1FIGL

Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
215
structure length
215
Chain Sequence
ENVLTQSPAIMSASPGEKVTMACRASSSVSSTYLHWYQQKSGASPKLLIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQYSGYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA 1F7 FAB (LIGHT CHAIN)
total genus 34
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1994-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1figL01
3T0EA 1AR2A 3IYLW 3SQOL 4M6NL 4M1DH 3SDCD 4IMLB 5GGTL 5KZCB 3P4NB 4HGWA 4NN5C 5IW6B 3GSWA 5FYJU 3GSNB 1JGEA 1O0VA 3H7LA 5JW4N 4YGAB 4HULB 4X0KA 3UXFA 4R7NA 4M6ML 3QUKA 4ZPVB 4PJ5B 3PWVB 4EUPB 3B4NA 2HKHL 5I8EA 1Q8MA 4GG6B 2GUOB 1U41A 1ZA3B 4MSWA 4PRAA 4U6HA 3NBNA 1MVUA 1IAKA 4WFGE 1OWWA 3JV6B 1GGBH 5CUSH 2NY5H 1G9NC 1DP0A 4PGBB 1QOKA 5HPMB 4PJ9B 3T65A 1MIMH 3GMOA 4MQ7B 1BJ8A 4PUBL 1T0MA 4HW6A 3HAEG 5F96H 1EJ6A 3VXSB 1KXVC 2AEQH 1HZHH 4HMCA 3G08A 1FC1A 5JPNB 3MV9B 2I60H 1QFUL 5F3BB 1U8PA 1KIRB 4CU8A 3PWPE 2C3HA 1NCAH 5DMKB 1CD8A 1DEEB 3VWJD 1QFWI 1CR9L 1ES0A 1F4YL 3HG1D 3WIHH 4YHYB 4DUWA 1A6WL 1ZGLM 2XNAA 4JM2A 2JK5A 2EIDA 2YD6A 2P5EB 2IWGA 3UTZB 4FFZH 3BSZH 3QUML 4JGMA 4HIJA 1QFWM 2CXGA 1CLYH 1KT2B 4H1LH 1UEYA 4LSQL 4P2QD 3DYMA 2VMFA 4Y4KD 4CAGA 3PQYB 2BHYA 4S1QL 3ZYOA 4PJFF 4PRBA 4NM8L 3D39A 3FRPA 3QXDB 5M7QA 2YS4A 4S1SL 5DEZA 2X1QA 1S9WA 3IXTA 1N4XL 1OAXH 3A6CH 5J89A 4R7DA 4K8RC 4YX2H 4LRIA 4RISH 3VXSD 2CD0A 1ZT4B 5BS0E 5JQ6L 4QRTB 3ZDXF 1MCCA 4ZUUA 1F45A 2BSED 2H2SC 4OCSH 2CSPA 5SWQB 4KUCF 4JFOB 5EFIA 4M03A 1A0QH 3VFPA 5IIEA 4B53A 4NGHH 3STZB 4YZFE 4X6EB 1G9MC 3RNKB 4PRDA 3CCHB 4U1LB 4GMTL 3O6FB 1J0JA 2W0KA 4RQQA 4QO1A 3VG0L 2COQA 5E6YA 3RQ3A 2YMXH 3QDJE 3F7RA 3G9VA 3W0WD 3IDMB 4CADB 1BMGA 2J8UE 3GRWH 1MCPL 4PRHD 3G6DL 2F5AH 1H3UA 1I3UA 4Z7UE 2DN7A 2XKSA 5CD5D 3VE0B 1WIUA 5EORH 3QHTC 1OB1B 2ADGB 2JJTC 4KJPC 5H37H 3MLVH 3HC4L 1S7TB 5CEXB 4ZO6A 4JCMA 4ZXBB 5K33A 2KDGA 3V7AE 1U2HA 1D5IL 1CXHA 3JUYA 1XCQA 1C1EL 2FGWH 1G7LA 2YOCA 1MCPH 3MRCB 1YEKL 4Z7WF 1DLHB 5DFTA 2YA0A 4PREA 4H8WL 4PUBH 3GK8H 1IC5L 2BSTA 4QRRD 5CSGA 4GS7C 3CSBA 3OZ9L 3CMOH 1L0XA 5BMFL 2R2HB 4RFNB 3NCYP 5T3XD 4L3CB 3SE4C 5D70H 1KJ3H 2A6KB 2PXYC 3EYSH 2NNAA 2F53D 5C0BA 3ZYIA 5J6HA 4HBCL 4UOJA 1YUHB 5HGDB 2DQFA 3EDJA 4ORZC 3ZKMC 4CNIB 15C8H 5L2KE 3L5XL 4O4YH 4EI5B 3UJJL 5C86A 5FA4A 5ID1B 1JV5A 4HG4J 1M7IA 5I1AB 5D70L 1I1AD 4XGZA 3UX9B 3DVGA 5CHNB 3RX7A 3OMZA 4Z7UB 4KDVA 1QTYT 1FNAA 4HF5L 3EYQC 5C08E 5DJ2A 1ETZB 2A6JA 3X14A 5EUOB 3MBEA 3F62A 4R26H 4PJBB 2P45B 3CH8A 2EYRA 1UGNA 4OCWL 1HWHB 1NAMH 2BNRA 2DL9A 4W4NA 3W9EA 1PZ5B 2NY0D 1A6AA 1E6JH 1PLGH 3MLSH 2A6KA 5LJYH 4OSUL 4HJGA 1BGXH 5HDOA 3OAUH 1YY8B 4U3XA 3GMQB 5EO0A 3S35L 4RNRA 3T0EC 5C0ND 4MD0A 5EZIH 3UTSD 4WUUB 4MA7L 1EFQA 5CD3A 1EZVX 2VDOL 3NMEA 1FSKC 3CMGA 5A40E 4XVUC 2VLJB 1NLDH 2C26A 5FM4A 3OXRB 1PSKH 1BVLA 2E7HA 4X4XB 4ENED 3DYOA 4NWTH 5I17A 5H8DA 2Q6WA 1MJ8H 1TJHL 1BREA 1OB1A 3U7WL 3QXWA 5LGJB 4N0CC 3KPPA 3CZFA 4DVBA 4YK4C 3C5JB 4M7LT 3SDYL 1II4E 2V17L 1RULH 4ETQA 4BFEA 3QUXA 2GYSA 1T5WB 1JUFB 1QBAA 4HLZH 3O4LB 5DTFA 1KN2H 3P4LA 4NSKB 5IVOA 3A6OA 1EMTL 2CIKA 1W72L 4LNVA 1S9VB 1FZMA 4JM2D 1YEEL 4FFZL 4PRIA 1QVOA 3I75A 3WE6A 3UTOA 1EUUA 2DLEA 2WK2A 1A4JB 2V17H 3DVFA 1HWGB 1UG9A 5IIEB 2O61A 2GSGB 5D7SH 1RZ8B 1J0YA 5T3ZD 1NGYA 4ZUUB 1BPVA 4K7FA 4I2XB 4XBGB 4YBLB 1A3LL 4X6DF 1I1YA 4WRLA 1HI6A 4JFDA 4KRPB 5E1AB 5E8OA 3MREB 1ITBB 3WKMH 2C4FT 4Y2DD 2OMBA 4H26A 5MI0C 4F57L 4WW1B 5EIIB 4JFPB 5DK3A 3IS0X 1SJXA 1H8SA 2D31B 1BQUA 5EUOA 4MA8H 4WW2A 2NQCA 1PJ9A 4PJIA 5DZNA 4GXUM 5EZOL 3UTZA 3BPNB 4GW1A 3S7GA 5HYQB 2F15A 4XP6L 3UPCA 1KG0A 1OQXA 3DSNA 4IRSA 4OV5B 1YA5A 4KUZL 5IKCB 4HJJL 4JM2B 2OI9C 2MCPH 3ULVH 2K9UA 4IDJL 5ANME 4L29A 1A14L 4ZAKC 3UTTB 4LSUH 2V2WB 3RGVC 4L9LA 1MCJA 1HSBB 4Y2OA 1D5ZB 4HUUA 5E99L 4JKMA 2Z92A 5J12C 1KJVA 3QDJD 1T0MB 4PJBE 5SV4A 3BDYL 4G8GE 3T65B 3RKPA 3LKSA 3CK0L 4KK9D 4Z7VB 3SDDC 1SJEB 3IDIA 1IAKB 5ITBL 2VDRH 1MVFA 3GBNL 1UJ3C 3T77B 2PR4L 3Q5OA 5FFLA 1A6TA 1TETH 4EUPA 2OX5A 3GMOB 3F58L 3L3HB 2NXZC 2MMXA 1J8HA 1XF4B 2Y25A 3NFNB 5HD8D 1G7LB 3ARZA 1CFTB 5GGQH 2XKUA 4MSWB 5LCVH 5AG8A 2VLKB 2B5IB 3VXSE 1AQKH 3HR5A 4R7NB 1NMBL 1IM9B 1QBML 5DVKA 3B9KA 3L1OH 4R8WH 5GS1C 3NCMA 3UYOD 1X6NA 4JFHE 4HGWB 2XWTA 3MV8B 3U4EA 4V2CB 3T3MF 4ZO8A 5CWSB 1XAUA 1X5ZA 1B6DA 4RZCB 3IAGC 1T1XA 3TBVA 1A7BA 4ZD3H 1T7WA 2KL6A 3LZFH 3MRIB 5I2IA 3WKML 2DQJL 3QXUA 4YIQB 3ORJA 1A7QL 4R4ND 4YAQA 4QRTA 1BZ7B 4PV9B 2HFFA 4YXLL 3VDBA 2R1YB 1ZT4A 3UAJD 2CXKA 2YC1A 4N8PA 5DRNB 1SBSL 1RZKC 1HDMA 3CFKB 2DLHA 1Y0LA 4X7CC 1MFNA 3ELAT 4J1UB 4UDTB 3W9DA 4F7CB 1C12A 4L8SB 32C2B 2BRRH 5D96B 1XGQB 4HX1B 4L1DA 1FHGA 1LNUA 3K81A 4WWKD 4D9LH 5D1ZD 4YO0A 2LVEA 3LKQA 3TO4B 1RI8A 1H3WM 1B0GB 3V7MA 4G9FA 1EGJL 5JO5B 3FB8B 3SDAA 5EC2B 2V7NA 1XGPA 1J0IA 3SDCC 3TESA 4WFFD 1KLUB 3FO0L 4IRZH 1H8NA 1RJZB 3KYMA 4NWTL 3T77A 3FT4A 4UV4L 4RSVA 3CXHK 4UIMA 3CX5J 1JF1A 1JZ7A 1PD6A 4K3HA 4YK4B 4OZIF 4JG1H 4XVJH 1YEJH 1NKRA 3BFOA 1IBGH 2VDNH 3O3EA 2I24N 3UTTA 4Y4FC 5GSRA 3GSQB 2PNDA 5I6XB 1F6AB 2P5WA 3QFJB 3P9MA 1RY7B 1RUAL 2WBKA 3GSVA 5D1XD 3U1SL 4N0RA 5H2BA 5AD0A 2J2ZA 5I73C 3OAZH 2VXTL 1MUJA 3X3FL 1AJ7L 2H41A 1NAML 4LHUG 3GKZA 3ZMRA 1B2WL 4L8SC 5GGSA 3MODL 1Z0MA 3MBXL 1H3PL 2V5YA 3W11D 3GMNA 1H9VA 1NGWA 4Q74A 3C6LB 1GC1C 5D1QC 3THMH 2M8XA 3TVMC 5I75B 1U8JA 2CDGB 3QEUA 5DJ6A 3CFJA 4OFYD 5DJYB 4D0DB 5D9SA 1LEIB 1GSMA 4JZJC 2EEAA 1NBZA 4MAUL 3GI9L 2E9IA 3RIFK 4AG4H 2AXHA 2APTA 4TVPE 5IWLC 5ERWB 1D5MA 4XC1H 4IRZL 3D2UA 1X5GA 5JZ7D 2B2XL 1G6RA 3HI1A 5IMLA 4W6YB 4S1SH 5K9JH 3GIZH 2NY3D 1KGCD 4OZHB 2OJZL 2WLYA 4XMPL 5IGXL 3V79C 4Q7DA 3MGOA 2H1PH 4PP1C 5SX5K 4O00A 1HH6A 5BV7B 2ICWA 5T3XH 5KSUA 1P4BL 2ZOLA 3U4EB 1NAMB 2BRRL 4DEPB 3DV6A 1D5ZA 4L4VE 3QUXB 7FABH 5GGRB 4LP4A 1TTFA 4JANB 4NQEB 3LMJL 5GZND 3OGCA 5FYJE 2ENYA 3O2VH 2R8SL 4QHLA 5I30H 3LKOB 3BH9B 4O5LH 4I0KA 4ZAKA 4HUMB 2PTTB 2ZOKA 4WO4B 4P9HL 3NA4A 1GGCH 5C0RL 3H42H 1BVLB 1MCWW 3RIAK 2PETA 1XGQA 4KJPD 5EORL 1UYWL 4F7TA 4KTYA 4B0MM 3HB3D 1DCLA 4GUPA 5CZXC 4OZGE 5I15H 4PJFA 3CDCA 1KBGH 3BZ4A 5I8OL 3I2CH 3CFKA 5IEKA 5KSAA 1H15A 1NBQA 4LLVB 5EBMA 3KPOA 3FKUS 3OAYK 5D5MA 4NUGL 1KTDB 3K7UA 4KY1H 4M1GL 3IU3A 4E5XB 4NQCD 4BZ2H 2AAVA 4WIQA 4KROB 1KNOB 1LO5B 4GW5A 2QQNH 3T0BA 5KSBA 2PXYD 5F1NA 2IQAB 2V2XB 1CIUA 4MYWB 4PJBA 1KIPA 3EOAA 4LF3B 1RD6A 1KUMA 1GGIL 3LQAL 2HTKC 1XT5A 4Z6AT 1NCWH 1UQSA 1DN0B 3UO1H 4RWHA 4L8CA 2X4SA 2X1OA 1T5WA 1C5CL 4WW1A 5E6IB 1A1MB 2N7BA 5DVOA 1YNLH 1ZLSL 5HHXL 4JFDE 3IFOB 2OP4L 5ICZA 5B4MC 4OZGF 2XZQH 1A2YB 4MXVE 1JCKA 2V5MA 4C83B 4PJDA 1J8HB 3DOSA 4KKBC 2GSGA 2CRYA 1CWVA 2EECA 3U4AA 3IDUA 3NVQA 4DZBA 3I3EA 1N5AB 3X12B 4TVSa 3MOAH 4D0CB 4HD9A 3U0WL 4U1IA 1CDGA 2Y07L 3DVNB 2R2HA 1BBDH 1ZHKB 3QA3A 4X6FA 1EAJA 5DF0A 1T21A 2QTEA 4M7JL 4GKNA 5AUMB 1WF5A 4QRRB 1WAAA 4ODTL 1HSBA 4F8TA 5J1AA 2F54D 2BMKA 1K3IA 2V2WA 4XP4H 1OTSC 4ETQB 3OKKA 4QHUB 1GOFA 1FGNH 1LDSA 3MLWL 3RKDC 3NIDE 1SJHB 4LHUB 4YFLI 4NM4L 1I9EA 4KKNA 1JPGB 3N9GL 5BV7H 4GRMA 4XVUD 3ARSA 2FB4H 3DX9B 4M6MH 1CI5A 4RBPH 5IV2B 1HYSC 4NO5B 2A6JB 3BAEL 5JW5B 4IJ3B 4RRPA 3H7BB 1JGVH 4WEMB 4ODVL 2VL4A 5IFJB 2GSIB 2P49B 1NFDE 3R0MA 2A6IB 1YMME 3QCTH 5IM7B 4RFOH 2VDOH 1P7HL 4QRRE 3E2HC 3MREA 3ES6B 2CRIA 4LSPH 4JB9L 4MA7H 1ED3B 1SYSB 2DQCH 4G7YH 4M3KB 1NGPL 1K9TA 3VFSA 3F65A 4HJGB 2G75A 3FRUB 4D0BA 1KC5H 2F54E 4WU7B 3OF6A 4LSUL 4F7MA 1QNZH 1DQLL 1YY9D 5CGYC 4KK6C 4PJHE 1DQQA 5DMYA 1YJDL 4Y4KB 5D71L 3DI3B 3IXTB 1CICB 3L3GB 4HH9B 5B39G 4WI4A 3FN0L 3VD4A 4LVEA 2X4PA 4PGEA 1PGRB 2OTWA 5DHXB 1GHFL 4M7LL 3BKML 5D71H 2XZQL 4PG2C 3MOBL 4GW4A 3OSKA 4TQEH 5KW9L 3DGCR 4PJAB 5DQJB 3VXRA 1F00I 5EU4A 1ZGLA 4GBXB 2PTVA 4M3JA 5C3TA 4UT9H 3AXLB 5F88A 1AO7B 2OTPA 3MO1A 2RHEA 2VR9A 1DEEA 2UY6A 1T66D 4JFQB 3KNBB 1FL6A 2DBJA 4ZS6D 4LSVL 3BAEH 2VLJE 1KEGL 2FIRT 3W0WB 4LCWE 3V8CA 4KK8C 1UH4A 3R4DA 1FFPB 4MD0B 4F3FB 4WFEE 1CYGA 4FXKB 3HLAA 4PBVC 4ORGB 4PRPD 5B38A 1GVIA 3EYVB 4HK3N 2NYYC 5HDBF 1QSZA 5HYSB 1CGXA 1WUNT 5CJ5A 2ZP0T 3FQXB 3BPLB 2NW3B 1JRHI 3O9WA 2W1NA 2ZSVA 3PIQB 5F44A 5INDB 5I8EB 1EK3A 3O2DA 4KHXH 3ZHLA 3MRDB 4KRNA 1RZFL 4B7IA 1KFAH 3HC3H 4P5TA 3TBYA 4K2UL 1XZ0B 2HFTA 1A2YA 5CEZD 1CIDA 1A4KA 1OY3B 1KELL 2E9BA 1AHWB 3CVHB 5DI8B 5C07E 4XAKD 1T4KA 4LPUA 2ARJB 3V4PL 4MXWL 5EO1A 5E6IA 4WU5A 5J9PA 1QBLL 5I18L 1HINL 2PO6B 1QNZL 4LDEB 4PRDB 2WQ8A 2J88H 3CFEA 5TF0A 3QJHA 2IAMB 3TIEA 1DEDA 2JJUA 3GK8L 3ABZA 4UNVA 2Y5TA 2GFBA 1IRAY 5ISZB 3MRPB 4W70A 5C0BB 5J6HB 1JYVA 5FKPA 1QSFA 2V9QA 4LARH 2CH8A 2W38A 1DBKH 4FFYH 4CMMA 5GS0L 3PWLB 3HN3A 4KJYB 1F6LL 4FQ1L 1HIML 2NY5C 1U36A 3UJTL 4JO3L 4KKCC 5CEZL 3KPSA 5DK2A 1OPGL 1SEQH 3DLQR 4GUPB 2AKRA 5T1LD 2VL5A 3LOWA 1Q9LA 2A74B 5E95B 5FHAL 1BVKA 2LVCA 3GJFB 1S7UA 3RBSA 1QRNA 3L95A 3WIIH 3QUKB 4ZPVA 2NX5B 4AL8H 4HC1L 2VN7A 2ADGA 4WFHD 3OBAA 3SE4A 3U9UA 4ZTOH 3VI3E 2Z35A 2F54A 5C07D 1TQCB 3EDEA 1EXUB 3MLSL 2OZ4L 5DA4A 1HHIB 4KV5F 1G0DA 1IAOB 1V3MA 1M71B 5TGBA 1HXYB 3EO0A 5FCUH 4XMKH 1C7SA 1U8QA 3H9SB 1BOGA 3S8WA 2D7TH 3ARPA 3S37L 5FUZH 4KTEL 2HN7B 2OJEA 4NPYA 5DQ9A 4NQTA 1VKXB 3R0NA 4JKKA 3IF1B 3V6FB 1FORL 2QADC 5HHXH 2O5XH 4M7ZC 3VRIB 3QIBA 1JF6A 4XVJL 4PJ5A 3N1QC 3BEWB 3CX5K 3RTQA 4Z77A 2VWEE 3GBML 3U4BL 4WNQA 2ZNXA 3C8HA 4XXDB 2VLLA 5I18H 3MX0A 1Z9MA 1R3IL 1WK0A 5E2TH 3RVVC 1PG7X 4WJ5B 4XC1L 4E42A 1MHEA 1D5XB 4EOWL 3PQYA 1T7YA 3QUZB 1EJOH 1U8LA 3IJHB 5TF1H 3S4SB 1YN6A 5KVFH 3PWJB 1R3IH 4ZNCD 4XB7A 1HOCB 2EE9A 4MX7A 4UB0H 3O6LL 4WW2F 3W11C 1YMHB 3OKMB 3VFVA 2DM3A 4Z7WA 1G9EA 4KXZI 3GIVA 3PGDA 5IVZA 4LIQL 5TFSL 3B5HA 1R6VA 5D6CA 2FX8L 3KPLB 4O51B 4EBQH 4I0PB 4OLVH 2I9LA 3ARFC 3D87B 3L6FA 3QIUB 1S7RB 2Z31B 2V2TB 3RI5K 3WN5A 4NKMA 3OPZL 5E2UL 2OZ4H 3W5MA 3ETBF 2NY3C 2J8UF 1SY6H 1KCRH 2EH7L 2CGRH 2WUBL 4DOHE 1EO7A 4FNLH 3U0PB 4C56D 3OKNB 4NDMB 1B4JH 1MAKA 4YDJA 1MLBB 2Z93B 1FORH 2WUBH 2IALB 3EFFA 3LHPL 3SOBL 5D8JH 1U58A 3BGMA 5D1XB 3DXAB 5EG6C 1S7VA 1T1ZA 1U8KA 3LQZB 5E9DD 5GZNC 2E7CA 4YH6A 3FN9A 3HE6C 3QDMD 2XN9D 1EEYA 2JIXD 4Z78A 5FOBB 3MLYH 3WFEL 4YHNB 4K3GA 1QFUH 3NACH 1K8DB 4IRJD 4QHNA 4JLRA 1AHWC 1UXSA 3FMGL 4R0LB 1D6EA 2WUCL 4PJFE 1O7SA 1EHNA 3FZUC 4I77H 2OXHA 4XP9L 3QIUD 4P2RE 4JM4H 3E6FA 1UM4H 4XCNB 3EYOB 3GJEA 4OJFH 3FRPG 4HKZA 1JPST 3Q6GH 1J5OH 1WTLA 4U1HA 1RURL 4ZUTA 4E41B 2IAMC 1JI1A 4OCXL 5FDWB 3QUMH 5C09E 4H25B 2EDKA 2IJ0C 4X5XA 1OCWH 4Z0BL 3PXJA 1DBMH 4YE4H 1JPSL 1A6ZB 3OAYH 2RB8A 4NQXA 2YK1H 3VXUD 1JN6A 1BZQK 2FIKA 4OV6F 2DQUH 4HAFA 1U8NB 5DD5H 1BOYA 2HJKA 3VFTA 4MJIA 5HYJD 4KQ4H 1OL0A 1KTRL 1CG9B 4HT1L 4U1JA 4G6MH 2IG2L 2E7LA 4LCYA 4UIKL 3JWOL 3NGBB 2CDFB 25C8H 1E4XH 4MZ2A 4Y2DA 5MP6H 1W72B 5I71C 1C16B 1IGMH 3AY4A 1FVCA 4M6OL 5ITFA 5J1SC 4C4KT 5CKGA 4JG1L 4IS6B 3MRPA 1RMFL 4KHTH 5CINH 3WD5L 3BP6A 4I2XE 4M7JH 4Y89A 2J6EL 4K3JL 4UIKH 1NC2D 1UEMA 4AM0B 1OM3L 3WSQL 3T2NH 3NIFF 4P2OB 1JTTA 2R29L 5D1ZB 4BFIB 2OQJA 2ZUUA 4S0SD 4X80L 4NRXB 1L0YA 2BC4A 3EJJX 3AGVA 5CFHA 3WJLA 1MCWM 1P2CB 3MGTA 4HUXA 4UUJA 3RGVD 2KKQA 4Y16B 4WI3A 2C1PB 4JDZA 4UT6H 4NQCE 1ADQL 12E8L 1DBBH 1QR4A 3H9HB 4YGVB 2BXYA 2APWA 3NH7L 1TETL 4UBDC 5IROC 1J0KA 5L8LB 3D85A 5FGRA 3QB7C 2UVEA 1ZK9A 1ZOXA 4CMHB 1BLNB 1PKOA 4QTHA 5I1IH 5GQBA 3MRDA 4CJ0A 3TJEH 2GITA 2YUWA 1LO4L 3MOBH 3LH2L 5C2BL 1QFWH 1N6UA 5DQ9B 2MNUA 5GS0H 3KPSE 4Z7NF 1JWMA 4PJ5D 5B39B 5C2BH 4PP2B 4XPAL 4OF5A 3KDMA 1TQBC 3FN0H 4QGYA 4HK0A 3U9PH 3U48A 1DQDL 4FN0A 2C4FU 2P8MB 5MHSD 3GZKA 2BNQA 4YHML 1JHKH 2F53B 3VDCA 4OLWL 4G6KH 4CDHA 3BXNA 3ZLQC 5DUBB 1RVFH 3WLBB 3QHFL 3MUGA 1INEL 1Z9SA 3K8KA 4XNYH 4UAOB 2R56L 4F15C 2CK0H 3C2AL 3BH8A 1MFBH 3G5VB 5IQ9A 1PKQE 3P11L 4NC1E 4XAKE 3SDAC 2AKRB 1GPOH 4PJAA 5I9QC 3KR3L 4HUWB 4KK5C 1JK8A 1TMCB 3EJZD 3V6ZB 2B8OT 4E0RB 3MRFB 4PJEE 4EBQL 3VFGH 4Q2ZA 4HUWA 2BDNH 4QTIH 1IGFL 3T1FA 5FGBA 1WFUA 5JMRA 4JZJB 3IDGB 5EH1A 4XCYA 3RVWC 5BOPA 2BFVH 3TV3H 3V5HB 1HXMB 1DQQB 5IFHH 1MCBA 3F12A 4RCAA 1JPFB 4HG4K 1LK3H 5EZJB 2XQYK 3QJHB 4XRCA 4M7KH 3RWHA 2MCPL 1T66C 3ULVL 4EOWH 4QXGL 2WP3O 4ZFOB 4NNXB 4F9PC 3BO8A 4NQEE 5E9DA 1W0YT 2EKSB 1T4KB 3Q5TA 4PY7A 5HHOE 2XN9A 3WV0A 1MNUH 1PSKL 4XMLL 1A4KB 4Y4HA 3T04D 3F7VB 3L3OB 1AGCB 1G7HB 4HGKC 1WZMA 4PG9A 1PZ5A 2NYYD 2IH1A 1RZJH 3JVGC 5FM5O 1MWAH 4OLWH 4R3SB 1IC4H 2X4TA 3WUWA 4FTVA 4XNZC 3I3DA 1T5XB 2BSSA 2D03L 2FEDD 3KYNB 4NRYA 5H94B 1D9KA 1S7WB 5EOCH 3WYRA 1J0HA 1LK2A 2PCPB 1L6ZA 1J8KA 4WY7H 2XRAL 4K94L 3P4OB 3DO7B 4XPBH 1RZKH 1E27A 1OAUH 4RMTA 3MRLA 3T09A 2QL1A 1CLOH 4PFEA 2GK0A 4KI5D 1F4XL 3BDBA 1WIOA 4QGTA 3G6JE 3PWPB 1WZKA 4OGYL 5HDLA 1ZLWK 4G8IA 4OFIA 1ONQA 3T08A 3STLA 3EO1B 3MLTA 3D9AH 3CXDH 4HDIB 3FFDB 3HFML 1A5FH 3VFUA 3CU7A 3GSRA 3EDFA 4R9HA 2O93L 1QLRA 4HUVA 1BAFL 3RWDA 1OGAB 3HZVB 2OJZH 3LS5L 5JZ7C 4JAMB 3G6AB 4JDVB 3VWJA 3EYFA 5IVXE 4I3SL 2FO1A 4OZFB 3RBGA 2X9WA 4CVUA 4Q2ZB 5BS0D 2KZ1B 5I1HL 2W9DL 4JFFA 1MJ8L 3ECBA 4GRLD 3MLYL 4P5KB 4K8RL 4K9EL 4LU5H 2FJGA 5B38G 5KAQF 4BZ1L 1LK2B 3EUUA 3CMOL 1YEIL 3UTPD 1NL0L 3O8XD 2VQ1A 4M43H 4Y4KA 3MLUL 1A21A 4H88H 1J7VR 1KCVH 3NAAH 3U36B 1QQDB 1PYWA 1A7RH 5EUOE 3ARVA 5DD1H 5MERB 2QSCL 1XF5A 4G3YH 5KVFL 1KENL 3SGKC 5T3XL 5CZKA 1NSNH 4YPGA 4EVNA 1G9ML 3V4PH 4L8DB 1H15B 4POUB 3HB3C 3TCLB 4R0LA 3GSNL 1YEFL 2JJVA 1RZIB 4PJEB 4U49A 4DK3A 1E4WH 1L6XA 3GBMH 3M8OH 2BJML 1N2RA 3SDXE 3P77A 4N68A 4P3CH 1FNSH 3O45A 2JB6A 5HDQL 1ZEAH 2DD8L 3RL2A 1RJYA 2VXUL 2OCFD 1P84J 2H26B 4JO2L 4A2MA 3GFUA 4UNTA 4PJIE 3UTSB 5CGTA 1UJ3B 4QCIA 5DMGC 5EN2A 1T1ZB 1U8KB 4BFBD 4X98A 1U9KA 2GY7B 2Q86A 3L3KA 3MCLH 4JY6B 4YHZH 4GG8A 2NY1D 1T20B 3B9KD 1FLRL 1CL7I 3TCXA 2DTSA 5CLTA 2WBJC 3RDTD 5EC1A 1TITA 5D5MF 3QUYA 5DVNA 2B2XH 4Q58C 4XZUA 4U0RB 4M93C 1NKOA 4TUOB 3ULUF 4UINL 4FMKA 3SO3B 5K59E 1FL3B 3MRKA 3O6FC 3O41A 4GAJH 2P5EA 3MFFB 5F6IB 3B2UC 1R0AL 3ARGC 3UJIH 4HPYH 1FYTA 4U2YA 2VDPH 1IC5H 1WT5A 3HNVH 3WLBA 2R1XA 5HI4D 3NZ8A 4O2FB 1IGFH 1KCRL 1Q38A 2EH7H 5C0FB 1IAMA 4KXZH 5C07B 2F53A 4YDLC 3O6ML 2ZPKH 1IQDB 3PHOB 4NHCL 4RGNB 3I84A 1MSPA 3QUYB 4IDJH 4JZOB 4ONGL 2DB8A 3FO9A 3QQ4B 2OYPA 4Q9QL 3G04A 3RWGA 6CGTA 5HPMA 4AEHL 4P3DA 4R4FL 5JHDB 5EIVA 2I5YL 1N5YH 2CLRB 1Y18A 5HYIA 3LD8C 1WAAE 5JXAL 5DXWA 1FAIH 5KSBB 5E0QA 1S7QB 2X9YA 2V6HA 4K23L 4KRPC 4X5XB 5FDYA 4DKEL 4MAYB 4S1DD 1P4BH 5KN5A 3D85B 2WBJB 4OZIB 2FX9L 2MQ3A 4IEFB 3L7EB 1JIBA 5EULV 8FABB 2WZPD 3QIBB 4LQ1A 3IDYB 4Y4HD 1CE6A 4OLYL 4F9PA 4GLRH 4KU1A 1GXEA 2X44D 2VO5A 5DJZA 5DFWH 1JGLH 2DQGH 4TSCH 1OAXL 1JF1B 2FNBA 4CN6A 3GGWA 1UXSB 1VFUA 4K7PL 3QHZH 2FB4L 2UVFA 3SQOH 3I9GL 5IJVB 4IRJC 3CDYA 5TH2B 3OKDB 5L8JB 4LLWA 1H5BB 1TPXB 4DVRH 4M1DL 5T3ZH 4LBEA 2K7QA 1ZGLP 1WWAX 4HS8L 3BGMB 5D1XA 3V4VH 1EFXB 2GCYB 3SGEI 1REIA 2K1MA 1WBYA 3CC5A 4APQA 4KMTH 4QOKB 2BFVL 3MBXH 4OGYH 3S34H 1F4WL 5DJCA 3FT2B 3ARTA 4MWFB 2IAMD 3KVQA 4ZG1A 3QI9A 2XZAH 4O58H 2MWCA 3SKMA 1N6VA 3RUGF 3VRLE 5C0JA 3VWJB 3O11A 1AXTL 3KYKL 5JXEC 3TNMB 2ESVB 4I18B 5IMMB 3O0RL 2HTLD 4G80A 5INCB 2GJ6A 2PW1B 1ACYL 4NQXB 1QR1A 3FQRB 1P53A 3VXNA 2NCMA 4AJ0A 5CMAB 4HWNA 1CF8L 5CILH 4LP5A 1G9NL 4R96A 5FIEA 3BPOB 1JNJA 2QEJA 5D7IA 2CKBA 3VXRD 3FB7A 4HIIA 4JN2A 3BKMH 5HVGB 3BVNA 1WCBB 3BKYH 1E27B 1JHKL 3ZKQD 4M8QB 1AGEA 4IRJB 5ESVA 1HILA 5DLMH 4LLYA 4S0TD 3PHQA 2R0LL 1D9KB 4OGXH 3DSFH 3ZKSD 3OX8B 3RIAF 3QUZA 3MJ8A 5HGBA 3FOMB 1YNKL 4W68A 4HFUH 5ICYA 5F71A 1AGCA 1G7HA 4PRPA 4G42A 3QXAB 4F15B 1J18A 5B8CC 1H0DA 3UYRH 1OVZA 1P7QD 3TYFB 1I8MA 5FYLE 2FR4A 3E8UH 5T5NG 3BO8B 4U0QB 3LEXA 1KBGL 4YDVB 4ZFOA 4LVHC 5DHVH 1AP2B 1CLCA 2D4DA 1MHHA 3EYVA 3S3PA 1U3HD 1BOGB 3O0RH 1A7QH 5C0RH 1Y6KR 2CUIA 4F3FA 5F3HB 4P4KD 3LAFA 4OM1L 4G6JH 4NO0A 3H3PH 4OUUB 1PQZB 5IVNA 5FEBA 3AS0A 1RJCA 1ONQB 4JFQA 4P4RB 5F8QC 2HFGH 3TIDA 1F90L 1G7QA 5SX5H 3FFCB 1KYOK 5KG9A 3DGGB 5IMOA 2E7LC 3PABA 4AEHH 5A1AA 1Q0XL 4Q97A 5DR5L 1JGVL 5FV2A 5IESH 3SDYH 2AJVH 2VDQL 4NHUA 1HKLL 3BEVB 4LSVH 2GY5A 1DQJA 3FQUA 4QY8A 4EXKA 3HZKB 2OTWB 2DMKA 3ROOB 2F8XC 3S36H 5JDSA 2KUTA 1BFTA 5EN2B 1BZ7A 4L8BB 5F7DB 1U3HB 3GBNH 1A6VL 3MJ9L 4TVPD 2HT2D 3ALPA 4MHHG 3RL2B 3WL9A 5I1IL 4XI5D 5T1DH 1GAFH 4MA1B 1YZZA 1L9NA 2YBRB 3HRZB 4PJXA 1JYNA 3H0TA 3UBXG 3DIFB 1QVOB 5FYKH 3KPRE 1FAIL 5LQBL 3TIEB 1SYSA 1BQSA 5DFVD 4OCLC 3AFLA 3WFHA 4AENB 3JTTA 4P9ML 1IEAA 3BZFB 1CGSL 1MF2L 1NCDL 5D93B 3GUTB 1HXYA 3WKNA 3VFWA 5E1HB 4LLDB 3SDCB 5CS7A 1GOHA 2EYTB 2C1OB 1D5BA 1ZVSA 2J6EH 2FD6L 3QP3A 4K3JH 3QG6A 4NO3B 4WUKH 5DI8A 1TJGL 3KXFB 3WLWC 3FTGA 2DQHH 1S8DA 4X7TB 5DJ0B 4HQQH 4HXAH 4ALAL 4BQ6A 5IBLC 2XTJB 2BNRE 4P5TB 1FNFA 3L95B 4WTZG 2OXGA 4OM0H 4QNPF 4OZIE 1YNLL 4GQ9H 5TPWL 2VL5B 3BE1H 2NW3A 1OAYL 3KHQA 3S35H 1FG2A 4LHJB 5EWIL 3I6GB 2CGRL 2E7MA 1BEYH 4HS3B 5T1KB 3DMMD 1GGIH 5C08A 3LIZH 3FO0H 4KJYA 3GSRB 3WN5C 1ZHKA 2BVQA 5I1JL 3REVB 1UWGH 1NMCC 4G8IB 2ICEA 3REWB 4OV5A 2G2RA 5TFSH 4DN4H 4JPKL 1W72A 3K8MA 2A83B 1S5HB 1IC4L 1UM5L 2EYSB 1IGTB 4U6XA 3RA7L 1LD9A 3FQTB 4UV7L 5FUCE 5IWLA 3X3GH 5FYLH 1NFIA 1UWGL 4Z0XB 2P5WD 3VD3A 2VIRA 4O2CB 4XBEL 4R90H 3VW3H 3DV4A 1ZLWH 2BNQE 3QO1A 1JWMB 1DANT 2HJKB 3VFTB 4P3CL 3ROLA 1R5IA 3MC0A 5BW7A 4JFPA 5HVFB 4MXQC 3BISA 4QRPE 4YHKH 4PJCB 1NCBH 3ME0A 1RU9H 3SGJC 1JPTL 2DQIL 4S1QH 3AM8C 5AG9A 3QDAA 1NSNL 4F7PA 1A7PH 4XPHL 1ZVHA 4GBXC 1RZ8A 5F97E 3O8XC 3THML 2PTUA 2VTFA 3X13B 4U3CA 3S88L 2WQRA 3DARA 1FFRA 1KNOA 1FPTH 1HQRB 4ODUB 3O9WB 3BGFC 4HQQL 4HXAL 2G75B 3U0TA 3VFWB 4UILL 4HLZG 1KCVL 1T80A 1VACB 4GKSA 3SE8H 3W82A 5DVMA 4QTIL 3ES6A 1MEXL 1DE4B 5E8EA 4G6JL 3HUJA 4QYOA 1RZKL 1MQ8A 2UY7A 5KSAB 4BZ1H 2CIIA 1BFVL 5FOBA 2ATKA 1WCBA 2VSDA 5FKAB 5E2WH 3QDMA 1ZKAA 1KELH 3KPNB 4M4PA 2A73A 1L0QA 3EO9H 2NTFA 1NCCL 1R24A 5JR1L 4WEBH 4GQ9L 2PUQT 3QIUC 5F96L 2ZG2A 3HC3L 4HWBH 4P46C 1C16A 3PV6B 1X5XA 1MLBA 4OKDA 1U3HA 3QDGA 3BOVA 2HJFA 5EOCJ 5FYLL 4U6YB 4FS0A 5F7WC 4LCYB 1MCNA 4HFWA 2IAND 3EZJB 5DMGD 1I8KA 3V6OA 1CS6A 5CKAA 2VABB 2CMRL 1OPGH 5MEQB 3QI9B 3G5XA 2ZOLB 2A6DB 2F53E 5TF1L 3WFCL 1CFVL 4FQXB 1A14H 4LVNB 4X6EA 5BRZD 3DGGA 3FT2A 5D5ME 1MHCB 1F4YH 1M6OB 5BV7C 2PO6C 1F02I 5DLML 2VLJD 2YKLL 2F74A 3LD8B 2XQBL 1SMAA 5KSAD 1MH5A 1T0NA 2GW5A 2IGFH 5IB1A 5F89B 4LPVA 2IQ9L 2A38A 3MRHB 4P49A 3E6HA 2BY1A 3PWJA 1J0ZA 3RVUC 1R3KA 2ZUTA 3BP5A 4FABL 5AAMA 3HI5H 4X6DE 1YEFH 3O2WH 1WVZA 3DJ9A 3RX5A 3VXUE 5F7HA 4JKWA 1S7VB 5I1AA 1IAIH 5JDJA 2VLLB 4Y5VC 4LF3A 1BLNA 5D7KD 3HCVA 5KOMC 2Z9TA 3KYOA 4OLZL 1QO3A 1UWEL 3QRGL 5ILTL 3RGVA 5J06A 2V2XA 3OL2A 1DQLH 1WISA 2Q8AH 1JPGA 3N1MC 4M6NH 3U0PA 3QJFA 3E1F1 1A1NB 4KROC 4LPTA 3DUUB 3OKKB 2AK4D 1TFHA 4KRPD 2NY1B 1AO7D 4EIZC 1I9IH 1F3DH 4BSWB 2NY5L 1BM3L 2JB5L 4JZOA 1HHKA 4G9DA 4YXKH 4DK6A 4YWGL 4HBQA 2HKHH 1HHIA 5E24E 3KLSA 4EIGB 5BVPH 1MVUB 3FB7B 2VLMD 2WIIB 5F9DC 3SO5A 1TENA 4O2FA 1YN7B 2VLRD 5CIPH 5J8OA 4YWGH 3Q6FB 3OKMA 1WEJH 1NLDL 3GMMB 5DHVB 3BQUA 3QCVL 1OP9A 1EH9A 2EXYD 3ZO0A 5JPMB 2SEBB 2FX9H 3GSOA 1FSKB 2VH5L 3MLZH 4JPVL 4LGRB 5IG7A 1YEJL 4G9FB 4BUGA 3IDMA 4I18A 2QSTA 5BOZG 2HRPL 5EPMB 5SV3A 4XHJD 4NN6C 5KANI 3QEGL 2ORBH 4TULL 5IHUH 3VFOB 1BF2A 3WEXB 3CCHA 1OP5K 1XEDA 2AI0H 3DSFL 1Z3GL 5D2LF 5DS8A 5TDPB 4J8RA 4XPTL 1JFQH 2R0KH 1KF9B 3LRHA 1KTLA 3OHXB 4WY7L 1JFQL 2R0KL 4Q6IB 4O58L 1LP9B 2X42A 4RGNC 1UH2A 3HUJF 1URLA 5JXED 1YEHH 5D72H 3JV4B 1IEBA 1OLZA 3HA0A 1KFAL 1VEOA 1IFHH 3WUZA 4P2RB 3QIWD 1R3HB 2JCCF 3WO4B 2EE2A 4FQPA 1IM9D 1KTDA 1FDLH 3P73A 3GI8H 5FAAA 5D6DC 1T22A 2WNGA 1P69B 5DSCB 2FX7H 3RY5A 4YPGB 3GKWL 3SE9H 1UZ8B 5KSVB 1CFNA 1MCEA 1I4FA 2Q87A 5AWNH 4L3EE 5DHVA 2H32B 3D3VD 1ZSDB 3HI6H 3NIFE 3ULSA 2QSQA 4KZEH 1ZHBA 5C0AE 2Q7YB 5CSBA 5ELIA 3LKOA 4ELMF 3GSVB 2P42B 1ORQA 5J1TC 5GGRY 3WD5H 3CFCL 1IAIM 2NY4B 3TJHD 4WW2C 5HYSA 3G08B 1NJ9A 3QNYB 5J11B 2ITCA 3GMLB 3RWGB 1JHLH 2B1AL 4P5KA 4EN3D 2YD8A 4Z7WE 3IJSB 1HHHB 2FEDC 3VGAB 4R4FH 4DWHA 3QAZC 3PL6B 3DNKA 1MCIA 4ODHL 1P1ZA 25C8L 3RJDA 3LKSB 4YDIL 4E9LA 2YPVL 4ZDHB 4GKZA 4PGBA 3VFRA 4NCDA 4JN1H 1EO8H 2AP2A 5GGUB 1EJOL 1DJSA 4HUVB 4DN3H 4CVWA 2YSSB 4Z7UF 3WMSA 1LE5A 1P4IH 3WO4C 5HY9B 4NC1C 5BRZA 2Y9RT 1PY4A 4R4BB 1DSFL 3V6OC 2APVA 1PVHA 3VXRB 5F7FA 1KG0B 2BK8A 3T2OA 1FE8H 4LPYA 3V4VL 3WJJA 5MHSE 3T0EB 1U8LB 4GSDL 3I6LD 1AC0A 1X5YA 3AREB 1N6QL 1QFHA 1KEMH 4HGMA 2CRMA 5HVHB 1SYVA 1FNEA 4B50A 1BQHA 3KYNA 1XMWA 1A3RL 3QO0B 4GRLC 4HCRH 1OT1A 2XI9A 4EXPX 3VXME 1RIUH 4W81A 3WFEH 2X2YA 4C57C 4MAUH 3S6CA 3OG4B 1U42A 4PJAE 5FGSA 3VFSB 2LFGA 2O61B 2BNUA 5D8JL 4HPYL 1RPQA 3V6BR 2EKSA 2MPAL 2UWEF 3MZTA 4LCCA 1U3JA 5CBAA 2HG5B 4XH2B 1FCCA 3MUHL 1DBBL 4G8GD 3KLDA 5CBEB 2VABA 4UINH 5I1JH 1N64L 5GGVH 1I8KB 3BN3B 3GNMH 3RI5F 1S7SA 1QA9A 3C6LD 3Q1SH 5L7XH 2XWTB 2YXMA 3MV8A 4WEBL 5CZVH 1UACH 4XPFL 2A9NH 4HS6A 3M1BA 1I1CA 1AO7A 5A2LH 5F88B 3ARED 4WEUD 1PYWB 3B3IA 1KJ3L 4GT7A 3PV6A 5C2UB 4FG6D 5LWYH 1ZGLB 5FYLD 3LV3B 1Q1JL 2B5IC 3QZWA 2HVKA 4L1HA 1RK1A 4MGXA 3KJ4B 3QWRA 3RZCA 1T1WB 2K3TA 2DIAA 4M48L 2FECL 1UH3A 2LAAA 3OXRA 4P23A 5F7MC 5ESAB 5HHVL 3NTCH 3CLFH 1SJEA 5CD3B 4Y1AE 1IILE 1FBIL 2EO9A 3PWLA 4R2GD 5LWYL 2AJSH 2HLFD 1MFDL 3MROB 4JG0L 1YECH 2NZ9D 1FQ9C 4J6RH 2LU3A 5DO2C 5T1MB 1BHGA 5FKPB 2XZCH 5GXBB 4L9LB 2BX5A 3VFUB 3BQUC 3MRQB 4OD1L 3EO1A 1S3KH 2MSPA 1HE7A 3UROR 3IGAB 4XP5L 3CD4A 2IANE 4AL8L 3MRIA 4OQTH 4M8VA 3WFDH 2AJSL 5MENA 3CFEB 2Y7QA 1RZFH 2HFEB 3VWKC 2AJZA 3UZQA 1TIUA 3JWOC 3K4AA 5FHAH 3M45A 4JO4H 3OR6A 1UM6H 1LEKA 5IVXA 1FRGH 1JNLH 2X4RB 3H7BA 4P59H 1UM5H 3ARFA 1IGIL 3FMGH 1W0WB 3B9DA 2F58L 2W9DH 1SM3L 5AYUH 5KVGL 4I5BB 5TQ0L 1IM9A 1FO0L 4RGNE 4FZEH 5GRUH 2W0PA 2W07A 3WNOA 3HRPA 1HKLH 1T2QL 3ZKNC 1MQKL 1NUDA 5FA4B 4H1LA 2A9NL 4PJCF 4LCWA 1MEXH 4UDUA 1A5FL 5C0NC 2Z8RA 4K71B 4OTXL 4NKQB 4S1DC 4X7FC 4FP8L 2YD9A 2A77H 5TPWH 4GBXD 2X4NB 4G8FB 3JWDL 3ILQD 1S9VA 2C7UB 3QQ3B 3C8DA 2BHZA 1GRWA 5D2LB 5CJBA 5DTFB 4P2OD 3INUH 4DGYL 3U7AA 1FL6B 1QKZH 5C9JA 1S78C 1DQDH 5DT1L 15C8L 1JPFA 1EGJA 4RWYL 4JZNB 3BP6B 4EI5D 4NZDA 3QPXL 2IC2A 3VGHA 5IKCA 4PGDB 4KC3B 4MCYA 1FVCB 1LGVA 2EYTA 3MRGA 1HHGA 3OQ3B 1KEML 5GGRA 1KTKE 1YEDB 3F5WB 4UU9A 4P5MB 3GRWA 3O6LH 4WHDA 3MJ9H 1MWAB 4G43A 5FK9B 4BM7A 2ZCKH 3DIFA 4Y0GA 4ZFFB 1ADQH 2YPLB 1KPUA 3OJ2C 4NP4H 2H2PD 4JHWH 1HI6B 3EOBB 2BNUB 4FQ2H 5FECB 4ZXBD 3HE7B 5FO8B 1I3VA 5L2KD 2F5AL 1QPPA 3ULVD 2BY3A 4KVNL 2J1KA 3FOLB 4JFYA 1KULA 5FECA 1FC2D 2PO6D 4PR5A 5C8JA 5IFHL 5FA3A 5TDNA 4JFDD 3C5ZB 4P57A 3FQUB 3HPJA 1Q9WB 1QRKA 4JRYD 1V8HA 3I75B 3WE6B 4EDXA 4KHXL 4J2XA 4OBRA 4WHTB 5J13B 2DJSA 5BS0A 4MJIE 5M94B 5ESAA 3O4LA 4PJDE 2VZ3A 3F5WA 3MUY1 4LCIH 3VXUA 2IEPA 1T1WA 5CHNA 5FUOH 4BQ8A 4P2QA 3CU1A 2A2QT 3TN0D 2N56A 1EBPA 5BRZE 4MCYB 5DMJB 2NY6D 1VFAB 5HYFA 4QHLB 1FNLA 4JVUA 1AQKL 4ISVA 3ARDB 3FB6B 3UPAA 2CRZA 4OUUA 1HNGA 1Z3GH 5EOQL 1ITCA 2Y23A 4HLJA 4XNYL 4P3WA 5GGQL 3M1BB 2AJXH 2YSSA 4PRHE 5JOFA 4W6XB 1PG7L 4LSRH 3T0VA 4JFEE 5C0CE 2ID5A 5DJ8A 4G6KL 4LGSB 4PB0H 3D18A 5K9KB 2YWYA 4YHMH 3DPBA 2NXZD 5HD8C 1YC7A 2W0LA 1YEGL 2Y6SC 5I1EL 5EO0B 3T0XA 4D9RD 3MRCA 1G1YA 4G42B 2B0SH 2M2DA 2GUOA 4M9OA 4PRAB 4U6HB 5EC2A 5FO9A 2X5PA 2F9BT 3KR3H 4QOKE 3FJTA 1T03H 1ZSDA 5TDOB 2Y4SA 4Y2DB 5L0QC 3MJ8B 5HGBB 4NQDE 2LU7A 2YD7A 4PJHF 5DJDA 5I0DA 3AB0C 3SOBH 3MBEB 3GMNB 5DGRA 4NO0D 4ZSOA 3P4NA 3TT3H 4F7CA 3SGKA 5MP6L 1KCUL 1AGFB 5CUSL 4IOIB 4Q9RL 4NJ9L 3OR6B 3QEQE 2C3XA 1AY1L 2I5YH 4AYFA 1N5YL 4LCCB 1G6RH 4C56E 5MEOB 1Z0NA 5D7IB 5MENB 5CP3H 2OR9L 4AQ1B 4R96B 4OLXH 4RGMC 4POYA 1MCOH 3IS1X 1UCBH 2FJHA 5DURB 3IU3B 2H9GA 1DVFD 1DBML 2P5WE 4DGVL 5T1MA 1DUZB 3SDXA 4LLVA 1N8ZB 4U31A 3FO2B 5LXGH 2B1AH 1IGYA 3BZEB 3BWAA 4NPYB 1FN4B 3MR9B 1TZHA 2MHAB 4AK1A 2MKLC 3FQNA 4L4TB 4QRUB 4WI2A 3IDXH 3TA3C 4WCYL 3UTQB 4UIMB 1IKNC 4J3SA 5IHLB 4OBSA 3IDNA 3KPQA 3V0WL 5DFVC 2WUCH 1MPAL 3QUYC 4DGVH 1Z9LA 3VGFA 2VAAB 4DVRL 3KLHD 1RK1B 2D7PA 1WBYB 4J3OC 1RJLA 4OGAC 4YBQD 3NCJL 2FHCA 1XGPB 4NUJB 5D2NB 1WC7A 3MJ6A 2XNAB 4D9QE 2AJYH 1CT8B 3DXAE 4GAGH 1NGQH 5B22A 2Q76B 3T8XB 1Q9KA 2FO4B 3SCMD 2XZCL 1LE5B 3L3HA 4GXUN 4FQIH 4NZRL 4Y19D 1VSCA 3DX6B 3WSQH 1S7UB 4Y5YB 1IEHA 3DV6B 4OLYH 5KSVA 2WIIA 1WICA 2XWBA 5IBLD 1TZIA 3IDIB 3GI8L 4U1NA 5F3BA 3MCLL 4TNVF 4KHTL 3BIKB 5F7NC 2BNRD 1RK0A 2NXYD 5T3XE 2IFGA 3JTSB 2JELH 2D0FA 2VDKL 2DLIA 3QIBC 2J5LC 1N8ZA 4OZHA 4U7MA 1ZT7A 3TJHC 5A43C 4F57H 1E4XL 2IBZY 1PEWA 2D2OA 2W9EL 5HJ3A 4KTEH 1I7UB 1PLGL 5F9WB 2ZCHH 2EIEA 4YC2C 2DM7A 4YAQB 3JV6A 1EFXD 3KPMB 4HPOL 1T04B 2QHLA 4ESKA 1OTUD 3DMMA 3K4ZA 3L3DB 1DQML 3VFVB 1QLFB 3LPGA 1XIWB 4RFEB 1AKJB 1LO4H 4XP1L 3KPRD 2VZUA 2D7OA 3Q1SL 4APQD 5L7XL 3PUCA 1N59B 4FQXD 3MRMA 3QYCA 1EBAA 2EXWD 2PYEA 4GW1B 5HYQA 3A0OA 3D39B 4LMQI 4P59L 4JRWA 4NKOA 1H3GA 4OCXH 2NY0B 3GMPA 3PNWB 1FYHB 1U93A 4Z8FL 1F2QA 2P43B 5IJKC 2PYEB 5CJOL 3MLZL 5BZWB 4MQXD 1SMOA 4O2EB 3C5ZC 3MLUH 4H88L 5E8NB 1MI5D 1IQDA 1TVBA 2R0ZH 3H9SD 4NJAH 1KXTB 1MHEB 5FM8A 3EHBC 3DX7A 2FWOA 4KZDL 4AH2B 4GAFB 1LO3L 3O3DB 3CPLA 4NKIH 4I2XA 3WFBL 4Y4FB 1EEUA 3QFDB 4KVCH 1CL7L 3QPXH 3V0VB 4RWYH 1M05A 4H20L 4PJ5E 5D6DA 3O3BB 5E56A 2NLJB 5FB8B 4OI9A 5C70A 1PG7W 3D0VA 3MV7B 3V6FA 1EIBA 4OUOA 1EGJH 3MV9A 4KDWA 3RVXD 4ZDHA 5K9KA 4UI2A 1UB6B 3IDJB 4Z7OF 1AIFA 3LEYL 3N0PB 1B4RA 2J6EA 3D9AL 4QRQA 3HR6A 4NYLA 5E7FA 4K9EC 3D39D 3BW9A 4MQTB 3HMXH 5F9JA 5GJTH 3BT2H 3MSPA 3MXVH 4HFWB 2YUZA 3VFNB 1OAQH 3MUZ1 4OZ4B 2NX5D 3QPQC 3RGVB 4XPBL 5C0GA 5FYKU 3NFSH 5CZXD 3WDJA 4NUJA 5D2NA 5IW6A 5AYUL 1Q9LB 4M5YL 1R5VB 3UTQA 3IFPA 3N1GC 1IGIH 4X7SH 5EIIA 1CDYA 3BWAB 4X9GA 5D7IF 4HF5H 1Z5LA 4JFED 3QDGD 5C0CD 4XCFL 4UNUA 1NUGA 3CFBA 4F7EA 3F7QA 6FABL 4PV9A 5JIHA 4J3VA 3AAZB 3MRHA 2FCBA 1NGYB 4ODUA 1QSFB 1VADA 4NC2B 4PTUA 5ADOL 4HSQA 3FFCD 2NY3B 4LRIC 4M7KL 4NKIL 3WJJC 5IR1A 5ADOH 5KSAC 3HCVB 1FZMB 5BQ7B 3S37X 1CGUA 1ED3A 4JDTL 1JZ2A 3F58H 4PJCA 4TPRH 4QF1B 2YEZA 4Z8FH 2CDEA 2VDRL 1UVQA 1OW0C 3BP5B 3BSZL 5B4MD 1UB5B 2GAZA 1U8OB 1ZHNA 3HZVA 2J88L 5BCAA 4ZSOB 2ERJC 3AS2A 4U6YA 3EOTH 3QDGB 1XZ0A 1V5JA 5HHNA 1UWXH 2B7DT 1F4XH 2P8LA 4YHKL 3E0GA 4QRSB 1BFVH 1SJHA 4LHUA 4YEEA 5EU3B 1R3JA 3LKNB 1J87A 2D03H 2XWJB 2F8OA 3O2VL 3GRWL 1GJIA 3VD7A 1V3JA 5EOCL 3SE8L 5DJ8B 1C5DB 1BBJB 5IHUL 4KAQH 1FRGL 1TCMA 1LWRA 5AUMA 2EIZB 3N06B 1OAKL 3G5XB 3EW3B 3HG1B 4P99A 1KLGB 3BP7B 2RFXB 3RKDD 1I9RH 4G6AD 2BP3A 3BPCA 4L3EB 4RFOL 4F33B 1BX2A 2APXA 3C6SB 1CGWA 4TSBH 1CXKA 2JCCB 4F9LC 5E8DH 4LU5L 4X4ME 5ESQA 4P2QB 3AXLA 1MAML 4NZUL 1CDJA 3FTGB 3QEQB 4K2UH 1CXEA 1D5BB 2GEEA 4U2ZA 3T4AA 4WW2B 3QDMB 1FVEB 2IPKB 4A2LA 4KZDH 4U05A 1LK3L 3JBG7 3GSUA 1AR1C 3Q5YA 3RWHB 4XHJC 4PJAF 2OLDA 4ONFL 3KPRA 2VC2L 1FZJB 5F6HI 5I66B 4FQQA 3CJJA 5CGYD 4XBGA 4PJXE 1Z6JT 3BP4B 3T3ME 1CICA 3L3GA 4HV8A 3RWJB 1YDPB 2B4CH 5ENWB 3O4LE 5SWSA 2ADIB 2NR6D 9CGTA 4CKVX 4PTUB 5DD0H 1TLKA 4GQPH 2LU4A 1NMBH 1S9YA 4DN3L 4PBXA 5IW1B 1LO2L 1KN4L 1MFBL 4JQIL 4LCIL 3ULVC 3PDGA 5JORB 5D7LB 1QHOA 1CFSB 1J1XH 4HS3A 5T1KA 1ODAA 4N0FB 4TQEL 5KW9H 4HIHB 5F7YC 3TT1H 4LFHG 3IAQA 4WFGD 3QIWA 4NQCB 5KVDL 4NO5A 1DBJH 1MHPL 1ZLUK 3VXMB 3C2SA 1T03L 2IG2H 3TIDB 3BPNC 2HT3D 1HHJA 4M61B 4W4OC 3ULUE 3DETD 4ZFOL 2FH8A 2IPTH 1WZ1L 2GI7A 4M1CC 4R97B 1CTNA 1VDGA 3I02B 3D48R 5C71A 2DTML 4PJGA 2P8PA 5I74B 4NM4H 2BMKB 4BSVB 3PWNB 3CX2A 3QUXC 1AIFB 2JTDA 1MHHB 4OLEA 2NY2C 3GMQA 1NC4D 3CIQA 4ELME 3O81A 5J0BA 5ECJE 4N8CH 2NLJA 3H8NA 4Y7MA 5FB8A 1I1AB 1I8MB 3ARBB 3VG9C 1CLZL 3ALXA 1DN2A 3V5DA 12E8H 3ESVF 1ZTXL 1MRFH 4H1LB 4L8BA 1GZQA 2IANB 3NACL 3BHBB 1ZHNB 1F3JA 1L4IA 4I5BA 3QDJA 4XAWL 3LS4H 1UVQB 1YJDH 3RWEB 4U0RC 1BZ9B 1NFKA 2J4WH 3NZHL 4Z7QF 2R0WH 3KJ6H 1KPRA 3MRMB 1EVUA 3SJVB 4C54A 3HRZA 4PRIE 3CSYB 2HFEA 5F1NB 3DMMB 3L3DA 3L1OL 2CKBB 4RA3A 1AD0A 5H2BB 3TBTA 5IMKB 2NNAB 1VADB 4MVBC 4OCNC 1U92A 5GGUA 3SPVB 1BIHA 1K6QH 1NCBL 2J8HA 4NP4L 3GSQA 3FONA 1PY9A 5I16B 3EZ8A 3VXNB 5GGTA 3U2SB 2Q3ZA 4FQLH 4OI7A 4BUHA 4MQ7A 4QT5B 2PXYA 1PW3A 1J1OL 1AP2A 5DK0B 1JRHH 1FDLL 1H3VA 3RWFB 3SKMB 5KVDH 1JN6B 3GJFH 1KACB 3BJ91 4KPHH 3Q48A 1RJZA 1O5DT 1IZKA 3JV5A 1OARH 3P0VL 2R2CA 5F70A 2VOTA 4PGCA 4XNUH 1QP1A 1U8MA 5IB5B 3S4SG 4CADA 3TO4A 3MOAL 2GAZB 4FG6C 5EU6D 2VXSL 3OX8A 1MRDH 4U1LA 3C5SB 3SCMC 1X6LA 4LLYB 1WWWX 2GJZB 1FBIH 1K8DA 1OD9A 3RPIA 3T4YB 2V9RA 5BQ7A 2FEEL 2OP4H 5IW3A 3MGOB 4HJ0C 3C8KB 4LOUC 5LBSL 4BH8B 3RU8H 2EEBA 5KANG 4LGPB 4DTGH 3NCYS 3TZVB 4EI6B 1JZ3A 1UA6H 3QIBD 4V2BA 2RGSA 3OTTA 4WFED 4JQXA 4K3EH 1JGUL 3SDXF 1LEGB 3WL9B 1NCWL 4GRWH 3N50A 1TTGA 1MJ7H 3MACH 2V5SA 3BQUD 4NDMA 4AH2A 4RMQA 1PX3A 1MREL 5B3JF 5IOPA 1X9QA 1CL7H 3STBA 1UKSA 4G80B 3CFJB 4PJGE 1CD0A 1CXIA 2W0FB 2R8SH 1QSEB 4LLAA 1I3GL 2Q1EA 3NN8B 4KFZC 4LEXL 3I3BA 4FMFA 3IFPB 3WN5B 5FYKL 2EXWC 4O9HH 3TWCL 4PRNB 1NEUA 1WT5C 2V5TA 1A22B 3G6JB 3QQ9C 3UTTD 3OGOE 1T2XA 4NT6B 1A7OH 3A67H 3VFMA 1S3KL 4YHOL 3GIVB 5CEZH 3BPLC 3I9GH 2R1XB 4HWZA 5BRZB 3ARFD 2P4AB 2FGWL 1AJ7H 2HWZH 3ZKND 3LIZL 4I8DA 3R1GL 1F58H 4GG6E 2ESVD 4J12A 2YRLA 4NYLB 3B2VL 4ZO9A 3OF6D 4AIZB 1RZ7H 4NN5B 4DJMA 1X4YA 4GFTB 4ODWB 4PJ9A 4XC3L 2R0ZL 4ONHB 4YUEH 3UPRA 2N1KA 4RBPK 4J23A 4OFYA 5FF6A 4WJ5A 4E42B 1Y6MR 3DBXB 4GG6A 3HPLA 3ZT5A 5I6XC 5DA0B 1UCTA 3QNYA 2HFGL 2C9AA 1YMMD 3FT3B 1FL5B 1OF2A 4P2OC 3CXHJ 4X0KB 1Q94B 1FP5A 3KYOB 3NPZB 4YUEL 3WHXB 4D94A 3G6JF 3K2MC 2XQBH 3VXQB 4JDTH 1WFTA 1VFAA 4NBYB 1UZ8A 1X4ZA 4LBEB 5K9OA 1NC4A 5C0EA 1C8PA 3LKQB 4HWEH 2NY7L 4H20H 1CFVH 3PWUB 4M62L 2FL5A 5EBLA 2HN7A 4YC2B 2ARJQ 4GRWF 4HEPG 2YPVH 4ACPA 5ACZB 2P44B 1LP9F 4I13B 4IRJA 5ESVB 4L4TA 4QRUA 2F8VA 4DGIL 1MY7A 1S5IL 1Q9WA 4GJTB 1I7TA 3VJ6A 3BVNB 5D1QA 1H3XA 1BD2A 4WHYH 3P73B 3JWNC 4MCZB 4OZGB 1S5IH 3ZE1F 1MNUL 4XMLH 5KSBF 1W2KT 4WUUD 5T5FL 3U30B 1JHTB 1A1OA 3HE7A 2H2PC 5DJXB 3UJJH 4HIEA 1MHCA 1I7UA 3OXSB 1UXWA 4N90E 5TE6H 4JY4B 2DQDL 3ZHDA 4WWKB 5DEGA 2UYLB 4LDOB 2WAHA 4OZHE 4TUOA 3WXVL 2DM4A 1TQCC 2FJGB 1BEYL 4U1SA 1VPOH 4MJID 4JY5L 2Q8BH 5HYJA 5EC1B 4QXTB 4L4VB 4HUNB 4JE4B 4LNRA 4AZ8A 1NUFA 2AEQL 5IHZA 1DSFH 3X11A 1ZWIB 1VEMA 4XVSH 5HGHB 3WHE1 1WJ3A 4MA8L 1F13A 5L8KB 3JXAA 5FM5M 2VLKE 5HYJE 1GGBL 3TN0C 1ERNA 4JFZH 4OGZA 3KLAA 3CSPA 1UCBL 1QBLH 1MRCL 3STLB 2BOCA 1A3LH 2VLJA 5DRXA 4LCUB 4KVCL 4PTTB 5EDXA 4HHAB 1GGYA 3TO2A 1VACA 2MHAA 1NBYB 4GKSB 3WS3B 4CL7A 2JKXA 2HMID 1U8HA 1VGEH 5EUKB 2ZCLL 2XPGA 4H0IA 4QHMB 3NCFB 2ARJA 1N0XL 1TVHA 4I4WA 2PCPA 3OB0K 1NGPH 4Y19B 1EMTH 3BDYH 1RUPL 5KVMC 2HT4D 2AQ1A 1PG7H 5GRYA 1ZT1A 4L4VD 4JY6A 4V1DD 5D2NC 1XF3A 2AS5M 2BNRB 5AZ2L 1KOAA 3DO3A 3QRFM 2Q20A 4M02A 3H3KA 3X3FH 2RQ8A 5LCVL 1RJYB 1HIMH 1F8TL 4YBLC 1MJJB 2X7LB 2VDML 2XN9E 2WWKT 4K7PH 2R9HD 1I9JL 4M5ZH 4CDGC 1R3KB 1W0WA 2EDFA 1A3RH 4NZUH 4I0PC 1YNTB 1LEKB 1WWBX 4MAYC 3U83A 1ZE3C 4YDKH 4XVTH 3PHOA 3W0WA 4P57B 3DVGB 3HFMH 3RJQB 2AXGB 5F8RC 1I9RL 1M7IB 3E6HB 2BERA 4KI5E 4K7FB 4WGVB 3B83A 2FATL 5J4MA 4WI6A 4PB9H 2DQFB 3SKJH 2Q3AA 4CNIA 4ZS7H 4GO6B 1HXMA 3PGCA 1XIWC 4Q6YA 43CAA 3GB7A 1EERB 4KK5D 2NR6C 1OGAE 2A1WL 4QXGH 3RY4A 3D18B 2B39A 1AI1L 1MRCH 1CZ8L 4EDWH 5J12B 3SKNB 4X6CA 2FRGP 2YN5A 4H5SA 3EFDH 1QEWA 4ZQKB 1NBVH 3D39E 4DFHA 1KC5L 5E2VL 5LGKA 2BSSB 4JVWA 3VXPB 2HJLB 4IHOA 3MJGX 3PHSA 3BH8B 3G5VA 4FTVE 3WNKA 4LCWD 2ZWLT 3VXUB 2YKLH 2AJXL 3BXNB 1IC1A 2HT3C 5H37G 3LQAC 1J86A 1TJHH 4D3CH 5MI0B 4POZD 1JPSH 1VGKB 1VFMA 2WINA 3LN5B 1QKZL 1JGDA 3S96B 4L8DA 5KZCD 3BPOC 1TNNA 2VWEC 3VCLA 5JOEA 3MLPA 4JFYB 3QHFH 1MJJA 4KDTA 3U0TB 5IB3B 2X41A 4YXHH 1KIQA 4XP4L 1OLLA 1ZHLB 3HE6B 2XXCB 4XNXH 1YEHL 4S1RH 5D72L 1JYXA 2BJMH 2AV7A 5L6YL 4PD4J 4WFFE 1AI1H 1RQ5A 2H3NA 3O2WL 4I4WB 4PRBB 3C09C 3QWQB 4MD4B 3OG6B 3MLVL 4E0RA 5KVGH 5DJ2B 4FQXC 4LVNC 4Z0XA 3P2TA 1V3KA 2UZIH 4OF8A 3QWOA 4TN9A 3VI3F 2JIXA 4X6CF 5HGAA 3RL1A 4IDLA 5DWUH 4MQXC 3GB7B 3MMEA 4X99B 3HNVL 1UM6L 5ID1A 4G7YL 4C4KO 4U1GC 1AXIB 3MV01 5L2KA 3DUSB 1KCSL 2J5LB 2V9TA 1JZ6A 2FLRT 1VGEL 5E8PA 4ETYA 5BW7C 1CDIA 3UEZA 1P7KB 4OFKA 2X1PA 4KUZH 1ND0A 3TNNA 2CDFA 2VN4A 3DXAD 5KS9B 3K0WA 4N0UA 3LH2H 4HKBB 2VZVA 5GHWL 3D0LB 3F6IA 3RVXC 3P4OA 4P23B 3WNLA 4PLJC 5JA8B 4MJ2A 4OQ1A 2NY6B 2HVKB 3DURB 3BKCH 3MV9D 2BCKB 3ZDZF 3T0WA 4UB0L 2EO1A 3Q2CA 5DRWA 2EDWA 2QKIB 4XCEB 3B3IB 3IKKA 3SHSA 4YHPA 4CVXB 3F7VA 3JWOH 5CD5C 1F97A 4LKXA 1B2WH 1LO2H 1I4FB 2DMCA 4JQIH 3QPQD 2I25N 3ARDC 2YPKA 3GJFK 1S7SB 2P48B 2RAMA 1AGEB 1A64A 3LDBC 5E2UH 5EU5B 3S3SA 3OJMB 3S96A 5HHPB 2MQCA 5IT2H 5I8CA 1VGKA 3H42L 1MFDH 5CBAB 4HHAA 1P2CA 4HUXB 4X7DC 2XY2A 5JMOC 3VWJC 2ICCA 4AENA 5KS9F 2FX8H 1F4WH 1RZJC 5D96C 5DRZA 4YPJA 5T1LA 1LO0L 2FJFA 5I19L 1XGUB 3LKRB 1G0YR 2QR0A 4P2RA 3QEQD 3TGXA 2EDQA 5BVJB 2PW2A 1K5NA 2AK4B 2IH3A 3VH8A 3O3AB 5ISZE 4IS6A 3MZGB 3L3JB 3RZCC 2HJLA 4IHOB 4NBZB 4XP9H 5HDBE 3S5LA 2IALA 3WBDA 5INCA 3KAAA 4XMPH 3DRQA 5IGXH 4HT1H 3VRJB 5CJQL 2EDHA 3QXDA 3QHZL 5F7DA 3RDTC 4CUCA 1FNEB 1EA9C 3ZTJH 3HZKA 1NAMA 3QDHA 4HCRL 4LPXA 2W65A 1OWRM 5A2FA 1PBYA 2EDEA 3KS0H 3VWKA 3O6FD 3FFCA 1BAFH 1QRNE 3U6RB 2ZG3A 3SEPA 4KMQA 2Z8VC 4KKLD 4AG4L 4JHAH 1MCLA 4MMZC 1PEZA 2CLZA 5JNYB 4GS7B 4XHQA 1YYLH 2DYPD 4QHKI 4FHBD 5EA0L 1UFUA 2G9HA 3KXFE 4PJ7A 3S3JA 1WTGT 2ZUXA 3MNWB 4LLWB 5HHVH 5IFAH 2VZ1A 5F3HA 5L9DH 5IJVA 1CQKA 1CDCA 1KIRA 3E6FB 4XCNA 1ROWA 4JKPH 1PQZA 1C1EH 5CP7B 2GJ6E 1DFBL 5DJYA 4IMKC 4GKZB 5GS2D 3VJ6B 1NAKH 4RA0C 1BFSA 1NCAL 1MJ7L 1INDL 4KGJA 3L5WA 3DVIA 3QXTA 3TBWB 1BQHG 3TYFA 1J05A 2WBJA 4RMVA 3AU1A 5JOPD 5I30L 2FL5B 4PPTA 1CE1L 1VEPA 3LEXB 1ZMYA 3RU8L 2CK0L 3C2AH 4HWUA 2BVTA 5D7JB 3OWEA 4XXDA 1F6AA 3TT3L 4Y4HC 4P3DB 4PJ8D 3BEWA 4ENEC 4Y19A 3PHQB 1MCFA 3BZDA 4PG2A 3H9HA 2ERJB 5I74C 4B41A 4JPWL 1FZKB 1N3NB 3B2VH 1U8HB 5EUKA 2C1PA 4JDZB 4RMSA 3MGTB 4BYHA 4NKMB 5GGTH 1CGYA 4NZTH 1HILB 2VNCA 2OQJB 4DEPC 5D1ZA 4BFIA 1A8JH 4MS8C 1HN1A 3JUZA 3LEVL 5H35B 4OLUH 1JHLL 3PJSB 3RNQA 3ARRA 5E6ZA 1I1AC 4X6BA 2W92A 1MH5B 2F54B 4GH7B 4ZUSB 3SDAB 5JO5A 4LVOC 2RIKA 1Z9OA 3EYQD 1CVRA 1I3RB 1YMHA 5E99H 3U6RA 3G6JA 1CICD 4FQXA 4XWGL 2PYED 1F11A 4Y5VB 3IJSA 2YA2A 3O2DH 4X4MA 3VFOA 1FNGB 3OJDA 2HTLC 3Q3GA 2P7TA 1A6PA 2W0FA 1FNGA 5GGVL 2AI0L 3AS3A 3QIUA 2P1YA 1UA6L 3CDFA 4ODHH 5I16A 5IHBA 4IIQA 5EOTB 1YMMB 4N8VG 3VRJA 3BX7C 3OKDA 5GIRB 1DLFL 1IGCH 1XR9A 3N85L 3O45B 3RWIB 1BF8A 4X6CE 2VH5H 3QI9C 4JPVH 3TBTB 3V5KA 3CSGA 3O3AA 1SEBB 2BVPB 4PJCE 1CDBA 1IMHC 1T1XB 3DETC 1U95B 1R5WB 3TBVB 1T1YA 4Y5XC 3MGAA 5I1LA 1XGUA 1I7ZB 2ITDB 5I1HH 1HHKB 2MOVA 4G9DB 1HOCA 3DUHA 4MB3A 1RV6X 3PF2A 3GGWB 2PO6A 1EAPB 2KH2B 4NBXB 2MCG1 2L0DA 4I3GA 1U3YA 5MERA 5IJKA 3MRNB 2QQLH 1NGXB 2AEPL 4M7ZB 4K3DH 3K8LA 2ZCKL 4MA3A 5IK3B 3SDDD 3I85A 3F7YB 5C09B 5E08L 5TE4L 1S7XA 2ZSWA 2HAZA 3GMRA 4JR9H 3TA3B 1CLOL 4UT6L 4JM2C 4KH2A 4P2RD 5A16A 3RIFF 2HA1A 5KS9A 3DURA 1AFVH 3BJLA 3QUZC 4ONHA 4X83A 4AQOA 5D7KE 5IB2A 1LHZA 3MRRA 3L3IA 3P40A 5FYJD 1MFCH 1MRFL 2R4RL 4HJJH 4KJQD 5DUPL 1FFPA 3RUGE 4ZUVA 1TTUA 3CFDA 2L4OA 1KXQE 3BQUB 3FONB 7CGTA 4YLQT 4P4KA 5CP7A 1R3LB 1JBJA 2GTWA 4Y2DC 1IT9H 1QSFE 3U79A 2R39A 5ISZD 1DBAL 1AD0B 3AY4C 3DUSA 3U9UB 1I7RA 4K07A 1SBBA 3O8XB 4ZUWA 4HK3J 1IT9L 4FP8H 5B21A 3NCCB 3ARGA 4EZMA 4MVBD 4NO2B 3H2WA 5FYKD 3S35X 4R8WL 1FV1B 3EYUL 4OZHF 1E6OL 5ANMA 4CU6A 1XIWD 4N9GB 2I26N 2DQDH 3IJHA 1BIIA 2BNQD 1T89A 1OP5H 2HT2C 1YEEH 4QRPB 4F2MB 3RDTA 4N1HB 2H26A 1JP5A 1KN2L 3O4OC 5FHBL 4YFDB 4PRPE 5DZLA 4PB0L 4JO4L 1P6AB 2FYYB 5JW3L 1AQDA 1B90A 3DRTB 3FO1B 1IM3B 4OZFG 4RAVB 5D7JC 4X8XA 2AABL 1YNKH 3TCLA 1MY5A 1U0QA 1OSZB 1FO0A 1M4KA 4X8JB 5B3NA 1FZJA 4TSCL 5I66A 3NCEB 3RPIB 4XRCB 1G7IB 3L9RB 4KKAD 2AJ3B 1FCGA 2ADFL 1OGTA 5E2WL 4RIRA 5FYKE 4X8JA 5HHMD 2XIDA 5EBWA 2QHRH 4TOYH 3TO4D 1CK0L 3F12B 4P9HC 3CH1B 4TNWK 4PD4K 4XP6H 4B5EA 4L9DA 3KNBA 3DHJA 4XXCC 2IBZX 3IDGA 2F74B 4OZFH 4YHPB 4CVXA 3U46A 3B9AA 4JB9H 1OT2A 4WV1C 2O5XL 2QKIA 4TSAH 1QRNB 3ZE0F 1L9MA 2D9CA 4I48B 1FLTX 1WEJL 4H5SB 5L2JB 5DUPH 1NANH 1JK8B 3IFLH 4PJHA 3KPSB 1MQKH 4NHUB 3SGDI 1F3DJ 4KQ4L 1INDH 2D0GA 2C3WA 4BFGA 1CFSA 5F9WC 1SVCP 1DQTA 1MFEL 3C60D 1FGVH 4FXKA 43CAB 4U1MA 3O6KL 4AEIH 3U2SA 3BYYA 2HJFB 1YY8A 1NC2B 3MV11 2OI9B 1UWXK 4HH9A 2B4CL 4I3RL 4HXBH 4QEGA 5GJTL 1OCWL 4Z0BH 1U92B 1M7XA 4JFEB 5C0CB 1R24B 2CMRH 3HC0B 1VERA 3ISWA 1SHMA 3B6SA 3FFDA 5SWSB 2GJJA 2Y5TB 4X7EC 2AERT 4NUGH 1X5IA 3SJVA 3U7YL 2XTJC 2A9MH 3CLEL 1Q72L 4TTDC 2AJUH 4NRZB 4DKAA 1OGTB 5EU4B 3L3IB 1RUQL 1UWEH 3QRGH 4OIBA 5ILTH 2YD2A 4MXQD 4NC0B 5JQ6H 1A9BB 4JHZA 4GW4B 5J9PB 4LFHD 2D0HA 5IFJA 2EDLA 2DWEB 4HH8A 4L8CB 4J6RL 5JW5A 2E6PA 2FYYA 1B0RA 1GGCL 2FDBP 3T2QA 5CINL 4PG9B 3EOAB 3U46B 1S7XB 35C8L 4HMDA 5IR1B 3G9AB 4ODXB 2AQ3A 2JCCE 4MHHI 4PLJD 5ICYB 5GS1B 1MI5A 1MJUL 4NWUL 4PY7B 4X7SL 3MV7E 1BX2B 3JVGA 2IH1B 3WUWB 4ZMAT 2XPGB 2BSRA 1WAAF 1D5IH 3VH8G 1A7NH 3ROLB 3H9ZA 2XN9B 4N5UA 2UV3A 4I0CC 4JPIB 1D9KC 5FGCB 5CP3A 1G7IA 3L9RA 2EIZA 3OPZH 4DZ8B 3ARDD 4AMKL 1KJ2A 2CO7B 4PJXB 3LVEA 3O8XA 4ZUWB 5FXCH 4P46D 2W60A 2ZPKL 4OF3A 4LHQB 3ULVF 4WI8A 5EU3A 4JKPL 5CEXA 3GI9H 4WO4D 1FFNB 3VXOA 1IBGL 3E3QE 4XBEH 4OJFL 5IHZB 3CFDB 4JM4L 1T83A 1A0QL 4ZSOE 3FQRA 1CU4L 3WJLC 3GHEL 4U1MB 1FZOA 2OBGA 3VXPA 3QZWG 2OL3H 1CG9A 2FEEI 1DQJB 4DGIH 3X11B 4N9GA 3O11B 3A6BH 2Z31C 2ED9A 4RQQB 5K93A 1FV1A 4BH7A 5HYJB 5C0AB 1XF2B 2AK1H 1QPXA 4NO2A 5A3IC 2X4PB 4PGEB 1UB6A 1OP3H 3VGGA 1CD9B 4O5LL 1A1OB 3D0VB 2UWEB 1N5AA 3X12A 3LHPH 2AABH 4ZUSA 1M05B 3WS6A 4P5TD 4PP1D 4KY1L 4KKLC 4JHBA 4F7MB 1BECA 4JRYE 5TH2A 5T5NF 3V4UL 4F7EB 1OOAA 3OKEB 3DX7B 5D5MB 4L9LC 4KKBD 3MRRB 3TC9A 5IB2B 1Z5LB 5E6ID 2A6IA 1OSZA 1T2QH 5C6TH 3GIZL 3HC4H 2XY1A 4LK4A 4R0LC 1NAKL 1P5VA 1QHPA 3BIBX 4WVRA 3GMRB 4G6FD 3WFBH 2X7LA 2YPLD 2DM2A 4PRPB 4MAYA 1GCFA 3QULA 1ZLVK 4FFWD 2D9QB 5K9OB 5ESQB 5D7JA 4KROD 3ROOA 3DBXA 3B9EA 3VXQA 3NAAL 1NGXA 5JHDA 2P5WB 4WTXA 1BIIB 2EEDA 4LVHB 5CJOH 5JPNA 3FT3A 3S9DB 5MEPA 3BW9B 1V7ML 5EU6A 4K94C 3MQIA 3HPLB 3OJDB 4QRQB 3KPOB 4PJ8C 3ZL4L 1F11B 4Y5VA 3PG2A 2R4RH 2X4OA 3K46A 4JO3H 4D3CL 4AM0A 2WM0A 1HYSD 5I1CH 2LTQB 4PJ7F 2GQHA 4MDJB 3TZVD 1N4XH 3MACL 3P3YA 1F8TH 3O3BA 5I1EH 2GTWB 4NM8H 2EDBA 4K3EL 3UTSE 3KLAB 3RNQB 2WIMA 4IIQB 5ID0B 5CMAA 3QFDA 4P2QE 3ZE0E 4MS8D 1GIGH 4ZAKB 1EUTA 4GSDH 4HWZB 2X4QA 4BZYA 5KAQG 3RUGB 4WI9A 2YN3A 3ZDYE 2EDRA 3FN3A 5CCKH 3CUPA 3T0EE 3QUMB 1A1MA 2APBA 1YPZE 2QQLL 3IDNB 5FCUL 2BVOA 1TJIH 3UBXB 1P4IL 3GMPB 3PNWA 1NEZG 4FQIL 4NZRH 4UAOC 3HNSH 4U1SB 2J8UB 3NPSB 4MWFA 2DMBA 1T20A 1U8NA 1AKJD 2ADFH 3ZTJG 4E41A 4APQB 4QKXB 1AY1H 1MFAH 3OR7B 5F7KC 4HKZB 4FABH 3QIWC 4OCRH 5SWSE 4I18C 3VH8B 5C08D 3TVMB 5IF0B 4H0GA 3K3QA 4ZOBA 3P9MB 3MV9E 4KMTL 5ERWA 1WFOA 4AIXA 5FDWA 2MPAH 4ZUTB 3SGJA 3H6JA 4KDTC 4MJ6A 1YJDC 2FJFB 1EAPA 4JGUA 4JO1H 2VUYA 5F1KC 3EIFA 2GJZA 1U8QB 4EUPH 5D9SB 1FFQA 1WCQA 4NQED 5IBUB 3L5WB 1LEIA 5DJZB 3QI9D 5TQ2L 4ODVH 4NQSB 2IF7A 3EJYD 5FV1L 3S97C 1GYAA 1XH3B 4UQ3B 4LKXB 5DJDB 1QLEL 4OLXL 4BQBA 3AB0B 3DTXA 3B9KB 1YMMA 4P48A 5T1KD 1VA9A 3MRBA 4PJ7B 3TVMA 3FHAA 4Y1AD 2XTJE 5DRWB 1JNNL 4YQXH 4ZNEA 1IC7L 3EAKA 3VFNA 3EFFB 3WXWH 2V7HA 4DKEH 1UM4L 1DBJL 1FL5A 1B6UA 1OF2B 3D6GA 3NPSC 1CF8H 5TJWK 2PYFB 4EEEA 2W59A 4AT6A 3VGEA 5I15L 2I9TA 2IPUG 2YXFA 1QBMH 2I9LB 1RUMH 4L4TD 1X5LA 1Y0LB 2XOTA 5DJCB 3K4DA 3QQNA 4XNZB 3NABH 3RP1A 1WBXB 5DRNA 3C9NB 4JN1L 3QUZD 4YNYA 3P0GB 2G60H 3SDXB 4AIZA 2M26A 1RUKL 3BMWA 3RUGA 3IRPX 3MYZA 4Z7WB 1IQWL 1CVSC 3EOTL 2DJUA 3CSYA 3D2UB 4K7PY 1QG3A 5DZOA 4ZD3L 1C5BL 1MCSA 3E8UL 1I75A 2R56H 3SKJL 4N5EC 3BYTA 2V7NB 4Q9RH 3MMEB 3MRKB 4LSSL 4C58B 4FQHB 3DROB 4KGLA 1YQ2A 5E08H 4D0DA 3ZE1E 4YO0B 1JWUA 4MX7B 3L7FA 4OIIH 2DI8A 3ILPA 1D5XA 3LQAH 4U6VH 1RFDH 3CAFA 4F37F 1BZ9A 1SJVA 5E70A 3P9LB 1S7WA 2IANA 5MENE 1WV7T 1AD9B 1LQSR 4XWGH 4D9RE 2IPTL 1IZJA 2BOBA 5CAYB 1U8IB 1AGBB 3L3JA 1QFWL 1SM3H 4FTVB 4XNMB 3ARBA 2VISA 1I1RA 3QISA 2QQQA 4NQVB 3RWCB 1QYGL 5ITBH 4WV1B 4YIQA 2QR0B 4FA8A 5GSRB 3X3GL 5AAWA 5DRZB 3G04B 1X7QB 1P84K 4HKBA 3MYJA 2YPLA 4LSRL 1RZIA 1WIPA 4N0UB 4G8EB 1J1XL 2ED8A 4BK4A 2BRQA 5HHPA 5D7JD 4Z95L 5I75C 4LEXH 1OGAD 1KJMA 1MWAA 4G8GA 4MNGE 5E8PB 3BRGC 2QQKH 3FT4B 2OK0H 1HH9B 4HBCH 1IAIL 4PJ8B 4L4JA 3VXTA 4PJGB 4XPTH 5A2JH 1JWSB 3EGSB 4JG0H 4ZS7L 3U36A 3VXMA 3V5HA 4OD2A 5J3HC 2FBJH 3FB8A 4PGCB 4CVZA 2VQ1B 4OB5H 4JZNA 3FQWB 5DD6B 3FL7A 5IUSA 3RZCD 2CR3A 1M7DA 2DDQL 3MV7D 3ECBB 5HYSG 1IGJA 4XVTL 2A74A 2HLFC 1EZVY 5IROA 3SQBA 1LO0H 2VUOA 5T33L 2EE6A 5DK0A 2NW2A 4XMKL 2FD6H 4RGOH 4WUKL 5T3ZE 1G84A 2ED7A 1IGYB 3MCG1 4Q0XH 5BVPL 2YRZA 2YC1B 2O5YH 5HHOB 2E7BA 2Z92B 3ZHKA 2EDDA 3BGAA 4MXVF 2X40A 4G7VH 4MNQA 1KIQB 4BK5A 1UJ3A 1QACA 4QCIB 4WU7A 3C60C 1LE9B 2PW2B 1RUQH 3VWKD 4YEFA 4O02H 5IMKA 1Q9OB 1MIEH 4DFIA 4KKCD 1E4KA 3CVHH 4D9LL 2VLRA 3MA7B 1MI5E 2JJWA 5GRWA 2XV6B 4IOIA 4G43B 3MODH 1YEIH 3EDDA 3W39A 4JQVA 1A6VH 3QFJD 4JPIA 5B39A 4K8RH 1DL7H 5TE7L 1KB5H 4FQ1H 4J4PD 3T0DA 1FVEA 4XGZB 1QQDA 4ZOCA 1BJ1J 1I1YB 2BVYA 4PGDA 5FO9B 2VRAA 5LG1A 2BCKA 1G9MH 5IB3A 1DFBH 1CD1B 1KB5L 2WWMC 4DCQB 5I1KH 3LCYA 1NCTA 5E4IA 1W0VA 4LSTL 1KENH 5D7IE 1I1AA 3ILQC 4LSQH 1NQBA 1K85A 2IQ9H 1A4JA 4FFVD 4JFFB 4MZ3A 2YD1A 1DTUA 1ULVA 4NWUH 3EYFB 3QA3B 4X6FB 3QNXB 4Y1AA 2ZKHL 3TO2B 3M17B 5I73B 1S78D 4OSUH 4I1NB 4OQTA 2DQIH 4DZBB 5IT2L 3PWNA 1BQLH 4GAYA 4P2OA 4EI5C 2RCSL 1EEQA 3VMNA 4XWOC 2Y36H 5IEHA 4TNVK 4Y8DC 3ZE2F 4C83A 3RVVD 3GM8A 4PJ9D 2X05A 3A6CL 3LKNA 3FZUD 4R26L 4HC1H 3BD3A 2K7PA