3GB7A

Potassium channel kcsa-fab complex in li+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2009-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gb7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gb7A02
4UZGA 5EZLB 4U1IA 2GSIA 3R0MA 4F7EB 3TA3A 2AKRB 5DHVB 4Q9QH 4HK0B 3GSVA 3STLB 1CTNA 3QIWB 1CXFA 4LPYA 3UDWA 3B9VA 5MERA 2KBGA 3VFSA 2RCSL 3EOAA 3O6KH 5FOBB 3MLZL 4EZMA 3LKPA 1I1RA 4P46A 1D3CA 3H9HB 3SGKC 4Y2DD 1I9RL 5I8CB 5HYEA 3OKMB 4KRPD 1QNZH 4QHNB 5E5RB 3SGDH 4AEIH 3BPOC 4OQTA 1YYML 5ITBL 4F7CA 2BFVH 4OJFL 5T3ZE 3PP4L 3H9SE 3V5HB 2DN7A 3LS5L 4JR9L 1TNMA 2CLRB 3FAXA 3V52L 4HIEB 4WDIA 1CGSL 5GRVK 5KG9A 1LK3H 5D2LB 5INDB 1VGEH 4JJ5B 4LHUD 4JQIH 1J9CT 5JHDE 2LAGB 1RVFH 1G7LA 2J8UF 1ULVA 5J0BA 2CDEA 1Q8MA 1P4BH 5B3JF 3PNWA 5HHPA 4QRPB 3ZDYE 2JK5B 2A6JA 1H3XA 2VLJE 1JL8A 1XF3A 5EOTA 3WFHA 1U8JB 2YPVL 3NPSC 1UFUA 4HT1H 4RGNC 3SKMB 3OPZH 4NUGH 3V2AR 4ZFOB 3RU8L 4G6ML 1UC6A 1A5FH 1H5BA 3QEGH 5I76A 2FHBA 3BQUD 3JWOL 5I19L 1B4JL 3NPSB 1UZ6F 4RGNB 5GGTA 4LHUG 4RFOL 4DK6A 4PJEF 3LS4H 2Y07L 4N5ED 4U1LA 2F15A 1JMZA 5DQJB 3TT3L 3OX8B 1IRAY 1QPPA 1TETH 3U0TB 2FL5A 4TUOB 1V7MH 3WFEL 3LN5B 1NCTA 4WV1C 5T5NF 2BK8A 2O5ZL 4YHOH 4GKNA 1KB5A 2OR9H 4WVRA 3WHE1 4I2XB 4S2SA 3SOBL 4F58L 1K5NA 5IBUB 4WV1B 1QR1A 5JIPA 1U8NB 4XNQA 3ZKXC 5E5MA 5CIPA 3TIEB 5TQ2H 2JB6A 5F1IA 5C2BH 3TFKC 4C56E 4PJ7E 1GIGL 3MRIA 4OUUB 4A2MA 4M1CD 4ENEC 3HKFA 3B9KC 1KUMA 3LD8C 5DD5L 3ZKXB 2D9QB 4NP4H 4C83B 5ADPH 43C9B 3QXVA 4M5ZH 1AXTH 1GZQA 3I84A 3B9KB 4WY7H 2IAMC 1MFBL 2VDLL 2NX5A 3LD8B 1K4DB 3WS3B 4MXWH 2XWBB 4H1LB 4YPGB 2D7TH 3V8OA 4W4NA 4YZFF 1ZA3A 4EXPX 1EEZB 4QNPE 1DUYB 2UZYB 2IAMB 3KYNB 3BWAB 3G6AA 2NMSA 3FB5B 4I5BA 4KHTL 5BW7C 2DIJA 4M5YL 4FXKB 4U1JB 1SYSB 4MJIA 2B1AH 3L95B 4L29B 4N8CL 5T3ZD 1VESA 1XGUA 3H9SD 3ES6B 1HHKA 1RIHH 4DWHA 6FABL 1BF2A 4POYA 3THMH 1JPGB 4HUKB 4WW2C 2X2YA 3CX5J 3F7VA 5TQ0L 1URLA 4G6JH 3EOBA 5B21A 3CXHJ 2F54A 1LO2L 4LAQH 4WW2B 1GGUA 3T77B 5T1LB 1QFOA 1ROWA 2XZAL 4JCLA 2GCYA 3BO8B 1IQWH 3TO2B 1FH5H 5FECA 1RJZB 4PB9H 2KH2B 4PRHE 3GM8A 1BQHA 5D7JA 3WFBL 5K9JH 2ATKA 1DFBH 2VLJD 5DZNA 5EBLB 2OMNA 2EH8H 1FL6A 2IPTH 3EDFA 1JGEA 5SV4A 1UACL 1AQKL 4TOYL 3AUVA 3O2WH 4P4RB 3IU4L 4X4YA 2OMBA 4KDVA 3RHWK 2BVPB 2OP4L 3KXFE 1QPXA 2DDQL 4GW4A 5B22A 5HPMB 3EJYD 1LE9B 5F3HB 4L3CA 1S7QB 2DQEH 5E8DL 2CR6A 5D5MB 2VDPL 1FFOA 5FM5O 4M6MH 3OL2A 4GH7B 1U8PB 3CU7A 1KCVL 4QTHA 5GRJH 3D5OF 1HDMA 3N85H 1W0YT 5KVEH 3S88H 1ZVSA 3EFDL 3MUGB 4I48A 2H2PC 1VFAA 2VB5A 1NEZG 3QUKA 1B2WH 2BY1A 3MV01 2C4FU 2R15A 2VDMH 1S78C 4RAVB 1A7OL 3GHBH 2EDHA 1E4WL 1L0YA 4J6RH 1L9MA 3Q6GL 3TYGH 5CSZA 4DKFL 1IGML 5FK9B 4OD2A 5SWQA 5FUZH 3SDYH 4C56D 2ZPKH 1A7QH 4YPJA 2F19H 1F3DJ 5DC4B 3VGDA 3ZLQC 3K7UA 3QG6B 3MODH 5CKGA 4R3SA 5I73C 4X80H 2BCKA 3FB7B 1LP9A 5DEGB 1NKRA 8CGTA 4BQCA 2PCPB 5BZWA 4NQUA 4JANB 1HXYA 2D0HA 5I73B 5CJQL 5AYQA 3DV4B 1AGBA 2VN4A 1YJDL 1I8KA 4XVUC 5I1HH 3IJYA 1T1ZA 1PKQA 4WEUD 1AP2A 4M7LH 5D2LE 4JQVA 2XKNA 2ZUWA 4JFZL 5F8RC 3HZKB 2SEBB 4MAUH 2R0ZH 5KVMC 2V7HB 3W9EA 3K4ZA 1GGYA 1KENL 1DQMH 5F7EH 5IK3A 4QRPE 2HG5A 4Z7WB 4NM4H 1NUNB 5K9QG 2IJ0C 2P5WA 3ARYA 4L3AA 2F8OA 4R4BA 1IC1A 1TVHA 3LAFA 5TDOB 2VAAA 3QXAB 1MVFA 4JG1L 1ZT1A 1QSFA 2Y7QA 3BDYL 4OB5H 2BRRL 1BQLL 1N6UA 3PHQA 1MUJB 1LILA 4Z78A 4RGNE 4Z6AT 2J8UA 3BUYB 4QY8A 1T7YA 1ONQA 4Y5YA 3RKDD 4P3DB 4OCXL 1OLZA 4NO0D 1U6AL 4YX2L 1PG7H 5CEYB 4NZJA 4PRHD 1F42A 4RAUB 3KYAA 2P5EB 1JNLH 2I9TA 2J6EL 3AS3A 2JELH 4PREB 2FATH 1YNTA 3FN0H 3MXVL 1YEIH 4K7PH 4UU9A 3V4PL 5LQBL 1HH9B 1F4YH 2XG4A 3QEHA 5BS0A 1SYVB 3RWJA 4XP6H 3LMJH 4FZ8H 3KXFD 5C0BA 2G5RA 2XYCA 5EA0L 4KKLD 1RURL 4PJEA 1NCCH 1JNHB 5LXGH 3N0PB 4PGEA 4Q2ZB 2YD1A 3PWLA 4L4TB 4FQIH 4XXDB 1UCBL 3LZFH 3CUPA 3QZWB 1YNLH 1Q9WB 3WIFA 5FB8B 2R2HA 3UAJC 4LLQB 4M7JL 4WWKA 3U82B 4AENA 4QT5A 1MQKL 1NGPH 4KVNH 4KTDH 3OB8A 3HI1B 3TVMA 4O2CA 2X4NB 4L8SA 2YN5A 2AERT 3QIWD 5D7IB 4QWWC 5SWSB 1OQXA 2YUXA 5DQ9A 2N4IA 5D2NC 2H3NA 3SDXB 5JQHC 4YHMH 3IGAA 3BXNA 3KPRB 5FKPA 5C0CB 2V2WA 1FYHB 1IC4L 5D72L 2QQLL 4GG8A 3MCLH 5D2NB 2Q8BH 4I8DA 1VB9A 4A6YA 4XP5L 1NANH 1UB5A 3IRZA 5C0DA 3VFWA 1BWMA 4GXVH 5HHXL 1WWWX 2A73A 1X3DA 2RR3A 3GMQB 3OMZA 1ZGLB 4WNQB 3T2QA 4Y4HC 4WCYL 2ITCA 4PR5B 2EDRA 1KIRB 3G9AB 4QRTB 3W5NA 4ZUWB 1B9ZA 5GGSY 3KPNB 2P47B 5L9DH 1OD9A 4NO3B 1QHOA 3CDYA 1MAML 4U4BA 2P1YA 1RZJL 4JO2H 5C0EB 4DUXA 15C8H 1CFBA 4QRPD 1G0DA 5EWIL 5DRNA 5TDNB 1WT5A 5D9SB 5M95B 4DUWA 1IE5A 2GY5A 2HN7B 4W6YB 1WAAE 1M6OA 1P7KA 2HT3C 2Q76B 4ZUUA 4CMHC 1CD0A 4QXUH 4X8JB 3ZKNC 3HZVA 4KKBC 4LSDA 4ODHH 1CF8L 3HTLX 1MCLA 4EOWL 4BSWA 4RGND 1T04A 1T20B 3L9RB 4CMHB 4ZNCD 4F9LA 1QEWB 2X70B 2XY2A 4YHZL 5KTEL 4X7SH 5D5ME 4EBQH 3VE0A 3VFMA 1S7WA 1T2JA 4HWZA 4AM0B 2XRAL 4ORGB 1CDIA 4DGVL 3S96A 4X5WA 2W65B 1MVUA 4JDVB 4KGLA 3QQ4A 1LD9B 2B5IC 3CMOL 5IROC 5TE4L 5DMKA 2J12B 5FGCB 1FVCB 2X44D 1RZ8A 4LOUC 1MCWM 2WLZA 2DTMH 1IAKA 2B5IB 3D2UB 5GJSL 3VG9C 4U7MA 1OSZA 2X4UA 1F4WL 1CDYA 1CZ8H 1MCCA 3S36H 4XPAH 1ZANH 4X6FB 5L0QB 3O11A 3LQZB 3Q3GA 1YMHB 3VG9B 4XCCL 3DRTA 2E7CA 3IRPX 1ZHKA 1CDJA 4QRUA 1U3ZA 3G6JF 4PJAB 1MWAL 4YHLH 4ENED 4Z0XA 1P53A 3QPQD 3B9KD 2W59A 4ZO7A 1GOGA 3BZFA 1YNKL 3MV8E 4N0UA 4XC3H 3AU1B 1MIEL 1QVOB 2BVTA 4P2QA 2YS4A 3ZE0F 3IKCA 4JFFB 3BT2H 4LGSB 3D0VA 2IAMD 4L1HA 5C0JB 4TPRL 4M02A 4W70A 1A7PH 4CL7A 5HDQL 4FQQB 4MHHI 4ZUTA 4CADB 2O61B 3WXWL 4Z7UA 2YD7A 4OGAC 1Q72L 5IW6A 3SCMA 2YD5A 3AMLA 2ADIA 2QSQA 1H3TA 5INCB 2R23B 5CJOH 4AQOA 3I3DA 1T0NB 3UTTA 3OXRA 4OM0L 4OZFB 3SDAC 5ANMB 1HIMH 2VZOA 5F70A 3MLVH 1EEUA 4NQCA 1OARH 5L8JB 3CVIH 4IRJA 4L4VA 3TCLB 2H9GB 1ZTXH 4FQ1H 5KSBB 1IKNA 1JV5B 3I2CL 3EDJA 4N9OB 3SDAB 4MD5B 3TNMA 5T1LD 3MNVB 3VXMA 1QBLH 5EO0B 4U6YB 3RVVC 2W0FA 5F6IC 4NWTL 4QRRB 2P5EE 5AUMA 4HUWB 2VLRA 5DD0H 2CRYA 3M17B 2A74B 2ZSVA 1MLCB 4H5SA 1KFAL 2AI0H 1CFTA 5F6IB 3EO0A 1JUFB 3OBAA 2BNQB 4WHTB 3F5WA 3IETA 1CU4L 4WI6A 1FVEB 1XT5A 3GSQB 5I8OH 1AGFA 5CCKH 3UTSA 1MFDH 3SO3C 2E8ZA 2QV2A 1ZEAL 2VE6A 4LLDB 3C9NA 1MHCB 4OCNC 5MHSE 1OWWA 3WUWA 4L4TE 1TLKA 1X5YA 2EE3A 1WBYA 4GRWF 4TNVF 3SO3B 4LBEA 1G9NL 3RZCC 3WLWC 4JFPB 4ODSL 2MWCA 4E41E 2BNRA 5ICXB 2J88H 2YMXL 1FE8L 2CUHA 4Y5VB 2F74A 2DQDH 3RZCB 3U83A 4YNYB 1N26A 2RIKA 1MREL 5D7IE 5TJWK 4L1DA 1T21A 4KPHL 2A83B 2XQBL 3GMMB 1S78D 3SDXE 4DOHB 5IMMA 4UQ2B 2VLLB 3KPRE 5C0CE 4YDVB 5L7XH 4QHKI 5D2NE 1UH2A 5DGQA 2YBRB 4YXLH 4O5LL 4Q9BA 3RBSA 1Z5LA 3A0OA 1KCLA 3P9MA 1I9IH 3GBML 1R3IH 3BIKA 2KZ1B 4QGYA 2NY5C 3ETBF 5DC9B 5FGBA 3DX6A 4OFYD 5IM7A 2R1YA 4FHBD 5JOEA 5EZIH 3STZB 4PTUA 2YPLA 4XVUD 3K80A 3WD5H 3IJSA 4ONOA 5HGAB 4ZTPH 3KPPA 3C6SA 4FQLH 4FA8A 4NC2B 4L9DA 3RGVC 3PWUB 4K3DL 3B43A 5E6ZA 2AJ3B 7FABL 4U49A 5F21B 3OKKA 4R7DA 3WDIA 3SE4C 2CPCA 3C2SA 3QH3B 3RGVB 1G7QB 2GAZA 4MD4B 2O5YH 4J3WA 1XGYH 2OTWA 1MCEA 5E08H 3BP7B 4UOJA 3DSNA 5IOPA 5J6HA 3EGSA 3MRNA 5D1QC 2P5ED 1KPRB 3BKJL 2Q86B 3LQAH 4M61B 1LWRA 5DYOA 1PDKA 2UYLA 4LLYA 1P2CB 4LDOB 1PBYA 4OT1L 5FGCE 4D8PB 5BMFH 3HFML 1S9WB 1H8NA 3OF6A 5D1QB 1JHLH 1I1YA 2ESVA 1EMTL 4I77H 2XWJB 2A6IB 4XXCC 3KLHC 4DGIL 3MNWB 2JJTC 2OZ4H 4NM8H 2YK1H 3MUHL 5MHSD 3MACL 2F5BH 4L4TD 3DVNB 4KDWA 2BERA 3BMVA 3HUJA 1XF5A 3QIUA 1FV1B 1X5XA 3ZHKA 1BZQK 3QG7H 2WQ8A 3HPJB 1XCTA 3O3AB 3DUUA 4PJAE 3JSSA 4LCWB 1XEDA 3IT8D 1A47A 4JVUA 5JPMA 2PKDA 3UAJD 4JHBA 4G9FB 1QQDA 4M1DH 2VDKH 5SWSD 2ZSWA 5FUOH 4Z5RA 4JFFE 12E8H 3KPMA 2OTUA 2UUDK 1E4XH 3RX7A 2EIZB 4QWWD 4AEHH 1FLRH 3L3GA 3KPRD 1ZE3C 3B6SA 5C0CD 4GKSB 1S9XA 3G6JA 3OR7B 3T0EB 5IB5A 2F5AL 3LN9A 5CHNB 4G3YH 1J0JA 4GXUM 3EAKA 4R96A 3MNZA 3MRGB 5ANME 4HUMB 1LO0L 3PHOA 1EDQA 4Y16C 1U58B 3KPLA 3D85B 5KSBE 5JXEC 2V2XB 4LCIH 4UV7L 4ONFL 4R2GB 4CVXB 4NGHL 4HIJB 3QI9A 5F71A 1OB1A 3H3PL 2X1QA 3DRQB 4MNGA 1SJEB 4PRPE 2WUCL 4JM2F 3HG1B 4JDTL 4QRRE 1U91B 3SBWC 3N1GC 4O9HH 3FB8A 3FTGB 4P23C 5HGBA 1WEJL 1EFXB 2OSLB 3H2WA 3O3DA 4LSRL 4D3CH 3GSNH 4HJ0C 2BNQE 1CLYL 3FT2A 4YDIL 3TH4T 1LEIB 5ID0B 4R0LC 2P8MB 1NSNL 2Y06L 2FH8A 2IQ9H 3MA9H 3L1OH 5D1ZC 3OZ9L 2HT3D 1H0DA 3ZKND 1HI6B 4R0LB 4FMKA 4KKBD 1KEML 5JHLH 1SEQL 1UXSB 2J6EA 3AY4A 5D1ZB 1JGDB 4XH2B 2G2RB 5ISZA 2OQJB 4TUKH 4GAJL 1OT2A 3VFGL 1N5YL 4PD4J 1JZ5A 1J8HA 2IH3A 3ZE2E 4IJ3C 1FCCA 1RJYB 3NABL 4FFZL 3G08B 1FNSL 2AGJL 4UNUA 1FO0B 2Q3ZA 1HZHH 1VADA 3R1GL 3V6OC 5F89A 1HQRA 4HX1A 3CXDL 1INDL 2AJUL 1OAUL 2DQFB 3D2UD 4IJ3B 5DD1L 4JFYA 2IMNA 4LOUD 3KS0J 1U8IB 3CFJA 4DOHE 5D71H 4HPYL 3NIGE 2RBLA 4U0QB 5EC2A 5EUKB 4F57H 1OAZH 3C8KB 3U0WL 4XPBL 5GS2D 2I25N 4LF3A 4JRYB 5FA4A 4ZSOA 2BC4B 3T3ME 1Q9LB 2DBLL 4GKZB 3HR5B 3GMLA 3NACL 1FJ1B 2H1PH 4HUUB 3V0AC 3QHTC 4PRAA 2VXTH 2YA1A 1J0KA 5BVPL 5C2UB 1U8LA 5J6GA 4JFFD 4IIQC 4M00A 5DQDH 1D5IL 35C8L 2NY4B 2R69H 3T0BA 2ICWI 2B2XH 3IAQA 1J1PH 4UDTB 4XHQA 4ODXB 4MSWB 4NDMA 3M1BB 2BSTB 4JVWA 1R3HB 2JIXB 5MEQB 3U1SL 1NGYB 4I0PA 1N3NB 2V9TA 1A2YA 5I1EH 4OGAD 2EKSA 2BX5A 4EIZC 1KXQE 1A22B 5AZ2L 4AEFA 4HIIA 5DVKA 3GKWH 3OR6A 3I6GB 1WZLA 3U6RB 3E8UL 5DJ0B 1QSVA 4AL8L 4GG6F 4XNUH 2PO6A 3HE7C 1TCRA 3SDAD 2YSSA 1G0XA 2AJXH 1QZ1A 4O2EB 2Z92B 3QEQB 3UBXG 2P46B 3QULB 4NT6A 3S3PA 4D9LL 3MLTA 2E6JA 1UCTA 1LK2A 3QHFH 1RUKL 4QRRD 3W11C 3HE7B 3QXWA 2VZVA 1HOCB 4U33A 3GMNA 2X10A 4NUJA 3RVVD 1HHJA 3P4OA 2BNQD 4YO0B 2BVOA 2WP3T 5I74C 4HXBL 3ROOA 3ILPA 1VACA 4FZEH 5HBBA 5KJRH 3GNMH 3RWIA 4DKEH 4OV5B 1EJOL 4OD1L 3B83A 3T1WA 2FGWH 1FP5A 5I74B 4GFTB 3IU3B 5CZKA 2IBZY 5DUPH 5IFJB 1JZ2A 3WS6C 3KHQA 1BEYH 2NW2A 3KPTA 1XCQA 2YD4A 1YYLL 4OFIA 5EU5B 3GHEH 4HJGB 5J9PA 5IJKA 4DW2H 1YEJL 4G8IA 2XFXB 4HGWB 3RZCD 3WLWD 4G9FE 5JO5B 1JN6A 1BZ9B 4GT7A 3S5LA 4K3JH 4PUBL 3MFFB 4YHIB 3PF2A 3F58L 1NH6A 2VC2H 4Y2DA 1UJ3C 3WDJA 3ZT7A 5FXCH 2C1OB 1TTGA 1G9EA 2H41A 1MWAA 2BOBA 2VQ1A 1A7NL 1JF6A 4ZXBC 1MJ8H 1CD1A 1KJMB 3QCVH 4UIMA 1UJ3B 3AS2A 4AJ0A 3BKCH 3J8F7 4HW6A 5CJBA 1K8IA 4B7LA 1U42A 5DC0A 5EPMB 4ZXBB 3CZFA 4ZS6C 2WINB 1FGVL 1CE1L 1FAKT 3BPNC 4J1UB 4OZGB 4FQ2H 4JY6A 1CLOL 5A16A 4OLUL 1CK0H 1ZLUH 1F97A 2ZG3A 3RTQB 1X6NA 1FZOA 5E8EB 3ORJA 1KEGL 3BPNB 1D5MA 1VDGA 5L2JA 3FHQA 4RFEB 1GOHA 4EDWL 4DVRH 2BHZA 2IC2A 2BP3A 3HG1E 1IC5H 3LH2L 3LKQB 1FNGA 3VJ6B 3K1DA 1RHHA 4OFDA 4HBCL 5DHYA 4HC1L 2NPLX 4N90E 4U6VL 1CTOA 3SKOA 4M43L 2DQUH 2P45B 3BQUA 3FO0L 2X4SA 5C0AB 4LKCA 2EYTB 3RWFB 1VFBB 2X9YA 5FDWA 3RGVD 1HN1A 4R7NB 3MRLB 4OSUH 4UTAL 4N8VB 4JM2A 3V5KA 1DN0A 3ARFA 2QL1A 4POUB 2L7JA 1I3RA 5DFVD 4M7KH 4CDHA 1F02I 2PYEA 5C6WH 5JUEH 4AH2B 1CS6A 2CGRH 5MEPA 4YEFA 5KS9E 4P5MB 1FBIL 5GGRY 4ALAL 4ZNEA 1JWUB 4HEME 3JWDL 3C5ZC 3C60A 5D1QD 3UTZA 1T3FB 3HI6H 4OZ4A 3S35X 1ZV5A 3DXAA 1ACYH 1A1OB 3LVEA 4QKXB 4B0MM 4K23H 4D0CA 5E8NB 3C5ZB 3CX5K 1JPSH 4NZDA 5F9OL 4ZDHA 4LSUH 3D9AL 5H35A 2GTZB 3V6OE 3VH8A 3CXHK 5DUBB 1UG9A 3KLHD 3WO3B 1AJ7L 4JKMA 4JRYE 1TZHB 3GJFB 4UOW1 5IG7B 4MQ7B 3VXRB 4LCWD 1XGTB 1UGNA 2YC1B 1G7JA 2E6PA 5L88H 3ZT5A 1YUHA 1YPZE 4POZD 4PY8J 2FEDC 4G9FD 2R1XA 5I16A 4YEEA 1HKFA 4JGUA 4L8BB 3OKDB 4R90H 2X05A 1EHXA 4MDJB 2VDRL 4PG9B 3L5JA 5EIQA 4RWYL 3ULUC 5KSAA 2CKBB 4YLQT 3IDJB 1XGPA 1GSMA 4QTIH 3RJDA 5C92A 3IDNA 1IBGH 1BBJA 4BM7A 4LGRB 1SBSL 5FO7B 3BEVB 2YR3A 5E2UL 2LTQC 1F58L 1NGXB 3V5DB 3V95A 1S7RB 1X6LA 5C08E 1OW0A 4FQPA 2QHRH 5B39G 1SEBA 2FEEI 2LQRA 2LTQB 3UPRB 3FO9A 4WEBH 3BJLA 4G9DA 3D85D 2CUIA 4R2GD 5I66B 1TTUA 2X4PB 2K7PA 2E27H 3QEQE 3VMPA 4DGYL 4XX1E 2A77L 4EQ2A 2MOVA 1W0WA 1G6RH 3L5WB 3TP4A 8FABB 4TQEL 3OKNB 5IT2L 2DF3A 1SM3H 5JXED 1QUNA 3HG1D 5DDHA 3QO1A 1EFXD 3MXWL 5J3HC 4XT1C 1OWRM 4N90D 4O51B 3DURB 3QWOB 1IGIH 4P48A 4X6DE 1N6QL 2FWOB 4MB5A 4P23D 3VFVB 4Z95L 3LEVL 2CMRL 2UZIH 1TVBB 4IBLT 4GG6A 5FA3B 1PSKH 4HJ0D 2IALA 5DS8A 4LLUB 4XVSH 3QHZL 4K3EH 1MAJA 4PGBB 3OAYK 3W82A 5DA4A 5D1ZD 5T1KA 2Z4QA 3HN3A 2OJZL 1EEQA 4IHOA 2Z8SA 5F9JA 4C4KO 5TFSH 1A7RH 1BFOB 4YBLC 2WANA 2CK0H 1IQDB 5BOZG 1MJUL 1S7TB 4HS3B 3V9FA 1AI1H 4JAMA 4OF6A 1DN2A 4HDIB 4XPHL 4XWGL 2CUMA 4YBLB 4GAGL 2D0GA 5IHZA 5HD8C 5JORA 1JZ7A 3IFPB 2V9QA 3TO4C 4LCUB 1M1SA 5IKCA 5IHLB 4ELMB 1A4JB 5GGVY 4PPTA 4ODTH 4JRYD 3VXNA 3UYRH 5HJ3A 4DAGL 4OLZH 4MAYC 1NL0H 1CIUA 3C6LC 3NFSL 4LCCA 1GAFH 1F5WA 2ARJB 4XNXH 4HAFA 1R3LA 3MLWL 3WFZA 2EDTA 3C6LB 4OZGE 1XGQB 5B38B 1HWHB 1WQVT 1I8IB 2NY4D 2EC9U 3WV0A 3MREA 4XBEL 3SDDA 4WO4C 5IHUH 2YWYA 2E9JA 4MJ5B 4WFED 5D6DA 5I1CH 3W39A 3BSZL 2JIXD 5C3TA 1TDQA 3WKNA 5J06A 1VKXA 1NCUA 3OKOA 2FX7H 2OCFD 1DEEB 2EEAA 3ZSTA 1KCKA 4WU7B 2BY3A 3V4VH 4IRZL 5IB2A 1LVEA 3B5HA 4XWOC 1DVFC 3E6HB 5GGQH 4LLAA 4D2NA 3HMWL 4L8DB 2XA8H 5ESVB 5F1NA 5C0AE 1F4XL 3IXAB 4D0BA 1BWWA 3L3IB 1C5BL 1EEYB 4IOIA 3SE3C 4JY5L 1I85C 1DVFB 4NO0A 1YECL 1YEKH 3AAZA 3ESUF 3QEQD 5FYJH 5T3XH 2OTPA 1I7TA 4RMWA 4G42B 4KUZH 3V6ZA 2HLAB 2JCCE 1WJ3A 3HE7D 1F3JB 1QFHA 2GFBA 3G6DH 4WJ5A 4EUPH 2BMKB 1KULA 3SKNB 1HSBB 1AD0B 3SDCA 4XHJC 3KXFA 3LKOA 5EIIB 4JN1H 3QNXB 1INQB 3AB0C 5EUOF 4KC3B 2VDOL 1Q0XH 3ULVF 3HZYA 1FDLL 1ERNA 1DE4B 3HMXH 2AV1A 2GJJA 3LSOA 1Q0YH 3NCCB 3O4LB 3AB0B 1CFQB 5JNYA 4UUJA 2DJSA 4K94C 1UQSB 4X4XB 3TEUA 3TJEH 3VDCA 4TVPD 3F6IA 5EZLA 4ETYA 2ZNXA 4F7EA 3VXRE 3TA3C 5DLMH 1P9MA 2HFFA 3U0PA 2WZPD 4O2FB 5DHVA 4HK0A 3STLA 2R29H 3EBAA 3UDWC 4PJBB 2GSIB 2EXWC 5FOBA 3TA3B 3H9HA 3WDHA 3GSVB 4RRPA 4I3RH 4ZUSA 5I8CA 1CFVH 5MERB 3VFSB 3REVA 5I15H 3OKMA 4QHNA 3ARTA 4H0HB 1RPQA 5LCVH 3LKPB 1WZ1L 1KCSL 3IXTA 4S1RH 2MHAB 4LFHD 3RVUC 4LSVL 3ULUE 2R4RH 3SPVA 4Z7WF 4RGOL 4PS4L 3V5HA 5AZEL 1ZGLP 2CLRA 2X1OA 4HIEA 2DKSA 4MX7A 5HYJA 4ZXBD 2LVCA 3AXLB 2OK0H 4QHLA 1MI5A 4OLVL 3VWKB 4JJ5A 4N0RA 3F8UB 1ETZA 1Q9KA 4WDIB 3RTQD 1EZVY 4ZS6D 3ARZA 3RNKB 5SV3A 3OSKA 4KK6C 4FQCH 1KIUA 2JK5A 5HDBF 4HJJL 1KCUH 1NEUA 5T33H 4LFHG 1VPOL 2CDEB 1MEXH 3KYOA 4NO5A 1AD9A 1DUZB 4YFDB 3BPLC 3SKMA 3EO9L 4XGZB 4HD9A 5HHPB 1PY9A 2AXGB 3L5XL 4PJ9C 1H5BC 2IG2L 1XF3B 2XN9A 1JZ6A 3WFHB 1P6FA 3NH7L 5C0AD 1SMAA 1W72L 5J11C 5D8JL 4MCZB 4JRXA 4N8PA 3TV3H 4PJ9B 2Y36L 5I76B 4JFEB 1Q94A 3PWNA 4NOFA 5DQJA 1A8JH 5J11B 4P9ML 1OAYH 4CNIB 2Q87A 2GW5A 4TSBL 5DJ2B 3RWDA 3U0TA 2ZP0T 4TUOA 2DQGH 3TBYA 1J1XH 3ARGC 3NTCL 4I2XA 1K2DA 4OIIL 3DO7B 1NCDL 4PJIB 4LVEA 2FL5B 5C9KA 3X3FH 1KB5B 3ARGB 3I6LE 1MJ7L 1FZJA 3TIEA 3C5ZD 3JV6A 4BZ1L 1V8HA 4N8VG 4XNQB 3O45B 3IFLH 4GBXB 4ELME 2I60L 4XPFL 1JE6A 2I27N 43C9A 1R3KB 4PJXF 3VXRD 4QLRA 1W0VA 2V17L 1FAIL 1K4DA 4XMKH 4JQXC 2XWBA 1KBGL 2VUOA 1IGCL 4YPGA 1A02N 3RL2A 1D5ZA 4LARH 5HHOB 4G8FA 5TF1H 1DUYA 2IAMA 3KYNA 2EE9A 3RWCA 4DTGH 1GGIH 1BMGA 3MLRL 2FEDD 3DSFH 3NIDE 1NAML 5DWUH 1SYSA 5BZDA 2HTKC 4CN6A 3G6AB 3RIAF 1C7SA 4G7YL 4DN4H 4L29A 1A1MA 4LSTH 4I5BB 4YUEH 4HS8H 4J7RA 3ES6A 3T3PE 1MCHA 2HVKB 4M1GH 3GSXB 4FNLH 4U1NB 1KXVC 3L7FA 3INUL 3NFPB 1HSAB 2P48B 1RJCA 3VDAA 5JOPE 4YDKH 1XGUB 4V2CB 1HHKB 1IM9B 3KG5A 4WW2A 5K9QI 1UKTA 3T77A 5T1LA 2ICEB 3UO1H 3LRSB 3TO2A 1RUMH 2LE9A 2H26A 1I9EA 3EOBB 1RJZA 4X83A 1QFWM 5D7JC 2VN7A 1IC7L 2J4WL 2GCYB 4HC1A 5IVXF 5D1XA 4G7VH 2D3VA 4NQTA 1WAAA 4JM4L 3VGAC 3RUGB 1CDCA 4UILH 4XVTL 1BQHB 5D7JB 1GXEA 3BRDA 3GSRB 1RK0A 5IBTL 1DBAL 1FORH 2BVPA 5AG8A 1FL6B 1QO3A 5HPMA 3VGAB 4N5UA 4P5TC 4KUCD 1PY4A 5J3HD 1P4LA 2R0LH 5K59E 1S7QA 5C0FB 4X4YB 1TJGH 3MJGX 5D5MA 4KAQH 3UTPE 1DQJB 3U9PL 4GW4B 3O4LE 1BFVL 1U8KB 4P5TB 4OF0A 3C08H 2ZKHH 4L3CB 2WV3A 3IDMB 3ULVH 3QP3A 1FFOB 4XZUB 3FB6A 3MROA 1OPGH 4QTHB 5KSUB 1HDMB 2MQ3A 3F12A 1MH5A 3LS5H 5JDJA 1N8ZB 1UM5H 4I48B 4RAVA 1VFAB 3ECBB 4KI5D 3QUKB 4PJBE 1OSPL 1I9JH 2EECA 3SKJL 3BE1L 3WMSA 2B0SH 5TE7H 3P0VL 3C5SB 2HKFL 1RZKC 3F6LA 3RY4A 5HD8D 2Y72A 4OD2B 2N7BA 5GS0H 3JVGC 1S7VA 6CGTA 4HH9B 4NKMA 5E2VH 5JW3H 2Y5TB 1NUGA 1WBXB 1V7NL 2CIKB 3MRCA 3DV4A 1JNJA 1BVLB 3RVTC 4DVBA 3C6LD 5J1AA 4KXZI 1Q1JL 1EERB 4OFYA 4YK4C 3BPCA 3HZKA 2SEBA 3KLSA 3W5MA 4RFOH 1I8KB 1LHZA 1KJVB 1T1ZB 1FIGH 1PKQB 4YBHA 3GI9L 2V7HA 1BZ7A 1UZ8A 4YK4B 2XKNB 1NLBH 4K71B 4Z7WA 1M05B 1JI1A 1ZAGA 3WFEH 1FYTB 5TDOA 3QXAA 5E1AA 4X9GA 2HG5B 5KBNC 5DVMA 1L7IH 4GJTB 3SOBH 5JOPD 3VFPB 4MZ3A 1I3GL 4RA3A 2P5WB 3LY6A 1MUJA 4R6UA 2K9UA 4OLXH 3U2SA 3DV6B 1X4XA 1ORQB 1FPTH 4XC1H 4P3DA 4XWOD 1TJIL 1DVFD 1BM3H 4Z7VF 1ZVHA 1JPFB 3FONB 5CEYA 5HVFB 4GMSL 3PHQB 4OUOA 4K3HA 4RAUA 3VXSB 4BH7B 2J8UB 1UT9A 4RX4D 5BO1L 1ONQB 5DD5H 5IVZB 1ZLSL 4S1SL 3QCUL 1B90A 2LAAA 3QCTL 1X5HA 3RPKA 3HC4L 5CP3A 4CU6A 5C6TH 2I9TB 1SYVA 1A14L 2I5YH 1TTFA 4PJIE 1G0YR 1IFHL 2EDEA 4KK9D 3K2UL 1O7SA 1C1EH 2CO7B 3Q6FB 1JNHA 1MCDA 3QEHB 5BS0B 4XHJD 3UTPD 1AR2A 4XXDA 3O4LD 1SVCP 4PTTA 5A2KH 3QZWA 2LU4A 1Q9WA 4PJEB 1BIHA 5FB8A 5I1KL 4M5YH 3HLAA 1N64H 3PWLB 3HRZB 3QEUB 2DICA 4YR6B 5LBSH 5ILTL 1T2QL 6FABH 3BVNA 1HXMA 4I9WD 3VXOA 3FMGH 3TVMC 1IAIL 3EOTH 3HI1A 4OM1L 2X4NA 4D0DA 5D7IA 4AENB 5SWSA 1U3HC 5HHOE 3WFCL 25C8H 5AWNL 1QTYT 4OGXL 3TA3D 4MWFB 3O0RH 5I0DA 1LGVA 3TF7C 1C08B 3ARUA 2X9XA 4OCWL 1U3HB 4N0YL 3ZDZE 1BIIB 4HPOL 4JO1L 3N9GL 3UC0L 2EXWD 2MPAL 5CILH 4HAGA 2H3NB 4FS0A 1FG9C 3IGAB 5I8KH 4LVOC 1N59B 4UT6H 3GMQA 5FKPB 1UACH 4NQDA 4PD4K 4WNQA 5ADOH 4O00A 4APQC 2YEZB 3RVUD 3GGWA 1YN6B 5ITFB 1KIRA 3WFDH 1RUQL 4P5KB 3ET9F 4LVOB 4QRTA 1UB5B 2VJXA 5C0DB 3VFWB 2ERJC 3VWKD 2A73B 1LEKB 3KPNA 2VXVH 4BUHA 3NPZB 4NO3A 4APQB 3QWQB 4JGJA 2D7MA 5E8DH 5A2LH 3C2AH 4MNHB 4GRLB 2AJYL 1J0YA 4X9IA 2ERJB 2ZCHL 43CAA 5C0EA 4LL9A 5EOQL 1KCVH 1INEH 3X13B 2F54E 5IW3A 5D9SA 3V0VA 1IGJA 4NNXA 4P57B 3EFDH 3V6FB 5HGHB 3ZTJH 4KK6D 4O02L 2Q76A 4IM8A 4B53A 2VXQH 5DRNB 3KVQA 4FTVB 1A3LL 1M6OB 2QADC 3L9RA 3GEWB 4ZUUB 3LEYL 2AQ3A 2X70A 3ZL4L 1IGMH 4PJ9D 1MPAH 3BDXA 4G8GB 4JFED 1T66C 4BSWB 3CLFL 4AM0A 1IT9L 2FX8H 4ORGA 2QADB 2C3HA 1AGEB 5C1MB 5IVXA 4Z7OF 1OM3L 2DLFL 3QPXL 3V79C 1LD9A 3VGFA 2MCPL 2QLVB 1V3LA 3VFMB 1S7WB 2EDJA 3D25B 3FCTA 4TVPL 2GY7B 2UY6A 4HWNA 1MVUB 1FL5A 5HHME 1XR9B 5DMKB 3D2UA 3ARGD 3LKSA 1IEAA 5LGHL 4YAQB 4PJGF 1IAKB 3UROR 3BZ4B 4X6CF 4X6FA 5BV7C 4MJ4A 3LQZA 2F9BT 4GBXD 1YMHA 1OSZB 3U9UB 5TH2B 4OGYH 3OJMB 4PJAA 5BV7B 3O11B 3QFDA 2X4QA 4M03A 4GLRI 1CGUA 2XZCH 3DRTB 1FVDA 3V6BR 4QRUB 1LP9E 5HHOD 3BDYH 3AU1A 2BRRH 1WTLA 2IGFH 5JPNA 2AJVH 5C0JA 1KJ2H 2OX5A 3BZFB 3BP6A 4Z8FH 2C1PA 4FQQA 4CADA 1A9BB 4OCXH 3QDGB 4F33A 1M71B 2NZ9C 4P2QB 3UJTL 1PKQE 1QRNB 3IKCB 3SCMC 2NY7H 1E28A 4ZUTB 3VXQB 4YXKL 1M7IA 5E2WH 4F2MB 1FYTE 1JPST 3SCMB 2DD8L 2HTKD 4OZFA 5ANMA 3SY0B 5CUSH 1V05A 1EBAA 2PETA 5C0IB 4TNVK 5C7XH 4IRJC 1IM9D 2P5WE 4FP8L 3JUZA 1IKNC 3IDUA 1JV5A 3I9GH 3SDAA 4MD5A 3MNVA 1GGBL 3X12B 5EO0A 4U6YA 4IRJB 4PGCA 4XVJH 5BCAA 3H9ZA 3VXSE 3H9YA 4MB4A 2J8UE 4XP1L 3M17A 5LVEA 2A74A 3KAAA 1RD6A 1MLCA 5B3JE 1WICA 1JUFA 4WHTA 2BNQA 4B7IA 1F6AB 3WXVL 5D7JD 3KR3L 2P8LB 3JWOC 5AUMB 4AG4L 2CJUL 2VLRB 1FVEA 3GSQA 1W72A 2FD6L 2ZSVB 2D7QA 4H5SB 3WSQL 5DGRA 4HZLB 2R8SH 3F5WB 1HNGA 2JB5L 4FFYL 4Z7VA 3REWA 4PGDA 5GRUL 4LLDA 5BS0E 2Q7YA 1A6WL 1UZ6E 5C0BE 1AGFB 2JJVA 3UTSB 3M8OL 4P5TD 4NZTH 4UT7H 4PJEE 3C9NB 1JTPA 2QSCH 4JFPA 5MI0B 4YQXL 2AK4B 1KLUB 3CFIC 3U7AA 1GCFA 3ZKSD 5EU4B 3TBTA 2BVYA 3MR9B 4QHUB 1EIBA 4Y5VA 5FHAH 3RWHB 1BQHG 4W4OC 3BAEL 3RZCA 3G04B 4YNYA 4LAJH 4XP4H 3GO1L 2BNRB 2V9RA 2A6KB 3NGBC 4M3JA 3HAEH 3MZTA 4M3KB 2A83A 1I1AC 2F74B 4UQ2A 3NGBB 2VLLA 3VDBA 1T21B 3TLRA 1I1AB 4ZFFB 4R26L 3CVHH 4YDVA 5I1GH 1CQYA 5IMMB 5D7SH 1VEOA 2GI7A 1B88A 4XRCA 2O5XH 3EYSL 4Q9RH 2B4CH 2V5SA 4Z7NE 5CGYC 5FGBC 1F90L 1NAMA 2DMBA 4H26A 4YZFE 1CE6A 4OI9A 2IQAB 2EH7L 5HHVL 5F1KC 5KTEH 4KMTH 5C09A 4ORZC 2C3XA 1U8MB 1WCBB 4HIHB 3PWJB 2P24A 4DGVH 5HGAA 1OAXL 2X89D 1YZZA 2YPLB 1RU9H 1FYTD 5SX5H 4EUPG 3LHPH 1AXSA 3IJSB 4JDZB 1T80A 4XMLH 4NN6C 1KJ3L 2AJ3A 2DMKA 4JO3H 4PJ7F 2P5WD 3KPPB 3C6SB 1JZ8A 3A6BH 4NKOA 1NGQH 1CGVA 1TZGL 3RGVA 1G7QA 2GUOA 4DZBA 4NN6B 4XNYH 4KJWC 4G8GE 1CBVL 1IGTB 2WUBL 5ELIA 3VXSD 1U93B 2Q86A 4M61A 1FZKA 1MRCL 4NHUB 1NBZB 4YBQC 2V5YA 2AEIT 4PJFF 1P2CA 4ZOEA 4LSSH 4D8PA 3S6CA 4QNPF 5IOPB 3CGTA 4XTRD 5SWZB 1LO3L 3GI8H 4AIZA 4C57C 4FQHB 2RFXB 4EEEA 3LQAC 1R5IB 4FFWC 4LLYB 1NCBH 3BH9A 3D69A 4NWUH 1PEWA 4FMFA 5IFHL 1C12B 1I1YB 5BS0D 2FSEB 5EBWB 3P30L 4YXHL 3O6FB 4F37F 1R0AH 3HC3L 2YZ1A 2JJTA 3QAZC 3QIUC 4Y1AB 1FV1A 2QHLA 3O2DL 1A21A 2EYSA 1B0RB 1L7TH 3HPJA 1QFWI 2XZQH 2FBJL 4LCWA 1YA5A 5ERWA 5FYKE 1JPTL 3QAZB 3QIUB 5KVDL 4XP9H 3CC5A 2AXHA 2VIRB 4HXAL 2OS7A 2DI8A 3ZZ1A 1ZLVK 1UWXK 3DUUB 1JGLL 3G5XA 3DVGB 1ZSDB 1YEGL 4KK8C 4PJGA 3BKML 1EZVX 3GIZL 1T5XA 1K6QL 2ZSWB 1U3HD 3QDGE 1JZ3A 5IUSA 4P2QE 5KVGH 4GKSA 3KPMB 2OTUB 3UYPA 4PB0L 1A6UH 3OR7A 4BK4A 3T0EA 1V3MA 4NWTH 1MHHB 4WHYG 2X4RB 5CHNA 3L3GB 5C3LD 2IANB 5HPOA 3G6JB 4KZEH 5T5NG 2ORBL 1U58A 4M62L 2NY0C 4MA3B 1RI8A 3D85A 3MLUL 4R96B 4CVXA 3MNZB 4APQD 4HIJA 5DD3H 3K8LA 4OCRL 3S34L 4GRLD 1AQDA 3DRQA 3KPLB 1SJEA 4Y4KA 3ZYOA 1MF2L 5JXEA 5DK0B 5F9WC 1ZT7A 3GK8H 5J13C 5DMIL 4J3XA 3QDMB 1OB1B 1EFXA 2OSLA 1U8QB 4H8WH 4HKJB 4YHYB 3UBXI 5F9WB 5ID0A 2XOTA 3BIBX 5J13B 2MNUA 2NY6C 2P8MA 2VLRE 4K9EH 4FTVD 3S37L 3O3DB 4M48H 3MOBL 4YWGH 1LNUA 5GHWH 1KG0A 5F7UA 3FT2B 4ODWA 2NTFB 1EPFA 1HI6A 2NY6B 3U7WL 1CLZL 4G8GD 5FYLL 4N1CA 4XMPL 4OIBA 3UTSE 1XF2A 3RAJL 1CD8A 1OTUC 4XH2A 2QADD 3GSNB 4LU5H 4Q0XL 3MLXL 2AK4E 2Q6WA 3CFKB 1T66D 4O5LH 5ISZB 2XTJB 1N7ML 3PG2A 3G08A 4U6HB 5T3ZH 4Y19B 2EE2A 2QBWA 3GBMH 2B8OT 3OHXB 2OL3A 1J8HB 2IH3B 4K94L 1X7QA 4HWBH 1NMAL 2BNRE 3F7RA 1R24B 2VO5A 5I71C 2VISB 1DDHB 4M6AA 2C5DC 4OGZA 5C0RL 1S9YA 4UDUB 1DQDL 2CSPA 5L6YL 5ETUB 5I71B 5I1LA 4JRYA 4GRWB 1ZS8B 2BC4A 1JFQL 2B1HH 4Q9QL 1Q9LA 5FYKD 4HUUA 4MS8C 2BZDA 4M7ZC 2CRZA 3PJSA 1U36A 3O6KL 5FA4B 4ZSOB 7FABH 1FNEB 4ZFGL 3RPIB 3LB6C 4UI2A 1MCRA 1S5IH 1NEZA 4M7ZB 4BFIA 5LWYH 1QNZL 3AREA 4AEIL 4UDTA 3QDGD 1FGNH 4PP2A 4P2QD 1Q9OB 2P8PB 3TNNA 3M1BA 1QRND 2BSTA 4JEGB 1R3HA 5MEQA 3Q1SH 3GFUA 2BFVL 1BVKA 3DIFB 2WP3O 4I0PC 4K7PX 4MXQC 4UINH 1N3NA 1BJ1H 1R3JA 1L9NA 2GT9A 4I4WB 2YPLE 2NZ9D 4NDMB 4KJQC 2X42A 4KDTA 3SCMD 1UYWH 4KRMB 1LK3L 2KPNA 3GRWH 4I0PB 1H3VA 4JQIL 3I6GA 2WBKA 2EKSB 2XIDA 1RVFL 1UM6H 5GRXG 3QA3B 2PO6C 4DGIH 4ZUVB 1LMKA 3O8XA 5BJTB 2EXYC 1P4BL 2OR8A 4NCC2 4OCYH 2Z92A 5JW4R 3QULA 2BVQB 3MUZ1 4JHZA 5H37G 3OR6B 4IRJD 3PP3K 1I8LC 3WNPA 2PO6B 3QUMH 2YSSB 1YMMB 4HT1L 3OPZL 4NUGL 3FRPA 3MLTB 1MRFH 2HMIC 2J8HA 1A5FL 1LK2B 5SWZE 3QEGL 5E6IA 2VLRD 4LEXH 4OV5A 1J0HA 4WFFE 1DQQB 2Z31A 3DI3B 4OLYH 4M93B 2HT2C 2VSDA 5GXBB 1HHJB 1DBMH 4HF5H 2BVOB 2AEQH 4WFGD 3LS4L 1VACB 5IFJA 1KB5L 2GSGA 2ZG1A 2W9EH 3VGHA 2ZUYA 3VGGA 1G7PB 1N0XL 3UTSD 1TETL 5EU5A 1U2HA 4Y1AE 2CIIB 3O9WA 4HJGA 4I13B 2OR9L 4BA8A 2AK4D 3AS0A 4NPYB 1XCQB 5IJKC 3HUJE 5C0NC 1KN2H 3ILQD 2XFXA 4XBGA 3D18B 4HGWA 1NLDH 3VA2C 1X5FA 5JO5A 3EJJX 1LO0H 2BNRD 3VI3E 5C2BL 3TJHD 4WWID 5FO8A 3MFFA 2DM2A 5T1MB 4YHIA 4G8IB 1X44A 4Y2DC 4JY4B 2RHEA 4UV7H 4ONFH 3D48R 3VGBA 4NP4L 3L3KB 4PJHF 3RIFK 1JYVA 4P2CG 2C1OA 5ADPL 1D9KA 4M5ZL 5E2JA 1AXTL 1I1AD 1KJMA 5GIRA 4WY7L 2DB8A 5F8QC 3PE9A 4MXWL 1B6DA 4PRBB 4WTZA 3WUWG 2GK2A 2D7TL 4G80B 1FNLA 2QQQA 2IANE 3GBNH 1BREA 3G6JE 4F3FB 1CD1B 4QCIB 3BHBB 3GMPA 3EJZC 4OZGA 3BX7C 4RMTA 3V0WL 4KJPC 5HI3C 2L7UA 4M6NH 3RTQA 3CZFB 3IJHB 3ZE0E 3FO2A 2B1AL 3DBXB 4JY6B 1UEMA 5CGYD 1EHLH 1TCMA 4RFEA 1NMBH 1RIHL 3LKQA 2E9WA 1FZOB 2FZ3A 4M8VA 3THML 2YPLD 5GPRA 4NRXA 4KXZH 1PVHA 2AEPH 4MNGE 2MKLC 4G6JL 1I1CA 4QHMB 1FNGB 1F8TL 3NFNB 3TZVA 3WBDA 1RHHB 4LAQL 4RGMC 2EICA 2W0PA 1IQWL 3A6CH 3EUUA 1FH5L 4R7NA 4JM2C 2RB8A 3ARFC 1Z6JT 4K2UH 4PB9L 2XNAB 2X4SB 5K9JL 4LKCB 3BGAA 4RGMB 4AH2A 5CD5C 2EH8L 2IPTL 5F72S 4P5MA 4X99B 4JM2B 3V5KB 1DN0B 3ARFB 2VUYA 3O2WL 4KJWD 3Q5TA 1JWUA 2PYEB 1LO5B 3RVXC 5SWZD 5E1HB 1WSST 3C60C 5ISZE 4NHCH 4E0RB 1T3FA 2BNUB 4WFFD 2V5TA 4YBQD 3DO3A 4RBPK 1YEDA 2VR4A 1A1OA 1J8HE 1KPVA 2DQEL 5JQ6H 5DRXA 3C60B 3NCYS 4M6ML 1D5IH 5GRJL 2GTZA 1G9NC 3N85L 2GEEA 3DXAB 5KVEL 3O6FD 5L8LB 3S88L 1QSEB 1MIML 4GS7C 4RBPH 4Y1AD 2PR4H 1B2WL 2QQKH 1TZHA 4GRWE 3GJFA 5IG7A 3K8KA 4MQ7A 1GHFH 2VDML 3VXRA 1OTSC 4UB0H 3OKEB 1XGTA 2YC1A 4JG0L 3QXDA 3Q5OA 3GHBL 4J6RL 4GS7B 3QIUD 3JXAA 3CPLB 4YHPB 1ZLWK 3TYGL 1NCNA 3IFNH 5DJAB 4ZSOE 3S9DB 4L8BA 2H2SC 3OKDA 3X17A 3X11A 1G7JB 5CEXA 4PG9A 2F19L 5KSAC 5DJYA 4AL8H 3X14A 3IDJA 4Q97A 3F7YA 5F7WC 3MODL 1VHPA 3EYUH 5FO7A 1TVDA 1Z9OA 3BEVA 3EYFB 4KQ4H 4X80L 1ZLWH 1A3RH 4FABL 3C87A 4KK8D 4QXGH 1QLEL 1Y6KR 5KSAB 1NGXA 3V5DA 3AVEA 1S7RA 3IDNB 4P49A 5CFHA 1PEZA 2IAND 5I1HL 1YEFH 4PYGA 2HJLB 3UPRA 4M7LL 3K1KC 2OLDA 3OJDB 5EO9A 3HCVB 1AGDA 3OG4B 2FH6A 1AGCA 5EU6A 4Y0GA 4MAUL 3CSGA 2R0ZL 2CKNA 5I66A 4JHAL 2X4PA 2R2EA 1DQML 3L5WA 3OAZH 1OAKH 5F7EL 4I0KA 8FABA 4G9DB 1T1XA 4NM4L 4Z0BH 4KI1A 1WV7T 4KROC 4KHXH 4MXVE 3QDMD 1U8OB 1YMME 3CSPA 1PLGL 3ZTNH 4MNQB 3JTTB 2VOTA 3FQTA 2DQCH 2ZWLT 4O51A 4OB5L 4KROB 2VMFA 2R0WH 2FWOA 3VFVA 4DKAA 3PDGA 5IB3A 2IEPA 4ACPA 1TVBA 3RA7L 3I50L 5FA3A 1G6RB 4F15C 1UEYA 5F7FA 5JXAH 3UPCA 3MRDA 1PG7L 2Z91A 4LLUA 5FHBL 2NY6D 4PGBA 4HK3J 3W0WB 1FRGH 1JNLL 4GG6B 2YWZA 4F15B 1WCQA 2JELL 2FATL 3MJ8B 2E9BA 5HDOA 2EDFA 1YEIL 2DLHA 4K7PL 2K3TA 1F4YL 1BFOA 3NOIA 3M07A 1JRHI 2XTJD 4XP6L 5T1KB 5ISZD 2Z4QB 1IQDA 1T7VA 2XWTB 4FZ8L 1HQ4B 1H3GA 5JDSB 4Y19D 4HS3A 3UEZA 1EXUA 3WJJA 4HDIA 4J3OC 1J8HD 4OLEA 3FRUA 1KT2A 2F53A 2PW2B 5ABDE 1A6VH 1T4KB 1NDMB 3SKUD 3UTOA 4FQIL 3IFPA 4OLUH 4OKDA 1YNLL 5EORL 4NKIH 3AC0A 4L5FH 4JJHA 3O2DA 4X7DC 5IHZB 3OXSB 4RZCB 4ELMA 3A67H 1FFQA 3D6GA 1S9KC 2XA3A 2IADA 1OP3K 2IPUK 2AV7A 4KVNL 1D5XB 4KTDL 1K8DA 5IKCB 4OF5A 2VZSA 1X9QA 2D31A 4HBCH 4UNTA 5KVFH 1WC7A 1DLFH 2ARJA 4NJAH 3DROB 2GQHA 2UV3A 4LRIA 3OB0K 5B38A 4YHML 4R9HA 4MS8D 4H25B 3SDDC 3MOQA 1R3LB 3ZYZA 4MJ5A 5D6DC 4GLRH 4PFEA 2Q8BL 3DX9A 4DQOH 3LB6D 2XT1B 3ZDXE 4GXVL 3OB0H 1DEEA 1PW3A 3SDDB 4ETQB 4LPVA 5TF0A 1GZPB 2H6PB 2D9CA 4WU7A 4MMZC 4U7KA 3HA0A 1VKXB 3RUGF 3KPSB 4NZRH 4S0SD 4I0PD 4MXQD 1B0GA 5ESVA 4KJQD 5HVGB 1S3KL 3IXAA 1EEYA 4HGKC 1OGAA 4JO2L 2HRPH 2HFEA 3P9WB 15C8L 4E9LA 1J05A 2R9HC 5F1NB 4YGAB 4RX4A 3BESR 2PO6D 3T2NH 1F3JA 2UVFA 4M4RA 1YMMD 1CXKA 2EXYD 3RKPA 2YHGA 5C71A 4QXUL 4A2LA 1SJHA 1HSBA 3O2VH 2PYEE 3SDCC 1AD0A 3V6ZB 2QR0B 2GFBB 5EIIA 4DZ8B 3GB7B 1IZJA 3X3GH 2HMID 4ZNEE 1MQ8A 3K2MC 4RIRA 3SDCB 1DE4A 4EBQL 5IW1B 3EDEA 4HUXB 3LKOB 3F7QA 3RHWF 2P42B 1U92A 3O4LA 3DXAE 2HT2D 4W68A 1SBSH 2NNAB 1QSEE 4NZUH 4BYHA 3LSOB 1G9MH 4NYLA 1BBDH 3IS0X 2PTTB 1UADC 2FJGB 2VLKA 5HYSB 1DZBA 4M8QB 1P9MC 2DTML 1GC1H 4O2FA 3RJQB 5FYKL 1J1OH 4PJBA 2KL6A 2Z8WC 4TSCH 1NKOA 3WIHH 1EK3A 1OF2B 2YXMA 1CZ8L 2HFFB 3U0PB 3S36L 5C0ND 4WHDA 5KW9H 4XPAL 5I1IH 3Q48A 2HJFA 5JIKA 4TQEH 3MV9B 2DL2A 4HBQA 2MHAA 5IT2H 4YHLL 4HMDA 1T0MA 2E7HA 4ZUSB 3IF1B 3DHMA 3REVB 5IWLA 4CVZB 3CCHA 3IXTB 4NCC1 1IARB 4N0FB 4XC3L 3HNTH 3AXLA 3SPVB 2X41A 3BT2L 5IV2B 4OZIF 4OTXH 5F88A 1RFDH 3VWKA 1M7DA 1A7PL 1YY9D 1S9VA 3B8YA 4J8RB 2NY2C 1CGWA 2CO6B 3PWPA 4P2YA 4MX7B 3IVKB 5HYJB 3B3IB 4QHLB 4OI7A 1MI5B 3QHZH 3RNKA 3EJZD 4XCNB 4JFDB 4JCMA 3S5LG 2NY2B 4KJPD 2GJ6B 4LNRB 5HI3D 2K1MA 1ETZB 1Q9KB 5CJOL 3WEXB 1X5ZA 1DUZA 1EAPA 5JW4Q 3T0AA 1HIML 2DKMA 4XGZA 2AS5M 3MLVL 5DJ6B 2AXGA 4IRSC 4NN5C 1OARL 1MJUH 4FQJH 1ZTXL 4FQ1L 3KYOB 4NO5B 1AD9B 4LPUA 2CH8A 4JPVH 4MCZA 4XAKE 1QBLL 4IRSB 4NN5B 1IL1B 4PJ9A 3BMWA 1L0QA 2XN9B 4ZODA 1HYRC 4JFEA 5HDLA 3W0WE 2MQ0A 4GG6E 3PGFH 5DO2C 3DHJA 5FYKU 3ARDA 5DD0L 4XNZB 4CNIA 4JRXB 3R4DA 3FOLA 5DJ2A 5D70H 4JM2D 3ARFD 4Y8DC 1Q94B 3PWNB 3NZHH 2D4DA 4S1QH 2XACC 2PYED 5HVHC 1I3VA 3RWDB 5T5FH 5CD5D 1QG3A 5CCKL 4PJIA 5GSVB 3RDTC 3KLDA 3DO7A 1MFDL 4ODUB 2ADFH 4L3EB 3TBYB 1KN4H 3ARGA 2DQJH 3DLQR 1KC5H 1K2DB 5DURB 5HVHB 3RVXD 5ALCH 1J10A 2Y5EA 3C60D 1SY6H 3RDTB 5BVJA 1QD0A 3DXAD 3O45A 5E24E 4GBXA 1FZJB 1QSED 4OLWH 1AE6L 1A9EB 3JV6B 1R3KA 3MCKA 4HHAB 5GS1A 2J88L 4Q74A 3QPQC 3DX7B 1F4AA 2DQDL 2V5MA 5FKAB 1YEEH 5D7KE 5HHOA 2DKUA 3B8SA 1F11B 1W0VB 4JKPH 1OTSD 3CFCH 1Z9LA 2H8PA 3BP5A 2WBJC 1J0ZA 4JQXA 4S11A 4BUGA 3RL2B 1D5ZB 1QFWH 4BQBA 4QRSA 2JKXA 4G8FB 4V1DB 2H2SD 1QYGH 2DI7A 5L7XL 1IGFH 3PDOA 2FECL 3RWCB 5IF0B 2WBJB 4IDJL 2BJMH 2V2TA 5KSAD 4HWEH 4QOKA 1I9IL 1DEDA 2HVKA 5F7KC 2HTLC 3GSXA 5TDPA 4U1NA 3VH8G 5BZDB 2VZ1A 3JV4B 1JGUH 3NFPA 1QR4A 2B7DT 3ZE1E 1HSAA 4PYHA 1A1MB 2ZUXA 4LRNH 1JHTB 2EIBA 4XPGH 1IM9A 1PZ5A 3L7FB 4GOSA 4C54A 1NPUA 3OKYA 2ICEA 3OQ3B 3WD5L 2VQUA 3LRSA 4N68A 4DFIA 1JHKH 3QWRD 1IKFH 4IS6B 1CFNB 4ZTPL 4AMKH 4C55A 4ONGH 5D1XC 2H26B 4FQLL 1BECA 3CLEH 5TGBA 2VXSH 3RUGA 3IDGB 5ESQB 3GSRA 4KROD 2I24N 1ADQH 5D1XB 4JZOB 3MGTB 3SE9H 5FYJE 2O5YL 1XGYL 5E08L 1VGKB 4XAKD 3P2TA 5C0FA 1RK0B 1IEBA 5IESH 1DQJA 1NMCC 1QO3B 1YC7A 5KANG 3W0WD 3WNKA 4J3TA 1V3JA 1U8KA 4P5TA 3LQAL 1G7HA 4PJDF 1P4LB 1Z0NA 3IDMA 5H2BA 1DQTA 1KCSH 4R4FH 3JWDC 4ZS7H 1EO8H 2Z8RA 4XZUA 5BMFL 4OF8A 1NMCB 3CH1B 4TYUA 2IH1A 5FCUH 1JHLL 1PD6A 5KSUA 5C8JB 5T1KD 2J8OA 4I77L 1BAFH 3VD3A 1N8ZA 4PJCF 3ECBA 3ULVC 2PF6A 3FB6B 2IF7A 3I3EA 3RX8A 3MROB 2WBWB 2OZ4L 4NM8L 3S35H 2YK1L 2DM3A 3F12B 1MH5B 5TPWH 4QRQA 3MA7B 2G9HB 5EUOB 1K9TA 1I3UA 3VRIB 3KPQA 3S3JA 1UKQA 3C5SA 2Q8AH 3SE8H 3QG7L 2VYRE 2X4TA 4MYWB 2IFGA 4HH9A 1ITCA 1DTUA 2A38A 2B20A 2Y5TA 4BZ2H 1A6ZA 1WBXA 1MJJB 2VDKL 2CIKA 5D7KD 1S7VB 3JVGA 5GS0C 1IGYB 1BVLA 1UA6H 3IB4A 4NKMB 4RWHA 4CBPA 2FJFA 12E8L 5F9AC 3VW3H 4JFQA 2FHFA 2QKIB 3MRCB 3CK0H 4AEHL 1FLRL 5HYJE 4X0KB 4DVBB 3LRGA 5KS9F 3MBEC 2Y36H 1KJVA 4M4PA 1MI5E 5J1AB 2ZOKA 3MRHB 3BPCB 3MJ6A 4PRIB 2R4SL 5GGSA 1FSKC 2H32H 1M05A 4G3YL 4TSBH 2X89A 3PGCB 5J56B 2EDXA 3SDDD 3MBEB 2X1WL 5EZOH 1FYTA 2HH0H 1A6AA 1BZ7B 3VI4F 1UZ8B 1RZ7H 4OIIH 2AXFB 3QJHB 3KPSD 1PAMA 1AXIB 1FSKB 4UIKH 3QQ9C 3VFPA 4LCIL 4QYOB 3DV6A 5E1AB 1ORQA 1BGXH 1TJHH 4K55A 1JPFA 3FONA 2XN9E 4ZTOH 3OJ2C 3VD7A 3VXSA 4MD0B 3U2SB 4O9HL 4BH7A 3E1F1 4JHWL 4JRXE 5IVZA 2ICWB 1YPZF 1BFTA 2I60H 4X5XA 4D3CL 3GSNL 5GJTL 1HCVA 4ISVA 3WYRA 4FN0A 2PW1B 2R9HD 1CR9H 3WJLC 1O0VA 4YHKH 2IQ9L 4BSVB 3MA9L 3L1OL 1IGCH 5MP6H 4L3EE 5FYJD 3Q6FA 1E6OH 4I2XE 3DGGA 3SDCD 4K7FB 1J5OH 5JHLL 2YZ8A 3MLSH 3MLRH 5ESAB 2MJWA 4TUKL 1O5DT 3ZMRA 3NCEB 4HCRH 5EULV 4J4PC 1CWVA 2JF1A 3AS1A 3HRZA 4MDIB 1EUUA 3QEUA 2NY5H 4YR6A 2VAJA 5CBAA 4PTTB 1YDPB 3HLAB 3T0DA 2AABH 3P4LA 4WTXA 1QACA 1C5CL 1A0QH 1QOKA 3D1MC 2AJZB 1HXMB 1U3JA 3BVNB 3VXOB 4MWFA 2W38A 4DEPC 4LLVB 3TIDA 1C08A 5D71L 4U1HB 4G5ZH 5C0GB 4D0DB 3CFDA 5EBGA 1E27A 2ATPB 4F57L 3NBNA 1OAZL 1MCBA 3AROA 3D3VB 1U3HA 1BIIA 1ODAA 1YN7B 3T0WA 3MV9D 2IPKB 3BZEB 4DEPB 5EZJB 5MEOA 1N59A 3IS1X 2H1PL 1VFMA 4CMMA 4JKKA 5IBLC 4PJXB 2YEZA 5DT1L 4I18C 4GMTH 4KVCH 1YN6A 5ITFA 3H6JA 4P5KA 5DQDL 2W92A 5IBTH 2R69L 3ARBA 2DMCA 1N4XH 1LEKA 4NQDB 2B2XL 4LLMA 1RK1B 3VG0H 2NXYC 5HYJD 4APQA 4I18B 3GGWB 3GKZA 5E2TL 4MNHA 1MI5D 4GRLA 1HYSC 4JFDD 3U9PH 2NY2D 5EIVA 2GJ6D 3X13A 2BDNH 2NXYB 4P57A 5I1EL 1KGCE 4RRPG 1S7UB 5HGHA 3V6FA 43CAB 1EGJH 1MNUL 4R8WL 1XIWB 4C59B 1JF1B 4BK5A 4WGVB 4QF1B 3GKWL 2NTSP 3V0VB 1I7ZB 1IGJB 4NNXB 4FTVA 4FFVD 3V4UH 4B50A 4XNUL 3UJIH 2ICES 2AJXL 4X4MA 2Z35B 1CL7I 4KY1H 3KPOB 4IRSD 3T4YA 4O58H 1F6FB 2XN9D 1XMWA 4G8GA 5F96H 3QHFL 3G5YB 5F44A 1AGEA 3DUSB 4JRXD 3QO0A 3K3QA 3I02B 3D25A 4PY7A 4FZEL 3GNML 4MA7H 5DO2D 1KELH 5DSCA 4DKEL 4F7PA 5IVXB 3WHE0 1KSRA 3HI5H 3EZJB 2VZTA 2FGWL 4L3ED 1XR9A 4GXUN 5DUPL 3FCTB 5F6HJ 5DURD 1PKOA 3QXUA 1Q1JH 1BEYL 7CGTA 4YAQA 5EUOE 3RDTD 1FL5B 2CDFA 4PJDA 3BZ4A 3GHEL 5L0QC 3UJJH 2M2DA 3LKSB 4ERSH 1IEAB 4ODBD 4GW1B 5DJDB 3U9UA 5TH2A 1GOFA 3NA9H 4CU7A 3FOMB 3KDMA 4DW2L 2DQHH 3Q0HA 3S97C 1LDPH 4PJCA 4ODVH 3ZO0A 4YC2C 5EB9A 4K3JL 2ED7A 3I85A 3D87B 2BY0A 4V2BA 2WWKO 1ZWIA 2VC2L 3EO1A 2X4QB 3QFDB 5JMOC 2D4FA 4W81A 4B5EA 5F3BB 5HVWA 1FVDB 4YC2B 2JCCF 3UPAA 1CXLA 5DVNA 1A9BA 3GJEA 3QDGA 3NCJH 5IBUG 3QRGH 1M71A 4V1DD 1QRNA 1MJ8L 5JPNB 3QCVL 3VFTA 4BJLA 3N1MC 4PRIE 2WBJD 3BKCL 3BP6B 4HFUL 3V7AE 2C1PB 3VXQA 5AD0B 1VSCA 5CEZH 3E6FB 4F33B 4ONHB 5CMAB 4F2MA 5IP4A 3F65A 2F8VA 4ZMAT 1NBYB 1S5HB 3SY0A 1KJ2B 1E28B 4H0GA 4Z7WE 3G5ZA 4FQ2L 1P4IH 2WIIA 5C0IA 4EKXA 1A14H 2DWDB 1M7IB 1CK0L 4KZDH 1CD9B 1LE5B 2HTLD 1FO0H 4GKOA 3MRMA 1T2XA 5FM4A 3X12A 4H1LG 1VA9A 4ELKB 4LKXB 2EC8A 4G6KH 1SJXA 4DVRL 1IC5L 1EHNA 3W2DH 1KGCD 1RULH 1P7HL 5DI8A 4JKWA 4PGCB 4URTB 4CVUA 2ADGB 1F6AA 1EFQA 3MOAH 1GGTA 2P8LA 3K4AA 2DQUL 1JWMB 3MO1B 5D1XD 4NO2B 4J3SA 4HZLA 4G6FB 4HUNB 4K8RC 4OSUL 2G75B 1JK8A 2YKLH 2M26A 5M7QA 1W72B 3ULUF 3QFJB 4M7KL 2A9MH 5JUEL 4FOMA 5FM5M 3FQWB 5T1DH 2CGRL 1MFNA 4NJ9H 4OCWH 1ZMYA 2GITB 4Y88A 4Z7VB 3REWB 1RMFL 2MPAH 4PGDB 2HAZA 2Q7YB 4JKLA 2AK4A 1KLUA 4EI5A 4TTGA 5EU4A 4LQ1A 4N1EA 3MR9A 3UXFA 3HI6L 4QHUA 1IMHC 1DBJH 4LCYA 4U1MB 4Y5VC 3RWHA 4HQQH 3QXTA 1ACYL 3QQ3A 4JB9H 2VDNH 3WL9A 3G04A 4K23L 4IMKA 2A6KA 1S7XB 3TBTB 1VENA 1OD7A 4LSUL 2LVEA 3MRQB 1N6VA 3TT1L 4W4OA 3BD3A 2IPUG 3ULVD 5ICYB 5SWSE 1MLBB 3D3VE 1JRHH 1CLCA 1MHPH 1I1AA 4ZFFA 2CLVB 4AEEA 1BQSA 3ALWA 4HKZA 3HAEB 3H8NA 1UVQA 4O02H 4P9HC 1DLHB 4WU5B 4R90L 1XAUA 3BH8A 1TMCB 1RIUH 3SJVA 3WE6A 1UWEH 3TYFB 4QTIL 3LPFA 4NQDE 4XRCB 2IQAA 5GS0D 3CVHB 3QUZC 4HLZG 1W2KT 2B4CC 5HGDB 4PJ8C 1NAMB 5F93C 1U8MA 1WCBA 4H26B 4NN7C 4PRID 4HIHA 3PWJA 1CE6B 3ARWA 2QHRL 3GMOB 3TN0A 3QPXH 3QUZB 3MBED 2FRGP 5C09B 4PJ8B 3TC9A 4JDZA 4NN7B 4WEBL 2P24B 1RSFA 4F37K 3O4OC 1V3KA 4MA1C 4MVBC 1AXSB 4U6TA 4BKLB 1WK0A 2LV4A 3O6MH 2E27L 1G6RL 5D4QA 5B8CA 3QQ9D 1MCPH 1SM3L 3O4OB 5DFVC 4G43A 1IGTA 2W07A 5FOJA 4MA1B 1RZFH 4Q6IB 4NKOB 2R56H 2GUOB 1U93A 4DZBB 4NHUA 3V7AG 1NBZA 3WNOA 5JW4M 5LJYH 3HB3C 4LASH 4X7FC 5DFWH 1IGIL 1BP3B 1PJ9A 4FQXA 5SWZA 1MCWW 5IVXE 1FZKB 4MA8H 4FQHA 2RFXA 2UZIL 2FIRT 1R5IA 5E99H 2VABA 3QJFB 1PSKL 5DK3A 1D5BA 4PLNC 5A2FA 3QDJA 4XVSL 4K3EL 1C12A 3OGOE 4RMQA 4U3XA 4AIZB 3MRKB 3FT4B 2FSEA 5CS7A 2AK1H 3TH2T 5EBWA 2X5PA 3BH9B 3O6FA 3D69B 3O3BA 3H42H 4HV8B 5DJ8B 3L6FB 4Y1AA 1HWGB 2J5LC 5EU7C 5TFSL 1A7RL 1B0RA 3L3OB 5E4EB 1TFHA 2CK0L 1FFPB 5CBEB 4OCMC 1AI1L 4XCFH 4LSPL 3CJJA 4POZC 2J5LB 2PXYA 3PL6C 2VSCA 2OZ4A 1Z3GH 4J4PD 2EYSB 3CU1A 2WAHA 2VIRA 1T22B 3TPUB 1KYOJ 3VGEA 2FB4H 5DMYA 5ERWB 1XH3B 1ZSDA 3DVGA 1VEMA 3P9LB 1CDBA 3PL6B 3CC5B 4RISH 1EO5A 4TULH 4KV5F 2DQIL 3D3VD 5IGXH 3G5XB 3ARRA 4ODTL 5DEFA 1SJVA 2GIYA 4PJGB 3UYRL 3T0EC 1NL0L 4X6CB 3B2VH 2GJZA 1CICC 1MHHA 1T5XB 2X4RA 2Z93B 4RFNC 1BOYA 3JTSA 5HHNB 4UTBH 1GAFL 2IANA 1ZHNB 3QZWG 2W9DH 1X5IA 4LIQH 2ZUTA 1BF8A 1CICB 4MA3A 1KCRL 2UUDH 4RFNB 4BSJA 4PLOB 1X5JA 4WI2A 2XPGA 4NQDD 32C2B 4PRNA 2A1WH 4R2GC 4HIXH 5IBLD 5IHUL 1F45A 5I1CL 2UWEF 4WENB 3GJFK 4Y4KC 1VCAA 2FX7L 2J1KA 4NIKB 2APTA 5DK0A 2NXYD 3QDMA 4HKJA 3V4VL 1U8QA 3IDXL 2DRUA 2HVJB 1AQDB 2HKHL 4Y4KB 3KJ6H 1A3QA 5CGMA 1HYSD 4Z7QF 1XIWD 5E9DB 1HHGA 5GGQL 4HK3N 3QNYB 1ZT7B 1T83C 2XA8L 4PGZA 2CLZB 1QA9A 3VMOA 5A2JH 1YEKL 1P5VA 2NTFA 5FYJL 5T3XL 5LGKA 1A6PA 5K93A 2ZG2A 1QLRA 2EC9T 3BGMA 4KUZL 1LNUB 1KG0B 3EIFA 3GSNA 1RQ5A 2CKBH 4ODWB 4OBSA 4Z7VE 1FFRA 5EOCH 5ALBL 5EG6C 3CFKA 1XF2B 1XZ0B 3ULUH 1G7IB 4U6HA 4JN1L 4Y19A 5IIEB 3DYMA 4H20H 3QRFM 3VFOB 1Q0XL 3OHXA 1OQOA 5D7LB 2Q6WB 1KLGA 3HMXL 5FDYA 4X98A 1R24A 4ZPVB 4CJ0A 4FG6C 2E8YA 2VISA 1DDHA 1Q0YL 1F90H 3BN3B 1MCKA 4U3HA 4UDUA 1Z2KA 4NQEB 3O6LL 1NBQA 1QBBA 2OL3B 1X7QB 3TJEL 2LU7A 5GS3A 4NOBA 5ETUA 2DQTH 2G5BA 1S9YB 5E6YA 4TUJA 1ZS8A 5DLML 1W8NA 5C70A 1BX2B 3GIVB 1S8DB 2VLME 1H3PL 2R29L 1GGCH 1JP5A 3U7YH 3U4BH 5I1LB 3ZYJA 3BW9B 3BD4A 4GQ9H 4KQ3H 1MHEB 1FNEA 5JHDB 3RPIA 2CXGA 5J12C 2NY4C 1RIVL 4I3RL 2W1NA 2Y9RT 4TNWF 4OZHF 2HWZL 1CFVL 4LQFH 4LMQI 5I15L 2VL4A 3PJSB 3AREC 3MQIA 3FL7A 5LCVL 3ALXA 1Q9OA 2G60H 2P8PA 4S1RL 5DUMH 5AAWA 5J12B 1JIBA 4LNVA 2P4AB 3DIFA 1NEZB 1X4ZA 4BFIB 3EYOB 2ZJSH 3AREB 4WI3A 4I4WA 5E03A 1KXTB 4PP2B 3TNNB 4KDTC 4PJ5A 5C09E 5I75C 4RDQF 1BVKB 1R3JB 2GT9B 4XCEB 5KOVC 2XI9A 3BYYA 2Y6SC 3RI5F 5I75B 1UM4H 3QA3A 5J1TC 4XNMA 1K3ZA 4ZUVA 3O8XC 5BJTA 2DI9A 2BVQA 4FQCL 3LKNB 1KCUL 5T33L 1MEXL 4JPKL 1BOGB 1DL7H 3BGFC 3O8XB 1YMMA 1ZHBB 3TBWA 4CUCA 3FQRB 2FBJH 1I8LA 2APBA 5E6IC 1JPTH 3AMKA 3BGFB 4KTEH 3IDIB 1H9VA 1HNFA 2Z31C 1DQQA 1WISA 4G6FD 3TV3L 2EE6A 3CD4A 4C56B 1JGLH 4PJ7B 1YEGH 4OZFG 5E6IB 1G7PA 3FQUB 4J23A 1I1FA 5I8EB 2Z31B 3GIZH 1OAYL 1K6QH 4MZ2A 2EKJA 2FBOJ 1HEZB 4K8RD 5I18H 2DQGL 2FJHA 4I0CC 4M6OH 2GSGB 3O9WC 2CIIA 1J1XL 4LSQH 1FFNA 4NPYA 3OGCB 4Z7OE 5D6CB 3W81A 4PJFB 3D18A 3PIQB 3O9WB 3X3FL 1RUAH 5IJVB 5JOFA 2D7OA 1UKSA 3QR2A 4LCWE 5T1MA 3P11H 4XBGB 2E7MA 4IMLB 4JY4A 4N0CC 2M1KA 5I1JH 3IFLL 3L3KA 5I30H 3FFDA 2YRPA 1D9KC 3P4NA 5F1SA 2DTSA 4EQ3A 5FO8B 2BHYA 1T89C 4PJGE 5EO1A 4X6CE 4I1NB 4BFEA 3QISA 3HNVH 4XMKL 2VLMD 4PRBA 1VERA 1D9KB 3B5TA 4G80A 3MGOB 3O81A 1A4KA 4LARL 4F3FA 1MELA 5GIRB 5TF1L 4QCIA 3BHBA 3T0EE 3LN4B 1R5WB 2OR7A 1JTTA 4DTGL 3R8BB 3MJ9H 3DSFL 1RZIB 1YY8B 3RTQC 4NNYA 3U46A 3GMPB 3IJHA 3MRFB 3PUCA 3DBXA 1KIPB 3D0LB 5AYUH 4DN4L 4XMPH 4LSTL 3UX9B 3RAJH 4YUEL 3SQBA 4HS8L 5DR5H 4NNPL 1JTOA 4M1GL 2VDQH 4FNLL 3EKCA 3FO2B 3QUZD 3LOWA 3MLXH 3LPGA 5C09D 3UTQB 4PJ8D 2DIAA 1NAKH 1B6UA 5E9DE 3MYJA 4QHMA 3BN9C 4NFDA 4YDKL 1AY1H 3TZVC 3NFNA 5DJZA 2FZ3B 4NRXB 5CZXC 3UO1L 2XXCB 2UWEA 3HRPA 4U1KA 3TZVB 3FO1B 1OAQH 2XNAA 5EFIB 5DK2B 2ZUUA 1YQ2A 4MVBD 4MQSB 4G7VL 1T7ZA 2JJSA 4X99A 3L7EA 4JFXA 4UILL 4CRPA 1KTDB 1LP9F 1JFQH 2ENSA 1LO5A 1FORL 4E0RA 2BNUA 3HB3D 2R0LL 5D7LE 4OQTH 1TJGL 2I9LA 1J18A 4KAQL 4ZFGH 4NQEE 1YEDB 3C08L 5JR1L 1KPVB 2ZKHL 1IAMA 1WITA 4DCQB 2N1KA 4JFOA 1AO7A 1QSEA 5DRXB 3RX5A 3ULVL 2W0KA 2FLBT 5GGVH 1QFUH 1OPGL 2MKWA 2NYYC 4UT9H 4MB3A 4TRPH 3OKEA 2DS4A 2X7LA 1XF4A 1UM5L 5FCSH 2YD8A 3BPOB 2HJKA 3CPLA 4YHPA 4LVNC 2FX9H 3STBA 1ED3B 3TPKA 1I9JL 5GISH 2A0LC 5DJAA 2B0SL 1MFAL 3QXDB 5D96C 5TE7L 3PL6D 4JE4B 4LVNB 5ID1B 3EYFA 3X11B 2ENYA 5GS0L 2BHUA 2YRZA 5CEXB 5D96B 1YQVH 1MSPA 5IEKB 1EX0A 5E2VL 3VMNA 5JW3L 1PQZB 5DJYB 3X14B 2DYPB 1P6AB 4HLJA 3F7YB 5GGTH 2DWEB 1FHGA 4WFEE 3WKMH 5JW5B 4OCSH 3T0ED 1T7XA 1D6VH 2HJLA 4P3CL 1CICD 3NVQA 3OJDA 5CD3B 4OZHA 1NUDA 3HCVA 1TZIA 1FC2D 5ICZB 3VXTB 3CSYB 1FIGL 1KB5H 5KOMC 2FR4B 1ZKAA 2HRLA 1NLBL 1OCWH 1N0XH 3QWRA 1AGDB 5EO9B 4F8QA 3P73A 5IQ7H 1AGCB 5EU6B 1FL3B 3C8HA 4F9PA 3E2HC 4LLWB 4FXGB 4JZJA 3UZEA 1U8OA 1JGVH 2R2EB 3RY6C 2HFGH 3MJ7B 5CIPH 3U30C 1MRDL 4MNQA 1AC0A 3JTTA 4Y4KD 1T1XB 1L7IL 3TWCH 5E9DD 4ESKA 3PV6B 1MFEL 3E2HB 2ZOLA 3NIFF 4OLXL 5FGRA 3U30B 1FPTL 2IFFH 4XC1L 1G6RA 3FQTB 1BM3L 5IEHB 4Y5XC 5B4MC 5IB3B 2N7AA 3W0WA 1F3DH 3MRDB 2Z91B 3MJ8A 4Y5XB 3OV6A 4NC0B 4WUKH 3OJVC 4AZ8A 3KYKL 5C6TL 4Z7NF 3QUYC 2I5YL 4JZNB 1CL7H 2XWTA 1HQ4A 1JNNH 5JDSA 4PJFE 1NCWL 2EYRB 3JUYA 5IMKB 1C1EL 4OD3H 4KI5C 3WJJC 4TVPE 5IFAH 4KKCD 5D7LD 2PW2A 2FO1A 3P4MB 3QUYB 1T4KA 1NDMA 1DBKH 3V0WH 2VXUH 3OAYH 3M45A 1AFVH 4NQED 1EXUB 1JYNA 3FRUB 1FLTX 3GSWB 5HYIA 1KT2B 1N64L 2F53B 4I3SL 2K7QA 3OXSA 4RZCA 4FG6D 4ZO6A 5LBSL 4ZYKA 4U31A 1JWSB 1D5XA 3FMGL 3U48A 3EOTL 1BFSA 1LEGA 5JMRA 2IADB 25C8L 2AV7B 3DARA 5BQ7B 1Y6NR 3DROA 3RNQB 1F8TH 3O0RL 1GPOH 1K8DB 4LRIC 5JHDD 2C3VB 2D31B 4HKXB 3P77A 1FZMB 3ISWA 1WC7B 5F7MC 3HPLA 4H25A 4JFHE 4QXTB 5CILL 5I8KL 4Z9KB 1MCOL 4UT6L 4PJHB 4Z76B 4PG2A 4ETQA 3ARED 1GZPA 2H6PA 1QKZH 5ADOL 4CN4A 1RZGA 1RUPH 1UXWB 3DX9B 4S1DD 3WFDL 5C07B 3KPSA 5K9KB 4ZD3H 2VXVL 1ORSB 1C16B 5I1AA 1QBMH 1AIFB 3BKYH 4ZOAA 1P7QB 4JPWH 4PIRF 3C2AL 2VL5A 1B0GB 3S4SA 1INEL 4PY8I 4H0IA 4G8EB 3LV3B 2PN5A 2Y6SD 1P1ZA 1MIMH 3O8XD 1OGAB 4F80A 2HFEB 1CN4A 4PRDA 3ARQA 1J05B 3PGDA 2VXQL 2NY1C 3D39A 2E3VA 2QR0A 4JG0H 3NZ8B 1FCGA 3S7GA 4X7TA 4DZ8A 3GB7A 1CFSB 1DQLH 1RZKH 4KK9C 1NFDF 3T0XA 1G7MB 3CDFA 1WF5A 1SJHB 2DM7A 2KQMA 2YXFA 1MPAL 3FFCA 2HFTA 4HEPG 2NY1B 3T0VA 5E6ID 5IW1A 4HUXA 1KB9J 3FQNB 4EUPA 2FX8L 2Z31D 2VH5H 1XGRA 5I1DB 4Z7UF 2NNAA 4RIRB 2EDYA 1F2XK 1DSFH 3NAAH 4FABH 1ZT4B 1QLEH 1U92B 3MLYH 2PTTA 2FJGA 3PHSA 1WWCA 4XX1G 5HYSA 4M8QA 3CX2A 1KV3A 2MFNA 4YGVB 3MV8B 3HMXA 4X6EB 4NYLB 3O9WD 5CP7B 4WTWA 1G9MC 4GSDH 4RNRB 2VLKB 3FRPG 3P0YH 1OF2A 1T6VN 3EHBC 3LIZH 1M4KA 1GC1C 4JHAH 2CD0A 4TSAL 3EDDA 3NN8A 5DFTA 3MV9A 4LPWA 4HUVB 4OGYL 1RY7B 2F58H 3FT3A 3EW3B 1L4IA 4N0CD 2AW2A 3IF1A 3RVWC 4ZPTB 3VXPB 2XZCL 1J87A 2HJFB 3DMMC 2FHCA 5EN2B 1PLGH 4CVZA 5IWLC 4JO4H 4NQVB 1D9KD 4RAHA 4N0FA 1T1WA 1T0MB 2IGFL 5IV2A 2AJVL 3VWKC 1KJ2L 2YUVA 2QEJA 2D2OA 3DMMB 4NKDA 3CCHB 4J8RA 4Z8FL 3RA7H 3I50H 5EBMB 3K4DA 3IVKA 5CINH 1UWGH 4JFHD 5FHBH 3B3IA 3B9EA 1FQ9C 1WBZA 5F88B 4XCNA 1M7DB 1SHMA 4JFDA 1S9VB 2NY7L 4UAOC 4Q6YA 1A6TA 2E7LA 4LNRA 2GJ6A 3PWPB 5EU6E 4QXWA 5DMGC 5TE6H 3WEXA 5BXFB 5E2WL 2C7UA 1P69B 4HSQA 3RFZC 5CUSL 3DOSA 2WWMC 1CQKA 4UAOB 5DJ6A 4WHYH 5C7XL 1NBVH 1HILB 5ACZB 5E8OB 1EAPB 2BOCA 3HS0A 3LCYA 3I9GL 5FIEA 3RL1B 3HNSH 4WTZG 4IRSA 3BN9D 1IL1A 3WN5A 4XVJL 3T8XB 3TZVD 2FEEL 3KHOA 4HS6B 1KPUA 5EORH 2GK0B 2LABA 3ARDC 5CZXD 3JZ7A 5DTFB 4E41B 5FFLA 4K8RL 1HKLH 4O4YH 2HYMA 1IM3B 4LVHC 3ARDB 3IDYC 3FOLB 5KANI 5GSVA 1JF5A 4ODUA 2R8SL 4L3EA 4HGMA 1M7XA 2C3WA 3VRJB 4LVHB 3IDYB 3QDAA 1DBBH 1NC4B 4A6YH 3LQMA 3RDTA 4KMQA 1TPXC 3VRLF 2NQCA 4KI5E 4NZTL 4UT7L 3H3KA 3CDGA 4GBXC 2F53E 2QSCL 1J8KA 1A9EA 2MTPA 4NQXA 5CGTA 4HG4J 4HHAA 5GS1C 5BVJB 1TPXB 4MQTB 4IOSD 5FHAL 2ZCLH 3DX7A 3GDBA 4UOW0 3UZQA 3P0GB 3EFFB 5FKAA 4XP4L 3MCKB 5GS1B 3TCXA 1SVZA 2NYYD 4UQ3A 1F11A 5F7DA 3WIIH 4Y4HB 2X9WA 1E6JH