3DI2B

Crystal structure of the complex of human interleukin-7 with unglycosylated human interleukin-7 receptor alpha ectodomain
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
195
structure length
195
Chain Sequence
DYSFSCYSQLEVNGSQHSLTCAFEDPDVNTTNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Interleukin-7
publication title Structural and Biophysical Studies of the Human IL-7/IL-7Ralpha Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 195
sequence length 195
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF18447 FN3_7 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3di2B02
2.60.40.1870 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3di2B01
4WFHE 3O3DA 3B4NA 4L9LB 3RZCB 5DEFB 2CKNA 4L4TE 3GNMH 1OSZB 1P5UA 3BMVA 5DVMA 3B5HA 1NCBL 2DIBA 1RJCA 2F53A 4HIIA 4XNXL 2VDKH 2EXWD 4H8WC 4Q74A 2DIJA 2XRAH 1BZ9A 1T0NB 5BMFL 3O8XB 4YR6A 4RX4D 4JR9L 2J1KA 1XGTA 2Z92B 4PJ7E 5FYKH 1CVRA 4CADB 3AREC 4HKZA 1FJ1A 3GSRB 4XC3L 3UBXB 4HWZA 4IDLA 2J8OA 2FJHB 1MFEH 4NQEA 2VL5A 1MLCA 1H9VA 1BVKA 5D7JA 2VERN 1C16A 4ORGB 5IWLC 1YEKH 3ZHLA 3MO1B 4DGYL 4Y16B 5LKNA 3PL6B 4V1DB 4X4ZA 3OJMB 4U1NB 4YEEA 1UZ8A 5LGKA 2NTSP 1K2DB 2P8PB 1LK3H 4NJAH 3P2TA 2ZCHH 4UQ3A 4HEPG 1YMHA 3OXRA 5GRXG 3BD4A 3ARDB 3ZT7A 4AEHH 5DJYB 2XOTA 3WFBH 3QNZB 4P4KC 1ZLWK 4MJ5B 4EQ3A 3IXTB 4FTVA 4TRPL 1XMWA 3PWPE 1A0QL 1T2QL 2DWEB 3DYOA 2LTQC 1NMAL 4X6FA 1AJ7H 2Y25A 4MYWB 1AR1D 1GZPB 2AI0L 2W9EL 4HIEB 5FEBA 1ZT1A 2AVGA 3TIEB 1P2CA 1DQDL 1OAKL 2VXUL 5DR5L 3DMMB 4BA8A 1G7PB 4LCUA 5HYFA 1KTRL 2GJ6E 4X8JB 1AD0A 3BFOA 3WHE1 1J0KA 2DQJL 2O93L 3MLVH 3HUJE 1ETZA 3H6JA 3RPIB 1I7ZB 2KZWA 1FG2B 2HYMA 2XTLA 1MPAL 2VLLB 4BSVA 2QSQA 3OX8B 2OL3B 3O2WH 4ZAKC 3KDMA 5CGMA 2ZUYA 5L8KB 3OR7B 1F3DJ 5DRZA 1GH7A 1F11A 1TETL 4XWGH 4WENB 3HZYA 5FV1L 1HH9B 3FRPG 5HDQH 1MFCH 3ZKMD 2JCCF 3FT3B 2YK1L 3OKNA 4LSQH 2IADA 3H42L 3AAZB 1XGPB 1SEQH 3ARUA 5IWLA 1UCBH 2G5BB 5EC2B 1C5DB 3OXSA 4XC1L 2CXKA 2GSGA 3WS6A 4ZFFB 1YEHH 4OIBA 3BVNA 2HJFA 4O4YH 2OBGA 3B2VH 1EX0A 3K2UL 3T04D 4MA7H 1E4WH 2C9AA 1KC5H 1KGCE 1HWGB 4HWEH 1SYSA 2H6PA 4CVUA 4ZUTA 5HDOA 4HHAB 2WQRA 1UZ6F 5DJ6B 5KSUA 2BNRE 5TFSL 3PXHA 3BJLA 4MA3B 3QUKB 2BHYA 1WT5C 3D85B 2E6JA 4TQEL 4DEPC 2EYRA 4U1JA 3W2DH 4PJXF 1UKSA 1KLGB 4PG2C 5D7KE 1WITA 2Q87A 1KJ2H 2FRGP 5IK3A 2O26U 3BXNA 5DA4A 3WUWA 2PXYB 3PWNA 1BWMA 4P9HL 1U42A 2DQTL 5LCVH 2ICWJ 1Q0XH 2Z31C 3QUYB 3KWWB 3DO7B 3QSKB 3QDMA 3O9WB 4MQ7B 3O2VL 5DD0L 1WEJH 3X11A 2D7NA 1CLCA 3DXAB 4GKSA 3PWVB 4IRJD 1HKLL 4O2FA 3ULUE 1XIWB 2AV1A 1NJ9B 5T1LA 4XH2A 1IGJB 1ZHKB 3MLTA 5CINH 5I17B 2CR3A 1DUZA 2JJWA 2XQYG 3V6ZA 5T3XH 1N64L 4RGMC 3L5IA 4G6ML 2B0SL 3DGCR 2UWEE 3TJHC 2X4SA 2NY5L 5DFWH 4HV8B 4JE4B 5EO0A 4R2GD 1F45A 2BSSB 3EDFA 4X7TB 3T8XA 3NFNB 4KK9C 3U36B 2I24N 3NCFB 5C09D 3O2DH 1D6VL 3TZVA 1EJOL 5BJTA 3PJSA 1L6XA 2I5YH 3EHBD 3PIQA 3ECBB 4FQ2L 1UFUA 4KKAC 4XCCL 3MCLL 5I30L 2NLJB 1QSVA 2FSEB 4NBXB 2WM0A 1YQVH 2OXGA 4XCNB 4Z76B 5KANI 3DX9B 5FYJD 2F5AH 1JNLH 3B5TA 2VABA 4KKCD 4PD4J 3UBXG 3E6FA 1FN4B 4W6WB 3EOYG 4EIGB 4LRIA 1BQSA 5IT2H 4DUXA 3C08L 1Q38A 1BAFH 2VXSH 4HG4J 3VI3F 5JLZB 3G5ZB 3O6FB 3OKMB 1YECH 3H8NA 4PJDE 3BWAB 5AUMA 3O6KH 4M6NH 5T1KB 3FRUB 1JPSL 3W9DB 5CD3A 2VLKA 5E2TH 1DCLA 1MRFL 2FX9H 4LSPH 1F58L 2WBJB 3T65A 4ZPVA 3UMTA 2V7NA 2Y9RT 3MA9H 1KCSH 2Z31A 2ED7A 2EDXA 5HHME 4FQLL 1QFWL 2ARJA 2JTDA 5FOBB 4PJ5E 4JFEE 2ESVB 2PYFA 3V6OA 4N0UB 1N2RB 5DRNB 5EO9A 3W0WB 4BZ2L 2WBWB 3CIQA 2VZVA 1MF2H 4M7ZC 2Y7QA 4LSTL 4Z77A 5GRUL 3RNQB 3UZQA 5T1MB 5IIEB 1GGYA 1PEWA 4FZEL 3QXDA 2OCFD 4KY1H 3S35L 3HI5H 5IW3A 5H35A 5GRJH 1F3JB 3JWDH 1GOFA 3U0WH 3ARBA 5FYLH 4YJZL 1ODAA 2GJJA 4XVTL 1HNGA 1I3VA 1QA9B 2ICEB 4K7PX 3G04A 1TJIL 4R4ND 4CVXA 3NCYP 1CICC 2CKBB 3KLHD 5BRZB 4OZIE 4HD9A 5IVOA 1BECA 1U58B 3V5KA 2VXQL 4HF5H 3D69A 3MFFA 1OT1A 5I1GL 3QWRD 4LPXA 1FE8H 5HVGB 1RUML 5CUSH 4QHMB 4L5FH 4RSVA 2BVQB 2X4QB 1AIFA 3GI9H 2VDPL 5DEGB 2C4FT 5A43C 3RGVD 4HXBH 3W9EA 5LQBH 4I3RL 3BKYH 3HG1A 3EYFB 5F9JB 3SCMC 5H8DA 2QHRH 1FNSL 1MHEA 5E2UL 4PGCA 2DKSA 3TVMC 5SX5H 1FNLA 2L7JA 1CTNA 3MLZL 1YN7B 2L4OA 1KUMA 4M48H 3NCJH 5CZXC 3RVWC 1XCQB 4PJ8C 3QUML 1OF2B 5F3HA 4PJ9B 5AAMA 3LEYL 2YEZB 3QIBA 1CIDA 3BGAA 4PRDA 2LU7A 5ESVB 1H5BC 2GTZB 4EQ2A 3MPCA 2A9MH 4QRPB 3QEQE 5E8NA 1Y0LB 3OJDA 1R5VB 4FQXD 1DANT 1DQML 5D2NE 4EBQH 1J05B 4QRUA 3DX6A 4LMQI 1U8QA 1BJ1J 5JW4R 1I9IL 4JQIH 4ODTH 4YGVA 3ZTNL 1H0DB 3WIHL 5IFJA 4M8VA 1X44A 1G9NH 3QDGE 3FFCE 2BRRL 3TWCL 1X5GA 3MRCB 4IOFD 5JQ6H 2HMIC 1NEZB 3QFJD 4KHTL 3IJSA 4JFFA 4PJXE 3Q1SH 4OBSA 3RBGA 1A8JH 1JF1B 2SEBA 2GFBB 3WYRA 3EUUA 3BYTA 4LBEA 1S9YA 5IB5B 4X6DF 3QDJD 5JW4Q 5ITFB 1QSEA 4M03A 5FYJU 1MJ8L 1KBGH 2Z8WC 4CMMB 5L9DL 3VG0H 1PZ5A 5TDOB 5K9JH 3V7AE 4NNXA 3GSQA 4KK6D 3KYKL 3MV9B 5J11C 4PJFF 1M7IA 1G6RA 1LK2A 1F4XL 3NTCH 1GGBL 5CSGA 3HE6C 2P5ED 2MKWA 5C07D 4P9HC 2VWEE 3EYOB 2EE2A 1CI5A 1ERNA 5J12C 3RA7L 3GMPA 1DFBH 4FABH 1IC5L 1U91B 1J1XL 4IEFB 5T1DH 2RCSH 3MRFA 4APQC 1RJLA 4MX7A 4TOYH 3TCXA 3BP7B 3JTTB 5I2IB 4OGZA 3UTSA 4D9LL 4Z7NE 4OUOA 4PJ8A 4KJYB 1YEEH 4PP2B 5DXWA 1EUUA 1ZVHA 4P2RB 3CZJA 1WK0A 2C3VB 5T33H 1FYTB 3QEGH 4OCSH 4K3DH 5IB3A 2PYEA 7FABL 5I1IL 1H5BA 3LY6A 4MDIA 4XXCC 4Y1AB 4JANB 4YNYB 5F89A 1YMMB 2NY5C 4OM1L 3V79C 1T5WA 4JFQB 5TQ2H 4QYOA 5E5RB 1T66C 3ABZA 1IAIH 3MACH 4IRSB 2XWBB 1TLKA 2DQHL 3LMJH 4K7FB 4UILL 3U1SL 5T3ZH 3BEVA 3F12B 4PRBA 2P8MB 3EJZD 5D6DC 1EGJL 4GBXD 5JUEL 4GSDH 3CVHB 2ADGA 4Y4KD 3NIGE 4JQXA 3DRTB 3G6JB 3KLDA 4KUCF 4RMVA 5IM7A 4N90D 3H7BB 4NT6B 3QPXL 1DANU 4X5XB 2ZCKL 3DRQB 3CLEH 3MLWL 1T4KB 4KQ4L 4YUEL 5L8LB 4N0FA 4LEOB 4HMDA 4OZHA 3BGFC 4Y4HC 4NHUA 5DTFB 5L8JB 4Z95L 1YN6B 1ZHNB 4NZRL 4D3CL 1RZJL 1FCCA 4U6XA 3QA3A 2DQGH 2FCBA 2EKJA 3QQ9D 4H88H 2LAAA 1MFBL 4XAWL 2FJFB 3DV4B 1FORH 5IQ9A 4P4RA 3UPAA 1T1YB 5HPMB 4QHNA 1SYVA 1JIBA 2F53E 1H3XA 1BREA 1KIPB 3ARSA 3KG5A 5J13C 3T77A 5I0ZA 2HVJA 1R3LB 4OI8A 1QYGL 2NZIA 1EA9C 5F7UA 4HBCH 4NO0A 4FOMA 1A7PL 1IC4H 3QPQD 3GMMB 3P77B 3TNNA 1UT9A 4NQEE 5JA9A 2YR3A 1DN0B 5TPWL 4G7YL 4OQTL 1MELA 3DNKA 4JZJB 3MRKB 2VDNH 2YXMA 5TE4H 3WIIH 1CD9B 4G80B 4YWGL 4ZFGL 3IFPA 2V9QA 4YHOL 4L4TB 3Q6GL 4BK4A 1YY8B 4G5ZH 3JWOC 3QCUL 3OR6A 3OPZL 4CAGA 2FR4A 4BQBA 3RWCB 1FGNL 4AMKH 4LGPB 3KYMA 4LSRH 5F71A 4ZUWA 5E6IC 2VXTL 3RUGA 1NDMA 1V7NL 3P30H 8FABA 4FTVE 3UTPD 1WC7B 1F2XK 4PJ7B 3U9PH 1FLRH 1T22A 1ZGLP 4HDIB 1ADQL 5E2VH 3U79A 4G8FA 4NWTL 2EEBA 3SDDD 4XVUD 2DLFL 2XTJC 4DZ8B 4Y2DA 3R06A 3GBMH 1DE4B 4Y4HA 4DCQB 1J88A 4NQXA 4P46A 3BP5A 1J9CT 2C1OB 4UTBL 3V4VL 1I1AC 1NC4D 2P46B 2VOTA 3HE7D 4LKXB 3WLBA 3LEXA 2ZOKB 1DL7L 5GGRB 5ILTH 4XNYL 4LLQA 5HGDA 5J06A 2PO6D 4X6CF 3UJJL 5EZIL 2NZ9D 3DHMA 4JB9H 1NEZG 1WWWX 3PWPB 3AUVA 1IAOB 4HUUB 4TSBL 3VDCA 2IQAB 2YOCA 3EYQD 2R23B 4N0CC 2Z8VC 1RUQH 4WFFE 5DUBA 3KPQB 3TO4D 4OD2A 3ESUF 3U30B 4LRNL 2VH5L 4WW1A 4D0BA 2Y06H 1IL1A 1EJ6A 2HKHL 3EHBC 4OM0L 2K9UA 3O3UN 3PDOB 1IGFL 4U0QB 3ZYJA 4LLMB 3HCVA 3BUTA 3PP3H 1P1ZB 4OKVB 1XF4B 2GJ6B 3CSYB 4FQIL 1BBDL 2V9RA 5EZOH 5IB1A 4EIZC 3CFCL 2GW5A 4KZDL 1GPOL 4K71C 3HUJB 4B41A 1SBSL 3L1OH 1WWCA 3GIZH 1AGCA 2OL3H 5LXGH 2D31A 3MRLA 5E6IA 4NIKB 3G5VB 3P9LA 1NGPH 3VFOA 2DMKA 5IMOA 1J7VR 3N0PB 1FIGL 4NRYA 4NQSA 2AJVH 1CD8A 4WU5B 4X6EB 1YPZA 3VGGA 3S3JA 1EXUB 4NN6B 2XXCB 3VXMD 1ES0B 3U9UA 1QFUH 43CAA 4UINH 3O6LH 1H8SA 2DTMH 3FL7A 5IHZB 1UM4L 4DFHA 4CJ0A 4XPBL 5CIPA 1E28A 4F80A 1GGCL 5ICZA 3QDME 2APXA 3LPGA 4ZUSA 2EIZB 3BP4A 1A1MB 4MAYD 3KLAB 2CLRB 2O5ZL 5TDNA 4Z9KB 1YDPB 4PRPD 4ONFL 2BNRB 2W9DL 3CXDL 3GSNL 1U3HA 3FB6A 2CIKB 3I9GL 4JN2B 2BNUB 1A1OB 3FQRA 2ZUQB 1JZ7A 2NW2B 4QXTA 5GRVK 4LLWB 2YA2A 5MERA 1YYML 4YHNB 3ZE2E 1CGTA 1IGCL 3V6FA 4OLYL 1EH9A 2NNAA 3SO3C 4LCYB 5A1AA 2B4CC 3ARGD 4MXVF 3D0VA 1QLFB 3QI9D 2Q8AH 3QHZH 4PS4L 2A2QT 1JN6B 2EDBA 3B9KA 5FF6A 3INUH 1II4E 1P4LB 2XWJA 4OFYA 1WISA 4ONGL 1JI2A 4FFYL 4QHUA 4OGYL 5FOJA 1AY1H 3QRFM 4JRYA 1CDBA 2AJYH 3L95B 5KSVB 4LLYA 4MZ2A 4L8SA 2UWEB 2IPTL 2YS4A 1DQQB 5E4EB 3OB0H 1KN2L 2E7CA 3GKWH 1Q9WA 3VWKA 1YEDA 2VR5A 3GRWA 1DBKL 4M6ML 1PYWA 2VLKE 2M1KA 2VDKL 2XN9A 4U1LB 4OCWH 4LVOC 1J0YA 1TJGL 1FV1B 8CGTA 2XRAL 4GAYB 3FT2B 4NRZB 1CN4A 1QSZA 4NDMA 5KN5B 3QIUD 3SDCC 5I1JH 3LKQB 2BOCB 3VWJB 3LQAC 1ZV5A 1TCMA 1MFEL 3NCCB 1CCZA 4R3SA 1K8DA 1RUAH 5DHYB 5DQDH 3CH8A 4PV9A 1SJHB 4OFDA 4JLRA 3VGAC 4PJBF 5IV2A 3FN9A 4AH2A 3JV6A 3HN3A 2APFA 4PJDB 1LK3L 1LHZA 4IOSD 5DD5L 4NJAL 2C3WA 1OAXH 3FQTB 5IEHA 5SX5K 4JHZA 1CLOH 1BFOA 2IPUG 1U8NA 4AEHL 5EIIA 2R2HB 4YHIB 5CBEA 4BSWA 5HHMB 5T3XD 3JBG7 4Y89A 3T0VA 1E27B 3WJLA 1XCTB 2VDMH 3MRNA 4YIQB 1HYRC 4N9GA 1CFBA 1LD9A 1RJYB 5FV2A 1AJ7L 2R15A 1QPPA 1BMGA 2Q76B 3MROB 3NN8B 5ESQA 4PJ5B 4JFEB 2Z91B 4YPGB 4HCRA 3RUGF 1X9QA 3A6OA 3QG7H 3R1GL 5DD3L 4OIIH 1FFPA 1I7RA 3S35X 3ELAT 5E99H 3HG1E 3BQUA 3MLVL 4X6BA 5GGSA 5L6YH 3GSUB 5F6HJ 4JDZA 3M17B 5JMRA 5ECJE 5DD6B 3BH8A 3O2WL 1G7MB 1D9KA 1ZK9A 2ADIA 2DLTA 2NPLX 2XIDA 4HXAH 2ZOLA 4CMHC 5E4IA 3FO9A 5HHPA 2F19H 4U1IA 4UDTB 1LVEA 4D9RE 3DVNB 4OZIB 2R1XA 4LKCB 5KG9A 5C0EA 4XWGL 3GBNH 4Y4KC 1IEBA 3ARYA 5D7SH 2CLVA 3DX7B 1FZOA 5J6GB 3X12B 5EORH 3D48R 2DQEH 1HHKA 3BZFA 1I8KB 5H94A 2IFGA 2DKUA 1UCBL 1KPUA 1QBLH 3UYPA 4GQPH 1GVIA 3EO1B 3VH8B 1CE6A 4ZDHB 1YEHL 4F7MA 2I9LB 2R1YA 1NLDH 4WHTA 4ODXA 5CHNA 1ORSA 1MUJA 5DYOB 1B3JA 1QFWI 1E4WL 2VDQH 4JFFE 4MA7L 3VU2A 2FLRT 3L9RA 1KC5L 4MDJB 2JELH 1WSST 4HKJA 5DJ0A 4HWEL 1QSEE 2EIBA 3FFDB 3N50A 4JAMA 5CEYA 5BZDB 1LO2L 4LVNC 4G8EB 5DT1H 4YHLH 4KI5F 3CVIH 1UGNA 1YEJH 3QEQB 5D2LA 1KJ2L 5I18H 2R8SH 5D2NB 4NBYB 3I02A 4J12A 4C56D 4PRIA 1FZJB 1IBGH 1JF5A 4KUZH 4PJGA 5FYLD 3BO8A 3WNKA 2VZ1A 1AO7A 3PHQA 4XZUB 4BQ8A 3Q6FB 1MCIA 5LCVL 3QDGB 1CU4H 3FFCB 3HRZA 3P73B 3TT1H 1CFNB 1Q0XL 1U93A 4YEFA 1XGRA 1YPZF 3WJJA 4Y5XC 4PJXB 3IDMB 5BCAA 3IS0X 3T4AA 1QO3A 3V4PH 3UTSE 1P7KA 3MUY1 4JJ5B 2R29L 3GMOB 2YRLA 4RIRA 3F7VB 3UZVB 5CINL 4MXVE 3IS1X 3LB6C 1HQ4A 1OAYH 4OTXH 4KJWC 1T04B 5T3XL 2PYEE 3GBLA 4PR5B 3TIDA 3CFJA 1J5OH 4O51B 4Z0BH 3IDGB 2FL5A 3PHOA 5J1SC 2ATPB 4ALAH 4ZMAT 1TZIA 3O2DL 3IGAA 4FG6C 2VN7A 3MV7D 2W0FA 5ACZA 1I1FA 2BNQD 4U1MA 1DR9A 3NACH 2ITDA 5C08D 2I5YL 5CEZE 1T89C 2HFGH 3QNYB 2LFGA 3REWA 1BFVH 5DQJB 1YQVL 3HE7C 1CFVH 2R39A 3K8MA 1V05A 1IFHH 2XQYK 2F5AL 2PO6C 4TYUA 4OZHE 3VG9B 1T1XA 3OKOB 2DYPA 3MBEB 4P3CH 5TQ0H 1UQSB 3LRSA 2E6QA 5IT2L 1FYHB 1WFTA 3ZYZA 4YFEA 1AR2A 3SDYH 3QCTH 1A3RH 1PSKH 4DVBA 3TBVA 5B8CC 4XNQB 3G08A 4DW2H 1YECL 3MJ7B 5HI5D 4YX2H 2JJUA 3VJ6B 1S7VA 1RJZB 2DMCA 1ZSDA 2XKNB 3CFIC 4M6NL 3J7HA 1X5JA 1Q1JH 1S7XA 3FQWB 4HIXH 5JXEC 3RX8A 4WFGD 5E2TL 1KTDB 5IW1A 2FX9L 4L3CA 2CJUH 1CQYA 1GOGA 3O4LA 3QZWB 3QFDB 4KRPC 3MA9L 1KCSL 5I71C 4OT1H 5J89A 3CVHH 4HUNB 5B39B 2AQ3A 4P57A 1BIIA 4JFHE 4WWKA 4JPVH 5IP4A 5I15H 4UTAH 3H9SD 4R6UA 2UUDH 4P2QA 1WZMA 3P4OB 3L3HB 2J6EH 3SKNB 5B3JF 3F62A 5ISZD 1KXVC 5DC0A 3LN4A 3TN0D 4PRHA 3FCTA 5C9JA 1MF2L 3REVA 4HS8H 3O45A 1X5FA 1PAMA 3IDYC 3O3DB 3O6MH 3X17A 1I9JH 2IWGA 2GIYA 1V7MH 1FL3A 4WHDA 1F3RB 2F53B 4HIIB 1KFAH 4XT1C 4BM7A 4XP5H 1I3RA 1XR9A 2ITCA 4XX1E 5E8EA 5GRJL 1OGAD 1RZ8A 3RI5F 1KCLA 4QY8A 3NA9H 3RUGE 1BZ9B 5FYLL 3U0WL 4YR6B 2R2BA 1XGTB 1C7SA 2GCYA 1QNZH 1HYSC 4HKZB 1FJ1B 1U3YA 4BH7A 4HWZB 4S10A 1VFBA 3MV8A 4JKPL 3VXNA 2JIXA 4HF5L 5CILH 4NQEB 2VL5B 5GGTL 1MLCB 1BVKB 5D7JB 3KHOA 5T3ZD 2BHUA 1C16B 1FE8L 1W0WA 2EDHA 2BY1A 3E8UH 1RU9H 4L5FL 1ZWIA 2EH8H 3TT3H 2GI7A 3D25A 1UZ8B 5LQBL 4WUUD 2AP2A 5DO2D 3BKYL 4UQ3B 4MB5A 2QHRL 3ILQD 4Q0XH 1YMHB 3OXRB 4S1DC 2R9HD 3WHXA 3VH8G 4LSUH 5DJ2A 3WFHA 2UVFA 4QHLA 4K9EC 4M48L 4Y2OA 4RMUA 3NCJL 4FTVB 5E7FA 4OF8A 3MODL 1ZHLA 3UTOA 1U2HA 5F6HI 3S97C 3QB7C 2DTSA 1UADC 1MVFA 3LS5H 3BDBA 4AK1A 4F58H 3QI9C 1FPTH 4LPUA 1WFUA 2DI9A 2A9ML 1ZT1B 4X0KA 1P2CB 4M7LH 1N6QH 5HY9A 4GXUM 1MFAH 4QO1A 3PUCA 4F7CA 4JM2F 2AGJL 5SV3A 5CLTA 4LCUB 3ARFD 4JQIL 4ODTL 4ZQKA 3T09A 1P84K 1J12A 1AD0B 4MA1B 2XPGA 1ETZB 1G9NL 4POUB 4H20H 4NQDA 4L3ED 1KB9J 4LPTA 4BSVB 1WZLA 2R69H 3W5NA 4YDLC 3MRHA 4I0CC 4BQ6A 3UP1A 3KDMB 3LHPL 2HP4A 5EC1A 2IGFH 4GOSA 4M61A 2GJZA 1JHKH 4A6YA 5DRZB 1U41A 3IJYA 1F11B 4DVRL 4CJ1A 1ZE3C 4K2UH 3HZYB 5A2KH 2NY3D 1Z3GL 3VG0L 1KOAA 2IAMA 2AJXH 2ZUXA 5K9JL 5KSAC 3EKCA 4UDUA 5GSVA 2JKXA 3LPWA 2X7LA 3OKNB 3RZCD 2XTJE 1KJ3H 1D5XA 2IADB 3CDGA 1VEOA 4GUPB 1A6PA 1OP3K 3OXSB 3RIAK 2CPCA 3NTCL 4YDKH 2AV7A 3IYLW 2GSGB 3RQ3A 3Q2CA 4YZFF 3BVNB 4MD5A 1CR9H 3RU8H 1Q9KA 1DFBL 4FABL 1EBAA 4E41A 5D2LF 5T1DL 1QBMH 4JHAH 2RCSL 4KC3B 3AY4A 5J9PA 3PDDA 4PLKD 1SYSB 1R24B 2H6PB 1I1YA 3LPFA 2B39A 4ZUTB 3RVVD 4LCWA 4Y7MA 4ENEC 1OSPH 5KSUB 2HTKC 4NYLA 1YEEL 3MV01 4FMFA 2X40A 5I1HH 3F8UB 4Y16D 1TVHA 3PL6D 1OARL 1NCTA 2EYRB 4V1DD 5T33L 4U1JB 1TQCC 2NR6C 4YC2C 1JV5A 2BVOA 4OCSL 4H0HB 5L2JA 2NXZD 5C9KA 4K3DL 5EZLA 1FHGA 3OB0K 3QNXA 1P7QD 2APTA 3V0AC 3TEUA 1MRDH 5F7FA 4R97C 5IK3B 5E2JA 3BXNB 5TQ2L 1WLHA 3MJGX 1X3DA 4G6AC 4U6VH 3WUWB 3PWNB 4LHUA 2NY0B 5T3ZL 3NFSH 4Q9BA 1RZGA 5MEOA 4XP9H 4DN4H 5IW6A 5D8JH 2EECA 3QDMB 4GSDL 5DHVA 5D5MA 3X11B 3S3SA 3KJ6H 4GKSB 3QZWG 3OQ3B 1BBJA 4ZAKB 2AV1B 1CFQA 5T1LB 4XH2B 1FNEA 5B39G 5JPNA 1QR1A 1MWAA 1RIUH 3MRIA 3RDTD 4GG6F 3CLEL 3MLTB 1DUZB 2VUOA 3DMMD 5GGSY 1WTGT 2AABH 3V6ZB 4DTGH 4PREA 4JRYE 4YLQT 4LFHG 1CDJA 1X6LA 2X4SB 2OP4H 2DQGL 4YBQD 4H88L 5EO0B 2AEQL 4G6JH 3F7RA 5F1IA 2BXYA 4U0RB 1FORL 1MCQA 3T8XB 3QO0A 5L0QB 2PCPA 5LJYH 3TZVB 3BGMA 3L3JA 1ACYH 2XN9E 4AEFA 1H3VA 1WF5A 3PJSB 5BJTB 5F7NC 5DMGC 3PIQB 1VB9A 3S96A 3NCMA 1A6UH 4AYFA 1KSRA 5IBTH 4A2MA 3RY6A 1P6FA 2GK0A 4EN3C 2VABB 3KYOA 1HK6A 3E6FB 5D7IA 3W39A 5I73C 3KPSA 3VMOA 4HGWA 5I1LA 4JY4A 4DFIA 2VE6A 4MCYA 4R26H 1UB6A 2VDNL 5TE4L 3WIIL 1ZVYA 2IBGA 3MUJA 5AUMB 3AS0A 4WNQA 4HKBA 2AKRA 5CD3B 2VLKB 3UJIL 4U6TA 1FQ9C 4LSRL 4AMKL 3T65B 4ZPVB 1KXQE 2V7NB 3JWDC 2Z31B 3P30L 3PV6A 3D85D 1AGBA 3U9PL 2IMNA 1FLRL 1J86A 2ARJB 5HHVH 5E2VL 4UV4H 3LS4H 1L6ZA 3P11H 1A64A 4Z5RA 3WNPA 5EN2A 3CAFA 5DJAA 4HWNA 1S7QA 2PYFB 3I50L 4PB9H 5EO9B 2ORBH 4X80H 2Y7QB 1T7VA 4ZOAA 4Z77B 4XWOC 5DLMH 4BFBD 2Y23A 5A2JH 4C83B 3O9WD 3BKCL 1MCEA 2XG4A 3QXDB 4P3DA 3WNOA 5H35B 1XIWD 3ARBB 4HJJH 4JB9L 3QDHA 3T2NH 3G04B 4CVXB 3VGEA 1RUQL 3MRPA 5HVHC 4QXUH 5I9QB 4MQSB 3SGJC 3V5KB 5AD0A 3D69B 3MFFB 4NKMA 5EBLA 5EFIA 5HJ3A 1OB1B 2Q6WA 2YPVL 2Y06L 3PABA 3T1FA 4EN3A 1ZMYA 4C4KO 4HK3J 5I8CA 3RIFK 3V6BR 2H41A 1AIFB 5FUOL 4XGZA 3FO1A 5C0BA 3W9EB 1KB5L 4G8IA 4PRAA 4Y5VA 5EZOL 3HG1B 4YQXH 1G9NC 1MHEB 3BIKA 4PGCB 3ZKXC 3L1OL 2YRZA 4RMSA 4HZAA 4WI3A 1IKFH 2YN5A 3MV11 4AL8H 4GO6B 5C0IA 5CD5D 4G9DA 2GTWA 4JRXD 4G8GE 3GIZL 4X9HA 4LOUD 2WLYA 4QRRA 1PFCA 5F3HB 1BGXH 5HYSA 2VLJA 1XH3A 1OAUH 4XCYA 3QIBB 1CXIA 4PRDB 4YZFE 3VD7A 1ED3A 3O6FD 4XXDA 4Q6IA 1I75A 2AJVL 2P1YA 4ESKA 5GZOD 5CP3A 3SKUD 5D2LE 5E8NB 2COQA 3OJDB 2IQ9H 5IVZA 4HWBH 4QRUB 5T1KD 3TESA 3DX6B 1OP9A 4Y0GA 5CJQL 1U8QB 4PRIE 4PJGE 4UNTA 4YGVB 3QJFA 1QFUL 1AO7E 4UINL 5IFJB 4N5ED 1S3KH 2ZG1A 3LN5A 3WUWG 5E24E 3TN0C 1CF8H 1T7XA 4JN1L 3AB0C 3IJSB 1CDYA 3MGAA 4JFFB 5GS2H 4L4JA 3DETC 2SEBB 4LBEB 1S9YB 4QEGA 3UTZA 1B88A 1QSEB 2ESVD 3W0WD 4F8QA 2YD7A 1PZ5B 5FKAA 2PTVA 3S36H 3PHSA 3MYJB 4NNXB 3GSQB 3VXUA 3K7UA 5AG9A 2HA1A 5IVNA 1M7IB 3CU7A 4NC0B 1LK2B 2G2RA 2KPNA 3T1WA 4G6FB 1JF6A 3GMPB 4LVHC 3CK0L 1ULVA 3I6KB 2Q8AL 3MRFB 1RUPH 3QHZL 1RJLB 4IRZH 4POZC 3LKOA 2WIMA 4MX7B 3UTSB 3DTXA 3INUL 3ARQA 3ILQC 3LSOA 1JUFA 4HKXA 4PJ8B 2R9HC 3QR2A 2UUDK 2CO6B 3P9MA 4XP4H 2P8LA 1IE5A 1C12A 3T0AA 5JZ7D 1AY1L 4UV7H 3E3QE 4RMQA 5IB3B 2EC9T 2PYEB 1H5BB 4MDIB 3OKLA 5F89B 1REIA 3IRZA 1ZLVH 1T5WB 1R3JA 4O2EA 4GXVH 2EKSA 1UG9A 3GKWL 1PY4A 3U6RA 4PJ9D 3C9NA 4NUJA 3O4LE 1KG0A 2ADGB 4OCWL 1RULH 5KVMC 5F7WC 5IM7B 5F7MC 3TLRA 1UH2A 3DUSA 1RZKH 2O5YH 1N4XH 1IM3A 43C9A 1WAAF 5I1JL 2H32A 1NCCH 4LPVA 5JOPE 2F54A 4N0FB 4P2QE 4OLEA 4NWUH 4OZHB 3GSOA 4NNPH 1Q8MA 2ARJQ 4NHUB 1FFRA 1QACA 4EXKA 4PRHE 3MTRA 1MCJA 1RUAL 5DQDL 4U6XB 3S37L 3QA3B 3R0NA 7CGTA 1JGEA 4R7NA 4P4RB 5FK9A 1AE6H 1K9TA 3L5WA 3NH7H 4PJCF 5GRYA 3VXPA 1KNOA 2X9YA 1OAXL 4GMTH 5GS3A 2F74A 3DURA 3ES6B 4J8RA 4QHNB 1SYVB 1AD9A 3ARRA 1CLOL 5D7IF 3T77B 4BZ1H 1DLFL 1X4XA 2HVJB 2QADD 4Z0XA 3EFDH 5ACMA 3VFSA 2JK5A 1H3GA 3C6SA 3OBAA 3HI1A 3O8XC 4NO0B 4GS7C 4X9FA 3LQMA 2DD8H 3MV8E 3TNNB 2JJVA 2VSCA 4FNLH 4K7PY 2LV4A 2EZ0D 5ETUA 1JJUA 2E9JA 2AJSH 1J0ZA 4ZTOH 3DV6A 4P2CG 4TSCH 1TZGL 3TPKA 3GKZA 4XB7A 3LH2L 3QG7L 1J0IA 5DFVD 4AM0A 1QFPA 4Y16C 4F9LA 4JKMA 3IFPB 4Q97A 3RPKA 2B20A 2IPUK 1PEZA 5INDA 2FR4B 1K6QH 3OAZH 3KYMB 2GHWB 4ZUWB 1NGWA 1IKNA 3ARDC 3ZHKA 3RUGB 2E7LA 1MRCL 3MCG1 1NDMB 4KMLB 4ONOA 4HAFA 8FABB 4P2RD 2BY0A 4HXAL 1TVBA 4HIHA 3O11A 1FYTD 1T22B 1ZGLM 2ZCLH 5DVNA 4G8FB 3U82B 1Z0MA 2IALA 4Y1AD 4DN3H 3GBNL 3DLQR 3ZT5A 1UKQA 1KACB 4Y2DB 3R06B 5D7SL 1JHLH 4O9HH 1S7TA 3SBWA 2X9XA 4RWHA 3A67H 4Y4HB 2DJSA 3BGFB 3ZSTA 2AEIT 1MCCA 2DQEL 5ICYA 4NQXB 5C0JA 4P46B 4GT7A 4E0RA 3BP5B 4PJAF 1QBLL 1S7WA 4KK8D 1U6AL 1BQLH 4Y5YA 4NQDE 3WLBB 1NLDL 3LEXB 2AAVA 4R0LC 4F57L 4LLQB 5HGDB 3ZE1F 3ULVC 2J5LB 4OSUH 2X4TA 2VDQL 2H3NA 4YHMH 1CE1H 2JELL 4IIQA 4NOFA 1A3LH 1MJ7H 5DUBB 1MFDL 4J3OC 4OD2B 4K8RH 3ALXA 3VXRD 3S9DB 4WW1B 5DT1L 4D0BB 1QFWM 3BX7C 1IL1B 4YHLL 1N7MH 3CVIL 4PPTA 2R8SL 5I18L 3DPBA 3HCVB 1MHCA 1FG9C 5AG8A 4OZFA 3BPNB 3RFZC 1OCWL 3HNSH 4F7TA 3ESVF 5IB1B 1NGXA 5DJXA 3L3DA 1FNFA 1DBMH 4ZNEA 1CU4L 3MLYH 3TT1L 2VQUA 1RVFH 2R0WH 4E41E 3CZFA 3P9WB 4HS3A 5I8OH 1AGCB 3U7WH 4LCCC 2D31B 3MRLB 1DVFA 5E6IB 3V4PL 1HEZA 4LCWE 1G1CA 4JO2H 2FHCA 3P9LB 1E0OB 1FO0L 3VFOB 5IMOB 4Q9RL 4NRYB 4NQSB 4IMLA 4U7SA 4POYA 4ISVA 4WFHD 3QO1A 1OAYL 4OTXL 1FAKT 1A6ZA 2XTJB 5J3HD 3LDBB 4L4TD 4IJ3C 1ITCA 1EFXD 3UJTH 3HNVH 4MNHA 1J5OL 1MJUL 2HRPH 3MJ9A 3U9UB 43CAB 5IMLA 5JW5A 4ALAL 2FBJH 2PXYC 4DUVA 1T2JA 1RIVH 3SGKC 5D7LD 5HHOA 5CIPB 1E28B 5C0AE 5ICZB 2JJSA 5C71A 3BRGC 4IRJA 3NACL 4ZUSB 4R0LA 5D5ME 2DI7A 3QUYC 3BP4B 5JMOC 5B3NA 4ERSL 2HFGL 2F9BT 3O9WC 5TDNB 1BFVL 3G9AB 4XTRD 25C8H 3U46A 3V5DA 4Y19A 5JQHC 5EZJA 1CFVL 1BEYH 1XIWC 1U3HB 3FB6B 4NM4L 4WEUD 2PTTA 1WWBX 4ELMA 3FQRB 1SY6A 1F90H 4P3CL 5TQ0L 3OB8A 4QXTB 5AZEH 4NN7C 4OV6F 4KJPC 2IPKA 5DWUH 3SDYL 2JJTC 3QCTL 1A3RL 5MERB 4ODUA 4UBDD 2EDJA 2IMMA 4DW2L 1MCBA 1QEWA 4YX2L 3V6FB 1KV3A 2NNAB 1QUNA 1Q1JL 3PWPD 4HIXL 4KTDH 1LEKA 2R1WA 3HR5A 3D0VB 4HC1A 4JZOA 5HDBF 2CJUL 4O02H 1I3GH 5IOPA 4LLVA 4HK0A 3QUZD 4MS8D 4OT1L 3CVHL 2DQIH 3B9KB 5FF6B 1NANH 2XWJB 4JPVL 3WIHA 4N8CH 4QHUB 5I15L 3BI9X 4UTAL 1CFSA 2VO5A 1NFDA 1EHXA 1P84J 5D1QA 2J6EL 2GJ6D 5D7IE 4JRYB 5FO9A 4NM8H 4LLYB 3KPSE 4L8SB 3AU1A 5I74B 1A6TA 3P4NA 5SX4H 4HS8L 2QQLH 4TVPE 1Z9LA 1YQ2A 4KXZH 4WY7H 3O6ML 2XZCH 1Q9WB 4KKNA 1I9JL 3VWKB 1YEDB 3O6FC 4OLVH 4JG0L 1EFQA 1V7ML 1PYWB 4FS0A 5I0DA 1KCUH 4ZTPH 1KFAL 2XN9B 5A2IH 5J1TC 4XP5L 4CU7A 3SHSA 5C3LD 3VFTA 4XP6H 3NA9L 2WBJC 4KVNH 1G0YR 4NDMB 1VFUA 1K8IB 3V4UH 1F6FB 2EDNA 2I9TA 5ITBH 2BERA 5CILL 2DQUH 5ADOH 3DSFH 3M1BA 4N0RA 1NFKA 3TA3A 4R3SB 4RMRA 1K8DB 5FECA 4PV9B 3E8UL 4QOKD 1RU9L 4JLRB 2MQ0A 5IV2B 2EH8L 4OD3H 3TT3L 4AH2B 4HJ0D 3GZKA 3JV6B 3GM8A 1P4BL 1KGCD 1HHJA 3GK8H 1GC1C 3C8HA 4O58H 5KVFL 5E2WH 4Q0XL 1XFPA 5IEHB 5IESH 3JTSA 4OD1H 3ZLQC 3TC9A 1BFOB 1U8NB 5D1ZA 4XPGL 5EIIB 4NRXA 1N0XH 3EOAA 4MLIA 1XF5A 3LRGA 5CBEB 5FCSH 4BSWB 4PJIA 2D0FA 1IC7H 4ODHL 5D7KD 1QRNA 5C3TA 1MIMH 2RQ8A 3MRNB 3LS5L 1FNHA 1MCOH 4GLRH 4N9GB 4AIZA 1LD9B 4NQCD 4F58L 3MLUL 1FPTL 1YNTA 2OMNA 2V9TA 4NUGH 1NBYA 5ESQB 4J3SA 2DQCH 3ZE1E 1OVZA 4NO3A 4M7LL 1N6QL 4R90H 5HSFA 1MFAL 3KJ4B 1HWHB 5GPRA 1EIBA 1FFPB 1I7RB 5C0BE 4ZOEA 2CR6A 3S34H 3I85A 4NFBA 1MH5A 3BQUB 5BO1H 4X6BB 1FNAA 4JFPB 4H20L 4DGVH 2R69L 3BH8B 4UNUA 5FM5O 4X9IA 2V5TA 1D9KB 1A9EA 2HT2C 3RZWA 2ADIB 4QRRE 5FGBC 2DOCA 2ZOLB 4GRMA 3SGEH 2IGFL 3FO9B 5HHPB 2X4NA 4U1IB 2VLJE 5M95B 1JHKL 2R1XB 4PJ9C 4FRWA 3CUPA 3O3AA 5C0EB 5KG9B 2YMXH 4FQXA 2AJXL 1IEBB 4RAHA 1ZTXH 3U0TA 2CLVB 1FZOB 2AK1H 2HG5A 3TCLA 5FFLA 1HHKB 1Q0YL 2EH7L 3MBXH 3BZFB 1M4KA 1EBPA 5H94B 1KPUB 3L7EA 5H37G 3MOAL 4YDKL 1CE6B 4KPHL 4KKBD 3RL1A 4F7MB 2R1YB 4JO1H 1I8LA 4WHTB 2AW2A 1CR9L 4ODXB 3RU8L 5CHNB 1ORSB 3D39A 4G3YH 1MUJB 4OQTA 2WAHA 3QDJA 4PP1D 1AGDA 1QBML 3L9RB 4G8GB 4ODBD 1QG3A 1SVCP 4HKJB 5DJ0B 4TNWF 2BMKA 3WHE0 1ZEAH 4JREB 1YEFH 3J8F7 1OSPL 1RZFH 3QXWA 4JAMB 5IHUH 5LAXA 5CEYB 3TV3H 1UKTA 3UBXI 4PIRF 2DJUA 5I1HL 1N5YH 1E4KC 1QLRA 3UYRH 5D2LB 1JWSA 3VXUE 4JQVC 3WFCH 4U1HA 5GS0H 3I02B 4TUOA 1MRDL 5C07A 4PRIB 4D8PA 4PJGB 1U9KA 3BO8B 3N1PC 5GJTL 3FB8B 1AO7B 3PHQB 1UEYA 2VUYA 2H2SD 3NFSL 5HHMD 3HRZB 2IFFL 4XP9L 2B5IB 1U93B 4WHCA 1XGRB 2W92A 1XF3A 5D8JL 4Y4FA 1FAIH 1HXMB 4OB5H 3ZKQD 3T4AB 1QO3B 1P7KB 5MHSE 4PJ5D 4RIRB 3QQ3A 1RIUL 2OR8A 5DUML 5DD1H 1AQDA 3T0EA 4I18C 2AABL 1HQ4B 1CFTA 4MB3A 5DGQA 4DTGL 5HDBE 4MA8H 3TIDB 4MB4A 3CFJB 2MMXA 3KYNB 2OP4L 2FL5B 3NZHH 2Q86A 3PHOB 4G6JL 3SKMA 4LASL 5K9OA 4GBXA 1WIOA 5IEKA 4IRSC 3VGFA 1TZIB 3IGAB 2W0FB 4ELMF 5ACZB 4XNZB 1YYLH 1ACYL 1I1FB 1T20A 4U1MB 2ITDB 4F3FA 4YBHA 4P5TD 2XI9A 3REWB 2EE3A 1V3KA 4DGIH 4KK8C 3C60D 3OL2A 2QEJA 2P49B 5IBTL 2F54E 5MEPA 3X13A 1T1XB 4OV5A 2DYPB 3LRSB 4P9ML 3TYGH 1X5IA 2BVEA 1LGVA 1C5CH 3TBVB 4DVBB 4R26L 2VN4A 3G08B 4JQVA 4JCLA 4WTZA 1S7VB 4U7MA 1ZSDB 2NMSA 3OAZK 1S7XB 1I4FA 3FZUD 1JYVA 5IW1B 4JDVA 4L3CB 5J1AA 3O4LB 3ZYIA 4XMLH 3E2HB 3UC0H 2X1QA 4UT6L 4P57B 1BIIB 4WWKB 5CEZH 4W4OC 4PGZA 3E0GA 4JO3L 5HHVL 3VD4A 3FT4A 1KLFA 1TMCB 3LS4L 4S1QH 4P2QB 3P11L 4U1SA 3S37X 4C54A 3F65A 1TCRA 1J8HA 1CDGA 4WGWB 2PF6A 2YZ8A 1TENA 5DFTA 3LN4B 4RFEB 4PRHB 4I18A 3EIFA 4PB9L 3QDGD 3FCTB 3FFCD 5C9JB 4X80L 3REVB 1AH1A 1QHOA 3DO3A 3O45B 4Z8FH 4UUJA 4B53A 2R0ZL 4JZJC 5DLML 3V52L 4PRNA 2YPKA 1GHFH 1YUHA 4BFIA 2P42B 1RD6A 3I75A 1FL3B 1D5ZA 4RWYH 3V8OA 2B2XH 1OGTA 1XR9B 2ITCB 5E8EB 2MOVA 1RZ8B 2QLVB 4QY8B 2R2BB 3SDDA 2GCYB 3T2NL 2WV3A 1MCPH 4BH7B 1NC2A 3B9DA 1UEMA 3C8DA 1VFBB 3MV8B 3BESR 4QXUL 1R3IH 3VXNB 2JIXB 4HLZG 4MZ3A 1XR8A 4I9WE 2FYYA 4KDWA 5CEXA 2FX8H 1LO0H 3VXQA 1IM9A 4HFWA 1W0WB 5GZND 4PJIF 2CQVA 3EO9H 1ZWIB 3D25B 2X70A 1N26A 1NCWH 2P5WD 4G6KH 4LSVH 5DS8A 3BKMH 5C0DA 3QXAA 4YQXL 3WHXB 5DJ2B 3WFHB 1IKFL 4HEME 4AL8L 4QHLB 3IU4H 2A0LD 2HRLA 3GO1H 1EHNA 1ZHLB 3D1MC 5F93C 1BGXL 1OAUL 5DA0B 1GAFH 5KSBF 2J8UF 2EXYC 4JFZL 3U30C 4X0KB 1CIUA 5BZWA 4RA3A 5HY9B 2IQ9L 4F7CB 5IR1A 2I26N 5FB8A 1PQZA 2XPGB 4ZNEE 4NQDB 1S3KL 4AZ8A 1IVLA 1LO3H 2BSED 1CF8L 4RDQG 1NLBH 3AFLA 3MRHB 5IGXH 4N1HB 4LIQE 3BH9A 4QT5A 5TDPA 3IETA 5EC1B 4LFHD 5HHNA 4JY6A 2VSDA 1WFNA 2YD2A 1OQOA 2VJXA 4M61B 2GJZB 2IEPA 5IVXA 4A6YB 5DHXB 3IJYB 4ZNCD 1CWVA 4I2XA 3UDWA 4XI5D 4Z7WF 2BVUA 2IAMB 1MVUA 2QHLA 1SJEA 5GJSL 4UDUB 1OTTD 3MMEA 5EBMA 5GSVB 3CSPA 3S36L 2X7LB 4BFEA 1D5XB 3ZE0F 3CDGB 4JDTH 4XPTH 2F53D 4Y8AA 1JGVL 4NN6C 2AV7B 5DMIH 3BSZH 2OJEA 5JNYA 1UB5A 4OKDA 3NBNA 1J0JA 2PR4H 3WLWD 5IUSA 4LARH 4MD5B 1HN1A 1T03H 4PGBA 2HVKA 1Q9KB 5HHOE 4WU7A 4MVBD 4E41B 4MJ2A 2QTEA 4PRPA 1RUPL 1FC2D 3B6SA 5J9PB 5EOTA 4HJ0C 2WBKA 4FQQA 4IRZL 2DBLH 1I1YB 4LCWB 5D7JD 4DQOH 4NYLB 4Y19E 2H2PD 1CLYH 3DJ9A 3BT2H 2YPLE 1ZA6A 2N1KA 1TVHB 4XP4L 3RP1A 1KCVH 2E7MA 1JV5B 2BVOB 3T3MF 4ELME 2P24A 4UV7L 5L2JB 1MEXL 1LILA 5EZLB 1U8IA 3RWHA 5I76B 3QNXB 2L7UA 3OKDA 3X14A 5DMKA 5H37H 4Z7UA 4GXVL 4YDVA 3ARGA 5IMMA 1KEGH 3VFMA 4LHUB 1U8JA 5E9DA 4FTVD 1RZGB 4MQXC 5C0AB 1QD0A 5IW6B 3AM8A 2EIDA 4K8RD 4MJ4A 4DKFH 4N5UA 1FC1A 5DHVB 3GEWB 5CIPH 1MHHA 5D5MB 3DWTA 1RULL 5FYJE 2C5DC 1BBJB 1RZKL 1CFQB 2O5YL 1N4XL 1FNEB 4UOW1 5JPNB 1QR1B 1MWAB 3ULUC 3MRIB 1NCCL 1NFDE 3WFDH 4NWUL 4NNPL 4PREB 2R0KH 3GSXA 1ZT7A 5C92A 4LCIH 4M5ZH 2RAMA 3TM6A 5F1IB 4KROB 5E4EC 3BMWA 1AE6L 1QOKA 4FFZL 3QO0B 3NH7L 3LKSA 1EK3A 2PCPB 2ZUSA 3BGMB 4L29A 3L3JB 5DJ8A 4WFFD 3EFDL 3QIUA 3S96B 5C7XH 3PWJA 3VGDA 4GAGL 3KPTA 5C2BH 1RHHA 1PKQA 1UWEH 2DD8L 1E4XH 2GK0B 3C5ZC 3SE4C 1T5XB 4FNLL 4PP1C 3KYOB 1AXTH 1QQDA 1WGOA 3VWJC 3WMSA 5D7IB 1A7BA 2JB5H 2W38A 2ID5A 3W39B 3WV0A 3KPSB 2GKIA 3B8SA 4ZTOL 4U7KA 1TQCB 5BVJA 4HGWB 5I1LB 4JY4B 2VE6B 4MCYB 1UB6B 1Z0NA 2IBBA 3EDDA 4I5BA 4WNQB 4HKBB 2AKRB 5ENWA 3G5XA 3KPNA 4P2YA 1WCBA 4P4KD 5F9WB 1K6QL 1WICA 4I4WA 4HUWA 3GRWH 2OS7A 2PW1A 4ODVH 5F88A 3HI6L 2Y07H 4P3WA 3THMH 5FCUH 3PV6B 4PJIE 1AGBB 3BPLC 5I75B 3LCYA 2ZCLL 4XVJL 2H2SC 1QRNE 5C6PB 4DN3L 3FONA 3OF6A 4Z5RB 5EN2B 5DJAB 1JHLL 4O9HL 1S7QB 2VQ1A 2CK0H 3A67L 1UJTA 3TJEH 3QYCA 1FFNA 5JOFA 3K2MC 1I7TB 3IB4A 3B3IA 3L5HA 4LHJB 4FQHA 4X98A 3QDMD 4M9PA 2W1NA 4WEMB 4CNIA 1BQLL 4P3DB 1IEHA 1E6JH 2GAZA 2WZPD 4ZAKD 3SE9H 5T1LD 4OSUL 2DAVA 3F58H 2K7PA 4NFCA 1CE1L 4KHXH 2B4CH 1A3LL 3NAAH 1MJ7L 1SM3L 4GW4A 4XMPL 3MRPB 5AD0B 3SDAA 4K8RL 4NKMB 5EBLB 5EFIB 5HJ3B 2Q6WB 3EDJA 1N7ML 3PABB 3T1FB 3C5ZA 3O3EA 4EN3B 3CPLA 5I8CB 1CGSH 5KAQF 2VLRA 4HCRH 3F7QA 2FO4A 3QEHA 2YA1A 3RNKA 2V7HA 4XGZB 3FO1B 1TTFA 5C0BB 4WEBH 3HNSL 4G8IB 4PY8J 4PRAB 4Y5VB 4TSAH 5CJ8A 1KENH 2OK0H 4FFVD 1DBML 3BIKB 1NGYB 1CXHA 3OAUH 3MLYL 2N7BA 3D39E 5C0IB 1RVFL 4G9DB 2R0WL 2GTWB 2WWMC 3QDJE 5IJVA 2DIAA 1SBBA 2BJMH 4QRRB 3Q5OA 1S9XA 3ZE0E 5DI8A 4PG9A 1OPGH 1SQ2N 1CDHA 1GGIH 3BDYH 4OZGF 3NZ8A 5HYSB 1CYGA 2VLJB 4R4BA 4JO2L 1XH3B 4XCYB 5IBLD 3SJVA 4PUBH 4HLZH 1MJJA 1ED3B 4XXDB 4Q6IB 2H9GA 4KZEH 1HOCA 2X4OA 5IVZB 5CGTA 3I6LE 4N8VA 4RBPH 1RSFA 5C07E 3UJTL 3HNVL 2ZUTA 5D2NC 2HRPL 3ZDYF 3ISWA 1A1NA 1TIUA 1A14L 1X6NA 2Z31D 4EI6A 5GGTA 3LN5B 3HA0A 3TF7C 2FBJL 4LHUG 1RIVL 2NYYC 4YK4B 1NSNH 3FJTA 2M26A 2D4FA 3MOBL 5C1MB 4XPFH 3TBYA 2VZSA 25C8L 3PG2A 3MRQA 5D6CA 3UAJC 2QKIA 1AC6A 1BEYL 2Y36H 1CXLA 2HKFH 5FKAB 3T0EE 3DUHA 4OAWA 3LVEA 3VXUB 4RNRA 5AZEL 3A6BH 3SE8H 1EMTL 5DWUL 2G2RB 2AXFA 2LU4A 4KK9D 3UCRA 1R0AH 1H3PH 5I1EH 2BNQA 5KOMC 2WLZA 3WDIA 3L7FA 5FKPA 5C08A 4KTDL 2VWEC 3S7GA 4O02L 1I3GL 5I1AA 5IFHL 4NKIH 3LKOB 4NHCH 12E8L 2AEPH 3DTXB 3PNWA 4V2BA 4G7VH 2RHEA 3ETBF 5CS7A 1RZKC 1JUFB 3LSOB 4HKXB 1A3QA 2VB5A 2JCCA 3RWEA 3P9MB 1C12B 1WQVT 2R56H 4JZNA 1MIEH 4NM8L 3VG9C 3OKLB 3P0YL 1JTOA 1PW3A 3MBEC 1O7VA 4XCFH 1K4CA 1R3JB 4UIKH 4O2EB 1EZVX 2QQLL 2FZ3A 2EKSB 5MP6L 1A4JA 2XZCL 2F8VA 5AWNL 2IC2A 2CUMA 4M4PA 3U6RB 4X9GA 1KCUL 5L7XH 4ZTPL 4HJGA 5FHAH 3C9NB 4J4PC 4NUJB 1KG0B 4LQ1A 2J7LA 3L3GA 2H45A 4MWFA 4M1DH 3QULA 5EWIH 3DUSB 4KVNL 43C9B 1IM3B 3TO2A 2AQ2A 4WCYH 3VXTA 2H32B 3KPRA 2F54B 5ITBL 1A9BA 1EDQA 5DJCA 2WMPA 2WQ8A 3GSOB 2DQUL 1J8HE 5ADOL 3DSFL 3OGCA 3WL9A 1TJHH 5MEQA 1JNJA 2D03H 5HVWA 1W2KT 2CDFA 1JGEB 4OD3L 4KQ3H 4R7NB 1NCDH 2MPAH 4JFFD 5FK9B 3ROLA 3VXPB 3L5WB 4J7RA 3KPOA 1KNOB 4L3AA 4O58L 1NUFA 5E2WL 2F74B 3DURB 2OMBA 4J8RB 5IESL 4OD1L 1AD9B 2EDTA 1QSED 3RTQC 1OAZH 4KJQC 2VTFA 3VFSB 1DEEA 2JK5B 3C6SB 4BJLA 3WLWC 3HI1B 4EXPX 1MIML 1DBBH 1MCOL 1OAQH 3VW3H 3RWGA 5HYIA 3CJJA 1G84A 4NUGL 2DQCL 5ETUB 2MCPL 2D9CA 3DV6B 5D7JC 3L3OA 4G6FD 3MFGB 3L3KA 1UWGH 3LD8B 2ZUUA 4WUUA 3ROOA 4XRCA 3SCMD 4AM0B 3LEVL 4JPWH 3S34L 3UXFA 1S5IH 3T0DA 1RI8A 2FD6H 2NX5A 1MAKA 5BO1L 5INDB 4NSKA 2P44B 4DGVL 5GGQH 3S4SA 5CZXD 3JSSA 1NGWB 4PJ8D 2BFVH 4I77L 3EGSA 4LDEB 1KYOK 4J4PA 5TF1H 5JO5A 1TVBB 4HIHB 2APBA 3WFEH 3O11B 1TNMA 3VFGH 1RY7B 2OTUA 2IALB 3U7YH 5HYSG 4LQFL 4K8RC 2YMXL 5F9OL 2ZPKH 1HI6A 1ZTXL 2HFFA 1S7TB 2AK1L 3ARFA 4DK3A 2VAJA 5ICYB 2IG2H 1FCGA 3UROR 3MBXL 5C0JB 1BX2A 4E0RB 4B50A 4CBPA 2AK4A 3TFKC 5TJWK 1S7WB 1DBJH 2ED9A 2CIIA 5CEZD 3WNNA 4J2XA 3VA6A 4JO1L 4OI7A 1HKFA 3CSBA 4MA1C 4G3YL 4HMCA 2X4TB 1MCKA 3Q48A 2H3NB 4PY8I 5CJOH 1UM6L 4HUMB 4IIQB 4C59B 4ORZC 3F7PC 3HRPA 5HBBA 3RTQA 5E5MA 1PLGH 3MXVL 2EDOA 1YEFL 5IVXE 2Z9TA 5JIKA 4M1CC 4KVCH 1WBZA 4I2XE 1DJSA 3C6LC 3TYFA 5L2KA 2W91A 4GS7B 2EDYA 1I7UA 4PB0H 1JGUH 1FDLL 1NMBH 1EUTA 3RX7A 1A7OH 5FO7A 3WFCL 1MHCB 3HE6D 1L4IA 4ONHA 4OZFB 3DYMA 4F7TB 4KRNA 3DBXA 1NGXB 2WINA 3L3IA 5DJXB 3L3DB 5B38B 3MRDA 3BRFA 3WS6C 1GOHA 5D4QA 4JFHD 4APQD 1KEMH 3UO1H 2VKXA 3CZFB 1U8OA 4HS3B 4PLJC 4PRPE 1FAIL 3S5LA 5E00A 3CMOH 4OB5L 3SPVA 4L4VA 2YD5A 1RFDH 1DVFB 2X9WA 1DDHA 1HEZB 4P5MA 1NAKH 2DLGA 3PL6A 3K80A 4V1DA 3S36X 1J18A 3OG4B 2VISA 4A6YH 2W0PA 4HX1A 5DD1L 1P7QA 4IMLB 4ISVB 3QO1B 3FO2A 4E5XA 1A6ZB 2WWKO 4MA8L 3DX8A 5INCA 1YNKH 4HGMA 1T66D 4FMKA 4KMTH 3MXWH 4MNHB 3SE3A 4Z7UE 3NZHL 5JW5B 5IMLB 2XQBH 2MNUA 3U4EA 5E9DE 3HMXH 5HHOB 2NY0C 2YN3A 1YYLL 3FO0H 4IRJB 2FEDC 4U3HA 3N85L 4R0LB 5KJRL 1CG9A 5D71H 3RDTA 5DK2A 4Y2DD 4DGIL 1KB5A 3DECA 3U46B 3WO4C 3V5DB 4Y19B 4K9EH 5LVEA 5EZJB 2YPLB 4Y4HD 3WKNA 1VEPA 1TDQA 2PTTB 4ELMB 3W11C 3C6LA 5HGBA 4R2GB 3R8QA 2M8XA 2IPKB 1W72L 1C5CL 4ODUB 4P5KA 1V3MA 3MNVA 4M62H 1QEWB 1VERA 4YXHH 1AQKL 4U0RC 4FP8H 5D1XC 1LEKB 2R1WB 1YEGH 3QQNA 1XGYH 4JZOB 4X6DA 5L0QC 1EEUA 4UI2A 3I6GA 5IOPB 2XXMB 4LLVB 4FFWD 3RJQB 3TZVC 1RIHH 4HK0B 4YPJA 4XMLL 3VRLF 1FIEA 1MAMH 3UC0L 1G0DA 5DHVH 1PJ9A 3ULSA 5CEZL 4LCCB 4FFVC 4B7IA 1A4KA 3T2OA 1PKQE 1CFSB 1F13A 5TF0A 1NFDB 4EUPA 3SQOL 5D1QB 1MWAH 4PJFA 5FUZH 3RY4A 3WFZA 5FO9B 2UZIH 4KK5C 4AG4H 4YXKH 3AU1B 1A6TB 5I16A 1A7RH 1H15A 3P4NB 4PBXA 2NQCA 4LRIC 5IBLC 4Z8FL 4IJ3B 5DRXA 2LQRA 1FVEA 4U2ZA 1NUDA 3FOLA 4EDWH 5E6ID 3VXOA 4RWYL 5LGHH 5LBSL 3VFTB 4Z7OF 2GK2A 2APVA 1NL0L 4ZG1A 4KGLA 2NY1C 1QBAA 1MCPL 2XTJD 1BFTA 3SGDI 5JW4M 5K9QG 5KVDH 2I9TB 1A6AB 3EYUH 1R3IL 2VDOH 1FFOA 4HFUL 3M1BB 1LO0L 3TA3B 3U83A 2Z4QA 2A6JA 4HUKB 4U6YA 5FECB 4Z7VF 3WN5A 5EBGA 1PG7W 3EO9L 2MQCA 3V6OC 1I1AD 4NN7B 1NCWL 3T4YA 1HHJB 4TVPH 4G6KL 2J8HA 3BKML 3EYVA 1IGJA 5D1ZB 1JBJA 3D2UD 4NRXB 5HYJD 3RVTC 4NJ9H 3EOAB 3IU4L 4JM4H 1XF5B 5D1XA 5HI3D 4LPYA 4PJIB 4N0CD 3ARBC 4LLDA 4TN9A 3BZEA 1MNUH 4WO4A 1QRNB 3EDKA 4XPAH 2X4UA 2XT1B 4J3VA 1GAFL 4AIZB 1YNTB 3ZL4H 1NBYB 4WDIA 5H2BA 3N1MC 5I9QC 1AI1H 4W70A 1YNLL 2VRAA 4RBPK 4NO3B 2VLRE 5I1DA 1EO8L 1RK0A 4M5YH 4OZFG 1MH5B 3QIWA 4AY0A 2XV6B 4JRXA 1LDPH 3B9KD 4XP1H 3G6AA 5B38G 4NO5A 5LGJA 4QWWC 1A9EB 4GRMB 2X4NB 1Z5LA 4JRYD 1E6OH 3HNTH 3CUPB 3O3AB 3SJVE 4BYHA 4DJMA 4CU8A 3QIBC 3RKDC 3U0TB 1GCFA 3FRUA 2BSTA 1IZJA 3N9GH 3D3VD 2HG5B 3TCLB 5L88L 3FQXA 4NC1E 1LQSR 4JDTL 3Q3GB 4XPTL 5GS0C 3GIVA 2EDRA 3L7EB 3AC0A 1A7QH 5DMIL 3BSZL 2ERJB 3RL1B 1U3JA 4OLWH 4LARL 1T03L 4P49A 3D39B 1Q9OB 3QDJB 1AGDB 5C0ND 1Y6MR 5ALCH 2IAND 2BMKB 2DBLL 3FOMA 3JWOL 5TH2A 1HDMA 5LAXB 1JZ8A 1CLYL 1QR4A 3BT2L 4URTB 4NZDA 4NZJA 4MXWL 3SQBA 4NBZB 3DI2B 1KCVL 2YUWA 4JGUA 1QLRB 1JWSB 1RV6X 5CP3H 4U1HB 2WW8A 4TUOB 5C07B 5BMFH 4D8PB 4JR9H 4N1EA 1G7IA 4NKDA 4TNVF 1KEGL 2HJKA 4X6CA 3P0VH 3OKKA 2BNQE 1UC6A 4B7LA 5C08E 4AIXA 3OJVC 1AHWC 1INEH 1XF3B 4Y4FB 4DKFL 4RZCA 2QSCL 4RFNB 3CFDA 2OSLA 3IAGC 3X3GH 5HGHA 2RFXA 4ZUUA 5DDHA 4DAGH 4JJHA 2JCCE 3QCVL 3QQ3B 5D96C 4XVSH 1AQDB 3T0EB 3WFDL 2Z8RA 5J6HA 1CFTB 5EOQH 1FZKA 2R0KL 4M6OH 4X4XA 1N8ZA 3KXFD 3FB5A 4M5ZL 2Q86B 3QH3A 3SKMB 4JO4L 3GHBL 2AJ3A 5K9OB 5A16A 1D9KD 2J3SA 4GBXB 5IEKB 1IGYA 4N9OB 5EU4A 2QSTA 3AS2A 3UPRA 1I8MA 1T20B 2NY2C 1M6OA 4ZS7H 4F3FB 1RZIA 1UZ6E 4E42A 4ZXBC 2RJMA 3TP4A 5C7XL 4H0IA 3SDCD 4CVZA 2FHBA 4JQXC 3ZZ1A 2D7PA 1HHIA 1B0WA 4D9QE 5SWSE 2Y5TA 5EU6D 5C2BL 3KPRE 5B21A 5MEPB 1E4XL 3X13B 5F9DC 4MHHI 5A2FA 3DYPA 5DUPH 1AXTL 1BHGA 1BVLA 1UWXH 2D7TH 4OV5B 2R0LH 2JB5L 1AKJD 2OQJA 5EA0L 1NMCC 1I8IA 4HUXA 5DK0A 3IFOA 4OF7A 1FO0A 4U1GB 4F7PA 4G8GD 4EKXA 1I4FB 4GKOA 3GMLA 1TETH 4JDVB 2Y6SC 4H1LA 3QXTA 4RGOH 3GRWL 5J1AB 2WK2A 2LABA 5I8KL 3HC3H 2Y07L 2YK1H 3BDXA 2AXGA 1AHWA 5E8PA 5FCUL 1U8LA 4JY5H 1NBZA 5F7DA 3TBTA 1V3JA 1UVQA 1G7JA 3ZDXF 3FT4B 3TH3T 5F9AC 1ZOXA 4PRID 4U1SB 5JDJA 1P6AB 2H32H 2ICWI 2W0LA 1TCRB 1J8HB 2JB6A 4GMSH 2Y72A 2Q8BH 1NKRA 2CK0L 4I18B 3SKOA 3MJ8A 4WUUE 2HH0H 3TJEL 5CZVL 1Y18A 1WJ3A 4UUJB 4M7JH 1MCHA 2C4FU 3RIAF 2G60H 4PRNB 2YPKB 1YUHB 2E27H 2CRIA 3BJ91 4BFIB 1RZ7H 3K4AA 3I75B 4QXWA 2NX5E 1D5ZB 3Q5YA 4UB0H 1E6JL 5KS9A 3ARTA 4WFED 1OTSC 2WP3O 3BISA 3SE9L 1OGTB 4UT9L 4IOIA 5M7QA 1I85A 1NANI 5C0GA 4KHXL 2B4CL 3SDDB 3NAAL 4ZXBA 2QJDA 1NC2B 3ZKSD 1SVZA 2XWBA 4JPIA 2WUCH 3GFUA 5IHLB 4JVUA 4P2OA 3MLRH 4JGMA 4I13B 3VI3E 1XR8B 5CEXB 1F6AA 2FYYB 1X5YA 2K1MA 2EE6A 5EB9A 5SX4I 3VXQB 1IM9B 1WUNT 4HFWB 4LU5H 4Y2DC 5AZ2H 4HCRL 2FWOA 2X70B 2AK4E 4AEIH 4WEBL 4YHPA 4DK6A 4P46C 4F37F 4TSAL 5DS8B 5C0DB 3QXAB 2OK0L 4PLNC 3QUXC 1MCLA 2J6EA 1A5FH 3OAUL 4I48A 4OF5A 1CD1A 4JHBA 3MX0A 5DRWA 3RHWF 2J5LC 1UA6H 1CT8A 1OPGL 1GGIL 3O4OB 3VXRA 2DYPD 2WWKT 5GS1C 4X8XA 5C0CA 4PUBL 5L2KE 4ZFOL 4OIAA 1DUYA 3JV4A 4FFWC 2HWZH 5GSRA 4PJBA 4KZEL 1EJOH 5BZWB 6FABL 2KQNA 3PQYA 3QWQB 4R4FH 3LQAL 5IR1B 3HC0A 3IFNH 3MCLH 5I30H 3BWUC 4IMKA 2UZXB 3BPNC 5FB8B 4X5WA 1PQZB 4MCZA 4OUUA 4D2NA 1OTUC 1NSNL 3DHJA 2J2ZA 4PV8A 3BH9B 4QT5B 4L4VE 4XPFL 5TDPB 2VZTA 3IETB 4P2QD 5HHNB 3C08H 4JY6B 1BD2A 4GLRI 3RVXD 2LVCA 5SWQA 2PETA 3MRKA 1JRHH 5D93B 5FUCC 2ZUWA 5IVXB 1JNHA 1NGZA 4EDXA 4I2XB 3LB6D 1XF2A 3RWIA 2D9QB 4KJWD 5KBNC 2Y36L 2FLBT 1MVUB 1EFXA 1FVDA 1SJEB 5EBMB 3MMEB 1L7TH 1MRFH 1F58H 4RQQA 4XNUL 3A6BL 3SE8L 4MJ6A 3LDBC 4FQLH 4OZFH 5D7LA 2OJEB 5JNYB 1UB5B 4FG6D 3TNMA 3CH1A 4OCYH 2HVKB 4W68A 1T83A 5JHDD 4WU7B 2DM7A 3QUXA 3SGEI 3DOSA 4PRPB 3B6SB 4NKIL 5DK3A 2EDDA 5EOTB 3MV8D 4FQQB 3VI4F 1HHHA 4M9OA 4NHCL 4LIQH 2ADFH 1Z6JT 1OW0A 2AEPL 2A83A 4G7VL 3BN3B 2X89D 1ZA6B 1UM5L 4C57C 5GS1A 2NCMA 4PY7A 1U3HC 2R56L 5IJKA 2P24B 3FAXA 5HI3C 4C55A 1U8IB 3RWHB 1MIEL 3EBAA 1M05A 3OKDB 3X14B 4XCFL 4XVTH 4BKLA 4UIKL 2EDFA 4Z7UB 5DMKB 1CL7H 4YDVB 3ARGB 3IXAA 5IMMB 3BZ4A 2FIKA 3V5HA 1U8JB 3VFMB 5JXED 2V2WA 4O2CA 2UZYB 3MJ9H 2CGRH 5E9DB 2XG5A 3QUZA 1NAMA 2VXQH 1NUGA 4KRPD 5L7XL 4X6DE 5FHAL 2D0HA 1VFMA 1S7SA 1MHHB 5FYKD 1T7WA 4M1DL 5EWIL 3P40A 3ULVH 1NCNA 1OL0A 3DI3B 2VDPH 4WCYL 1KLUA 3B9KC 1TZHA 4I3RH 1FGVH 3NFPA 1HCFX 5F7HA 3RRQA 1U2CA 4PJFE 5F96L 5E2UH 3QWOA 1KJMA 3GSXB 4UOJA 1TJHL 1ZT7B 2D03L 5JPMA 3K46A 1SY6H 4NQDD 4QRSA 3BN9C 2Y4SA 2BDNL 3RIFF 1LO4H 1VCAA 4L8SC 3BEWA 4KQ3L 5I74C 1NCDL 4LK4A 1ZLSH 1T6VN 3VWKC 4L29B 3GMRA 5DJ8B 5GRZA 2A74A 4LSDA 4UQ2A 3FTGA 1OAZL 4HC1H 3QIUB 2EEAA 4PYHA 1HYSD 2FATH 4QNPF 2IAMD 3PWJB 1JE6A 3FN0H 2MQ3A 5FYJH 1I9IH 1F5WA 1RHHB 4S2SA 1PKQB 1INDH 1OAQL 3VW3L 3VFPA 4BQCA 5F1OB 2YC1A 5C0NC 4QOKA 1QQDB 3HKFA 4KHTH 3C5JA 5BVJB 1YJDH 3EJJX 1UWGL 4KI1A 2EIZA 5BVPH 4E41D 1LEGA 3FHQA 4ETYA 4S1DD 1IQWH 4WI9A 1EAJA 1S5IL 1MJ8H 2FD6L 2PW2A 5ENWB 1FLTX 4ZOCA 3G5XB 3KPNB 3M45A 1WCBB 5L9DH 4I4WB 4HUWB 5GGQL 5BS0D 3V0WH 2PW1B 5F88B 1OP3H 2O61A 4YO0A 3KYKH 2G9HA 3IDUA 5TF1L 3WFEL 1IAKA 4NQCA 3VFGL 1EEYA 5KAQG 5F97E 4QTHA 3U7YL 3WJLC 1PZUB 5KS9F 3FONB 1EVUA 3RA7H 2ZPKL 2DJ4A 1BOGA 3VFNA 4LHUD 2VQ1B 5ERWA 1J1XH 1RUKH 1U95A 2IG2L 3V8CA 3HC4H 5BXFA 1NCAH 1FFNB 5JOFB 5E6YA 5KVGH 3HFMH 1JPTH 5C0AD 2BVPA 3B3IB 3KJ4C 1DBJL 3W82A 4CNIB 2VLME 5AYUL 4JRXE 2GAZB 3LIZH 2DM4A 2MWCA 3BQUC 2A73A 3C2SA 3T2QA 3ALWA 5I1IH 5C0RH 3GNML 5HI4C 4BH8A 3G6JF 3DVGA 1D9KC 4GW4B 1PLGL 1CGWA 4LLUA 3BW9A 5A2LH 1OT2A 4JM2C 1KELH 4KVCL 5KSAD 3SDAB 4BFGA 2B1AH 4ACPA 3V2AR 6CGTA 2HT3C 4KROD 5FYKL 4YFLF 5CJXA 4PB0L 3C5ZB 1X5AA 2CDGA 3CPLB 1NMBL 1J1OH 2VLRB 2FO4B 3QEHB 2V7HB 5ESAA 4WUKH 2QQNH 3V6OE 1LE5B 1YEKL 3BD3A 2VDLH 3MLWH 4YUEH 1KEML 3UO1L 5IJVB 5FYKU 4LGSB 4XBPA 3CMOL 4ENED 2ZCHL 1S9XB 1RFDL 2HTKD 4NZRH 4PG9B 4GRLC 3NZ8B 1NAKL 4R4BB 1FL5A 1MFBH 4XAWH 1NBQA 5MEND 2VC2H 3BPLB 2ZKHH 3SN6N 3KPSD 3WFBL 4JREC 2NR6D 3SJVB 4M00A 4A6YL 1MJJB 3NA4A 4TVPD 4XBGA 5E5UB 2H9GB 1HOCB 3HMWH 3ORJA 3FQNA 1T2XA 2X4OB 3M8OH 4N8VB 3EO0A 5C70A 1YNKL 4G6AD 5HVFB 4KMTL 3MXWL 1WV7T 2WANA 1A1NB 1Y6NR 1X5HA 4X6CE 3UYOD 5DZLA 2XQBL 3D5OF 4EI6B 2XYCA 5HYQA 3HMXL 1KJVA 3FO0L 4WV1A 4YBLC 2B5IC 1GC1H 5TPWH 4YPGA 4OQTH 3WJJC 1OD9A 2N4IA 1S78C 5D71L 3TBYB 5ABDE 4PJ7F 2E9WA 2ZG2A 3KVQA 4KAQH 3MRQB 5D6CB 4K9EL 2QKIB 1H3TA 3BAEH 4YHOH 1UWXK 3RWDA 3MLSH 4JM2A 3AGVA 2V6HA 2EDEA 1F4YH 3GMNA 4RNRB 2VXTH 4WTXA 4PJEA 2CKBH 3VFRA 2AXFB 1OWWA 5HDQL 1QZ1A 3MGOA 1MFCL 4M62L 1DQJA 2GUOA 2BNQB 4LSQL 2OJZH 4R96A 4OZIA 3L7FB 3NPSB 5FKPB 5C08B 4FP8L 4P5TA 1SEQL 1NFIA 5DMGD 1HXYA 1XGYL 4LF3A 5ALBH 5I66A 1JWMA 1VEMA 3MRGA 5I1AB 3C60A 4YGAB 1RIHL 4XNZC 1HHGA 1J0HA 1MAML 4O4YL 1BOYA 3PNWB 4UZGA 3B2VL 5JW4N 3BKJH 4EN3D 2JCCB 3RWEB 4GRLA 2DLEA 3UTQA 3VH8A 1D5IH 5AEAA 3G9VA 4MJIA 1MWAL 5FUZL 4JZNB 4I0PA 4XNYH 2UZIL 2VR4A 1EAPA 1LNUA 4YXKL 4AG4L 3E3QC 2V2TA 1A7RL 4ODWA 4Q2ZA 1K4CB 5FA3A 5F1SA 2WP3T 1WZ1H 1Q72H 2FZ3B 2X4PA 4GJTB 3FMGH 3W2DL 1A4JB 2XZAH 4LP5A 4AQ1B 3KAAA 5JIIA 1R5WA 1TITA 4QRRD 2GEEA 5F72S 2OZ4A 4EDWL 3HUJF 5E8OA 5GGVH 32C2A 4YDJA 5HHXH 3JUYA 4JCMA 3WXWH 3L3GB 4OCMC 4MWFB 3QULB 3ZHDA 5SWSB 3E2HC 3TO2B 2KUTA 3VXTB 4WWKC 3KPRB 1WEJL 2ED8A 5KVDL 4RMTA 1A9BB 2DQFA 4J6RH 1MI5D 3HB3C 5DJCB 3SKJH 3BUYA 3WD5H 4KZDH 3OGCB 3WL9B 1ORQA 4EI5C 3K0WA 5MEQB 5DF0A 3RVXC 1NH6A 4XWOD 3H7LA 2CDFB 2AXJA 5GXBB 1GXEA 1M7XA 3ROLB 5C6WH 4TVPL 3KPOB 3N1FC 4K3HA 4XHJC 1DQLH 1T7YA 1FIGH 5A3IC 5KS9E 3QHFH 2XZQH 3DGGA 3GGWA 4JM4L 4YFDB 5MI0B 1DEEB 4RRPA 4XCEA 3CD4A 4GG6A 4WIQA 1QRKA 4WTWA 1N3NA 3VXUD 4XBEH 4XPAL 1MCRA 3EOTH 3RWGB 1JGLH 3QXVA 1O0VA 1S7RA 3ZL4L 1INQA 2EO9A 2G75A 3VFUA 3ZKNC 3L3OB 3L3KB 2P5WA 3P4LA 4WUUB 3ROOB 1JNLL 1YY9C 4XRCB 2QR0A 4PFEA 4WW2A 5E0QA 2NX5B 1LDPL 3KYAA 4NSKB 1BAFL 2VXSL 3AROA 4Z78A 4XP1L 3S4SB 3I9GH 4OCRH 5GRVL 3JVGA 5GGRY 3EGSB 3E6HA 3GB7A 3AXLA 3O6KL 5JO5B 1IZKA 1E4XI 4LSPL 5F1KC 3VXRE 1YYMH 2OTUB 2FNBA 5C0CE 3HNTL 3P3YA 1QSFD 4OLYH 5KTEH 2UY7A 1HI6B 4LDOB 4PJBE 4NFDA 3N9GL 2EDQA 3ARFB 2YSSA 3PQYE 3QFDA 2UWEF 1RK1A 2KZ1B 1T6WA 1BX2B 4NQUA 4TNWK 4EI5A 2AK4B 4N8VG 2VL4A 4OF6A 2RBLA 2CIIB 3TPUB 2BVYA 3MREA 4OLWL 3CCHA 4MSWA 3DETD 1U8HA 1JHTA 1G7HA 2HJLA 2F54D 5ALCL 4MNQA 1SEBA 2IPTH 3RTQB 1BD2E 4KY1L 5E5MB 3HI5L 1MY5A 2V17H 3JWDL 1WBZB 4Q9CA 1BZQK 3TYFB 2QQKH 5L2KB 3MCKA 2MHAA 4M6MH 1DBKH 1I7UB 4JKLA 4U1KA 2IAMC 4G42A 5FO7B 5C2UB 1TJGH 2XNAA 4MMZC 4ONHB 3DIFA 2XY1A 3DBXB 2WINB 5D7LE 3L3IB 4JGJA 3P0VL 3MRDB 4PJDF 5I1KH 5CUSL 4POZD 3GI9L 1INEL 1U8OB 4HXBL 2EC8A 3S5LB 5E00B 4UAOB 3SPVB 3DUUA 4L4VB 5BOPA 2HN7A 1DDHB 1SJXA 2OLDA 3AY4C 5K93A 4P5MB 3X3GL 1BFSA 1VHPA 1M1SA 3CLFH 4DAGL 1F42A 2NXZB 2VISB 5DD5H 4HX1B 4XVSL 1P7QB 4KKLC 5DVLA 5EOQL 3FO2B 4E5XB 4M6OL 5IROA 3DX8B 3QHTC 5INCB 4X6FB 1RURH 1T21A 2CK2A 5DJZA 5TE7H 2B1HH 3U4EB 4EBQL 5E70A 1T1WA 1EHLH 1EZVY 4X83A 3S8WA 1M7DA 2ZP0T 3GHEH 4X7FC 4ZS7L 1HH6A 1CG9B 4PJEF 5CP7A 3KS0H 4KDTC 1RQ5A 3BD5A 5DK2B 3RDTB 4I9WD 5FM5M 1KB5B 5JQ6L 3R1GH 4H0GA 4KI5E 4MD4A 5DD3H 4P23A 3Q1SL 4OZIF 2Z93A 5FUCE 4RISH 2DWDA 4P99A 5DUPL 1IQDA 2D7TL 2R0LL 1C08A 3C6LB 5HGBB 3LKPA 4UIMA 1KPVA 3ZT6A 1H3UA 1KBGL 4H25A 2V5RA 3ARWA 3C09B 5I8EA 4P5KB 3GJFA 3MNVB 1YPZE 4Z7QF 4KROC 3V7AG 3AREA 4X6DB 2ICES 4RGOL 3H9HA 4CW1A 3I6GB 3VD5A 3HC3L 1IGMH 1ZS8A 3O8XD 2HJFB 4JY5L 2E8YA 3IF1A 3ULSB 5DVKA 4TTGA 1AGEA 4GUPA 4FZ8H 1A4KB 1NDGA 1R5IA 4EUPB 4TOYL 4PJFB 1WBYA 4QOKE 3RY6C 3L6FA 4GMSL 1NPUA 2Q8BL 1QTYT 4HS6A 4YE4H 2LU3A 1F97A 1KF9B 5I16B 2YKLH 1H15B 2HH0L 1FL6A 2MSPA 4Y88A 2H1PH 4M7JL 1R24A 3VCLA 3QEGL 2G60L 5DRXB 4P4KA 1FVEB 2E27L 5DURB 1RZ7L 3FOLB 1DVFD 5CAYB 1LO2H 3VXOB 5FGSA 4FQJH 3ARDD 4UB0L 3QQ4A 2BVTA 1IAIL 3MACL 2ICWA 5F9WC 1GJIA 4F9PC 3LMJL 3S4SG 2C7UA 4NQCE 1V8HA 1KN4H 2M2DA 1URLA 2Y5EA 5I75C 1JPST 4K3GA 4KDTA 3IJHA 2WUCL 3WO4B 4PTUA 1FFOB 3MLRL 1XZ0A 1Z9SA 4O2FB 2AJZA 2Z4QB 4LU5L 2A6JB 2C3GA 4U6YB 3WN5B 5AZ2L 2APWA 4YHYB 1IGTA 5HHOD 4X7SH 3CDFA 4AEIL 3T4YB 2R29H 1JZ3A 4ZAKA 1YA5A 4CN6A 3ULVD 2WNGA 3I2CH 3EYVB 2BOBA 2OX5A 1J10A 4DKDC 1A5FL 4PGJA 1C7TA 5I1CH 4Y19D 4JG1H 3STZA 5D1XB 2YPLD 1VFOA 1WAAA 3STBA 3U2SA 1UA6L 3PXJA 4LLDB 4HW6A 3BZEB 4Z7NF 4WO4B 4X7CC 5B3JE 2CSPA 2X4UB 4WW2F 2AJUH 5DZNA 4OFVA 2LAGB 1JZ2A 3MRMA 3EFFA 4WDIB 5H2BB 5C0FA 3VFVA 4PGEA 2HWZL 4HBCL 3H3BC 3ULUH 3QXUA 1IC4L 4PJCA 3AS3A 5I1DB 4R4FL 5BV7B 3IFNL 5F6IB 2E9BA 1RK0B 1GIGH 1I9EA 3QIWB 4ZD3H 1CGVA 4JRXB 4PTTA 5IKCA 3EYSH 4Y5VC 1MLBA 3UTTA 3G6AB 3EJYD 4NO5B 5LGJB 3NIGF 1WT5A 1U0QA 3CMGA 4G5ZL 5D1QD 2OI9B 4DOHE 3S5LG 4PG2A 1FSKB 2Q1EA 1Z5LB 1F8TH 1JRHL 4I1NB 4F9PA 1K4DA 4XNMA 1OP5H 2PN5A 4TTDD 2NY1B 1JK8A 2BSTB 4LVEA 1L7TL 4Q6IC 3FQXB 4RGNC 3R0MA 3GIVB 3K4ZA 1CD0A 1HSAA 5CKGA 3WCYA 5F7LB 2MJWA 2PXYD 35C8H 3GBML 3VDBA 3HZKA 4OCYL 3QUYD 2QL1A 4YK4C 3FOMB 3DXAD 4LIQL 2ADFL 5TH2B 2HT4C 1HDMB 5ILTL 3VXSA 3G6DH 3TA3D 3CFEA 5KZCB 4C83A 4GRWF 4ETQA 4OBRA 4G43A 1T1ZA 1JTPA 3PP4H 3C87A 4KJPD 4PJAA 5DQ9A 4PJEE 1EO5A 1RAMA 3MA7A 5D1ZD 1CL7L 1G7IB 4NKDB 5F70A 1NEUA 1P9MC 2HJKB 1CDUA 4X6CB 1D5BA 1GSMA 1V3LA 3OKKB 3MJ9L 2CGRL 3NGBB 4JRWA 2NXYC 4JKPH 4WVRA 5GGTH 1OB1A 1QRND 2XKSA 4RZCB 4M7KH 1UXSA 5AYQA 1C5BH 1OD7A 3CFDB 2OSLB 5HGHB 2RFXB 3ULVL 4ZUUB 5DDHB 5BQ7A 4G9FA 4N1CA 4Z7QE 4X99A 2OL3L 1FGVL 2VXVH 4HLJA 4NC2B 5T5NF 5LXGL 4MJIE 5EUKA 5J6HB 1FZKB 3WDJA 4EUPG 1I9RH 1B4RA 4X4XB 1N8ZB 4NP4H 4QHKJ 3FB5B 1NGPL 1SY6L 2BK8A 1HSBA 1LO4L 3QH3B 2AJ3B 3MODH 1ZLSL 5A16B 1VSCA 1FVCA 1IGYB 3QAZB 5EU4B 2HTLC 1N5AA 5KW9H 3UPRB 1UENA 1I8MB 2WBJD 1M6OB 1RZIB 3VFWA 4E42B 4HC1L 3O6LL 1T0MA 2DTML 4QRQA 2FATL 4CVZB 3LN9A 2AGJH 1HHIB 3FN0L 3IAPA 2R4RH 2Y5TB 5FYJL 1INDL 1IC1A 5JHLH 3CX5K 1BVLB 4WHYG 1X4ZA 1U3ZA 4JFDA 2YRPA 2VIRA 5CBAA 1JWUA 1YJDL 2FHFA 3OMZA 4UOW0 2OQJB 3LHPH 5BVPL 3B43A 1I8IB 3D39D 4HUXB 5DK0B 3IFOB 1FO0B 4F7PB 1IQWL 4BSJA 3GSVA 2QADB 4GKNA 4DVRH 3GMLB 1G6RB 1P9MA 2EXWC 1Z3GH 4H1LB 3V0WL 1CICA 3GJEA 5FM4A 3MYJA 2AXGB 1AHWB 5E8PB 5HGGS 1U8LB 1NBZB 5F7DB 3TBTB 3WNMA 4F7EA 4GG6E 1UVQB 3CU1A 1BWWA 5FAAA 2A9NH 1OLLA 2YD3A 4JVWA 1G7JB 1ZHBA 3QEUA 5BRZD 5LWYH