3DI2B

Crystal structure of the complex of human interleukin-7 with unglycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
195
structure length
195
Chain Sequence
DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
molecule keywords Interleukin-7
total genus 34
structure length 195
sequence length 195
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di2B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di2B01
1J86A 2IH1A 4GJTB 2VXSL 3OXSA 5EA0H 1RI8A 4KZEH 1AP2A 3ZDXE 4MJID 2V5MA 1NGPL 3MRJA 3B3IB 1BM3L 4YDKH 4RWYL 1CFSB 3IFOB 1KJVA 4K7PX 3W9DA 3JWDL 4JY4B 2PTVA 5D2LA 1AO7D 3QXDB 4HFWB 3GMNB 5CCKL 5KS9B 3O3BB 4KVNL 5A2KH 5BV7L 5HXMA 5J6HA 4ZMAT 5EBLB 3I50H 4CGTA 4EBQL 4D0CA 3IDGB 5MENE 1EHLL 3IF1A 4J12A 1TCMA 4JZJC 1XGUB 4XRCA 4OF7A 1MCLA 4HWZA 3REVB 1QKZL 4WO4C 3WLWD 1CTNA 1P4LA 1H3WM 5DJ2A 1G9MH 4WDIA 3CDYA 4OFDA 3QPQC 4M1CD 1YY8B 1T1XB 3ARBD 1PDKA 3VFOB 2I9LA 2P24A 5D7IE 5E00A 1NEZG 2DS4A 2XKUA 1TQCC 1QA9A 3EJZD 5F7MC 5BRZB 1N8ZB 3QUXD 1LDPL 3FO1B 1H0DA 3ZMRA 3MROB 3C6SA 4LCYA 2JJWA 5C0AD 4QNPF 5F21B 5BVJA 3VFOA 5ICZA 3P30L 1B2WH 3EOAB 4AEEA 1FG2B 4OZHA 4UIMB 2XTJB 5EU3A 3OX8A 3VXSA 2EE3A 1LK3H 4R3SA 1BM3H 4ISVB 4YDKL 3BHBA 3G6JA 3ARQA 4WFFD 2IG2L 3OKEB 4APQC 1CK0L 3BPNB 4LLMA 4OZHB 3S5LB 3BEVA 4LSVL 1IAOB 2OL3B 4BYHA 5L8KB 1AD0B 5ID0B 3E6HA 4UNTA 1NC2B 4UUJA 5CD3B 3G08B 3S34H 1MIEL 3MMEB 3Q6FA 4NKMA 3FB5A 2I9TB 4FFWC 2NY3C 5EUOF 2BOCB 1UXWB 4IRJD 4DOHB 3SKJL 3HFMH 3LEXB 4LPXA 4C54A 2O5YH 2NY2C 1MJJB 5IG7A 1YYLH 2ZUUA 4KKCC 3U6RA 1OOAA 3TBVB 4TN9A 2PO6B 5DJ6A 3SDDC 4GW4B 3UBXB 3AGVA 5KSAD 2AKRB 5TPWL 1KULA 1FIGL 2BFVL 3VXMB 2XKNA 4JFXB 5DK0A 5DC0A 1MWAB 3NOIA 2VERN 4PRBA 1CVSC 3UC0L 1EFXB 4KKCD 3NFNB 3P73B 2Q6WA 2CK0L 1RURL 2P4AB 5JPNA 3HNTH 4OUUA 1YPZB 4G80A 1XGTB 1VPOH 4Z78B 4YHMH 1IT9H 2M2DA 3I75B 4PRHD 4TPRH 4AQ1B 3P30H 4U6TA 1XGPA 2W91A 3QNZB 5JZ7D 3AM8C 4Z6AT 4JLRB 4ETQA 4KTEH 1SYVA 1G7JA 2HWZH 4J3SA 2KZ1B 4D2NA 3CXHJ 1A1MA 4MNQA 1A5FH 4W70A 5SX5H 1RJZA 4XPBH 3M07A 4YNYB 3GSXA 3HI5L 4U1GC 1BBJA 3GSVA 3OMZA 2AEIT 3WNOA 5C0EB 1AR1C 4HJJL 1OPGL 3JV6B 5BZDB 5KS9A 1JPTL 1G7IB 1ND0B 3T0ED 1I1FB 3FT2A 5GS1B 5C7XH 1BWWA 4MWFA 1VDGA 2Z31D 1CG9A 3HRZA 3QUYC 2CKBH 3ARED 3P0GB 1ED3A 1RZ7H 5I76A 3JWDC 2EIZA 5BO1H 3MJ8B 4PGDA 1KPRA 3HI6H 3L3JA 5EFIA 5GS0D 2BVPA 1FO0H 4TTGA 3B83A 3DXAB 4DFIA 5AZEH 1A6WL 4OZHF 1YEHL 3SDDB 1WUNT 1EIBA 1YN6A 4G8GD 4WI4A 4Q0XL 1BVLB 4N8PA 5IROA 2DQEL 2GTZA 4U2YA 2OL3H 4HG4K 3D69B 4OZIA 2XG4A 2XPGA 4MD4A 2J5LB 2CK0H 5EDXA 3EHBD 1YUHB 1DUZB 1ZVHA 3D3VA 4O5LL 5BRZA 1AE6L 4ZUSA 4HLJA 2IAND 4K3HA 4M48H 3O2DA 4G8GE 4S2SB 4R4FH 5DMJB 4IDLA 4MAYD 5GS0L 1YUHA 4XPHL 1YEFL 3FN9A 4G7VH 5I74B 1VGEH 1CICC 4Y8AA 1KB9J 3SE9L 4AL8L 5ADOL 1VEPA 3KPLA 4YDJA 4YO0A 3DVNA 3PQYA 3BH9A 5E8EB 3CDCA 4ZO9A 2PR4H 4RGMB 2YUZA 5EUOE 1W72H 1C5DA 4WFHD 4YDIH 4N0UE 1RMFH 4GMTL 5DS8B 3OB8A 3HZKA 1IVLA 1AHWC 5DA0B 3KPLB 4YDJB 5J0BA 1OP3K 1NC2A 5FHBH 1A1NB 4MS8C 5SX5K 3HUJB 2ATKB 4KPHL 3LPWA 5FKPA 4TVPE 4JQVC 4ZFFB 4X98A 4ERSH 1DQQB 4X7SL 1IQWL 1KEGH 4PFEA 4L8DB 2GUOB 3MA9H 3U1SL 4JM2C 1DBKL 2HTKD 3TESA 1DN0B 2VLKA 1YMMD 2D03L 3NAAH 3TV3L 1CLYH 1OAXH 4JHZA 4LCCC 5C92A 4XCNB 2DM4A 2KPNA 2ZCKH 5HVHB 3MOBL 1YQ2A 5D2LB 3QXDA 5LAXB 1CDHA 5DEFA 2A1WH 4NQCB 2G60L 1RFDH 5ENWA 4K9EH 2R0LH 3GMOB 3FO0L 2OXHA 4J7RA 5H8DA 1DANT 1NBYA 3V5HB 2FLBT 4HS8L 5LAXA 1KJ2A 1CZ8H 4XPHH 2Z31C 5D7KE 5KVDL 4KGLA 4YZFE 1GVIA 1I9IH 2F74A 3UPAA 3MACH 4YE4L 4CU8A 1WT5A 1QNZL 3L1OH 2EH7H 4FMKA 1NFDB 3GSXB 4A2MA 5D7JB 2IANE 3D5OF 3L3HB 1CDCA 4FQXA 1BECA 1H9VA 3MRDB 3LS5H 4UTBL 3VD3A 2VLJB 2X2YA 3UAJD 1YA5A 1BFVL 1AO7A 1FORH 2MHAB 3BIBX 4Q2ZB 4X99B 2X05A 5DJZB 1KF9B 5T1LD 5C0GB 1EMTH 3C09C 2V2XA 4XX1G 2PN5A 5CJBA 3MLSH 4NYLB 5FCUH 3HRZB 3P0VL 3UTSD 4WFFE 2VIRA 2Z31A 4HWUA 3UX9B 3MJ6A 3FRPA 1X6LA 4O4YH 1K8IB 2YRLA 5AUMA 1ZEAH 4E41B 1RHHB 4AMKL 2ZUWA 1MH5B 2YR3A 3L6FB 3PDGA 1YJDC 3C5SA 4IRJA 3KPSE 5JPMB 4Y2DC 3MOBH 1YY8A 2YD9A 3MGTB 3T0VA 4AEIL 3TO4A 3BAEL 2C4XA 5D7SL 5KSBB 5FUZL 4JPKL 5I8KL 3VA2C 4YX2H 15C8H 4YXHH 4ZUSB 3OJDB 3LEXA 3NGBB 1KIRB 3C5ZD 1HXYA 2ARWA 2ZUXA 3VFGH 1K5NA 2XZAH 2ADIB 1FN4B 3CIQA 1H3VA 1HIMH 3EO9H 4MAYB 3VGFA 5KVFL 3EBAA 1MLCB 3ARDA 3U7WH 3O8XB 3ARTA 3C08H 2Y25A 3STBA 4RZCA 5JHDD 3VFSB 3X17A 1YEJL 3A6BL 1F11B 1A9BB 1S9YA 3E3QC 4R97B 5I73B 1BBDL 4CU7A 4HIHB 4NNPH 3VD4A 3VCLA 1OTSD 5JW3H 1NMAH 4YXLH 1EMTL 1WTGT 3QDJE 3QAZC 1PG7L 4FG6C 4HV8A 4HUUA 5GGQH 3QULB 1NLDH 2P5EE 3SQOH 5H35A 2IH3B 1YY9D 5E08L 4OZ4A 1V3KA 1M05A 3ILPA 1U92A 3RGVC 4Z0XB 2KDGA 2ADFL 4Y4FA 3UZQA 1D5XB 1DQTA 5DR5L 4V2BA 5F9AC 3ULUF 2XXCB 5CEXB 5KW9H 5EO0A 1RZKC 4RRPA 1FC1A 1JBJA 1KPUA 4EVNB 4YR6B 5I6XC 1JHKL 5GGSA 1N3NB 3CDFA 3RY4A 5IT2H 2GJJA 1A7PH 4QWWD 3V6FB 4PJAF 1HNFA 2IF7A 3HZYA 1KNOA 4N0UA 2P44B 5HYQA 3VFNA 1BVKB 4GH7B 5KVGH 5T1LB 1IQDB 1D9KA 4PRHE 4WI8A 1QBBA 4Q58C 4JFDD 1E27B 2RGSA 1Q94B 2IANA 1A9EA 2B5IB 3ES6B 4Z18A 2Y5TB 3PUCA 1NEUA 1VHPA 4OLWL 4PGBA 2NW3A 2R69H 4KKLD 3BZFA 5I1HH 4NKQB 1A6PA 2X41A 4RAHA 2XN9B 3ARSA 4J8RB 3ZKND 1HSBB 2V5RA 3DXAA 3QRGL 1WZLA 1HHJA 4XB8A 2APFA 43CAA 1CGVA 2FH8A 3OJ2C 2JB6A 2R2HA 3QO1B 4I3SL 3OX8B 3VXSB 1HYRC 5E9DA 4DUVA 2GITA 2DICA 4HC1L 3GSQB 3RVXD 3MRJB 1P1ZA 2P5WE 1EDQA 4QKXB 4OQTH 3ULVE 4U6HB 2OI9C 1MAKA 1F3JB 1FE8H 4NNPL 3C87A 2V7HA 4JM4L 3HC4H 1FZKA 1XF5B 3WSQH 1PG7H 4GKNA 1I3RB 1UJ3A 4ZNEE 5JR1H 4HWBH 3Q1SL 3CU1A 2VIRB 5DC9B 4K8RD 3NCEB 3ZE2E 4FP8L 2EYSA 2VDRH 2CPCA 4XNUL 5J6HB 4J6RL 4N5EC 4OCRL 4QLRA 4OGYL 3BH9B 4GQ9L 1X4YA 1Q72L 4FNLH 3L7FB 2X70A 3IFLL 1T0MA 1K6QL 3RHWK 5BQ7B 2Q7YA 1CGUA 4NQVB 4BUGA 1U36A 2O26U 3RAJH 2EDOA 3D69A 5ISZA 1NANH 1RVFL 5HGAA 3K8KA 2UY6A 5EZJA 3CJJA 1H3TA 2UVFA 3CUPA 4F7MB 5JUEH 3DETD 1BFOA 5D7JC 4MQ7A 4O58H 3OGOE 4GG8A 5E95B 2DDQH 4MLSA 3BMWA 1YJDL 1LE5A 1LO3L 4LSDA 4MD0B 4OLYL 3DSFH 3JWOC 5E94B 3T2NH 1NC4A 3WKMH 1JF1B 3OKYA 5EULV 4JG0H 5F1NA 1NKRA 1JYNA 2W1NA 3H9ZA 3FQNA 4I4WA 1QLEH 1I8LC 4OSUL 3MZGB 1VACB 2BNRA 3VI4E 4G8IA 1VKXA 3GNML 2FZ3B 5DZNA 4XC1L 4YBLB 4JGJA 1PJ9A 4P23B 4P9ML 4OTXH 1FNAA 4YHYB 1O7VA 1YEKL 4HKXB 4PR5A 1UJ3C 3QWQB 4DGVH 2BRRL 4DW2L 1UVQA 1G7HA 3WHXB 2VDML 43C9A 4PJDA 2M1KA 4UT9L 1G7IA 4L8DA 1J8HE 5DUBA 2K9UA 2W0LA 2CRMA 3LN4B 2VL4A 4C55A 2Q87A 3MRGA 5CWSB 4PJ7B 1JTOA 3ET9F 5DJ0A 1AR2A 4JM2B 4M5YL 3QEQA 3PE9A 1AXTH 5J3HC 1QUNA 5EU5A 1G0XA 4JFED 4HEME 3GI8L 3WEXB 2V5YA 1EXUA 3K2UH 5MERB 2I60H 3ULUD 2OZ4L 4IMLA 4PGZA 1W0YT 4RISH 3RVWD 5ADPH 3VWJA 3RAJL 4OIIH 1GGIH 1E4KA 5DGQA 4XWOC 1RVFH 4BFIA 4U1SB 1RQ5A 4WJ5B 4J1UA 2HVKB 4GG6B 1I7ZB 4NN5B 1CFTA 5HD8D 4FQLL 3I3BA 1ZV5A 5IBUG 3ULVD 2J8HA 2JELH 2ZG2A 3RZCA 3PWVB 4MNHA 3KHOA 4QRPE 3VXSE 3VGBA 4S10A 1I8IB 4FHBD 2NY0B 3P73A 4S11A 1A7QL 4XBGB 1M7IB 4JAMA 2FD6L 4MYWB 4XVSH 3IXTB 3O4LA 5F7UA 5KVMC 5BXFB 3C9NB 2XN9E 2YEZB 2ERJB 2IMMA 1UB6B 4ODVL 1TTFA 5FF6B 2C3WA 1I8IA 2E7BA 3ZTJH 2EDHA 1XMWA 4R2GD 1E6OH 2P47B 3MROA 4K3JH 1J0KA 4RWYH 5HGBB 3MO1A 5FO9B 4KDWA 4PUBL 4P9HL 2HLAB 2XZZA 1F3JA 3BSZH 3MRIB 1S5HB 1KLGB 5EOCJ 3U7YL 5JXED 4HAGA 3CPLB 4HK0A 3B2UC 2BSSB 4KJQD 4X7TA 3NACL 3WO3B 3DV4A 3OSKA 3R06B 1R5IB 4MCYA 5IVXA 4NOFA 4E0RA 1NAKL 2IADB 2E7HA 1Z9OA 3TBTA 4EOWL 4HGWA 3Q5YA 1MJUH 3U83A 1AXTL 4NN7C 1QSZA 2NY6D 2NXZC 2X9XA 3OR6A 1GPOH 1HHIA 4XNQA 5C0BD 3QDJB 3N1PC 4JFYA 3RA7H 3V0VB 1DDHA 5BV7B 3MYZA 5J1AA 2NY3D 2IGFH 4FQ1H 1LE9A 1K85A 1IGCL 1LD9B 5AYUL 2VITA 4NC1E 2GJ6D 3IS0X 2LV4A 3DUUB 3NIFE 4G9DA 3RWHB 4OD1L 1MNUL 1RZGA 3GBNL 2RQ8A 3W9DB 2FD6H 2GK2A 3MR9B 4LLQA 1HH9A 4IRSD 3HI1A 5I9QB 1NCDL 1V7NH 3SDXE 1LGVA 1AGEB 3O0RH 5ITFA 4M6NL 4QRRA 2AK1L 5EWIL 3PHQA 3P4NB 1YNTA 4PB0H 5CEXA 4NHCH 4Y5VB 4MJ5B 2FGWL 3H6JA 1BD2E 4EXPX 5LGJA 1WSST 1QRND 2IMNA 4JDTH 4G6AC 5JNYB 1VEOA 3RVWC 4Y16D 4HF5H 2BK8A 4U31A 4N1EA 4MMXC 3IRPX 3HZYB 1UKQA 4YO0B 4FXGA 1BD2D 3P4NA 5INDA 4HIHA 4MJ5A 1X9QA 3QWOB 3VCLB 4BK4A 2DI9A 3QZWA 4F37K 4HIJA 1V5JA 1E27A 1OARH 3ARBC 3IFNH 4FQCL 3SO3C 4QTIL 3QPQD 4QHLA 3RPIA 1PSKL 1T03H 1OB1A 3LY6A 3JUYA 1M05B 3ILPB 3DNKA 4QHKI 1IAIH 2ITDA 3SDAA 4NQED 3LD8B 4ORGA 5HPMA 1BQHG 4IOSD 1AKJD 4UQ2A 5AD0B 4QRPA 2V5SA 4Z0BH 3KPNB 3I2CH 4DCQB 4LSTL 5IFHH 4YZFF 3H42L 1T1ZB 1F3DJ 4MD5B 4NN6C 4PJCB 4TOYL 4HIXH 4LLAA 1DBML 1M6OA 4JZJA 4XGZA 2W65B 5DO2D 5GIRA 2FYYA 4HDIB 5GGVL 3TO4B 4RFNB 4JRXD 1NAMH 4OLVL 3EOYG 3QCTL 4KXZI 3MV9E 3BE1L 4O02H 4OZGA 1U8KB 5TQ0H 3MXVH 4LNRB 2IBZX 1PYWA 4ZQKB 2BXYA 2YC1A 5D70H 1RUQH 2EDEA 4XHQA 25C8L 5MEQB 5BCAA 3LDBB 4IBLT 5TF1L 5EOCL 3GK8H 2B2XL 3Q3GA 4UQ3A 1NFDF 4QF1A 4PJBA 1NL0L 4B7LA 5E8OB 2QSVA 5IHUL 4XWGH 5T3ZL 4U1LA 1IC7H 3T08A 5BMFL 5A2JH 4WWKD 5AG9A 5DVMA 3CLEL 5HDLA 4RZCB 4DGIH 1GGBH 4MAYC 3OKLB 3TJHD 1KCSH 3LN5B 1BQHA 3U79A 3IDXL 1NGPH 3MRDA 3L95A 1UG9A 1DBAH 3RDTD 1EGJA 1HHHB 4N8VG 2EEAA 5J8OA 4U0RB 2VDPH 4Q6YA 3MXWH 2Q6WB 1RSFA 5T1DL 5GHWH 1RZ7L 4OGAD 1ROWA 3L95B 4XX1E 1BPVA 1EH9A 2FJHA 4R8WL 2GT9B 4Y16B 2ZPKH 1FO0L 4YHNB 3DUSA 4KK8D 3I2CL 2FBJH 1GZPA 4NUGH 5FYKU 5C07B 4KTDH 4L4VE 1A6WH 1HZHL 3BPCA 3AREA 1YEEH 1NCWH 3UYRH 5I30L 1DBMH 4JKWA 3QIUD 2AJZB 3S7GA 4B53A 2VXVH 4F2MB 4X0KA 3DRTA 5EUOB 4P3DB 1ZGLP 1F90L 3EYSH 1RIUL 2H3NA 4G9FA 3U9UA 3OPZH 3RL2A 1OAQL 3MBXH 1MWAA 4R4BB 4HX1B 4HJ0D 1LEKA 4F2MA 2WV3A 4GS7C 5EOTA 1UZ6E 1QSFD 2R15A 4G8GB 4XVTH 2F54B 2HKHL 4KFZC 4M8QB 3BP7A 4LF3A 4UBDC 4XWGL 1NBVH 5T3ZH 1SY6H 2VNCA 5E8NB 4A2LA 3EDEA 4P0DA 2EIZB 3QISA 1X5KA 4GMTH 3ULVL 3BT2H 4N8VB 3D6GA 3RZCB 1GXEA 1X5LA 1DUYA 2VZTA 4J3XA 3GMQB 4S1DD 3HR6A 3VXOB 3TT3H 4I9WD 2Q86A 2YPKB 4O2CB 2XWBB 3DXAE 2PYED 3CVHH 2B20A 4WUKH 1DQML 4Y4HB 1N5AA 2FJGA 1AH1A 5DSCA 4K3EL 3TP4A 3FOLB 4HUUB 4M6AA 4P4KB 4UDTB 3S37X 1CXLA 1U8PB 5CJ5A 4M1GH 2R1WB 3PIQA 3X11B 5C0GA 3ZSTA 4I5BB 4KTDL 1F4HA 3OKNB 3NAAL 4DN3H 3S97C 5DSCB 1FJ1B 2AEQL 5GZOD 4GG6A 1FL3B 1L7TH 5BOZG 1ERNA 4YDVB 1G7PB 3D39A 2QQNH 4KKBD 4LVNB 5D2NA 1MJ7H 3OF6D 3MUGB 4FFVC 4UILL 2A0LD 4AIOA 4NSKA 4OZGB 3RJQB 3IU3B 3P11H 2HJKB 1LILA 3MBED 4YDVA 1KUMA 4JFFA 5DHYA 3UC0H 4FFVD 4FTVD 3FL7A 4J4PA 2OS7A 3MLXH 2ICWJ 5C3LD 1BZ9B 2E3VA 4HUKB 5CEZL 4PRPA 4Y2DD 4YE4H 1YPZE 1Z9LA 3FAXA 5I1IH 1BD2A 1NBQA 2P48B 3V95A 3HHRB 3VGHA 3TZVC 1T7WA 3PL6C 5CBEA 5IROC 3QQ4B 3X3GH 2FCBA 1QD0A 4WU5A 4YQXL 3DMMB 3F7VB 3ARWA 2A83A 2AABH 3ARFD 3VXME 5JA9A 3RVUC 3VRIB 1EO7A 3WIFA 3DMMC 1RZKH 4K94C 5KJRH 1QPPA 3CAFA 3HI5H 1HOCA 5ESQB 1DQMH 3B8YA 5CEYA 3MLSL 4U05A 5FCUL 3LKOA 3RZWA 2PTTA 4IJ3C 1OPGH 4J3TA 5ENWB 5D72L 4XP6H 5CGTA 3MLUH 1VESA 4R4ND 4DOHE 1HHKA 1MJ8H 5JO5B 4HWEH 4XCCH 2CKBL 1EBPA 1U8LA 4P4RB 3NFPA 2UZXB 3G08A 2RFXA 5TDNB 4OFVA 3GBMH 2EDKA 3I6KA 2UV3A 2AJUL 3D3VD 4P3DA 5I66A 3PWPE 3QUXB 2PYEB 1QQDA 2A6JB 1R24A 4FQHA 2WIMA 3LKPA 5HHOE 5C0AB 4EI5B 1T7YA 2DIBA 2Z8WC 5GGUA 3L9RA 5FGBC 3GSRB 3ILQD 4NQXB 3VFGL 1CDYA 1X7QA 3BYTA 3PWLB 3EO9L 3FQTB 5IEKA 4M8QA 2I5YH 4PB9H 1AO7E 5F3BA 5DJDA 5BRZE 3R0NA 4L8SC 1QR1A 2X89A 3GKWH 2OR8A 4HT1L 3CX5K 4NUJA 4RFOH 3WLBB 2GSGA 5HSFA 4NKDB 4F7TB 1KBGL 1ZT1A 5F44A 3WDJA 3A6BH 3F5WA 1EV2E 3ABZA 4ONGH 4K3DH 4M6OH 3MRHA 4P5TD 3DO7A 4XBPA 3O2VH 4JG1L 4X8JA 1IKFL 4QOKD 1T04B 3ZE1F 4L8CB 3C60A 5GGQL 1FBIH 2AVGA 1IC4H 2YPVH 3GRWL 2WUBL 4B41A 2BVUA 1YC7A 2ENYA 2DMKA 1C08B 5MENB 2LVCA 1WWAX 3ZTNL 4I2XE 1MCFA 1MJ8L 4P4KD 3F7YA 2R2BA 4WWKA 2YRZA 4GS7B 3AS2A 3S8WA 4GAYA 5KS9E 2DLTA 4IRSA 2CDEB 5ID1A 4R90L 4OZFG 3F8UB 1JTPA 4JGMA 5I8EA 4G7YH 4HC1A 3P9LA 1NGXA 4TRPH 2CSPA 1RZIA 2FJFB 1X3DA 4PJGA 5DJ2B 5HY9A 1TJGL 5IGXL 3S88L 2XI9A 1QBLL 4PJDE 1QACA 2Z0BA 3ALXA 1P53A 2GIYA 3TBVA 3LS4H 2OP4L 4ORZC 1GIGH 3QI9A 1N8ZA 2UWEE 1M7IA 4JAMB 5LXGH 5F7DA 4NZRL 2N56A 5EZIL 4Y5VA 4L8SA 4OZIB 5BVJB 1WT5C 1UACH 3F58H 4OFPA 5DS8A 5ALBH 1EFXA 1OP5K 1FFPB 5KVDH 5CMAA 2J7LA 4ONGL 2DN7A 4LHUB 5L2KB 4NKOA 4IHOA 1QNZH 3L1OL 4R7DA 3MCLH 2HT2D 1X5GA 1ZA3B 1MRFH 3TJEH 2WWKT 3Q1SH 2AERT 4F9LC 5TDOB 4NQEE 1PEWA 4YIQB 1MVUB 2I07A 4Z7VE 3UP1A 3FQXA 3TEUA 3VFUB 1GYAA 2J4WL 3KDMA 5GJSH 4Y1AB 3SCMD 3NFSL 2D0GA 3ZTNH 3VXSD 5IIEA 2BOCA 3LQZB 3SHSA 4EN3C 1GC1C 4JFHD 4NO5A 5BW7C 2UWEA 4GQ9H 1FYHB 1VFAB 3FB6B 4NM4L 4PG2C 4W6YB 4YNYA 3FO2B 4K71C 4K94L 3SDCC 1QFWM 2BVYA 1E4XH 1CFNA 2VR4A 3VFVB 3WCYA 2BX5A 1FNFA 1X5HA 2XIDA 2Y6SC 4EDWH 1IFHL 4BH7B 5IOPA 1CICB 1MQKL 2OBGA 4JZJB 5CIPH 4YC2B 3M17B 2XQYG 4GXUM 5EU7C 5FYJU 4JKLA 1TZGL 1QSFE 4ACPA 4LQFL 2HAZA 3BAEH 4D94A 3T0EB 1CU4H 5DK2B 3C8DA 3RX5A 3HPLB 5DEZA 2YD8A 2I25N 1UQSA 5IBUB 2ADGB 3HZMA 3QFDB 5FUOH 2W9LA 4LP4A 5F72S 3WKML 5MEQA 2YPLA 2DQGL 5F3BB 4LHUG 1PZ5A 2D7OA 3BEWA 4U0QB 4LSSH 1AGBA 4HKBB 2HT4D 1KELH 4IOFD 4UB0H 2EEBA 3CFDA 2P1YA 3GNMH 1LEGB 3VXUE 1LO4L 4X6DA 1MIML 5CILH 1FL6B 2EXWC 3F6IA 1F5WA 1DP0A 43CAB 5C0BE 4BH8A 1CVRA 4F7PA 4K2UH 4JO1H 1TZHB 4PGJA 2BRRH 3DGCR 5C0JA 1FNGA 3O4OC 2I26N 5D7LD 3SJVE 1LNUB 3MRFB 3HE6B 1XZ0B 1J9CT 3HLAA 3KPSA 5T1KB 4NN6B 2HLAA 4P2CG 4JQVA 1B0GA 4AEHL 1NUGA 5ETUB 3TCLA 1JPGB 3DURB 2DMBA 4UT6L 5HDBF 4H8WH 3N50A 2VLLA 3CZJA 5HYSA 2AS5M 1WFOA 3GSNH 3B2VH 4KMQA 1SQ2N 4PY7B 1B9ZA 5CJ8A 1WZ1H 5E5RB 4I3RL 2XZQL 1M71A 4ENEC 1HHGB 4IEFB 3G6JB 1MRDH 4LLYA 5T1MA 3MFGB 5FKPB 5HD8C 4UNVA 4WEBL 1D6EA 5ESQA 4RAUB 1MFDH 3CSYB 4UTAL 1OCWH 5IT2L 5J6GA 5DMIH 3ZKXB 2BVQB 1Q38A 1A7QH 4NWUH 3IDNA 3ZDYF 5D1QD 2J6EH 4F7MA 5C70A 1OQOA 1U93A 4RMSA 3LEYL 3BMVA 1K3IA 5D5MA 4YGVB 3RY5A 1NCAH 3U0TA 3NCBB 3KLHD 2PW1A 2R0WL 4LSSL 3NPSC 5B38A 1KELL 3NCFB 2UWEF 4GW4A 2GK0A 3U4BH 4M7KL 1HXMB 4JB9H 5DEFB 3GSOB 3GHEH 4KK6C 1F4XH 3QRGH 2HP4A 4WW1B 3BD4A 3RVVD 2A83B 5ICXB 1FVDB 1EJOL 4FTVA 1D5BA 3GGWB 1E4WH 1SBSH 3O41B 4ZNEA 4M7JH 1S9WA 2NY2B 4W6WB 2X6MA 3EAKA 1DUYB 2XRAL 3TH2T 3NIDE 2FZ3A 1HN1A 1IGML 5J56B 1I7ZA 4U1IB 4CU6A 4BZ1L 4ZO7A 2F74B 4X6EA 1OSPH 1J8HD 4X5LA 5GRZA 1OP5H 2VABA 4IJ3B 1MJUL 3NN8A 5DUPH 1T5XB 1UYWH 2FWOB 2O5ZL 2OK0L 2BDNH 4JM2D 5C9JA 3QEHB 4ZTPL 4LEOA 1OW0C 4TNVK 1L0YA 4X4XA 5IBTL 4CAGA 3QT2A 2BNRD 3RIAK 3L3OA 2DKMA 1LO2H 3NN8B 3S96B 2NY0C 3TT1H 1AIFA 2XTJC 5FGCE 1L9NA 4PRPD 1LP9B 5TF0A 1EEZB 1DEEA 2WBJD 4F7CA 4ELMB 1T2QH 5T1KD 2DQTL 4XAWL 3CDGA 3IU3A 4L5FL 3DETC 3RVTD 2P42B 1NCDH 1V7NL 3ARGA 5JQ6H 3SKMB 2VDKL 4NFDA 3H3BC 4HPOH 3DV4B 5F7EH 4I13B 4NHCL 4X7FC 1ZA6A 2VTFA 1KFAL 5KTEL 5LCVL 4OLYH 2DQJL 3RWDB 4JZOA 1WTLA 4LCWD 2AQ3A 4AENA 1FC2D 3E8UL 4YC2C 1GAFH 4KMTH 3P4OB 2I24N 1EJOH 4R2GB 1A9EB 1PBYA 5HDOA 3MNWA 1UB5B 4PJBB 5E2VH 5HHME 1UCTA 2R1XB 3TBYA 5C71A 2IBGA 1I3RA 1UJ3B 2XRAH 3UTQB 4UT7H 3W0WE 3FQUB 4Y2OA 3LKQA 1T03L 3P9WB 4XNZC 1J8KA 4ODWB 4UOW0 1IM3A 4L4VD 3LHPL 4OGZA 3G5ZA 4MJIE 2HRPH 3WD5H 4E9LA 3LKOB 3D48R 1NMBL 2Z92B 2DF3A 3UMTA 1OTUD 5IVXB 4E0RB 1R5VA 3NIGE 1T0MB 4Z5RB 4ZTPH 3MJ9L 5IHZB 3VWJD 2NY6B 1RUKH 3KPRD 5E0QA 2CIIA 2P46B 4UMGA 4MXVE 3DVGA 5IFAL 3TT1L 3EO0A 5EU4A 4NRZB 1FAKT 5TH2A 4D8PA 3RWFB 5IM7B 1D5ZA 1GZQB 3QEQE 5DRWA 4OLVH 4OQTA 2IPKB 3FB8A 3GO1L 1IGTB 5FB8A 3KPQB 3PV6B 1JP5A 4TSBH 3LOWA 1I9RL 1LK2B 5HHQB 1JZ4A 1OW0A 3KNBA 2ICCA 5KSUB 4NZTH 4F15C 1KIPA 4X98B 5KZCD 5BJTB 2JELL 5EOCH 5HGDB 2B2XH 3UPRB 1A3LH 1UA6L 3MYJB 2WP3O 2OTUB 3AAZB 3QDGE 1Q9KB 1AXIB 3RGVD 2B1AH 4Z95H 3I02B 3UTZA 5IHUH 1QRNB 4XMLH 2C1OA 4I18A 1LEKB 1VCAA 5IMMB 2G2RA 4NRYB 2ZCHH 1X5FA 1IEAA 3HC3H 4LDOB 4CMMA 1GGCH 4XCNA 3EJYD 4HUWB 2FHFA 4ZYKA 4F15B 5E94A 2EDXA 4Z77B 4WDIB 2G5BB 1CWVA 3LHPH 5HVHC 3GMOA 4QXTB 5CWSA 1W0WA 3U7YH 3TN0B 4CNIB 1U8OB 1D7FA 2VABB 4TVPH 5C0CB 1X5XA 3RPKA 1T2JA 1PY4A 3BDXA 4OKDA 3OKDA 1MEXL 4WY7H 4XP9L 5MEPA 3VXOA 2F53B 5TE7L 1KJVB 4LCWB 1GCFA 4MDIA 4OIBA 5C6WH 5GISH 1A4KA 4X6DE 3KHQA 4PV8B 1KPVA 3VWKA 4ODTH 1HZHH 5E6YA 1NGYA 1WZKA 1U8LB 5DQ9B 4HK3N 2VXVL 4URTB 2JIXD 3ZKMD 5JDSA 5LKNA 2F53A 2YPLE 3KJ6L 4D0BB 5EFIB 1CGWA 1Y18B 4LPUA 3ZDXF 4QOKE 1CT8A 4LVOC 3V6FA 3OKNA 1I85A 1N5YL 2CMRH 3QIWC 3KXFA 1KGCD 4H0HB 1K4DA 1TNNA 2DQFB 3FFDA 4MB4A 4MJ2A 4ZUUA 5IB5A 2EE2A 3KG5A 3SKMA 4B7IA 4ZDHB 4G43A 1H8NA 2QBWA 1BF2A 1ZLSH 3SOBH 2IPUG 4HPYL 5DD1H 4OD1H 1IEBA 2DBJA 3SDCD 2Z35B 4A6YL 3V2AR 3OZ9L 5GSRB 1AC6A 1J1OL 4EI5C 2EDDA 3E6FA 1NBVL 2R29H 4P59L 5AUMB 5IEKB 3UJIH 1T1XA 4JR9H 4WRLA 3QDME 3VXRA 4OB5H 3CH1B 2AJYL 3BT2L 4LHQB 1KLUA 3DTXB 3QAZB 2P49B 4KZEL 2DLGA 5F7HA 1BQSA 3KYNB 4KKNA 1YYML 3V7MA 1QFOA 3CVHL 1JN6A 12E8H 2X44D 5ACZB 3SE8H 2QV2A 5JPNB 3PWUB 2FECI 5DGRA 1K5NB 3RL2B 2JCCB 2XWTB 2PYFA 2XOTA 1UXSA 4L3CB 3H9HA 4G8IB 1JN6B 4Z7WB 1QHOA 4OD3H 5IB4A 2OJZL 4PJHF 4FTVB 1R3LB 4TVPD 3GSUA 3NMEA 1ZKAA 2YD4A 5CGMA 4G8FB 3L7EA 1NMCB 3EKCA 4XMPH 5GS1C 1CGTA 1HSAB 3H0TB 1N5YH 1F11A 1S9YB 2EH8L 3I85A 4JN1H 4FFZL 4YHLL 1RUPL 2QQLH 5FA3A 2P5EA 5F96L 3ZKXC 5C0CD 3AROA 4JVPA 4TQEL 2BMKB 2ICES 5GGVH 4EUPG 5BZDA 4OZIF 4H1LB 5F9OL 1G6VK 5LVEA 3DECA 4O02L 1QLRB 1ITBB 1I3VA 3T65A 1J1OH 1GH7A 1OT1A 2ZUVA 3FZUD 4QXUH 4NKIH 2AI0H 4HW6A 2H9GA 4U2ZA 4CADB 3I6GA 1EJ6A 1FZJB 4JDVB 4OB5L 3CC5A 3WFDH 3TH3T 4HKBA 1A7RH 3HAEG 3MV8B 4DAGL 1NL0H 3R4DA 3VXPA 3C09B 3HAEH 3TIDA 5EOQL 2BHZA 4Y19B 1XR8A 2A77H 3I3DA 3I75A 2MFNA 2A74A 4N5ED 1L9MA 4OCXH 4R7DB 3RP1A 1MAMH 3O4OB 4ZFZB 1GGBL 1HI6A 4OD2B 1JPSH 3C6LC 3EOTH 2EE9A 1EAPA 4WI9A 1F6FB 4JFOB 3P0YH 1OM3L 4DQOL 1F4AA 4ODXB 4P2QA 4MNQE 3FQXB 4MQSB 3OKOB 2WUCL 5IB3A 3O2WH 1XT5A 4HWEL 2XTJD 2VDPL 1A6ZB 4LAQL 2ESVB 2VXUH 3NABL 2Z31B 3BUYA 4DVRL 5EORL 4UDTA 1RIVH 4XXCC 2VXSH 4PP1D 3T1WA 4JN2A 3BRDA 3MNVB 3VD7A 3KLAB 4RDQG 3V6BR 1CT8B 1NFKA 3FZUC 5F9JA 1OAZH 4H1LG 1JK8A 1YMHB 3KXFE 3N85H 3MV7B 4ZSOA 3SGDH 2V6HA 4R96A 3NZHH 1ZOXA 3L3GA 1QEWA 1EO8L 4JJ5A 5F9OH 5F1OB 3LPFA 3Q3GB 4UQ3B 3OR6B 4IRZH 3VH8A 3G6DL 5F9JB 3PWPA 3S3PA 1YN6B 1RIUH 2JE8A 5IHZA 2YA1A 3QEGH 5GXBB 1UENA 5IW3A 3OJDA 1WBXB 4P5TB 1MCOH 2GCYA 2XQBL 4OF6A 2HT3C 3O4LB 4NM8H 5AWNL 3U36B 1REIA 5EUKB 4R4NC 4LVEA 1LD9A 5CJQL 3MJ9A 3CH1A 3RIFF 5C0IA 4HBCL 1DBJL 1SMAA 4NQSA 5I1EL 2MQCA 3GMMB 4OZGF 4KK5D 3V4UH 2YBRB 4RQQA 1A5FL 4Z7UF 3QEUB 2R9HC 3F12B 1BQLL 1TMCB 3DARA 5HYJE 4M6OL 5A1AA 2FEDC 3KLDA 3T0EC 5D1XD 1AHWB 3ARFC 3QFJE 3DX7A 4OCSL 4FA8A 1B4RA 3S3JA 1IBGL 2KQNA 5LGJB 2AEPH 3GJEA 3P9MA 5B3JE 3IJHA 4LCCB 4OCWL 4LIQL 5T5FH 1NCCH 2IADA 1UM4L 3BXNA 1N26A 3HG1D 5JZ7C 1GZPB 5C07A 4OV5B 5I74C 1T5XA 4PJ5E 5ANME 4HUNB 3ZYOA 1C16A 1HINL 3PWLA 4XP5H 2ATKA 2VSCA 4BZYA 1YPZA 4G80B 3SGKC 4R90H 4PJ5D 4PRPE 2IPKA 3FB8B 3VFMA 5BS0A 1NUFA 2HLFD 4LP5A 4X7EC 1IJ9A 3N85L 2CXKA 2J5LC 3QHTC 5IGXH 3S88H 4G8EB 3SDAB 4GAGL 2OMBA 2AJXL 3L3IB 5D7KD 5KBNC 4Z7NE 2ZNXA 3VI4F 1KNOB 3GMNA 4KKBC 3V8CA 1QYGH 5DRXB 4F7EB 1CICA 1BOGB 1I3UA 4WI5A 4QRSB 4NQCD 8CGTA 4JY6A 1Z2KA 4YK4C 3WDHA 5SV4A 2V17H 1ETZB 3M8OH 5D71L 2O5YL 4LCUA 1E4XI 3CFBA 4TSCH 3QH3B 3GM0A 3VMNA 3W81A 1DBJH 5DHVH 1Y18A 1ZGLA 2AV7B 4LSPH 5GGTH 5JA8B 5IQ9B 3BN3B 3QXUA 1UH2A 4G6ML 5IF0A 4HXAH 4JO3H 4PJHE 2CLRB 3PGCA 2ADJB 3IDMA 5AG8A 4MSWA 4U1GB 4YQXH 2AEPL 3MLTA 1PZUB 4O2FB 3BP5B 4XNYL 4JFEA 5KJRL 5EC2A 3T4YA 4XBPB 5C0FB 4PJ9A 5DJXB 5C0RH 2WQRA 4HS3A 3BKYH 2V7NB 2DQHL 2VZOA 3EJYC 4C56D 1MRCH 4MNGB 3RWJA 2H32A 4O2EB 3RX7A 2ADIA 2J8OA 1HQ4B 1C7TA 3QUYB 3LN9A 1OSZA 5INCB 2SEBA 3GMLA 1P7HL 4XVJH 3WL9A 4L9LB 3OR7B 4E41D 4WWKB 4I0PC 5FO9A 3EDFA 3U9PH 4OFYD 4KHTL 1BZ7B 1JGLL 1PKQA 4NPYA 3QCUH 3WHE1 4FOMA 4HWBA 1HHGA 3B9EA 2G60H 3P9LB 4DVBA 2E5EA 5IWLC 4MMZC 5DZLA 1J0IA 5I9QC 5F6HI 1NKOA 4P5TA 1A0QH 1V8HA 3D25A 2BVQA 3QHFH 2BERA 4ZODA 3DROB 1A3RH 4GSDH 1A1NA 4MZ2A 1I9JH 3SCMA 5JW4Q 2C26A 3QJHA 1C12B 2Z93B 1K8DB 4KUZH 4CVZB 2H6PB 2ZOLA 1EHAA 1U95B 3MLYL 4JANA 5JXEA 5CILL 3RNKB 1HNGA 5GGTL 1RZJH 3HNVH 5E2WL 1YPZF 2FR4B 4XNMA 3TF7C 2FGZA 1Z5LB 2AK4B 1ZANL 4GUPA 1JWUA 4PG9B 1KOAA 1YC8A 2QSTA 4X80L 4IS6B 1L7IL 3HE6C 1KBGH 4MQXC 1XEDA 1RJLB 3ORJA 3MRQB 1H3XA 3TA3A 5SWSA 5SX4I 4NJ9L 3FQWB 4PLKC 5DXWA 3LVEA 3G5ZB 1JWUB 4PG9A 5GGVY 5HGGS 1IKFH 4YK4B 3HE7D 2DQHH 3QXTA 4WHTA 1D6VL 5MEPB 4N90D 1YEFH 2F8OA 1UZ6F 3U2SA 1I1YA 4HKJA 3GRWH 4U1IA 1L4IA 1AQKH 3UJTL 3HZMB 4Y1AA 5ADOH 3ZE1E 4I3RH 4D9QD 5DEGB 3O3EA 4AMKH 4I1NB 1IL1B 2VISA 2CO7B 1QHPA 5EU5B 1CLCA 1X4ZA 2H1PL 1D9KD 3QEHA 2B1HH 2JK5B 4PRBB 1LP9F 1KG0B 3DWTA 5GRUL 4HFWA 1FLTX 3DRTB 4JPWL 4M02A 3DIFB 3BYYA 4JPKH 5I8KH 3DGGA 1WFTA 5DO2C 3NCJH 4CRPA 2F58H 3O81A 1Z3GH 1JUFB 3PIQB 3X11A 5F6HJ 3T4AB 2DLEA 2RCSL 2RFXB 4R0LA 1LO0L 2R1YA 5JHDB 3SGDI 5DFVD 2GKIA 3KWWA 5T1KA 3LAFA 3TCXA 5EO1B 1EFXD 4PGEA 4X99A 2BVPB 5AZ2H 5K93A 3C9NA 3MLPA 1ZGLB 2X4PA 3KPPB 3OJVC 4WFHE 5CJXA 4KQ3L 3MREA 5LQBH 5DJYA 3ILQC 3HNVL 5DJCA 1CR9L 4R7NA 2LVEA 5GRYA 3NA4A 2BY3A 1FG9C 1I75A 4GRLD 3U7WL 3DTXA 3OAYH 4MNGE 1ZANH 2ZCKL 3D0VB 1CFQA 4Q6IB 5DJ8A 3ZE2F 1L7IH 4HUWA 4PJHA 5GJTH 3QSKB 2ZUYA 2C7UA 3ZYJA 1FIGH 4H1LH 3MJ7A 4ODXA 1KLGA 3WXWH 2YPKA 2Q86B 1FCGA 4YXLL 2XWBA 3ZKNC 2EDBA 3VRLF 2FEEL 5DUPL 1P4IL 2R2BB 3RRQA 1ZT1B 4PJHB 4FFYH 4G6AD 3ARUA 3VFRA 1UKSA 3TPKA 3EJJX 1CS6A 2DBLL 3TN0C 3CFJA 4DK6A 2JF1A 3TLRA 5D4QA 1DVFB 2C3VA 4YBLC 4MXWL 2WW8A 4K94H 5DHVA 5KANI 2AP2A 4QWWC 3DMMD 2C1PA 4YDLB 1QEWB 4NT6A 3SGEH 2YD6A 4PRIE 4JCMA 4Q9RH 3QG6B 1BFVH 1YNLH 3IJHB 4N5UA 5KVGL 3O3DA 2ZUSA 4I77H 3WXVH 2NXYD 3JWOH 4NRZA 5TH2B 4D8PB 4Q9QH 5F7DB 4G6KL 4Z9KB 2QQKH 5FCSH 4MX7A 1TZGH 1LO0H 1UWXK 1INEL 1P7KB 2G75A 1FAIH 1VFUA 1KENL 1MCIA 5L7XL 3S4SG 1C12A 4IMKA 5AZ2L 5HY9B 4NQSB 1J11A 1ZEAL 3DYMA 1ITCA 3MV9D 4PRPB 4QRRB 4Q74A 4JHWH 5K9QI 5GGRA 5HDQH 1XF2B 1G7LA 2YD7A 2ZG1A 2DD8H 5FYJD 1N6QL 5BW7A 5KSVA 3V0WL 5C9JB 1RUML 3H9SD 5HHXL 5BO1L 1MF2H 3A67H 4OUOA 1J10A 1HXMA 4N0YL 4HC1H 3QFJA 4XCEA 1TPXB 3LEVH 2YRPA 4OQTL 1S7RA 1YEHH 3P9MB 4YHIB 3QDGA 3ROOB 2JCCF 2AK4D 15C8L 1RK1A 4OCYH 2VLRA 1CGYA 2NZ9C 1L0XA 7FABH 1UM5L 2CKBA 5KN5A 3QFJB 5HYQB 1C16B 5HYJB 3KPMB 3MUY1 1FLRH 2XA8H 1PY9A 3KPTA 5HHOD 5GSVB 3SDDD 4ZD3L 3VFPB 1I1RA 2W9EH 3RWGB 4MXWH 1RUAH 1YEDB 5B3JF 3GSUB 5E5MB 4X6BA 2C3XA 4RGMC 3LN4A 1T04A 1HSBA 3O4LE 4X6CE 1ZGLM 3ARZA 3FFCB 1UEYA 1T22B 3LQZA 3RI5F 3B9KC 4TUOB 1A6AA 1S5HA 3W11D 1AIFB 5F1KC 3CFIC 4G6KH 1KGCE 3QFDA 4Z7UE 1T1YB 3PF2A 1ZTXH 4Z7UA 1NBYB 5CKGA 2V7NA 2Y72A 1DQJA 3TYFB 3OG4B 3MV7E 1B88A 3O6FC 1HWHB 1AD9A 1FAIL 3O3BA 3KXFB 5L7XH 2ADFH 3W0WA 2R2EB 4P2YA 1J5OL 5DR5H 1V7ML 4G5ZH 4QOKA 1CFVL 4LASH 4DKAA 2X4PB 4PD4J 3OR7A 2NTFB 1UJTA 3HC3L 3I6GB 1J87A 1HEZA 5CINL 2DYPA 4NDMB 3UAJC 1VFMA 3T04D 3QIBA 4JRYA 3OAZH 5I6XB 2ESVE 4NHUA 4LVHB 4C4KT 1AY1L 1BOYA 4JFFE 5C09E 5A40E 4XC1H 3HLAB 5FFLA 1BAFL 1MFEH 2R9HD 4MNQB 5F3HA 5EU4B 5JXAL 1OAXL 4HJ0C 3ZLQC 1N0LA 4JFEB 2J12B 1WJ3A 3TBWA 5FHAL 1CLZL 1OTUC 4RFNC 2P8MA 4UT9H 1A4JA 1WWWX 2HN7B 4X9FA 3V52H 5CSBA 1RFDL 4O9HH 2X89D 3MCKB 5EBWA 3HMXL 2R0LL 5B38G 4P5KB 1AGFA 3DHMA 1A7BA 1JHLH 3GI9H 4WI3A 4Y19E 5IB3B 4M5YH 1ZT4B 4MWFB 4JPVL 4LCYB 2W9EL 3VG0H 3G9VA 3HCVB 3QA3B 5CIPB 2VWEC 3QIWB 4XNMB 1XZ0A 2GSIB 1C5DB 3TFKD 3KJ6H 2N7BA 2XKSA 5HVFB 4OIIL 4Z7WA 1U2CA 3G6JF 3B9KA 3HAEA 5HJ3B 3WFHA 3MODH 1N6UA 5I17B 1NANI 4KKAD 3T2OA 5TE4L 3WSQL 3BO8B 1URLA 4HCRA 1T2QL 1V3MA 5FV2A 4KRPD 3DX6B 2DQTH 4P48A 1QLFA 1LK2A 1AGCB 1QOKA 1JYWA 4PPTA 3TVMD 3VFVA 4BFBD 5IW1A 4LQ1A 2COQA 4EKXA 1FFOA 4Q9BA 1G7HB 4JANB 3O3EB 1ES0B 4JGUA 4JR9L 4CN4A 4HPOL 4YGAB 1KCRL 1XCQA 1WZMA 3U6RB 1I7UA 4BKLB 3B8SA 3PABA 4V2CB 1S9WB 3MOQA 1XF3B 4FTVE 5LCVH 5KSAA 4P4KC 1MWAH 2IAMC 1KB5A 3WJJC 1I8KA 4M4RA 1BAFH 1MFEL 3SGJA 1S78C 2JCCE 3KYMB 2MWCA 4PUBH 4NFCA 3SY0B 2VE6B 1A6UH 4O58L 5B38B 3BIKB 4NQDA 3O2DL 1WBZA 2W92A 3J7HA 2H2SD 5E7FA 2FWOA 3KXFD 1JI1A 1AGBB 4TUJA 3E3QE 3GSNB 4FXGB 3AFLA 4O9HL 3VXNB 4JQIL 4NQUA 2LFGA 1EA9C 3KPMA 4OCLC 2XN9A 3AY4A 1TJHH 2LU3A 2NQCA 3CFCL 5KVEH 2XNAB 1U8PA 5E8OA 4YHOL 1BVZA 1VADB 1FIEA 1CXEA 3QDMB 3UZVB 2ZWLT 3UDWC 2GSGB 4XPTH 1ZLWK 3RA7L 3W9EA 4V1DA 5D7LA 3O6MH 1JGVL 5E6ID 5JIPA 1NDGB 4W6XB 5TE4H 3WKNA 3C08L 3CU7A 3TYFA 3UTTE 1BBDH 1PQZB 1WK0A 3IDJB 1RU9H 5IBLC 1DSFL 4XGZB 4JFQB 4NZTL 3SJVA 1EEZA 4HLZG 4F7CB 1L6ZA 3MUHL 5K33A 4ELMA 2NR6D 2YPLB 2EIEA 4WHYG 1S9VA 2WAHA 1IEBB 2WANA 7CGTA 1UB5A 4ESKA 1MHHA 1RK0A 5EOQH 2DYPB 4HGWB 4NDMA 4Q6IA 2GITB 3MLRH 1QVOA 1CD1A 1TJIL 2APVA 4ZPTB 4KJYB 4X6DB 5EUKA 4LCWE 4LDLB 2DKUA 3PQYD 1Q9WB 5DJ6B 1KTDB 1MAML 1AFVH 4P2OA 5C0CE 4FQIH 3O2DH 1KYOJ 2UZIH 3JXAA 3L5WA 4LRNH 6CGTA 4F33A 4KI5C 4DQOH 3N9GL 5DA4A 3ECBA 3OGCB 3GKZA 1JPGA 2ED9A 4CN1A 3H3PH 4DZ8B 2OL3A 3HPJB 3NFNA 4Y0GA 4TULL 4OLXL 1UWGL 4FQ2H 3DVGB 3U2SB 5F8QC 2KBGA 3SGEI 3GGWA 3UTQA 3PNWB 4P2RA 3ULUL 4JO2H 3QIWA 1MEXH 2GSIA 4PREB 3M1BA 2R69L 4AYFA 1UXSB 3B6SA 4GOSA 4K3JL 1UWEH 4QGYA 4OV5A 1ZLVH 3IVKA 1QRNE 3PHQB 1QBML 2Z92A 4TOYH 1BQUA 3ARPA 5T1MB 3PXHA 4G8FA 4K7FA 1I1AD 1SYVB 1KIPB 2XY2A 1UCBL 2EXWD 1F2XK 2FO4A 2X4TA 3QCTH 1P7QB 2Z91A 3T0DA 2J3SA 2ESVD 5DUBB 4TVSa 4LPWA 4YHYC 3MRLB 4I8DA 3V5KB 2EDQA 1QRNA 1A22B 2DQIL 2XQBH 1PKQE 3D2UD 4JKPL 5D1XB 1H8OA 5EZLB 5IESL 1ACYH 1ZVSA 3O6KL 3LKRA 3LV3B 3PJSB 4HPYH 5CJQH 3WFZA 3VRJB 3QWRA 1I4FB 3AM8A 2CLZB 4TNWK 1HXYB 3FMGH 4JY6B 1DEEB 3AY4C 4XZUA 1JPFB 2BNRB 5DUML 3DVFA 5AEAA 5IMOB 3MV8D 1G9MC 3FFCA 5KSUA 3VGDA 4JRXB 5I76B 1IGCH 4S0SD 4OKVA 4JQXC 4WGWB 3JWNC 2NY4C 1DL7L 3V6OC 2UZIL 3QDGD 4PJBF 2HFFB 2FEDD 4MJIB 2IFGA 2ZSVA 2OJEA 3ARBB 5F97E 4LIQH 5T5FL 4EJ1C 4D9LL 3EO1A 3FONB 3EYVB 4MXVF 1N59B 5IBLD 1Y0LB 2LU7A 2WBJA 3ME0A 2P5ED 3NCCB 2WZPD 2V9QA 5I71C 1G7QB 1OTTC 4MD4B 5T1DH 5ILTL 1QA9B 5HHMB 4PJBE 1T89C 4DGYH 4EXKA 4JDTL 5DD5H 4OLEA 5C09A 3UBXG 4JFPB 2FBJL 4Y4FC 1OGTA 5F7LB 2BY2A 1KTKE 4S2SA 2BNQB 4QNPE 3EFDH 3C2AL 4JG0L 2GAZB 5C9KA 4XP4H 1DQDL 4GAGH 1YQVL 4K8RL 4LCIL 2X4QA 1S9KC 4JVWA 4XHJD 4U1LB 3BZDA 2ZJSL 5IKCA 1X6NA 5DD6A 3QDAA 4QHMA 1NH6A 4P9MH 4TUKH 4X6FA 4PD4K 3B43A 5T1LA 4HFUL 5DI8B 2HVJA 1F00I 1G7PA 4TQEH 1JF6A 2VDMH 1S7QA 2W0FA 2YMXL 1JMXA 5FYJL 3HCVA 3W0WD 5CIPA 1MCKA 1IGIL 4MA7L 5FGCB 3FMGL 1CDBA 2JJSC 2G9HB 1C5BL 4M7ZC 3S35H 2P7TB 2VDLL 1GHFL 2YPLD 3FOMA 3TO2A 4UIKH 5FK9A 5DRNB 1CD1B 4RRPG 3ISWA 1S8DB 4G6MH 3GIZH 5JOFB 1YN7B 4WENB 5DJCB 5FGBA 3BDYH 4PJ5A 3TBWB 4YHNA 5GSRA 2PO6C 3PQYB 4OQ1A 2JCCA 2XWTA 3I02A 2EDFA 4U49A 4ZS7H 4FZEL 4P99A 5T33H 4YPGA 3BKYL 3F62A 3O8XC 3EOTL 5JLZB 3KPOA 3NPZB 5I15L 2APTA 3LH2H 4U1NB 2HTLD 1VACA 3QO0B 4PREA 1QO3A 3LIZH 1QBAA 4XVJL 3MBEB 3SDXA 4APQB 4YPGB 4Z8FL 4PLOB 5I17A 1CL7L 1ZHLA 3RTQD 3QWOA 5CD3A 1IEHA 3WE6A 4NKDA 1HWGB 2YSSA 4X4MA 3U82B 4LCIH 3RKDD 5L9DL 5DD0H 4UINH 2DM7A 3T0BA 2YN5A 1T6WA 2NY0D 4N1CA 2F19H 1A6AB 2Y06L 1CXHA 4YHZL 1OGAA 1V3LA 5TDPB 3P11L 1PD6A 2YD3A 4QHUB 3BSZL 1SEQL 5DDHB 3ZO0A 1P9MC 3NZHL 3A6CL 1MVFA 4YXKL 1BOGA 2BVOB 1WEJL 4IRZL 1AJ7L 4LFHD 1E6JH 3OQ3B 1IAMA 1MFAL 3G6JE 1Q0XH 1SMOA 1MCOL 5GZNC 2FHBA 4J1UB 5E2WH 3IAGC 2G2RB 4H88H 5FGRA 5IK3B 4WTXA 4RIRB 4IRSB 3GIZL 4WO4B 2VAAA 3BDYL 4NHUB 4U1MA 1K8IA 3RHWF 3PWVA 3NGBC 1AGDA 3ARFA 3FRPG 4CVWA 1JV5B 3JZ7A 3RBGA 1VKXB 3EOBB 3G6AA 4RCAA 4NQDD 5IK3A 3FO1A 4NJ9H 4ZOEA 3N1MC 2EDLA 1D9KB 1SVCP 1M7DA 5CJOL 3QCVH 1CXKA 5C0JB 2YEZA 3VXPB 4HWZB 3REVA 4X5WA 4OCSH 5H94B 3TN0A 1U8OA 4Y2DB 1A7NH 4DVBB 1D5IL 4NO0B 5J7CC 3ZHKA 5C0BB 3UJTH 3MLUL 1NCCL 1CIDA 1OTTD 4J3VA 1JGUL 3VXUB 2CLVA 4J4PD 2Y5EA 5HDBE 4KKAC 4XVUD 3P4OA 2I27N 3MLVL 3OTTA 4PB0L 4MD5A 4PJCA 2MTPA 1EAPB 3OAYK 1XF4A 3TZVD 1DANU 1AI1L 5M95B 3TVMA 1FFPA 1MFCH 4CBPA 3QUYA 1OTSC 3GJFA 3GBML 5IVZA 4GW1B 5JW4R 1BGXH 1MI5B 1XGYL 3TFKC 2K1MA 3GSQA 3KVQA 2CK2A 3NCJL 5DD6B 4EI6A 3OGCA 1IMHC 1QFUH 1K4DB 2DQFA 3FFDB 1QG3A 4P57A 4ZUUB 1CGSH 4FQCH 4YBQD 1U6AL 4XI5D 3U7AA 4XPFH 1S3KH 5A2LH 5DQJB 4M1GL 4MCZB 3S35X 1H3UA 3TO4D 3CX2A 4ZFFA 5JHLL 1HKLH 2A2QT 5LQBL 4PGCB 3U0TB 3IETB 3FO2A 4P3CL 2NY6C 2X09A 4RFOL 1S7VA 2QQNL 2VLKB 1HEZB 1LDSA 2YA2A 2FX8L 4JKMA 4GRWE 2H2PD 5I1DA 4ZUTA 5EUOA 5ICXA 4LSQH 2Z91B 4Y1AE 4P2OD 4NBZB 2HJFB 4PRHA 4GW5B 4LRIC 3AMLA 4Z7VB 3PP4H 4DKFL 3D2UA 1N3NA 3CX5J 4NQEB 5DTFB 1S7VB 2LABA 3RNQA 3T77A 1EX0A 4HJGB 1NAML 5C6PB 3FT4B 2CKNA 4FFYL 4X9BA 3QXAA 2QKIB 1LE5B 4EUPH 3C8KA 5CEZH 4QTHB 4OZFA 2XT1B 1FH5H 1JPFA 4GAJL 1RJYB 3UTOA 2X1QA 4OZFH 1U3HC 4UDUB 1NGWA 1B4JH 4NRYA 1ZT4A 2O5XL 2PUQT 3QUXC 2IBBA 1VADA 3QDMA 1AI1H 4OZIE 1DR9A 1BF8A 3WE6B 4H20H 4C4KO 4X4YA 3X3GL 1KN2L 4LK4A 1BGXL 3GJFK 4G7YL 4S1RH 2VLJD 1HCVA 3SDCA 3T0WA 4Q9RL 1CCZA 4LRIA 5ALCL 3NH7H 2IEPA 1NDGA 2CR3A 3WXVL 3QNZA 3B9VA 5E2UL 2QQKL 4F57H 1CGSL 4DGIL 5IB1A 5CFHA 3OWEA 5T3ZE 2E9IA 5TQ2H 4ZXBA 1U6AH 5HGHA 3IDXH 4PJDB 3F5WB 1CD9B 1RPQA 5BOPA 1MIEH 5L2KD 1EZVX 3JV5A 4OT1H 3T65B 1TXKA 2VKXA 3SKJH 4YAQA 5E2TH 4PV8A 2AV7A 5GZND 1TITA 5HDQL 1G9EA 3L3IA 3WIHH 3QIBC 3C5JA 1RY7B 4EUPA 3JV6A 3TIEB 5EIIB 5HHXH 2BY0A 1A3RL 4GSDL 5CZVL 4R8WH 4QRTB 4MB3A 3IDMB 4I2XB 2Q8BH 1B0RA 3VU2A 1ETZA 2EDTA 5DT1H 3ROLB 2DL2A 2BFVH 4BSVB 4R7NB 3MV7D 1FQ9C 3MCLL 5D93C 5DLMH 5GGRY 2P5WA 1WBXA 5INDB 4OM0H 2EO9A 4K7PY 1S7QB 2W0FB 2BY1A 3FFCD 3LKQB 1FNSH 3NA9H 4XTRD 4M3JA 5DD3H 2MCG1 3MRMB 5EBGA 3HNTL 1GOFA 4H0GA 3LD8C 3OPZL 3NFSH 3BIAX 2HTKC 8FABA 2H41A 4L4TB 4TPRL 3IAPA 5I1KH 5HPMB 1ZWIB 3VXQA 5I0ZA 1FSKB 1JNHB 2WP3T 5FF6A 2NLJA 3K74B 3WNMA 2OTWA 2NYYC 3MTRA 4PRNB 5D7IF 3SO3B 5CBEB 4OLZH 1AO7B 4JCLA 4L1HA 4WW1A 5GS2D 1NLBL 4ISVA 4EDWL 1DVFA 4HZAA 5DRZB 3KYNA 1T20A 3HUJA 2E6QA 2VLLB 2JB5L 4WWKC 4RAVA 4EI6B 2XYCA 1U8JB 4G42B 4BA8A 1U9KA 1ZTXL 2PCPA 3GMPA 2MJWA 3DX9A 5EA0L 2XICA 5GRUH 2DWEA 4IOIA 5JORA 5C0AE 1J0ZA 5HHOB 1IC4L 4ONHA 4X9GA 4PS4L 5L2KA 2CXGA 2GT9A 4Y16A 2PYEE 3PWPB 5F1SA 3OB0H 5C7XL 2PYFB 2R39A 1Z3GL 2E7MA 4LNRA 1V7MH 4G5ZL 1UVQB 3HMXA 3LSOA 2PCPB 5L2JA 1S9XA 4H25A 4LGRB 1TZIB 2EDNA 5TDOA 4QRRD 4LKXB 1GSMA 1WICA 4MQXD 2AJZA 1AGCA 1CICD 4F8TA 2AXFB 4DTGH 3RZCC 4WNQA 1MHHB 5IR1B 5F9WB 4KTYA 4TRPL 3QB7C 1C5CH 1N0XH 5DT1L 3V4VH 5I66B 5JXAH 4ETYA 5DLML 3SDAD 5BV7C 1ZHKB 5E8PA 4BFEA 3PABB 1QBLH 2EKSA 3LQMA 2VITB 5J4MA 1MLBB 1CLZH 4CVZA 1ORQB 3MPCA 1FN4A 1UFUA 4L9DA 2Y7QB 5LBSL 2OM5A 1JNLH 3UXFA 2AGJH 5D1ZC 3IAQA 2EC9U 1WLHA 4Q9CA 4Y89A 2VDNL 1ADQL 4H8WL 1BJMA 4CNIA 2XN9D 3C8HA 5C0CA 2DAVA 2EKJA 1G1CA 4HXBH 1F42A 5ALBL 3PGCB 4M7LL 4AL8H 1F4YH 5IP4A 3STZB 3QR2A 1PAMA 4JZNA 1W72L 4YDIL 4O2CA 5C8JB 2FECL 1R24B 4FQHB 3MRHB 4N9GA 4ODUB 2R0KH 4ZFZA 1CL7I 2XWJA 4OD2A 1IGFH 1ZE3C 4XB7A 2EECA 4OM1H 2H32B 4Y16C 2AABL 4PJ7F 5FUCE 2RBLA 1QP1A 4OZGE 2IG2H 4C56A 4F7PB 1CK0H 2J6EL 2AXHA 5MENA 5FDWA 1WWBX 1R3KA 4GKSB 1MHPH 2P8MB 3O45A 5DJYB 3SBWC 2R0WH 3NIGF 5I1GH 5EIIA 3BESR 5D72H 3S34L 4QRQB 1XGUA 2NY5L 4XRCB 3RL1A 3WO4C 1FYTE 5FV1L 1JRHH 3MGAA 3ARFB 4EN3B 4C56E 4AM0A 1N6QH 5IQ9A 4XNXH 5ESAB 3UO1L 2B4CL 5FM8A 1R0AH 1HHIB 2YZ1A 4M7JL 3S4SB 3WFCH 2GTZB 3A67L 3SDYL 4QYOB 2CRYA 2DQCL 1KIRA 4I9WE 4PLJC 1T3FA 2DLHA 3KPRE 1OT2A 4UOJA 1IGMH 4JQIH 3ARRA 3ARBA 3KAAA 4D0DB 5EC1A 3VXUA 4OBSA 1WAAA 5IB2A 3DX8B 4PJEA 4XCFH 5CEZE 1A14L 4NFBA 4MJ4A 5KAQF 4Y4FD 3R0MA 4EQ3A 4UB0L 5LGHL 1WBYB 1TETH 5IBTH 5A16A 3CMGA 3G5VB 4FFWD 4U6VH 2FSEA 1XF5A 3BZ4B 2NY1B 1MOEA 2NZIA 4KJPD 4AT6B 1IT9L 4KHXH 3O6ML 4P23C 2F54E 3DVNB 3QA3A 2BJMH 3F12A 2Q76B 4MA8L 1QFWL 1IGJA 4JO1L 3VFRB 3RWCA 4HT1H 5AAWA 1ZT7B 4W68A 3AU1B 2R0KL 1DQLH 2DYPD 5GZOC 2CIKA 3VWKC 3IS1X 2IH3A 3HE7A 1FPTL 1WQVT 4G6JL 3H7LA 3L7FA 3LRSB 4HD9A 1NAMA 3DUUA 3NCYP 3ULVC 4LAJH 5FB8B 4Y5YA 2JK5A 3UBXI 5I1GL 1JPTH 2VAJA 3NZ8A 4ODHL 1K8DA 2XZQH 4L4VB 4NCDA 3IJSA 3SKNB 2GY7B 5C07E 5D1XA 5C0DA 1CFVH 3T8XB 3EJZC 1Q0YL 4ZAKA 4XNXL 4CMHB 5F7YC 5ESVB 3MOAH 4BZ2L 4IMLB 3WFCL 1XF3A 5CINH 4D3CH 4Y4KD 3NZ8B 2R1YB 2VO5A 1JGDA 2Y07H 4LRNL 1ORQA 4M00A 2H32H 4NQXA 2IJ0C 2A74B 2GHWB 2B39A 3MRQA 5I8OL 4MA3B 2QEJA 4UBDD 2DLFL 2HRLA 4HDIA 4KAQH 1MCRA 1BZQK 1JVKA 1OAKL 1HHJB 1U8QB 3C2SA 1ZXQA 4PBWD 3DJ9A 3CMOL 4P46C 1NCBL 3V6ZB 3TNMA 3ULUH 1X4XA 1JGEB 2XZAL 4HMCA 4HAFA 3BWUC 5F88B 5LGHH 2MNUA 4K23H 3ULSB 1B0WA 2VOTA 4BSWB 1UM6H 3QXWA 2OI9B 2ICWA 4UQ2B 4MA8H 1SBSL 1FZMB 1P4BL 3OKDB 4POYA 1WCQA 1J7VR 3TBSB 1GL4B 1FGVL 4L8CA 4NJAH 3O11B 4KI5D 5A43C 1OGTB 3WIHA 1R3HB 4GRLC 1E0OB 4WIQA 3CLFH 2OR9H 4NN7B 4RBPK 2YN3A 3BP6B 3G5YB 3EYFB 3MV9B 4HZLB 1JWMB 3O9WD 4C83B 1KT2A 4R26L 1PKOA 4WU7B 4EI5A 1I3GH 4ZO8A 5HYEA 3FQUA 1I7RA 1K9TA 2XTLA 1N2RA 4PJCE 4KROB 4CVUA 4PGEB 1ZLUK 5DI8A 4ERSL 1FNHA 4X8XA 5B39G 3IDGA 1KT2B 4WU7A 1Q0YH 3K0WA 4BUHA 2NY3B 3GM8A 5LG1A 5C0IB 5C6TL 3IDYC 2MKLC 4RAUA 4J2XA 4WO4A 4LSRH 4KJWC 3PXJA 3G04A 3OF6A 4YPJA 3VJ6A 3UYOD 4KY1H 3IVKB 1A4JB 3S36L 1J05B 3GSWA 3GRWA 2ARJQ 4LOUC 3BD3A 4JFXA 4D9LH 2QHLA 2NY5C 2X70B 5BVPH 3ALPA 2ERJC 1QFPA 1KLUB 1RZ8A 3P2TA 1NC4B 3RGVB 2P8LB 4ODSH 1NCBH 2R0ZH 5B8CA 3EYQC 4OUUB 3ECBB 1MCWM 5GISL 4YWGL 1SJEB 4X6DF 4KUCF 2QADC 3E8UH 3PWNA 3G5VA 2DJ4A 4GXUN 3K3QA 1UM6L 1U8NA 2D4DA 4PLKD 4F58L 3C2AH 4PRAB 3DSNA 5I73C 5CBAB 4R97C 1KJ3L 5E2VL 4HMEA 1BD2B 1D6EB 4K8RH 2BXZA 3MCKA 4LVOB 4UIMA 5EBWB 3MRKA 1VENA 1A6VL 3SDXB 4APQA 2JJSA 1YEIL 4JRXA 1MI5A 1MHEA 1R3LA 4KKLC 1VSCA 4O00A 3HC4L 3LRSA 4X6EB 2Z8VC 1XCTB 1C1EL 5EN2A 1TENA 4JFOA 3LRGA 1SY6A 3SOBL 2CUHA 2IAMD 1I7UB 5HTSA 3WJLC 5J1AB 1PLGL 2MCPH 4LLWA 5I1AA 3PGFH 4UT6H 5ISZE 2R29L 1HHKB 5GRWA 1FVDA 5GRJL 2ZZUT 4H5SA 5D1QB 5F71A 1D5BB 5E6ZA 4Z7VF 3VGGA 4JN2B 3B2VL 4ZUVB 5T3XH 4XZUB 4O4YL 4QGTA 5IMOA 3G5XB 3MFFA 4KRPC 3K1DA 4ZSOE 3I6KB 3K8LA 4BSVA 5I1LB 4CADA 2Y7QA 2X4UB 4Y4HC 5B4MC 3O9WB 4Z76B 2O61A 1OP3H 3T2QA 5GIRB 4GW5A 3HS0B 3NTCL 3T4AA 5DZOA 5SWQA 2FLRT 2P8PA 2IFFL 1HYSD 4OGXL 2D7TL 4U1SA 1MVUA 4NZJA 2OR7A 1IARB 4IDJL 5B39A 1IGYA 3LMJL 2CUIA 2ZKHL 4UZGA 3ZL4L 3L5IA 2OJZH 5IVOA 5MI0C 2J2ZA 4F58H 4EN3A 1WBZB 4MNGA 2BVEA 3RBSA 2X4NB 4LMQI 1NCAL 1ZHBB 2KQMA 4PG2A 4PJAB 5EU6D 3BUTA 5JMRA 2JB6B 1BZ9A 1P9MA 2R2HB 5D7IA 2ZOKA 2BSSA 4JQXA 2ICEA 5CD5D 3IXTA 2BRQA 4L9LA 3GHEL 1UH3A 4ZPVA 1HDMA 2R4SL 4WTZA 3GMPB 3K80A 4NOBA 2X4OA 4QRPB 1W0VB 1YMME 2V2WA 2VUOA 2FIKA 4GKNB 3QBTB 4GW1A 1JYVA 4ZXBB 1I85C 3QG7H 2HA1A 4PJXE 2VDOH 4POZD 4GG6E 1E6JL 4XNQB 3VE0A 1JK8B 1YMHA 3EZJB 1PLGH 1I1AC 3RL1B 1WBYA 4HIIB 2MOVA 1CBVH 4QXUL 4HWNA 1OSPL 3BISA 5CGYC 2QQQA 2GJ6A 4JKPH 5C07D 1FHGA 5JLZA 4Z7QE 1ED3B 4KROD 4XBEH 1A7RL 5IJKA 2A6KA 5JPMA 2YK1H 3TBTB 1ZT7A 4RISL 3QI9D 1GZQA 1G7MB 1K4CB 1NUDA 3MGTA 2CJUH 3FKUS 3GB7B 1NGQL 4PJ7E 5FM5M 2O93L 3L3DB 2CMRL 5I8EB 4PJFE 1U8HB 1MJJA 4GRMA 3W39B 3SDDA 2BC4A 4G8EA 5F3HB 1J8HB 4R2GC 4YUEL 3NTCH 4DZ8A 2HH0H 2CUMA 3B9KD 4J3WA 1A7NL 1Q8MA 2QSQA 3H0TA 3UPRA 1EO5A 1TQBB 2EYTA 2YZ8A 4P2QD 5DQDL 4L5FH 2Y9RT 1DLFL 4M3KB 1OLZA 2D31A 5IHLB 3BVNA 4BK5A 2GFBB 3FB7B 3N0PB 3LN5A 2YUWA 2MPAL 1HH6B 4B0MM 1U58A 3ESUF 4U1NA 3WNKA 4AZ8A 2QHRH 3IJYB 4NQDB 4HCRL 5IM7A 4F37F 2VL5A 1JGDB 2X9YA 2WK2A 9CGTA 3OKKA 2HMIC 4NBYB 2BZDA 5AYQA 3V5KA 2ED7A 4XMKH 4XP4L 3QIUB 5FECB 1U8QA 4HV8B 2CH8A 3QUMA 4JRYD 3GMQA 2DWEB 3TO4C 2ARJB 5CZXC 4EOWH 4JY4A 4P46B 4KZDL 5CHNA 4AG4L 3I84A 1ZLUH 5I1AB 4ZOBA 1OD7A 1YDPB 2G5RA 5GSVA 1OAUH 1ZAGA 1NMBH 4M5ZH 3L9RB 1YYLL 3GHBL 5L2JB 2CRIA 3TPUA 5IJKC 1M6OB 1VERA 4FP8H 5FM4A 2OQJB 3H9YA 4YAQB 4NRXA 5IMLA 1BIHA 4M62L 4J6RH 2JKXA 2E27L 3F7YB 4UOW1 2ZSVB 4RBPH 4IIQA 1ZVSB 4CMHC 3KJ4C 2FHCA 3O9WA 2D7QA 3JTTB 5F96H 3MUJA 3QNXB 3BQUA 4U1MB 3HKFA 2C9AA 4KXZH 4PJ9D 2Y36H 4PTTA 2HH0L 5D2NB 1EEUA 5E8PB 5FYJE 3IU4L 5IV2B 5MEOA 4V1DD 1BIIB 3GBNH 5DQDH 3FHQA 5E7BA 5E8NA 2AXGB 2P5WB 2EICA 3U0WL 1WAAF 4XPGH 5CSZB 3RVTC 2AK1H 4KJYA 1B4JL 5BZWB 2NX5D 2ZUTA 3L3KA 2V2TA 2DRUA 3MNWB 4R9HA 5I15H 4XP5L 1YJDH 1INQB 1UA6H 1LO3H 5JOPE 1WGOA 3KPSD 1KN2H 4I0PA 4WHYH 2OCFD 1KTLB 1HQRB 1RHFA 2HJLB 4AT6A 1PFCA 4XCYB 3W9EB 4XPBL 5I16A 5K9OB 3W2DH 5FKAA 1E28A 1MI5D 4X6FB 1FFQA 1RIHH 3TVMC 2W0KA 5EBMA 2NY1C 1GRWA 4R3SB 2C1PB 4BFGA 5K9JH 2DQDL 3QQ9D 32C2B 1BJ8A 3P0YL 5DRZA 2HN7A 4PRHB 2Q8AL 3B5GA 4OT1L 4KV5E 1EEYB 1IAIL 1JNNH 1AHWA 1T0NB 1I7TA 3PGDB 2VN7A 5JDJA 1U8NB 1R3KB 4UI2A 4TVPL 1W8OA 4ONHB 3QHZH 5FA4B 4YEEA 3Q6FB 4NKMB 4LCCA 4CJ0A 5BV7H 5TE7H 5SWZE 5J1TC 4KH2A 4HUVB 1QSEA 1FNEB 4JFYB 2X40A 1OAZL 1DEDA 3U9UB 3C5ZA 4RA3A 5FA4A 4CN6A 3OV6A 2DQEH 2BC4B 1RULH 2P5EB 4HXAL 3CUPB 4O51A 2OL3L 4XXDB 5DMYA 1KTDA 3T2PA 5ADPL 3JSSA 3QUYD 2WLZA 4W4OA 2EZ0D 1NJ9B 5EPMA 3V79C 4CVXB 5GS0C 2FATL 2CLZA 3AREB 5TQ0L 3C6LA 4RMQA 3D2UB 1MCDA 3LKPB 4NWTH 5C0AA 1MPAH 1WF5A 5AWNH 4XXDA 1Z6JT 2ZUQC 2W60B 2QLVB 3DXAD 1JGEA 5HYJA 1S78D 5EO1A 4UAOC 4G7VL 3PNWA 4LFHG 4QRUA 4OZFB 1W72A 2A73A 5I1EH 3UROR 3H9SE 4UAOB 5I1LA 1AC0A 2PR4L 2CDFA 2HG5B 3L5XL 3CK0H 1YEGH 1RMFL 3MRNA 4AH2A 1DBBL 2JLLA 4NNXA 4QRTA 1MFCL 2Q1EA 1NCTA 2OSLB 3DRQB 1R3HA 3SEPA 1S7XB 3SDCB 3RPIB 1IGTA 1L0QA 4K71B 1JPST 2CIKB 3DI3B 3JV4B 1A2YB 1UM4H 2MQ3A 2RJMA 2R1WA 3BW9A 3QDHA 4S0TD 3U0PA 3SBWA 5KSBE 3PHOA 1JNNL 4ZOAA 4X7SH 3I6LD 3MXWL 5MEND 2DWDA 2YA0A 1BJ1H 1A3QA 1TQCB 2FX9H 4NQTA 2Y4SA 3KPSB 4HH8A 3CXDL 4MGXA 4R0LC 3QUXA 2VR9A 4S1SH 1O0VA 5HI5D 2OQJA 3V4PH 4M1DL 4E41E 3BQUD 1T5WB 5C2BH 2C1OB 2FH6A 1TVBA 4MB5A 4P49A 4I18B 3VXRD 1PX3A 4PJ8D 5K9QG 4GXVL 1RULL 1X7QB 4DEPB 3TA3D 2X4SB 3VDBA 3WJJA 1Y6NR 5DYOA 2VRAA 2LAGB 4I2XA 3RKPA 2H2PC 4ZYKB 3KPPA 2H45A 1Q9OA 1O5DT 4LSQL 3ARGC 4IRJC 2IPTH 4FQ1L 3VE0B 5J57B 4RNRB 5D7LE 3SJVD 4KUCD 4NNYA 1BFOB 2V17L 4WI7A 5IW6A 2EC8A 2A0LC 2VH5L 4QYOA 3BKCH 2VLJE 4ELMF 4TSCL 4IOIB 4PJIB 1T7ZA 5MHSD 1S8DA 1AGDB 2IANB 4MAUH 3C5ZC 1JIBA 4LMQE 3ES6A 2ILLA 1NFDE 2WLYA 5HI3C 4WCYL 2CDGA 1B0GB 4M7LH 4ZFOA 3LQAL 3MACL 4MDIB 1KN4L 4NKIL 4M93B 4JHAH 1HK6A 5HYIA 2EH7L 1JTTA 3T0XA 2O5XH 4GBXC 1P2CA 1DBBH 2OTWB 4ENED 1AQDB 1IC5H 4S1QL 2HWZL 1QSFA 3SE3A 4JJ5B 1P5VA 1PG7X 3ARDC 4MCYB 1IC1A 3NH7L 5J12B 4XNYH 2EYRA 1ZLVK 5E9DD 1BMGA 4NQCE 5HI3D 1B3JA 1OF2A 4XAKD 4HIIA 3RJDA 5ACLA 2V7HB 5IB4B 5EN2B 1MHPL 3K4ZA 2K7QA 5D2LE 4KK5C 4RFEB 5DJAB 4M4PA 1CE6B 2I07B 2DB8A 4QTIH 4KK9D 3ZDZF 4Z5RA 4R6UA 5FO8B 1P5UA 5IHBA 4ONFL 1K4CA 1CXIA 2ATPB 1V05A 3BEVB 1U93B 3FOMB 4X4ME 4YGVA 1S7WA 3OAUL 2PW2A 4KMLB 4DVRH 1CE1L 3UO1H 4ZUVA 2B4CH 3KYKL 1R0AL 4Z7VA 5CZVH 1KJMB 2BOBB 4O51B 4ODBD 3CCHB 1UKTA 4WNQB 2FL5A 5CGYD 4LSTH 2J8UA 5D96B 5AZEL 3RU8H 1KIQB 1R3JA 2EYTB 5M94B 4L8SB 4C57C 3HUJE 4DFHA 2XA3A 4M43L 2KUTA 2E9BA 1FYTD 1CFBA 1JFQL 3PWJB 4UDUA 4NC2B 3QHFL 4N0UB 2VKWA 1ZHNA 1U58B 3MLXL 3DGGB 3EDKA 2R2EA 5HYJD 5J11C 2R2CA 3S6CA 4U6VL 5BXFA 2EEDA 1KN4H 3UTZB 3R8QA 5FYLE 4Y7MA 1NGZB 3O45B 3CVIH 2X1WL 3EOBA 3J8F7 3FRUB 2WWMD 5SWZD 3GSRA 3Q5OA 4AIZB 3RDTB 1BX2B 3WFEL 5L0QB 4PJIE 1IM9B 3ZE0F 4KRNA 5H94A 3VMOA 3DV6B 3V4UL 2B5IC 1IC7L 5D7LB 1YNLL 5DJDB 2DIAA 4YH6A 4I77L 1DE4A 1OY3B 3S4SA 1MHEB 1TDQA 2V2WB 3O4LD 1INEH 2HKFH 3SQOL 4DKEL 1F3DH 1EAJA 2VB5A 1EZVY 1JHTA 2VLKD 4XP6L 3BP6A 1IM3B 5DJZA 3M17A 5KG9A 3O8XD 3DO7B 4TTDC 4X8JB 4JHWL 5KAQG 3BPNC 5FOBA 5FIEA 2BNQA 1T1WA 3V0WH 3KYKH 2EYSB 1JHKH 5T3XE 3GDBA 4Y8DC 2WBWB 1CDJA 5DFWH 3BQUB 1MCHA 2XACC 1MY7A 3V0VA 1UQSB 4KDTC 3L3GB 3HAEB 3MUGA 3JUZA 3MRMA 1G6RL 3BH8B 1YEEL 2HVKA 5MP6H 4EUPB 4HSQA 4X9IA 3VD5A 4RNRA 3K7UA 4GAYB 3LB6C 4RGNC 4PGDB 5J6GB 2WBKA 5KSBA 3PV6A 3RWJB 3HE6D 3EYSL 3UBXA 4K23L 4K9EL 3QNYA 2CDGB 5E4EC 2WIIA 5E5UB 3RWIB 5EC1B 3H9SB 2VDNH 2KKQA 2I5YL 4FQPA 4ZD3H 3C6SB 4U6XB 3STLA 2NY1D 2FR4A 4F9PA 3AXLB 5KSAB 4MHHG 3M1BB 2GTWB 4NO3B 2CGRH 3DX9B 4LLVA 1TVDA 4LVNC 4MAYA 1TIUA 4YIQA 1F4YL 3VD9A 2HFGH 3P3YA 1FE8L 3MV01 3EYQD 4CKVX 2X4RB 3LQAC 2PTUA 4WFEE 2GTWA 3ULVH 4LLMB 1QFHA 3THML 3V5DA 4DK3A 3ESVF 5DHXB 3F65A 5L8LB 4DKEH 2FO1A 2VZ1A 4NKOB 2VDRL 1IKNC 2FJHB 4MA3A 5T3ZD 2MMXA 3VH8B 1AKJA 2AXFA 2VLME 4XPAL 1U95A 4KWUA 5SWZB 5A3IC 5C0RL 1IL1A 2VISB 4I0CC 2V9TA 1A64A 1MHCA 4K3EH 3RI5K 2AV1B 4JO4L 5IG7B 4GFTB 4YEFA 3F6LA 4LSRL 2Q3ZA 3KDMB 2FIRT 2AXJA 5IMMA 5DWUL 4NC1C 4AIXA 3ULUE 2PO6D 4DN3L 5HHNB 3JWOL 4Q9QL 1YEDA 1NFIB 4YR6A 3HE7C 4PRIA 3FO9B 3FQWA 3QUKA 5MERA 3BP4B 2P45B 4ZS6D 4RSVA 3SDYH 1KEMH 4MJ6A 1PGRB 4OZHE 4M61B 3CDGB 2OP4H 5F8RC 4UV7H 5FUZH 5E4EB 3EW3B 3L3JB 4QRUB 1WCBB 3JTSA 3MLWL 5E1HB 4JDZB 3BXNB 2UUDK 5EZIH 1A0QL 1MFBH 1KB5H 1VFOA 2XTJE 2CDFB 3F58L 3WN5C 1QLEL 1NFDA 5HBBA 2QADB 3MRRB 2WINA 3ULSA 2CGRL 2HMID 5T5NF 4JDZA 2UUDH 5KOMC 1IILE 3MJ7B 1YEKH 1T4KB 4HH9A 4D0BA 5D7IB 4GKSA 5D2NE 1DQLL 4YLQT 1A02N 3D85B 1N64H 4NO0A 1FPTH 2XA8L 1I1FA 2D3VA 3PGFL 3FT2B 2VSDA 5GS1A 3OKOA 2DKSA 1IE5A 1RHHA 5E70A 4ODUA 2H8PB 3MRFA 1MH5A 1XIWD 3F7PC 3GI8H 4C58B 1D6VH 4JO4H 5HVGB 4U3CA 4CDHA 3PG2A 1SJVA 2Y1VA 2QTEA 4YBHA 3IDJA 1AGFB 4PY8J 1Q9LA 5I1JH 1F4WL 1RZFH 2N4IA 3Q6GH 5D9SA 2NY4D 1SBBA 5BQ7A 5DVNA 1G9NC 4RWHA 3X3FL 2IFFH 1A7PL 5JMOC 4OGXH 4FQXD 2A6DA 1BIIA 3MX0A 4U1JB 3S3SA 4AM0B 4MXQC 3MLWH 4HX1A 4WGVB 1WISA 3CSYA 5FUOL 3CFCH 1OAKH 2DM3A 4XWOD 4NQDE 4ODVH 2BHUA 4GG8B 1MFBL 4BM7A 2Q76A 1MCPH 3I3EA 2EDJA 4PBVC 1FFRA 4NCC1 3AXLA 4ZTOH 1KJMA 4WFGE 1AY1H 2N7AA 3X14A 4KQ3H 1JF1A 4XXCA 3WHE0 2FB4H 3GKWL 5D8JL 4NC0B 3TIDB 1NAMB 4ZS6C 4N8CH 3MA7A 4ZFGL 4L3ED 1C8PA 5GJTL 3V52L 5TDPA 4PJFB 3HS0A 4PR5B 3IJSB 2DWDB 2XQYK 3O2VL 4JG1H 1D5ZB 4JEGB 5SWZA 2J8UF 1U3YA 2X10A 4S1DC 2JTDA 4JE4B 4XBEL 3GSNL 3OHXB 1FBIL 4LCWA 2YPVL 4P46A 1EGJL 5J12C 3RQ3A 2DL9A 3FQRB 1J88A 2VYRE 1F4WH 3DUSB 4RX4D 1II4E 1TJIH 1FJ1A 2IGFL 4OGYH 4JDVA 1OAYH 3CC5B 4PJXB 5DQ9A 5JDSB 3D87B 5FYKL 4GBXB 1I4FA 1H8SA 5T5NG 1TCRB 3BP4A 1YMMB 3D85D 2BNUA 4JKKA 1S5IL 3R1GH 4PYGA 4IIQB 3N9GH 5CP3A 1CFTB 5FGSA 1DLFH 5B8CC 1D3CA 2A9NH 4E41A 5JUEL