5DK0B

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRGDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B01
2PW2B 2A74B 3ZT5A 4C83B 4N1CA 4PJIF 1CFNA 4X5WB 1CLZL 1CVRA 3WLWC 4UQ2A 4PRID 4TUKL 5FB8B 1I8MA 3QI9D 1Q0YL 2V2TA 1HHJB 4Y4KB 1CR9L 3ILPA 3U7WL 3ME0A 3AREA 1NKOA 3FO2B 4G5ZH 4I0PD 1E28B 4KKLC 2J6EA 4ZFFA 5HHMB 3VRIB 1YNTB 2AK4A 3P4OB 1PZ5B 5CZVH 3PWUA 1J8HA 2UZYB 4PBVC 1I1FA 1KBGH 1QFUL 4GLRI 3WFDL 4IJ3C 3WS3A 1PG7H 1R5WB 1NGYB 3GIVB 3F58L 3UDWC 1L7IL 1A7QL 1LK3H 5AAMA 1QFHA 4K94H 2W59A 3QCTL 5H35B 3A6BL 1PKOA 2Y1VA 1WT5A 2WSKA 3E2HB 2I25N 1S78D 2IBBA 1FNLA 5ESVB 5A16B 2X4TB 2XQYK 4TVPD 5K59E 4LP5A 1ZVSA 4XVUD 4PRBB 4W4OC 2RJMA 3B6SB 2MCPH 4HIEA 1W72A 2IH3A 4FN0A 4TSAL 4GS7C 5K9KA 4M7LT 2CD0A 1KV3A 4KTEL 2AABL 2D03L 4KH2A 1MREL 2FRGP 5CGYC 5EORH 1FN4A 2ZUTA 3NIDF 4FRWA 1FNFA 1XZ0B 2EH8H 3MRKB 3GJEB 4HGWA 1QSFA 1PX4A 3PIQB 4MQSB 4XCNA 5CMAB 2UWEB 1Q9WA 2VXVH 3BPLB 2QADB 1ZEAL 2I60L 4FFWD 1CE6A 4IOFC 5C7XH 4HS8H 3VFMA 1LE9A 4MVBD 2O5ZL 5J9PB 3ILQD 3QUXC 1KN4H 2AXGB 1YY8B 3LD8B 5D7JA 1C5CL 1FYTD 4WU5B 1NGZB 3IETB 5DEGA 5JHDE 3WN5C 2ZSWB 4O2EA 2P5WE 1RUAH 1E4WH 4M02A 3MLZH 3F7QA 2YD4A 1NBVH 5KVGL 1YN6A 1OW0A 4UIKL 3RL2B 2YXFA 3E3QC 4I2XE 3BPOB 3WSQL 4XNQB 2DAVA 4FFYH 5C0IB 3DX9A 2NXZD 1DL7H 3O3BB 4K7PH 3RBGA 4U6YA 1U2CA 4RWYH 2X89D 3GSNH 4M5ZL 3RY6C 5FHBH 3CD4A 3RVTC 1I1RA 4M9PA 1SJEA 4OB5L 2FGZA 1TZGL 3IJHB 1WEJL 5JXEC 4ETQA 4M6OL 5JUEL 5DRZB 1XGRB 3LHPL 2X9YA 3O2DL 3H9HB 5HYFA 1J1XL 1KCUH 4OZHB 1KLUB 3MOAL 4ZYKA 5I1DB 1BIIB 1RUML 4MJIA 1MJ7L 5GISL 2HVJA 5EH1A 1CD9B 2WQRA 1HWHB 3VD3A 3PWLB 4LDLB 4XP5L 1S7TB 4OZGB 3LKOB 3BJ91 1ZHNB 5D7SL 3P4NB 3WFCL 3VXMA 1H9VA 5JR1H 1MCWW 2A83A 3QUMA 5IB2A 3FRUB 5TFSH 4R9HA 3CLFL 1YY9D 4YFLI 3LZFH 1B4JH 1FRGL 3MREB 4JY5L 1IM3A 1U3HB 4G7YL 3HPJA 4G6FB 3SJVE 5J11C 4GRLC 5HGGS 3T3PF 3F5WA 4HJGA 2AXHA 3VXRB 4QOKD 4KV5F 3OV6A 2AJZA 2GK0A 3CK0H 1PVHA 2X10A 2XRAL 3GZKA 3O3UN 1PG7W 3RDTA 1T66C 4XWGL 2GJ6D 4RBPK 4G7VH 1O0VA 4TQEH 5DMYA 3KPSD 2WBJC 1UZ8A 1YZZA 3QFJB 4OGAD 4U6VL 5E2WL 4W4OA 4PRHE 5E2VH 4YHIB 4NQCA 1NC2D 4DZ8B 1UYWH 3MBED 5INCB 3EGSA 4LHUA 3IU4H 1INEL 1WCQA 4RMVA 3ZTNH 1P1ZB 4M7ZB 5LWYL 3UROR 2CLRB 3MV7D 3IGAB 4M6NL 3WO4C 3EYUH 1PSKL 1QFPA 4JM4H 4HKXA 4QRRA 2K7QA 4BELD 3W0WB 2W9LA 2Z4QA 3ZE1F 3UYRH 4OFIA 3NN8B 3KXFD 1E27A 2JIXB 4U1MB 3GO1H 4RGNB 2XACC 1N6QH 4JPWL 3FT4B 1I7ZB 3HUJA 4OJFH 3I02A 4KRPD 3QUXA 2PKDA 2GUOA 4OZIA 5IG7A 5GIRA 4AMKH 2WBWB 4GG6A 5DJYA 4LCWA 5IROC 4PJIE 3WN5A 4ZFGH 4KJYB 1JUFA 4UDTB 1KIPA 4M8VA 5H2BB 5JOFB 3G6AA 2ZNXA 4WTXA 4G8GA 4P5KA 1S7RB 1S9KC 3B5HA 4OCYL 5CD5D 5IB5A 3KLHD 3QIBB 4DVRH 2YD6A 3DX8B 1G9ML 2W60B 1JPSH 2P49B 4OCLC 4RFOL 4KI5D 2DQIL 3RPIA 2BMKB 2DQDL 4LGSB 3EYFA 4HIIB 4QRUA 1EVTC 3LEYH 3RY6A 2BY1A 1BQHB 2DMKA 2BSRA 4UT7H 3WEXB 1IAOB 2R4RL 1T2QL 3FFDA 1NGQL 3QHFH 1KIRB 1NAKL 3GSUA 5TE6L 1SQ2N 4NO3A 5HJ3A 2P7TA 3FB8B 4L3EE 2YD3A 3BRGC 3TIDA 4E5XA 4N68A 3L7EA 5F8RC 1DLHB 4NJAH 3CGTA 3EO9L 3UJJH 1OTSC 5KSAB 4RIRB 2XFXA 5T1LA 4XNXL 2EYSB 3ULVC 5ICXB 3R8BB 3VXQB 5I8KH 1X6LA 1T0NB 1CD1A 2JCCF 3IFOA 5EOCJ 2YPVH 3FQRB 4LVOB 4Z7WF 1WC7B 4Z7VA 1JJUA 3L3IB 1HIML 4TTDC 1CDBA 5GGUA 4R4BA 1JPGA 4QHLA 1OTTC 1JNHA 2QQLL 1NH6A 2X9XA 3ZMRA 2CPCA 3MGTA 1L6ZA 3PWVA 2VDNL 1IEBA 2FO4A 4PJEB 2O26U 5C08E 2DQHL 1JP5A 1S7XB 3HZVB 2W0PA 2EZ0C 3I3EA 1CGSL 4MB5A 3ORJA 2WWKO 3G6JB 2VB5A 3RKDD 2CDFB 3OZ9H 3VWKD 3ILPB 2EE6A 2Y07L 4OSUL 4K8RC 1R5IA 2R0KH 3MOBL 4N0RA 4GRLA 4K55A 3PDOB 5EZOH 1HKLH 4KDVA 4KDWA 1A7NL 3GIZL 3NIDE 1FL3B 5I1HH 1KJ2A 3GRWL 3WKML 1KLGA 5DD3L 5JPMA 2OTPA 4XAWL 1GIGL 2XKSA 3MCLL 4MZ2A 1E6JH 4JLRA 3UTSB 1QBBA 3O4LB 4YH6A 4P2RB 3RGVD 2WBJA 3N1FC 3QB7C 3HC4L 3MV9A 4U31A 1PY4A 2CRIA 3X13B 3RZCC 3KYOB 1FJ1B 2X7LA 1FSKB 2OP4H 2YMXH 5EIIA 2NY3B 1XF5B 2XZQH 2R2EB 3CFDA 4PRPE 4HS3B 1CLYH 2HRPL 4XP9H 2EC9U 4M1GL 5I71B 1MFNA 5F70A 4Z95L 4J4PC 4NO0D 3I6LD 5BS0E 3Q3GA 1W72B 3HG1D 5EO9B 5K9KB 1XR9B 2MCG1 2OR9L 3WFZA 4DAGH 1RIVL 4H0IA 2BXZA 4U1SA 1CG9A 2XKNA 5IMLA 4WI4A 4P2YA 1TQBB 1M6OA 5D2NB 3TO2A 1BVKA 3UTQA 1FZOA 3F7RA 4XAKD 1FGVL 1EHXA 1DP0A 4XCNB 4P5MA 4X9HA 5J1AA 3FHAA 3C6LD 4ZUWA 4MAUH 3OKLA 1ZLUK 2VQ1A 5ESAB 1DDHB 3PL6C 4TRPL 4RA0C 2GTWB 3RUGA 4HK0B 3D85D 4MNQB 5FUCE 4MD5A 5IB3B 5D5MF 3CMOH 3D39A 5FOBA 3OKOA 3PWNA 4DVBA 4X9GA 3S7GA 4BQBA 1AGEA 4U3HA 2D31A 1C5DB 2R0LL 1RVFH 3H6JA 2APTA 5D1QC 1DQDH 2Y72A 1IGCH 1KGCE 2MQ0A 5DD6A 5ENWA 3AS0A 2ZCHL 2GTZA 1S3KH 1RJCA 1F6LL 1LDSA 5E00A 4O2CA 1XGUB 5CBAA 3T3PE 3T04D 4PRAA 3ZKQD 4X6DA 4WRLA 3AS1A 4KV5E 5EOTA 3MLUL 5FDWB 4QRQA 4ETQB 4PJFA 4Z0BL 5M7QA 3IF1B 2VOTA 1QLFB 5ADOL 1I1AC 4L8DA 1MCHA 1RI8A 3U4AA 2ITDB 4LARL 4Y5VA 4BJLA 3D25A 1YDPB 1A4KA 2GT9B 3QHZL 1YEDA 5BMFL 5F1KC 2NY0D 3B3IB 2R29H 1VFAB 4I1NB 5DJDB 3EOTH 3OX8B 1MJ8L 4HIXH 3GK8L 4WFFE 4YDVB 3STLA 4YFLF 4D0BA 1J0IA 3FFCD 2EDHA 4MB3A 1L7TH 5IWLC 4MXWL 4I3RL 3W11D 4MSWA 2ESVB 2ZUXA 3ZE1E 1CGWA 4Y2DB 3D2UB 1IM3B 1MIMH 1ZT4A 3HPJB 4IJ3B 5IOPB 3EDDA 3NPZB 3TT3L 1CK0H 3R06A 5DD1H 4H25B 1Q0XH 5TQ2H 3RZCA 2PETA 3HNVH 4LSPL 3U2SA 3T8XA 4Z7UF 2AJZB 2EXWC 1W0VA 1ZTXL 4LDEB 5TDPB 3F7YB 4GMTL 5B38G 1V8HA 3MLVH 4PJ5D 1DANT 3UEZA 4QNPF 4CU6A 2VDML 4Y4FB 2SEBA 4NPYA 2C3HA 1CBVH 1A7OL 3BEVA 2D9CA 4YHNB 3MXWL 1MCPH 4J4PA 1BAFL 1YNLH 4P9HH 4K23L 4YE4H 4MMXC 3BQUC 5E9DA 2VLKE 3V8OA 2FHBA 1NAMA 1TVBA 5HGHB 2PW1B 4RFEA 1QSEE 1JFQL 1F4WL 3ULUL 4FFZL 2OJEB 4DGIH 2CMRL 4HKXB 4O51B 3C2SA 1FNHA 3FZUC 4EXPX 4FQJL 3WL9A 5GGSY 5IR1A 4Y16C 2WM0A 1RK1A 1E27B 4R4FL 1YECH 3N85H 3CFIC 1H3PH 2IG2L 4NRZA 1S7SB 4CDHA 2ATKB 3BDBA 4D8PA 1J1OL 3WLBA 4ZTPH 1JL8A 2VKWA 4LASH 3MJ7B 3WBDA 5I19H 5IFJA 1Z9SA 3PL6A 3LMJH 4X6FB 4UAOB 2LAAA 3I6GA 3HUJB 2VZ1A 5F3BB 2JCCE 3O6MH 2GUOB 3QDAA 2FD6H 4IMKC 4M6ML 1T7VA 4Z7WE 5IG7B 3VRJA 2NY4B 2V6HA 2V7HA 5DJYB 4LCWB 4NFCA 3WN5B 3W9DB 5J3HC 1IC4H 2DYPD 3SHSA 5D1QA 1ND0B 1NBYB 4R7DA 5IB5B 1ULVA 5CJ5A 5DI8A 5E8DL 2Q1EA 1ORQA 4MNGA 1XGQA 2YKLH 3IDGB 1FP5A 3U0TB 2UY7A 3PQYB 2P8LA 1RFDH 4WI2A 3CFCH 3S96B 3ZTJH 1G0DA 2L4OA 1AD9B 2VZVA 3HN3A 3MJ6A 4JRYA 1I9JL 4NO3B 5HJ3B 4U6XA 5FYJE 3O3DA 5I2IA 1IJ9A 3DYMA 3TIDB 5DK2A 3T0XA 1I1AA 3L7EB 1X4YA 3CUPA 1FO0A 4I3SL 4BK4A 2KQNA 3CXDL 1ZXQA 2UVEA 3OJMB 3KYMA 5T1LB 2XWTA 1CD1B 3I9GH 1CU4L 2PYED 3PABB 2ZNWA 4WU7A 5IBUB 5L8JB 5GGUB 1WIUA 1QR1B 3RWDA 3DYOA 4KY1L 4MAYD 4Y8AA 3QXAA 5FKAB 5IWLA 2OR7A 3UJIH 1HINL 3U30C 1IZJA 43CAA 3BZDA 2R4SL 2N1KA 3T0EE 4LP4A 3CDCA 1CDJA 4M00A 3BIAX 1R5IB 1RUKH 1G7IA 2J6EH 2VDRL 3KR3L 4GRLB 5J11B 5C09E 1AJ7H 1C12B 1CFQB 4XX1E 1MJUH 4U1NB 2DJSA 3SO5A 4HPOH 4KZDH 3DSFL 4I0CC 1MNUH 4EN3D 5DYOA 5BV7C 1DCLA 1QG3A 2X4PA 1A6PA 1CYGA 4KKCD 1U95A 2AAVA 3CVHA 1HKFA 2DTSA 4KMLB 4P2OB 5DR5L 2WIIA 4FQXB 1ADQL 1KEGH 3NOIA 2WANA 3GMLB 4A6YH 5KVFL 2V5YA 4CVWA 3TN0D 1EO7A 3BQUA 1U42A 1UEYA 3QRGL 2X7LB 4L1DA 1KF9B 2AKRB 1OGAA 2J2ZA 4PJ7B 5D5ME 5J4MA 4UUJA 1XIWC 1CD8A 4FP8H 4IS6B 3VDBA 3V6ZA 3VWJC 2VDPH 2IQAB 3HI5L 4OLUH 1D6EA 5C0BD 5AZEH 3FQWA 2DM7A 4YXKH 4EVNB 3R0MA 3T1FB 4Y16A 3TYFA 4GW1A 4JREC 2NY2C 4HT1H 1JK8A 4QHMB 1XGYL 2H2PC 3PXJA 5KVDL 4XMPH 4KK9D 3W9EB 4CAGA 4JRXD 1M6OB 4XNYH 3TO2B 3B9KB 2ZOKA 4P3WA 4IMKA 1PFCA 5D2LA 3P11L 1AGFA 1YJDL 1ZVYA 2PYFB 4JFFD 4PIRF 4P46D 2AV7A 3UP1A 1HQ4B 3DI3B 5MENB 1ZGLB 5FO9A 2VQ1B 4H8WC 3U46A 3HMWH 3F65A 1VESA 5L88H 4YUEH 1WZ1H 3BT2H 3GNMH 1BREA 2VLJA 5E1HB 5ITFB 5FOBB 3OKOB 5HVHC 1WFUA 1AY1H 2F8OA 2F19L 5KS9F 2DIBA 4BH8A 4F8TA 3VXUD 2V9QA 4OTXH 1M7IA 1T04A 2XZAH 4NQEA 4M9OA 1M71A 1AXIB 1E0OB 4L3AA 4L4VE 1RZIA 4I0PC 2JJUA 4LQFL 4PRAB 1U93B 2WMPA 4ODHH 2XN9E 4N8CL 4Z7UE 5EOTB 3QEGL 4PG2C 3IFNH 5I76B 4PJFB 4QNPE 1RZKC 3CZFA 3VU2A 3H0TB 1JNNL 5EC1B 4ORGA 3WE6A 2XTJD 4UQ3A 5DT1L 1YPZF 4JGJA 3SE9H 1LHZA 3LSOB 2P42B 1A4KB 4FQ1H 1FLRL 5CCKH 3MRLA 1R24A 1BFOB 2FATL 3LS5H 3SDDB 3ARVA 4I3GA 3ZE0F 4WJ5A 1FORH 4D0BB 2HJLB 1S78C 3U7AA 2PXYD 2D7QA 5I74C 2YR3A 3S8WA 4X7TA 3C5JA 5I9QC 2M1KA 2FJGB 4XVUC 2BVQB 4ODBD 1BBDH 3V5DB 2RBLA 5C8JA 2BHYA 2DQEH 1ZT4B 3HTLX 2A1WH 1JNJA 1IM9D 4PREA 4NBZB 3BGFC 3QUYD 5IW3A 4Z8FH 4U0RB 1G6RL 3T8XB 2YN5A 2ZCLH 3QPQD 4WW2F 4GRWF 5GS3A 1RJLA 2AJVL 1GPOH 1XIWA 4NPYB 1R3LB 3VWJA 5DUMH 5EFIB 4IRZL 4HHAA 5HY9A 5IEHA 3MLXH 2MNUA 4KGLA 1TETH 2AEIT 4FFWC 1WQVT 5JIHA 1I8KA 1G7QA 5E6ZA 5C07D 1BFVL 1HI6B 4NM8H 4MVBC 2IF7A 4CL7A 1NAMB 3ILQC 2DKSA 4ONGL 2NX5A 1AGCB 4ODSL 4G9FB 4JR9H 4BFEA 1GGIH 4IDJL 4NO5A 1G9NL 2BHZA 2NY5C 2BVPB 1T0PB 5HGBA 1T4KA 4CDGC 5IR1B 3G5ZA 3SE3C 3ES6B 3VJ6A 4ZUSA 1MHCA 1YMMA 4NRZB 5DK3A 2WK2A 3HZYB 4JFHE 3U9PL 5J0BA 4Z7OF 4W68A 2NXZC 1QBLL 1B2WL 5IFJB 4JQIH 4JEGB 2O5XL 3EOAB 3MLRH 1I3GH 5IHBA 4JG0L 1QHOA 32C2B 2ADFH 2L0DA 3T4AA 3BD3A 2X44D 4UTBH 4HZLB 4YHPA 5E99L 3RNKB 1Z9LA 5TDNA 1Z5LA 3E8UL 3FT2A 3S3JA 5M94B 4BZ1L 3THMH 1MHEB 4WVRA 4XNMB 4Y4HD 5FGBC 1OP5H 4PRIA 1BGXL 3VFVB 5TE4H 3QI9A 1OCWH 3BEWA 4UT9L 3MR9A 1MFCH 1XGQB 4MNGB 2AEQH 5GGQH 1A14L 3D0LA 1T1XA 4PJHF 4G8FA 3CX5K 2P8LB 3WUZA 4PRNB 4I0PA 3LRSA 1N5AA 5GGVY 4J3UA 4XMKH 4PG2A 3JSSA 3MRIA 2J5LB 4PB9H 1AH1A 4YNYA 4KK5D 5K93A 3VMOA 4XRCB 3JVGC 1YY9C 4Q9RL 2G9HA 3CUPB 3K46A 4LCIH 5LGHH 1A7PL 3FO0H 5DQJA 2RGSA 5SX4I 3KYMB 3FQUA 3O2WH 2AXFB 1F58L 4YHLH 3LOWA 2X4SA 4WU7B 2H2SD 5DZNA 1GZQA 1UC6A 3VD9A 3B43A 4MNHA 1JIBA 3MGOA 3BD4A 3QXAB 1YEHH 3DVFA 1S7VA 1SBBA 3HLAA 1I9RL 4I48B 4OGAC 4RISH 4RCAA 5B4MD 2JK5A 2LTQC 1WBXB 1S9XB 3ARQA 1R3JB 1CXLA 3MBEC 4GMSL 5F1NB 5BV7L 5CFHA 1JRHH 3LN4B 1G7IB 1IT9H 3RRQA 1WLHA 1KPVA 4XNZB 5FOJA 2DLEA 3BFOA 3GKZA 3LB6D 2WUBH 5DF0A 3MLPA 3QPXL 3QFDA 1C16B 1U36A 4S1SL 5F3HB 5J06A 3SGKC 3MCG1 2X4PB 1P7KA 2F53B 4W70A 1BVZA 1U58A 4C57C 2XOTA 4YDIL 3P4MA 3CVHB 5FGCE 3QDGE 4X98B 2X5PA 3O0RL 1G6RB 2W1NA 2IWGA 3D0VA 3FMGL 3FT3A 2VXSH 1T1YA 5DJ0B 4R0LA 1LNUA 1QPXA 2R1WB 4OAWB 3JWOL 3LEVH 4KRPC 2HT2C 3KPOA 1FYTA 4EDWH 2XQBL 1SEQL 4GAYA 4YJZL 3FQWB 5DLML 4P3CL 4KVNH 4Y16B 5CD5C 3K2UH 4GW1B 1VGEH 2CRZA 3BHBB 4M62L 5CJXC 4YHZL 1JZ2A 3KLHC 5LXGH 3PGCB 2I9TA 3BE1H 4QTHA 3D48R 4WHTA 4F7CA 3TLRA 4HBCH 4KI5C 4EKXA 3D87B 4FQIH 2FHFA 1XR8A 2X89A 4HZAA 1BMGA 3UPAA 4K3DL 4NM4L 3OJ2C 1V05A 4E41D 2X4NB 1AGFB 4NHCL 5DJCB 5ITBL 1ZT1A 3VFWA 5FGBA 2ORBL 1EGJL 3FN9A 4X6BA 1RJZA 3MUGB 5F96H 1E4XI 5GRYA 3HNTH 3AU1B 1RIUL 1P6AB 3ZE0E 5C70A 4RNRA 3QNZB 4YWGH 4GAJL 5FM5O 2HVKB 2RHEA 3DYPA 3LKPA 4IRSB 1T7WA 3LN5A 4LLAA 5E8EA 3RNQA 4V2BA 3JVGA 3ALXA 1OAYH 3B8YA 5DFWH 3QDME 3F7VB 3ULVH 3RKDC 1UEMA 3FKUS 4NQEB 3C2AH 3VWKC 5JZ7D 4LNRA 4G3YH 2E8ZA 3GMOA 4S1RL 1XT5A 5EN2A 1KYOK 3DTXB 1UH2A 1A9BA 2AEPH 2JB6B 4QOKA 5HYIA 1S9YB 4W81A 1KEML 4GRWE 5KTEH 3BH8B 4YDJA 1ZLSH 1OVZA 3CZFB 2DRUA 1IGFL 3MMEB 1FV1A 4NUJA 5ETUA 2GJ6A 4KUCF 1I7UA 2COQA 4WV1A 3UO1L 1P2CA 3RGVC 3KPSA 2WWKT 3RI5F 2XKUA 4DOHB 4DKFL 2W91A 4QYOA 4I5BA 3QR2A 3H7BB 1II4E 4OZ4B 4G8EA 2R15A 1NC2A 4HJJH 1KN2L 3MBEA 1OM3L 2IBGA 1RMFL 5GGRA 1JGLL 4QT5B 4WI8A 4PD4J 5CJOH 4PGZA 3MV7A 1FPTH 5MEOA 4AT6A 1UM6L 3RWGB 4K9EH 5F1IA 3TBYA 3BAEH 5BV7B 3SGKA 4F7TA 4Y19B 3WUWA 4XBGB 5C8JB 2CDEA 4LBEA 2HKHH 4IEFB 3KXFA 4Z7OE 3EAKA 4PREB 1JGVH 3V8CA 5SWSD 1OPGL 3ARFD 3T65A 4UILL 3IVKA 3H7LA 1W0YT 4LEOB 1XCTB 3BMWA 1CFVL 1HSAA 5C0RL 4R2GC 2I07A 5A3ID 3NA9L 4S1QH 5DTFB 4M7LH 1BQLH 2BNUA 5FFLA 3GM8A 1UA6H 1QNZH 4M48H 1V5JA 4MDJB 1XH3A 4U2YA 2BHUA 4J6RH 3DECA 5D72H 2WIMA 3C6LC 1A1MA 3SDXE 5JOEA 1HXYA 5HDQL 5EC2B 3REVA 4HEME 4JREB 3CCHA 3H42L 1XCQA 3DUSA 2UWEF 4MQ7A 1JZ8A 5LBSH 2ARJA 1HEZA 2W38A 4DN4L 4OIBA 1PKQB 3QXUA 1VACA 2UV3A 2NX5B 4J3VA 4OLZL 4X7SL 4HC1A 4P5TB 3QP3A 4NC2B 1YNKH 1P84K 1OP9A 3G5ZB 4NDMA 1MLCA 3VJ6B 4YK4C 1UWGL 4WUUE 1CL7H 2F8XC 1YMMB 1V3JA 1QSVA 3O6KL 1LEIA 2EH7H 2C1PB 4XPAL 3MFFB 3ARGB 3QCUL 5GS1C 3LS4L 4FTVE 3ZKMD 4OBSA 1ZGLM 3QZWG 3FN3A 5HYEA 3UYOD 3T4AB 2CUMA 2JJVA 4YHKL 4DCQB 4UNUA 4C56D 5TDNB 3FT2B 3HAEA 4FQQA 4R3SA 2B39A 3BYYA 1ED3A 3IDMA 2NNAB 4PJGF 2HWZL 3NCEB 2W65A 1T3FA 2XXMB 4ZPVB 3BW9A 5DUBA 1T03L 2OX5A 2NW3A 2EC9T 4OZHF 2NY0C 5T1DH 4H1LB 1T1XB 4LLYA 3VWKA 1NL0L 4HCRA 2VLRD 3ZDZF 5HYSB 3VG0H 5IFAH 5DVLA 4I0PB 4RDQF 1N59A 5F7LB 4I18C 3VCLA 2WUCH 4K07A 3NAAH 3MRIB 1MCCA 4YNYB 2VN7A 4OZGF 1FO0H 4WY7H 2C3GA 4S11A 1X5ZA 1DBAL 1A6TA 2DIJA 4LKXA 3RGVA 5CEZH 3QHTC 1KB5L 5I1AA 4OCXH 4XH2A 5D71L 1U3YA 1RULH 1CXFA 4G42A 4NKIL 1A1OA 5D70H 1XF4A 3W2DH 4HXAL 1KULA 5T3ZH 3C8KB 3VXSD 3P0VH 3L3JA 3QA3A 3IAQA 2ZUSA 5I17A 5LCVH 2GITB 1K8IA 5I1GL 5EUOA 4PJBB 1P4BL 5L6YH 5F89A 2WBKA 3NPSC 3IFLL 4LEXL 1QO3A 4NO0A 5B39G 1I75A 4UU9B 3HG1A 4DEPB 1WAAF 3K0WA 3C60D 4XPFH 3RVUD 1FNEB 3BGFB 1I1YA 4JHZA 3I50H 1JVKA 5CSBA 3VXNA 3SDCD 4JM2B 2MJWA 1U8IB 5BOPA 4JO2H 3PP3K 4Z77A 5CILL 2WZPD 2Y23A 1MAML 2P5WD 3WNNA 2X4RA 3P4MB 5I66A 5JNYB 3GBML 2GSIB 3TWCL 3TBSA 4KXZI 2E9BA 3C6LA 4F7MB 1NMCB 3FONA 1MFEL 3BUYB 3OKMA 4ENED 4P4RA 4JQVC 2DJUA 2HKFH 2VNCA 3BWAB 2D7PA 3D85A 2X40A 1RPQA 3CFJA 4WCYH 5I75B 1FYTB 3MFGB 5E70A 3TCLB 2AJ3A 1Z9OA 2FX8L 1V3LA 4JFYB 3TJHD 4GJTB 3D3VD 1VFBB 4GAYB 4F15C 1JYNA 1OD7A 3QJHB 3VGDA 4HWEL 3JWDL 3NABL 4OI8A 1H3WM 4JFZL 4UBDD 4OLXH 5TF1H 3QWQB 3FB7B 4HG4J 4S0SD 1KJVA 1D5IL 3MUZ1 2FYYA 3S98A 1R3HA 5GS1A 2CDGB 1EHLL 2VDQH 4GFTB 4WUKH 2IPUK 4AL8L 1YEEH 3HI1A 5ERWA 2MTPA 1NCWL 4H0HB 5IMMA 3L3KB 5JO5B 1SJHA 1MVUB 3SGJC 4Q6IB 4DGYL 5HHME 4AQOA 5L7XH 2OXHA 4F33A 4EIGB 2HTLD 2ITCA 2OK0L 4H5SB 4AY0A 2ZUUA 4R6UA 4KUZH 3MRMB 1FFPA 2DQGL 3GM0A 4RNRB 5GS0L 4MA7L 2J12B 4RGMB 1GHFL 5BQ7B 1NEZA 2L7JA 2H32B 4WEMB 4I18A 4JPKL 3FFCA 5HVGB 1KT2B 3LN5B 5ADPH 4KHTL 4CNIA 4G6ML 2ATPA 2EEBA 3H9ZA 4F8QA 1EUTA 1KSRA 2Y6SD 4WGVB 3PHQA 1Y18A 4PRHD 4POYA 1ETZA 4H20H 4LNRB 2F74B 1WWBX 4GUPB 4JKKA 4FFVD 1FDLL 5E5MA 2CO7B 5EN2B 3CVIL 1A9BB 1VDGA 3G6JF 2B4CH 1CDYA 3QULA 1AP2A 3L9RA 1BM3H 3DX6A 1JWMB 4YDJB 4CJ0A 3MQIA 1BQUA 4PJ5A 4EN3C 5I0DA 1KB5B 1RU9H 3T4YA 4NUJB 4KKCC 4HUXA 1DBBL 3GI9L 1HHIA 1IAIL 3KPSB 5DA0B 4QYOB 4I5BB 2IMMA 4RAVA 5ID0A 2LTQB 3AXLB 4ELMA 3TN0C 1C1EL 1NC2B 4Y1AD 2VXQL 3MBEB 3RWFA 2UWEE 2AJYH 3NZ8B 5DD0H 3A6CL 3SO3C 4OBRA 4NFBA 4KTYA 4AT6B 5C2UB 3A0OA 5JOPE 4CMMA 4PUBH 4LLQB 4J1UA 5E6ID 4PGCA 4F7TB 3WUWB 5TDOB 2O93L 4KU1A 1IC7H 1J7VR 5ANMA 1SM3L 4R90L 4MLSA 4HUWA 2CDEB 2VKXA 1C08B 3KXFB 4NWUH 1RJYA 4DTGH 4ELKA 5JHDB 4OZFB 1EXUA 4OQ1A 4NRXA 3WNOA 4ERSL 3AAZA 5DHYB 5FYKE 4KK9C 5F9AC 2F58H 3L3HB 3VFRB 4JQVA 1MCLA 2I07B 2BSED 1AKJB 1HE7A 5CAYB 4ZO8A 4PY7A 3HC0B 3GDBA 5CZKA 5HVWA 1EX0A 4LSQL 2BC4A 4P46C 4P59L 3D9AL 2VRAA 2IAMB 4PJGE 2ZJSH 2DYPA 4CVUA 1DBML 1A1MB 3CPLA 1EEYB 3REVB 4UDUB 5FF6A 3RWIA 4L4TD 2Y4SA 4E42A 1UM4H 4NQXA 2OCFD 1HQRB 3TV3H 4YIQA 4OZHE 5EU5A 3OPZH 1U8OB 3DHJA 4NYLB 3QXDA 5GRUL 3B2VL 3ZDZE 4R4ND 4QHKI 4AENA 4OD2B 4M4RA 5AWNL 5D1ZD 1TIUA 3L5WB 1OSZA 3MJ8A 4KTDH 5D93B 3GGWA 5IMKB 4NDMB 4OZGE 5GPRA 3VGGA 3VFNB 3EO0A 3SGJA 2XXCB 4HWBH 3HE7D 1LEIB 4GKZA 4X4MA 3UTZA 5CWSB 2HN7B 2E6PA 1TITA 1S5HA 5A2KH 1K2DB 2PYEA 1IKFL 3V52L 5E8OA 1F6AA 1N8ZB 4R3SB 5H8DA 1CLZH 1T2JA 4MAYA 3DVGA 3SJVB 4CVZA 1DLFL 1DVFC 3VXRE 4WTZG 4ZD3L 4TUKH 5E1AA 2XTJC 1Q0YH 5EG6C 1I8IA 2B1AL 4KMTH 5JW4R 1CR9H 5CHNA 1AXTL 5DUBB 5C6WH 3BRDA 4ZTOL 1EJOL 3O9WB 1PY9A 5HHOB 3U7WH 5C6TL 1WAAE 1C5BL 3WDHA 1B0GA 4KJPD 3QFJE 4WI9A 5T3XE 3VE0A 5E7BA 2E7HA 1KXQE 3LQAL 3VCLB 1RZKH 4PRPD 2PXYC 1S9VB 5I1CL 4APQB 2E9IA 4EN3A 1IGIL 3KS0H 5T5NF 1P4LA 3IDNA 1TJGL 5ESQA 2G5RA 1A6TB 5IBLD 3WFDH 4LKXB 4YGVA 3OHXB 3RGVB 5BS0D 3F58H 1QLRA 5I1AB 1L7IH 1QBML 1A7QH 3W0WE 5GS2H 1PLGL 3QUYC 3QCTH 4PS4H 3TN0A 1XF4B 3A6BH 3PHSA 4RFNC 1JGDB 2LFGA 1JF1A 3OGCB 4OGYL 1NLBL 2VABB 4RGNE 4GKSA 5C3TA 3QPQC 3L3JB 1F3DH 2R1YA 3MA7A 4LVNC 4LLDA 5DJZA 1T2XA 4MCYA 3WHXA 3QT2A 4YHML 5KG9B 2ZPKL 5C0BA 1LO4H 4WTWA 4D94A 2RCSL 4NO0B 4B7LA 1K4DB 2B20A 1VPOL 4TSAH 2JJSC 3CFEA 3HG1B 4U6HA 4KTEH 1WUNT 2XZZA 2AABH 4OV5B 4P9ML 2D03H 1ZA3B 5DHVA 1MREH 4XCCL 5A2IH 3SDYH 1OLZA 2AJSL 3VXNB 2BSSB 4JRXA 4R2GB 3BKYL 2LE9A 1Q9OA 4YQXL 1L9MA 4Z77B 4NZUL 3PDDA 1JMZA 4JFFA 5GRXG 1ZSDA 2VSCA 3MRQB 4NHUB 1RV6X 5LJYH 4KHXL 2I60H 3TBSB 4TNWF 3O3AA 1LGVA 5DRWA 43C9B 4XC3H 4GXUN 4NBYB 2O5ZH 4P4RB 4L3EB 5F7DA 4OF6A 5EO0A 4FZ8L 1C5CH 3CFJB 3K8KA 2NY5H 3VI3F 3QH3A 3VFSA 4KK8D 1INDH 3HUJF 2OXGA 3DRQB 3VXUA 2BK8A 4Y4HC 4OZIF 4PLOB 5KVGH 4UIKH 4X8XA 4YK4B 3I6KA 1HHKB 3L1OL 1CQKA 2RR3A 1F4AA 1KJVB 4M5ZH 4PLKD 5GS1B 3V0WL 4JFXB 3TH3T 3G6JE 4OB5H 2KUTA 2H1PL 4WFFD 1TZGH 3TBTB 4ONHA 1WEJH 4ZODA 5JUEH 1SY6A 5IMMB 2Z91A 3O2DH 3HRPA 1J1XH 4KK5C 5FYLL 3MOAH 3DARA 3H3PL 1RUMH 1MJ7H 5GISH 4WWKB 2VWEC 1MRCH 4XPBL 4G80B 2ITCB 5DRXB 2ENSA 1LP9A 4XP5H 2NY0B 1QYGL 4JHAL 3UTSE 2Z8VC 2QHRH 3MO1A 1FFPB 3IXTA 4P2RE 2H2SC 4NQSA 1N7ML 3VFPA 5D7SH 4GSDL 5HDBF 3TP4A 5F72S 3WFCH 2WW8A 4I18B 2PXYA 1XGPA 3CLFH 1FVDA 3QWOA 2ATPB 3MRBA 1FRGH 4JY5H 3PV7A 3ZKXC 1RIHH 5B4MC 3Q6GH 4G7YH 1Y18B 1RY7B 2DLGA 2ED8A 1HYRC 5T1MB 3W39A 3IKKA 1IM9A 1R6VA 2E27L 3BXNA 3QUYA 5IMOB 4GXVL 1QSED 5C0AB 3L9RB 2XRAH 3L95B 3WO3B 2Q76A 1U8KB 1CGXA 1SMOA 1WWWX 1VA9A 4XWGH 3T4YB 3VGHA 2D4FA 1IL1A 3QAZC 1ZS8B 1H3GA 3B9DA 5D2NE 3TZVD 5EU3A 1WTGT 4U6VH 4OKDA 2HJKA 1I7RA 1I3VA 5GJSL 4TTGA 3VA6A 3GI8L 1MY7A 3NPSB 4YHOH 3D69A 4ELMB 4EI5B 2CSPA 3MBXL 2R56L 2JJSA 1Z0MA 5C07A 3UC0L 1INEH 3FB6A 2G75A 1G7JB 5LWYH 5JMOC 1IVLA 3OXRB 5A2FA 2A9NL 5C86A 1MY5A 3NFPA 1PSKH 3V0VA 4ZNEE 5IJVB 4MJ5A 1A47A 4PTTA 1UWXH 3G08A 4OQTL 3HE6D 2YEZB 4MNQE 4J1UB 5HI5D 4PGCB 4EBQL 1N4XL 4PJ7F 5IF0B 4YXLL 2W07A 1BVLB 4NN6C 4Y89A 3S97C 5ALCL 3D18A 5IHUL 3KJ4C 3AAZB 2GHWB 1HDMB 4JPWH 5JHLL 2HFEA 4ODXB 5I1IL 3U4EA 5IVZA 3O6FB 4XXDB 2YK1L 5DSCB 1CGYA 1S9WA 4LLWA 3PWJA 4OM1L 1INQB 5FYJL 3GB7B 1DQLL 3SPVA 4EJ1C 2NY1D 4F15B 3P0YL 3V79C 2DYPB 3GSRA 4Y4HA 1C8PA 1YN7A 3CPLB 3T09A 5L2KD 2VXTL 4MHHG 2DM2A 5ISZB 2R69L 3HKFA 4M5YH 5GSVA 2ZUQC 4RFOH 5EU5B 3S88L 3QIUD 2DQDH 2DQJL 3K7UA 4MJIE 5CBEB 4U2ZA 4LK4A 2AK4D 1DQQA 1I9IL 2IBZX 3BP5A 1GC1C 1T2QH 5EZIL 3HPLA 3TVMD 5TE6H 1W0WA 4P23B 3BIKA 2EDLA 2OMBA 3OJDA 3T0VA 3EO0B 4JO1L 3EO9H 3GBNL 2K1MA 3QCVH 5IQ7H 3EOBA 3SN6N 5JZ7C 4HAGA 4XNXH 4WIQA 2VIRA 2C3WA 1DEEB 5C09D 3QXWA 5F1SA 2YD8A 4HUVA 1Q38A 1HIMH 1QP1A 2GIYA 1MCOH 3UJTL 1ZK9A 1UXWA 3DVGB 4CVZB 5MERA 1IGML 3ROOA 4X6DF 5DFTA 3GHBL 3DXAD 2DQHH 3K1KC 5E1AB 3ZDXF 1CGSH 1G9EA 1EO8L 2EYRA 4FXKA 4H26A 4RMRA 4PJFF 3S36L 1RZ7L 2Y36L 5KOMC 1MCSA 1ZLUH 1NUFA 4OSUH 2YRPA 2OBGA 4LSUL 3MOBH 5FA3B 1QFWM 4OUUB 9CGTA 3R4DA 2ICES 3DIFB 1CDIA 3VE0B 1A7NH 4NN5B 3GIZH 3FRPG 4Z5RB 3GRWH 3WKMH 3X11A 5DD3H 1F42A 2CH8A 1JHTA 1EHNA 5D6CA 2Y06L 4JB9L 1GIGH 2Q3AA 3MCLH 1J10A 4EN3B 2VLKB 2VLME 1F45A 4YR6A 1AQKL 2YS4A 4ODUB 2CJUL 2J88L 3HRZA 3BH9B 2QKIA 5C0GA 4LCCC 2F54D 3HC4H 4JZNA 3U0WL 3BO8A 2OZ4L 4JJ5A 4W6YB 1D5ZA 2W9EL 3ARFC 4IRJD 4ZXBD 1JF1B 5EOCH 5FDYA 1PAMA 1MHPH 3BP7A 4GKSB 3HHRB 3BN3B 5A3IC 3M1BB 5C0DB 5JQ6L 3SO3B 2R1YB 1AD0A 2PTTA 3MA7B 3VI3E 3B8SA 3BPNC 1S7UA 4HXBL 4LLDB 2HRPH 3V6FA 4LLVA 1GRWA 3ZDYF 5DJZB 3HUJE 4M1GH 4PJ9B 2FJFA 3SKJL 4JO4L 5FKPA 3HR5B 5C0BB 1M1SA 1MWAA 3CMGA 2H3NA 2QSTA 1TJHL 4LCWE 4BZYA 3PP4L 1QKZL 1UWEL 2OR9H 5FUOL 1RIVH 2Z93B 3CSPA 3RAJH 4D3CH 3T2OA 3NZHL 3E3QE 3H9SD 2H8PA 4HDIB 4P48A 4GRMB 1Q9OB 1BJ8A 3CFBA 1FGVH 4E41A 5E94A 3PQYE 1EAJA 2ARWA 4JFFB 1ZSDB 4P46B 2IANB 1JE6A 3DMMB 5FO7B 2DWDB 1R3IL 3QNXA 2YA1A 2G5BA 3REWA 3TJEL 2FWOA 4M3KB 4TRPH 5DRWB 1NSNH 4LVHC 2A6DA 2XWBB 4K94C 3ZKMC 4L4VD 5B39A 4JGMA 2BY0A 4QHUA 1RHFA 4AIOA 5LGJA 3IJSB 3QH3B 5CIPA 4PYGA 5HTSA 3AM8A 5HDBE 2R0LH 5IB1A 4U1JA 3IKCA 4XTRD 3TNNA 2CKNA 3KG5A 5IGXL 2OJZL 2EDEA 3L3DA 3NIFF 2ZCHH 1EZVX 4JO3L 4F9LC 1H3XA 4RZCB 1BZ7A 3WIHL 4GAFB 1AFVL 5MP6H 4P57A 3LQZB 3ECBA 3MLSL 4XBPA 2AQ3A 5E56A 3MLUH 5E8PB 1VKXA 4PY8J 4PV8B 1DVFB 2G60L 2W0FB 1J86A 5ICYA 5D1XD 1TNNA 1LMKA 1F90L 1QLEL 3FB5A 3BP4A 5BMFH 4V2CB 4E9LA 2ADJB 2D7TL 3TM6A 5EOQL 3QQ3A 5HGAA 3G5YB 4MMZC 3MO1B 3IXTB 4LLUA 4OCSL 1MJ8H 4G6AC 1A7BA 5SV3A 3GK8H 3K80A 5DS8A 3VFPB 1Q94A 4QXWA 1J1PH 5BVPL 4N0FB 4Z0XA 2YBRB 2PXYB 5JW3L 4MXWH 4NQVB 1IFHL 1XGPB 4EI6B 1FVDB 5FM5M 1FL5A 4PJ7E 5DEFA 4MXVF 4P3DA 2CIIB 3DVNA 4OLYL 3B2UD 5D5MB 3S35X 2W92A 4LRNL 3SY0A 1QA9B 2ZUVA 4LCCA 3TT3H 3MUHL 3C60C 5BZDB 3RVUC 2ZOLA 4GW5A 5SWSA 4LSPH 2R2HA 3ARFA 3BXNB 1UADC 1ZTXH 3SDCC 1VEMA 3L6FB 4GMTH 3ULUE 1I4FA 2Q76B 5GSRA 1XGTA 2VDMH 1NFKA 1IL1B 4LVNB 1IAIM 3AS3A 3QJFB 2VITA 1YEFL 2XNAB 3WDIA 5EU3B 4NKOB 1T22A 5D9SB 5EPMA 3KPLB 3R1GL 1BAFH 4HF5L 3VFTB 5J6GB 3WNMA 1CGUA 4K23H 4OF5A 4CJ1A 1T5WB 4ODWA 1JZ5A 4XX1G 5C07B 4ENEC 1G7HA 4ODVH 4WNQA 5MENE 3MNZA 4W6XB 4PB0L 1JFQH 5SWQA 1F4WH 4QRSA 4FFZH 3ULUH 3DHMA 2Q3ZA 1KFAL 4KDTC 1M7DA 4MJ5B 3OKDB 4FQJH 1EEZA 3TJHC 1CFTA 1LEKB 4JVWA 4Z76A 1DFBL 2DL2A 3U6RA 3V4VL 3NVQA 4EUPB 2P46B 4R4FH 1MVFA 2CRMA 2IG2H 2ERJC 4UBDC 4N8VB 2GFBA 1BP3B 2C9AA 1CE1L 1PEZA 1MPAL 3KVQA 2A73B 5I0ZA 4O02L 5BJTA 4BH7A 1NC4D 1XF2A 2PF6A 5EA0H 5FGSA 4NO2A 1S9WB 5C0JB 1D7FA 4C56A 1P6FA 3ARRA 1KNOB 3QQ9D 3SPVB 2OTUA 3O8XD 3EIFA 4X6DE 1EFQA 3QG7L 4PR5A 3ZDXE 3GSRB 1P9MC 2VO5A 4PP2A 1YN7B 1GC1L 4PJFE 3S4SG 4D2NA 2WINB 2HTLC 4L4JA 5H37G 2D0FA 1HNGA 4Q9BA 4F9LA 1AXSA 5CEYA 2BXYA 2FLBT 1OAZL 4IM8A 2I9LA 4JQXC 3P9MA 5AYUH 2VLRA 3BP5B 3E0GA 2CGRL 1JWSA 3QNYA 3TNMA 5E95B 1I9JH 5IQ9B 5AD0A 1VCAA 2ZSVA 5EB9A 2IADA 4BSVB 4X6CA 1IQWL 2BJML 1ZWIA 5C9JB 2Y6SC 3EOBB 3CXDH 4WFEE 4XB7A 4FFVC 4FQCL 1S8DB 3X3FL 2DWEA 5CINL 1CU4H 3EYQD 3FAWA 4JFED 4NSKB 1NPUA 1V3KA 2DI9A 3NCJH 5F44A 4B5EA 3VXSA 1JYWA 2DBJA 2GKIA 3KNBA 5MERB 1HILA 5HPMA 1N2RB 5IESL 3ZDYE 1H8SA 3S37X 1PGRB 1BFTA 2NZIA 2EYRB 4FXKB 5I6XB 1GAFH 3ABZA 3QDGD 4OM0L 1HINH 2R0WL 2JKXA 2APXA 3WS6A 2AV1B 2R4SH 3ZKXB 5DRNA 1SVCP 1MF2L 3IDXL 4JY6B 1CT8B 1WBYA 1ES0B 2VDRH 3KR3H 4KPHL 3C60A 2LU3A 3GSNA 5F97E 2FIKA 3GSQB 3RVWD 2WV3A 3X11B 3ZYIA 3SDCA 1JHTB 2RIKA 3ARDD 1D6VL 4QTIL 4ALAL 3DSFH 4L8BA 1KTLA 5E6IC 5F7MC 3RWJB 2P5WA 4KFZC 5C3LD 3O41B 3UMTA 5DR5H 3OMZA 1ADQH 2A0LD 4WO4D 4YPGA 4AJ0A 1OB1A 1JZ3A 4I2XA 4JZNB 3BO8B 5KVFH 5DJAB 1KCRH 4JJ5B 1G7LA 1D5ZB 4RRPG 3WFHA 3QRGH 5JDSA 4ZO6A 3A67L 1AD0B 2PTTB 3G9VA 3CFKA 4PGJA 4KDTA 3VXOB 4LSTH 1FL6A 1KOAA 1XF3A 1DN0A 3GSOB 5KW9L 3D3VA 3NIFE 5EBWA 3GUTB 4NN6B 1XGYH 1CICD 5IW1A 1WJ3A 5KVDH 3INUH 1TPXC 5EO1B 3QQNA 4XVJL 4M7JL 2CKBL 5FYKU 3ARBC 4R4NC 1KBGL 2H8PB 4MNGE 4YHYC 5IVXA 3QUZD 3CFBB 5D1ZC 1IGJA 5TGBB 1YJDH 4KK6D 1LK3L 1OY3B 1ZHKB 3O3EB 3QO1A 4OLEA 4ZUVA 4JDZB 2DLIA 5H94B 3PGDB 4N0CD 3QNXB 1P9MA 3KPQB 4U49A 3TA3D 3HE7C 2Y5TA 2FWOB 3QDMD 2ZUQB 2A6DB 1YC8A 3W81A 2HFGL 3KHOA 5IV2A 1EFXD 2P8PA 2CQVA 2V2WB 4JQXA 3P77B 4J12A 4NOBA 1CXKA 4L3CB 1FZKA 1NANI 2F19H 4G9DA 2ICEA 4DZBB 4X7FC 1JHKL 35C8L 1B90A 3SGEI 3BDYL 5IB1B 3IKCB 3QDJB 4FQPA 1JN6A 4E0RA 4NP4L 3LEXA 4GG8A 2BNRD 5KZCD 2ILLA 4ZS6D 3BSZL 2EH8L 2LU7A 1DQMH 4HIHB 3G5XB 4PRHA 2CLZA 1RURL 4LQFH 4KJPC 1R5VA 4OI9A 1NCNA 4N8CH 1JV5A 2KBGA 3QEGH 1F2QA 3OKEA 4LCYB 5INDA 1Y6KR 3RA7L 3X12B 1JNNH 5HHQB 4NNPH 2OL3L 1FCCA 5DT1H 2N56A 3IS1X 4NZRL 1DUYA 4O58L 5EWIL 5IBLC 5IKCA 1T83C 2XPGA 3ZL4L 3BP4B 1FLRH 3HZKB 2F53E 2YPKA 1A6ZA 1GOFA 2FATH 3DX7B 4P2QD 3NCCB 4Y1AA 3D1MC 1L0XA 4JFDB 4JFQA 1CFSA 4Y2OA 3TPUB 1LEGB 4ZDHA 3K4DA 3JXAA 4FFYL 2NXYB 1D3CA 3BKML 2UYLA 3OXSA 4ZUTA 1QRNB 2EXYD 3HNSL 3IXAB 4POZD 4L1HA 5DEFB 5E6IA 1J87A 1VADA 4HKBA 2NY6D 3BPCA 1NJ9A 3F12A 3CJJA 3SY0B 3QQ4B 1U8QA 4LCCB 1IAII 5KS9B 5DMKB 3UTTB 5SWZB 4PJBF 1KCUL 1YYLH 2R2HB 3ARFB 3DROA 3KPRB 4QHNA 2BSTA 3OR6A 1ZKAA 4J3WA 1FFOA 4HUUB 2AJVH 3OKKB 5GSRB 2EYTA 3BPNB 3NCYS 3SGDI 3QRFM 5D7IB 5EBMA 1AE6L 1BWMA 2X9WA 1F4HA 4IRZH 3TT1L 4JM2F 1HH9A 4RAUA 3KLSA 5EPMB 1KG0A 3PGFL 4HKJA 4U1LA 4D9RE 4L4TA 3LKRB 1BFVH 1P5VA 5JW5A 4LNVA 5TFSL 2P1YA 4FTVD 2DICA 3MNZB 2P5ED 1UZ6E 1T20A 3LZFL 4ZAKB 4ONGH 1YPZB 3UX9B 4XCYA 4QRSB 1SJXA 4ODSH 4B0MM 4IDJH 1J0YA 1G9NH 4KK8C 3MRPA 3HC3L 1MI5D 5D1ZA 1FZMA 2VLJE 3N1PC 1F5WA 3U9PH 5EBLB 2CKBB 3RWCB 3VXPB 3JV6A 5CEZD 6FABH 5K9JH 3HE7A 1B2WH 5FHAL 3SQBA 1IAMA 1EEUA 4PLKC 1BFSA 4TQEL 4XC1H 4JG0H 4BH7B 2EEDA 4HX1A 4NQEE 5DWUL 3NTCL 2FECI 5JXAL 5E2VL 1LILA 4PV9B 1O7SA 3DGCR 3IFPB 4OF3A 5E99H 4C56B 3E8UH 1U91A 4BZ1H 1FVCB 1H8OA 1AC0A 4HWZB 4U1IA 4PP2B 5DQDH 2R9HD 1BGXH 3BGMA 2WAHA 5D96C 2WWMD 4P9HC 4TULL 4GRWB 3G04A 1A14H 5CEYB 3CXHK 4AH2A 2VLRB 4DOHE 4ZOAA 4FQLL 4P4KD 3DV6A 2V5RA 4X4ZA 3GO1L 3TNMB 2R2BB 1JPFA 1CGTA 2H26B 3DO3A 3L3OA 4PRPA 1N6QL 5AD0B 3I3BA 2ZSVB 3QEQD 2IADB 4XPTL 2X4UA 4YXHL 1A7PH 4M93B 3EOYG 3SCMB 1T83A 5BS0A 4ZFGL 4QRPB 4Y19E 4XNUL 2DWEB 1F58H 4LIQE 1FZJA 2V7NB 2NLJA 3T0BA 5E0QA 3HS0B 1ZA6A 5CJ8A 5FA4B 4UB0L 4LPWA 4FG6D 5I8CB 3RWHB 5KJRL 2C3VA 1B0RA 2L7UA 3TZVC 2VL4A 2GJZA 1I9RH 3Q5YA 4ZFZA 2ADIA 2G2RB 4NC0B 3C5SA 4GMSH 4CVXA 4CUCA 4X5XA 4U05A 3JTSA 4KROD 1OAQL 3GSNB 5C9KA 1GGCL 5MEPB 4NJ9L 3BN9D 3QPXH 3V4UL 4FABH 4XHQA 2X1OA 1NCUA 4S1SH 4WW1A 4I4WB 4L8BB 5F7YC 4MJ4A 4QXGL 3HE6C 3NH7L 2BVEA 5HI5C 1OLLA 1MFDH 4ISVA 3S5LG 5F88A 3R8QA 1PKQE 2MHAB 4PJHB 1Q9LB 4YDIH 5T1KD 2NX5E 3O0RH 4X7EC 4PJXA 3MRNA 3HZMB 4M8QB 1NBZA 3FMGH 5DQ9A 1PYWA 1BECA 4RQQA 4PJCB 1N3NB 1G7LB 3VXTA 4EDXA 3JWOH 1YMME 4NZTH 2ADGA 4WUUB 2DQFB 5JA9A 3LIZL 4MLIA 3VH8G 4L5FL 3O11A 2VLLA 3OZ9L 1X3DA 5GGSA 1SEQH 5MHSE 5I8OL 4FQ2L 2NY1C 3D3VB 5EUKB 5DLMH 4P3CH 3MJ9L 1HKLL 3MRGB 2EDNA 3DETD 4YHZH 4M62H 4QXTB 5C0FA 3AREC 1ZLWK 5I1HL 1EA9C 2ERJB 4AIZA 2BNQB 3OAYK 4F3FA 3QIUC 4PRIE 1YEIL 4NRYB 4K3DH 3CC5A 4NM4H 2E5EA 3TVMC 3S6CA 5IVXB 1S7WA 4X99A 3CU7A 2NW2B 1TVHA 3DUUA 5ITBH 1N64L 4ZUVB 1MHHB 4QY8B 2YMXL 2OP4L 2ORBH 3LKNA 2YPLB 3UAJD 5MEQB 2Y5TB 3BP6A 3LV3A 1RZGB 2DIAA 4KMQA 1WT5C 1XMWA 4DJMA 5CP7B 1RIUH 3HCVB 5CIPH 2P8PB 1FNGB 3DBXB 4GAJH 1DE4B 1MCKA 4IHOA 4HKZA 4U7KA 4WFHE 4GG8B 3M17A 1OOAA 4M43L 2VMFA 5GJTL 2Z9TA 1NKRA 2ICWJ 2YUZA 2Q6WA 4PG9A 3HFMH 1CXEA 1MFBL 4WHYG 5IM7B 4TVPE 4TSCL 4QRTB 2CXGA 4PJBE 3WNPA 1MOEA 3WIIL 1F97A 1X5GA 2NY7L 4U3CA 1KEMH 2DS4A 1QSEA 4QF1A 4P2CG 5JOPD 3MA9H 1IGFH 3L7FB 1CXIA 1K4CB 1T0MA 3STZA 3UO1H 5IKCB 3TZVA 1ZT7A 3CMOL 3IT8D 4PGEB 3ZO0A 4KKAD 1UH3A 5EIVA 3BZFA 4UMGA 1R3KA 3FQTA 5FYKL 1KN2H 1OM3H 3GMPB 1DQDL 1KJMB 2FZ3B 3LPFA 4IRJC 1JGLH 4ZXBC 4JFQB 1CFSB 1AIFA 4KJWD 4NZJA 5DGQA 4N0YL 4GW4B 5D7LB 1UM6H 5IJKC 1S3KL 2J4WL 3BMVA 3KS0J 3OXSB 2BFVL 4HH9A 3HE6A 3ULSB 4Q9CA 1FYTE 2CUIA 2C4XA 2IH1B 5FM8A 2X05A 3BPCB 3SKOA 1JWUB 1U8QB 5EUOF 2JLLA 1OPGH 3N9GL 3L5XL 4UILH 3TH2T 1CFVH 5C0RH 1F3DJ 5J6HB 1LK2A 3V95A 4YLQT 2CLVA 1NGXB 3MV8D 2C7UA 1OWWA 1UCTA 3MLTB 2R29L 5EBMB 4FXGA 5ECJE 3MYJA 2E9JA 3EOTL 4HWNA 2YD5A 4DK6A 1KG0B 1X5HA 5L2KA 1TCRB 2YN3A 1T5XA 3H42H 4L4TB 4R26H 4K7FB 4QEGA 3V0AC 3FO1B 3HMXA 5L2JA 3SOBL 3QIUA 2VR9A 1T20B 4JAMA 2R23A 3MV11 3Q1SL 5HSFA 4OLZH 3ARBB 1Q72L 4X7SH 4G6FD 3Q2CA 4JFOB 2J1KA 3TVMA 4ZQKA 5D1ZB 1FZMB 4XTRC 2X70A 1MCNA 3VXRD 2R1XA 1UWGH 4D0DB 3DV4B 1IEAB 15C8L 5KAQG 2E9WA 3O6KH 4LLMA 4BSJA 4S0TD 4XPAH 5DD5L 4HK3N 1A2YB 4HJ0D 1UVQA 4A6YA 3AC0A 1OF2B 3WFEH 5GS2D 3OKNA 5T3XL 3QFJD 1X5FA 1RZJC 7CGTA 5C09A 4UV7L 4X83A 2GJJA 1MCPL 3RDTC 5IVNA 3WNKA 4PGDA 3BOVA 2MMXA 4KRLB 3SDAD 4PJDB 1IGTA 5F9WB 4MQTB 4U1IB 2YC1B 5C0CB 2HWZH 4HFWB 3DXAA 2MQ3A 4HMDA 1JYVA 5F1OB 4LSRL 1L6XA 3KPMB 5D1XC 2IQ9L 2NTFA 1KCVL 4I9WD 3S3PA 1T03H 2AVGA 3QBTB 2XG5A 3W0WD 4AH2B 1NL0H 4HV8A 5IK3A 4CADA 1PG7X 1LO2L 1FFNA 3KPSE 3WIFA 2JIXD 3MC0A 3MODL 2J8OA 4RGND 1H3PL 1QFWH 4JPIA 3AY4C 4JANA 4BFIA 2GQHA 1JPFB 3IU3A 4OF7A 2X4UB 3MV7E 1UKQA 1DBAH 4F58L 3O6ML 1WICA 1KB5H 5D71H 2F54A 4HGKC 1FZJB 4NKIH 5KN5A 4Q97A 3S4SA 4IRJA 1AO7B 4HXAH 3KXFE 4ZXBA 4OGXH 4L9LB 3QIBD 4V1DB 3EDJA 3NFSH 4BQ9A 4BKLA 2A6JB 3FQXA 5IJKA 2IALA 3DLQR 5I1GH 1B0RB 1OP3H 1E4XL 1AQDA 3PE9A 1X4ZA 1D5XA 2ZCKL 4ZFZB 5FEBA 1P4BH 3ARXA 2OSLA 4X4YA 2QR0A 3IFLH 4LEXH 2RAMA 3BD5A 3ZT7A 1IILE 3CFCL 1Z9MA 3C5SB 4ZFOA 1KACB 1QTYT 4X5XB 1JTPA 3ZE2F 3EYOA 4R7NA 1KCLA 5DK0B 4R96A 4G43A 4PJGB 2DDQL 5J12B 4ELMF 5KSAD 4XXCC 3H9SA 3ARWA 2FSEA 4TN9A 1IC1A 3LKQB 3KPTA 1N5YL 5F8QC 1NLDH 4LSDA 3GBMH 5DUPL 5I16B 1MAJA 1FYHB 4KQ3L 4GKNA 3O45A 2VC2L 1F6FB 1MFEH 3FOMA 2HT4D 1J18A 5JORA 5IIEA 4K7PX 1M05A 4MDIA 3UJIL 4L4VA 3C6SB 4BFGA 2VLLB 4ZUUB 4Z7UA 1DR9A 1GVIA 2FX8H 1MJJA 3C09B 3SKMB 3QQ9C 3EYVB 2J6EL 1H3VA 2FIRT 5HYJB 1AJ7L 3H9YA 1TXKA 4HWEH 1HOCB 1MJUL 3JWDH 3NABH 2F5BL 4JFZH 1SEBA 4Y5YC 3ROLB 1SVZA 3C5ZD 2PCPA 1D5IH 3PJSA 3UTSD 1HYSD 4JCMA 3O4LD 4P2RD 3CC5B 4B7IA 2KZ1B 2XIDA 3QISA 3EKCA 4RRPA 5HHOE 4X99B 2XQYG 4BA8A 1NCWH 4UOW0 5FCSH 4HS6B 2NY3D 4NNYB 4DGYH 4P49A 3P0GB 4ONOA 1V7NH 2CK2A 2IBZY 5EU6D 3BP6B 3KYNA 1A9EB 5JIPA 5D1XA 1ORSA 3ZYOA 4ZOEA 4Q2ZB 1MQKL 4S2SA 3MNVA 4RDQG 3EYQC 4QGYA 1W72L 1EVUA 4MA7H 4HW6A 1GHFH 3OBAA 2CK0L 3AY4A 1C7TA 4JPKH 2QSQA 4HKZB 2GAZB 2VDKL 2VXUL 4FQHA 4KHTH 4XMPL 2Q86A 3MROB 2FLRT 5CKAA 4GBXD 4BSWA 1VGKA 1JZ6A 5SX5H 2FNBA 2J8UB 3MRFB 3RVWC 3CVIH 3MCKA 1A64A 2VZTA 3VDAA 3OF6D 3HG1E 3JTTB 1VERA 3ARDC 3HMWL 4OKVB 5I1LB 4MNQD 1G1CA 1UB5B 4YUEL 2ICCA 1DBBH 2X42A 2RFXA 3GI9H 3BT2L 4R8WL 3UBXA 1IAIH 4GXUM 3TZVB 2VZOA 1ZT7B 3KJ6H 2A0LC 2AW2A 4WO4C 4AM0A 4NQDD 4L8SA 5GZND 3BVNA 1C1EH 5TH2B 2VXQH 1F3JB 1U8LB 3EFFB 3A6CH 3HR6A 3EO1B 1A1NB 1AIFB 3SGDH 1CTNA 2HJFB 2XZAL 4XXCA 3P73B 3DURB 1K8DA 4N9OB 1SM3H 4R90H 1BD2B 4J2XA 1LO5B 1QQDA 3OR7A 3QO0A 1AR1C 1KPUA 1QSZA 8FABB 1RUPL 1LVEA 3B4NA 2MPAL 4ERSH 2OI9B 2ZG2A 4Z6AT 1CICC 3WLWD 1URLA 4IMLA 1L0YA 5I73C 2D4DA 3GSWA 3X3GH 1MCIA 2HH0L 1A6AA 4HUMB 4MYWB 4XGZA 1CFNB 3GHEH 1NC4A 4ZNCD 1N6VA 2DJ4A 4UQ2B 4LSQH 4FXGB 4P59H 4Y5VC 3MYJB 3D9AH 3RU8H 1I8MB 4KQ4L 2V2TB 3NGBB 3O8XA 5BRZD 3NFNA 1DBMH 1FORL 4N0CC 3TA3C 4CMHC 2FO1A 1GCFA 3QUML 1T5XB 3GMRA 3QEHA 4PLJD 3AREB 4Y5YA 3MRJA 2HG5A 3LKSA 5JPNA 2ESVD 3B2VH 3DGGA 2R23B 4Y2DD 3B5GA 3U79A 4ZFFB 3WJLC 2CUHA 3D2UD 4MQXD 2AK4B 3GEWB 4WW2C 5AWNH 1BQHG 3PWUB 1J8HB 4K9EC 4Z8FL 2Z35A 3C8HA 1FE8L 1I1FB 4CN6A 5F7WC 3WS3B 4ZS6C 4KZEL 2OLDA 5DZLA 3VFOA 1TCMA 5TE7L 1U8MA 4Y4FD 1UVQB 3PXHA 1Y6NR 4F2MA 3OJVC 4CN4A 4JFEA 3MLXL 1IKFH 1EZVY 1G84A 3G5VA 4K3JL 1TETL 4WHDA 1DLFH 4NM8L 1ZVSB 1F13A 1AGDA 2XA8H 2KQMA 3DXAB 5CGYD 3MUJA 5C0AE 3WXVH 4HIEB 4YC2B 2IH3B 4HIJA 3QDGA 1GGIL 4ZTOH 4JRWA 1UB6A 5C6TH 4HV8B 4BZ2L 1C5BH 1FN4B 2A2QT 4K2UL 3ZE2E 5HHXL 5HD8D 4XT1C 4WENB 2YD1A 4MX7A 3LQAH 4ELME 3TF7C 4HGWB 1QSFB 3ARDA 4IOFD 1MLBA 5I1CH 2EXYC 1IGIH 1Q9WB 2AK1L 3IU3B 4POZC 5IFHL 1TJGH 3P3YA 2NY4D 2NY6C 2O61A 3IDYC 1CE6B 4C4KO 4WO4A 3VFMB 1QBMH 1LE9B 3GBLA 2ID5A 4YBQD 1PLGH 5D7JB 1LO0L 2B1HH 1KIQA 1JTTA 1NLBH 4OGYH 2VDLL 5DEGB 1MCRA 2HA1A 1X5AA 2IPKA 4O2EB 1IQDA 5J57B 3O4OC 1MFCL 3FQXB 1O7VA 3PV6A 2VL5A 3PQYD 1YN6B 5I30L 2VQTA 3RVTD 1EMTL 2B5IC 2OSLB 3DX9B 4X4YB 4JG1L 2RCSH 1Q1JL 3F7PC 4U6YB 4HWUA 1VPOH 1UJ3C 2AJXL 4DW2L 1SBSL 4PJAA 1CICA 1SJEB 1U0QA 4XCCH 2AJSH 5ISZE 4RAHA 5LGHL 1B3JA 5EDXA 3BKYH 3H9SB 2FSEB 4YQXH 1A6WL 1U3JA 3QUZA 4NZUH 3KDMA 1Y0LA 4ZYKB 1NMBH 4MJIB 2DMCA 2HVJB 2QEJA 2VJXA 4KHXH 4TNWK 3RGHA 3T77A 1Z6JT 1EK3A 4JJHA 3TA3A 3FOMB 4JHWL 1JPTL 2Q20A 3QDMA 3GJFA 1FAIL 3EJZD 3ARYA 4FZ8H 1LE5A 2HLAA 1EFXA 4X4ME 4RISL 3WJLA 4UT6H 1CS6A 4JVUA 2A83B 4N90E 4PJ8D 1WWCA 3VXMB 3SE4C 3QUMB 1MJJB 4R97C 5IB2B 5L0QC 4WW2A 1IAKA 4DKEL 1JRHL 4PTUA 5FYLE 2HLFD 1KJ2L 2R9HC 2BNRA 4X8JA 4JKPL 1YEJL 1SYVA 1QRKA 3L1OH 2WWMC 4TOYH 3S5LA 3MX0A 3T0AA 3F5WB 1AGBA 4HJGB 1OP5K 2CIKA 5FUZL 2GCYA 3V0WH 2GK0B 4QKXB 4P2OD 4FQXD 4P4KC 4X4XA 1A0QL 6CGTA 2H1PH 1NFDA 3RDTB 1CLOL 4CW1A 2VXSL 1NGPH 3LVEA 5HHPA 1J9CT 3GMQA 3VH8A 1UZ8B 2VAAA 3CH1A 2APWA 1Z3GL 3H3PH 4C55A 3MOQA 4XPBH 4YFEA 4NQCB 4NKMA 4EDWL 2EICA 1ORSB 2DBLL 3EGSB 4GS7B 1L0QA 4LHUB 2FL5A 4TSBL 4JHAH 5DC0A 3MACH 4LU5L 1HNFA 4F7EA 4P2QA 2HFTA 3T0DA 2KZWA 1CDUA 2P8MA 3ULUD 4QRRB 4FG6C 3RBSA 4F7PA 4NT6A 5T5NG 2Z4QB 3O6LL 2DQTL 2Q86B 4FQIL 4HLZG 2JELH 4LKCA 3B9KD 3KPNA 3MRCA 2XI9A 4XP4L 4CU8A 3SDXA 1WBZA 5D4QA 2M8XA 5C0BE 4KROC 1DQTA 1X5IA 3I02B 3QUXB 2E27H 3EYSL 1OARL 4OZIB 3F6LA 5GIRB 3AROA 4GXVH 5MEND 2FX9L 1B9ZA 5F71A 3AUVA 2BOBA 3BN9C 4GG6B 1DSFL 1F8TL 1JUFB 1KIPB 3G6AB 4G8GB 4P5KB 3BKCH 4Q6YA 2F5AH 4JN2A 3UBXB 4NC1C 1FH5L 5E5RB 3IDJA 4TPRL 5GJSH 4AM0B 3GI8H 4OCMC 1DJSA 1G0YR 4HUNB 3RPIB 3BVNB 4JFFE 3EYFB 1UJ3A 2OTWA 1GGBL 2R56H 3MBXH 2IANE 4QRUB 4EOWL 4IBLT 3W5MA 3UC0H 1BQSA 2BSRB 4MD4A 12E8H 2GEEA 1KPRA 4FTVA 3FFDB 3LPGA 2A9NH 2Q7YA 3GSUB 2P5EA 3QSKB 3V6OE 5E4EC 3ULVL 3C2AL 1K9TA 1MFAH 1PD6A 2P7TB 4OQTH 4JZOA 1MI5A 1N4XH 4EBQH 1BX2A 4E5XB 4YXLH 4QCIA 5F7NC 1KPUB 5CGMA 4DWHA 3DETC 2XFXB 1P7QD 5ALCH 5IHUH 4PRDA 1ONQA 3IFOB 2YHGA 3K4ZA 1U8PA 5JHLH 4Z7VB 5I1IH 4R4BB 1JPGB 4QHLB 1A6AB 2KH2B 1JNHB 1F2XK 2B4CC 2YK1H 2X41A 3MGTB 2XT1B 3PWVB 4GLRH 1IEBB 2FO4B 4K3EL 4K8RL 5KVEH 4OM1H 3SE4A 5FYJH 4XCEA 2FJHA 1DQLH 3SDDD 3P0YH 4M3JA 3GKWH 3NFNB 2VXTH 3UAJC 2R69H 5I1EL 3GMRB 5I8EA 3QEHB 3HMXH 1KB9K 5F93C 3IYLW 3LKSB 2DQJH 3RIAF 2VAJA 4JFPA 4N5UA 1KJ2B 1I9IH 4UINL 1KLGB 3B9AA 3F6IA 5HDLA 5EZIH 2GSGA 5JTWA 5JPMB 4P4KA 5BVJA 2B0SL 5DJXA 3PNWA 4JLRB 3KWWA 4NNXA 4BM7A 3QEQA 1FG2A 2WBJB 4MA8L 1D5BA 1FHGA 4JO1H 2AI0H 4OV6F 4FOMA 1J0ZA 3MV9B 4U3XA 5GRJH 3FCTA 1TNMA 4ZSOA 3U36A 3VFUA 4F2MB 5EIIB 2JJWA 3L5HA 1OWRM 1BF8A 3CFDB 5BZWA 4CBPA 1G7PA 3LRHA 3UJTH 3QWRD 3WO4B 3ZHKA 3UPRA 1NAML 3FTGA 3W82A 2AGJH 1IGMH 1LD9A 5IBUG 3RX8A 1ZMYA 1NCTA 3GHBH 1IC5L 1AR2A 2EEAA 3Q3GB 5IW6A 2Q8BH 4G9FD 4JGUA 4HIJB 3S36H 1RZ7H 3ZSSA 3N06B 3CDFA 2Y36H 4KKAC 4DUVA 4ONFL 2PNDA 4U1SB 4LSUH 1CG9B 2XKNB 5B3JF 5IMLB 4XWOC 4LF3A 1BVKB 3UTQB 4L9DA 1FZOB 1PEWA 3DUHA 4KJWC 3U9UA 5C07E 2EE2A 2YA2A 3SEPA 2Y06H 4P5MB 1JZ4A 5J1AB 5E08H 1AQKH 1P7HL 5F9DC 4ZUWB 2CJUH 1NGWA 2J88H 3OKLB 3NCYP 5T1KA 1MUJA 4BQCA 2DB8A 2PW2A 1CVSC 4WO4B 3AMKA 4C83A 3U0WH 1JF5A 1NCDL 3RUGB 2RQ8A 4X5WA 3V5KA 4MD5B 4JKWA 5H37H 5EZLA 2D9QB 3D39B 5FB8A 3GSXA 3PWNB 1E6OL 5DGRA 4DVBB 1AGEB 5JQ6H 1HHJA 2D31B 4UNTA 4HXBH 3MYZA 3TIEA 4GH7B 3RVXD 2DLFL 3SKJH 3FO2A 5DD6B 5IFAL 3QI9C 2P47B 5ENWB 1E28A 2GTZB 1N0XL 3U82B 2FBJH 3VRIA 4JN1L 5E00B 3PP4H 4O2CB 5D7IF 1YNTA 2DD8L 1QKZH 5CBAB 3NAAL 5FUOH 5ID1A 1FO0L 4EUPH 4HPYH 3CX5J 4WY7L 4NWTL 4X6DB 5JLZA 3NZHH 1GL4B 4QRQB 1VENA 3MRRA 3GIVA 1U41A 5ALBL 1Y0LB 4L8DB 5IBTL 1OAUL 5D70L 4Y5VB 5H35A 3W2DL 3G9AB 2QSVA 3D25B 1R3IH 5T3ZL 3OL2A 1YEDB 3P0VL 3TA3B 3BKJL 3TJEH 4C59B 4GKOA 5ESVA 5A16A 4HJ0C 4OT1L 1LE5B 3RQ3A 3STLB 2R8SL 1EFXB 5IHZA 3B6SA 1QHPA 4G8IA 1TJIL 2BDNL 2FH8A 1OQOA 4WFGD 1IAKB 3E6HA 2OYPA 3SDAC 4MSWB 2B7DT 4M7ZC 5IGXH 2OJZH 3I50L 4N1EA 2MSPA 4X8JB 4OFYD 4YZFF 5KZCB 4JO3H 3R06B 1MCDA 3MRKA 3MLWL 2F53D 3GJEA 3WIHH 3CVHL 4ESKA 2CIKB 1AFVH 3RZCB 1TENA 5A2JH 4LCUA 4JDVA 3U2SB 5I15L 1RZJH 5DMJB 2HP4A 1W0VB 4RGNC 4CW1B 4HBQA 2VUYA 2SEBB 5HHPB 2DF3A 5IB4A 3BEVB 5J9PA 1KIUA 2AXGA 1YY8A 4R0LC 4WU5A 1F90H 1QLEH 5E9DB 1DBKL 2ZSWA 2D7TH 4X6CF 5GGVH 5EOQH 1TVBB 5E2TH 4RFEB 4F7EB 4P2QB 3U4BL 4OCSH 3RL2A 2BVYA 2YXMA 1B6DA 2P8MB 3QIBC 3RZWA 4XNQA 5LQBH 3U0PA 5C0IA 5TF1L 3WL9B 3O3BA 1GSMA 4OD1L 3ZYZA 2FCBA 3C87A 1RK1B 4QXUL 4D8PB 4OLYH 3WLBB 3IJHA 4LRNH 3B9EA 3IDYB 4HWBA 3PL6B 4D9RD 2BP3A 3FHQA 1XGRA 3I6GB 2ICWA 1KLUA 1A7RH 3VRJB 4AG4L 5I1DA 2V7HB 2BOBB 5F7UA 5KSAC 1TZIA 1YMHA 1L9NA 3IS0X 2EDYA 3MV8A 1OAKL 4NUGH 3PWLA 5DURB 5D1QB 3PG2A 3LRGA 4R7DB 2VE6A 4MXQD 4OZGA 1CF8L 3R1GH 1ZHNA 5DI8B 2ZP0T 3OSKA 1ORQB 1DQJA 4LOUD 4IRSD 1DBJL 4LHJB 3FRUA 2X4OA 5CS7A 4PB0H 2Q7YB 4PJCF 1J12A 4JRYB 5ABDE 4U6XB 3O3DB 3TC9A 1UENA 5B8CC 4JVPA 5I2IB 1MI5B 5DK2B 3T2QA 3V4VH 1BJ1J 1I1AB 3I75A 5JIIA 1FO0B 1NUNB 4HD9A 1R0AH 3VXRA 1K6QH 1HZHL 5C6PB 2O5YL 4TNVF 3QDJE 4PRDB 1CE1H 4PLNC 3C5ZC 2XWTB 4H88H 4AEEA 1A3RH 1RU9L 5FO8A 1KYOJ 1U8PB 3EFDL 1HYSC 4O02H 4OLWL 3RWDB 1ZOXA 2EIZA 3QFJA 4YX2H 1UGNA 4DZ8A 4XCEB 4WV1C 5INCA 5L0QB 1UM5H 3SDAA 2NY3C 3QG7H 5DD0L 1P1ZA 2I27N 4PYHA 5IVXF 2CLRA 43CAB 4A2LA 2V9TA 1OGTA 1FGNL 2KL6A 4NCC1 4LIQL 3N1MC 4Y19D 5I71C 5FV1L 3W0WA 5B3JE 1OAZH 4Y5XC 2CGRH 4FZEL 1I7TA 2BVTA 2JIXA 5T5FL 4U1MA 3ARUA 2XZCL 4OLVL 1YEGH 5DYOB 5DJXB 2P24A 1ZLVH 3PNWB 1JBJA 3KWWB 3OB0K 1U95B 3PWPD 4JFDE 1FG9C 3FT4A 2WIIB 4M61A 1IQWH 5D2NC 2F58L 5KVMC 2BJMH 1CWVA 4GBXC 4QGTA 4D9LL 1QRNE 3BQUB 4ZSOB 2PTUA 4FQCH 4KJYA 2NPLX 3VFUB 3RL1A 5CINH 5H2BA 1J11A 1OGAB 5JOFA 4KVCL 4OCWL 1S7RA 4G6JH 1G7PB 4UUJB 3OAZK 1CGVA 5ACZA 5KS9E 3QIBA 3V6ZB 3DX8A 3UTTE 5SWZE 2W60A 3TV3L 1D6EB 2DTML 3BESR 3KPRE 5IESH 2BMKA 2FBOJ 1ACYH 4TUOA 4HIIA 3TYFB 4OM0H 2R0WH 1BQHA 3V7MA 3WHE0 4XP1L 4P5TD 3WEXA 1IAOA 1JK8B 5GZNC 1KIRA 1MF2H 2QTEA 3IDXH 5D7IE 4LF3B 1KENL 4B41A 2ZOKB 5D2LB 4H8WL 5GZOD 1DLHA 2EDTA 1CDGA 3ARGD 1D6VH 4QTIH 4RIRA 4ALAH 5KSAA 1P84J 2EYSA 1YUHA 2AV7B 3VXQA 5MHSD 1T0NA 4NGHL 1YPZE 3O2DA 4KJQD 1NGWB 25C8L 1MCFA 5FO9B 1WC7A 3DSNA 5L9DL 3L3IA 3UTOA 3U46B 2AERT 1WGOA 3V5KB 5EZLB 4PJEA 3X14A 2VLJB 1S7XA 3HZVA 3GSXB 1PBYA 3I2CH 4KMTL 2D3VA 4BH8B 3A67H 1OAXL 3G6JA 5E4EB 2CDFA 1M7IB 3TIEB 5B8CA 5KW9H 4EQ3A 3PDOA 3AB0C 1BHGA 1T04B 2N7AA 3DI2B 4YZFE 3VI4F 4C56E 4OI7A 1FL3A 1K85A 1M71B 1RZKL 4PLJC 2OMNA 3BISA 1OT1A 4EZMA 1RZIB 4WDIA 5ID1B 2Y25A 3C5ZA 5JLZB 4XVJH 4Y2DC 4M7JH 3UTSA 2CKBH 3O4LA 4P2RA 4MQXC 1QD0A 5DJ2A 3MRRB 4ORGB 1T1ZA 3RIFF 3WE6B 1J5OL 4UQ3B 5CKGA 2DM3A 3KYOA 1FJ1A 3X13A 2VLRE 4WFHD 4PS4L 4HEPG 1XF5A 5EULV 2R2EA 3GJFH 3U30B 3MRLB 1R24B 5EU6A 5JW4M 4HS3A 4TVPL 4Y4FC 4NFDA 4X6CE 1WFOA 1VEPA 2HFGH 4WJ5B 5BW7C 4Y5XA 5IHZB 1LO4L 4GRWH 4G8IB 1YYML 4QRPE 5EO9A 3E6HB 4X7TB 1XR9A 1JHKH 3C5JB 35C8H 3BDYH 4NP4H 4ACPA 1BEYH 3ELAT 4FMFA 2A9ML 2DQUH 2AQ2A 5DMIL 3SDYL 3I3DA 4JM2D 1Z0NA 3VXSE 5D2NA 3BSZH 5CJQL 3WFBL 4PJDF 2GY5A 4GBXA 1JHLL 2LAGB 5DJ6A 4OUOA 4LCUB 4JDVB 1RURH 1YC7A 5HD8C 1FIGH 1RJLB 1ZANL 1AI1L 3OF6A 1XIWB 4FS0A 4YDLC 5ESAA 1DDHA 3VWJB 4ZNEA 3RA7H 1A6VH 2GTWA 5IB4B 4HHAB 4UAOC 4XC3L 5HY9B 5IEHB 5C0ND 4HK0A 2OL3H 1RHHA 3V4PL 4MNQA 5IB3A 1F4XH 3J8F7 1CIUA 5E4IA 4NZRH 5EWIH 4O58H 5TPWL 1CFBA 2FB4H 2NY4C 1FFRA 1I8KB 1G7QB 2NY2B 2NY5L 3ZL4H 2VUOA 2R2CA 4NQDA 2NZ9D 3VDCA 1W2KT 1INDL 1C5DA 4PJHE 4RGOH 4YBQC 3TFKD 2YSSA 5J56B 1CN4A 4Q9QL 1OSPL 4NO5B 3U0PB 4PJCE 5K9QI 5HGBB 1T4KB 3BKMH 5F21B 1QUNA 2ZG3A 5B38A 1XGUA 3HNSH 4ZUSB 1MHCB 1FBIL 4OF0A 1JI2A 4C4KT 5FDWA 2UZIL 1WZMA 5LKNA 3D3VE 3IF1A 3X17A 1QLFA 2ICWB 4NOFA 2ZKHL 5GQBA 2ITDA 5CP3H 2BNQE 4YHPB 5HVHB 2LVEA 1TZIB 1MRCL 1YMHB 1Z5LB 1YDPA 3CH8A 1OTUD 2GT9A 3MV8B 3ESUF 2NR6D 3B3IA 1AE6H 4PRIB 4XPHL 3RY5A 3TT1H 1VFAA 2VE6B 2QHRL 5DJDA 1Y6MR 3OX8A 3MXVL 3QI9B 3BEWB 5IVXE 3PGFH 5BRZA 4AEFA 3MR9B 2JB5L 4JCLA 4YDVA 1DQJB 3QIWD 3D0LB 2IGFL 5BO1L 4BQ8A 4G8FB 3P9WB 3EJZC 4PJXF 4WHYH 2X4OB 3LRSB 1N5AB 2YPLE 2ESVA 4LPVA 4Y2DA 5E2UL 1RIHL 5AG9A 3Q6GL 3D2UA 4PJ8C 1RK0A 3HC3H 3ZSTA 3GRWA 5IOPA 3W11C 3UDWA 2WP3O 2G9HB 3I75B 4K7PY 2HLFC 4H25A 5DQJB 3ZYJA 1WZLA 1V7ML 4N0UA 5TDPA 3F7YA 5FV2A 3FQUB 1NCAL 1C7SA 5FHAH 2C5DC 5FO8B 2X4SB 1JZ7A 2PUQT 2C26A 4Y4FA 4BYHA 4P2OC 4FQXC 1YEKH 1GZQB 1ZHLA 3MSPA 2EIZB 1NCCL 1VB9A 4MNHB 4WI3A 4YHNA 5BW7A 3MGOB 5DWUH 3NTCH 1IGYA 2X1PA 5JXAH 4YHOL 5I74B 3CSGA 1S7VB 4ORZC 3HLAB 5I9QB 3SDAB 1CDCA 1P4IL 5HGHA 3EDKA 2PW1A 2JK5B 2DKUA 1OGTB 2OJEA 4TULH 2OS7A 1X5JA 4O51A 1KPVB 4Z7NF 4F37F 1K5NA 3L3GA 3EDEA 2Q87A 4FQLH 1I7TB 3QFDB 4H1LG 5JHDD 1S7SA 3ULUC 2ATKA 1QZ1A 5CD3A 5HYSG 4UZGA 2P24B 1P7KB 1U58B 1A3LL 3MJ7A 4Y1AE 2YWZA 1P69B 5HHNA 4X6FA 4M61B 4XPTH 5F3BA 4YXHH 1AKJD 3B9KC 4ODTH 3D0VB 3VMPA 3FT3B 5D7LE 1MEXL 1T1YB 2DLHA 2HT2D 4R0LB 1LNUB 4Z18A 1ZLWH 3W9DA 3RL1B 3RVVD 4XNUH 3OAYH 1KTDA 2IAMD 3QG6A 4XMLL 4X80H 1ND0A 1KELL 3KPOB 2ZG1A 1NBYA 5ACZB 4UB0H 3QDHA 5IT2L 4M5YL 4JHBA 2EECA 2J8UF 5KJRH 3IDGA 4TUOB 3U0TA 3UPCA 1RZ8A 3PQYA 4HC1L 3UTPE 2I9TB 4QTHB 4WHTB 4F7CB 3VI4E 2NXZB 3S96A 1FNSL 1AD9A 5JXEA 1XR8B 2WNGA 3H3KA 4UI2A 3U83A 2VYRE 1OAQH 2GY7B 1UQSA 1GGCH 4NJ9H 5FIEA 3V4UH 3UBXI 4L4TE 3QCVL 5IQ7L 4PY8I 3NACL 1ZT1B 4QXGH 3NH7H 1YUHB 1UXSA 3VFWB 2I5YL 3HB3D 4NKQB 3PABA 3MRHA 4X6BB 1RJZB 5KANI 3M8OL 4OIAA 1MCOL 1ITCA 2R0ZL 1QR1A 1UWXK 2MKLC 3SJVD 1HCVA 1NMAH 1JGUL 1KUMA 5BCAA 3X14B 5FKAA 1MAKA 5GS0D 1CTOA 3LIZH 4MAYC 4L5FH 3O9WD 5HHOD 3TYGH 3LKPB 4O00A 4HCRL 2ED7A 4PJ8A 2NQCA 5E8EB 1WF5A 3SDDC 1JMXA 5B8CB 5I8OH 4FQ2H 3RNQB 4ZOBA 2LQRA 1C12A 1CFQA 3MJ9H 4U1NA 2MOVA 3U7YH 7FABL 4PJDE 3GMOB 4WDIB 5TQ0L 4APQD 5C0CE 3C5ZB 2EDKA 4HUKB 1YEIH 4QOKB 4P2OA 4FQXA 3QYCA 5DJ2B 3GMLA 3B83A 1PJ9A 1FV1B 5ETUB 1N64H 1T1ZB 2GJ6B 2DMBA 3P2TA 1I7UB 4WV1B 4U0RC 1P2CB 3H3BC 5EOCL 2AKRA 4RMQA 4XPGL 1MHPL 4U7MA 1G1YA 4M6AA 1JRHI 4PJ7A 5EU6B 4G8EB 3VGAC 4IS6A 5F6HJ 3KLAA 5GGRB 2IQAA 3Q5OA 5EU4A 2APBA 3MV7B 4Y5XB 4EVNA 2DI7A 3T1FA 5MEOB 1YQ2A 5F1IB 3TBYB 1I3RA 3P9LA 1WV7T 4QHMA 4LAQH 5SV4A 1AO7E 4DQOL 4V1DE 4LBEB 3RAJL 3W9EA 4D3CL 4M43H 5GJTH 4R2GD 3B9KA 2CRYA 4GBXB 3T65B 3IVKB 1MFBH 3FL7A 5DJ6B 4C54A 5F9OL 4TSCH 5IROA 2PYFA 2XWJA 1HSAB 3AMLA 3N0PB 5DC4B 3WIIH