1GGBL 4BQ6A 3KPPB 5F72S 3P4MB 3Q0HA 4KHXL 5CGMA 3EO9H 3OHXB 3TJEH 5EFIA 2P4AB 4KZDH 2IWGA 1J1XH 3TBYA 3LKSB 1NJ9A 2HTKC 5HDLA 4YFLI 4K07A 1M6OB 4X7CC 1U36A 1C12A 2BOCB 3Q3GB 1UJTA 4G43A 4WWID 5BXFA 5IM7A 1EGJA 4M1DH 3I6LD 4QT5A 2IF7A 2FLBT 4ODHH 2WUBL 1UFUA 3U46A 3I02B 1HWGB 1IAIH 5C0CA 5JXED 2Q3AA 1KENH 4AIOA 2NW3A 3PJSB 2NMSA 2MNUA 4LASH 3SDXB 2PYFB 1U8NB 1MCPH 2NXZD 1DQML 1T20A 3MV9E 3T2OA 5DK0B 4A6YA 3ZKND 5IB4B 5L2KA 4HPYH 4LBEB 1VESA 2FWOB 3D9AH 3EKCA 4X8XA 4QXGL 5EWIL 4F33B 4KKBD 5HBBA 1OTSC 4UU9A 1WUNT 3N1GC 2R4RL 5C09E 1B0GA 4G9FE 5C0ND 1DBBL 4KI1A 5JXAH 2G2RA 1J0IA 1DUYA 3RWJA 4JQVA 3OSKA 5E6ZA 5GGRA 3QUXC 2R8SL 3FFCA 2VXQL 4W4NA 2E9WA 4G9FA 4W6YB 3RNQA 4EJ1C 3JVGA 2EDDA 4MSWA 4YWGH 1ZTXH 4KKCC 1ZLWH 3WFCH 1UH4A 3V6OE 3OKDA 3KHQA 3QDGB 1AHWC 1U8MB 3DBXB 2H9GB 3STLB 3P77A 3QCUL 4LARH 2BJML 4N0UB 4YHPB 1Q9LA 5JW4N 1OAKH 4HS3B 5CEZD 2CGRL 4AG4L 3O11B 1HH9A 4WJ5A 4M5ZL 2IALA 1YEIL 5HYJD 4OCYH 3T3PE 1FFPB 3VFMB 5HDBF 2PO6B 1KCSH 4MD0A 5KSAC 4RRPA 2GSGA 4JDTH 5DZNA 4XTRD 1ZAGA 5A2KH 5IG7B 1G6RB 4QY8A 3BUYB 4NO5A 3MJ7A 2WINB 3OKLB 3BIKB 2KQNA 3VRIB 2CDGA 1GZQB 4XRCB 5LQBH 1WBXA 5I8EA 1SQ2N 5I1DB 4PJHE 5C0IA 1H8NA 2P46B 5ALCH 1TCRB