5DK0B

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRGDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B01
1X4XA 4LSRL 4NYLA 5CS7A 2VNCA 2R23A 3IJSA 5CWSB 5E03A 2XV6B 1MCWM 5CD5C 3O6LH 5AWNL 3GGWB 3R1GL 1RZ8B 2HFEA 3VH8B 1RU9L 1JGVL 5E99H 4DFIA 1KGCE 4YXHL 5FF6A 43C9A 3WXVL 1T0NA 1NAKH 1D9KD 5DHYB 2DLTA 1KC5H 4HWUA 1KXVC 3DGGB 2B4CH 5TF0A 1F3DH 3OPZH 2EXYD 5EU3B 2C3XA 5GRJL 3K0WA 4NNPH 5KJRL 4U1GB 1D6EA 1HSBA 4WUUA 3WDJA 5I30L 3DO3A 4TSAH 5E2UL 3S8WA 4QRRD 1EZVX 4PYGA 1EIBA 3CMOL 1WAAE 4NFDA 1JZ2A 5K9QG 5HVHC 5ADPH 5JOEA 4PTUB 3RBSA 3CX5K 1KCSH 2OTUA 5I19H 1OB1B 2XN9D 1A7OH 4S1SL 3FT2A 2CK2A 4RGNC 2X05A 4EDWL 2ARJA 5IFHH 4ZUVA 5E2VH 4LVEA 3DI3B 2DLHA 3V95A 4LKCA 4PJBF 5C09D 1WWBX 3BUTA 4BKLB 3FN0H 4JFHD 1MQKL 3EYFB 3O8XB 5DURB 1JZ7A 1DQDH 4PGJA 3DMMA 5B38B 5E94A 4U7SA 5DT1L 2OL3A 3QO0A 1ZA3A 3T2QA 4OCLC 1GJIA 4NSKA 4UNVA 1HEZB 4TNWK 5FKPA 1R6VA 4LNRA 5DMKB 1DUZA 1WQVT 5GRZA 1N6QH 3DTXA 1JE6A 4ORGA 5BJTA 3K8LA 3L9RB 1EFQA 4JREC 3NPSB 4K9EL 3SE9L 2L4OA 4PJBA 2P47B 2P49B 3OJ2C 3ULSB 2DMBA 5DTFB 5DJ2B 5K9OB 1HHKB 3U0WL 4PJ9A 2DQTL 4F7PB 3BSZL 3VRIB 4FFZH 5CKGA 4JN1H 5I16A 2OL3L 5F3HB 1DEDA 1QSFD 3B6SA 3I6LE 5JHDB 2WBKA 3IFOB 2IFFL 3QDGA 4U1HB 2ZJSL 5F6IC 4K8RD 3MRQB 2ZOLB 3VFRA 3K80A 4JFFD 2ZCLL 3ZSSA 4WO4A 2XT1B 3DRQB 5C9KA 4JKMA 4AENA 5D7JA 4N5UA 3V4UL 3QISA 3MRHB 2KBGA 3MV8D 3GKWH 3C87A 3MQIA 4OZFA 5HHQB 2EYTA 4M43L 1AKJA 5IW3A 1EO8H 2ICES 4GKOA 5L2JA 4U7MA 4X8XA 3RX5A 1EEUA 2P7TB 3T0BA 3HE6B 5EU6D 5DZLA 5FGCE 4OZHE 5IMMB 4N90D 1CGWA 3MJ8A 5E00A 1S5HB 4Y1AD 5K59E 4K94L 4XNZC 3H3PL 5E9DA 3FTGB 3X11B 2ED9A 4QOKB 4X6BA 2BVOA 2NTFB 3GSXB 1I3UA 3NCJL 5B4MD 3J8F7 5IHBA 1EXUB 3VWJA 3BKJL 1NCBH 5CJOL 4JJ5B 3TESA 2GK2A 2VDLH 4ODHL 3N1QC 3U46A 2P5ED 4LSDA 5KG9B 1BFOA 4R9HA 2PYEB 3IVKA 4MB4A 3CLFL 2Z91B 4NQUA 5EU4B 1ZHBA 2R56L 5C0RH 4I18C 2BNQD 2A73A 4MSWB 3JVGA 3JWOL 4DFHA 5EUKA 5IT2L 3EYVA 3GB7B 2UWEA 2G75B 1JV5A 2P24B 3CVHA 1NFDE 5LWYL 3KPNB 5DZNA 2V2TB 1YC7A 3PP4L 3I75A 3O2VH 5JNYB 4R4FL 2YD1A 3B9DA 2ERJC 2VISB 4PRBA 3LEVH 2B7DT 3GSRB 4BZ1L 1PJ9A 1QEWB 4GUPA 5JUEH 3SDDC 2CD0A 4D9RE 1VB9A 3JWNC 1SQ2N 5F3BB 3D9AL 1U8PA 4DGVL 1GZQA 4GLRI 4Y4KD 5IF0B 3MX0A 3GSQA 4OCXH 2HRPL 2RFXB 5ECJE 3V79C 1VADB 3HRZA 5E8NB 4NKOA 3RNKA 1ITBB 5GPRA 4LSQL 3WYRA 4Y4HD 1FVEA 1VDGA 1M7DA 1RVFH 5DD5H 3P77A 4OI7A 5L88L 3F6LA 3LN5B 4OCRH 3VGDA 4TN9A 1I9IL 4JFQB 5J9PA 5T3ZL 4NIKB 4IMLB 4KY1L 4ODWB 1PG7L 2LQRA 3IDYC 5EBLA 9CGTA 1V7NL 5AG8A 1T0MA 1YMHA 2FEEI 2VC2H 4ACPA 4S11A 2R4RL 3LKOB 3X14A 2VDMH 1DQJA 2H2PC 3EZ8A 4M7KH 2VZVA 1K8IB 1BQHG 5DSCA 1T21A 3JWDL 2AJYH 4QCIB 4H20H 3T0VA 1PSKL 2W9DH 5EUOF 3KPLA 5E6YA 4PRIA 3L5WA 1FO0B 1NBQA 2OR8A 3P4LA 4O2CB 1RJYB 3W9DA 4M7ZC 4OLVL 3RVTD 1MSPA 5E1HB 2NYYD 3MNWA 5DO2D 4CNIB 3QDMB 4HMEA 3T4AA 1EH9A 3ETBF 4UTAH 4X6DA 4L8CB 4PG9A 1T04B 1J1PL 3NZ8B 2BFVL 5M7QA 5MI0C 1X4ZA 2JLLA 3OAYH 4GRLC 4CW1B 3ARYA 2QR0A 4QHLA 4Y19B 4QXTA 1YQ2A 3DRTA 2DIJA 5GRUL 3C08L 3SDAB 4Y2DD 3D25B 3T0EC 1ZHNA 4XXCA 4ZXBB 1WITA 4AMKL 1HQ4A 3V0WL 1XR9B 2EEAA 2ZCHH 4RGOH 1KIQB 2IAMB 2Q76B 1TVBA 4BSVB 3ARGA 3BIAX 4GKNB 4BFIB 3PV7A 5GS0L 5HDLA 5MERA 5FO7A 1PKQE 1CD0A 4LCWD 3P73A 1MOEA 3ALXA 5GS1B 3FRUA 4JFEE 4C55A 1L7TH 1T1YA 5D5MF 2FHCA 1E4XI 5IW1B 3L7EA 4L4TB 1NMBL 1I9RH 1U9KA 1NCNA 4OT1L 1JN6A 1CDHA 4PR5B 1OCWH 1A7NL 4YZFE 4IOIB 3VE0B 5C0FA 3MLUL 3MBEB 1HYSD 1OP9A 1RFDL 4FRWA 2IQ9L 3RL1B 1MY5A 2HTLD 3QCTL 4F7MB 5EZJA 4H26A 4R2GD 4XCFH 2QHRL 2EYSB 1FL5A 2FHBA 2NZIA 3O4LD 1ES0A 5IMLA 1I8KB 3T3PF 3IETB 3DUUA 5J4MA 1UJ3B 5L7XH 1CFNA 1OAQH 2YOCA 1C08A 3RDTA 2I07A 2VDNH 1TZGH 4KI1A 4TUJA 4OF6A 5FB8A 4XVUC 2NW3A 4RQQA 1PQZB 2EZ0C 5EORH 2P45B 5F6HI 3BP4B 1DE4B 4YGVB 5JOFB 2XKSA 2NXZB 4LVHC 4XH2A 1B88A 4M6NL 4U1NB 4PTTA 3O6KH 3OHXA 3A6BH 3D2UA 4JDVB 2Y36L 1K4CA 3RWEB 1UFUA 4LEXL 2AJUH 4XCEA 4NZUL 1CFVH 4W4NA 3RNQA 5FDWA 3S3SA 12E8L 5C0AA 4WRLA 4O4YL 4XC3H 2QKIB 3DYMA 3TBWA 3FB5B 2B2XL 1FNEB 1PKOA 5C9JA 1CLOH 1T66C 2IMMA 2MTPA 4NHCL 1YEJL 3FMGH 1QTYT 4DK6A 4MAYD 5CFHA 3TF7C 3FO2B 2VR9A 2FEDD 1MCKA 3C09C 1P9MA 4IRSB 1WAAF 3CU1A 2ZUQC 4WFFE 1KT2A 1AXTL 2AEQL 4G3YL 3CZJA 1EPFA 4ZUTB 3AUVA 3PWVA 3NFNA 2I9LA 1BFTA 2DWDA 1CZ8L 1JTTA 4KJQC 4U1MB 3CPLB 3BRGC 4OLUL 5MENB 3SQOH 5DRNA 1A9BB 1HZHL 3SKOA 4TPRL 1NEZA 1RIVL 2P5WD 4IBLT 4GAGH 4R90L 3KPMA 1DQTA 3VFMA 4MA3B 2A0LC 1TVHA 1XF5B 3MLTB 3TH2T 5KS9E 4YDVB 1AXSB 1CR9L 1U95B 1E4KA 2WM0A 2YD7A 2BP3A 3F58H 4HX1B 3WFHA 1RZKC 3HUJB 2V5RA 3QRGL 2CRMA 4LBEB 3TH3T 3WO4C 5EA0H 5HHMD 4JGUA 5DDHA 3HE7B 1MVUB 3L3JA 2J8UA 3FFCA 4ISVB 1VERA 4Q9RH 1VFBB 3KAAA 3BN9C 2F5AL 1OW0C 2CMRH 5IKCA 3GM0A 1U8IA 4OD3L 4HJ0C 3NCBB 3GMNB 5CZKA 3UJTL 5F7UA 1T5WA 3GJEB 4YHZL 3KYKH 1IQDA 4GS7C 1H3TA 3QFDA 3HMWH 3QIBC 2ZUYA 3DROA 4K2UL 1DBJL 1UXWA 1YJDC 2YA0A 3HLAA 5DK2A 1GOFA 2HG5A 1I8IB 4HBQA 3WIIL 2NY0B 3TN0A 5T5FH 1WZMA 1L0QA 1Q9KB 3QEUB 5LGHL 3WKML 3KVQA 4JHZA 1YUHA 1XGPB 4LLVB 1KN4H 1DN0A 3MRKA 1P7QA 1IZKA 3O2WL 5DQ9A 4NM8L 2DWEB 1A1NA 3PWPE 1DVFD 3N85L 2RR3A 3AM8A 3INUL 3W11C 1P4IL 4X6CE 3HPJA 3RFZC 4OZHF 4J2XA 5GJSL 5D8JH 5JO5B 5K59F 4JM2A 2VXUH 5JW5B 2SEBA 3UYOD 5L8KB 3UJIL 4QRPB 4NQXB 4DEPC 4RNRB 3FB8A 5CJXA 1W72A 2JF1A 4C56E 4OBRA 4O02L 3ZT7A 4WUKH 2MPAH 1X5IA 3WXWL 3DUHA 2VLKE 4RAHA 3QB7C 4Z0XB 4LHUB 2XICA 3L3DA 4YLQT 4GRMB 2FWOB 1RUMH 1F4YH 2EEBA 4ONFL 5SWZB 2IF7A 2DQJH 1Z5LA 1RZGA 1W72L 1MLBB 1NFDF 1QRNA 2OXGA 5ERWB 5FM8A 5E2JA 3ARQA 1JIBA 3KPQB 1C7TA 3TCXA 2JJUA 4PJ5D 1QZ1A 4MJIE 4AQOA 5DD6A 4R7NB 3BVNA 1NKRA 3BH8A 3FL7A 1A0QH 4BZ2H 4I3GA 4HWZA 2WBJB 4ELMB 5J1SC 5ICYA 2GCYA 4F3FA 3H9SD 4BQCA 1JYNA 1D9KA 4XRCA 4KQ3L 4LGSB 1E0OB 3CK0H 4EDXA 1G7MA 3VFPA 1NFDA 1N0LA 3UTSD 2FNBA 2AJSL 2NY7L 4YX2H 3NA4A 5DC0A 1ZWIB 4M8QB 2VLMD 3GK8L 4DN3L 4HDIB 3O3AA 3TNNB 4X7FC 3VXMD 4I9WD 1QSEB 1LEIB 3A6CL 3ZKQD 4L3EB 3QDJE 4NQDE 4NC0B 1IM9B 2HN7A 1JHTA 5CZVH 4RMVA 5GSRB 2E27H 2F54B 4OCWL 2DQFA 1FPTH 4HT1L 4ZFZB 3WHXA 2WANA 5JXAH 4WGWB 1YYML 4RX4D 5IVXA 4W6XB 2X1PA 2CKBA 2V5SA 4ZS7L 1DBAH 5GIRA 1UA6H 1QYGH 2WUCH 3SGKA 3RUGE 2NTSP 3DBXB 5C0GA 3RA7L 2HWZL 1RIHL 3QIUD 3C5ZC 2YKLH 4KPHL 3B9KD 4P0DA 1DLHB 1F90L 3CFCH 5C0JA 4WY7H 2CKBL 3OKNB 4JAMB 1JUFA 3UZEA 5IMKB 2ZUXA 3FT3A 1MCSA 4HFUL 5C0BA 1QFPA 4PRDB 1LK2A 4KROB 5I71C 1JZ4A 5HYSA 2FIKB 3QQ3A 2UZYB 1QFWM 4L4VB 4QO1A 1B0RB 5KSUA 1Z3GL 4KK9C 3WNNA 5I1LB 2IPKA 3RY6A 4GG6B 1R5IB 2K7PA 4PUBL 3QHFL 2LTQB 2VMFA 1RK0A 2Y6SD 1E4XH 3U30B 5IB3A 1MLCA 2YEZA 2BSRB 3MV8A 3TT3H 5K9QI 4HEPG 2ARWA 4KZEL 5TGBB 2X4UA 1IVLA 1IC7L 3QYCA 5ESAB 1BZ7B 3MRFB 2YD5A 4YQXH 1P69B 4Y4FD 2PCPB 1N7MH 4YZFF 1JHLL 3D39D 3OKKA 3GHEL 2PTTA 1EHAA 2GKIA 2YPLA 3FRPG 1A47A 2M8XA 1S8DB 3N1GC 3QNYB 5JR1L 4ZAKB 3QZWA 4ERSH 4MA7L 1IGIH 2VE6A 2BNRB 5IB5A 3GMLA 1M05B 4LCCC 4X4YB 1S7SB 2VH5L 2MQCA 3RRQA 1ZS8A 2MHAA 2X4QA 2CDEB 3KYMB 4AEIH 3MCKB 1FL3B 1JWSB 3GSUB 4QWWC 4HZAA 3SE4A 3VG0H 2BNQA 2FJGA 3S4SG 3W2DL 2IMNA 2VL4A 3S36X 5ICZB 2YC1A 5ABDE 3HZKB 3S35X 1UCBL 1Z9SA 3JUYA 2R4SH 4MCZA 5EU7C 4P9HC 1ED3B 1G6RB 3L3IA 4OLWH 5F1KC 1XGQA 2ATKB 4QT5A 1Y6KR 3WN5C 5HYJA 1IAKA 3QEQB 2QQNL 4R96A 1XR8A 5FYKU 1JNLH 5M95B 2VN7A 4YC2C 4DVRL 3CSYB 4HLZH 4P23C 3QNXA 2ICEA 1P7KB 2AJ3B 4APQA 5IROA 3O6ML 1Q9WA 4Y4KA 1KG0B 5CCKL 4YNYA 3V6FB 4PLNC 3RIAK 4CVWA 5DD3L 3O0RL 2ED8A 3B5TA 2CLRA 5C08D 4RFEB 4ELKB 1S7VB 2GJ6D 4X80L 4Q0XH 1H0DA 4Y4HA 2G2RB 3VW3H 3VFWB 3EFFB 5KAQF 3AFLA 3MLZL 4FQCH 3MUHL 3OKOA 5JHDE 4DKFL 4XNXH 2QSCL 4JO1H 4FMFA 6FABL 3NCYP 4RWYH 1I1RA 4HS8L 4QRQA 3T4YA 2OJEA 4J3VA 5F9OH 3TIDB 4PJDB 5IIEB 3QQ9C 2B1AL 4PRHB 1KUMA 2MMXA 5KS9F 2R2EB 1AQKL 3HB3C 2BSED 2A1WL 1WF5A 1JGLH 4U7KA 1SEBA 4HC1L 1BD2A 1Q0YL 2C4FU 3NTCL 3LVEA 4DCQA 4OGXH 1PEZA 3AS2A 4X98A 1NC4B 3EO9H 5CEXB 3DMMC 2KL6A 4MXWL 1CG9B 3C8KA 5BW7C 3K3QA 3HNVH 2DRUA 3MLWL 4V1DA 4TSCL 4QOKE 4NQCD 1K4DB 4JHAH 2XACC 3TZVD 1JWUB 2AXGB 1KJ3H 2EH7L 2HTKC 1LO5B 4G9FD 1A4JA 5HJ3A 2OSLA 3F7YB 1FCGA 3BIKB 2OX5A 4FQQA 4JG1L 2G5RA 5DD1L 2PYEE 4HXBL 3O2DA 4RA3A 3BZ4A 1R24B 4EIGB 3U2SA 1EMTH 1U93B 2HJFB 4PLJC 1CQYA 4KRLB 3EO1B 1OAYL 3WNMA 3S3PA 4IOFC 1G9MH 4LLMB 4PRPB 4NO5A 4ETYA 2CIKB 1AH1A 4LCWA 3UYPA 1BZ9A 3AXLB 3KHQA 1XGTB 5I1CL 1RULL 2R29H 5ENWA 1NBYB 2M2DA 3O2DL 4OZIB 4X6CF 3GI8H 5D7JC 3TJEH 3VFSA 3HFMH 2CO7B 2Z31D 4M1CC 3LD8C 1IGTA 3QJHB 5D71H 3QEGH 4FQ2H 1WT5C 5K9KB 2AW2A 2JJTA 1CDIA 1G6VK 1T1ZB 4EN3D 4U0RB 1CLZH 3JWOC 2P8PA 4U6HA 2IGFL 2XRAH 5L8LB 3PIQA 3QI9D 5GZNC 3ARUA 5ACZA 2AGJH 3MZTA 4UNUA 1FDLH 3MTRA 5FYJH 3PWPA 1NLBH 4X6CA 3CLEH 5DUBA 2BNUA 4X0KA 3U0PB 3WUZA 3BQUA 2DQCL 1MI5D 1SJHB 3VWJC 4GQ9L 5J6HA 1T89A 5I1KH 5C86A 1C1EH 4MD0B 3OR7A 3GSVA 3OF6D 2DKSA 1X4YA 5CLWA 2X9WA 4M6OL 2Y5TB 2HFFB 3OQ3B 1F58L 3JVGC 3S34L 3MGTA 1AJ7L 2XZCH 2BC4A 3G5VA 5F7EL 1QLFA 1RUPL 1BBDH 3KWWB 4OGYH 3WE6A 2RCSL 3MRGA 1AC0A 1R5VB 1WWWX 1JNNH 4J1UB 3VXSD 1CD1B 4RMTA 2A6DB 1SBBA 5TF1L 4DUVA 3IFPA 2UUDK 4KZDH 3MRLA 4HKZA 1M7XA 4WU5B 3ZE2E 5EN2A 4C59B 3D85A 3LKSA 3QDME 1JZ5A 1IKFL 4H5SA 4KHTL 4HBCH 5D6CA 1GPOL 3STBA 4FOMA 4DUWA 1KJ2B 3L95B 4MAYA 3M8OH 2JB6B 4MCYB 3CFBA 5HGDB 4MJ2A 4Y19E 2I60H 1JRHH 5TJWK 5CSBA 2A74B 4OCSL 3GMOB 4ZFOL 4HIHA 2Y7QA 1U3HB 3SDXB 4W4OA 2ADGA 2W0FB 1YYLH 4FZ8H 2ADJB 3T8XA 1C5BH 3LEYL 3ME0A 1U92B 4ZD3H 3U6RB 2GAZB 2P5WA 1YEFL 3U9UA 3IDGA 3RUGF 1FNGB 5HHPA 4ODTH 3KGRA 3V7AE 1KGCD 1PY9A 3D18B 3UTTD 5D96B 5F72S 4HUKB 5KSVA 4YBQC 1MCNA 4P5TA 5CHNB 2I9TB 4L4TE 5DMJB 1ZLUK 4HCRA 1AHWA 1PYWA 2G60L 2Q8BL 1MFBL 3MLVH 4YHML 15C8H 4XPFL 4CMHC 2H2SC 5I1GL 2DDQH 2XFXB 1QSVA 5J06A 1N64L 3HG1B 5I1IH 1CFBA 1MREL 4ODVL 4KUZL 4RGMC 4C58B 4NC2B 3TO2B 2EC8A 3QXWA 5DLML 5DEFB 4WWKB 1RZFL 4QRSB 1QA9A 4JZJA 3RVXC 2IPUG 5ACLA 1MWAH 1NGWB 2NX5D 4D0DB 3RZCB 4HCRL 2AQ1A 3KJ6H 1OAZH 2GUOB 4D8PB 1BREA 2FZ3A 3WIFA 4ORZC 4G42B 4XWGL 4LF3A 4IDJL 5CBAB 1G7QA 4RAVB 4OSUL 4XXCC 4G7YH 1YNTB 3WMSA 5FHAL 5C2UB 5KSAD 3L5JA 3ZL4H 3ARGC 4GT7A 3DX8A 2XG4A 3BPCB 2K1MA 2LV4A 4XX1E 5EU5A 5C8JB 1LVEA 1UM4H 1GGYA 1D5XB 2V17H 1KYOK 3FO1A 4PJAB 1IEBA 3LS4H 2ZNWA 3MGOB 3AU1A 4S1DC 4M1GL 4LHJB 1JZ3A 1A7RL 2XWTA 3P4OA 2X4NA 3ZYOA 3JXAA 1A6ZB 4P59H 2EXWD 4RWHA 1IM3B 1Z9LA 2XA8H 5ESQA 3I6LD 5J13C 3ZKMD 5CWSA 3MUZ1 3CXHK 3TT1L 1IKNA 3GGWA 3PWLB 4ZTPL 4RGNB 2KUTA 3NN8A 3VXTB 1FIGL 2VLJB 5HTSA 1S7QB 5C0ND 1CFQA 3X12A 5BV7L 1M1SA 1RMFL 1TETL 3V4PH 1D5BA 5CMAA 3WLBB 4ONHA 5MENE 1AR2A 2ZP0T 1WJ3A 4J4PA 4MJ5A 2X5PA 1T0PB 3O3BA 1BWMA 5EU3A 5T1LB 3CC5B 3ROOA 4P4RA 3ULUE 4PJ5A 3TFKC 4HIEB 4TULL 1QQDB 3DX9A 2ZNXA 5SWQB 1S9YB 2Y06L 1J0IA 3WEXB 2H1PH 5EO0A 4PTUA 2QADD 1IGFH 4JREB 5BMFH 2AK4B 3SKJH 3RU8L 3HC4L 4YHLL 3HUJE 3F65A 4NRXB 3AC0A 2OYPA 3M17B 3X13B 3MODL 4MX7A 3ULVD 2AQ2A 1S7TB 1A6UH 3OAZK 3UPRB 5KOMC 2VL5B 3ZMRA 1FBIH 4E0RA 1DDHB 1JPSH 3EYFA 2H45A 3O8XA 1P6FA 2IEPA 4TQEH 4CKVX 2FGZA 5HHXH 5F6IB 3VXOA 3NGBC 4D9LL 4OLYH 3BUYA 2V2WA 4NHUB 5JHLL 3QXUA 3GJFB 3REVA 1YEHL 1P9MC 3FHQA 2JJVA 4OD2A 2OK0L 1T4KA 3SCMC 3T77A 3EOBB 5HYIA 2IH3B 1ZOXA 3Q6FA 3MLRL 2CUHA 4KDTA 1G7PB 1W8NA 4DZBA 4P2QA 3W39B 3TYGH 1BGXL 1EHNA 3C6SA 2X4PA 1QLEH 2X7LA 4UUJB 3QIUA 4F7PA 3WNOA 4YK4C 4HIJA 1EFXA 3TO4C 1A2YA 1LD9B 3QNZA 4XNZB 5T3XL 1DANU 5DHVB 5E56A 4OM0L 5I2IA 2X2YA 4N8VA 2A9MH 2I24N 2VITA 3MRQA 2BVYA 5CKAA 4QRPE 5F96H 1ZGLA 4EUPB 1E4KC 3GJFK 5GGQH 3AAZA 3DRQA 4ZPVB 3KPRB 4MNHB 5C7XH 3RTQD 3O6FC 5H2BA 3QUXD 3H0TB 2X89A 4HPYL 3WLWC 3IDNA 1E6JH 3CVIL 3TPKA 3VDBA 5DEZA 3L7FB 1WIUA 5SWZE 1A4KA 1NDMA 3FO0H 3IU4L 3SPVB 3BXNA 2JIXD 1T2XA 1Q8MA 3JTSB 2UUDH 4NM4L 1AIFB 4L8DB 2ERJB 5FHBH 4ZSOB 4LP4A 4QOKA 4Z95H 3RHWK 4YHKH 2EDOA 4OZGB 1UZ8A 1HIMH 3ZDZE 4FQJL 4MS8C 1MF2H 4KKBD 4H8WL 3SDDB 1JTOA 4ZQKA 1CLYL 4P3CH 5E2TL 4JJ5A 3UBXA 4QY8B 1DEEA 3TN0C 5B39A 5E2WL 2H32H 4OZFG 5DQJB 4NUJA 4NT6B 1J88A 5JW3H 1N3NB 4ELME 3VXPA 5IESH 2RQ8A 3GB7A 1OAXL 5KN5B 1GGCL 2C4FT 2EH8L 5DJCB 5JQ6H 4JPWL 1ZT1A 2XTJD 3AM8C 3V6OC 1CGXA 3RL2B 3U9PL 1TPXC 3VFOB 4OAWB 4JM2C 1JPFB 2EDXA 1DBKL 1QSEE 2X41A 2VISA 2R0ZL 3BT2L 4LQ1A 3IDYB 5CJXC 2D4DA 4L3EE 1QBLL 3EDKA 1QEWA 1BJ1J 2FL5B 5D72H 2F54E 2UZIH 2R2HA 3OKEB 3KXFB 2Z35B 1FZKA 3P0VH 1ZLUH 3LB6C 3BAEL 4NO3B 5L6YL 1NGXB 3DURB 3ZDYE 2RFXA 3S37X 4P57B 4I48B 3PGCB 1VADA 4J3OC 4OD1L 4P2RA 5E8NA 4JFED 3JV6B 4G6MH 4QLRA 4M5YH 3KPTA 1NMAL 2KZ1B 1K8DB 3LN5A 1GZPB 4M7ZB 1T5XA 1MRDH 1AGFB 2R1XA 4FFWD 3BEVB 3SY0A 4NKIL 2IG2L 5E5MB 4ODWA 4PGEA 1KELH 2C5DC 4I3SH 1S3KH 5MI0B 3ZE2F 1RUKL 1CK0H 1BVLA 1XGRB 4GRLB 2VERN 3AY4A 1GHFH 3BDYL 3QA3A 3ARBD 1FNSL 3LKOA 3GMMB 1MFDH 4ZFFA 4WGVB 5C08A 2GJ6A 2YSSB 4AT6B 4HKBA 3KR3L 1D9KC 2Z8RA 3G08A 4LRNL 3T0EB 4JZNA 3PUCA 4NCC1 3AMLA 3X3FL 3SGDI 3MNZB 3UZVB 5T1MB 1FO0A 4L4VE 5JW4R 2EE9A 4MD5B 1YQVL 3BMWA 4UQ2A 4GG6E 2MFNA 4S1RH 2ICWJ 1WUNT 2CRZA 5DRZA 4Z77A 5FA4B 3G5YB 2XI9A 2FYYB 4F9PA 1X6NA 3L5XH 1CYGA 3MLXL 1YEDB 4YDKL 4POYA 1F8TL 4XZUA 1WFTA 2A9NH 1FO0L 4G8GB 1V5JA 3KYNB 3SDAA 3SGKC 1FORH 3WBDA 4TVPE 4KDWA 3QPXH 3D0VB 2N1KA 1MHPL 4YR6B 5HGBA 3M1BA 2NY3D 2Q76A 3N1FC 2AKRB 4FQXA 1A14L 3I6GA 3LRSB 4GMTH 3OXSA 1ERNA 2DD8L 4WFFD 4NQCA 3WV0A 4U6VH 2HLAA 1U8OB 4X5LA 4GKNA 3TM6A 1I7TA 4X9IA 2BNRE 4JKWA 4XVTL 4WI4A 4I77L 1MCQA 1T7WA 3C6LD 3T3ME 5IWLA 1IBGL 5GS1A 5I1HH 4NNXB 3OMZA 3MOAL 5F9WC 3QWRA 3C60D 3P0YH 2NR6C 5MHSE 4L4TA 3S4SB 4YXKL 3K74B 1F42A 1HNFA 2ADFH 4LVHB 2OJZH 4JR9H 1LP9B 5JDSB 1LWRA 2HT3D 3IDIB 3K2UH 3RY6C 4K8RC 2F19H 1ETZA 1Q72L 4MD4B 2FSEB 4UIMA 3QEQE 1W8OA 3IETA 5HI4D 3O45A 1UJ3A 2DM3A 1JPGA 3ZKNC 5DQDH 4LDOB 1OGAB 5CEYA 3K2MC 4WFGD 1ZK9A 3N9GH 1MUJB 1FZOA 4X7SL 4N9GB 2EDRA 4Q6IA 3D3VD 5DWUL 4U1JB 4E41B 3SEPA 3C09B 3TVMA 1C16B 1U41A 2EDKA 4U6YA 2ZUQB 4EN3A 2Q7YB 3VDCA 1LO0H 5EOQL 4YGVA 1J8HB 1YZZA 2D4FA 4OLEA 3G6AB 1MCIA 3NAAH 4JQIH 2VDQH 3VFUA 4GRWH 5B4MC 5IEKB 5B8CA 1MI5A 1R5WA 4Z7OE 2D7TL 4XP6L 2VAAA 3MOBL 1V7MH 2H3NA 4C57C 1A6TB 3OB8A 4KVNL 3OF6A 4P5MB 4AM0A 1NCAL 1QBML 5F7DB 3DO7B 3SE4C 3T1WA 1J0HA 4PJDE 3LPWA 3B5GA 1NSNL 4MWFA 4NUGH 5DUPH 2HH0H 4PJXB 4PRHE 3ULUF 2AJZA 1IAII 3VXSA 1DLFH 4G6KH 4Q2ZA 5DYOA 5ID0B 2MKWA 3WO4B 1I1AD 5D7LD 4ZUTA 5FFLA 1WZ1H 2B0SH 2PUQT 4WTZA 1FN4B 5SWSB 3H6JA 3HUJF 3IDMA 2VLKD 1HHHB 3LH2L 4GKSA 2GJZB 1OVZA 4U1KB 3O81A 1N2RB 4YH6A 1BM3H 5IROC 1GRWA 4APQC 3NH7H 3UYRH 2DIBA 4Y4KC 4KMTH 5FM5O 4GS7B 3EYOA 5DGQA 3P4NB 3QIBB 4XNQA 1C5CH 1CU4H 35C8L 4LLQA 1CIDA 3HCVB 5I73C 1GOHA 4YDVA 4MDIB 5MP6L 4Y4HC 2EKJA 2FBJL 1MVFA 3CNKA 3IDXL 5EWIH 5LAXA 5D7IB 4RISL 3DX6B 3QXDA 4G7VL 1J87A 3UXFA 3WFBH 3THMH 1MVUA 2DQGH 4HWBA 4Z76B 2H8PA 2GIYA 4ONOA 2XWBA 2ZG3A 4I3RL 1NEZG 4P4KD 4PRPE 5ID1B 2FR4A 1KTRL 4K3GA 5DEGB 3CDFA 4XI5D 3PL6D 2VQ1B 3UTTA 3N1MC 3ILPA 5EIIA 3LAFA 1MRCL 4KUCF 2ZUSA 5IK3B 1KN2L 3HZYA 4DEPB 1WLHA 1SJVA 1YMMD 2ED7A 5I17B 4OZIE 3A67H 1X44A 2R8SL 5I8CB 2X1OA 4EI5A 1SYVB 5D7SH 2E7CA 1HH9B 5JORA 3TBVA 3N06B 3ZTJG 4HWBL 5F7HA 4L8SB 3U83A 4C83B 3P9LA 2HVKA 4NQDD 4YE4H 3RVTC 3GSNA 5E08H 3LDBC 5DO2C 3IS1X 1BFSA 1UVQB 2CK0H 5AZEL 5F7LB 3WS6A 1A3RH 1XGPA 2PKDA 3GMPB 4LLVA 4X8JB 1T7VA 1YPZB 5DK3A 1R3IH 4OB5H 2P46B 2DMCA 1NUDA 2NX5A 5DJ0A 3U4EA 2FX9L 4LVNC 2DTML 4D0BA 5D1XA 5ICXB 2YD9A 2ICWB 5GGRY 2BOCB 4LSVL 5IB2B 5JW4Q 5JXEA 2DLEA 2QQQA 3GSNL 5ESVA 2GTZB 3ZDZF 5K9JL 5FCUL 5L2KB 5DJZA 4JQVA 5KSAA 1JZ8A 1NAMA 4G80B 4LHUA 1IQWL 3WS3A 5T1DH 4PS4H 4B41A 1NBVL 4PV9B 2EECA 3F12B 5HYQA 3QQ4B 3GI9L 5CEZL 5LBSL 4ELMF 1H8NA 4DQOH 3PHSA 4FQ1L 2N7AA 3CDGB 2GSIA 4S2SB 1AXIB 1ADQA 1MLBA 3CFDA 1DANT 4WHTB 1CT8B 5E1AB 5BRZB 2AXHA 2BSTA 3KPQA 4QHUB 2RAMA 1BAFL 4POZC 2RHEA 1NAML 3LSOA 1ZLSH 3N0PB 2HTLC 2IBGA 2KDGA 4JGJA 4X6EB 4UB0L 1VGEL 3VXRA 4G5ZL 1ZT7A 3CUPB 5CUSL 3SDXE 3KPPA 2C3VA 1ADQL 4KK8D 2CR6A 3ZDYF 4OIIH 1FZMB 5C1MB 1F11B 3RWGB 4FXKB 5J3HD 3C5ZB 1UH3A 4PJHA 4M8QA 4XHJC 3VA2C 1T89C 4HDIA 3RWDA 1HHJB 5BZDA 4F37F 3OG4B 1I7ZA 2F53B 3MMEB 3QUKB 2ZUTA 5C6WH 3PWJB 1EEZA 3FB6A 1INEL 1S9VA 5CLTA 3MRBA 1P6AB 4O51B 1A9EB 2I5YH 2QL1A 5AYUH 5C0CA 1FYTB 1HI6A 3TIEA 4XGZB 1KB5A 5IJVA 5I71B 4YHIA 1VEOA 1CXEA 1KLGB 3HG1E 1RAMA 1TVDA 5DD0H 1OP3K 4U4BA 3U36A 4MXQC 3HR5A 3V5DB 3BP5B 1JF1A 4HQQL 4ZDHB 1QFWH 1AGCA 4Q7DA 1X9QA 2D03L 5FYLH 3VD7A 4MAYC 5AAWA 4LARL 3WFCL 2FEDC 1ROWA 1J0ZA 4HZLB 1RZIB 4QKXB 4GG6F 2K3TA 4N0UB 1KB5L 3C2SA 1AD0B 4JVUA 5MEQB 5DURD 2E7MA 1H3VA 3QH3A 3TA3D 4PRDA 3F5WA 4CDGC 5EZOH 4NGHH 3P30H 5BVJA 4W4OC 4Y7MA 1FSKC 3MLYH 1LEGA 1ORQB 4U49A 3RBGA 2FIKA 4NBYB 4HJJL 5BZWB 3DIFB 3E8UL 4HGKC 1QRKA 1SYSB 4HIIA 1SEQL 5EO9B 1B0RA 4G6JL 3HS0B 5E7BA 4PJAE 2IPUK 1XT5A 3S6CA 4Z7UB 4LCCB 5AZ2L 1QR1A 4P5TC 1Y0LA 1BX2B 3UJJH 5ADOL 2GFBB 1AHWC 1FFRA 3LKQB 4XP1H 3QUXA 5AUMA 1UXSA 3T3MF 4XBGA 5J1AB 1TJGL 2DQHH 5HYSG 3C2AH 1S5IH 4L8BB 1BZ7A 4OCNC 4RGNE 4XCNA 1Z9OA 1UC6A 4XPBH 1HXMA 5HY9A 3RIAF 2VLJE 1NFKA 1MJUL 5IR1A 1U91A 5KVDL 3OR6B 4JQXA 4ZUUA 5F1IB 1UB6A 2FGWL 3WN5B 4X99A 3CZFA 1TJHL 1QR4A 3SBWA 4YC2B 2BNRA 4P23B 2YA2A 1F4WH 1N8ZA 4HHAB 4PGBB 1S7SA 2ZPKL 1CL7L 2FB4H 3JTTA 4NYLB 2R23B 3IJSB 5IBTL 3KYMA 4ALAH 4D2NA 3G9AB 1CXKA 4HK0A 3NABH 1NLDL 2AK4E 5FF6B 1IILE 43C9B 1T0NB 3CJJA 1FLRL 3OKYA 5HHOA 4I13B 4F7CB 1CXHA 1DSFH 5CAYB 4EOWL 2J6EH 4RRPA 5C2BL 5BV7C 2VXTH 4FHBD 5GGTL 1D6EB 1HSBB 4WUUB 4N0FA 4G6FD 4GXUM 5GISH 4NWUL 1ZLWK 1F4AA 5CGYD 5J1TC 2AJ3A 4Z7OF 5IEHA 1EUUA 1U8NA 3T09A 2OTUB 5JTWA 1IKNC 4LPYA 4A6YH 3FT2B 5A2JH 3OGCA 1NC2D 1M7IA 2ARJB 4ZUVB 4PJDF 3B9EA 1G6RL 2G2RA 4LKCB 3VFWA 3OL2A 1U8LA 4RMQA 4PREA 2XIDA 4XP5L 4KKAD 4J4PC 4LLYB 2MQ0A 3DMMB 3O9WD 5CIPH 5E94B 2V5TA 2OL3B 3QO0B 4HKXA 1ZA3B 4NSKB 1HOCB 5FKPB 4LNRB 1DUZB 3MLSH 5ITBH 5EH1A 5BJTB 5D6DA 4PJDA 3KPRE 3VXQA 4XVJL 3RPIA 4OI8A 2QQKL 2R2EA 3NA9L 4HWEL 1GYAA 5TQ2H 2EDYA 1GC1H 3KHOA 4PJ9B 1YEIH 5J56B 5IQ7H 5I16B 5E6ID 2F74B 4UIKH 4JPKL 4ZOBA 2OQJB 3QHTC 2XQBH 3QDGB 1B0WA 3MRIA 4CADA 3MCLH 3VFRB 1U8QA 4O2EA 2V7NA 1GGIL 4HAFA 4IJ3C 1OTUC 1HHGA 4ZSOE 4JO2L 4WO4B 1T3FA 4OZGE 3UTQA 2NY4D 1JWUA 2D2OA 4E9LA 4AENB 3HMXA 5D7JB 2CJUH 4R4ND 3AROA 3LV3A 5DR5H 4ZYKA 8FABA 4WHYG 4H25A 3LD8B 3LN4A 2EYTB 43CAA 1AKJB 4OQTH 4OZIF 4ZUWB 4KDTC 3O6LL 5L2JB 1JI1A 1R24A 3QIUC 3MJ8B 5E00B 1U93A 1D5MA 5FGSA 1BFVL 1NCWH 3B9KC 4ODSH 3QIWD 1KC5L 1XGUA 1VFOA 4LEOA 3BKYH 2B4CL 3V4VH 2BVOB 3HMXL 1MCWW 2W38A 4CGTA 4ZXBD 2BMKA 4NNPL 1NDGB 3VWJB 2R15A 3EHBD 3RX7A 1UKTA 2IAMD 1IT9H 2VZ1A 2NNAA 5F9DC 3MXVH 3FN9A 4H8WC 4OFPA 1ZHBB 1EBAA 2DJSA 4LSPH 3FO9A 3KXFE 3Q5OA 2A73B 4ZTOL 1PFCA 5ADPL 5EUKB 3EYVB 5CSGA 2UWEB 5I19L 1MEXH 3CVHB 1WGOA 1N0XH 1U6AH 3I75B 2BJMH 5E2VL 4XNMA 4K3JH 3MUY1 2JELH 3E0GA 3G5ZA 4Y89A 3TJHC 3FN0L 4PRBB 1JL8A 4TRPH 2Y6SC 3MBED 7CGTA 4GUPB 4BUHA 1X6LA 3D3VA 1ZMYA 3ARED 1KEGL 1U8PB 4P2CG 1GZQB 3BRFA 3ZKXC 4NCDA 1YDPB 5J8OA 4KVCH 3GSQB 1N6QL 4UILL 3Q1SH 3HRZB 2VRAA 1XEDA 4EIZC 3RNKB 2VZ3A 4LAQH 4UMGA 1FVEB 1DZBA 1M7DB 1OLLA 3T0EE 4N68A 3HKFA 3P77B 1FHGA 4X4ME 2M1KA 4J1UA 4NDMA 5IVNA 2JB5H 3ESVF 5J9PB 3SDXF 1BF8A 4FFZL 3BYTA 4XBPA 1FG2B 5EBLB 1P4BH 3MV9D 3PJSA 2NXZD 1YMHB 4P2OD 2YUZA 2LABA 2IJ0C 3MXWH 3X14B 1DQJB 5FYKH 4HFWA 2FECL 1A7QL 5DSCB 1RURH 3IDJA 2H9GA 4U31A 5F7YC 2CGRH 4CUCA 1T21B 1H3UA 4L4JA 4G8GE 5D7LA 4CMHB 3GKWL 1A3LH 3KPLB 5TE7H 3G6DH 4PLKD 1DN2A 3L5WB 4PRIB 5CJBA 1EO8L 3V52H 1UWEL 3T04D 1B4JL 3W9DB 4HWNA 4RGMB 1UWGH 1CGVA 3MNWB 2Q8AH 2IADA 4JKPL 4X6DB 2DBJA 2IALA 4PG9B 2WLZA 3D0LA 5I18H 5CD3A 2JK5A 4H0IA 3AY4C 3QUZD 3W9EA 3D18A 4LASL 4NQEA 5HBBA 2QR0B 4JHBA 5ALCH 1NCBL 3DRTB 5DRXA 3RGVD 3R06A 1ZHNB 1HQ4B 1K2DA 1PBYA 4JGMA 5C0DA 5AWNH 3ULUD 2GK0A 1TVBB 4X5WA 1LP9E 3Q0HA 1RU9H 1JGVH 3HG1A 2QV2A 3ARGB 5EOCH 2WK2A 4BELD 3WXVH 4M02A 3PL6A 5MERB 5FO7B 5D1ZD 2V6HA 3O2VL 4QRSA 1YEEH 4F9PC 1ZLWH 1I8LA 3FRUB 5F7NC 1YMMA 5IBLD 3LEVL 1OGAE 1T1YB 1YY8A 5GRJH 2UY7A 5HYFA 4PJAF 3L7EB 4D8PA 2Q6WA 1JN6B 1BJMA 4JM4H 1NGPL 5C0FB 5J13B 3ARXA 4E41E 4IMKA 5CBAA 1TZHA 1UM6H 5HDOA 3LS5H 2D7OA 3LN9A 1YNTA 4AG4H 5EZJB 1J8HE 1P84K 4U1IA 4F33A 4AIXA 1S9XA 1FL5B 4FQXC 1HK6A 4EDWH 1EAPA 1ES0B 2OM5A 3O3EA 5AAMA 4KJYA 1RVFL 5CBEA 5IMLB 3OJMB 3DUUB 1PVHA 1QD0A 32C2A 1CFNB 2AI0L 4M62L 3CH1A 4AZ8A 1AC6A 1MJ8L 1C08B 5D7KE 1D5XA 2I07B 1NKOA 3H9ZA 2IQAA 4PJAA 5INCA 4D94A 4TUJB 1Q1JH 5FB8B 1U36A 2C1OA 2NW3B 2XA3A 4MQXC 3BFOA 5I76A 4Q9BA 3Q3GA 3JSSA 4Z7VA 2VC2L 4P46D 2BVUA 4X9GA 1B9ZA 4PJXE 4XBEL 2VDML 4PTTB 3D2UB 5GGSY 1K4CB 4QRPD 1R3LA 5D1QD 2EIBA 3BDXA 4K9EH 3SE9H 1WIPA 2UY6A 4KTYA 1CE1H 4UNTA 4LRIC 4ZOEA 4MNQA 3HI1A 3RWJA 5SWSE 5A40E 5F44A 5FDWB 3RNQB 5CZXD 5GGUA 5C0AB 5TQ0H 1JNHA 2EE3A 3BSZH 4LAJH 4LLUA 4HEME 3CXDH 1GL4B 3TBWB 3NGBB 2P43B 2IFFH 5F7WC 1HN1A 4Q6IC 4X7CC 4D9QD 1OAKL 5B22A 3RKDD 1T03L 3TVMC 4EN3C 1KT2B 1YEGL 3FOMA 1RK1A 3IYLW 3DHJA 3PWNB 1HQRA 3SCMB 4PJ8D 4JFOA 3VWKA 1JFQL 4NFBA 3OX8A 5D7IE 3V4UH 3NFNB 3FT4A 2DWDB 3DV4A 4M43H 5DRNB 2ZCHL 4RGOL 4WFED 2VL5A 3EJJX 4YK4B 3QP3A 3SKOB 5B8CC 1NEZB 1KCKA 4CU8A 4HG4K 4H1LH 4QTIL 1I1CA 4K94H 1EO7A 3KPMB 1TMCB 1UQSA 3VFMB 2Y25A 1KCVH 4DTGH 4RZCA 2D7QA 4CL7A 1JHKH 5IHLB 5C71A 3RHWF 3LPGA 1L7TL 1N6VA 1A5FH 3V6ZA 2X70A 4A2MA 4OZFH 4HGWA 3WFHB 2YD2A 3O6FB 1I9RL 2E7BA 1IZJA 4ODHH 1T2QH 1OCWL 5DVKA 3CLFH 4L3ED 1CFTB 1IM9D 2J8UB 2R56H 3FFCB 2IBZX 2WWKO 2F54D 3UO1L 5IT2H 2FATH 3SKMA 1G9NC 4UUJA 1YPZE 2IPTL 4W68A 1U8IB 3P40A 4OBSA 5ALBL 3EOTH 3RIFF 2QSQA 1S7UA 5L7XL 4R4FH 3QFDB 4OGAD 3DROB 3QCVL 5A16B 4HJGA 1TZGL 1UXWB 4GRWB 3HLAB 4KV5E 4EUPA 5DK2B 3TA3A 4MGXA 2HG5B 4BZ1H 3KPRA 4OZGF 3TN0B 5L2KE 4OCYL 5EORL 1OSPH 4J23A 4DGVH 3BJ91 4I18A 1YUHB 1DN0B 3MRKB 2AV1A 1P7QB 2R0WL 3V5HA 5DQ9B 3O6KL 1KPVA 1A1NB 1K3ZA 1DFBL 4RAUA 3LY6A 4Z0BL 1AGBA 4PJCA 5I66A 3HPJB 4JRWA 2AJUL 3BWUC 1OT1A 1S7RA 1PLGH 1TPXB 1HCVA 4N8VG 3BKML 4JM2B 2SEBB 4KROD 3FQTA 1CFVL 3LZFL 3E3QC 4B53A 3FB8B 1W72B 3N50A 1BBJA 5T3ZH 5BRZE 2DYPA 3FQXA 4OZGA 1JBJA 4XC3L 4QYOA 1GVIA 3REWB 1V7NH 2PETA 2KKQA 2CH8A 1GSMA 1CLOL 3FMGL 4QY8A 3I3EA 1EERB 3O4OB 1MCOH 4XXDA 4ZUSA 4UV4H 5DJ6A 3WS6C 3AB0C 3VD9A 1RZGB 3JWDH 4PBVC 1QRNB 2NY6D 4WVRA 3ZO0A 3SQOL 4J8RA 4R97C 4XAKD 1FYHB 4HGMA 5D1XC 4TVPD 5IOPA 1YNKH 3HI6H 4X9BA 2X4OA 4MA8L 2F53E 4JG0H 4GAGL 5JXEC 2MNUA 3BVNB 5B39G 5CGMA 5KSAC 4HWZB 1FYTE 5HI3D 5JIPA 4AH2A 2BVQA 2GCYB 4F3FB 1IFHL 1D9KB 4XRCB 3BGAA 3GM8A 4NO3A 3F58L 3EDEA 3SJVD 4EDXB 4UAOC 1G7MB 4JPIA 3VFPB 3RVVD 5GRUH 5EA0L 5BQ7A 4O9HL 3IRPX 3MRRA 1H3XA 1OSZB 3O3AB 4MB5A 3IKKA 1IC4H 4QRRB 2E6QA 4WCYL 1MCDA 3GRWH 3SKNA 2HN7B 1JHTB 1RZ7H 3NIFE 5GS0H 2KQMA 4NOFA 1G0YR 2DF3A 2DQFB 4KRNA 4N0UE 3WHXB 2HKHL 2YRLA 1UB5B 5IVXB 4FMKA 2CKBB 4UBDD 3QEQD 1VSCA 5F1OB 4KAQL 2ESVD 5GIRB 1NMBH 4OT1H 2Q20A 4B5EA 4ZO8A 1A7NH 5T5FL 2YBRB 2GT9A 5C0GB 3LIZL 3O9WA 1D6VH 1RFDH 3QCTH 2NZ9C 3HAEH 4MD5A 5IVZA 5C0JB 4EZMA 3OKLA 1I3VA 4Z7UE 5FA4A 1JUFB 2ORBL 2VXUL 4HLJA 2QADC 4LKXA 3QFJD 2WINA 5C0BB 2Q86A 4PB9L 2E6PA 1LK2B 5F9WB 4MXVE 1FNFA 4WUKL 2Q7NA 3UEZA 3ULVC 2MPAL 2XQYG 4NOBA 1BVZA 3OZ9L 3T0DA 3QQ3B 1VEMA 3MR9B 5EU7E 4YR6A 5KSUB 4RIRA 2IPKB 1F4YL 3IF1B 4M6NH 1DCLA 4EI6A 4F80A 4JFFB 1LP9F 4LEXH 3RZWA 1EX0A 1G7IA 1U8OA 2X40A 4TTDD 4NN5C 5KZCB 1SBSL 1RK0B 1CGTA 2YRZA 5CP7A 4AY0A 4OF0A 1B6DA 1MCRA 2GJJA 1MLCB 2YEZB 3MV8B 1NC4D 2NY2D 4KKNA 2X4UB 4LLAA 3IU3B 3X3GL 4OFIA 1FAKT 2W65B 3ESUF 4JDZB 5EU6B 1CTNA 1FGVH 3NCMA 4DJMA 1A0QL 4BZ2L 3PE9A 3OKKB 4G3YH 3LKPA 2PTTB 5I75C 3IDIA 3CK0L 2BY2A 2YPLB 5E8DH 4HUUB 3TH4T 3QZWB 2VE6B 5IB5B 3GMLB 4WUUE 1WFOA 2DMKA 4UTBL 2P44B 1OQXA 4XMLH 1ZS8B 2MHAB 2NLJA 1CICA 2X4QB 4TPRH 3RTQC 4F8TA 1H5BA 3QUXC 2BNQB 1NGQH 4N0RA 5D2LA 2UVEA 5CZVL 2E27L 4PRPD 5DVNA 3RGHA 3VFTA 3EUUA 1FPTL 2YC1B 4JKKA 5JXAL 1VHPA 4MCZB 3DJ9A 3MA7B 4JQXC 4PJXF 1DBAL 1XGQB 4QT5B 1UA6L 1QYGL 2WUCL 5HYJB 1IAKB 4R96B 1XR8B 4O5LL 2X4RB 1WCQA 4FFYL 4M93C 4G43A 2ICEB 3DECA 2J8HA 2F5AH 4Y5XC 1WBYA 4APQB 3DUSB 5D2NA 1Q9WB 3CFCL 3UJTH 4MMZC 4Y4KB 1IGMH 4YNYB 4WY7L 5F7DA 1I9JH 4YHZH 5EZIL 5I73B 5CINH 5FO9A 3NACL 5C6PB 2AJXH 2F9BT 1H0DB 4Y4HB 4K2UH 4KGLA 4M9PA 3ZTJH 4DGYH 3S37H 3SGEH 2XTJC 4PGCB 4GBXD 3D5OF 3Q5YA 1MCEA 3B2VL 4XX1G 3V7MA 3QQNA 5JPMA 1EHXA 4M7LL 3OKOB 4OF3A 4BFGA 5D7IF 4HV8A 1KCRL 5HGAA 3QDGE 3WKMH 1D5IH 3MV9A 1JF6A 5IB1A 3O2WH 5JDJA 1J9CT 4P2OA 2GJZA 3T4YB 4U1KA 4M6AA 2EO9A 1PY4A 3EJZD 1NUFA 1SMAA 5GJSH 1NANI 1RZKL 3TLRA 2YPVH 4O02H 4MDIA 2BXYA 1SEBB 1BD2B 3WXWH 1OF2A 4DCQB 4H0GA 4WTZG 4FFWC 1BQSA 3LDBB 2ATPA 5JW4M 4YQXL 3C8KB 2GI7A 2GSGA 3UX9B 2G5BA 5E6ZA 4ONFH 4V1DB 5J6GA 1DQLH 2WAHA 5DEGA 3DYPA 1LEKA 3QUZA 4BA8A 1YPZF 2HLFC 2D7MA 2NY5C 4PP1D 4QTHA 5ISZA 3RJDA 1B2WH 4ERSL 5HVWA 4I1NB 1IAIL 3KYOA 4LVNB 5D6DC 2OSLB 2PO6D 3BDBA 4RFNC 5HJ3B 4FQQB 4EBQH 4LDEB 2APWA 4ZPTA 3I02A 3BZ4B 4U6XA 4JY5L 4Z8FH 3VG0L 4KV5F 4Q97A 4WJ5A 3U2SB 2UWEE 3MBXL 1N5YH 1L7IL 1EBPA 3EFDH 1JCKA 3MGAA 1FE8H 1X7QA 5IBUB 2R4SL 3BHBA 1UKQA 4RBPK 4KQ3H 4NO5B 4ODUA 5D1ZA 5DFVC 4LCWB 5EOCJ 3C8DA 4GH7B 1BZ9B 4OLWL 3UPCA 4I2XA 5ENWB 5LG1A 1JNLL 2B4CC 3RVWC 3GK8H 4DN3H 1BVKA 3VFSB 2DLGA 5DVLA 3W0WA 1IGTB 2ICWA 4MB3A 5SV3A 2ILLA 3C5SA 5FKAA 2X10A 2ZCKH 3O4LB 2P8PB 4U6HB 1YYMH 4Q0XL 3R4DA 3S3JA 4KWUA 1HH6A 3VW3L 2A6JA 4PV9A 5ACZB 2VDPL 3ARSA 5DUBB 2UV3A 2BNUB 3GSOA 5I15H 5J6HB 2MQ3A 1MNUL 2DQEL 2XYCA 4Z78B 3Q2CA 1EHLH 1CT8A 3OR7B 3GSVB 3PWUA 4KPHH 3JV0A 1MJJA 4P46A 3FKUS 2YRPA 2I27N 3TBTA 5KSBB 2HVJB 1G1CA 1JK8A 2BC4B 3G5VB 1OAUL 1QLFB 3T2NH 3EW3B 1V05A 3WE6B 2HT3C 3MRGB 4M1DL 4LHUG 1W0VB 5D1QA 4MZ3A 2D0FA 4PRIE 4OF7A 1JGLL 1FVDA 2FH8A 2AJVL 2VXQL 3IFPB 5TE6L 5HI4C 3BD4A 4P99A 4OGXL 4HKZB 5C0IB 5GSVA 5IV2A 3EO9L 4H5SB 4JRYA 4X6DE 5D6CB 4HUNB 3HNVL 1Z3GH 4XPAH 2VLLA 2FD6H 4ZOAA 4MAYB 4CDHA 2VLJD 3QUKA 3QHFH 3CFBB 4JHAL 2BSSA 1QPPA 3CSBA 3QEHB 4PJ8A 3NIFF 2BY0A 4PJ7A 1FYTA 1G7LA 4U0QB 4HIHB 1OWRM 2Y7QB 4F57L 5KVGL 1FSKB 2ADGB 3UP1A 1KPUA 1UENA 3G9VA 1IC7H 1ONQA 4PJEA 5HYEA 5HGGS 2P5WB 3U9UB 3IDGB 4ZDHA 1VESA 1JHLH 5HHPB 5ANMA 2AK4D 4QF1B 5KTEH 4XPHH 3BO8A 4LPTA 5KSVB 2V2XA 3WFDL 4MA7H 4P5TB 4OKVB 3MROA 2VH5H 3KDMA 4Z7UF 1AD0A 1AHWB 3TJEL 1PYWB 5HHMB 5MEQA 3L3HA 4FQ2L 1XCQB 1XIWA 4MXVF 5KVEH 3W2DH 4HW6A 2YPKB 4R3SB 1QA9B 1UCBH 2XRAL 4GG8A 1FRGH 5E8OA 3HS0A 1GGBH 2EDDA 2AGJL 5SX5H 1K85A 5FYJL 3M07A 3CLEL 4N1CA 2FZ3B 4Y16A 3WIFB 5HXMA 1CIUA 4DVRH 2BERA 1C1EL 4LF3B 4K3DH 1G7QB 1ZT4A 3KLAA 3O6MH 1QNZH 5CCKH 4K7FA 1MAMH 3QG6A 4YHOL 2XZCL 5A43C 2R1WA 5EC2A 3O0RH 1BBDL 5E70A 4OGYL 4P4KC 1HDMA 3DX8B 1YEKL 1EVUA 3N1PC 1WFNA 1ZA6A 5DJAA 5EU5B 1A8JH 3PL6C 2XKUA 2N7BA 2X42A 4XP9H 3FO1B 5BV7B 1T7ZA 4HSQA 1IEBB 5C0AE 3AU1B 4KZDL 1I8LC 7FABH 1KIPB 2W0LA 2X1WL 2XZAH 2F8VA 2XWTB 3P4OB 4DKFH 4HBCL 1WTGT 5ESQB 4HHAA 4PGBA 6FABH 4DKEH 4CVUA 2MJWA 5D9SA 4HS8H 3M8OL 4IMKC 4GOSA 4U33A 4XP4L 4D3CH 3BH9A 3NN8B 1JRHL 1QFUH 2I60L 3ELAT 4P9HL 1DQQA 4GAJL 1CFQB 1S7XA 3X12B 4WTWA 1D5BB 3SDDD 4F7CA 5HPMA 4JZOA 4HC1H 1FLTX 4ONHB 1YYLL 5CMAB 1Q0YH 3UC0H 4MJ5B 1MHHA 1C5BL 3O3BB 4ZD3L 2BVTA 4MDJA 2OI9C 3ROOB 4P4RB 4PY8I 4G9DB 1JYVA 5IGXH 3Q6GH 4PJ5B 4ODTL 3DX9B 5JA9A 3BISA 2DI8A 3BI9X 5FGBA 5EO0B 5IHZA 1MQ8A 3T65A 3EYUH 5IP4A 3H9SB 4IEFB 5FUOH 1MWAA 4PRAA 3KS0H 5FV2A 3SJVA 4PD4J 1NCUA 1ORSA 4MX7B 5DD1H 3U48A 5KVFH 15C8L 3QHZL 2J8UE 3FFCE 2DDQL 3C5JA 4E0RB 4RRPG 1L9MA 1ZXQA 2VLRD 3MO1B 4RBPH 5I1IL 4MA1C 3KXFD 4LLYA 2A6KA 1K6QH 1OAYH 5BW7A 4NNYA 2W0KA 3VXOB 3B8SA 4IJ3B 3BUYB 2V2WB 2HYMA 3BPNC 1HOCA 3QULB 3REVB 1JPTL 4JFYA 1F3RB 5BS0D 4OD2B 4GRWE 1RULH 3H8NA 2D31B 1OAZL 1T4KB 3DPBA 3O2DH 3T77B 4GQPH 5EFIA 3OB0K 3VWKC 2ESVA 3MYJB 3Q6FB 3TYFA 4M8VA 2J8OA 4P2QB 4KK8C 2VWEC 4DZBB 3C6SB 4ONGL 2X4PB 2X7LB 4WW1A 5J3HC 3QIUB 3TGXA 2IBBA 2F74A 4HIJB 1EFXB 3BMVA 1A2YB 4JHWL 5FOBA 3B9KB 2OQJA 3QNZB 5C07D 3V6OE 3WO3B 5I2IB 4LCUA 4N8VB 3HA0A 2IGFH 3I50L 2VITB 4BFEA 3WUWA 1FL6A 2EDQA 3T0ED 1ZGLB 2EYRB 3VGAC 3QFJA 3LS4L 3AAZB 5J0BA 2DQCH 1FNAA 2H6PA 4ESKA 5H2BB 2XA8L 1MJ7H 4QXGL 3IDNB 3MRMA 4TSBL 4ZUWA 1WT5A 4M6OH 1DP0A 3ZT5A 1F58H 1J0JA 3S34H 5JW4N 3B9AA 1A4KB 1NDMB 3BXNB 5GHWH 3PGFL 2RCSH 2UWEF 4P49A 2O5YL 3LRGA 3PGDA 1QRNE 4N5ED 3VG9C 4WEBH 2KZWA 1MH5A 4G8GD 1UZ8B 5DMIH 4R4BB 2O93L 4ZQKB 1NDGA 1CBVL 3TA3C 5FGRA 3UBXB 1C8PA 1GPOH 1DEEB 4FQHA 5B39B 3KPSD 4PY7A 4NRYA 3ZKXB 4NUJB 1KLUB 1MFAH 1E6OH 3VXPB 5FYLD 1IGFL 2W60B 3IFNL 1ZT1B 4OCSH 3T08A 4NO0D 5DMGD 5I8EA 2YUWA 1A6UL 1DQMH 3L3GB 1HHIA 3VRJA 1XZ0B 3H7BA 4QRRE 4JKLA 1JPSL 2ITCB 4TQEL 4GW4A 5HHXL 1CN4A 3B9VA 1ZHKA 1GH7A 4NQVA 1HXYA 1DL7H 2R2HB 4OLYL 4L3AA 1FZKB 4NZTH 2DL9A 4J3TA 4JLRB 4KHXH 1YDPA 3CVHL 5IVXE 3UTPD 4MZ2A 4ODXA 2AV7A 1OTTD 4P2RB 25C8H 4YHPA 4XPGL 2FJHA 2Q8BH 1MFBH 3R0MA 5A2IH 4XPFH 2ID5A 5I1GH 3TYGL 1T5XB 3RX8A 2R1XB 4QRUA 5BVPL 1QLEL 3RQ3A 3SY0B 1ZTXL 4ODVH 5B3NA 4EQ3A 4PGEB 1FG2A 1JWMA 5DLMH 2JE8A 1J8HD 4XAWL 2UVFA 1BVLB 3GFUA 4RFOH 2A9ML 4X6DF 3QA3B 5J11C 2CDFB 4I4WA 5F96L 4ZFFB 5C0BE 2FJFA 5C08B 2GJ6B 1QHPA 4HKBB 3VFNA 3BZEA 3G08B 5D7KD 4JZNB 4GBXA 4JFZH 1I9EA 3K4ZA 4XWGH 2EDNA 3R0NA 1HSAA 5HI5C 4OSUH 1E6JL 2AERT 2A0LD 5T1KA 5I1DA 5FHAH 2H32A 4KTDL 5T33H 4UQ2B 4WI3A 5CGYC 4JFFE 2I25N 4Z77B 5DRZB 8CGTA 1IGCL 2YD4A 1MCPL 3M45A 3BIBX 5FHBL 3DETD 4Z95L 4YHKL 4X4XA 3QRFM 4XZUB 3S97C 4M1GH 1HIML 3MV8E 1MF2L 3PXHA 5SWSD 1A7RH 2X6MA 3V0VB 1N59A 5F7KC 1M4KA 2XQYK 4CN4A 5EU6E 4MQSB 1U0QA 4L9DA 4N90E 4KKAC 5HGBB 2VXSH 3O9WC 1T2JA 3M1BB 2ZKHH 4FQXB 4MQ7A 4XVSL 4ZTPH 3I6GB 4AK1A 3OXSB 4UT6L 1FIGH 2YPLE 1UM5L 4NQCB 4QHNB 5JQ6L 2HLAB 4JRXD 1I7TB 3WCYA 1TETH 2PO6A 5CSZA 2V5MA 2DBLH 1MCJA 3EAKA 4XNUH 1UYWL 2ZSWA 2LU3A 4OFYD 3KLHC 2BCKB 2BNQE 1C12A 5D72L 3IGAB 1GXEA 2UZIL 4FS0A 1J1XL 3ARDD 5E6IC 2N4IA 2R0LH 3P0VL 2Y06H 2VYRE 1KULA 3SO3C 3RI5F 2BDNH 1JGEA 1WBZA 5C3TA 1ETZB 3HC4H 3FCTA 4UIMB 5HYJE 3MODH 1YC8A 1FV1A 4M5YL 5L9DH 3O45B 1IAOA 2NY4C 1JPGB 3PF2A 1FJ1A 1MRDL 1T20A 4KXZH 4R4NC 5CEYB 5HD8C 1FZOB 4FFVC 4K71C 4Q6IB 1KELL 3HAEB 5GS2H 4I3SL 4YAQA 3T2PA 1CK0L 5DC9B 2H26A 3TVMB 5JHLH 1CDJA 4U6YB 3ARFD 4EN3B 4HXAL 1SJEA 2WW8A 1YEHH 1MFDL 3BP6A 4FN0A 2P4AB 2OK0H 4OJFH 3D1MC 2J5LC 3IKCA 1UWXK 2Z8WC 5HPOA 3QIWC 2X4SA 3QXAA 3BEWA 1R0AH 3VFUB 1NGYA 2PTVA 5B8CB 1MI5B 1R5WB 5L2KD 3SE8L 3ALPA 2NY1C 2VAAB 3EHBC 4MJ6A 2H3NB 1CICC 3QUYD 4NKQB 3CFIC 4S1RL 1AI1L 3LQAH 4AM0B 5EPMA 1H5BC 1BZQK 1JF5A 4OM0H 1CE6A 2OLDA 3HC0A 4MWFB 1KCUL 2AJZB 4G8EA 4LDLB 2Q87A 1INDH 4IRJA 3RAJH 1D3CA 3VXSB 3PWNA 1AP2A 4Q2ZB 5DYOB 3SCMA 1BD2E 5I8KL 4FQPA 2XZQL 3U79A 5BRZD 2FDBP 4BK5A 1M6OA 1FORL 3MLPA 3QPXL 1RQ5A 2PXYD 3IDMB 4S1QL 4GKSB 5C0EA 4V1DE 2J8UF 3TO4A 1P7HL 3IU4H 3AREC 2OMNA 5CJ8A 3ZZ1A 5D2NC 4S10A 4U6VL 4NM4H 3EYOB 4QXUL 2OZ4H 3O3DA 4XNQB 5IHUL 4LLQB 3MUJA 4GKZA 5DUML 4JFPA 2J88L 4Z7WB 5I1HL 4IIQA 4FQJH 3PQYA 3P0YL 5LAXB 1FVCA 4JPVH 4HS6A 5E2TH 4GRWF 3O6FA 4PV8A 3VDAA 3MV7D 3MNVB 3QXDB 5E2WH 3LOWA 3QG7H 1CFTA 3SDCD 5F7MC 2H8PB 2OJZL 2XWBB 4Y8DC 2FR4B 3K2UL 1GGCH 4LCWE 4P2OC 4NP4L 4PJGA 3UTTB 2EH8H 4GMSH 4NBXB 3MJ7A 3ILPB 5EIIB 4UINH 5IB4B 3HZYB 4LSSH 4KI5C 1DBKH 4JM2F 1DJSA 2R0ZH 5FCSH 5A16A 4M3JA 4EI5B 1QBLH 4KK9D 4PLKC 5JORB 3TBVB 3L5IA 2J3SA 1BMGA 2WIIA 4NZJA 3P9LB 2HVKB 1OGTA 3GSNB 4JFDD 1LO4H 3O4LE 4NN6C 3BAEH 3PP3K 1LO0L 5L6YH 1MAKA 3AB0B 3K7UA 5FYKD 4YDIH 4IS6A 4HK3J 3V6OA 5GGRA 3NAAL 3K4AA 1U8JA 2NX5B 3QUZC 2VDQL 4HMCA 5DJ0B 3DSFH 1NCDH 4FTVA 3U4EB 4R26L 5IG7B 4R97B 4BH8A 4D0BB 5D1XB 3RGVC 2IANA 2DLFL 1V7ML 3SE3A 4EUPG 2IG2H 3D69B 2AXFA 3CD4A 3RP1A 5AEAA 2YXMA 3NIGE 4P9MH 5ESVB 3REWA 5KSBE 4TVSa 5DJZB 1RUKH 1T83A 5KSAB 2V7HA 2HAZA 1NAMB 5DUPL 4NUGL 4U1LA 1DBBL 3WS3B 2EDJA 4UAOB 5HYQB 3KR3H 4G6KL 5D1ZC 2D9QB 1OP5K 4LRNH 2B0SL 1TDQA 4DZ8A 4UQ3A 2GSIB 3I2CL 4QWWD 1F6LL 3X3FH 2OP4H 3MRPA 5IBLC 3CFDB 3GKZA 4KKCC 5HGHA 4B50A 2VZTA 2BSTB 1YQVH 1L0YA 3TP4A 1KB9J 1BM3L 1RD6A 3LSOB 3NH7L 4DUXA 3UYRL 1EVTC 2PW1A 4KMTL 4GLRH 1C5CL 3UTZA 3JZ7A 5GRYA 3VXRB 4TUOA 2FO4A 4GSDL 1ZT7B 3UPAA 1AO7D 5BXFA 1HWGB 3KPPB 3DXAD 2HFTA 4P23D 1B0GA 2C3VB 1HKFA 2P48B 5EWIL 5IVXF 2V9TA 2JTDA 3OKMA 3MREB 3HR6A 3WFBL 2P5WE 2DQGL 4PJHB 5HHNA 1F3DJ 4FZEH 4Y5VA 2KH2B 1OSZA 3RWDB 3MA9H 4NBZB 5BZDB 1XGYL 4QRRA 1I7ZB 2HFGL 1A14H 1U8MA 1BQUA 5FUZH 1XF4A 2DAVA 4P46C 1EEZB 3FB6B 3IAGC 1S9VB 3MRBB 1AGDA 2QADB 4QHKJ 1BF2A 3EJYC 4XVTH 1GOGA 5C0CB 2AQ3A 2XN9A 3FAXA 3ZT6A 1HI6B 3TIEB 3A67L 3IJYA 1NH6A 1UB5A 1KB5B 5D1QC 5HHME 3MOAH 5IJVB 3E6FA 2YD3A 1CS6A 1U2HA 3QPQD 4YHIB 5D7SL 4HAGA 4UZGA 4LLWB 5C09A 4F8QA 2E7LA 2OR9L 3U36B 1P53A 5JZ7C 2YBRA 3HR5B 3P2TA 1JF1B 2PW2B 1A6PA 1AGCB 2E9BA 1ZE3C 3ORJA 1R3IL 4OB5L 4GFTB 1Q72H 3HB3D 5AG9A 1G9MC 4NN5B 5BS0A 2Z93A 1URLA 1L0XA 3L6FA 2PR4H 4PJ8C 3L3OB 1VENA 3VFVA 3F6IA 5EBWA 3QH3B 2ZUWA 1VKXA 3DMMD 5AD0A 3F5WB 5F8QC 5BVJB 4E42A 1CL7I 1LEGB 5F89A 1CTOA 3MRDB 4Q9QL 1L6XA 4E5XB 4HIIB 5FM5M 1N4XH 4WNQA 1J5OL 1QSFA 5EOQH 1P2CB 5I75B 4F37K 3MR9A 4PS4L 4NQSB 2BHZA 1A6VH 3IF1A 4KRPD 5EO1B 5FOJA 1PAMA 3MV11 4XB7A 1I7UA 4JFFA 1OWWA 4DQOL 3HC3H 1D7FA 5SV4A 4LU5H 3HNTL 1QR1B 2VSCA 4PJ9D 1WFUA 3I85A 1Y0LB 4NZRH 3RTQB 4PLJD 1CDCA 4XP6H 4AQ1B 1P5VA 3QUXB 1Q38A 5AUMB 4KVNH 1UXSB 1E4JA 4IOFD 4KTEH 4N8CH 4XBGB 3Q5TA 1QBMH 3IU3A 1ZLSL 4XCNB 2W65A 4JDZA 2HJKA 1XIWC 5ITFB 1NSNH 5EU6A 5HY9B 1HXMB 4K8RL 4WO4D 5IR1B 1U91B 4Y1AA 3OSKA 4ZUUB 1JNJA 1UB6B 2WQ8A 3QT2A 1A22B 5A2LH 1BIIA 4X99B 2ZOKA 2XNAA 3CZFB 1WZLA 4HUUA 2C3GA 4OGAC 4YPGA 1AKJD 1OY3B 4M93B 4Y16C 1N8ZB 1VPOH 4PJ5E 3JTTB 4Y5XB 1QVOA 2P5EA 5CILL 3KPSA 1JP5A 5C70A 1GAFH 4HK0B 1I3GL 3W82A 3S9DB 5E9DD 4XHQA 4M48L 2I5YL 2QQLH 5I6XC 1AFVL 5HHOB 2XTJB 5FUCC 5MP6H 3A6OA 5IFAH 4NO0A 4Z5RA 1YNLL 3MA7A 3IDXH 1G84A 4I9WE 5FYJU 1ZANH 5DD0L 4G7VH 4N0FB 4AIZA 2X4RA 1J1OL 3VD5A 4R7DA 3PDOA 1OD9A 1QFWL 3RWFA 1Q9OA 4I3RH 5T3XE 3ULUH 5IEHB 1U8NB 3DUSA 2X09A 3PXJA 1KN2H 3OGCB 2IBZY 3W5MA 1M7IB 3FONB 2WMPA 4ZG1A 2HMID 2R8SH 1JI2A 4XWOC 4HS3A 1QKZH 4M61A 4PRNA 1CI5A 4P2QE 5T3ZD 4NGHL 3P30L 1U8LB 4PREB 2NY6C 3DX7A 4PGCA 4DKDC 5EDXA 5GRVL 2R0KH 4Q6YA 3DVIA 4HKXB 4YDJA 2X1XR 2JCCB 3GBMH 2APVA 1J18A 3SQBA 1RIUH 5DF0A 2Z8SA 1EGJH 1IAIM 5FGBC 5HI3C 1YECL 5DJXA 4RFNB 3VXQB 2FX9H 4DOHB 3RPIB 3UJJL 2J1KA 2DTMH 5CP3H 1U42A 4B0MM 4OFDA 1NFIA 2E6JA 3TBSA 1DBMH 2VOTA 2DQHL 1S5IL 2UZXB 4LNVA 3CGTA 5LGJA 2YWYA 4XPBL 1F2QA 1N26A 4AYFA 4YBQD 3MRIB 4CADB 2IH1A 1U8QB 4O2EB 2V7NB 1BOGA 5FDYA 1HHGB 3WNKA 4BJLA 3DI2B 4FQ1H 1T3FB 3UTQB 3B2UD 2HKFH 4PRID 2J6EA 2HJLB 1XF2A 3LV3B 4ZYKB 3PHOA 8FABB 4PFEA 4H25B 3LN4B 2FB4L 3U1SH 43CAB 4LSUH 4Y2DA 5TPWL 4F58H 1WWCA 4UT9H 4I0PD 2VZOA 2XY2A 4ALAL 3KLSA 3PHQA 3U7AA 4FXGA 1D5MB 4UDUA 5GS0D 4UB0H 2EIEA 1VGEH 3ARRA 1JGUH 2CXGA 1ZHLB 3H9HA 1V8HA 4A6YA 1E27A 1A6WH 1XGUB 4LEOB 4BH7A 1DSFL 4LOUC 4DN4H 4Y0GA 1U8HB 2BMKB 3CFEA 3SOBL 2YN3A 2VAJA 3EYSH 2J4WH 2VDKL 4OFYA 2NNAB 5CIPA 4NC1C 3ARGD 4OQ1A 3FO9B 3ARDA 4HLZG 1MFCL 2C26A 3P9MA 1WIOA 1RUAH 1INEH 4M03A 5TH2A 3NIGF 4N0YH 2FECI 4P2RE 1MCLA 5KSBF 3O4LA 4M4RA 4XNMB 3G5ZB 2B39A 3VXUD 4PBWD 4NO2A 1U58A 3GNML 2DJUA 4WFHE 4GXVL 3PNWA 2D3VA 4HQQH 4XMPH 4DW2L 2NY2C 3D3VB 4Z78A 2DB8A 4Z6AT 2D03H 4M5ZH 4ZNEE 3ARFA 1XCTA 4LARH 5C08E 3MLSL 5KSBA 2GJ6E 5ITBL 2EDEA 2WV3A 2HVJA 3EIFA 1V3LA 3RDTD 3LMJL 3G6JA 5I8OL 1FH5H 1AE6L 2A6IA 2NW2A 1W0VA 1FFNA 4O58H 3ROLA 4NDMB 5TQ2L 2NXYC 1GC1L 2V9QA 4UV7H 3TFKD 1X5GA 4M7LT 1YEIL 4JN2A 3CFKA 3QDHA 4XBPB 4UIKL 4HJJH 5C0IA 2YHGA 3E8UH 3OJDA 2XQBL 2WSKA 3PJSB 3GO1L 2WP3T 5GJTH 2BY3A 4QHMA 4G6JH 3MCLL 3D2UD 1HWHB 4HFWB 3IDJB 5FV1L 2H9GB 4YGAB 1INQA 2CJUL 3QEHA 3KNBA 5DR5L 5D7LB 4GO6B 3UMTA 1K3IA 1CDGA 2JJSA 2ADIA 1HCFX 5ILTL 5T5NF 2XWJA 2PXYA 5BOPA 3CFJB 1H3GA 1HKLH 2IADB 1QFOA 4DK3A 2IALB 3ZSTA 3D0LB 4NQCE 4ODSL 5CD3B 5KVDH 2D7PA 3V9FA 2JK5B 3BKYL 3V4VL 4G6AD 3W9EB 4HIXL 4NQEB 3VXNA 4QF1A 1TJHH 3RWHA 5DRXB 1E28A 4OKVA 3FOLA 3R06B 2ZPKH 1CL7H 4GBXC 1K2DB 5DFTA 5EC1A 5IBTH 4LSPL 5C0DB 1KJVA 2GK0B 4X5WB 4TVPH 3SDCA 3CCHB 1MEXL 1FNLA 1XCQA 4K3HA 4P4KB 4M7JL 2Y9RT 2YK1H 1U6AL 3IS0X 2YPKA 3PL6B 4R3SA 2FIRT 2BJML 3DVNA 3EJZC 1I1YB 4K3JL 4NQTA 2JELL 3BZDA 1X5LA 1YMMB 3WLWD 1YY8B 3RJQB 4TRPL 2DKUA 3BP7A 5GGTH 3QCUH 3CX2A 2CR3A 2Q6WB 1PG7X 3TBYB 4LLDA 3WKNA 1A6AA 1KNOA 1TZHB 2E9WA 4JFDA 5D4QA 3OV6A 4KVCL 4U1IB 4F33B 1S9XB 3S36L 1T1XA 1UACH 4LAQL 1EAPB 5CBEB 3O3EB 3S35L 4KJYB 2I26N 4MS8D 1WCBA 3WHE0 1DVFA 4WWID 1G6RH 3UCRA 3NCYS 4OLXL 32C2B 1KEML 3CH1B 2JB5L 2FBOJ 2BVPB 1MI5E 1QO3B 2IQAB 2R1YA 3TN0D 4BFBD 1LQSR 5INCB 5JMOC 5JPNB 2OI9B 2PO6C 4JCLA 1KLFA 4XP5H 2C1OB 2A83A 5I76B 1KIPA 1MCBA 3VGEA 2EE2A 1P4BL 3Q3GB 1WICA 1P7QD 4Z7VB 5GGSA 2RJMA 5HVHB 5ETUA 4GAYA 4WI7A 2NPLX 2QHLA 3VXSE 5IMOB 2G9HA 5A1AA 4XVJH 1R3LB 1PZ5A 2BRRH 1YA5A 4PPTA 2CGRL 4MNQB 3HI1B 3NA9H 4FABL 4HWEH 3RWJB 4KJWD 5FM4A 5GGUB 4YXLL 1JNHB 4WI9A 1OPGH 4MA1B 1UWGL 4LLUB 3LB6D 2Q8AL 4LCIH 2P8LA 2R2CA 2COQA 4G9DA 1CGSH 1WBXA 1KTDA 3FOMB 3VMNA 1RK1B 4Z7WE 3GHBH 5F1NB 1HQRB 1I4FA 1AO7A 1QRND 1S7WA 4JFOB 4Z18A 3VWKB 3DXAA 3H9SA 3OX8B 3OAYK 1H9VA 2ICCA 1A1OA 3FT4B 3QWQB 5F8RC 1MRFL 3DV4B 3UTSA 1I7RA 1WTLA 4M6MH 5D70L 3VXMA 1HILA 3MO1A 4XMKH 5EOCL 4BSWA 1BFVH 4O00A 3UTTE 1UQSB 4UOW0 1T80A 4RZCB 1WK0A 3E3QE 2XKNA 1YEEL 3VGAB 1ZVSA 3HMXH 4JO4H 2FX8H 3QULA 2CPCA 3UAJD 3OKDA 4IRJC 4RX4A 3V6ZB 2X70B 2D31A 4HGWB 3P11L 5LQBL 4JM4L 1ND0A 3MYJA 1BWWA 1FC1A 1ACZA 4ZTOH 3MRNA 1UM6L 3LS5L 4Z7NE 3EYQD 3SKMB 4D9RD 4AG4L 4FQIH 3BRDA 2C7UA 2GITA 3QAZC 3LPFA 3B9KA 2XY1A 5I9QC 1OD7A 4N0CD 4POUB 2VDOL 2NX5E 3OXRA 3VG9B 1S7UB 5CEZE 3ZE0E 1JMZA 4WV1A 2DN7A 3F7VA 4WENB 3PV6B 4HJGB 3LHPH 2EYRA 1I3RA 1Q1JL 3GIZL 1OM3L 5FECA 4IIQC 3TA3B 3WIHH 4J3XA 1M71B 2AK1H 2ENYA 2O26U 1KEGH 1KTLA 4I18B 3U7WH 3DOSA 3P9WB 2LFGA 3GMQB 1H15A 2AV1B 4OIAA 3T0XA 3V5HB 4UILH 4U3HA 1KPVB 5A3IC 4RAUB 4R8WH 1AGBB 4PJCB 5I66B 5C0BD 1T22A 3FFDA 1F13A 1S7RB 1CE1L 1WEJL 2B1HH 2NR6D 3FQTB 4JY6A 3IXAA 3SDYL 3WUWG 4UDTA 1BBJB 5TQ0L 2DYPB 3FQXB 4KQ4L 1UADC 3CXDL 4I0CC 5LCVH 1RHHA 4QYOB 1YN6A 4R4BA 4XPTL 1TITA 1RJLA 4FP8H 4IRZL 3F62A 1NGZA 4G8IA 2DM2A 2VUYA 3GMRA 4H1LA 1RZJH 1G9EA 3EOYG 2IFGA 3MJ6A 3VXRE 1KLUA 2P42B 4XXDB 4ZUSB 4Y4FA 5DJ6B 1A7QH 5KZCD 3ZKND 3D39A 2W60A 1UH2A 4AL8H 3AS3A 3RIFK 5H35A 2CRYA 4JVWA 1XF3A 2GY7B 4LSTH 1UWEH 4PJHE 3GEWB 4J8RB 1B4JH 3L3GA 2Y07H 3BGMB 1ZVYA 1XZ0A 5IOPB 3ECBB 1ZLVK 3LQZA 2ITCA 2X4OB 3SE3C 4JKPH 5IFJA 4K3EL 4F7EA 1LDPH 1KJ2H 3ES6B 4OZ4A 5DC4B 3QWOA 1U8KA 1KCVL 4DTGL 5J11B 1T83C 4YWGH 1JHKL 5C0CE 2YPLD 4AH2B 5F6HJ 2BVQB 4JLRA 4LASH 5IM7A 3ULVE 1A5FL 4JPIB 1RJZA 1T2QL 1CCZA 1IL1B 3WFEL 5BQ7B 3MRRB 2E9JA 4OI9A 3FQWA 1SY6H 3L5HA 1FIEA 4G6FB 4L9LA 2FATL 3L1OL 3SKNB 1VGKA 4RDQF 1XF1A 3VJ6A 2FRGP 4G8FA 4U3XA 1TJIL 3EOTL 1KIRA 1BOYA 4X9FA 4K23L 4U6TA 3I6KB 4OUUA 1NC2B 5HYJD 2CDFA 4ZNEA 3OAUH 4U1SA 3QO1A 4MAUH 5C6TL 2C1PA 1NGPH 1OSPL 2GT9B 4J3WA 1F97A 4APQD 3O9WB 1DUYA 2EXYC 3WSQH 2E5EA 4Y5VC 3P3YA 5IVZB 1MIMH 3OKLB 5FK9A 4LGPB 1JGDA 1LO3H 4TOYH 1EAJA 1I85A 1PLGL 1S9WA 3BW9A 4QGYA 5L0QC 3DHMA 4M62H 2AI0H 2XG5A 4LKXB 2Y4SA 1MJ8H 2DLIA 2WINB 2Q86B 2DM7A 3L3KA 2NCMA 3V0VA 1GIGL 1MHCA 3C9NA 5E6IB 2HA1A 2E7LC 1MFNA 2VIRA 4XBEH 1MCOL 3SO3B 4RIRB 5JOPE 4UV4L 4EI6B 4LIQE 4YEFA 5I1JL 4OLZL 3S96B 5DK0B 4BZYA 2L7JA 4QHNA 1G7IB 4QRTA 1FAIH 3TZVA 2NY4B 1BD2D 5CP7B 5E4IA 4G9FA 3VD4A 2BXZA 4GW5A 5F88A 4EXPX 4K71B 1YNKL 3HI6L 5DRWA 4O2FA 4FNLH 4I0PA 4JG0L 2BCKA 3BPLC 3B43A 3BE1L 4V1DD 3GRWA 3IGAA 3BGFC 2BZDA 2YS4A 1OAKH 3T2OA 4N8PA 1PZUB 1RUQH 1AGEA 1T03H 1QOKA 2P8MA 2Z92A 1YEGH 2J5LB 5HHOE 2XTJE 1KBGL 3LKPB 3OAZH 3QIWB 4LHQB 1JFQH 5EUOA 2WWMD 4LRIA 2YD8A 3SN6N 1P5UA 1HE7A 1JPST 4MVBD 2NY1B 4J6RH 1QBBA 2NLJB 1IC4L 3U7YL 1CICB 2HT2D 3TCLB 4C4KT 1MPAL 1NJ9B 3GRWL 4UI2A 5D93C 4QTIH 4V2CB 1H5BB 2Z31A 4X7DC 5HDQL 1ZGLP 5D2LB 3F8UB 1RZ7L 3HAEA 3VFTB 1T6WA 4WU7A 2OBGA 3H2WA 1A1MB 4WDIB 1KIUA 1FNHA 3VXUA 3QI9A 1Q0XH 4N5EC 2CKNA 4X7EC 1Q94A 4POZD 1D6VL 1Q9LA 4G43B 3UO1H 1PDKA 2JCCE 2M26A 5FA3B 5GXBB 3B83A 3AREB 2IPTH 1WBYB 2EIZB 5D2NB 1CF8L 4UU9B 4LPVA 5ALBH 2DOCA 3GJFH 1KPRA 2VUOA 4DOHE 3NIDE 5FO9B 2BHUA 3PWPD 5D5MA 3QCVH 4MNGA 4F9LA 3MRCA 3BQUD 4XHJD 2WUBH 3W5NA 5DMGC 4Z7WF 3BKCL 2GTWA 3U4AA 1TZIA 2BHYA 4OCYH 4C56D 3DYOA 5JPMB 1K5NA 4JFXA 2R2BA 1AR1D 2CIIA 4HV8B 5HGAB 4XTRD 5KW9L 1P4LA 1J05A 3DARA 3MV9B 5F9AC 3O41A 5IB1B 1A64A 3JV4A 2R0WH 3LCYA 4P2OB 5DHVH 1MFEH 1DFBH 4Z0BH 1NL0H 2CLVA 2A77L 4NKDB 3BKMH 4WW2C 2OTPA 5DJ8A 3LZFH 4EUPH 2DI9A 5TDOB 2NQCA 5IJKA 3D87B 1OTTC 4MXQD 4Z7WA 3D85D 1C7SA 2EDTA 1LE9A 2GQHA 1OF2B 1PX3A 2E8ZA 4L5FH 1LK3L 5ELIA 4BK4A 1FFOA 1BIHA 1G9NL 3MNVA 4NN6B 2ATPB 1FGVL 2LVCA 2W9EL 3O11A 2GSGB 4WIQA 3UTOA 4HUVA 2O61A 4FQLH 4MJID 2G5BB 5J6GB 5DS8A 2BY1A 4BUGA 4Z7NF 5E8DL 5GGVH 1LEKB 5HVFB 3QUZB 4IHOA 5ISZB 1SM3H 2QEJA 4QTHB 3QDAA 4WEMB 1ZLVH 2YZ8A 4I5BA 3KYOB 4KU1A 5IB4A 1I1FB 3RGVB 1U3YA 4XMLL 5MEPA 3ZE0F 3I9GH 4ZPTB 3I02B 5HHVH 1IC5L 2ICWI 4U6XB 5BO1L 4MA8H 1NGQL 4WJ5B 4WEUD 3BWAB 1WAAA