3DI2B

Crystal structure of the complex of human interleukin-7 with unglycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
195
structure length
195
Chain Sequence
DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-7
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 34
structure length 195
sequence length 195
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di2B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di2B01
1I1FA 4D0DB 1KPVB 3RTQC 4MNQA 5F9AC 3IDIA 1Z0NA 4ZS7H 1FL3B 1U8PA 3IDGA 1EGJA 4U6XA 1LE5B 5HHNA 3SCMC 1OTTC 5CBAA 2VOTA 1OM3L 1N8ZB 5T1KB 2APFA 2NY6B 5ESVA 1HI6B 4P9HL 4FQ1L 1GGIH 5CEYA 1VFUA 2VAAB 4N0FA 3QYCA 1RJZB 1IL1B 1HHGB 1JZ8A 2J7LA 2X4OA 1U8LB 2CDEA 1MWAA 5JHDB 1UM6H 5A2KH 1WC7B 2NXZC 5BV7H 4JM2F 5FGCB 1H5BA 1OSZB 4QF1A 1FSKC 4BQBA 3WNKA 2E7LC 3QCVH 4RFEB 3ETBF 2AEPL 3PV6B 4XVTH 1J8HD 2X4PA 3SY0B 2LV4A 3H9SE 3GM8A 2BNQD 5CP3H 4O2EA 4JHWH 3SGDH 2H3NB 3ZHDA 1A7PL 3Q3GB 2Q87A 1TCRB 1I3RA 3D9AL 1S5HB 3STLB 5ISZA 1JV5A 3OZ9H 1NC4B 1DUZB 5KVDL 2DTML 4ZQKA 4LSTH 4JO3H 4KWUA 5E6YA 3QXWA 1TJHH 5E5MB 1BM3L 4LKCB 2YMXH 2LAAA 1IEBA 1AP2B 5TH2B 2P47B 2MHAB 4HV8B 5EUKA 3ARDB 4ELMB 4H26B 4YHIA 3EOAB 3MBEA 4HW6A 3CFKB 3V79C 1TVHB 4LK4A 1ITCA 2F5BH 4EDXA 1VKXA 3MLWL 4NC1C 4Y5YA 1YYML 2NMSA 1GGBL 5E94A 3TCLB 1UCTA 2P5EE 3RVXC 2O5ZL 3LKNB 2X40A 2COQA 2ZG3A 3DGGA 5GJSL 1T83C 2ITDA 2ZOKB 1K3ZA 3KHOA 2OZ4H 3ZYZA 2ILLA 4OB5H 1RFDH 1S7RA 1XR9A 3KPPA 4MXQC 4DVBB 1BQHA 1OSPL 2DQTL 4PJ9C 2DDQL 4JVUA 2WUCH 5JXED 5C86A 5DT1H 4PLNC 3MCLH 4WHTB 1KFAL 3MMEB 1JTTA 1UC6A 2H32H 1FH5H 4OLYL 4E42A 1FVEA 3O81A 5A2LH 5SWZE 3TBVB 4GO6B 4EXKA 1I9JL 4JHBA 3OR6A 5I17A 4DOHB 2AAVA 1EUUA 4F7PB 4H0GA 4U2YA 3DUSB 4MMZC 3QFDB 1ZTXH 1N64L 1EAJA 3E3QE 4WHCA 5DZLA 4MX7B 1NDGB 1R3KB 3U6RA 3J8F7 3EOTH 2A9MH 2FBJL 3HMXH 2GAZB 4P46B 3WDHA 2P5ED 4YDJA 1G7QB 3HZYA 4LSPL 4GT7A 1DANU 4LCUB 3GRWL 3PWUA 4HUUA 3BHBB 2XRAL 4M1GH 3QEGL 3TT1L 1OGTA 3FONB 4QHNB 3OJMB 4F7TA 4KZEL 3BN9D 4IS6A 4FNLH 4JDTL 1CDHA 4M93B 3ZDZF 1KCRL 3C6SB 4M1DL 4FQCL 4PJEA 1IM3B 4PJ8A 5F8RC 3BZEA 3PGFH 2P42B 3MLXL 1X5KA 4K23L 5SWZD 2HKHL 3JVGA 4LVEA 5AAMA 5JW4N 4BQ6A 4O9HL 3WNMA 2EIZA 2ADJB 1A3RL 2P49B 1S9VB 2Y06L 1N7ML 3FFDB 1RHHB 4Y4FC 5ILTH 1H3UA 3QUXB 1YNKL 5IHZA 2UZYB 3KPOB 4M6AA 2NY4C 4R8WH 2ZPKL 3B9KB 4HS6B 4YXHH 1KTKE 2Z35B 4LPUA 3PGDA 2VSDA 5L88H 1BVZA 1VERA 3C9NB 3UPCA 2Q76A 4JN1L 4LCCA 1U3YA 4OV5B 5D72H 1J1XL 2VN7A 4JRYE 1O5DT 4X6BA 5KG9B 4EVNB 1DJSA 4GG6B 2QQKL 3M8OL 4P2QA 3UP1A 3MLZL 3IYLW 4Z7UA 3BUYA 4TSCL 2VDPH 2BNRE 4MJ2A 1YEHH 4ZO8A 1KCUH 1TXKA 5IFAH 4MAYD 1CFSA 5DRZB 4QKXB 5D7IA 4KKBD 3KXFE 2PTTA 4KGLA 3F12B 4NZRL 1HYSD 3SDXB 4XGZA 1IGYA 4MA3A 2CSPA 2Y07H 2E6JA 3DUUB 4AIXA 2DTSA 3O0RH 4HF5H 1HINH 5DQJB 1FV1B 1HDMA 3U0TB 4Z76A 3TBTA 3F7YA 3MTRA 3EYQC 4KHTH 4UAOC 4OGAD 2CRMA 2A74B 2D03H 2IQAA 3KPQA 1YEJH 4WV1A 1YPZE 4TQEH 3RZCB 3HMWL 3VXTB 4JRYD 3ALPA 1MJ7H 4LHJB 4OCRL 1A6ZA 2B0SL 5C2BH 4UOJA 3TVMB 5CEXA 2GCYA 3Q6FB 3BZ4B 4LSSH 1CDYA 1MCBA 4N68A 1I7TA 4POZC 3MRJA 1NH6A 2BNRD 4NWUL 3V0WL 1FFQA 3HI1B 3TV3H 1JHKL 1E4KC 2VDML 3MGTA 3PHQA 2J6EH 1DBKL 15C8H 2ZJSH 3P11H 3QXAA 4LOUD 4I0PB 4JFPA 3OJDB 4K71B 4XZUA 4OJFL 3KXFD 4RAUB 3RNQB 4R97B 5C0BB 5CWSB 1ZT7A 4RQQA 1S7SB 1IC7H 3R0NA 3FN0L 3MV9E 4OF0A 5EOTA 5FCUL 4PP1D 2R1WB 1DBML 5J57B 2AEQH 4MJIB 4OCWL 2G60L 4M6ML 2DD8L 2MQ0A 4ZD3H 1I9EA 4P2OD 3D3VB 1A1NA 3TPUA 1V3JA 4OGYL 3WXVL 1CLOL 3O41B 5D2NE 4QRSB 4Y16A 2X4TB 3I2CH 2XTJB 4QRTA 1JWMA 3LS4L 5KSAC 1JNJA 5I0DA 1RZGB 5KOMC 4O58L 2RJMA 3DHMA 5C0GA 3ROLA 4Y4HD 5EBWA 5DEFA 2I07B 4JZJB 3WXWH 1ZKAA 3VXQB 3TEUA 1N6QH 1P4LA 1NGQH 1AXIB 2ZSWB 5HTSA 3OAYH 1IM9A 1S7XB 4DZBA 3P40A 3PDGA 5B8CC 2CLZA 3OKNB 5DUMH 1MI5D 4CU6A 1QLRA 1K4DB 4NQCA 1A7OH 3OPZH 1JFQL 5K59F 5CP7A 3QCTH 5D1ZB 4P9ML 4JFXB 5IQ7L 3O8XD 4K55A 3V5KB 5I1CH 1C12A 1N2RB 4KMQA 4YX2H 5DRWA 2WBJA 1FDLH 1R5VA 2QHRL 5IWLC 4FZEH 1F2QA 5DC0A 1RJYB 3MV9D 5JORA 3IKCA 2BXYA 3ZLQC 3L5WA 2C7UA 3U4BH 3JXAA 1J12A 4F57H 1NMAH 1JWSA 5SWSE 2NY1D 1MHPL 4XP5L 4YFEA 2X9YA 3KPRE 4L8BA 1IQWH 3HC4H 3RTQB 4Q7DA 5FAAA 4M7KL 4E41A 2YKLL 5E2TH 8CGTA 2VUYA 5IVXA 3SCMB 3KS0J 1IGML 4U7MA 5D7LA 4HWNA 5HDLA 4G6MH 4CMMB 4R90H 3UZVB 3FB5B 4RZCB 1NCCL 2DAVA 4FQQB 1IQDA 4AT6A 5I1HH 5LGKA 3WS6A 1AXSA 5F3BA 5E8EA 4OF3A 1RD6A 3K4ZA 4ZYKA 4MB4A 4LLUB 3CFDA 1T0NA 2NXZB 4WFFE 4HMEA 4U6VL 3GSQB 1FSKB 2NY0D 3X17A 1A0QL 4OLVH 1RIHH 3H7BB 4KUZH 5I1KH 4XNXL 1KEML 4V1DB 3BO8B 2CKBA 3QIUA 3QUYC 4QLRA 3WV0A 2G75A 1XGYL 4N0YH 4W4NA 1FNEA 3HNVL 5GQBA 3GJFK 5GRUH 4EEEA 1R5IA 3OKMA 3NFSL 1N5AB 1SJEA 4IOIB 5DMIL 5SWSD 4WO4A 3U1SH 3MRKB 3OKOA 5I74C 4QOKB 1E27B 3KPRD 5CCKL 4WTWA 4NP4L 1G1CA 4UV4H 5CJBA 3WFCH 3RWCB 2I60L 1CS6A 2LU3A 4HIHB 5IF0A 4LCWB 1P4BL 4F58L 5D6DA 2GJZA 4XRCA 1JUFB 4ERSH 1YEFH 5I1GL 1I4FB 2R56L 5CZXC 2E6QA 3QDGA 5HYJA 2DQUL 3IB4A 4MXWL 2LQRA 5DJ6B 1MAMH 4PGEB 1A8JH 2L4OA 3QCUH 4PLJD 3SJVA 1KIPA 3TNMA 5IKCA 4WFFD 3MLVH 1Z6JT 3MJ7A 5D70H 4H1LA 1CD9B 5A2JH 3NTCL 4QNPF 3IDNA 2H6PA 3GUTA 1IKFL 3QISA 4P5TD 2BSSB 4JFZH 4PJIE 3C60C 4NNXB 1GZPB 1QYGL 5D7JB 2Q8BH 1FE8H 1CYGA 3DMMB 1P1ZA 1CTNA 1IAIL 3IU3B 4RFOH 2GFBA 4PJ9B 1EPFA 3ES6A 1DBBL 1HH9B 3D85B 4K3JH 3U4EB 1K85A 1GXEA 2AJSH 4NNPL 1HQ4B 4DCQB 3QUZA 1TVDA 1XF1A 3OF6D 5E7BA 1S7QA 1LGVA 5FFLA 4LLAA 3TBWA 4G42A 1ZMYA 1J0HA 4PGBB 1F6LL 1NPUA 4XP9L 2VQ1B 5FXCH 3REWB 3REVA 4LEXL 2Z0BA 5HPMA 4PV8B 5IFHL 3TT3H 3MRNB 4GQ9L 3DX6B 1LP9E 1FJ1A 4XCFH 1YUHB 3RWEA 3WLWC 4KRMB 4RGNE 5IW1B 1ZS8B 2OI9C 5DR5H 3ZKMC 2A1WH 2C3XA 3BD3A 3H0TA 3MV01 1TQBC 2YEZA 1QTYT 4X9BA 5DUPH 2WINB 4PJBA 2K7PA 3EJYC 1A64A 2E3VA 1MY5A 5E8DL 3ET9F 4OZFH 3O4LE 4WWKB 3MRIA 2P4AB 43C9A 5HVWA 4LHQB 3GI8L 4H5SA 4TVPH 4IDLA 4C4KT 3KWWB 4YIQA 1OT1A 2BFVL 1H9VA 1QR1A 1HHKB 3RWJB 4NKDB 1BOYA 5D5MF 2VXUL 4CN4A 1DUYA 1C16A 2EKSA 3RDTD 1NJ9B 2OTPA 1P7KA 4P23D 1CFVL 1DE4A 1KOAA 2XA8L 4I0CC 4MCYA 1MCOH 2VC2H 1U8JB 4Y4FB 1WFNA 4LPYA 1A7NH 5L2KD 3U30B 1LDSA 1RK0B 2NY4B 5IEHA 4Z77B 4UQ2B 4OIIL 1HKLL 4XAKE 4RGND 4LAJH 3KR3L 4X0KA 3RKDD 3X14A 5FGRA 4GXVH 2IJ0C 3GHBH 4OLEA 4PY8J 5KVFL 5EO1A 4DN4L 1DN0B 4LGRB 4ZOAA 3ULVL 3HPJB 4JFYA 5KVGH 1HSBB 4X98A 4FQIL 1KV3A 3CUPB 3AREA 3MFFB 3O4LD 3V4PH 4M1CD 4GW1A 3GIVB 2OM5A 3N9GH 4NM8H 2Z8WC 1A6WL 4Z7OF 1MQKH 3WD5H 4P5KA 2P24A 5E2VH 4ZS7L 2P7TA 5LAXA 1KNOB 4DUVA 4MA8H 2X4SB 2WQRA 2C3WA 3QR2A 5J6HB 3VFVA 5L8KB 3OHXB 1QFPA 5IM7A 3H7LA 4HKZA 5DHYA 2IC2A 1GGIL 3DIFB 3NA4A 2W0KA 1KGCE 4U1LB 5A3IC 2Z93A 3EDEA 3S9DB 4I3GA 4XAKD 5JDJA 1O7SA 1UM6L 1VGEH 4AH2A 1KELH 4MB3A 3LD8B 3RVWC 1TLKA 2M26A 4L3EB 1ED3A 2ENSA 4PB0H 5DHVH 1DQQA 3QCVL 4H25B 1TPXB 1QOKA 1CE1H 3RA7H 4XVTL 3F6IA 2VLRE 4HHAB 1TDQA 2CUHA 3P4NB 3PWPE 5GS0H 3OG6B 4RA3A 3ISWA 2EDLA 2P8LB 1YEGH 4JHWL 5I71C 4X4MA 2Y25A 1C1EH 2F8VA 1G7IA 3FZUD 3MLSH 3QEQA 4XVJH 3PJSB 4ODUB 5HHPB 5HHMB 1IAKB 3OZ9L 3GSXB 4LP4A 4JFHE 1TETH 2BC4B 4ZUVA 4LSTL 4JO3L 1BZ7A 2J1KA 1TJHL 5CGYC 3C5ZA 4YPJA 2YMXL 5JIIA 3VXRE 3L3HB 1OTUD 3TFKC 4OZGA 1TTUA 4JFQB 4NKQB 4Y19B 3W39B 2IANE 2ADGB 2BMKB 1QO3B 1KGCD 2RAMA 2P1YA 4JZNA 5I16A 1NGPH 1CVSC 2F5BL 3QQ9D 5A2IH 4KV5F 4G8IA 4BSVB 1EFXD 4H0IA 5F1SA 5KSBA 4OF7A 1U8IA 5IVXF 5KSAB 2GW5A 3QDME 2XZZA 4IMKA 4PJGB 3VXUE 3JTTA 1A5FH 1SYVA 3KPSE 2I9TB 1CIUA 4GRMA 3CNKA 2DYPA 2VLRD 3PWPD 4JFEE 1Z5LA 1J5OH 3CFBA 2FX8H 1P7QA 3GJFA 5B8CB 2G2RB 4J3TA 5FYLH 2OZ4L 3VWKA 5C6TH 4OB5L 1MCRA 5JQ6L 5DJXA 1P6AB 2WUCL 3W0WE 3W5MA 5FHBL 1CT8A 2BOCA 5DT1L 4LAQH 4U49A 3MCLL 4Z8FH 1KUMA 2WLYA 4L5FH 4D8PB 2IWGA 2VISA 3FO9A 3B3IA 3CDFA 1NMBH 3VA6A 1FH5L 1L4IA 1FYTE 4LVHB 2FYYA 3VXRD 3P9MA 4IHOB 5E70A 1C5BH 2ATKA 2IAND 2K7QA 4F8QA 1WBXA 1NCWH 5C07A 5IIEB 1ZTXL 5F1IA 3O2WH 3RZWA 1CL7H 3EOTL 1XF4A 3RAJH 1XZ0A 1CXHA 3QDMD 4U1NB 2UUDH 4A6YB 2A9ML 3VXUD 3HMXL 3KPSD 4LASH 1J8HA 5KW9H 3SDCD 4D9QE 4EDWH 2DICA 3X11A 4PRNB 4LLMA 3EYVB 1YY8A 3WHXA 4JFED 1MEXH 4OFYD 3WNLA 2FSEA 4M1GL 1QPXA 3HPLA 1CCZA 3QNXA 2VLKB 5FGBC 4PTUA 4FMKA 1WAAE 3W0WD 1U3ZA 4FNLL 4GRLD 3G6AA 4PJCB 2C4FT 4I2XB 5DQ9A 2XTLA 3T0VA 3QNZB 4F7CA 3PGFL 4OIBA 2LFGA 4LHUG 4C56A 3BUTA 3IS1X 1FAKT 4B5EA 1Q9KA 3QUYB 3LY6A 3HE7A 1DR9A 2X42A 3H42H 2BY2A 2FO4B 2DIBA 5ILTL 4J3SA 3IDMA 2Z91A 1MELA 1U3HC 3BP6B 3D18B 4R8WL 2A73B 4PD4J 2O5XH 1GYAA 4RRPG 4YXHL 5I74B 3BW9B 4QHKI 2A77H 4QYOA 4IEFB 3FCTA 5L88L 4L9LA 4RNRA 3FO2B 4ONFH 4AIZA 4Z6AT 5D72L 4CVZB 4D9QD 4J8RB 4LLQA 4MVBD 4R4FL 2FB4H 1ZT1B 4PG9A 2HFFB 1T4KA 5KOVC 1R3JA 4XMKH 2FL5B 2CK2A 2VDPL 1YEHL 5IFJB 5IEKB 1PFCA 5ERWB 4G8GB 3NCYS 1KCUL 3SEPA 4TSAH 5JIPA 5IFAL 3BOVA 2DKSA 5F6HI 4BK5A 1EDQA 1YNLH 3QPQD 3RPIB 4I9WE 4RDQG 1HSAB 1AGFA 2JCCF 3E8UH 4FFVD 4OLXH 4ZPVA 5E4IA 2Y07L 4PJBF 4RBPH 3C60B 3O0RL 4HF5L 3H9YA 1HINL 3QDHA 1P2CA 3KDMA 1T21A 2W9DH 1CG9B 3MLTA 4OZIE 1A1MA 3PNWA 2NPLX 1VFOA 2A38A 5C70A 2HTLD 4U1IA 4Z7NE 4JANB 3EFFA 4JDVB 2R1XA 1NDMA 4N8VG 4MHHI 3T1FA 3FB8B 3HE6C 4NM4H 1YEJL 4NUGH 3RVTC 4GG8A 2ATPA 3QI9A 3BD5A 2LVEA 4TQEL 2HN7B 1WICA 2FJGA 3V4VL 4O51B 1MCLA 5C2BL 1QQDA 3GMOB 1E0OB 3OKDB 4Y1AE 5FYKU 2YPLA 4FXGB 3WNPA 4M03A 3IJHA 2BSRB 3NCCB 4OAWB 2DN7A 5ICZB 3TV3L 1EIBA 5ACMA 2J6EL 3U36A 3WJJC 15C8L 5J9PA 2ZJSL 3P11L 5IB1A 1ZLUK 3I6KA 4PP2B 2QQNL 4C57C 4I9WD 5IMMB 3MOAH 4OCNC 5SWZA 3C87A 5EA0H 5FECB 1TQBB 1VACA 3CU1A 4GXUM 5I1AA 5MEPB 3NIDE 1IC7L 2DQGH 3SN6N 3OV6A 2PXYC 5F44A 2RGSA 1T7VA 3ULUH 4K8RH 2AEQL 5K33A 3QXTA 2B39A 4EN3C 1ND0A 1YEDB 2D9CA 4E0RA 3I02A 2Z8RA 3OSKA 3D69B 4HUWB 4P3DB 5FYJE 4XX1G 3I2CL 5HGAA 3V8OA 3ARBD 2AKRB 1VEOA 5GGUA 4DGVH 5HI4C 3HUJE 1G6RH 1FG9C 3RX5A 5IHUL 3THMH 4ODVH 3WXWL 3T0EC 1P5UA 5C0CB 4R0LB 1N6QL 1FNHA 4HIIB 4Y1AD 3VMNA 1NGQL 3TWCH 5DUML 1YQVH 1T3FB 5GS1B 3RL1A 5MENB 5JMOC 2CDGB 3JTSA 5JUEH 1A7OL 2EYRA 1FC1A 3OPZL 4TRPH 2HRLA 3AU1A 3GSWA 3KYNB 3QCTL 4KROC 5E2WH 3OKYA 4ZTPH 1RPQA 3QB7C 3S4SG 1F6AA 1SQ2N 4I18A 5I1CL 1SEQH 3DROB 5ANMB 5EU3B 5JHDE 3FRUB 3FOLB 5BV7B 4YX2L 4ZSOB 2DS4A 3NCEB 1MRCH 1FDLL 4MS8C 2UWEA 5FGCE 4XMLH 4FZEL 4RCAA 2VERN 3LN5A 4F7MB 5C0DA 2J8UB 2WQ8A 2D4FA 3U4BL 2R2EB 2EDBA 4F57L 1NMAL 3SQBA 3T8XA 4U6YB 2MMXA 1JN6B 4IOSD 5FYJD 3MUY1 1L9MA 1IQWL 2W60B 3HC4L 2VITB 1QUNA 4R6UA 5E2TL 3HLAB 1MH5A 3LQZB 5E9DA 5A1AA 5T5FH 4G6ML 4TSBH 1HWHB 4MDJB 4R90L 4X99B 2NR6D 4OCSH 4TULH 2IFFL 4M7LH 1QKZH 5GZOC 1M7DA 2WANA 2XFXA 4ENEC 5TGBB 1JIBA 5I1HL 5T1KD 2NY6D 5HYFA 3KXFA 5KSBF 2WNGA 3DI2B 4NT6B 4G5ZH 4WI2A 1EX0A 4ELME 1Z0MA 4NBZB 1U8KA 4ZFZB 3V7MA 1TFHA 5JHDD 4HS3A 1MWAH 4G9DA 1D5ZA 4N90D 4OLVL 3UBXA 1RIHL 4KUZL 1ZGLB 5I1KL 2KDGA 1VSCA 2YD7A 4RAVB 3CZFA 3EZJB 5DVMA 2GJ6A 4P2OA 1FZOB 4F37K 1AJ7L 4N0YL 2E7MA 3RU8H 4RIRB 1NKRA 1MF2H 5GRUL 5I71B 4IIQC 5HHOB 3RBGA 1EK3A 3U1SL 3U9UB 4JO1H 3VG9B 4W6YB 4BELD 2VZVA 4UV4L 3BZFB 4H0HB 3WFCL 2VR4A 3VFRB 4IRSA 5FEBA 7FABH 1HEZB 3AS2A 3GSNA 3VFWA 2VL5A 4NFDA 1MI5A 1NC4D 4P4RA 4ERSL 1YEFL 2H32B 4K3DL 3ZDXF 4LHUB 5EOQH 3G5VA 3NCMA 2A6KA 4NO2B 4TUOB 3UDWC 1XGQA 4YDKH 4ZFFB 3ZO0A 2EKJA 3P2TA 1MAML 1AC0A 3O8XA 1U91A 3QCUL 2HKFH 2YPVH 2YA0A 3ARDD 4DOHE 4MD4A 3MLVL 1PGRB 3PHSA 5D70L 1J8KA 2XQYK 5HXMA 4AM0B 1BD2E 5A16B 4L4VA 3K1KC 1FO0A 1L6ZA 4JFZL 2FATH 3AY4A 1JNNH 2Q8BL 2XG5A 3QUKB 1RZ8A 3S96B 3GM0A 3IJSA 4GFTB 2UYLB 1FE8L 3WIHA 3AS1A 1A14H 1VFBA 1OT2A 2V17H 3HTLX 3QEUA 3ARGC 1JYWA 2DLIA 1AIFA 4RFOL 4K3JL 4JPIB 3CSYA 5C09A 2IALB 2VDQH 5C9JB 2AJSL 2NY2B 1N0LA 2ITCB 4WJ5B 1BJ8A 1JK8B 4PUBH 3T2PA 5J6GA 3TA3C 5JPMB 2MSPA 3MROA 5F9JB 4NQXB 4GAGL 2LAGB 5IJKA 4PJXB 2V2XA 5TF1H 5FM5O 4O2CA 1Q9WB 1LD9A 3EOBB 2ICWJ 3MRHA 5F7LB 4IDJH 5IOPB 3KYMA 2DIAA 4LDLB 1L0YA 3TT3L 5EFIB 1I7UA 4XCFL 3U7AA 2K9UA 4F9PC 32C2A 5DR5L 3P9WB 2OXGA 5DJ8A 2A1WL 2YD2A 4N8VB 4KUCD 2XOTA 3N06B 4EI6B 5DUPL 4X7FC 3B8SA 3O2VH 3BKMH 1UG9A 3DTXA 1Y18B 3ZSTA 4QRPB 1UXSB 3H9HB 1KJ2H 3M17A 2V5SA 3TIDA 5SWSA 4WHDA 1MHCA 5IROC 3SKJH 2R4SH 3QG7H 4GG6E 4JLRB 2CQVA 1INDH 4TVPL 3EW3B 1BGXH 2X1XR 4N1CA 5I8CB 4Q6IC 1WZKA 2R9HD 1HXMA 3RPKA 5KN5B 3P9LB 1RJLB 5DA0B 5IBTH 4MQSB 1SMAA 3SDAB 4JN2A 1T1YA 3V0VB 4Z7VA 3P30H 2OX5A 3SDXE 3V5HA 1MCOL 4XHQA 2VC2L 5CMAA 1MREH 4CMHC 3F6LA 3B2UD 1A7NL 5ICYA 3VE0A 2FH8A 3MV8B 1U3HB 4HFWA 4WEMB 3UYPA 2A6IB 1KN4H 3L3GA 3TP4A 1U95A 5LKNA 1EEYB 3QUXD 4PV9A 5HGDA 4RMWA 1QFWI 2EDNA 2R15A 3B9KD 5IB4A 1AD0B 3GHBL 3LKPB 3EO9H 5IW6B 4HKXA 3RUGB 5JW5A 2JK5B 3JV6A 4IM8A 5KVGL 4ZUSB 4GUPA 1UH4A 4J6RL 5D1XC 2PYFA 3L5XH 2Q86B 1XH3B 4OZFG 4TNWK 4HKBB 3V4PL 1Q94B 2AV1B 2VDRH 3N9GL 5DJZA 4Y5XA 5AEAA 1GGCH 3OF6A 1MQKL 3LSOA 3WD5L 5E2VL 4OD2B 3N1QC 3MRRB 4YNYA 4ZO7A 4MA8L 1ADQH 2Y5TB 3S4SB 1OLZA 1B0RA 1IGJB 5DK0B 1UB5A 1XF5B 3UYRH 2CDFA 1FNLA 1S8DA 1R0AH 5C0BE 5I76A 3UMTA 4QHUA 4UUJA 5GGVY 3IJYA 3IXTB 4NKMB 5FOBA 1JHLH 2NYYD 1CICC 1FL5B 3HFML 5C0RH 5SWQB 5EH1A 1VGEL 4MJIE 3HE6B 1MCCA 3EO0A 1KELL 3D3VE 3GSOA 3WDJA 2YZ8A 2FJHB 4U4BA 4PJIA 2YSSA 3IXAB 4PB0L 3HZMA 1CE1L 1OWRM 3RA7L 2V2WB 4D0CB 2B7DT 5GS0L 1KBGH 4L8DA 5FHAH 3RZCD 1QSFA 1YEGL 4DGYH 5JLZA 1SBSH 4R96A 5J3HC 2X2YA 3NFPB 4Y0GA 4N0CD 1C1EL 3TVMD 3RJQB 3MLSL 2C1OB 1S7WB 2YUVA 3IU4H 4O2FB 4Y88A 1KULA 1CQYA 2DOCA 1MJJA 3NPZB 1C7SA 2D0HA 1TETL 3HB3C 3IFOB 3VJ6A 1KIRB 5J1TC 5AD0B 1NGXA 3FT2A 4P23A 4I0PD 2D7QA 1K3IA 2EEAA 4M02A 5FO7A 2PXYB 5GIRA 4U6HA 3MRLB 5L2KA 1F00I 5C0BD 3A0OA 4QT5B 3L3KB 3TF7C 4EN3B 1LP9A 1F3RB 3EO1A 5DD6A 1NGPL 4JJ5A 2CO6B 1V7NH 2WP3T 4MJID 1URLA 2YRPA 4FQHA 3DVGA 3D3VD 5ITFB 3VFSA 1A5FL 4XNQB 3RVUD 2H2PC 2R2CA 4LU5H 4MWFB 3P4OA 1ZSDA 3D6GA 3B8YA 4QRQA 1FFPA 2XTJD 4XP4H 5JDSA 3G08B 4K2UH 3P77A 3T0EB 3S3SA 3QSKB 3BGMB 3PDOA 4GAYA 1J5OL 2FX8L 2MKWA 2Y1VA 5CZVH 5FYLL 4NNYB 4LVNC 1I9RH 5C6TL 5JOPE 4NQEB 2HVJA 4MQ7B 4PG2A 3BEWA 4NZUH 3N1FC 3NZ8B 4KROB 4MMXC 3WN5A 2IADB 4LAQL 1PQZA 2D2OA 5ICXB 4Z8FL 3D25B 3X13A 3H3KA 4L5FL 2HJFB 3ZKNC 2OK0H 3LKSB 1UB6A 1A3LH 1NMBL 2OL3B 4J3XA 5D1ZD 2PNDA 1G7HB 2LVCA 1AR2A 4NO5B 5DJCB 1G9MH 1LE9A 4ORGB 1C5BL 2QJDA 4JQVA 1MLBB 4PY7A 1FQ9C 5JXEC 1VHPA 3QRFM 1UQSA 4R4NC 1CDCA 4V1DE 3BESR 1MVUA 1NCWL 1F45A 4HKJB 3TN0C 1CXLA 1NLBH 3C8KA 3E6HB 3O2WL 1YPZF 4PJAB 4G9FA 4QO1A 3L5IA 1BIHA 1CL7L 3PWLB 1JF1B 5IVZB 3RAJL 4H8WC 4S0SD 4LASL 1ACYH 5KW9L 2R8SH 4ONHB 2C3VA 4QOKE 4EDWL 3RTQD 2B4CH 2FJFA 3VCLB 4PREA 3BH9B 1MEXL 5IW6A 1EEZA 3SCMD 4PJFB 4LCWE 3UC0H 5JOPD 3H2WA 2YXMA 1OP3K 1V8HA 4OD3H 3GB7B 1JF6A 4P4KB 1BZQK 1I3UA 4UT9H 4V2BA 4G3YH 4YDVB 3PP3K 4NC1E 5ID1B 3QO0A 1AHWB 2NXZD 1QFWH 1VFAA 4F33A 2Q3AA 1NFDB 5DLMH 2FWOA 3H42L 3HS0B 2W1NA 4IIQB 4GMSH 4V1DD 1FN4B 1K8DB 4UDTA 2O5XL 2CMRH 1NUDA 4H8WL 2A77L 3ZE1E 3FFCB 5JZ7C 1IVLA 3VD9A 2VLRA 3S5LA 4ONFL 3PWPA 3GFUA 2CIKA 4QOKD 4NCDA 2VJXA 4BH7B 2FB4L 3T0XA 3LV3A 1JGDA 4DW2H 3WMSA 1NSNH 4XMKL 4LCWD 2Z31B 5F88A 2AJXH 5GSVA 4TSAL 1JMXA 1T5XB 3FRPG 1WBYB 3MO1B 5GRWA 1YNLL 1RZKH 5ESAA 3ROOB 3MOBH 3E8UL 4OLXL 1ZLSH 3MA7B 4X6DB 5E6IC 5I18H 2IANA 4H1LH 1UACH 3D39E 2W9DL 3PABA 4GH7B 1JPFB 1T6WA 4X6FB 5D7JD 3ULUC 4K8RC 5C08B 4KKBC 4OZFB 1QRNB 3DMMD 4PJ7B 1IEAB 3VXUA 1T1WB 1SMOA 1IGIH 1GIGH 1HHHB 4MXQD 4NM4L 2QR0A 3LN9A 4CJ1A 3TA3B 5T1LA 4PJ9D 1RJCA 3QHFH 3D85D 1HIMH 2BVYA 1Q9LA 5DFVC 1LO5B 3PL6C 1NAMA 4OFYA 1VADB 4XC3H 2VAJA 3LN4B 2OP4H 4F7EB 3VGDA 3U82B 1CLYL 4QXTB 2F19H 2H41A 1T0MB 3W0WA 2F54B 4YHKH 3MZTA 3F7VB 1JPST 3EIFA 5BVJA 1ZA3B 1QVOA 4ONOA 4BJLA 3O45A 5MEQB 3FTGA 4NYLA 4LNRA 3MJ8B 4XPTH 3MOAL 5EA0L 2L7JA 3RWDA 5INCB 3WFZA 5EZLB 1JTPA 4UINH 3DNKA 3OXSA 2DQGL 4LSRH 1A6AA 1OGAA 1BVLB 1NFIA 2ZCKH 3ULUL 4K8RL 2HT4C 3U46A 2QKIB 5D71H 1T04A 1W8OA 1FNAA 2ESVB 4EXPX 4OQ1A 4EI5A 2GTZA 1QFHA 4DJMA 4WWKD 4PGDA 3LQAH 6FABH 4DGVL 1CIDA 1G6RL 1A4JA 3THML 4ODVL 3PP4H 4PP1C 1T89A 3QWOB 3SOBH 3Q5TA 2FZ3A 5JPNB 4LPWA 3TWCL 1YQVL 4X8JA 3IGAA 1WAAA 1N59A 3PHOB 2XWBA 4N0RA 1NGZB 3QQ4B 1MHEB 1U93B 3WFBH 5JUEL 4TRPL 1LO2H 4XNMA 2PCPB 2FIRT 3BQUC 5E2WL 4Y4FD 4ZTPL 1S9YA 1UZ8A 2KZ1B 2KZWA 4PJIF 4Y4HC 1SEQL 4LSVH 1RULH 2NY4D 1ZHNA 5GSRB 4KU1A 5F7DA 5DK2A 5B38A 3O3AB 4FTVA 1MRCL 4WFHE 4XMLL 5DHVB 3GMLA 4L3EE 1D5MA 5IMOA 3A6OA 3WBDA 1JNLH 2XA3A 1H5BC 1A4KB 2W9EL 4PR5B 1G0YR 4JY6B 2VIRB 5EO0A 5SV4A 1NFKA 3SGJC 1GJIA 4MJ6B 1LQSR 1Q1JH 5AG8A 5C0IB 3WEXA 4R7DB 4JCLA 4S2SA 1I9IH 1FFOB 1E28B 3NN8B 2AQ2A 5IR1A 5DD0H 5T5FL 4DZ8A 2W92A 2VTFA 1NEZA 4TSBL 1J0JA 4OCSL 4TULL 1U58B 2APWA 2CLRA 1LP9F 3QBTB 4M7LL 3F7QA 1QKZL 3MRPB 1IGTA 5DD5H 3DURB 4ZDHA 5D2NC 4KRPC 2ZCHH 5GRVK 3MRGB 5CHNA 5L0QC 3P73A 3W5NA 1CICB 2IPKA 4G5ZL 4Y19E 1RSFA 4P3WA 1UH2A 2YHGA 3ARFC 5FF6B 1SEBB 1NGWB 3AAZB 4YGVB 3RY6C 1MWAL 4K7FA 3UZQA 1FVDB 1RIVH 3MBEC 3QDAA 2AXJA 4JFFB 2GY7B 1S3KH 5CFHA 2G9HB 4PJGE 2KH2B 4LL9A 4L3ED 3FQTB 4OFPA 1YMMB 4KJPC 3RU8L 4Y5YC 5DURB 1MF2L 2WWKT 3MRMB 3ARBA 2PUQT 3MGOA 2EE3A 3IFPA 4JO1L 2NY0C 4H20H 4KHXL 5IJVB 1E4WH 4JQIH 3D0LB 3MV11 4XCYB 7FABL 5HHMD 3DVIA 3LZFH 2Z8SA 1J0YA 1X44A 1TTFA 2DM3A 4O5LH 3B9AA 5EOQL 1HZHH 2NW3B 4YDKL 4HPYH 2Z4QA 4NKIH 1EHXA 4LNVA 4JGMA 4Y19D 2HKFL 2YPVL 4CN1A 3OKKB 5EIQA 5JHLL 2N56A 1MFCH 1AO7B 5KSAD 2FATL 4S1QH 2LABA 5B3JE 1JNNL 1JL8A 4HC1A 4CVWA 1A14L 3VXOB 5IMKB 1QLFA 4LVNB 2V17L 2V7NB 4OKVB 2VLJA 3TIEA 3V6ZA 1D6EA 3UYOD 3OTTA 5IMLB 2VDQL 2A6JA 4HJ0C 1KTLB 3HUJA 4PUBL 4P5TC 5GS2D 2VLKE 1FL3A 3OXRB 4LLDB 3W2DH 2GEEA 4LSQH 4PJCE 4I2XE 2R2HB 3H9SB 3VW3H 5F1KC 3EYOB 5TF1L 1N8ZA 5T1KA 5DMJB 5E00B 4ELKA 2W0FA 1CFNB 5JR1H 5K9OB 2AEIT 1MOEA 2AP2A 3ZHLA 3TN0B 3IRZA 1CGYA 1WIPA 4OSUH 4DEPC 1OD7A 1U8LA 3VMOA 5JHDA 2ZSVA 1DN2A 4LPXA 5GGTA 3RHWF 2DQFB 3V5DB 3IAGC 2DWEB 1FVCB 3QXUA 3VGHA 3EDJA 3BKML 3BI9X 2YUXA 4J4PD 4RFEA 3LRSB 3U0WH 4NRYB 3PV6A 1KJ2L 4ZXBB 3SY0A 2EDOA 1T03H 1IC1A 3SKJL 1BIIB 4GXUN 5DK3A 3QG7L 4PRIB 1X5ZA 1C7TA 1Q8MA 5EC2B 1INDL 2H3NA 5HD8C 2HP4A 3C5JB 5FK9A 1BGXL 5F7NC 3VXMB 1YN6B 3Q3GA 3RIFK 1S5HA 3STLA 4G8GE 2H45A 4P2RA 4JKMA 2VLKD 4Z7WB 1NC4A 3IF1B 3JSSA 1MLCB 3G6JB 3NCYP 3ZKSD 5IBTL 5HYIA 4FXKA 5C7XH 3BGAA 3P30L 4XBPA 4NQSB 2HFGH 3SE4A 3T0DA 5TH2A 3HZVB 1MREL 4NN5C 2E9IA 2XZQH 4WTZG 4ELMA 5F7UA 4KKNA 3QUYD 3S88H 3EOAA 4QGYA 1KN4L 3CFKA 4LKXB 3SKMB 3CC5A 3UCRA 5CEZH 3B83A 3F7PC 4HK3N 5DZOA 4Z78A 5DGRA 1X4YA 1KLUA 3EO9L 4TNWF 2G5BA 2YD1A 3E2HC 4QHLA 4M62H 3L5XL 4RAHA 2QTEA 2ZOKA 3S97C 4JFDB 4TPRH 4RMTA 1VENA 5EUOB 2J5LC 5M7QA 2VDRL 4DVBA 5HVFB 1GGCL 4WDIB 3CPLA 3RKDC 1P7HL 3V2AR 4BUHA 2QQQA 3W82A 4G8GD 4WHTA 4IRJA 1ADQL 5C0EA 3JV4B 5CIPH 4R4BB 3O2DH 4QHKJ 4HEME 5DJ2B 5E6IB 5DI8B 3UYRL 3TBVA 3MRCA 1D3CA 1R0AL 5H37H 5IB2B 2L0DA 4MD0B 2A6DB 3C60D 1C08B 1JHLL 3DUSA 1Q9OB 5C0RL 1QFUH 1I8KB 2AJVL 3QFDA 5EN2A 2YZ1A 1WUNT 2FNBA 3ULVE 4M3KB 1NDGA 1R3KA 2VL4A 1G9NH 1JE6A 1YNTB 1T66C 4N5EC 3DV4B 3PL6B 2GAZA 1CR9H 5F6HJ 1AGDB 4PGZA 5BZDA 1NCUA 1G6RB 2BZDA 2IPUK 1WAAF 1KBGL 2EDDA 5FHAL 4DUXA 3E0GA 2NX5B 4DGYL 1CGVA 3NACL 1SBSL 4X83A 1D5XB 5ELIA 5C0CE 3IU4L 1KJVB 1U8OB 4QHNA 2X70B 3PG2A 1YEKH 1AC6A 1JHTB 4ZPTA 5MENE 3S36X 2N7AA 2BSTB 1WIOA 1IM3A 1RVFH 3DVNB 2XPGB 4WW2F 2W9LA 4DGIH 3WLWD 3UJTH 3O11B 4W4OC 3ZKMD 3ZDYE 4BFEA 2OTWA 2ZOLB 5ANME 3FOMB 3IDYB 1NBYB 1OD9A 4ZSOE 3MNWB 5IVNA 3CMGA 1OTSC 4W81A 3BMVA 1G9MC 2FIKB 3FFDA 3ULSB 1V7NL 2FD6L 3K4DA 3KPOA 5IB3A 3G5YB 2J8UE 4KMTH 2VXVH 3TO4A 3ULVD 3B9KA 4G8FB 1AQKH 1UXWB 4HS6A 1HKFA 4OCMC 1NBQA 2DQHH 3VGGA 3ARRA 2YD3A 2DQJH 3C9NA 4LU5L 1WISA 4XP4L 3VRJB 4K2UL 4GJTB 3S35H 5KG9A 1IMHC 2B4CC 4MNQB 3IDIB 5CZVL 5EZJB 2IMMA 1I9RL 1U8PB 3IDGB 5IQ9B 2A9NH 4U6XB 5C0CD 4NZUL 2HLFC 2X4RB 4U0RC 3MYJB 4YPGB 4NO0B 5F7KC 1S9KC 3BQUB 1UWXK 2VZSA 4ETYA 1KCSH 5MEND 3SKUD 1QZ1A 1KJMA 2OK0L 3O3UN 3BP7B 4OZIF 1A3LL 4MAUH 1R5WB 3WS6C 4Z7NF 2X4OB 2CDEB 1MWAB 4D2NA 4L29A 1W2KT 1G9ML 5FA3B 1FV1A 3U0TA 4M61A 4POYA 1H5BB 4QF1B 5CBEA 3SKNA 4MD5A 1NLBL 4CJ0A 5ADOH 4G80B 4EKXA 4I77H 2VABA 5GXBB 2GJJA 3MODH 5HHOE 5DFWH 1EEUA 2LU4A 3H3PH 2ARJQ 1ACYL 2R8SL 5GGRY 1JZ6A 5D2LA 2B4CL 3MX0A 3VXTA 4I5BA 1I3RB 1DQJA 1EZVX 3TVMA 3MACH 3Q6FA 5ISZB 4JRWA 2V9QA 4ZQKB 3UC0L 4KRPB 1CK0H 1T1ZA 1HNFA 4FFYH 2YUWA 3Q0HA 1CBVH 1CD1A 4OD3L 4XH2A 5A3ID 2VN4A 3NPSC 4NGHH 4I0PA 3NIDF 3ARFB 3G04A 1VEPA 3DX8B 4UT9L 3G5ZB 4G3YL 5ACLA 4JFOA 1RZKC 3VWJC 3HC0B 4RAUA 4YHIB 3MBEB 4JQXA 3RNQA 4TUKH 1HK6A 5HVGB 4EZMA 1QFWL 4UIKH 3RVWD 4EDXB 3VFPA 4NO3A 5IESH 5DLML 4L1HA 4MNGE 4J2XA 4Y5YB 5DRXB 4ZFOL 5DSCB 4Y2OA 5CD3B 1ZEAH 4GMSL 3EKCA 2GK2A 1KYOJ 3G5XA 2Y4SA 3CLEL 5JW4R 2CMRL 3DECA 3HUJF 4JAMA 5JIHA 5EU6B 3PXHA 5HHOD 2ITDB 1CLCA 1I1CA 5INDA 4OQTA 4FG6C 5T1MB 1S7RB 2E5EA 1J0IA 5K9KB 3ZKXC 3V6FA 3GMMA 2I07A 4KY1H 4JZJA 2VE6A 4DW2L 4GRWH 4TNVK 4OZHB 4W68A 3VXQA 4MA1C 1NSNL 2ZSWA 5CGYD 3C2SA 1S7XA 3GMNA 4C54A 2JKXA 3GSNH 3QUZC 4K3EH 5IV2A 2YA2A 3BXNB 4PJXE 2EEBA 2E7HA 2AJXL 1K4DA 1JVKA 1HCVA 4LHUD 1FVEB 2ENYA 5FYJU 3NBNA 3AVEA 1RZKL 5D1ZA 3MOBL 3ZT5A 4JFXA 4N1HB 3S36H 1RIUH 4M7LT 4MVBC 5I8KH 2APBA 1ZLSL 5KANI 2VDOH 2MCPH 4J7RA 4NN6C 5JW4Q 3AFLA 1WZ1H 5I18L 4ZUTA 1UACL 4FQXC 2J8OA 5FCSH 1RJYA 1E4JA 4D94A 4QRPE 1IT9H 1KJ2B 4AK1A 3R8QA 4JPWL 1RUKH 3FKUS 4YDJB 1A22B 4XCNB 3HZYB 4KK6C 1IGIL 1GIGL 4S1DD 1UKSA 1U8MB 3RTQA 3ZYIA 2RQ8A 3QHFL 1F4WH 5KTEH 2OMNA 1JMZA 1OGTB 3LQAC 4HWUA 4XC3L 1G7MA 2NY2D 3SCMA 1IILE 4M9PA 2OP4L 5BRZB 4WW2C 4F7TB 4YE4H 1BX2A 1KLGB 2F19L 2HTLC 1LO0H 4PJEB 4ELMF 4KRNA 4PJ8B 3BZEB 1R3IH 1JWUA 4APQC 4YHKL 3CX5K 4NHUA 5KVEH 1ORSA 4DEPB 1F4XH 3E6FB 4M6OL 3WIIH 4PRAA 3KLSA 2EIZB 5AWNH 4XPTL 3IVKB 3MV8E 3C8HA 3GSQA 1LEGB 4OGZA 5EIIB 3MA9H 1CFQB 5IHZB 4UINL 2E7LA 4H1LG 1Q72H 3B6SB 5TDNA 4LSRL 3QXDA 4XX1E 4V1DA 3BO8A 1U42A 1FCGA 2ZCKL 4IBLT 3PGDB 3CVHH 3RUGE 5D71L 1CDBA 2AXFA 2Q76B 4QRPD 3FQWA 3J7HA 1BPVA 1N5AA 1NMCC 5C3TA 2CXGA 2ED9A 3MRKA 3B9EA 3LQAL 6FABL 4Z7UB 5C0JB 3BUYB 4U1JA 1N4XH 3RWCA 4GMTH 5I1DB 3PP4L 1WSST 4LCWA 1CFSB 4IOFC 3SOBL 5D7IB 3FB6B 1I4FA 4UQ3A 4NN5B 4YDIH 5LGHH 4ISVB 3SDAD 4QTHB 1I7ZA 3WFBL 4MA3B 5DJ6A 4KUCF 4XT1C 4PGEA 1JNHA 2M1KA 2WUBH 3F7YB 3MV8D 1U3HD 4LSVL 5J12C 4AENB 1E6JH 1IJ9A 1ZLUH 4AEFA 4WW1B 3DVFA 1EXUA 3EHBC 4KDTC 4YEEA 2WWMC 2BSSA 5KS9A 1NEUA 3E2HB 4NNXA 4W6XB 4MLIA 3S37X 2R1YB 2IQAB 1JNLL 1T83A 4HUMB 5CILH 2J5LB 1U9KA 1H0DA 4KI5E 2HFTA 3QDJB 3IU3A 1Q1JL 4RWHA 5IG7A 4PJ9A 3D85A 1A6ZB 3U4EA 1DQMH 5TPWH 1GHFH 1I9IL 5CEXB 2HAZA 5DJYA 4JDZA 2H1PH 5ECJE 2IGFL 3MXVL 5DD0L 1ZGLP 5B3NA 2NQCA 3QZWG 1FG2B 3U83A 2VKWA 4JFPB 2ZUVA 4Y7MA 4PGBA 3ABZA 5DD5L 2JE8A 4NFCA 2ZCHL 1JPTH 2WV3A 3CFJB 2IMNA 1GGUA 2GTWA 3FHAA 3DX6A 4Z5RB 1YUHA 5IW1A 1U8HA 1ZS8A 5EOTB 2E27H 2FX9H 4U05A 1LO3H 4HMDA 1RIVL 4I13B 1U8NB 3HE6D 1ZHLA 1KCLA 1S3KL 1DCLA 1I8LC 4QXGH 4GG6F 2WINA 3FAWA 3GGWB 5M94B 2P5WA 3RVTD 5BQ7B 1RUMH 3QG6B 4JVPA 4BQCA 1BZ9B 1PVHA 5EBLA 4X5LA 3T0EE 3SE8H 1QA9A 4GOSA 2DL9A 4KI5D 5DEFB 2FEDD 4NC2B 5FGSA 4H20L 1P4LB 4NQEE 4DZBB 1IM9B 1HHKA 2APTA 3RWJA 3SDXF 4JQIL 2HWZH 3VWKC 3MC0A 1CZ8H 5LG1A 4NQCB 4RX4D 5JOFA 3MV7B 4NQVB 3QIBC 3LZFL 3R8BB 4X4ZA 1NJ9A 4O5LL 4XMPH 4KFZC 4XI5D 1MFEH 2AK1H 1HZHL 1QP1A 4HPYL 3WCYA 1GAFH 5IP4A 4Y4FA 4NKIL 5E2JA 5DRWB 2PXYD 1KC5H 1RK0A 2WBJB 4Z77A 4LEOB 2XN9A 4EN3D 2C26A 3K80A 5JORB 5CJQH 3IKCB 2ZNWA 4LCIH 4PJAE 1ZANH 1MFCL 2C7UB 3EDDA 2C3HA 2W07A 2K3TA 2F5AH 4S1QL 1DN0A 1HSBA 1U41A 1B90A 4E41B 5GRYA 3CUPA 4GSDH 4KVCH 4BSJA 3T0ED 1SY6A 2YRZA 2ZUUA 3MFFA 3ARDC 4U0RB 3GIVA 1J10A 4HFUH 4RMVA 2PN5A 4PJFE 4NQED 5MHSE 4O02H 2HT2C 2BRRH 1IQDB 5ADPH 4KROD 1KNOA 3W2DL 2X4SA 1AXSB 4M7JH 4JVWA 4LSQL 5FV1L 5C0AA 3VW3L 3V6OC 5DJAB 5HYQA 3OHXA 2EEDA 5JR1L 3AXLB 3IAPA 2E7CA 3P4MB 4MS8D 1KJ3H 5B39G 3BYTA 1NFDE 1SJVA 4ZFOB 5T3ZH 3RQ3A 4OSUL 3PE9A 4HWZA 2CLVA 3HE7C 5B22A 4PJ5B 4Q6YA 1RZIA 4M00A 1ONQB 1SJHA 1R5IB 3OKMB 4L3EA 4P3CH 1LNUA 1WFOA 1CE6A 3FFCE 1SJEB 4H25A 4LBEB 3KPNA 3I50H 4XVSH 3NIGE 4WO4B 2E6PA 3U0WL 4BFGA 2ICCA 4HMCA 4HHAA 4BZ1H 3P4NA 4NPYB 2XNAA 3S37H 1T03L 1DVFC 4BK4A 5EORH 1T20B 2P8LA 1YZZA 4XNZC 3RGHA 3INUL 5IF0B 1E4KA 1JBJA 2XWJA 5GZOD 4ENED 4HWBH 1FZJB 3NPSB 1AR1C 2F15A 1NGYB 5HHPA 1MRFH 3MRQA 3BKYH 5MHSD 4JY4A 3K8KA 1WCBA 2OYPA 3VWJB 2BC4A 2V5TA 2HT3C 1JI1A 3EJJX 4P4KD 3HCVB 5C7XL 1QR4A 3GSRA 3O4OC 4P46C 1KIPB 3FMGH 5IKCB 3DPBA 2HFGL 3L3HA 1OHQA 4H1LB 3O3DA 2ZKHH 2KQNA 4JFQA 3UJJH 4X6DE 3W39A 2XZQL 2H6PB 2BMKA 1QO3A 2VDLH 3S88L 2HLAB 1XF2B 3I6GB 1A3QA 3BN3B 1XEDA 2MNUA 5CEZL 1XIWC 3S34H 1MAKA 1P1ZB 1FYTB 5C08E 2CKNA 3ESUF 1GZQB 4DWHA 1QRNE 4PJ7E 4PJGA 3ARXA 1G9NC 3ZKXB 4TVPE 3FFCD 2L7UA 2D31A 3AC0A 3QO1A 5FM5M 3IDXH 4M62L 4XPHH 2JJWA 5CGTA 2PYEA 4KK9C 5H35B 3QUZB 1HXYB 3ZHKA 4TPRL 5B8CA 2G2RA 3R06B 1WLHA 5E5RB 2F54E 2Z31D 2YD4A 4J1UA 4UI2A 5TFSH 3REVB 1H3WM 5F72S 5C0FA 5FKPA 3SBWC 5DYOB 3RWIB 3MJ9A 4DAGL 3O2DL 4NJ9H 4KK8D 1F58H 5E03A 4WU5B 5JIKA 4FQXB 3GMQB 3RWEB 2BNUB 1T80A 5IWLA 4IHOA 4XCEB 3VFUB 3VI4F 4UNTA 3H0TB 4GKOA 1NCBH 3ZE2E 5F9DC 3WHE1 1QFUL 4G7YL 1Y6NR 5IIEA 4ORZC 3ILPA 4Y4KC 1G9NL 9CGTA 5C08D 2ESVE 3HG1A 4U1NA 1QRND 3AMKA 1OPGH 3NIFE 4QTIH 4HLJA 43C9B 1CR9L 4UOW0 3UTTB 4TVPD 4H5SB 4HGWB 1IRAY 3TA3D 4YIQB 1QR1B 2VZ1A 3QZWB 5DMKA 2BOBA 1KPRB 3IDUA 4AG4H 1DQLH 1OWWA 4APQB 3RIAK 4NBYB 1C16B 4BA8A 2JB5H 2VLKA 1YEKL 3MR9B 1P7KB 5ETUB 3NCFB 2F54D 4MCYB 1GOHA 4H88H 2W59A 1RVFL 1F6FB 5BS0A 1CWVA 5FKAA 3C5SB 4DGIL 1Z9MA 3UJTL 5I19H 2J88H 4HEPG 5IEHB 3U0PA 1ZVSB 5H37G 3QUYA 4DK3A 3ZE1F 4X0KB 4MDIA 1FRGH 4XBEH 2QL1A 1IAOA 1HWGB 1Z3GH 5EO1B 1NMCB 3RVVC 3D18A 3SDYH 3TBYB 3BP6A 3VXPB 3CSBA 2VXVL 4KMTL 1AQKL 2P44B 1CI5A 4X98B 4BFBD 2OJEB 2DQHL 1MCFA 2ESVD 2JELL 2DQJL 1B2WH 4GW1B 4PRBB 3FO2A 4LSDA 4NWTH 3S35L 1DBJH 3F62A 2P7TB 5LAXB 2A9NL 3EYSH 5EU7E 4NKOA 3X12B 5IEKA 4UZGA 4G8GA 2XKNB 5FUCC 5DHYB 1KCSL 3RVUC 2BHUA 2NZ9D 3RPIA 5AYUH 1A9EB 4O00A 5J12B 1HSAA 4MAUL 3MQIA 2Q1EA 4JO2H 3UTSE 1GSMA 3C60A 4XPGH 2A83B 1PYWA 1QLEH 3LIZH 4JFFE 1ED3B 3G6DH 4CVXB 2NY7H 2N4IA 3TH3T 1YMME 1W0WA 4JANA 5ADOL 4I77L 1NQBA 3N1MC 5FM8A 1BFOB 3ALXA 5DGQA 3MODL 5GS0D 3FB8A 4G7VH 5FYLE 3H3PL 2F8XC 2X09A 5SX5H 3FO1A 2WLZA 4PYGA 5F71A 3GBNH 5I9QB 3D2UB 3GMOA 5HHQA 2QSTA 1B6DA 3MACL 5GZNC 1UYWH 1TVBA 4FXGA 1A9BA 4JZOB 1BZ7B 4IRSC 5GGRB 1CK0L 2BSRA 4OAWA 3QFJA 4FFYL 1CBVL 2AXGA 5B39B 1ETZA 4NZDA 2O61B 1M6OA 4NGHL 4OZGB 2KL6A 1CICD 3AS0A 1XCQA 3PWVB 4JZNB 5I16B 4TUKL 2J4WH 1L9NA 4KTDH 4N5UA 4UIKL 4QRRA 4G8IB 5MEPA 2N1KA 3CAFA 5IESL 4AQ1B 5KSBB 5GISH 3C09C 4WI7A 4JFFD 1AKJB 1AO7E 1ZEAL 3VFNB 1SYVB 4O4YH 5J06A 1XT5A 1WZMA 4GRMB 4EOWH 1YMMD 3D69A 5DUBB 4WUKH 5I1EH 5DURD 2OQJB 4XNYH 4WGVB 5J3HD 1Z5LB 1EHLL 3CFBB 1UWGH 5JMRA 5FYLD 3WE6B 2KQMA 1NAKH 3VWKB 2YC1B 2AKRA 5BVPH 4TNVF 3QIBB 1V3MA 5DJXB 4L9DA 4KY1L 4L4TB 3HB3D 5F7WC 5C0CA 3WDIA 4HIIA 3L6FB 4OZ4A 4NUJA 5E95B 3HI5H 3GSNL 4K3EL 3T65B 4TYUA 3FO9B 3B3IB 1T3FA 3DHJA 4N8PA 2CDGA 2EIBA 1ZLWK 2EDRA 1S7TA 1B0GA 3KYNA 4I3RH 4ODTH 1KB9K 3D48R 4NRXB 2ATKB 4YO0A 3S36L 1RIUL 1OP3H 5I8KL 3FL7A 3DROA 1MJUH 1WBXB 2VDOL 2MCPL 2IG2H 3FOLA 1WZ1L 5C07B 3IDJB 1KXQE 5DDHB 4RA0C 3PP3H 2H2PD 2BCKB 3PWNA 1XZ0B 3Q48A 1AO7D 1IT9L 3TGXA 1C5DA 3WS3A 3BWUC 3VXNA 1RUKL 1A47A 1G0DA 2R2EA 1KPUB 4Y2DC 3OAYK 1WFTA 1J05A 4LLMB 1YY8B 1YJDH 4XC1H 4PRIE 1OAKH 2W60A 1L0QA 1F4WL 5KTEL 2UY6A 2FHCA 3L3OB 1LK2B 3TC9A 3VXME 5D6CA 3HPLB 3LEYH 4FFWC 2ICWI 3HLAA 12E8H 1M7IA 3LQZA 3BIKB 1PX3A 4Z7WE 3ZKND 4AY0A 3G6AB 3L9RA 3G6JE 4CRPA 1CFTA 1LO0L 5D7JC 1R3IL 4F7CB 1OAXH 3H9SD 3DMMC 5F96H 2X9XA 3ALWA 3BEVB 1AGEA 4C56B 5KVEL 1MFDL 3WIIL 3HE7B 4NDMA 5AWNL 4R4ND 4RISH 2WWKO 4PJGF 3TN0D 3UAJC 2HFEA 3MA9L 3IDMB 2Z91B 4GKNA 5FB8A 4MSWB 1Q72L 1ZGLA 1SYSB 4RAVA 5SX4I 1FFRA 4QYOB 1FZOA 3FCTB 1DVFB 1QNZH 1NBZA 3CVHL 4RNRB 1L7IH 4XNZB 3HR5B 3GBMH 4ZXBD 1D5IH 2D7MA 2OCFD 2OZ4A 3UJIH 4JFDE 4PG9B 3U9UA 4JB9H 1T4KB 3JWNC 3K8MA 4PRID 4YBLC 5EUOE 1X9QA 1BD2B 3ESVF 3VXMD 2X4NB 3B9VA 3VFRA 4GMTL 1JGVH 4L8CA 1FNFA 3O4OB 5CIPB 1OARH 3BDYH 1Z2KA 4TUOA 5J4MA 1VB9A 4YDIL 5IT2H 5LGHL 3MZGB 5J13C 3RWGB 4HXAH 1A1OA 4X4YB 2F58H 4ZFFA 5KJRH 1UADC 4WWKC 1QPPA 3DXAB 4NZTH 2KBGA 3SQOH 1ZHBB 1X5AA 2WUBL 1XIWB 4RMRA 1T21B 2BRQA 3MLTB 3ULUE 4M8QB 1A1MB 3PNWB 1E6JL 1F42A 1H8NA 1ZAGA 4U1IB 5F1NA 5JZ7D 5EOCH 4AM0A 1NDMB 3A6CH 3OWEA 4B0MM 2FECI 3S96A 3QNYA 2UYLA 4LLVB 2W0LA 1NC2B 4YXKH 2JB6A 5CILL 1VCAA 3QI9B 2CH8A 5ACZB 2VUOA 2DQCH 4KPHH 3U30C 2FJGB 1K6QH 1U6AH 4ZO9A 1DQML 2NX5E 5TPWL 1GHFL 4PJCF 1QQDB 4JFDD 3NA9H 4DKAA 5K9QI 2YPLB 2H1PL 4WJ5A 1JK8A 3IJHB 3WNOA 5JPMA 1MCIA 2BVQB 3P3YA 4HQQH 4OKDA 1MIEL 2EICA 2AK4B 4ZOEA 2EC8A 2HJKA 2WBWB 2AJ3B 5E6ID 4U7KA 5IOPA 1EA9C 1JPTL 2PR4H 3CSPA 1RZJH 5CJOH 1UVQB 3I84A 1XMWA 3JUZA 4NHCH 5E5UB 1SM3H 3T3ME 4Y4KB 3SGEI 1NUNB 5T1DH 2E27L 3ULUD 4K8RD 3TZVC 5AG9A 4J3WA 1ND0B 3QULA 4E0RB 3FAXA 5D9SA 2CUIA 4EI6A 3PQYB 4I1NB 1KG0B 4QXGL 2MFNA 5D5MA 4QRPA 1RUML 5HGAB 5DFVD 3CZJA 1UXSA 1DEEA 2NTSP 2VNCA 3PL6D 1OQOA 1TNNA 1ZLVK 3QEHA 3SE8L 1K9TA 2IBBA 4Z7QE 4MNQE 5FGBA 4S1RH 2NX5D 2R0LH 4P2CG 1K5NB 1BOGA 5HYSA 1JGLH 4CL7A 2HWZL 3NZHH 3LD8C 3RL1B 1CZ8L 4NSKA 3P9LA 1RJLA 4PG2C 1QSEB 4WY7H 4G43A 4FMFA 5ALBH 1TPXC 4XMPL 3WN5C 1FP5A 1MFEL 2AK1L 1F6AB 1B4JH 4J23A 1GAFL 5DQDH 5TE7H 1RV6X 2PTVA 2WK2A 1KC5L 4RGOH 3MV8A 2HT4D 2UWEB 4UT7H 5CKGA 1DQTA 1T0PB 3LN5B 2IH3B 1EEYA 5CJQL 5C0DB 4JQVC 4LCIL 1ZANL 3VG0H 4X80H 1EBAA 2F5AL 3EDFA 1QSZA 2JK5A 5E8OB 2Q86A 4GSDL 5CS7A 1MH5B 4HKBA 3QWRD 1Y6MR 5E9DB 1YECH 1Q94A 2AV1A 2XYCA 3HN3A 4HFUL 5ISZE 1QBML 4MNQD 4NQDB 4XTRC 3UTZA 4ZUUA 1T7ZA 3QQ3B 4O02L 2J6EA 2XFXB 4LSUH 5F6IC 4OD2A 4NO0D 5ADPL 3W9DA 3BD4A 3BQUD 3PIQA 4M7JL 2Y5TA 1CU4H 2VZTA 3S3JA 3S4SA 3BSZL 5KANG 2BJMH 1R24A 4L3CA 4YQXH 5DK0A 5B4MC 3ULVF 3OMZA 2FH6A 2F53A 1KJ3L 4EJ1C 5SX4H 4G9DB 3IXTA 5T3ZL 43CAA 3V6BR 4KJWD 3CZFB 2CIIA 2GJ6B 4OIAA 3HE6A 3UTOA 5C8JB 2R0KH 3OAZK 2FJHA 4P3CL 1JYNA 5JA8B 5H94B 1YC8A 5EU6E 3H3BC 3IXAA 2GUOA 3I50L 4XVSL 2E8YA 2V2WA 4LVHC 1Y6KR 4BZ1L 3S37L 1QG3A 5EORL 5JW4M 1GVIA 1MCHA 4GRWB 4IRSB 3CIQA 4RMQA 4F9LC 3NFPA 4OZHE 2OXHA 3GSNB 3VFWB 2VL5B 3GNMH 2C1OA 1VDGA 1Q0XH 2XT1B 3ECBA 3WJJA 4HWBL 5ISZD 3T2NH 4RX4A 3ZDYF 4KRPD 1MRFL 3BKYL 2VB5A 2A6KB 2EDKA 3IFOA 4J4PC 2Z8VC 5AD0A 1AI1H 5GRJH 3ARFD 4X4XB 2DL2A 4YHOH 5EG6C 2J8UF 2XACC 3FMGL 5DO2C 2PXYA 3C09B 3CH1B 3MBED 3MRLA 2ZKHL 3UJJL 1Q0YH 4QT5A 3BFOA 4EN3A 4JHAH 3VGFA 3C08H 2J2ZA 3L3IA 4KJPD 4L4VB 1EVTC 2H9GB 3O9WA 3S34L 1UGNA 2DIJA 3IJSB 5JOEA 1G7JA 4QNPE 3OB0K 2OL3H 3QEUB 3LMJL 4Z95H 5ITFA 3AM8A 2X9WA 5EU6D 2XQYG 1VGKA 4D0BA 5C09B 4M8VA 1I1YB 2D0FA 3T0EA 3IDXL 4OQTH 4XPHL 3BGMA 4GKZA 1EVUA 1D9KC 4D3CH 4NCC2 5BZWA 5BRZE 2FHBA 4ZS6C 5DEGA 4ODWB 2EC9T 4NQEA 5T5NG 4MQ7A 4YHNB 4PJEE 3NZ8A 3HRZB 3K46A 2V2XB 1SVZA 2JJSC 4A6YL 3MRHB 5TFSL 1QRKA 4DTGH 3NFNB 3D25A 1K4CB 3SGEH 4F3FA 4NJ9L 1F58L 1JPSH 4B41A 1M05B 4BFIB 3F8UB 1G7HA 2ADFH 4HCRH 3MUGB 4NO5A 2BDNH 1YA5A 2EIDA 4ORGA 5KZCB 3CD4A 1ZHKB 1NCBL 1EAPB 2A2QT 3A67H 1ERNA 3CVHB 4Y2DB 4HKJA 3MRFA 1KB5A 5D7SH 4XCCH 4PJAA 5F3HB 3QH3B 2ZWLT 3M17B 4AL8H 3PWLA 5IVZA 2DM2A 3U2SB 2EYSA 3O3BB 1WBZB 1OPGL 4QTIL 2ICEB 4HJ0D 4ZG1A 4JEGB 1OQXA 3UXFA 4LQ1A 4Z7UE 3S5LG 4N8CH 3RIAF 1HXMB 1P84K 3BH9A 5FDYA 1TNMA 4AG4L 1TZIB 2VH5H 2D3VA 1DQLL 4PJFA 5FA4A 1M7XA 5BRZD 1X5LA 3VD7A 4JCMA 4KKLC 2JB5L 5D7IE 3IRPX 4PJ8D 4Z7VB 3EFDH 3V5HB 3WKMH 2LTQB 4H88L 3LKRB 1WWBX 5L9DH 4JG0H 1WCQA 2XZCH 2CD0A 5ICYB 4YDVA 3VE0B 4HFWB 4R3SA 4WCYH 5I19L 2J88L 1K2DB 5ID1A 2Q20A 3AS3A 3L3GB 2IAMC 1G7LA 2UUDK 4PGCA 1NFDA 4PV9B 5HGDB 2DWDA 4KQ3H 1FRGL 2P43B 2N7BA 4MB5A 4XBEL 1FIGH 1Z3GL 1JZ5A 3MLPA 3SDYL 1FN4A 1DSFH 1K8DA 3ELAT 4PRHB 3LH2H 4RMSA 1PSKH 3VD4A 1K8IA 4YBLB 2PYFB 2FRGP 2X1PA 5DTFB 5HD8D 3QDJE 1CFBA 1B2WL 3D39B 4RDQF 4NWTL 3GHEL 5AUMB 4PJXF 4YH6A 2JCCA 5T3XH 1CXFA 5C0NC 4LF3B 4LARH 3OKLB 3CVIH 1DBJL 3CFEB 3UDWA 4YNYB 1MCDA 5J13B 4DK6A 3EYSL 4P57A 4K7PH 3ULVC 1KCVH 2VZUA 1A7RH 1DL7H 2V9RA 3CCHB 1CL7I 2VXSH 1UB5B 3MO1A 2CDFB 1F90L 1RK1B 1EO5A 4NCC1 3BKCH 5E8PA 5AYUL 3ROOA 5J7CC 4N9OB 2ZCLH 4QHUB 2Q7YB 4UUJB 4UB0H 3BWAB 4JO2L 1S7UA 3MA7A 4E5XA 1IZJA 1QLEL 1RZFH 3LIZL 4R0LC 3T4AB 3GSOB 3VFOA 3KNBB 2YSSB 2AQ3A 3T2OA 3RFZC 1JCKA 4QCIB 3G6DL 2DJ4A 3ARGA 3HZMB 4X6FA 5GS1C 3CH8A 2NY7L 1CF8H 5TDOA 2DLTA 1QRNA 4OZFA 4PJ7A 1IEAA 3PWJA 5I66B 4G7VL 4L8DB 1HHHA 3QDJD 1I85A 1QSFB 5DJ0A 1GRWA 2OS7A 3N0PB 4R96B 2R2BB 2ERJC 3D5OF 5BV7C 3S8WA 1VADA 4HDIA 3LN4A 3GBNL 1IGCH 4R2GC 4F7EA 4Z9KB 4NQCE 1LVEA 4JY5H 4QXTA 4X8XA 4L4JA 3MV7E 1UYWL 1MJJB 3VJ6B 5FDWB 1T0MA 2XKUA 4P23B 4PBVC 5IB5A 4LLYB 3EGSA 4F9PA 5MEQA 1I1AC 3TZVB 1IKNA 1UWXH 1BMGA 2WIMA 4R7NB 1BBJB 2IF7A 5DD6B 2J4WL 4JJ5B 2IPTH 4KTDL 3RUGF 2FO1A 3HKFA 2ZPKH 3RI5F 3T77B 1T66D 4N5ED 5LGJA 4FQHB 4OCLC 5GISL 4Q2ZA 3RWHA 1FCCA 2DM7A 2HRPH 5IROA 4O4YL 5M95B 4JGJA 5EC1B 3KPTA 3BGFC 4EOWL 1J1XH 2ESVA 4WUKL 5I1EL 4E41E 5CSZB 5F97E 4DKFH 4XNYL 3PDOB 4GAYB 4Q6IA 1UWGL 3GKZA 5L7XH 1NAKL 5BV7L 1T22B 5BVPL 1YJDC 2HVJB 4L8SA 4F8TA 5F8QC 5LWYH 1PKOA 1IM9D 1N6VA 4AZ8A 5ALCH 3WN5B 1KENH 4CDHA 4NQCD 1PQZB 3F5WB 1IGFH 3MV7D 3HI5L 3X13B 1UB6B 3PHOA 4JRXA 3DO7B 1MHEA 1U93A 4UDUB 2PCPA 1OTSD 4I3RL 4ODTL 3VG9C 5MEOB 2Y6SC 1MJUL 4PY7B 1UQSB 2WBJD 3F65A 4BUGA 5GSRA 2IG2L 5CJXC 3DX9B 4PJ5E 1XGTA 3C8KB 4KI5F 5DHVA 3B2VH 3VRIA 5D1XA 4Y8DC 4FA8A 3DSFH 2Y5EA 3IETA 4WI8A 4WNQB 4LLWA 4PR5A 4JY6A 2VIRA 2W0PA 2FJFB 5E1HB 1HHIB 1VPOH 4E41D 3BZDA 3T08A 1YJDL 3B4NA 4R7DA 4TUJA 4XC1L 1EEZB 1O0VA 1OAKL 1SY6H 4JG1H 4PJHB 5H2BA 2HLFD 3HAEA 1FFOA 1YEIH 5F6IB 1X5IA 3NN8A 3LEYL 12E8L 2AJZA 4UMGA 1FNSH 1ZWIB 3WJLA 1FGNH 1U58A 3GMPA 1C5CH 1DTUA 1S9XA 1OAXL 3MRPA 1MHHB 1J7VR 4HK0B 3DURA 3RRQA 3UTPE 4WI6A 2ICES 1RFDL 3QO0B 4S1DC 1CXKA 4F33B 1CGWA 3QJHB 1CICA 4U1MB 5EPMB 4RISL 5HSFA 4U1SB 1AGCA 2NY2C 2OSLA 3TBSA 1HQRA 1SEBA 4OCXH 4NRZA 1A6VH 4JFHD 2Q6WB 3PV7A 4KJYB 1FVDA 4UDTB 2PF6A 4PJ5D 4QHMB 4JFFA 4OGYH 1OOAA 3FQTA 1QNZL 2JJTC 3RGVC 1L7IL 4IJ3C 2BVPA 3S5LB 4WO4D 1JRHI 3UTQB 2CIKB 3GBML 1IFHH 1FPTH 2XI9A 3FQNB 1D5IL 3WKNA 3BIBX 1JGDB 3UJIL 2V9TA 1G0XA 4JB9L 5ID0A 4YBQC 4C59B 1T7XA 4LCYB 1MCJA 4JPVH 2Z92B 3D0LA 1JGVL 4XCYA 1OB1A 1OARL 4LGSB 2BNQA 4DFIA 3BDYL 1DLFH 3VWJD 1I7RB 3RBSA 1BLNA 5IT2L 4Y5VA 4IRJC 4OLUH 2BX5A 3ZE0E 3UTPD 4HXAL 2F58L 5KJRL 2YRLA 3SGKC 4NZTL 4PJAF 1LDPH 1RZJC 3OKKA 2MQ3A 3FB7A 4M43H 2Q8AH 5BCAA 3VMPA 1FYTD 1AO7A 1NBVH 4FG6D 3SDAC 4PJFF 4KDVA 1D9KB 1FLRH 1M71B 5T1LB 3UTTE 4KK5C 2FGZA 4YXKL 3VXOA 1Q9LB 2YKLH 4OKVA 2DQCL 4KPHL 1K6QL 3QUZD 3NA9L 4U7SA 2XKSA 3LAFA 1KTLA 3FRPA 5BW7A 1F5WA 4HQQL 3MJ6A 3CX2A 5BVJB 1QVOB 5HDQH 1NFDF 3H9SA 3O45B 3FTGB 2IBZY 4FXLA 3EYOA 2FX7H 3HHRB 1SHMA 4LNRB 1F4YH 3QWQB 5FO8A 3MJ9H 1CFNA 1G7PB 3S3PA 1N6UA 5JXEA 2PR4L 4FQXD 1RZJL 3GSUA 1P5VA 5CJOL 3TN0A 4XNXH 3OGCB 1SM3L 3OXSB 1OGAB 1NFIB 5AAWA 5T1DL 4KI1A 3NIGF 1P9MC 2V5YA 2DQFA 3V5DA 4JPKH 4KK6D 2DWEA 1FVCA 5HVHC 5J56B 4MNHA 4EI5B 2GTZB 4BKLB 1T2JA 3LRSA 4LGPB 4K7PY 2EXYC 4WTXA 3UTTD 5ESQA 3SO5A 2XG4A 4DKDC 1BIIA 4X6CB 3W9EA 5JQHC 4PRIA 4KHTL 2QSCH 4M4RA 5GHWH 4MQXC 4S1RL 4PS4H 3VXMA 2R0LL 1YN6A 4G6KH 1JGLL 1FL6B 2D03L 3QQNA 4APQD 1XGUA 4HSQA 4CBPA 4X5WB 3IGAB 3NZHL 4ZAKC 1N59B 2XWBB 2P5EA 5KBNC 2DLGA 3IF1A 3Q1SH 3BP5B 5AZEH 2ZUTA 4X6DF 2NNAB 4XVUD 4ETQA 2I9LB 3BDXA 4WY7L 4XNMB 2WZPD 2IAMB 1MJ7L 1ACZA 1S9YB 1UZ8B 5EU5B 1EFQA 4KI5C 4LSSL 4I0KA 5F7YC 1B4JL 5GGSY 4NQSA 5DQDL 5TE7L 1ZHNB 2V6HA 2OJZH 3HZVA 2FEDC 4WU7A 5EBMA 5MERB 5BJTA 4FTVB 4PJ7F 4RGOL 3VXSB 5HGBA 3SKOB 1AFVH 5EU4A 5IMOB 1NUGA 5EO9A 1KXTB 4PTTA 1A6WH 1D7FA 1XGPB 1CXEA 3VG0L 3ME0A 4X80L 4XI5C 4GKSA 2VZ3A 1KCKA 2HJLA 3CXHK 3DBXB 4X4ME 4NFBA 4D9LH 1I8IB 2WSKA 4IOFD 5F9WB 1YECL 3JWDH 5EUOA 4QWWD 4ZD3L 4DZ8B 2DQIH 5DRNA 5I8OH 3RP1A 1HCFX 4WDIA 4LSUL 2WAHA 2HG5B 4XBGA 3L5HA 2IEPA 4HK3J 4UU9B 1CU4L 1X7QA 1KT2A 3QAZC 4OZGE 2DI9A 2IPKB 2BJML 1F2XK 5E6IA 5DJ2A 3ZE2F 1FFNB 4YQXL 1YY9C 1F3JB 1SBBA 5E6ZA 5HY9A 3EHBD 5C2UB 3MFGB 2WWMD 4MD0A 4K7FB 4MAYA 3BRFA 3BPNC 5TE4H 5KSBE 1C08A 3NIFF 4G8EB 2BP3A 1H15A 3UO1H 1KYOK 1I8KA 1JRHH 2VLLB 5K9JH 2X4QB 3LQMA 3LEXA 2R0KL 5I6XC 2I25N 2ERJB 4K07A 3R4DA 4LP5A 3MGOB 3PL6A 3W11D 3IFPB 1AGDA 4R2GB 3TPKA 3E1F1 3MCKA 3I75B 3GK8H 4I3SH 3VRLE 4L4TE 1D5XA 3D2UD 1OAQH 5DD1H 3GNML 1U8OA 1B88A 3T2NL 1I1AB 4XXDB 1MJ8H 2BSTA 4I48B 4JRYA 5E99H 3RWFA 3DVNA 5GGQH 5GRJL 2NY5H 1BFSA 2PO6C 4YHOL 3ZDXE 5EOCJ 2VWEC 2BNRA 3FOMA 1NBYA 1EGJH 5C07E 1Q0YL 1FIEA 4F15C 4HG4K 4JHAL 2FECL 1T7WA 3BGFB 3C08L 2XWTA 3C6LC 4G6JH 3X3FH 5I8EA 2QHLA 3SDDC 3G5YA 1AKJD 5TJWK 4LRIC 4G8FA 1Z9LA 4WEBH 4P4KC 8FABA 2OL3L 5KAQG 4Z95L 35C8H 2VLJB 3TIEB 3V6ZB 1D6EB 5JO5B 1EERB 1A2YA 5F7EH 3GSVA 4HWEH 4ZNEE 1AHWC 3T0WA 3VWKD 3T3PE 4OQTL 3QWRA 1GOFA 3GO1H 3QIBD 4D3CL 2HMIC 4L4TD 5EZJA 3V6OE 5IQ9A 4EUPA 2VQTA 2LU7A 5I15H 5ENWB 2X4RA 5DC9B 3MYJA 4YPGA 4NO0A 3BQUA 3RL2A 3KLHD 1IC5H 1MIMH 3DX7B 2W0FB 2HYMA 4Y4HA 4C56E 4DTGL 4ELKB 1YPZA 4N9GA 4YZFE 5JNYB 3BP7A 1TZGH 1R5WA 1JPSL 2HVKB 4IMLA 1YMHB 2ADFL 4HCRL 5CEZE 2ZSVB 2DQEH 2ARJA 2BDNL 2AABH 4Z0XA 5FA3A 4CU7A 5C07D 4PJDB 4TOYH 3S7GA 3SGJA 2Z31C 3A67L 2GK0A 4HIEA 1J88A 5D7SL 3IKKA 4XCCL 4CADB 4G80A 3HZKB 5F89B 4CGTA 4X7TB 4AL8L 1LEIA 1BWMA 4KK8C 4LDEB 5DEZA 5K9QG 4U2ZA 5FK9B 4XP1H 4MNGB 5SV3A 3BPLC 2HT2D 3MV9A 1II4E 1ITBB 1D5BB 1LEKA 4N8CL 2HTKC 3LS5H 4FOMA 2VH5L 1W72A 1JPGA 4P2RB 5AZ2H 1MUJB 3T4YA 2QADC 5D2NA 5E0QA 3O6MH 3V8CA 4FXKB 5J11C 2XQBH 4GBXC 4WVRA 5CJ5A 3EFDL 4HUVB 3R1GH 4XBPB 3WKML 4C56D 3DXAE 2Y7QB 3ARFA 3LRHA 1NCTA 5L9DL 4JG0L 3DX8A 2XZCL 5CZKA 3G5ZA 3RY6A 4M6NH 4WCYL 1CQKA 3HC0A 3HE7D 1S7VB 1G1YA 4KJQC 3DWTA 4GLRI 4AJ0A 4UIMB 3G9VA 1S78D 3CC5B 5CEZD 3M45A 4KQ3L 4Z78B 3RGVB 4IJ3B 5DRXA 5DSCA 4BYHA 3QHZH 1KLUB 1FIGL 5CD3A 1R3LA 5I30H 1NCAH 2YWYA 3I85A 3K74B 3OR7A 1DSFL 3LH2L 2G5BB 1DVFD 1EV2E 3D1MC 2FLRT 1PSKL 2VDKH 1UM4H 4QHLB 5EU6A 4N0UB 1KIQA 4LVOC 5HBBA 3P0YH 5JTWA 3UPRB 5T1MA 5JQ6H 1AR1D 3P4LA 3T1WA 2YPLE 5K9KA 3RHWK 5T3XL 1BD2D 2AW2A 3CPLB 5FHBH 4LARL 4Q74A 5HGHB 3CVIL 2HT3D 4C58B 4OZHA 2A0LC 4IRJB 1VESA 3FT4A 4P46D 3VH8A 2AK4E 4K7PL 5C0EB 1INQA 3BXNA 1KCVL 3ZTJH 3KPRA 1A7RL 1DL7L 2IFGA 2VXSL 4YGAB 5I2IA 3MRCB 4WTZA 2VZOA 5IK3A 3BKCL 5E4EC 2X4UA 3DXAD 2ZCLL 4P49A 3T04D 4P5MB 1DEDA 2X7LB 2ZUQB 1XIWD 4UB0L 5JA9A 4MJ5A 3AMLA 5EN2B 5TDPB 1RZFL 5GJTH 3M1BA 1JTOA 3PQYE 1J0KA 2KKQA 2EXWC 1KJ2A 5CUSH 1TMCB 3KPMB 5BZDB 1CF8L 4KK9D 3GIZH 1JGEB 2NZ9C 1NC2D 1F4HA 4XCNA 4ZUWB 3PDDA 3EJZC 1S9WA 3QI9D 4HGMA 3JV0A 4Z7WF 1U8MA 1RU9H 4KKAC 3G6JF 4P5TA 2H8PB 3L3JA 3TLRA 4GXVL 2YPLD 1IGCL 1PY9A 5BRZA 2V2TB 4ZPTB 4JY5L 1KLGA 5FOJA 3BT2H 1QSEE 2IPUG 3MLRH 2AK4D 1SVCP 5EBGA 3DGCR 5GS0C 3KGRA 4AIOA 3VD3A 4NM8L 1F02I 2OTWB 3E6FA 2B20A 4XXCC 3FHQA 3LKOB 4OGXH 3LHPH 3IVKA 1Z9SA 3MXWH 2I24N 2UWEE 2LE9A 5J1AB 5L2JA 2IPTL 1LEGA 5LCVH 5HVHB 4Y4KD 5EIIA 2YA1A 1CFQA 1A6TA 5IB3B 2XZAH 3TO4B 5L8JB 3B6SA 5EU7C 2ICWB 5EUOF 2HRPL 3PQYD 2ADIB 1MCNA 2P8MB 1LMKA 5DVLA 3CLFH 4CNIA 5F70A 5I0ZA 1HOCA 3QPXH 4R4FH 2PETA 4PLKC 4DKFL 5BOPA 1UJ3A 1WV7T 5E9DE 4UTBH 5L7XL 4ZAKB 5C0JA 1CGXA 4NQDE 4BSWB 5FUCE 2X5PA 4KTEH 3WLBA 5LWYL 2X05A 5I1DA 2V7HA 3OG4B 5ALCL 1AQDA 1ADQA 1KENL 1XR8B 1IGFL 2PW1A 3FB6A 1KJMB 1QSED 4RMUA 3ULUF 3UX9B 4ISVA 4GAJH 4QTHA 3VDAA 2X1OA 4JM2C 1F3DH 4WEUD 2VXQH 4XVJL 4L29B 4HAGA 2D4DA 2R69H 2OTUA 4M61B 1MCQA 3RVVD 4HD9A 4AENA 3RDTA 5CBEB 3SKNB 1HH6A 1EMTH 4MD5B 2GJ6E 3DV6B 1WEJH 4WW1A 2QSQA 4EQ2A 4HUXA 1MCWW 2YK1H 3RY4A 5D1QC 3BVNA 5EB9A 2VABB 3B2VL 2SEBA 1JZ3A 2EDWA 2R1YA 3DSFL 4LIQH 5D2LB 3QDJA 3FQUB 1VPOL 2NLJB 4I5BB 3WUWG 4WUUB 3V4VH 1JJUA 2PW2B 4GRWE 1DQJB 1PX4A 1SY6L 3L3DB 4JG1L 5E9DD 1YEIL 4U1HA 1A6PA 1MI5E 4NQDD 4YAQA 1T1ZB 5IVOA 2VDNH 3QAZB 1FNSL 4JE4B 1CD1B 1FGNL 1FG2A 3DETC 4XH2B 1C5CL 3O4LA 3KLAA 3T3MF 3G04B 2QQNH 4GLRH 4HAFA 4JFOB 3L1OH 3BPNB 3TJEH 2VSCA 1GC1H 3CFJA 5J1SC 3VFPB 4NO3B 3RNKB 2NY3C 2W38A 2W65B 4Z5RA 1WWWX 4S0TD 3ZT6A 3FQRA 4IRZH 2PKDA 2P8PB 1W0VA 1U2HA 4L4VE 3Q5OA 4MA7H 4OCXL 1ZLWH 5BO1H 5I6XB 1A6VL 2D0GA 1XAUA 2GJ6D 3G5XB 4HH8A 2R23A 1U8NA 4X5XB 1RI8A 4Z7QF 3GGWA 4JAMB 5BQ7A 3QG6A 5INDB 1BZ9A 5C09E 1TZHA 4OCYH 2YN5A 1IFHL 1FPTL 2NTFB 3W81A 3V6FB 3GMMB 5GZND 4HZLA 3SE3C 4KAQH 1YN7A 5IHUH 2VE6B 2ID5A 4IRSD 2O93L 2BVEA 4D9RE 2YN3A 4YHPA 1Y0LA 3NGBC 3WIFA 3GMNB 5IV2B 4JPVL 1WWAX 3WFHB 4FZ8H 3MV7A 4NQVA 5D7KE 2PO6B 3BH8A 4W4OA 1OW0A 1WT5C 1DLFL 1WTLA 4UOW1 1AGBB 4X9IA 4JR9H 4M9OA 4XPAH 4I4WB 4OLUL 4ZXBC 4F15B 3OKEB 1P6FA 3C6LB 1PLGH 1UZ6E 3O6KH 3SDDB 4ZUTB 1LDPL 4LEOA 4HZAA 3BP4A 1CDUA 4RWYH 1V5JA 4NBXB 4OD1H 4L4VD 4YR6A 4M43L 2Q8AL 4FQPA 3TYFA 3O6FC 2H26B 4OF8A 5CGMA 1NBVL 4LRNH 1JI2A 4P48A 1FLRL 3QIWC 1T1XB 5C09D 4UTAH 5HJ3B 4AMKH 1UA6H 1EFXA 1G7MB 1N26A 1XF3A 3MRDA 2CKBH 1UCBH 4ZOBA 1BX2B 3FT3B 3KPLB 4D9RD 3FN3A 2IFFH 4JJHA 5FO9A 1JWUB 4Z7VE 2UZXB 3RX7A 5D7KD 2X1QA 3EYFB 4NHUB 5HDQL 1ORSB 3FQXB 4PRAB 2FX7L 5DJAA 1F4YL 3TNNA 3MJ9L 1ODAA 1PZ5B 1IE5A 4OLWH 3AXLA 3TO2B 3P4MA 1JZ7A 3U48A 3GZKA 3MBXH 4ZFOA 2XXMB 2WIIA 5TDNB 5KZCD 3QXDB 2FR4A 3LPFA 4HH9B 4PJ5A 1AJ7H 1BWWA 2EZ0C 4JPKL 4PRHE 4Y2DD 1ONQA 2AXFB 4CW1A 4E9LA 1KB5H 3VXRA 3FQWB 4U6TA 4KQ4H 2AEWA 3BPLB 3ZT7A 4OZHF 4LBEA 1MFAH 3LB6C 3SPVB 3CDGA 4FFWD 4GW5A 1BBDH 4NPYA 1BF2A 4U1JB 2QADB 1R3HB 4WHYH 1GOGA 1T20A 2EIEA 2QSCL 2ZP0T