3GB7A

Potassium channel kcsa-fab complex in li+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gb7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gb7A02
1LQSR 3NIFF 2P5WD 1IZJA 3VXQB 3VMNA 3PJSB 1CQKA 2H6PA 4HF5L 3QIWB 4LCWA 2X9WA 2J4WL 3EJZC 3GJFH 3KPRE 2R4RH 5HYQB 2HTLD 3LQAL 1U93B 2BX5A 3FB7B 4LMQI 4Y19D 5C2UB 4CVZB 4HWEH 3P77A 1RIVH 3RFZC 5DD1H 1XZ0A 4L4VA 2NR6C 4IDJL 1QO3A 4J1UB 3RBSA 3FAWA 3QUKB 4LDEB 1MHPH 4DKEH 4U1NA 1D5XA 5IK3A 5EU4B 3GMMB 4KVNH 2FCBA 1MI5A 3U7AA 4EI5A 2HVJA 1NCNA 1KB5L 1F97A 2DBLL 4EDXB 4JANA 3BW9B 3JWOH 2WUCL 4FXKA 1RIHL 3MRFA 3INUL 1DEEA 4JKPH 4KUCF 4XH2A 1A1OB 4X7TB 2HKHH 4GKSA 1GZQB 4QRPD 4YUEL 5SWZE 2GJ6A 4JLRA 4XP5H 3I50L 3O0RH 1HKLL 2MQCA 2X6MA 3QULA 1S7RA 5IHZB 3PGFH 3OKMA 4ZUTA 4BH7B 2Y5EA 3G6JF 3WKML 2K7PA 2CK2A 1IC4H 5CGTA 1PG7W 1MCNA 2XZAH 3IU3B 5J1AB 4R0LC 1DLFH 3ECBB 3TN0B 3F5WA 3KJ6L 4GLRI 4AK1A 4LK4A 1GRWA 2V5MA 4L8BB 4U4BA 2JCCB 4YDLC 3ALWA 5MEOB 3KXFE 3WUZA 4KPHL 2AJZB 1INQA 1D9KC 2YA0A 5BW7C 5F97E 4YXKH 4LLYA 2EECA 4JVPA 4KVCH 1OQXA 2EDWA 3LV3B 2MCG1 3SDCA 4OCXL 2QKIA 3DMMB 1PD6A 4CW1B 4U7SA 5TE6L 3BZEB 3BFOA 5F7NC 4LGSB 4LVOB 4EN3C 3SY0A 1S9VA 3C6SA 4HWUA 4IRSB 2AGJL 3UROR 2JJSA 3MYJA 3RWJB 1LP9F 2A1WH 4HIJA 3OJ2C 5IBUB 3EZJB 2N56A 2VDOL 3OQ3B 1I9EA 1QFWI 3I6LE 3U48A 3BGAA 4HH9B 2XICA 5D1XB 1AO7E 3DUUB 2E9WA 1INEL 4Z5RB 3UPRB 4N5ED 4WJ5A 1XF4A 3MRKA 1HINH 4P4KA 3MXVH 1MJJB 4POZD 5SWSE 1A5FH 3NGBB 1U92A 2CDGA 5TDNA 1IQDB 4OLUL 1GGCL 1KJ2A 1KJ2L 4FQIL 2D03H 5BZWB 2NY7L 1F6AA 2FEEL 4YEEA 3BX7C 3L7EA 2X05A 3GUTB 4FFVC 3SDDA 3WFBL 1FGNH 2EC9U 3V4VL 4BKLB 1YMHA 1OQOA 3PDOB 4DKAA 4G5ZH 2JB6A 4Q6YA 2NY1D 3V5HB 4K3HA 2ZWLT 5BJTA 2ZNWA 4JFED 1J1PH 4LVHB 1AGDA 4XT1C 4Q6IA 3DXAA 5E95B 2GSGB 4U1JA 5T33H 3B9KA 4QRQA 3LKPB 5E9DE 5GGSY 4AQOA 1QRNE 2E9BA 3BDYL 3GSOA 1YUHA 2DLEA 2Z35B 1B4JL 4IS6B 1L6ZA 5E0QA 5I1EL 2BNRB 2Z9TA 4OUUA 1J8HA 3HRZA 2FHBA 2VITB 4I3GA 4AEIH 4HFUH 2GJZA 5D7IA 1YECL 5HGAB 4ONGH 5BO1L 4QXUL 1MCRA 1HWGB 2PNDA 1AIFB 4PRPD 3ZE1E 4JFYA 3GJEA 3WL9A 5D72H 3V5KB 5SV3A 3LEXA 3KLHD 2Y1VA 4RFOH 1AP2A 3QP3A 3AXLB 5E6YA 2NNAA 4PJ9B 4P23C 4DOHB 2JELL 1C5BL 1HI6B 3U0WL 4L8DA 1JPGB 4YBLC 4XWOC 4MQXD 3S37L 3FO9B 3HC0A 2JCCF 2FJGA 5F1OB 2QV2A 4PGEA 1ZVSA 1LO3H 4JFFE 5CKAA 1QBML 4YAQB 5HI4D 1P53A 3V4UH 3AC0A 4OQTA 2FDBP 3WLBA 2YPLD 5JO5A 5IQ9A 5I16A 4A2MA 4FG6C 5C0DB 4WCYL 4PIRF 2BXYA 4ZOCA 1FNSL 4FFYH 4G80B 5DHYA 2ZUUA 1BOGB 4CDHA 4RMTA 4X6DB 1CR9L 1DQQA 1FZMB 2IQ9H 3OJDB 4LARL 2VN4A 1DBJL 4DTGL 3FFDA 5AG8A 3RX5A 4Y4FA 4FZEL 4JPVL 1MFBL 4L1HA 2UZIH 4UIMB 4OFYA 4L5FH 5IB2A 1J1OL 4C56E 4PP1D 3EJJX 1FE8L 4K07A 4PJCA 4S10A 5CZVH 3SKJH 1X5KA 2ADGA 4U6YB 3GM0A 3MR9A 1EAPB 1HNFA 4PRBB 1TVHB 2DQHL 5GS1A 2H26A 3HC3H 1YEFH 1H8NA 3KJ4C 4JHAL 2L0DA 1CFNB 4JEGB 1C12B 4S1DC 4J3WA 3TBVB 5K59E 3GNMH 4M9OA 3TBTA 1KIRB 4PR5A 2IBGA 1MNUH 4RAUB 2J88L 1A4JB 1T83A 1WGOA 1HK6A 3LPFA 3DV4A 3JV6A 2F54E 4YWGL 4YR6A 3C87A 1CGSL 3FO1A 3G5ZB 2BCKB 2VDPL 4HDIB 3WCYA 1MELA 4YFDB 3GSRA 4Y16A 3DETC 3RA7H 3QWOB 2NQCA 1VHPA 4HUMB 2R9HD 1G1YA 1ZHLA 3PHOB 4Z0BL 1BF8A 2ICCA 1NFDA 4MJ6B 4PV8A 4P2QA 3T1FB 2ZUQC 3SGEH 2WIMA 1LEGB 1FNFA 3QJHB 5IBUG 4QF1A 2NY0B 5FM5O 1JNJA 4M00A 1ZT4A 1AGBA 2JIXD 3PWUA 3HMWL 5ACZB 4HGMA 1BFVH 1MAJA 1O5DT 2YSSB 3QIUB 4JRYB 2BVUA 2PYEB 1XIWB 1AQDB 4WW2A 3WS3A 3IKCA 2I5YH 3GRWA 5BS0E 3NCJH 2I9LA 4H1LB 1RIUH 3VXUD 3B8SA 1VACB 1JJUA 1JMZA 1JZ2A 4JAMA 4R6UA 2GJJA 5D7JB 4PLKC 1HSAB 4NFBA 3WJLC 4YHKL 2CJUL 1NLBH 4Y2DC 4KI1A 1Q9KA 3VGDA 4JM2B 4DGYL 5IWLA 1QSFB 5D93C 4D9RD 2C1PA 3D3VD 3OAZH 3TC9A 4IRJD 4GSDL 4I2XB 4KMLB 3DHJA 3VD9A 4LDOB 3P2TA 3QUMB 5DC0A 5F6IC 3HC4L 5IESH 5HPMA 2A77L 1KJVA 3TZVD 3IDYB 2Q86A 1T03H 1Q9OA 4HKXB 4ODUB 4ACPA 1QEWA 5MENA 3I3DA 3D6GA 4C4KO 4PJIB 5CZXD 5E8OA 1MWAH 2XKNB 5A16B 2Q20A 1CIDA 2EIDA 3C5ZB 5HYEA 3ULUD 1TVDA 2ZCKH 4QY8A 1DVFC 3FOMB 4PS4L 1ZLUK 3LKSA 4LSQH 2E7LA 1A6PA 3CZJA 2CLRB 1SBBA 5DA4A 5GZND 4BFIA 4AENA 3BN3B 2O5YH 1DJSA 4TSAL 2R69L 3OKDA 2XTJB 1UKSA 4UAOB 1QACA 4Y5YA 4XVSL 4X6DF 2JE8A 4PREA 2BOCA 3MLXH 4E0RB 5FGBA 1TCMA 3RGHA 5FA3A 3RZCB 5ETUB 1KJMB 3MOAL 5DLML 3KGRA 5H2BB 4GRWH 4MDJB 4JR9H 5A3IC 3ARFC 5CEXA 4CMHB 2YUVA 3GGWB 4FZ8H 2VLKB 4PBWD 4PG2C 2CSPA 2IFFH 2B8OT 2XQBL 4MHHI 4BUHA 1JGVH 2VLJE 4OZGB 4PBVC 2PTUA 2R2EB 3V2AR 2EO1A 5T3XD 1H15B 2X7LA 3L3OA 4X83A 1I8KA 4ORGA 5JQHC 3NABL 1DZBA 5I8OL 4YQXH 5KTEH 5L2KA 1HXMB 1I9RH 4EQ2A 2UWEA 2DMBA 5TPWL 3BWAB 3BQUD 1NBVH 4MA8H 2YUWA 1IM3B 5B8CA 3MRQB 4NQVA 5DFWH 1MEXH 1EJ6A 3ELAT 1B0WA 2GYSA 1T5WB 4JRXE 2FEEI 2PW1A 2D0HA 1ND0B 1G7QB 2VIRA 2H2PD 4LLMB 4GW4A 3D2UA 5FYKH 3RPIB 4QRRB 1WCBA 2UZXB 3PGDA 2VMFA 3ZKMD 1WIUA 3BO8A 3PWPD 5IQ7L 4K3GA 3DX8B 4HGKC 1XR8A 4MNQA 4NKIH 4FQJL 1CS6A 1R24B 1JWUB 1NCCL 4W6YB 3W0WB 4W4OC 5JNYB 4ELKB 2NTFB 4MJ5A 2G9HA 3H6JA 3EO9H 3GEWB 4JPIA 3NMEA 5EU7E 5CJQH 2VXSL 4Z7OF 1BF2A 4PYHA 3SGJC 4Z95L 4GXVH 3WN5C 4XPFL 2EH8L 4K2UH 4P0DA 4YNYB 1A6VL 4R4BA 1C7TA 2J6EH 3IDMA 3QAZB 4L3EE 5I1JH 5K9OB 4F7EA 4JM2F 4PTTB 3HG1D 1FCCA 2AKRB 1RMFL 4NN5B 2GTZB 4R97B 3O6MH 1NGYA 3QG7L 4ODBD 4CUCA 5BRZA 4G9FE 1HHIA 1VEOA 2BSED 1UCBL 3PHQB 1SEQL 2CGRL 1A02N 1IBGL 4IIQA 4MVBC 2Q87A 3QEGH 5LGHH 2P4AB 2Q7YA 4PJIF 1VFMA 5T1LB 4ODXA 1G0DA 2VDQL 5D7SH 4MD4B 3SDXE 4H1LG 2OL3H 3T4AB 3T77A 2I9TA 2ZOLB 4U6HB 3GJFB 1G6RH 2ORBL 1VFBB 2VE6B 1UQSA 4BYHA 3BE1L 1FORH 3QUML 5B38B 4DZBB 2MOVA 2NW2B 2NZ9D 4Y1AB 4OCMC 3BP4A 3DX9A 5FO9A 1NFIB 3LN9A 1AQKL 3M1BA 5IVOA 5HHME 3K2MC 4N5UA 1ZHNA 5I1IH 3QG6B 4MX7B 3C60C 5KJRL 3W5MA 4AL8L 1UKQA 4NO3B 4U6VL 1ZVYA 5DQ9B 5E24E 4G8EA 4OZGF 3GMRB 2AJYH 1VFAB 2YPKB 5A2FA 1PLGH 1QLFA 4I3SL 4GG6A 3BSZH 4LSRL 4BK4A 5I1GH 5HSFA 3GMQB 1L9MA 3T2NH 2F19H 5KSAC 1NAKH 4NQSA 4TVPD 3VD5A 2AI0H 5CBEA 5JDSA 2DDQH 4PJFB 4O02L 1NEZB 1Y0LB 5F70A 3RP1A 1DANT 4ALAL 5JUEH 3QUYA 4KMQA 2V5SA 2DMCA 5C9KA 4LFHD 3MFFB 5CWSA 4R90H 5SV4A 1XGQB 5JXAH 1JP5A 3HE6D 5HHOB 2F53D 5K9KB 1X5LA 2XPGA 5FB8B 3CU1A 3MGOB 1I3RB 1RZGB 2IH1A 1BVKB 4E42A 3SKUD 2P5EE 4YIQA 4RISH 3D39B 1NUGA 5E2VH 1CXFA 3RVWD 2Q8BL 1U3HB 1K8DB 1AGFB 5DMKB 2BHYA 4JO2L 4U1LA 2YUZA 3DSFH 1YEKH 1MIML 2MKWA 4FTVB 1NH6A 4XPAL 4DAGL 5LBSH 3HMXH 3C8KA 2BSTA 3FQXA 1YJDL 3UXFA 3UTSB 5GISL 1DQML 3ROLB 5I1CH 3GSQB 2J3SA 2D31A 4U1HB 4XZUB 4JDVA 5JZ7D 4CNIB 4EOWL 2IF7A 3L5HA 5GHWL 3N85L 5AUMB 1OGAD 4JJ5B 3L5JA 3TPUB 5F7FA 1KTLA 2FL5A 4PJBE 5LQBL 2R23A 2ZCLL 4M7JH 2P8PA 5DA0B 2V9TA 5ICZB 4LLQA 4LCYA 3W9EA 1CXLA 2NY6D 2X4QB 4JHWH 4DK3A 2QQLH 3RU8H 2A0LC 2B20A 1RUAL 2GFBA 4WTXA 2A6DB 5DT1L 5JW4N 4ZAKA 5JHDE 4JG1H 4L4VD 3UEZA 5AYQA 4HIEA 4FP8H 4NQEE 3KPRB 1E28A 1RJZB 3CMOL 4X9GA 1MI5D 3S35L 2AS5M 3GO1H 5DC4B 4R0LB 3TNMA 2XWTB 4XCEB 5DRXB 3TBSB 2OJZL 3MA9H 4M7LT 5J13C 3NPZB 1X5ZA 1WT5C 3MOQA 4OLWH 1LNUB 2DN7A 3FOLA 4APQC 1NGPH 1XF3A 5FUOL 3S3PA 1N5YH 4LHQB 4LQFH 5T3ZD 2DQJL 3D85D 2HVKB 2APWA 3QIBC 2GJ6D 2MCPL 3HLAA 1TJGH 3VD3A 3Q6FB 5FDWA 3B2VH 4DKFH 5I30H 1PKQB 2PO6A 2APFA 1EVTC 1DBBL 4PJFF 4ONFH 1J0ZA 1MREL 5SWZB 5TH2A 1F4WL 4HS6A 5CMAA 1E6JL 4NC1C 4IOFC 3TYFA 4PFEA 5B38G 4F9LA 3S35X 4O2FB 2X5PA 1VEMA 3T2OA 1Q9LA 4KI5E 5DJ8B 4I9WD 3O6KH 2DIJA 1VSCA 1P7KA 2QHRH 4PGBB 2H2SC 2H8PB 4JKPL 4OT1H 5HHQB 5KVFH 5ISZA 2E6PA 1HZHH 3TH4T 4LPUA 2X9XA 4XP5L 5FYLH 6FABL 3B9EA 4GBXC 4KHTH 5L0QC 1MCCA 1KCUL 4TPRL 2A6KB 3QXDB 4NWUH 3SDCD 2IANB 3RQ3A 3RVTD 4P5KA 3AU1A 5TE4H 4G8FB 4G8IB 3MRNB 4BQ8A 5IFAL 2K1MA 5EU6E 2ED8A 3SDYH 1NEZG 4HAFA 4NWTH 5DO2C 4NHCL 1Q0YL 1X6NA 3HTLX 5E1AB 5IBTH 1XGPB 3UBXB 3S96A 2E9JA 4TTGA 2AXJA 3G6AA 1KFAH 1CF8H 3S98A 4TUJB 4WI9A 2V7HA 4DGVL 1MQKH 2Z8RA 5IIEB 4D0DA 3VFTA 2R8SL 4UB0L 3PL6C 1KCLA 2FEDC 4I18C 2Q3ZA 3GB7A 1RZKC 4KTYA 4OCRH 2CUHA 5GRVL 4L8CB 2NTSP 2NY3C 4LCIL 4GAYB 3W2DH 1OL0A 4P4KD 1UT9A 4LIQE 2VLRD 1E4JA 4M61B 1DBML 1JPFB 1AO7B 5GGRA 4XCFL 1KN2H 2BRRH 2XRAL 5C0GB 3SDDD 2BNQE 2VZUA 3SE8H 4X6BA 2NXZB 1P6FA 1C5CH 1CDUA 3MRBA 2COQA 2QEJA 4WNQA 4NN6C 5F1KC 1DQJB 4HK3N 1OARH 4RNRB 3P4MB 3DXAD 4GAFB 3B9KD 1VERA 1C1EH 4JFZH 4L4TA 4XC3H 3L3IA 1NUNB 3MRPA 1MF2L 3QRFM 4YBLB 4M1DL 2AXFB 3UP1A 5SWQB 1KXVC 1JFQL 1JWMB 3O3AA 1H3TA 4NJAH 3SKMB 2VAJA 3FONA 1YEJH 4MA7H 1IEBA 1J8HD 3FHAA 4X4YB 1TXKA 3C5SB 5BQ7B 1CTOA 1OAKH 3MXVL 3MCLH 5F88A 4UDUB 1F6LL 1A5FL 1QRNB 3U4BH 5DRWB 5JIPA 5A2KH 1JF1A 4KMTH 3EYSH 1UB5A 2VJXA 3H0TB 1MVFA 2BC4B 2ADJA 3O41A 2R2HB 3ET9F 2UVEA 4G5ZL 2EDFA 3CH1A 4E41E 4XAKD 1LEIA 1S5HB 5EN2A 2D7QA 5DSCA 1BLNA 1N6VA 5C0RH 5DTFB 3LKNA 4K7PL 2JK5A 2BVQA 3O9WD 1RZKH 3O45A 4LASL 1MCOH 5E8PA 1U8KB 4LCCC 5FO7B 3GSNA 3GSNL 1WBYB 3VD7A 3F12B 3WIHH 1U58B 2NW3B 1QFWM 3SE4A 1YEGH 1EA9C 3LIZH 4KKAD 5CJXA 4NBXB 3EYOB 3MA7B 1JWSA 2C1OA 1I3GH 4PJHB 2OP4L 4D0CA 2HWZL 2Y07H 1Q9WA 5DUBA 4TYUA 1W0YT 5D2NC 5EC2B 5KG9A 2HT4C 2J1KA 2HG5B 4ZPVB 4XBEH 1F11B 5EA0L 1QZ1A 5I75C 4FFZH 3VW3H 3P4OB 1FAIH 2CKBH 3VMPA 5EO0A 4BH8A 3RUGE 4K7PX 4P5MA 2ZUQB 4YGVB 4PBXA 4GRWB 3W82A 5JA8B 1PSKH 3O2WH 1BVLA 4YPJA 1FL6A 1UENA 4G6ML 4C56B 3ULSA 1OCWL 2XFXA 1JHKL 3VCLB 3Q3GB 1ZS8A 2ZUXA 4G8GA 2EDYA 4HWZA 3MUHL 1CE1H 1SBSH 2HLAB 4FFYL 3HNVL 1E4KA 4M03A 1A7QL 4XP4L 4NDMA 4H5SA 4CVXB 1TETH 4NZUH 2I07A 2MKLC 5GJSL 5KAQF 1NGZB 1JPSL 2ZP0T 5DJ0A 1YNKH 1LE5A 1TQBC 3TCLB 4R2GB 5D93B 5I19H 3DVGB 4HK0B 3OKNA 4RA3A 4Y4HA 1WAAE 1UWXH 3I84A 2XQYK 5F6IB 3HC3L 2NY2D 3MRJB 2E27L 5F3HA 3BPCB 4KKLD 4HKZA 2A6IB 3NAAH 3GNML 3A6CH 4X5WB 4O58H 1G84A 5FEBA 2XKSA 1EBPA 4H8WC 2C26A 1DVFB 4WV1B 2K7QA 4WO4A 2NLJA 5SWSA 1T20A 4NO2A 1G7IB 1HH6B 1CN4A 1M6OA 2EEAA 5BS0B 1V7NH 5IW3A 5KAQG 5J3HC 4YC2C 3MBEC 1WCQA 43C9B 1XF1A 5FO8B 2GITA 1SYVA 4WFHE 3SOBH 4GMSH 4KK5D 3VXSE 5GZOD 3HNTH 2ZKHH 3QFJE 5CJ5A 4XNQA 1BFVL 5MEND 4U3XA 4XI5D 5E9DA 1Q38A 1R3LB 3ZKND 3OKEA 3KPPA 1CU4L 4MXQD 4QHLA 4JQXA 1RUKL 2FR4B 3REVB 3LN4A 3MV9E 4PJHF 3MROA 3TLRA 4JB9H 3LN5A 4TNVF 3V0VA 2IEPA 1F90H 4XXCC 5K9JH 3MNZA 4FQXA 4FQQB 5EFIA 1IM9A 1ZHKA 5DMJB 3SDAC 1WZLA 4NZRH 5DUPL 1I1FB 3CGTA 2OL3B 3U0TA 2EH7H 5MEQA 3UX9B 1FL3B 3FT4A 3B5HA 3U4AA 4N0UA 3ES6B 3TM6A 4UINH 4WHTA 2I26N 1BQLH 3MLYH 3E8UH 3TBWA 1NBZB 2RBLA 4X98A 4ZFZB 3WHXA 3CCHB 4DGIH 3HAEB 3K4ZA 4GRWF 2FLRT 1CDHA 2XY1A 4NNXA 1P2CB 3V8CA 2AK4E 1T7WA 4X6CE 5I1HL 1JNLL 4P2OD 2A9ML 2WMPA 2EIEA 4H8WH 2C4XA 5JPMB 1W2KT 5K9QG 2HT2C 3IDJB 2PR4H 4JFFA 4PP2A 1LO5A 2AJSH 5DD5L 4GKNB 4EI6B 1IGFL 1IFHL 1M7DA 3TT1L 5L2KD 4U3HA 1IGTB 1P84J 1MCBA 2MPAH 5IVZA 2VLJB 5E8DL 4M1CD 3WN5B 3HA0A 3RTQB 2CUMA 1S5IL 3SEPA 1B6UA 1DUYB 1UZ8A 4PRIA 4GW5A 4PJ7E 3RGVB 4JFXB 5GGSB 4PRNA 3MQIA 3OXRA 2XTLA 4QXWA 4ZUUA 4MMZC 1U91A 4Z9KB 5INDB 5FHAL 1DN2A 3ARBC 3G5VB 4H20H 4Q2ZB 1VKXB 2XWBB 3VFSA 4XHJD 1HN1A 3EGSA 1PQZB 2X4NB 4MNQD 4WW1B 1DQDL 4M5YL 3VGEA 1A14L 1DE4B 2ICWJ 3U79A 5JXED 1BEYH 5C09A 4HS3A 5EOQH 1RJLA 3QDMB 5DHVA 5TGBB 4YE4H 5DEFA 2ENSA 2X2YA 3D69A 1U42A 3BOVA 4OIIH 4DVBB 4RFEA 4X6FB 3BP7B 4NYLB 2ZG1A 3I6KB 4MLSA 4RMWA 4PRDB 2QQNL 4H25B 1YN6A 3FQTB 3S88L 5DWUH 1G9MC 2LVEA 1CK0L 4HG4J 1U8OA 5HHXH 1OTSC 1ED3B 4HC1A 1P4BL 3D1MC 5CP7A 3EZ8A 4L3EB 3RWIB 2AJUH 5CP3H 4MAUH 5CEZD 1FC2D 1FO0H 1YMMB 3C60B 2BSRA 1HE7A 1DN0B 4LU5L 3G6JA 4JCMA 2WIIA 4NKMB 2BDNH 2ADFH 5IVXE 3RZWA 1ZLSL 3U7YL 5IFJA 2FZ3B 5ESQB 2WUBH 1TTGA 1CICC 1EGJA 2Q76A 2E6JA 5KSAB 3DX7A 2HJFA 1U8LA 5IB5A 4YX2H 5DD3L 1S9YB 1X5AA 2N4IA 5HHVH 5J9PA 3IDGB 2I24N 3PXJA 3IT8D 5MHSE 3O6ML 4P2RB 2OLDA 2P24B 2F58H 3VWKC 2P42B 3LS4L 5FUZL 5GRYA 3WDJA 3P0YH 3T3PE 3WSQH 3DX6B 5EOTA 2EKJA 2HKFH 3ME0A 3VFOB 3BZ4B 4RMVA 4YFLI 1FBIL 4LEXL 2Q6WA 1MRFL 3CVIL 5DRNA 5HHMB 3BIBX 4HUVB 3ARPA 1YEEH 3DUHA 4P59L 2WBJA 5EWIH 4JY4A 5FK9B 1DEDA 4KJQD 4GG8B 1XH3A 3ZDZE 3JVGC 2GQHA 2P5WE 1G0YR 5ENWB 4DZ8A 5B3NA 1AE6L 5E99H 4P2CG 1LP9A 4TVSa 1FNEB 3FRPG 1G9MH 2R39A 3QUYD 3T2QA 4JDZB 1U8JB 5JMOC 4KJPC 1SM3H 2XWJB 4Y19E 2B5IC 1ORSB 3GI8H 5ADPL 4OCSH 1T1ZA 3IETB 4M6AA 4MD0B 4URTB 4PB9L 3TP4A 3HI5L 5HI3D 3UBXI 4RWYH 2KBGA 1NEUA 1YYLH 3CK0L 3PJSA 1DUZB 3Q6GL 1CE6B 3WHE1 1JI2A 1Q1JH 3U9UA 3MOBH 5HYQA 2YD1A 3R1GL 4NQXB 1HQ4B 1AR2A 5CCKL 1CBVH 3TFKC 3KNBA 3MV11 4K55A 4UT9L 2NX5D 2P5EB 4YHPA 4QRPE 1N59A 2AI0L 3V0WL 5JUEL 1J9CT 3WFHA 3RI5K 4EDXA 5CSZB 3NN8B 3WBDA 2CIIB 3ZDYF 1H3PH 4R90L 1S3KL 1NBQA 2FSEB 2IADB 4DN3H 1CDJA 4HIHA 4HX1B 4JRXA 3QUXA 1GZQA 2VZSA 3BRDA 3K4AA 2EDOA 1K8IB 5B39B 3MLTB 3WD5L 5GGQH 4XP9H 4N1HB 3ILQC 4RISL 2W38A 1IGYA 3IFNH 5E2VL 1LO0L 3RY6C 4U0QB 4APQB 5DURD 4UOJA 4BH7A 1X5IA 1AKJB 5F6HJ 1DSFL 5EBWB 1YEKL 5IHBA 3QIBB 4PJBB 3IU3A 1EXUB 5J1AA 4ZAKD 3EFDH 4JFOB 3ULVD 1UM4H 4L3AA 1H3VA 3ECBA 1U8MB 3QCUL 1TJHH 1RV6X 1Q8MA 4G3YH 2F15A 4GRMA 4KK6D 1HHJB 2V17H 4X99B 2PXYC 5JHDB 1A7BA 5ICXA 1ZAGA 4UTBH 3HS0A 4J3OC 3CPLB 1R0AH 1DP0A 4L29A 4M7JL 4WWKA 4FQ2L 1MFCL 4K7FB 2EDXA 2ICWB 1GOGA 5JW3L 5GIRB 5AEAA 4CW1A 3WFEL 1IGJB 3RU8L 1CGYA 3CVHL 4GBXB 4IRSA 5L0QB 2PO6D 4M1GH 3A6BH 3MSPA 5B22A 4YPGA 3KYNA 4U1MA 1IE5A 3GSUB 3WIIH 4QXGH 3O3BA 2FB4L 5D6CB 2MMXA 1FZKB 1GZPB 5IVNA 1AXSB 2WINB 3ZE2F 4MNHB 1DR9A 2UY7A 1KIQA 3NACH 5D1XA 4M93C 2X44D 5DC9B 2KKQA 1F58L 1A9EB 4JFEE 4LEOB 1E6OH 1GL4B 2D7TL 2YN3A 1QFPA 3EO0A 2Y72A 2FJHA 2R15A 1NGPL 5ISZD 4JZJC 5DS8B 2NPLX 3STLB 3T0XA 1GGTA 3NH7H 3KYKH 1G7MB 2C3VA 1I7TB 2AK1H 5LGKA 1YEDA 2NY3B 4AG4L 2C4FT 3PDOA 1IL1A 2FBJH 3B2VL 1CYGA 4WEBL 1KOAA 3V5HA 1SJHB 3FRUA 2QADB 4XBPB 4Z7UE 1HHKA 1KPRB 3HE7D 4X0KB 4TNWF 3RNKB 2VLLB 2QSQA 4NN6B 5EBLA 1QVOA 1EHLH 1QLRA 3DGGA 4MAYB 1BGXH 5CIPH 2BNRA 2M2DA 2Z4QA 2OK0L 1HOCB 3DV6B 4AMKH 4X8JA 3O4LD 2V2XB 2CKBB 4NCC2 1A7OL 5SX4H 1LO4L 2G75A 1QSEA 5ERWB 2A74A 4I77H 3U4EB 5E4IA 1N6UA 3PIQB 3L3DA 4OCWH 4E5XB 1JZ8A 3V5KA 1HKFA 3MV7B 3SCMB 5HDLA 4PJBF 1GJIA 3MFGB 4TQEH 3BN9C 2YPLE 3E6HB 5ITBH 3AXLA 3GMNA 4HWBA 2Z31B 3QNYB 3BAEL 4PJ9A 1HI6A 4TRPL 1S7TA 3BDXA 3OGCB 5LCVH 3SDYL 3WHE0 3VXMD 1G7JA 3NA9L 1YNTB 3RNQB 4TULL 5JW4R 1JYXA 3T65A 1KFAL 35C8H 5DVMA 4PLNC 2OXHA 3LCYA 3LZFL 4MB5A 4XX1E 3TO4C 2F74A 1CD1B 4O4YH 1N64L 4X4XB 3H9SA 3CSYB 3LY6A 2X4RA 4MDIA 5B39G 2EXWC 3OG6B 4AIXA 3MACH 4HT1H 3DGCR 4LCCB 4KK8C 2DLFL 4PJDE 1BOGA 5DDHA 1MLBB 5TJWK 5IFHH 3WYRA 1FLRL 2G2RA 1T04B 5F7LB 4JPWH 5I1KL 1KN2L 4K3DL 5IW1B 4JFPA 1J0JA 5KS9E 2G5RA 4RFNC 1JGDA 1OF2B 1KEML 1BZ7B 5DJ2B 5JW4M 5C0NC 4P49A 4WU7B 4F8TA 2R0WH 5D2NB 2H1PL 4PRBA 1TVHA 3GIZH 3DYOA 4U0RB 3ZTNL 4NQEA 4DKDC 4MCYB 5ESAA 5HVFB 4N0CC 2N1KA 5EOCJ 5CJOL 5F9AC 3BYTA 3X14A 1C1EL 1JF6A 4L9DA 3TBVA 2W65B 4TTDD 2IGFL 3O3DB 4KRPD 4HFWA 3I85A 4F33B 1AR1C 5GGVL 4EXPX 1VADA 4NJAL 1RZIB 5GS2D 5TQ2L 2A83A 4E41B 4P9MH 1OPGL 1FH5L 4HDIA 2GY7B 4KI5F 5EZLA 3LS5L 4ERSL 1UACH 1J88A 4KRNA 4G7YL 4YHOH 4LLVB 3PHOA 3QO1A 3THMH 3SKNB 3VXUE 4X4MA 4YBQD 4PJXA 3BVNA 3UTTA 4N8VA 1LEGA 1ETZB 5AZ2H 1U3JA 4R8WH 1S9WB 4QWWD 5ACZA 4HXBH 2VB5A 4PB0L 1H5BA 1TQBB 4XNXH 2I60H 1XIWA 4QOKD 5C0RL 1F4HA 1AQDA 4D9RE 3Q48A 1JHTA 3HUJE 3O2DL 5C6PB 1VACA 1BVZA 2X4OB 3CFKB 4N9OB 4G6KL 1Z9MA 3L95A 5D7JA 5F9JB 3FN0H 4YFEA 3RUGB 3C9NA 1WICA 2YK1L 1FJ1B 5EU3A 1T2QH 4G8GD 5IHUH 2BHZA 4LAQH 3VXTA 3WFZA 5C9JA 3F7RA 3MLVH 1QG3A 3UO1H 5JR1H 3ULUE 1JVKA 3QI9C 4TSBH 2HFFB 4OZHB 2GT9A 1V8HA 2G5BB 3ARGB 3C08L 1MAML 3JTSB 5I0DA 3WNMA 3MRHA 4ODUA 4RAHA 3UMTA 3B2UC 1IRAY 4YC2B 3MBEB 4Y4HD 3ZE0E 1FAIL 2CKBL 2XKNA 3P0VL 3C5ZA 3FOMA 4PJ8A 3EO1A 2CLRA 2XOTA 4OUOA 5DMGD 1F4YL 4U1SB 4ZS7H 3VWJD 1JGLL 4CVWA 3PWLB 2YD6A 2FBOJ 3EJYD 3AM8A 1JPTH 5E08L 1CCZA 4H26B 1PG7L 4WO4D 4E0RA 4JO1H 2ZUYA 5T3XE 4S1RL 4LIQL 1V3KA 1G9NL 1KJMA 2Z91B 3T4YA 1J0HA 3CZFA 4MDJA 1TTUA 4NZUL 4KZDH 2HRLA 5INCA 4R26H 3NZ8B 1U0QA 4ZXBA 5DJ6A 2FX8L 5HGBA 2BNQA 1BFOA 4XCNA 3VH8A 1NC2B 3W11C 5BZDA 2VLKA 2OBGA 3SE9H 3WE6B 3QPQC 1YPZA 4XPTH 3UC0H 4YDKH 1GYAA 1F4XL 1KLUB 5GS0L 2KL6A 4QHKI 4XXDB 1L7IH 3N1FC 1H15A 2VAAA 1CDBA 2CDFB 3C2AH 4QRTA 4QT5B 1WJ3A 3O2VH 4BUGA 4JGUA 4F7TB 3F7YA 4GMTL 2ATKB 1ORQB 2XN9A 3UJJL 3CMGA 1XGTB 1WC7A 1SJEB 3PWPE 3FCTB 4O58L 2VR4A 1I8IB 3BWAA 4WI8A 3QFJB 1WZMA 4JGMA 3P9LB 5ILTL 1AFVL 3MRQA 4N9GA 5FUCC 4UQ3A 3VG9B 4HJ0C 1T5WA 2EZ0C 5L7XL 1IM9D 1P7QB 4FNLH 5EG6C 3PE9A 1G7QA 1KCKA 2CQVA 2ED7A 4V2BA 2M1KA 3V9FA 3OZ9H 4LOUD 4LLMA 4X8XA 4HXAH 4J3XA 5HTSA 4G9DB 4QRRA 3FT2B 3MV9B 4GQ9H 3MRMA 4P4RB 1T4KA 2IAMA 5CGYC 1XGUB 2O61B 3C6LC 4JG0H 4ZTPH 5JNYA 3CFEA 3CSGA 2ZKHL 3HG1E 1OB1B 3BEVB 2FLBT 3MODL 4L8SA 3G5YB 1ZLVH 4R3SA 4WUUB 4O9HL 1T3FA 3ALPA 3U1SH 5DQDL 3WEXA 2GAZA 4F15C 4YNYA 3NA4A 2BVOB 1AI1L 4JY6B 1SY6L 2X70A 2RFXB 5JOPD 1S7UA 3K8KA 3RUGF 1R5WA 4ZSOB 1I1AC 2DQEL 4YXLH 4PJAE 3GI9L 4KH2A 2H3NB 5DJYA 4PTTA 2V7NB 4IHOB 4O5LL 1WEJH 4OZHF 5D1ZB 1QHOA 2GTZA 4PRID 4NZRL 4ENED 3MLZL 5JW5A 4Z7VE 4R4FH 4RBPK 1IAOB 3QEHB 1EEYA 1BQLL 3E8UL 5T1LA 1RZ7L 3HR5B 4DGIL 2V5RA 1BQHA 5DD0H 2AJVH 7FABL 1XGRB 4MD4A 4HEPG 1RI8A 5HYJB 1NMBH 2J5LC 4O2CB 4H8WL 4J12A 2VXQH 4OF5A 5C09D 4KQ4L 3QXUA 3P9MB 2PR4L 3FB6A 5D1QC 1OW0A 3GJFA 2AJSL 3QQ9C 1D5ZB 4KTDH 1VFBA 4XAWL 4UV4L 5ESVA 3SGKA 3I3EA 2R1WA 2NW2A 2NCMA 3CDGB 1R5VA 1CICB 4YJZL 3VXPB 1T89C 3MLWL 4WTZA 1FFRA 3BISA 4RMUA 4TVPE 1I9JL 2X4TB 2ZJSL 3BIKA 1GAFH 3QG6A 1S7QA 3JV0A 2LQRA 4EBQH 5HDBE 1XCQB 4QCIB 3QXVA 4GLRH 1T5XB 4XVUC 3FO0H 1OGTB 4WGWB 3ARXA 4JY5H 5IB1A 2F53E 3VWKB 4DUVA 2OX5A 4KU1A 3PQYB 1H0DB 3RL2B 3VGHA 1T6WA 3T0WA 1WTGT 3FAXA 1NSNH 3L9RB 1JNNH 3CFIC 3CDYA 4QTIH 4F7PA 3CSPA 3K74B 1NEZA 3U6RB 1C08B 2BY2A 4Y4KD 3CUPA 3WS6A 3L3GB 2VDKL 2D0GA 5F8QC 1P4IH 5IEKA 2EDKA 3V6OC 2CLZA 5M94B 1QFUL 2V5YA 3BKML 1MRDL 4KK9C 2X1PA 1KIPB 3RWGB 3MCKB 3MGOA 3ETBF 3CFDA 4XTRC 1UA6L 1I3RA 2R1YB 5D2LB 2Y5TA 3IS0X 5E56A 2O5ZH 5AYUL 2B5IB 5DGRA 3ZYZA 2OTWB 4F58L 1BBDL 1U8PB 1IEAB 1AGFA 1QFWH 2AJUL 3E6FB 1EHXA 4WUKL 4OD3H 1LD9A 1ZT1B 2ZUWA 3LH2L 1QTYT 3NCFB 3FMGL 4W6XB 1BD2D 3WIFB 2MTPA 1OGAE 3BI9X 1VA9A 3BEWA 5C6TH 5ACMA 1MPAH 4AT6A 5C0BA 1XCTB 2B1AH 3MLSH 2HFTA 3TA3B 1EEQA 1CFQB 4LKCA 4HCRH 3VGFA 3ROLA 4LCWE 4U1HA 1YNLL 5E6IB 4XZUA 4NPYA 5D5ME 4LSDA 5AUMA 2DQGH 2P5WB 2X9YA 3JUYA 3P73B 4L4VE 3QEQD 1GHFH 1H8SA 1F00I 2FD6H 4EIGB 2G60L 1ONQB 5ICZA 1IKFH 3DBXA 1CG9B 3MRGB 1MI5E 3V5DB 5F1SA 2V2TB 5DK0B 2A6DA 5IM7B 1BWWA 3G5XA 5IOPB 1L9NA 2YBRA 3GHEH 3FB8A 5FYJH 1B2WL 2X4UA 4FXGB 2BERA 5T3ZE 2DM3A 1J8KA 4X6EB 5CLTA 3RAJH 2GJ6E 3MNVB 3QUZC 2NY5L 1DQTA 1YDPA 3EOAB 5EOCL 3VD4A 4R0LA 5BVJB 1BBJA 3LKOB 5DRXA 5MI0C 1SM3L 3D0VB 3I02A 1AHWB 3ZO0A 4K23H 4PJ7A 1HSBB 4A6YH 1KB9K 2A2QT 3AMLA 3LQAC 4ODTH 1AJ7L 4OF7A 1T0MB 3GKZA 2QR0A 4OTXH 4QO1A 1P4LA 4P46C 3RWFB 4YO0B 3IJYA 3VFUB 2QQKL 4C58B 1X5HA 5I8KL 3AY4C 3NIGE 1D9KA 5BW7A 1T22A 3AFLA 2EXYD 4I9WE 2DLHA 5CIPB 5F9OH 1WZKA 3GBLA 4JDTH 3LB6D 2RGSA 2ICEA 5HHPB 4EI5C 4XPGL 5CILL 3QDGB 2F8XC 1FIGH 1L0XA 4UUJB 5A43C 3VGAC 2XACC 1SMAA 5ITFA 5L8JB 4EN3A 5LXGH 5HJ3A 5B4MC 1VGKA 3KPNA 4O2FA 3RIFF 1R3KB 1BJ8A 1KTRL 1RULL 3CLFH 3QNXA 4KC3B 4EUPH 4LSTL 4OSUL 4AEHH 1UG9A 3RWDB 4Y8AA 3ARSA 5FHBL 4G7VL 5D2LF 4V1DA 5IV2B 4ZUSB 3NIDE 1ZA3B 4DW2L 4I0PC 3WNNA 2J7LA 4M93B 2YN5A 5HYIA 2DTML 4EVNB 2OJEA 3TYGL 1HXYA 4WWKD 4GXUN 3IFNL 3H7BB 5F89B 4JO3H 1ES0B 4BJLA 5I1DA 3GMPB 2NXYC 4JZJB 4ZO9A 1LWRA 3O81A 2P45B 2YKLL 2YEZB 3H3PL 4J6RH 5HBBA 5JMRA 1D5IH 4G8IA 4N90D 3MRNA 4C54A 3BGFC 4OLVL 1TZGH 3MRCA 5F1NB 1EH9A 1T21A 4IRSD 1MFDH 1FRGH 3R06B 2FO4B 3I2CH 1XGPA 2VLRE 3KPTA 4MJIB 4O2EA 1I8LC 2DIAA 3AREC 1C5DB 1UXSB 4G6AD 4HF5H 4WY7L 3KYMB 2PW2B 1A6ZA 2J4WH 2F8VA 43CAA 2OI9C 1N0LA 1Q94B 3ROOA 4CRPA 3LQAH 5L2JB 1HQRB 1FFNA 5D1XD 2F8OA 2EEDA 1U2HA 1G7PA 3SDCC 1Q0XL 2WW8A 4LBEB 1QP1A 4Q7DA 5HGDB 3OXSA 4L8CA 4IDJH 2JJTC 3DXAE 1R0AL 3K8LA 4D8PB 2OM5A 4HUWB 5DQJB 4MA1B 2DBLH 1KB5H 1EEUA 5IKCB 2E8ZA 2WUCH 5C0FB 3INUH 5DYOA 5IMMA 1J8HE 1DQJA 5EUOB 1WZ1L 1ZWIA 2BY0A 3F58L 4RCAA 4YUEH 2HN7B 3CD4A 4G43A 2W9EL 2VERN 5D7IE 4GAJL 4P23A 2UYLB 1UFUA 1HKLH 1N7ML 5LAXA 2AXFA 4W70A 3ARDC 3PNWB 4XVJL 4Y19A 3KPSA 4R7DB 3WKMH 1NGWA 2BNRD 3BZFB 4XAKE 1RHHA 3IJSA 3JWDL 4Z76B 3TO4B 2ZPKH 5EIQA 5FECA 4ODWB 4YZFE 4Z7WB 3KJ6H 4OJFH 4ZODA 3L3HA 3U0PA 4ODSL 2BC4A 2FRGP 4OF3A 2R2HA 2FBJL 4G6FD 4PY7A 5HGHA 4YXHL 5LGJB 4X80L 1R3HA 1OAQL 4Y5XA 3SO5A 3WNKA 2DLTA 3PP4H 2DJ4A 3BKJL 4UBDC 4PJ9D 4QRPA 1S7SA 1UWEL 2B0SL 1UM6H 3CNKA 3QIWC 4EIZC 2GSIB 3OHXB 3H9YA 4I48B 4RFNB 2DQUH 5BVPL 3QFDB 2BFVH 3TVMC 4OCXH 4JKWA 3SQOL 3WNOA 5IJKA 4MS8C 2AEQL 5TE6H 3F12A 2NW3A 3ZT5A 2R2BA 3BH9B 4RZCB 2AGJH 3MA7A 5JOFA 1A4KA 2XZQL 3H9SD 3GZKA 3D0LB 4BELD 1HHGA 1MWAA 3PDDA 4PJCE 3TV3L 2VDOH 4OGAC 4IMLA 4JREB 1MHEB 4NP4L 2JJUA 4OGZA 2BVEA 3P40A 1QYGH 4NUJB 5IJVB 3LEYL 2HLFC 2XZCL 3WXVL 1AD9B 4MQ7A 4ZUWB 1INEH 4U2ZA 1CFTB 4LSUH 4U49A 3WO4B 4M6OH 4KZEL 3FZUD 3S36H 4X7CC 4OLUH 1GGCH 4FQIH 1KJ2H 2H32A 2XI9A 2NY7H 1S78D 4MWFB 3WFBH 3IU4L 3EDKA 3V4VH 3IJHA 2EIZA 1T1WA 4K3JL 3ZHKA 3VCLA 4MD5B 1NFDE 3TN0C 5EH1A 4BSVB 1CT8B 1EFQA 4Y4FC 4EQ3A 1EMTL 4XB7A 5ID0A 3U9PH 3KLDA 3BDYH 3WJLA 2VOTA 2V6HA 1B0RB 4X7SL 1IKNA 4Y2DA 5IF0B 5DEGA 1M7IB 1D6VH 5I1EH 3QI9B 5EUOF 1FVDB 1NMAL 1W72L 3DVGA 3UTTD 4JKLA 1KYOJ 4LLDB 5E00A 1BZ9A 2VDMH 2ITDB 2NY0D 3DMMC 3MJ7A 2P8LA 3GIZL 2C3GA 5ICYA 1YECH 5BO1H 4QXUH 1T83C 1U6AL 3BPCA 1EEZA 4JRYD 4CMMB 2WLYA 1XIWD 3PDGA 5EC1B 3QHTC 1UEYA 5GRVK 2CRYA 4JFEA 4LNRA 2EYTA 3RL1A 4Y16C 2MHAA 2AV7A 5F21B 3U46B 3LEVL 5C3LD 32C2B 2JELH 1C5BH 4ONOA 2AEWA 3U0WH 2GTWB 3DECA 5D7JD 4Z7WF 1G7IA 2DWEB 1MCWM 2AERT 5MENE 1JZ5A 3S37H 4GUPB 2WM0A 3ARWA 1KPUA 2Y6SD 4JM2D 1QSFD 1QBMH 2J6EA 1SHMA 1H8OA 1BZQK 5FOBB 3VXRA 4WCYH 3PUCA 2X4PB 3CFBA 3LQMA 3ARFA 5AZ2L 1FNSH 4UT7L 1HDMB 2B1HL 4HXBL 4PRPA 1I1YB 1XGYL 2F9BT 4LARH 4PRAA 4WFED 3UPAA 3C5ZD 1DBJH 2AXGB 4DTGH 5CKGA 4PJ8D 1VEPA 1W0VB 4FZEH 4JPVH 3REVA 1MFBH 1AD0A 5E2WL 1J1OH 2Q3AA 3FRPA 1NLDL 5IWLC 3S4SA 1FE8H 3VFVB 1W8NA 5JPNB 3GHBL 4JRWA 1ACYL 4KTEL 1T2JA 1FP5A 2VXVL 3MTRA 1GGUA 4F2MB 1N0XH 3QCVL 4JHAH 1ZK9A 2NMSA 3RZCD 4CN6A 1J5OL 4R7NB 2R4SL 1JGEA 1G6RA 2BP3A 4HIXH 2YPLA 5L2KE 1NBZA 4ZFZA 5EPMB 2J88H 1Y6MR 3KVQA 1MIEL 1JUFB 3FQNA 2VLKD 4ZFFA 2E7LC 1EHNA 4WHDA 4YWGH 1UADC 3P30L 4KJYB 1CGSH 4ZO7A 3RWEB 3OTTA 3KPLA 1FDLL 4NKOB 4PLJC 1D5MA 4Y5YC 3C6LB 4W4OA 3V6ZB 4KKBD 4LAJH 2YWYA 4Z0XB 5I76A 4GKNA 5C07B 4EI6A 1GGYA 5FGBC 5GJTL 2X1QA 2XN9D 5KZCD 5SX5K 2VSDA 4FOMA 2W60A 3SGJA 1UEMA 1ADQL 1PYWB 4MNQE 4F15B 1CZ8L 5LG1A 1MCWW 2GUOA 3MPCA 4PJDA 3HZKA 5EULV 5GGSA 3HMWH 1HNGA 2CLVA 3PWNB 4F57L 2CUIA 3VFWB 1I1AB 1Y18A 1U8QB 3UZQA 2BNUB 3BUYA 5FKPB 5C0AB 1I8MB 4QRRD 1JHLH 5KS9A 3AROA 4KV5E 3SE9L 2X4NA 1K5NA 5TE7H 4WENB 1WBZB 4WW1A 4RGNC 3UC0L 4YHKH 2CJUH 4OLEA 1MJ8L 3N1MC 4ETYA 5E70A 3E1F1 1NCWL 3J7HA 2EDHA 4DGYH 3QDMA 4PLOB 1CGWA 5B8CC 5J11C 1S7XB 4GSDH 5BRZE 4QLRA 4K8RD 4YDJB 5FYJU 3HC4H 2A77H 3KPQA 3HG1B 3PV6B 4H25A 1U8IB 2JIXA 1AH1A 4AM0A 5I74C 5DGQA 1QR1A 1ULVA 3ZL4L 3FQRB 3IGAA 2ARJA 4PS4H 4Q0XL 4PV9B 3TWCL 1TENA 5FXCH 4WIQA 5JIHA 3RWIA 1I7UB 4PJAB 2SEBB 2R69H 4TSAH 3HI1B 1YMMA 3L5XL 2HT3D 2A38A 4XVSH 3L3KA 1DN0A 2AEIT 5T1LD 1CXIA 3BXNB 3QNZB 5C0JA 1XT5A 1MUJA 4NKMA 3FQUA 4NQCB 3O6FC 4C83A 1MLCA 4Z7VB 4XNYL 1T1YB 5ESQA 3D3VA 3MOAH 5DLMH 3RVXD 3FT3B 5FGCE 4P99A 4FQLH 3HUJA 5FF6A 3X12B 3L3JA 5KSAA 5HD8C 3C09C 4CDGC 1M7XA 4NM4L 4QXTB 4GO6B 4EJ1C 4LPXA 5GGRY 3QIUC 3DRTB 1HILA 1FQ9C 3E3QC 3OJVC 5DK2A 5DJDB 3LKQB 3LRHA 1V05A 3WDHA 5MERB 1EFXA 1QBAA 3VFMA 3NABH 5I8OH 1ZVHA 3L6FB 4R4FL 5CINL 2VISB 3VFRA 2LU4A 2VZVA 4HZLA 2R0ZL 4K94C 3UJIL 5TPWH 4QHUA 1T7YA 5T1KA 3VFOA 3BZ4A 2W0PA 1IEHA 3RKPA 4OV5A 1QQDB 5KVEL 1JGUL 2HH0H 3QISA 4A6YB 2DS4A 5D6DA 2EDDA 5DD0L 2OZ4A 2OZ4L 3B9DA 3MMEB 4GRLC 1AXTL 3UPCA 3IFOB 2NYYC 4HV8B 2ENYA 2VZ1A 5DUML 1KPVB 1I7RA 1QBLL 3ISWA 5IQ7H 3VFPB 4AH2A 4FQJH 1X7QB 2P46B 1HCFX 1NFKA 1NCCH 2XWJA 4XMPL 4FABL 3V7AE 1QFHA 2YPVL 1QNZL 5T3XL 3O3EA 2NX5E 4YHNB 2HJLB 2VXSH 5JORB 3MO1B 2XTJC 3RKDC 3ARZA 4XPFH 4OZFB 2EH8H 1DUZA 1A6VH 1CE6A 5GRWA 2IQAB 4K7PY 2EE6A 5IP4A 1X5JA 1U3HD 2XKUA 3BQUA 2BRQA 3MRLB 4QRUA 1TZIB 1X9QA 1KTDB 4BM7A 1HQ4A 4TNVK 1MVUA 1K2DA 2DI7A 2VLMD 3DRQA 2EDRA 1RMFH 4FTVD 4UOW1 3CIQA 3EJZD 3KDMB 4CMHC 1JNNL 3QG7H 5FFLA 1N2RA 2VQUA 1UCBH 4FN0A 1OSPL 1J0IA 5C0BD 4Q9BA 2BVYA 1SEQH 2OTUB 1OAYL 2NR6D 3D9AL 1J87A 4MSWB 2IADA 4U31A 2VDQH 4HX1A 4NKQB 3QQNA 3GSWB 5TDOA 4K94H 3ULVE 3MLTA 5MI0B 3H2WA 2O5ZL 4PJAF 4OAWA 2NY6B 1WT5A 4YHIA 2H6PB 4GW1A 3FFCA 4NM8L 2VUYA 1JRHL 2P48B 4LCWB 2ORBH 3J8F7 2OMBA 3GIVA 1CLZL 2RCSL 1QA9B 4OD3L 3BE1H 3MJ9L 3QUMH 1YEHL 4Z7VF 1YJDC 3QDJA 3QIBA 1XZ0B 1AQKH 4L4VB 1QO3B 3JZ7A 4HUUB 4U1NB 1D5XB 4J3TA 1LK2A 4JZOA 5IK3B 1HYRC 5KJRH 1MI5B 4EI5B 2EYSA 4AL8H 3WFCL 2HVJB 1KB5B 3QQ3A 2B1AL 1GSMA 4U6VH 4JANB 1CFSA 4JKKA 1Z3GL 1IJ9A 5I71C 3VGAB 2HFGH 4FXKB 1HHJA 3MRFB 1B4RA 3DARA 1E4WL 1GPOL 4LSRH 1FNGA 4XH2B 2FIKA 3V6FB 3S34L 3CPLA 3M17B 4MQSB 3QAZC 2GJ6B 4JLRB 4MB3A 2J2ZA 2QL1A 1D6EB 4O02H 4ALAH 3QULB 4Z7QE 25C8L 5BXFB 4LGRB 4MYWB 4XNMB 4ZUTB 5EO1A 4NN5C 1D9KD 4UDTA 4R97C 3NCMA 5GGTL 1KCSL 4LLAA 4AEFA 2NXYB 1E27A 5ISZE 5FYJL 4NC2B 4LHUA 3F5WB 4QHMB 3BGFB 1YN7A 1YY8B 4EN3D 1AXSA 4NRZA 6CGTA 2Q8BH 4MNHA 3BP6A 2Z93A 3R4DA 4JO2H 1ZGLA 1RFDH 1A9EA 1MIMH 1QRKA 1FG2A 3DWTA 3OX8A 3G08A 4WHYH 3O3UN 1JZ7A 4KWUA 3VE0B 1DBKL 2N7BA 2YC1A 4TVPL 4V1DD 4DAGH 3U7WL 3PL6A 4I18A 1C16A 4XBGA 2I25N 1YJDH 3QPXH 3SDCB 1G7MA 4TUKL 3TNNA 3QH3A 5GISH 1DQMH 2YR3A 3WIHA 5ELIA 4ZD3H 1YZZA 3HE6A 5KOMC 2AP2A 3LD8C 2IAND 4ZFOL 1SJHA 3C6SB 4EOWH 4F9LC 5GHWH 4XBPA 3N85H 3MYJB 2ED9A 4Q9RL 3ARYA 4LFHG 1MRCL 5CJBA 4HIJB 4FFVD 1BECA 4L1DA 4F37F 1SMOA 5DVOA 3EYFB 12E8L 2FYYA 1S7WA 1FHGA 1OTUC 3AS1A 5FDYA 3V95A 1RUAH 1RZFL 4H0GA 1HOCA 2Y4SA 5DT1H 5J0BA 4WJ5B 1XF4B 3MRKB 4WFFD 2KQMA 4OZFG 3VXME 4P4KB 2AABL 1ZSDA 1U92B 2CDGB 3TCXA 1KJ2B 1HYSC 4OFIA 3MJ6A 2EIBA 4J23A 1F6AB 3MLRL 1E4XL 3L7EB 1REIA 3CMOH 1VENA 2DWDB 3MV7A 4AJ0A 5H8DA 3TH3T 1TZHA 4W4NA 4OZIA 2JB6B 3IRPX 2ESVB 3QNYA 4J4PA 2OJZH 1AGDB 3DI2B 1NAMA 1OGAA 3TJHC 4FMFA 4KKCC 3DXAB 2ZOKB 5ID1A 3PF2A 5CD5C 4QRQB 5FUOH 5IMKA 3RNQA 3I2CL 1WWWX 3K81A 2DQJH 1MY5A 3BESR 3GSOB 5KVDL 2MCPH 3MRDA 1CVRA 4P23D 3CX5J 1CLYH 1P6AB 4NRXB 4XWOD 5D5MA 3CSYA 1J8HB 1DBBH 1KBGL 3TVMB 3HRZB 2CIKB 4MJ2A 1IGCL 3KPSD 1G9EA 4LCCA 5EZOL 1MREH 1F4WH 1QD0A 3NPSC 2GJZB 3RWHA 1E6JH 1MLBA 4H88L 1BQSA 4JFYB 3GJEB 3WL9B 3FN3A 4FG6D 4NBZB 3LEXB 2ADIA 2WP3O 3MRIA 1JN6B 3EYQC 1ITCA 5I9QC 1WUNT 1OF2A 5DJ2A 4L8DB 2J8OA 1RJYA 3NIGF 5D2NA 2AV1A 3T0EC 2JKXA 4HAGA 4LP4A 5T3ZL 4MCYA 3MZTA 3D85A 3HC0B 2FJGB 5EORL 4PGEB 6FABH 2VZOA 1LVEA 4JKMA 4K9EC 1IILE 1KCUH 4TPRH 3WLBB 5JO5B 5IQ9B 5DF0A 5I16B 1CIUA 3Q2CA 2CR6A 5JOEA 5IFAH 3WFDL 5D8JL 2F5AL 2FECL 1K85A 4N8CL 2E7HA 5AZEH 3OKOB 3GDBA 4S1DD 5DHYB 4Z7NE 5I6XB 3X17A 4NHCH 2ZPKL 4CU7A 4GKZA 1Q0YH 2MNUA 4QOKE 2UY6A 1SYSA 3DJ9A 4LLVA 4DGVH 3MGAA 4OJFL 4Y4FB 3NIDF 4LLUB 3SKNA 1KC5L 4ETQB 5A2LH 2R8SH 4UB0H 1TQCC 5IB2B 2E7BA 3N06B 4GS7B 4JM4L 2HRPL 3ZYIA 3IDXL 1ETZA 3UTQA 2Q1EA 3DETD 3X3GL 3DSNA 3CJJA 3PP4L 1KB9J 1KELL 1S9WA 3MR9B 4G8GE 3SJVA 3ARTA 5CFHA 1UM6L 5GS1B 4ODVL 3BP5A 4LCIH 1UXWA 4KROC 1ZGLP 5T1DL 4LSVL 4XPBH 1DBMH 2DQUL 4HKBB 5FIEA 5EO9A 2BFVL 2BJML 1PZ5A 3TBTB 4XCFH 2GK0A 4D3CL 4PR5B 2XRAH 3E2HC 4M62L 3IXTA 4CJ0A 1A1NA 5GSRB 4P3WA 1CFBA 2W07A 3CXDL 5F9JA 1CDGA 5FA4A 3DV4B 1FJ1A 4YR6B 3FO1B 2YHGA 5C0CA 4IDLA 4LDLB 3V4PH 1PX4A 4C4KT 3WLWC 1BX2A 4M43L 3GSRB 4D9LL 4Y16B 1JRHI 1MFAL 1A0QL 4OZHA 1ZHLB 4GXUM 5C8JA 1MF2H 2IG2L 4PLKD 1X4YA 2ATPA 1WV7T 4M1DH 1QYGL 1NFDB 4MHHG 4P2QB 1JFQH 2VKWA 4Y2DD 3JTSA 5L6YH 3VRJA 1QFOA 4QF1B 4LSUL 1JZ6A 4K9EH 1QPPA 3MBEA 3PWUB 1U9KA 4N1CA 3VJ6A 4M6OL 2NY2B 2PETA 2VLRA 5J6GA 2L4OA 3S36L 1R3JB 2FHFA 4WW2B 5E8NA 3T8XB 2J8UA 5F9DC 1K6QL 2R2CA 5FYKD 4NO5B 4U1SA 5KN5A 4G42A 4JAMB 3BYYA 1FNHA 1A7RL 1MAKA 1DLHA 1DVFD 2CPCA 3BKYH 4H26A 1J05A 3WNLA 2DI9A 3B9VA 1FNAA 8FABB 5IGXH 3U9PL 4TNWK 2C1PB 4K7PH 2P49B 4RQQA 4NUGL 5CHNA 4LASH 1F13A 1BJMA 1MH5A 3SDAA 1RK1B 4PJGE 3GSNH 1DL7L 4NQDB 3Q5OA 4RIRA 1D6VL 1LGVA 4ZPTA 4OCYL 2Q86B 3D18A 1Q9OB 5MENB 3VXRD 5SX5H 2OP4H 2VDML 3W9DA 3S36X 5A3ID 4XPHL 3ARFD 2HWZH 4QY8B 3JV4A 1F2QA 2NXZC 3LKSB 2AEPL 2PCPB 2R56L 1HEZB 1H3WM 4BFIB 1SJEA 4HK3J 3ZKSD 3EYVB 1FO0A 1P84K 4N0UE 4LCUA 4BZYA 4Y5YB 5EA0H 2DM2A 2F5BL 1NMCB 4PREB 4ELMA 2BOCB 1LE9A 3F7QA 2BXZA 3MXWH 5I18L 3T0DA 3QR2A 1CD0A 5FA3B 4Q74A 1P7QA 4PRHA 3O9WA 3LAFA 1CWVA 1VDGA 4RGOL 2DKMA 1DBAL 3F65A 1NJ9A 5JOPE 5CEXB 4G6MH 1OCWH 3GSVB 4OQTL 3IF1A 1XGUA 1JHKH 2WAHA 1FVCA 4W68A 1CXHA 3ARBA 3KPMA 4JQXC 3BEVA 4JN2A 3G5YA 3HNVH 3L3OB 5JIIA 1A7QH 4WUUA 4PRIE 4XP4H 1A3RL 1HHHA 4ORGB 4MQTB 4RGNB 2YUXA 5GJSH 1NCAH 4FQXC 4CADB 1JPSH 2RQ8A 2UWEB 1G1CA 5B8CB 5HYSA 4CU8A 2H3NA 5J11B 5HY9A 5I2IA 2AQ3A 4NQVB 3DVFA 4HG4K 3S37X 2PW1B 1E4XI 2DQDL 1N0XL 1MCIA 5HVWA 4BZ1L 2VIRB 2E27H 1NFDF 5C09E 3EKCA 3D2UB 4V2CB 1IAOA 1QBBA 5E03A 4ZNEA 5GRXG 3BO8B 4HIXL 5DVKA 3WUWB 5I74B 4FRWA 4XMLL 1XR8B 5HHNA 1KXTB 1KCRH 3M45A 1XF5A 4MJ5B 4LRIC 4WW2F 4WDIA 1HWHB 1XGRA 5A1AA 5HYJA 5E7FA 5FKAB 1RZ8B 1OM3H 3MV01 4HBCL 4MVBD 4OB5H 1EBAA 3AVEA 4B7LA 3QDMD 2H41A 1KN4L 4DCQA 1D5ZA 2ZCHL 3O6FB 3IDMB 1FIEA 5ACLA 5GGUA 1XR9A 2CH8A 3CDGA 1CICA 5ABDE 2XNAA 3C09B 4FQHA 4RMSA 4WWID 3G6JE 1J18A 1NGYB 5BRZB 1HHIB 3RWCA 2EE3A 5IMOA 1CU4H 4EEEA 2FO1A 3GRWL 1RUKH 1JHLL 4JO4L 2Q7YB 4M48H 5TE7L 4ODXB 3VWKA 3QEUA 2IH3A 5C86A 1YMMD 1T66C 3C60D 3HCVA 3PQYA 5DRZA 1A6TA 2FH8A 5DUPH 4FFWC 3LDBC 3EDFA 4R2GC 2X4SA 3TBYA 4M3KB 2I9TB 2OR9L 1ZTXL 4MNGA 4NNYA 1UQSB 4GRLB 4E9LA 4NIKB 2FECI 3JVGA 2D7PA 1IGIL 5KSAD 1MHHA 1X4XA 4HGWA 3BP4B 3DX9B 5FO9B 1KIPA 1BD2E 3RWGA 1FAKT 3M1BB 5HXMA 4FQ1L 1F02I 3NFNA 2VO5A 5DI8A 5I1HH 1JNLH 3A0OA 2R1YA 1ZHNB 2A9MH 4XVTH 5D2LA 1U3ZA 1EFXD 3B6SB 4WV1C 4YEFA 4P2RD 4U6TA 4DVRL 5DD5H 2UV3A 5LJYH 1LP9E 5T5NF 1IGFH 1IFHH 2VN7A 3TT1H 2JF1A 1UWXK 4M8QB 5E8DH 2CRMA 1A8JH 5GQBA 1SEBA 4GG6B 1CTNA 5I1AA 5T1KD 1S5IH 3BT2H 2IBBA 3Q1SL 4NQSB 3QEQE 3UAJC 2AJXL 5CBEB 5JDSB 3EOTL 5DJZB 2UWEF 4JPKL 4FQLL 5FHAH 1FZOB 5D7LB 2EC8A 3GKWH 2DM7A 5CWSB 4HHAA 5CUSL 2VC2L 1EO8L 3U36A 3HKFA 1S8DB 1DQDH 4M5YH 3H9ZA 4N0RA 4P2OA 1A14H 2I27N 4XB8A 1JNHA 2IH1B 5H35B 5D9SA 4E42B 1Z5LB 4L9LA 2DD8H 3BGMA 1T1XB 4PGCA 2WBJC 2BSSA 2YD8A 5H94A 4U1LB 2VL5A 2Z92A 3V5DA 3H9HB 2RAMA 2QQNH 5L8KB 5GGVY 2HH0L 3S88H 3QXWA 1CK0H 1OP3K 4FXGA 2GKIA 4PG9B 1WWCA 3FQXB 1WIPA 4X6EA 1P4BH 5F3BA 2A0LD 5EUKA 5FYLD 3MNVA 1CGVA 1F3JA 2Y7QB 4RRPG 2KQNA 5GSVA 3MNWA 3QT2A 4JDVB 2DIBA 2WBWB 4XNZC 2VDRL 4LU5H 5D4QA 5DFVC 5EU5A 5JXEA 2Y36L 5I71B 2R23B 1ZLSH 3U7YH 1T0MA 4PJ5B 2P8PB 3WUWG 4QTHA 4HJGB 2PXYA 4PJEA 4YHLL 3RTQC 5DURB 1EVUA 4LLQB 4LVNC 2WNGA 4LCYB 3W9EB 1W0WA 5DR5L 5F1IB 3RGVC 3FFCD 2VABA 5CIPA 4APQD 2GFBB 3EOBA 5DD3H 2Z8WC 2EDNA 1AKJD 3ZKXB 3MRRA 2HFEB 4NT6A 4ZAKB 4NKDA 3QDJD 3QIBD 5I8EA 1A9BB 4HIEB 4XCCL 1NCDL 5EBMB 1WIOA 3MJGX 1E28B 3BWUC 4RAVA 3WJJC 3LS4H 3MV8A 3QUXC 5FUZH 2D4DA 3T3ME 3TNMB 4KY1L 2H9GB 1FBIH 4LEXH 4ZOBA 2P7TA 1MRFH 3CVIH 4N90E 3Q0HA 3VDCA 4JFDA 1BJ1H 3DUSA 4IOFD 4O51A 3VXNA 4P59H 1IGML 3CXHJ 1XF3B 4OBSA 4K94L 3EAKA 4WGVB 2D7OA 4QRSA 2ARJQ 4D0BA 1AE6H 5EU7C 2H2SD 1FV1B 3HLAB 4GG6F 5F89A 1ES0A 1LDSA 4JZJA 2PO6B 4Q9QL 5E94B 3STBA 5ADPH 2C7UA 3HAEH 2GK2A 3QCTH 4GBXD 5TH2B 4HS6B 4PB9H 3HI5H 3HZVA 5CMAB 3LD8B 4YDIL 4MJIA 4POYA 3CK0H 3Q6GH 5DEZA 4LHUD 1UXSA 1Q9LB 2PW2A 4U1KA 3PWJB 5L2JA 2DQFB 2HFGL 2OCFD 5DO2D 3R1GH 1P7KB 4YLQT 1I9IL 3RVUC 1KSRA 4P3DA 1H9VA 1PFCA 5L88L 5CCKH 3CC5B 4LBEA 5HGDA 5ISZB 2GCYA 4UT9H 1FFOA 1I85A 1IAKA 2BVTA 2QBWA 2VWEE 2XG5A 1Z0NA 3V0WH 3PL6D 2FEDD 3CLEL 5ALCL 3MUGB 1S3KH 4P5KB 3AU1B 2ZUTA 1NBYA 1CLOL 2NY3D 1BM3H 4OGYL 2BNRE 1NGXB 2OSLA 4U6XB 4X9IA 4RA0C 5HI5C 5EUOA 5I73C 3BPLC 1S9XA 3TJEH 3WD5H 1KG0B 1QSEE 3G6AB 1I7ZB 2ZSWB 3OKLB 1LO0H 3VFTB 3S5LA 5CJ8A 1DSFH 3QA3A 1RFDL 3GB7B 4UNUA 2NX5A 3BZFA 1M4KA 2V9RA 1TJIH 4DOHE 4OCNC 4Z76A 3TO4A 3S97C 4ODWA 3QCUH 4QHNA 1AGCA 3V7AG 4U05A 1LDPL 3PHSA 3QPXL 1JE6A 5GGRB 3EUUA 3NPSB 4WHYG 4NHUA 4X5XB 3OKKB 1RUPL 4ZD3L 3MV7D 4X6BB 1QPXA 5F7EL 3WMSA 3MRBB 4DQOL 4WNQB 3H9SE 2OQJA 4J4PD 4NCDA 4F9PC 4AYFA 1NKRA 4M4RA 2R0LL 1DFBL 2ZUSA 1U8HA 3TIDB 3HZYB 1RD6A 4FQ2H 5I9QB 5TFSL 1MFCH 3QFDA 4L4TB 5JW3H 4OZ4A 3MRPB 4UIKL 3T0EB 1QSVA 3WFEH 3O3AB 3IVKA 3HPLA 3FONB 1WFUA 1IAII 4RZCA 3CVHH 3I75B 1IEBB 1FL5A 1RQ5A 3IB4A 3D0LA 3ULVL 4S2SA 5F88B 2EYRB 5T1MA 2FJFB 4MLIA 1JF1B 2FB4H 1T7VA 1MHEA 1QLEL 1UB5B 4TUOA 1N8ZA 3BHBA 1CDIA 5IJVA 2ADJB 3O41B 3GMLB 1T80A 5I66B 1BIIA 3NTCL 1AD9A 4ZUWA 1F58H 1EHAA 2W92A 4JVWA 2D7TH 2YZ8A 4NC0B 1OY3B 3CH1B 1LEIB 1YEIL 5EN2B 5DSCB 1BLNB 1TQCB 1XEDA 3LKNB 2HT4D 2JK5B 4XGZA 2GW5A 4XMKL 1YY9C 1MJUL 3AS3A 2PYFB 5E8PB 4HPOL 4M6ML 3GSNB 4I4WB 1J1XL 1CLYL 2R1XA 5KSUA 3MREA 4AG4H 4KROB 4WEBH 2EDTA 4X4ME 2VQ1A 4PJXE 3UTTE 3X3FH 3FO2B 1JWSB 2C1OB 4IOIB 4BSVA 5E4EC 1CT8A 4D0CB 2HTKC 3F7VA 2FATH 4OF6A 3E2HB 3HI6L 3UDWC 1Q9WB 2BOBB 5DUBB 3DIFA 4Y88A 4JRYE 5F7UA 3RIFK 3FZUC 4S1SL 3VDAA 3IDNA 2NY4C 2YA2A 4Z7OE 1LHZA 4P2YA 3QI9A 1FVDA 2OK0H 3OG4B 3QJFA 3LHPL 4ESKA 4BZ2L 2ITDA 3IXAB 1A7OH 5TF1L 3N1PC 1LO4H 4NRYA 4P5MB 3SJVD 3VFGL 3X11A 1BVLB 5DJAA 1QSFE 1FL6B 1GGBL 3ULSB 4I2XE 1T0NB 1OAUL 5J1TC 4XWGL 3KXFB 4JQIL 2HMIC 1ZS8B 3BAEH 4G8GB 32C2A 4TRPH 5AZEL 2WWKO 4HWZB 3KPOB 3HE7A 2CKNA 3NA9H 4NDMB 4GUPA 5C0CD 4TULH 1A6AA 2I07B 4WFEE 1RURH 3BKCL 2RHEA 2VRAA 3VRLF 1OHQA 3VFNA 3LZFH 5DJ0B 4P57B 3T0BA 1LE5B 1NC4A 2PTVA 1N64H 1OLLA 5FOBA 2JJWA 4ZTOL 3O4LA 5SX4I 3OKNB 1YYML 4Y4HB 1KULA 3K7UA 4KI5C 3JWNC 3GSXA 5J3HD 2DLFH 3MBED 3DYPA 4FA8A 1FPTL 1JF5A 4QEGA 5F3HB 1JTTA 3EDJA 1FLRH 2DAVA 4XPBL 2QADC 4J8RA 1A7NH 2MWCA 5I1KH 4K3DH 1A3LL 1BJ1J 3KLAB 4OGXH 5DZNA 1U8NA 3NZHL 2VLKE 3PWVA 1YPZE 3VXMA 2NLJB 2EC9T 1KEMH 4RSVA 4A2LA 5SWSB 1T20B 4ODHL 4NO2B 1KT2A 4OZGE 2H1PH 3OSKA 1I3UA 1M6OB 4MXWL 3ZTNH 4F2MA 3V4PL 2PTTB 4MAYC 5CJOH 4UQ2A 1JTPA 1K4DA 1G7HA 2IGFH 1KACB 5GGVH 2XN9E 2GITB 1SYVB 4X4ZA 3SDAD 1NC2D 5J6HA 5L6YL 5TQ2H 4OLZL 1NDGA 4K9EL 1DDHB 1OPGH 1FH5H 4UNTA 4P48A 4QYOB 3HB3C 4XNQB 3SCMC 3Q5TA 1KXQE 5E5MA 5E9DB 3LS5H 4ERSH 4LPWA 4F7MA 1IC7L 3C6LA 3P11L 1NQBA 4G7YH 2Z31C 4LQ1A 1D5BA 5MP6H 3LN4B 4QRRE 5C08A 4PGDA 3R0NA 3MROB 1G9NC 3LN5B 1RVFH 3V0VB 5FGSA 4Y7MA 4B41A 2CXGA 3MNZB 4FQXB 4P5TA 5KW9H 5EFIB 4ZXBC 3BKYL 2HT2D 1ZHKB 1WWBX 5CD3A 4PB0H 4M7KL 5IGXL 3U0TB 3LRSA 1P7QD 1FGVL 1GVIA 1U8QA 3FT4B 5KSVB 4PRHD 3LSOB 3DROA 5GS0C 4N0UB 4F8QA 4Z77B 4WHTB 4Z7NF 3GK8L 1I8MA 3TGXA 2EO9A 3O2DH 1RU9L 4YFLF 3TBWB 1A6UL 4X98B 3WHXB 2ITCA 3O6LL 5HDQL 4G6KH 3ZMRA 2QSTA 3SE3A 2CMRH 2YK1H 1F45A 3D25A 3ARBD 3ZHDA 4WUUD 1U2CA 4PP2B 4JFFB 4R4NC 1LO5B 3OWEA 1OWRM 4OI8A 5IW6A 5IVZB 2YWZA 3C08H 5KSBA 4U0RC 1MAMH 4CJ1A 3KR3L 3AGVA 5D1QA 1UZ8B 4PRIB 3MLUL 4GW5B 3MXWL 4PRNB 5KANI 4QOKA 1A21A 2IAMC 3OXRB 3P0VH 3V52L 3HPJB 1U91B 3RVVC 4Y5VA 4PV9A 3JTTB 1OTTC 4HKJA 3VFSB 4HCRA 1I7UA 1F4YH 1P9MC 1JGLH 1JK8B 2DQCL 3S7GA 1OTSD 3N9GL 3UZVB 2BY3A 5E08H 1PG7H 1KV3A 4S1RH 4LIQH 1MOEA 3QDHA 1KJ3L 4HS3B 1H3XA 1G9NH 1EX0A 1RJLB 1Z9LA 1NUFA 3FT3A 5DHVB 5HYJD 4M6NL 5DEFB 1NCAL 1X5GA 2FX8H 3D69B 4XP6L 4RFEB 2IWGA 5C0IA 2DQIH 5A2JH 3LDBB 4RGMC 2F54B 1UKTA 3UBXG 1F4XH 4QHKJ 1ZGLM 5GS0H 2XY2A 1CICD 1G6VK 4HS8H 1U8OB 2O93L 1DTUA 2A6JA 2QTEA 1BHGA 1RZJL 2XXMB 2YRZA 5CP7B 4U7KA 15C8L 4LSPL 3AAZA 4GMTH 1AGEB 3VWJA 3UJJH 1IMHC 3IDUA 1ZLWK 1F42A 3PABA 5E5UB 4OFPA 4MJ4A 2ICES 2BSRB 1KCRL 4A6YA 3IFPA 5ILTH 4JE4B 1AFVH 1QKZH 4ZDHB 2WIIB 2CDEA 3VWKD 4HH8A 1DANU 3PQYD 3ARGC 5L7XH 3P4NA 4HV8A 1OM3L 1OD7A 4OB5L 1CGXA 1SJXA 4H0HB 3D5OF 2Q76B 2HJKB 5EBGA 2HJFB 2A73A 3U2SA 1KPVA 4U1GC 1U8LB 5IB5B 1IC5L 4TOYL 2Q8AL 3LPWA 1M71A 3ZE1F 4ZFGL 3DPBA 3S9DB 5J9PB 4U33A 2VLME 3MODH 2HJLA 4FTVE 1B3JA 4O9HH 1B0GA 5DQDH 4RMRA 3U30B 3VRIA 3MBXL 4IRZL 4KJPD 3MJ8B 4PJGA 5C0BE 4EUPA 1OP3H 1AI1H 1SY6H 5L9DL 5IBLC 5FCUH 1VGEH 1TZIA 2DQEH 4M48L 5GRUL 3GI9H 5DRNB 2WBJB 4JY4B 4JN1L 4O5LH 2B7DT 1XH3B 2DM4A 3RPKA 1S7VA 2IALB 4M4PA 3REWA 3MLZH 1UB6A 4FS0A 3QYCA 5JLZA 4HJJL 3KWWA 4LRNL 4OD1L 1F3RB 5KVMC 4WFGD 1RZ7H 3A67H 5JIKA 1A47A 5ANMA 3QUZA 1T1ZB 1T0PB 7FABH 3LMJL 4XVTL 3KYOA 5A40E 3ZTJH 4OI9A 4XNZB 4KQ4H 1U95A 2XIDA 2J12B 3G04A 1AY1L 3OPZL 4XAWH 3U9UB 3VG9C 1QA9A 4KHXL 4UV4H 3EHBC 4P46A 3FL7A 3KNBB 4LVNB 2AJ3A 1WFNA 3LKRA 5CBAB 1C7SA 3AY4A 5K59F 3ILQD 3MLWH 4WEUD 2BMKA 3BT2L 4HUUA 3I9GL 4LF3A 2E3VA 4YHPB 3CSBA 4B53A 4OLYL 1N59B 1I9JH 2ZJSH 3PGCA 1KB5A 3WFHB 2PKDA 5GPRA 1MCEA 1KNOA 3GKWL 1PDKA 4LPVA 1ZHBB 5M95B 4NGHL 1GGIL 3OR6A 1FSKB 4NZJA 1HH9B 2MFNA 1K3IA 1PKQE 4HIHB 3AUVA 5FAAA 4JRXB 2Y06L 1J86A 1FFPA 3UTZB 3QUXB 3V6FA 3M17A 3MX0A 1D6EA 4R96A 3V7MA 1FYTA 1IGYB 5BXFA 2DD8L 2PXYD 3V6BR 4I0PA 4MA3A 2VDKH 4XNMA 1OLZA 5D1ZC 1GOFA 4EDWL 1ZLVK 1L0QA 1QFUH 3BKMH 1MRDH 1FN4B 5DD6A 2NY5C 4MCZA 4V1DE 4OKDA 3QDGD 1IAMA 1UA6H 5B3JE 3BPOC 2XA3A 4HC1L 5AYUH 4QHMA 3PV7A 2KDGA 1PBYA 1YY8A 4KDVA 4KUZL 1BBDH 4F58H 4DFHA 3SPVA 1ZMYA 4GRMB 4WUKH 1N5AB 3MV8D 3LH2H 2IANE 1I8LA 5ICXB 3AREA 3FMGH 3HS0B 3VE0A 4JFDD 4ISVA 1ZA6A 4G9FB 4L29B 1DQLL 4WWKB 5HGGS 4Y4KA 4DWHA 5EIIA 1EGJL 2JJTA 3F6LA 1X4ZA 4NOFA 3RIAF 1YNLH 3CVHB 1TNMA 1Z0MA 5F9WC 4WFFE 4Z6AT 1IT9H 3O4OB 3SDXB 4KJWC 4YPGB 3KYNB 3TEUA 4U1MB 5J4MA 3O3BB 4B5EA 1NCUA 1X3DA 2G60H 2YD3A 2VXUH 3EYFA 3KHOA 4MJID 2DL2A 3O8XC 1KIQB 5I73B 1N6QL 4KAQL 4NN7C 3BPLB 1R3IL 1BD2A 4D9QD 3EO0B 2FJHB 2L7JA 3L7FA 3ARDA 3QO0B 2FX7L 1B2WH 2D7MA 2HP4A 2B4CL 1TVBA 4WEMB 4BFBD 2C3VB 2DWDA 2NY5H 1KENL 1YEDB 2YS4A 5EOCH 4LLWA 1IL1B 2X1OA 1V5JA 2ESVA 3FRUB 1SVCP 1TCRA 1KCVL 3GBMH 3KPSE 3QEQA 3QCTL 2ZOKA 1HHKB 5DJXA 1AJ7H 1P7HL 3S8WA 3TO2B 3BN9D 3VXQA 5EBLB 1QVOB 2QQKH 5I8KH 3HAEG 3M8OL 3QIWA 1QLRB 3DGGB 2EKSB 3NCCB 3CDCA 4NRXA 2W9DL 1U93A 2Z4QB 3FB7A 1NGQH 2KH2B 3TVMA 2CIKA 4CVZA 4XPGH 5CILH 3O11B 4X8JB 3UYRL 2QJDA 4J1UA 3TA3C 3ESUF 5IMLB 3ZDXE 2G75B 1QSEB 3QUKA 4M9PA 2A74B 2R0KL 3RDTC 1MFEL 5IR1B 1BOYA 3TO4D 5EU4A 5E6IC 1TTFA 1GXEA 3GMMA 3L3DB 3B83A 1RULH 2EXWD 4G6FB 3SKOB 4LSTH 3BW9A 4XP1L 4OSUH 1JN6A 4KK8D 3GMNB 3VG0L 5FHBH 2E8YA 1BM3L 4G7VH 3TF7C 1S7TB 1A1OA 2HTLC 1G7JB 1M1SA 3EW3B 4X7TA 4DW2H 4PJHE 4WRLA 4EXKA 5TQ0L 2GI7A 5JDJA 2DTMH 3TJEL 3EDDA 3BJLA 2GHWB 3TYGH 3T65B 4JGJA 5IHZA 2UVFA 4FQCL 1MFNA 3JWDC 5FGRA 5C0ND 2F74B 2YKLH 3H3PH 3H9SB 4KGLA 1WLHA 2X4RB 4MDIB 4M5ZL 4OLVH 4S1QL 2BK8A 4N0CD 3OKOA 2Q7NA 1TJIL 4I13B 4KQ3H 5DDHB 3T3MF 1EPFA 1AR1D 5LWYL 4LKXB 1V7ML 3TN0A 2G2RB 4Y5XC 2H45A 4GRWE 1AHWC 2ZSVB 5E4EB 5DMIL 4WY7H 4L8BA 4LLUA 4HUXB 4ETQA 2JCCA 3KLSA 2VDLH 4JFPB 3SDXF 4IM8A 3QSKB 5MEOA 1JGDB 4I3RH 1KYOK 2YXMA 1Q0XH 1ROWA 2VNCA 2DL9A 5IJKC 5F8RC 2AJZA 4Z8FL 4M7LL 1L7TL 3IFLH 2NY4B 4NQEB 5DFTA 5ESAB 3N1QC 4M7ZB 2DICA 3HNSL 5F7KC 3X14B 4HKBA 2QSCL 3LV3A 2HAZA 2PUQT 4HFWB 3DMMA 7CGTA 1WQVT 4GAGL 3BZEA 3B3IB 1VADB 3SGDH 5GSRA 1UZ6E 2A83B 1Y6NR 4PTUB 3RWJA 3VU2A 1WZ1H 3STZB 5EZLB 2OTPA 5JQ6H 3F58H 2RR3A 2W9EH 3RHWK 1JPST 4KRMB 4GAJH 1N7MH 4HH9A 2E5EA 5BMFL 3IKKA 3QO1B 1I3VA 5FYKE 1MY7A 2KPNA 3DNKA 4PJXB 3BVNB 3UTTB 3RY5A 3HZMB 3DUUA 1OAXL 4QGTA 4XVJH 4YK4B 3OB0H 4N8VB 4Z5RA 3UPRA 3UJTL 5FOJA 3QI9D 1MJ7L 4J3SA 1MJJA 3JWDH 1H5BB 3NCBB 1KEGL 4LSSL 1R3JA 1IQDA 5BZWA 5C0EB 4JQVA 4NJ9L 1JHTB 4FMKA 3T8XA 3F7PC 3GUTA 3DO3A 5E2TL 2DYPB 4ODSH 4NO5A 3B2UD 1I75A 4BKLA 3EYUH 4YXHH 4X80H 3L95B 1OAQH 1KLGB 4GJTB 3X3FL 3C9NB 3VXRE 2MJWA 5EU3B 3BKJH 1IKNC 3KYAA 2B0SH 1URLA 1UWEH 2GSGA 2FATL 5GRJL 3SBWA 8FABA 3VXTB 5C9JB 3LKPA 1IAIM 4N5EC 4HIIB 2PN5A 5BVPH 4F37K 4PRPE 2GT9B 4POZC 4UV7L 3SQOH 1RK1A 2AEQH 2B2XL 2Z35A 2DOCA 4IS6A 2IPTL 4NQDA 5J89A 2D9QB 5EU6B 1AC0A 4XHQA 2X89A 1UM5L 3MRHB 1NC4D 2XZQH 2VITA 3NOIA 1MHCB 4MA1C 3TV3H 2NY1C 4KDTA 3IDIB 5HGAA 3GMOB 3VA2C 3W11D 3CU7A 4PJ8B 2VDNL 4OFKA 3QPQD 1AIFA 3EO1B 4NP4H 1DCLA 1A2YB 2Y9RT 2PCPA 1HEZA 4PD4J 3EYVA 3LEYH 1EERB 2XZCH 3WXVH 1WF5A 1UJ3C 4I5BB 4HWBL 1AXIB 3NVQA 2BZDA 3ZZ1A 1JPGA 4NZTL 4KZEH 4PUBL 4YGAB 3FO9A 3T4YB 2X1XR 3CZFB 2H32H 4UNVA 3ARQA 5INCB 1RURL 4ZXBB 5DJ6B 2OR8A 5HGBB 2BNQB 1BFOB 3IU4H 4XCNB 1ZOXA 5AWNL 4YAQA 3VH8B 4J3UA 5BZDB 3OGOE 3GSVA 1YPZB 2YMXL 4HJ0D 2EZ0D 4K3JH 1PZUB 5C0DA 4WI6A 3KLHC 3TT3L 2OXGA 4HLZH 3K3QA 4M02A 2YXFA 2CD0A 1EMTH 4G80A 2VAAB 4X6DA 1T7XA 1NANI 4QRTB 1FZMA 2Z8SA 3OJDA 5CGYD 4AEEA 1A7PL 3F7YB 2XN9B 3C6LD 1A7NL 5KZCB 1BFTA 4MQXC 1WC7B 4CADA 4X7SH 3VGGA 1YC8A 4UIMA 2WWMD 5J56B 5C07D 1UJTA 3OAUL 1BAFL 2O26U 1CQYA 3E0GA 3C5JB 2O5XL 4OGXL 1W72H 1NMAH 5C08D 1JV5B 4B0MM 4RRPA 2MQ0A 1N3NB 5HI4C 3WXWL 4N9GB 2IPKB 4UQ3B 3UYPA 3UTPD 4U6YA 4OD2B 1EAPA 4P5TD 3L1OL 4PJXF 1U6AH 1CFNA 1C12A 4NFDA 1I1AD 3QDME 1EIBA 5DJCB 4YHZL 3MRMB 3WUWA 1T4KB 1KIRA 3QWRD 2IAMB 4RAUA 5C0AD 1M05B 1A4JA 4ZO6A 3CFEB 3NFPB 3LEVH 4JREC 3OR7B 5J57B 4L8SB 3G5ZA 1LK3L 3ZDYE 3KAAA 2BCKA 4R3SB 4PP1C 1T3FB 5KVGL 2RIKA 5FKAA 1RZ8A 3WEXB 2GAZB 3K2UL 1F2XK 4OKVB 3QWOA 4UMGA 2FGWL 1JZ3A 3ESVF 2X70B 3WO4C 2C5DC 3O6FA 1S7UB 5MP6L 1F4AA 1INDL 3DOSA