5DK0B

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRGDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B01
4LLWA 2EXWC 3OB8A 4HLZH 2OM5A 2IG2L 4TNWK 4G8FA 2VSDA 5FYJL 2GJ6B 3WUZA 3GBNL 2D7OA 5H35A 3SKNA 4TNVK 2OQJB 1YQVL 3BH8A 5EBWB 4U0QB 2D3VA 3MLZH 1BFVL 3HR5B 2P4AB 3STLB 3BQUC 4PJ8C 5GJSH 1HH6A 3OMZA 1UXSB 2R2CA 3P9MB 1LDPH 3QCTL 2C4FT 2VH5H 4XCFL 2F58H 3BXNA 4P5KB 4Z7NF 3QISA 5D6CB 2ZOKB 1IAIM 1YNKH 3H7BB 3HPJA 3LN5A 5LBSH 5DT1H 2DLTA 4XNYL 3U0TA 2X89D 2F54B 3UBXI 1K3IA 1MHHA 5EA0L 1KLFA 1UYWL 3LEYH 4G8IB 5L2KD 1RJCA 1YECH 1BD2B 1J1PH 4HIXL 2A73A 4C83B 5EZLB 2WBJC 1VENA 2DQHH 2FLRT 4HQQL 4O2EA 3I2CL 4UT6H 1M4KA 5F7DA 4WTZA 4OGXH 2GFBB 2ESVD 4M02A 4POZD 4I0PB 3RGVC 2FHFA 5C1MB 1IAMA 1U8LB 3K4DA 1N2RB 2ZKHL 2LAGB 5FAAA 1WUNT 1PQZA 3C6LD 2IG2H 3VFPB 3EIFA 1E6OL 1S7QB 3WJJA 1A6UL 5FYJH 3L7FA 1JGEA 5D9SA 3GBNH 3SE4C 1IM9A 2NLJB 3PL6B 5MEPA 1YQVH 2ITCB 5E8PB 4CVUA 2NW2B 5EIIA 2VL5A 4U1GC 1BFVH 3TFKC 2C26A 1X5HA 1G7LA 1TXKA 4UNTA 5JW5B 1IVLA 4HWZA 1E4KA 4U1SB 1QVOA 1I1AA 3OXRB 4NRYB 2I24N 4K3EL 1CXKA 1J8HB 1GC1C 4ELKA 3QCTH 4YFLI 4XCFH 1M7IB 4HIEB 1E27B 4RA0C 1NH6A 2EE3A 1IEAB 4KKCC 4AT6B 5HYJE 1NMBL 5IBLD 4Q6IA 1NAMA 4GRWH 1W2KT 4XNYH 4KV5F 3IDGB 4JG0L 1BLNB 2BY3A 5EA0H 1UYWH 5EBMB 2OTPA 3WN5A 1AGCB 3L6FB 4MJ5A 1BVLA 2ATPB 4HQQH 1FFQA 1JPSL 1RJZB 2JB6B 3I2CH 4OZGA 1CE1L 1ZTXH 5EO9A 3RQ3A 2Q86B 4CU6A 2O5YL 2CO7B 3MV9E 4PJ8A 3TBYB 2ZKHH 1Q9LB 3DO7A 1J12A 2ICCA 4XNZC 1UZ6E 2VLRA 1W0WA 2G75B 3CVHB 3VXTA 5DLMH 1E6OH 5FYKE 1A6UH 3VWKA 4Q58C 1T5WB 4YBHA 3F62A 4D0DB 3U7AA 2NY5L 5TGBA 2R0KL 1E4XI 1ZAGA 3MRMA 5MI0C 1TLKA 1UB6B 4NKMA 5DFVC 1KPUA 1JMXA 2H32B 4OZGF 4NOFA 3HE6A 4XVUC 2UWEB 1MHCA 3GSVA 5KTEL 4H0IA 3RTQB 3THML 2VN4A 3NACL 1NMBH 3IDXL 5E4IA 3LIZL 4JG0H 3TT3L 2C3GA 1V5JA 1JNLL 4ISVB 3KPSB 5A2IH 2D9CA 3X3FL 1PX4A 2J2ZA 3RVWC 4HGKC 4GMTL 4MB3A 5JIPA 3CFKA 4UDTB 3R06B 5I0ZA 3LS5L 1CE1H 5KN5A 4OZIB 4ZXBC 1YYLL 3CSYB 3NPSC 3NGBC 5I15L 4LEOA 2O5YH 1RUKL 4PJ9B 3RI5F 1WJ3A 4Z6AT 5D5MA 3BH9B 4N9GA 4Y5XC 1YN6B 5E94B 2PETA 5D1ZB 1VCAA 3G5ZB 2BVQA 1D9KD 1KENL 3KYOB 1HWGB 5CLWA 2QR0B 3RKDD 4UDUA 1T3FB 3GMOB 1I3VA 4Q97A 1YDPA 2NY5H 5INCA 4QOKD 5MHSE 2R0KH 3RWEA 2XKUA 5HBBA 3GSNL 3EO0B 1UZ8B 4PGDA 3PUCA 1SBSH 2R2HA 2H1PL 3UAJD 1U8HB 4MXVF 3U48A 1RZGB 2CIIB 2D7TL 3MYZA 3KS0J 1QSFE 4G42A 2XA3A 3LRSB 5KTEH 3UEZA 3HKFA 5C6TL 1FG2A 2PUQT 4MB5A 1OLZA 5D5MF 2ZCKH 3NACH 4TUKL 3LIZH 5CBEA 4FG6C 1LMKA 1I8LA 2EDBA 3TT3H 3RL1A 4LPXA 4MLIA 4IRJD 1JNLH 4U6YA 1JMZA 2D9QB 3X3FH 1KJ2A 1IEBB 3JVGC 3MOAL 3HE7D 4GMTH 5GSVB 1ZLVH 4X6BA 3LS5H 4JFFE 1YYLH 2BHUA 2BNQE 5I15H 4OAWB 4X4XB 1BOYA 1RUKH 4W70A 5IB3B 5FM5O 2AJXL 3RIAF 5I1IL 2MKLC 3BKJL 5DUMH 5JA8B 3LKQA 2CRMA 4I2XB 4XNMB 2ERJC 3VDBA 4R0LC 4WW1A 3CFJA 5C8JA 1EEYB 3EO9L 3O11A 2HG5A 3ROOB 3DROB 2NXZC 3PGCA 3VFTA 1KENH 2H26B 4MJIB 5HHPB 1J7VR 5C08A 2RGSA 2X4RB 3BDYL 3BZEA 3GSNH 1T20B 5F97E 3BMVA 1KF9B 2H1PH 3VG9C 4PRIE 1ZEAL 4JR9L 1QUNA 5FGCE 1CK0L 2D7TH 2PXYC 4G43A 4DZ8B 2BSSB 4NQEB 1FH5L 5FIEA 2ITDA 2R1XA 5FM4A 5C6TH 1KG0A 1A7OL 1R6VA 3B5TA 4GG8B 4TUKH 4P46C 2Y36L 3QIWD 4KKLC 4XPFL 4M7JL 5FYLL 4JN2A 5H2BB 5MEQA 2VAAB 2QADD 3LPGA 4HKXB 1F6AA 1H8NA 3QUYC 4GAFB 5HGHB 2FCBA 3MOAH 2YR3A 2ADJA 5FB8B 3OX8B 4IRSC 3F12A 4LSUL 5BRZA 4F8QA 2Q3ZA 4K8RD 4FTVB 4NQCD 4FFWD 4XPGL 2FX7L 4GS7B 2AJXH 5C0BA 5I1IH 3BKJH 2DMBA 2X1OA 5DRZB 1FIEA 1EAPA 4OGZA 1AXTL 5CWSB 5DQDL 3MO1B 3QULA 3UCRA 1A6AA 2X9XA 1IZKA 3FO9B 3O9WB 4RMTA 3SQOL 3EO9H 5I76B 1A1MA 1XF2A 2AQ3A 3IJSB 1LE5A 3QG7L 4I4WB 5F1IA 3G9AB 3VCLB 3QSKB 4BQBA 3BDYH 4R4FH 3NCCB 5J11B 3MGAA 4EI5A 1EVTC 3PE9A 4XC3L 1INEL 2MCPL 1I8KB 4KK9D 2O5XL 4JR9H 2MJWA 4QKXB 3DLQR 3QUXB 4LCCC 1WBXA 4UOJA 1U8JB 1CK0H 1MSPA 4MNHA 4QRUB 4BYHA 4U1IA 3BKML 3BISA 1FH5H 1FC2D 3KAAA 2AK4E 1A7OH 4XVTL 3PDOB 3MRGA 2VTFA 2Y36H 2F74B 4XPFH 4M7JH 5FYLH 5HHNA 3O8XC 3GGWB 2VRAA 5LAXA 2OZ4A 1I4FA 1V8HA 2BRRL 4L8SB 4AMKL 1NMAL 3FO1A 4LSUH 3VI4E 4ZG1A 4L1HA 4GXUM 2SEBB 4E42A 1BZ7A 4EN3C 2FX7H 4RGNB 2VJXA 1WC7A 2YSSB 2VAJA 3QPXL 1AXTH 1RIHL 4JFZL 4K71C 25C8L 4G9FB 4WI5A 3SQOH 1ZT1B 4YDVA 1NFDA 3QG7H 4F15B 5IFJA 1GC1L 2ZCHL 4P46A 2RIKA 4IMLB 3BSZL 2YA1A 3MRLB 1JN6B 4N8VA 1A14L 3ARFD 4CDHA 5IMKB 1HEZA 1A6ZA 4NO0B 3QRFM 1FNGA 4YHNA 1A7NL 3CCHA 4KKBD 4Y4KD 2ZG3A 3CVIL 4RNRB 5HGAB 4XC3H 5FO8A 4ZNEE 2HFFA 1INEH 3ZL4L 2MCPH 4LGSB 4YH6A 1HHGB 4IRSA 2O5XH 4APQB 5CD5C 3OWEA 1BP3B 1C12B 1CG9A 3EOAB 4HHAA 2BOCB 4ETQA 3BKMH 4PJEE 4W6WB 1XGUA 3MV8D 2HVKA 4J3VA 4XVTH 2GUOB 5DRXA 5ESVA 4FS0A 3T2QA 2Q7NA 5ESQA 1N4XL 2I9LB 1HSAA 4G80A 2V2TA 3OKOA 1XZ0A 3D39E 1RJYB 1RUAL 3AMLA 2X70B 5FV2A 4J8RA 1NEZA 2YD7A 2BRRH 3INUL 3X13B 4AMKH 4F7CB 4JANB 3P3YA 1NMAH 4M3KB 2OJEB 1KCUL 5I66B 1KJ2L 5DVNA 3HG1D 2AGJH 1I1FB 1U95B 1MCCA 1MIML 4Y2DA 3QPXH 4JFZH 1RIHH 1JV5B 4PGJA 1CFSB 1JF1A 5K9QI 25C8H 3X12A 4G6FB 3DI3B 3FQUA 2QTEA 2YKLL 4JEGB 1PY9A 1GC1H 2W92A 3IJYA 4DJMA 2ZCHH 5C07D 4ONFL 2UZXB 3BSZH 1Q9WB 3I6KB 1AFVL 4GBXC 4NOBA 5T1KD 5BZDB 1A14H 4JKKA 5SWSA 4MNGB 1MJ8L 3VGBA 3GMNB 1I85C 3ARTA 1A7NH 2FBOJ 3UYOD 3PHOB 1NKOA 3CVIH 5DJ8A 5I30L 1GGIL 1NDGB 5KS9E 2EIZB 3ZL4H 2ZSVB 4K7PL 4U1KA 5DA0B 5D7JD 4WDIB 5HDLA 3AAZA 4ZO7A 3KWWA 4NQDA 5B4MD 4EN3A 1AR1D 1DQTA 1SJEB 5HHOE 3R0NA 3T0EA 1G7JB 4OZHE 1N4XH 4ZAKB 3HZYB 3A6CL 3MREA 5BV7B 4DKFL 4HCRA 1U2HA 2CXKA 1RUAH 4HZLB 4OFKA 2VLJE 3TN0D 4Y4FC 3SOBH 1DQLL 3E3QC 1SMOA 1NEUA 2ICWJ 1CWVA 1TJIL 1U8IA 3DMMD 3PWJB 4NUJA 5D4QA 4L3AA 3VFWA 3INUH 2WWKO 4RFOL 1KCUH 3ARGB 4EJ1C 1VEPA 2LU7A 2V2XA 1J0YA 3ARZA 3KPMA 1MQKL 5B38B 5DK0A 1G7QA 3SGEI 1MIMH 4BFIA 3UJJL 4AENA 3VRJA 5JMRA 3RIFK 3MBED 4PJGB 2X44D 1N8ZA 3TJEH 4PRHA 1CR9L 5HGGS 2YKLH 1OP3H 2BSTA 3NMEA 2XWBB 1P7QA 4L4VD 4ONFH 1Y18A 1AFVH 1OTUD 5F7FA 3UTOA 2BNUB 1A3QA 1MJ8H 4UIKL 4DZBA 1OLLA 2DTML 1CDCA 4O51A 5I30H 5HHXL 1JGDB 1GGIH 2HT4D 4K7PH 1A6TA 2WZPD 4AZ8A 3KLAB 3BEVA 3UPRB 5TF0A 4H1LB 3JXAA 1AHWC 2AJ3A 1QG3A 1I3UA 3BGMB 3PIQB 1GJIA 5I16B 3NFPB 5HVFB 5GS0C 1CD9B 3KYAA 3R1GL 1UXWB 2X4UB 3GI9H 5BXFA 3VXUE 5I0DA 2OTWA 3MNZB 5FDWB 5BVPL 3A6CH 3F6LA 4DKFH 5E5MB 1Q1JL 3UTSD 5DZNA 3FOMA 1Z5LA 1BBDL 5DEGA 1MCKA 3GNML 1W0VB 1DQLH 5KVFH 3MLVL 1TJIH 4H5SA 5DJ6A 4RFOH 1ZHNB 3WNKA 2OZ4L 4WU7B 1WWCA 1YPZA 4R97C 2CLRB 2BCKB 2MQ0A 1MQKH 3VXQA 4HIHA 2WSKA 1QQDA 1N64L 3UJJH 1YY8A 3PWPA 3DIFA 1P1ZA 2XRAL 4K07A 1JP5A 2EDJA 1SQ2N 1NCTA 4PJ5D 1I9IL 1CR9H 4I3SL 2OMBA 5C0CB 3S35X 5JHDD 5DS8A 4HV8B 4JRXD 1VFBA 1HSBB 3S36X 4QRSB 3QI9B 3EYSL 1T83A 1T21B 3SKOA 3D9AL 5ESAA 4Y4FA 5HHXH 5EO0B 4LGPB 3QRGH 3IF1B 5ITBH 1YN7B 4PB0H 2OR8A 2AV1A 2Y6SC 3CFBB 1CQKA 4WWKA 2NTFA 1YPZF 1T04B 4UUJA 1EEUA 4WI3A 2HMIC 3K81A 5KSVA 4PLJD 3R1GH 4XTRC 4WI4A 2HRLA 2VE6A 2P24A 4NPYB 3EJYC 1ZT7A 1K85A 5L6YL 2RFXA 3MLSL 3H3PH 5BVPH 1CT8A 5JO5B 4EOWL 3MRHA 1Q1JH 3VXRD 1X5ZA 3IAQA 1BBDH 3GNMH 2X6MA 2QSVA 2LTQC 3MLVH 4P2CG 2ZNXA 3NIGF 1RVFL 3ISWA 2HJLA 2HVJB 1G7MA 2OZ4H 4N8CL 5D2LB 1FZJB 4KZDL 3QHTC 1TVHB 3F7YA 1CCZA 5EBLA 3P4NB 2CUMA 2X42A 1ZHLB 2XRAH 3G5XB 1OW0C 5HYQA 2F53E 4Y16B 5I1KL 1JHTB 2GSGA 1I9IH 4I3SH 1NC2B 2V9RA 5D1XD 3X17A 1KXQE 3L1OH 2FEDD 3ZKXB 5EFIA 3EYSH 5A2LH 2I27N 4NCC2 4PY7A 1F3RB 2XPGA 2WBKA 3LQZB 3TBVA 2VZVA 3L5WA 4RMUA 3FZUD 1J0HA 4JJ5B 4X6FB 3PDGA 4JJHA 3ARQA 5LG1A 5FO7A 1A1OA 3DO3A 3QEQD 1OAUH 1INQA 2E6PA 4UAOC 3ZYZA 1YYML 2E6JA 5L6YH 2CSPA 4RZCB 4EOWH 2EEAA 3MRDA 4WO4D 4JFEA 2VLKE 3I50H 5EZJB 4NHUA 4U2ZA 3VFMA 3QG6A 3HPLA 4F37K 2Z35A 2JELL 4QRPD 4KZDH 1KULA 1S9XA 2UUDK 3VXPA 2E7LA 2HWZH 3TVMD 3H0TB 4ZSOE 1YMHA 2OL3B 1I3RA 1HHIB 3GSOA 1MCHA 1MCFA 5I1KH 4GG6A 3LH2L 1EFXB 4PIRF 1GGYA 5ALCL 4POZC 4FQXA 5CEYB 3WO3B 4JO2L 4JZNA 5HHMD 4CL7A 1KLGB 4JHWL 3FFCE 1QRKA 3T1FB 1HINL 4TSCL 4NRZA 4CVXB 1TQBB 2DQFB 3ZE1E 2PKDA 3C6LC 4IJ3B 4UQ2A 1F58L 1N5AB 2IAMD 1Q8MA 4RMSA 5GRVK 2QSQA 5AG9A 1BGXH 3BD5A 3BJLA 1YYMH 4MCYA 1P4IH 5F6IC 1S5HA 3VGDA 1AO7A 3SDAA 4GG6F 5DVMA 4ERSL 3EOBB 2Y23A 4U1NA 1AD0A 3GMLA 3MACL 3PQYA 2D4FA 5DC0A 5C09B 4LFHG 4JFDB 5GS1B 4DKDC 2JELH 3MLYH 1P7KB 3G6AA 5IBLC 1K4DB 2NX5A 2W9EL 1JZ7A 3P4OB 3LD8C 4PRPA 5J1SC 3QHZL 2OTUA 3KLDA 4BKLB 3BP7B 1JGUH 3DBXB 4HKJB 1S7XB 2YD5A 3LH2H 4HZAA 2D4DA 3RDTD 5J1TC 3D3VA 2YBRB 3QDJB 5J8OA 1QRNE 1D5XA 3VXNB 3SQBA 3TCLA 4NKQB 2ORBH 4JO2H 1FFOB 3W0WE 4JHWH 1NBYA 2C1PA 1HINH 4TSCH 3CZJA 4JVPA 4HWUA 5DQJA 5EZIL 2NTSP 1SEQL 5IMLB 2VDKL 2JCCE 3IKCA 4LVNC 3UO1L 3C9NA 1FO0B 5EUKA 1F58H 3HTLX 3FO0L 3OF6D 3LKRA 1EA9C 3RPIB 1CDGA 1H8SA 3U82B 5DRWA 1NUFA 4PJFA 1IKNA 5T1LA 2VXTH 4U1HA 1O7VA 3SCMD 2YRZA 1D5ZA 4ERSH 4CJ1A 1CXEA 1LK2A 2GKIA 1UKSA 1B0GA 2IQ9L 5I1JL 3KPRE 4XBGB 3KPTA 4RRPG 3GSWB 3VI3F 1ZVHA 4HBCL 3TZVD 1U6AL 2IANB 2ICWB 1JIBA 2EIDA 4L9LB 2Q7YB 3GHBL 5A43C 4ETYA 1BJ1H 4Z7OF 4OKVB 3MV7D 1MWAA 2Z9TA 2W9EH 3OJVC 5D2NA 3LB6D 1XGPB 3QHZH 4POUB 5HPMB 5T3ZH 5HI5D 1AC0A 4LHUA 1IGTA 2IWGA 4MS8D 5C0EA 1J1OL 3BZ4A 2PF6A 3GMMA 1YMME 2HT2D 1Z6JT 4JM2B 3SKJL 1XIWB 3FOLA 4PG9A 1KN2H 2HFEA 1FL6A 3ES6A 5GS0L 1AH1A 1GVIA 1KCRL 2E27L 2YA2A 3VFRB 4YBLC 1LEKB 5CGYD 4Z78B 2AXGA 5EZIH 4F7PB 1K8DA 1SEQH 3PV6B 5CINL 4G8GA 3O2DA 3UO1H 2OSLA 1EEQA 1D9KC 3FO0H 4KTEL 4X9BA 3RKDC 1OSZB 1G6RB 1R3KA 2PNDA 4ODXB 3QFJD 3ULUD 4PV8A 3DGCR 4E0RB 5JLZB 4BQ9A 1DQQA 1T1YA 2Z8VC 1UH3A 2HJKB 2CLVB 1T4KA 3UAJC 5C3TA 2EZ0D 3FN0L 3GSQB 2IQ9H 4XZUB 5I1JH 3WIHL 5DD0L 5JPNA 2G60H 2IPUG 4CU7A 4HBCH 4Z0XA 3TYGH 4L8CB 3QBTB 1U8NA 2BNRD 3QDGB 1HWHB 4MVBD 3GHBH 3WS3B 3C09B 3GSUB 2CKNA 4C56E 1FSKB 4JZJA 3RZCD 1F3JA 1FL5A 4IRJC 5T3XE 4JAMB 1D5BB 2ICWI 1J1OH 2R1YA 3HE7C 2XICA 1AP2A 3SKJH 4MNQD 5IVXB 5J1AB 3RA7H 5GS0H 1KCRH 2E27H 2B7DT 1NCBL 5DJCB 4NIKB 3QQNA 4LSRL 3TF7C 2YMXL 3O0RH 4WFFE 2NMSA 3VW3L 4P2RE 2FR4B 3FHQA 5EPMA 4XPHL 4NZDA 4WEBL 3KXFD 1HXMA 5DVLA 4UZGA 5IESL 2ENYA 3BHBA 1D5MB 4B41A 4OV5B 3D2UB 4QRTB 4UQ3A 4WUUA 2IFGA 1X6LA 3FFDA 4H0GA 4D0CA 3G5YA 3UBXG 1MI5E 1IL1B 4UTBL 4WI9A 2G5BA 1U8QB 3NBNA 1WWBX 1YNTA 4HJ0D 3QO1B 3N9GL 4Y19D 4L3EA 5EOCJ 1OM3H 3BE1L 3V7AE 1HHHB 3VFVB 1QSEB 1BOGA 4IHOA 1QLRB 3MFFB 1F00I 4WNQB 3WIHH 1OGTB 5DD0H 3IDNA 3V52L 5CJQL 3MJ7A 4OIBA 1IAKB 3VWJB 2J7LA 1YEHL 5DURB 4BELD 4LKXB 2FJHB 2VZTA 3QIWC 1UACL 3FONB 4ESKA 4MMZC 1UJ3C 4QHNB 4NO3B 2QADC 3EJJX 5GZOD 4GUPB 1DVFB 4P5MA 1PGRB 2IEPA 3HUJA 2JJTA 3P9WB 3KYMB 2DLHA 4K8RC 5CEZD 4LVHC 5E2JA 4FFWC 4J6RL 1NCBH 4JREB 3WDIA 4NBZB 4X6DF 1JPTL 1NC4A 4LSRH 1DQJA 3FQNA 3NPZB 4HF5L 3WE6A 3VW3H 1Z2KA 4HWBA 5SV3A 2HYMA 4XPHH 4WEBH 4XCYB 5KSBE 3KPLB 4QCIA 5KSUA 1A6VL 2R0ZL 4NM8L 1ETZA 2EDHA 1B3JA 4XB8A 5E1AB 4C58B 1DDHB 2IBGA 3IFOB 2XN9A 1WCBA 5I1AB 2FEEI 3SGKA 3TO4A 5EUOE 5GS2H 4BZ1L 3MUGB 3QA3B 1P4BL 1ULVA 4UTBH 1N59A 4YHKH 4XPTL 5DHVB 3VXOA 1FZKA 3N9GH 4HLJA 3BE1H 4XHJC 5KVEL 4KK9C 4PJXE 3HUJF 4JLRA 4NC1C 3V52H 3GMRB 5CJQH 4GMSL 3HZMB 5J12B 4D94A 1ZHBA 2AI0L 1W8NA 1YEFL 4PGZA 1YEHH 2H2SD 5MENA 1M7DB 1MCEA 3JV4B 1UACH 3QXDB 5C0GA 4E41B 4BQ8A 4LMQE 2COQA 1MWAL 3OHXB 4NQVB 4TSBL 4XP4L 3OGCB 4J3UA 1CD0A 2QSCL 4M62L 1XGQB 3IETA 4OQTA 3LOWA 5HY9A 4J6RH 2X40A 1JPTH 1UB5B 5CP7A 3MZGB 4Q9RH 1T5XA 4HF5H 4U49A 3SE3A 1ZT4B 3T0BA 1SBBA 3T4YA 5EU6A 4F33A 4P4KB 4LASL 2V7HB 1S7SA 1IAIL 1A6VH 2R0ZH 4JHZA 4NM8H 1YZZA 5D8JL 3ZT5A 4M7ZB 4XAWL 4YHLL 5C70A 4NQXA 3L3DB 3O2DL 4GKSB 5A2JH 3ARFC 5IQ7L 5AWNL 4BZ1H 4N0FA 1EEZB 1I7UB 4KKBC 1P4BH 4Y4KC 3K80A 4XPTH 2C3VA 1CICB 5CEXA 5KVEH 2V5RA 1L9MA 4ZFZB 4LCYB 3U83A 3O6FB 4GMSH 5JTWA 2AI0H 1T0NA 3ZKND 1YEFH 2F8VA 1DBBL 2A83B 1KIUA 1WZ1H 1BQHA 2DI7A 1MFBL 4BK4A 2A38A 4L9DA 1AGEA 1MWAH 4X5WB 4TSBH 5IVNA 3V9FA 3JTTB 1D6VL 1HOCA 1X5AA 2QSCH 4M62H 1UWGL 2WQ8A 4ODSH 3B2VL 5EU7E 4YDJB 5DRNB 3BRFA 1OT2A 4GW5A 3LEVL 2BP3A 2FWOB 2GJZB 2Z31A 5IJVA 4PG2A 5E8EB 1T0MA 1K3ZA 1WBZA 2PW1A 3QDMD 2RQ8A 5BJTA 2FSEA 3TM6A 5CGTA 4PJ7B 4LASH 3LSOA 1QD0A 4P49A 1IAIH 4RX4A 5F44A 5D8JH 5HYSA 5SV4A 3RWCA 2GHWB 4YHLH 1N6QL 5IQ7H 3ZYIA 5AWNH 5F72S 5BQ7A 12E8L 1KIPA 1KPVB 2DMKA 2CIKB 3D85D 2NY2C 4QRQB 5KJRL 1HHKA 5B8CA 1TPXC 4ZO6A 5EULV 5D7JC 2O61A 5B4MC 5EIQA 4EUPA 1AR1C 4N68A 4FQPA 1B0RA 2XV6B 3DVFA 5SWZE 1DBBH 4S2SA 2A77L 4QO1A 2NW3A 1MFBH 3STZA 3AREA 4YJZL 3TT1L 3EYFB 2R39A 3TN0C 5C0JB 5CILL 5L2JA 5E5UB 4U31A 3RWHA 1A3RL 3DMMC 1QEWA 1D6VH 4LLQB 3L95B 5IB5B 3B2VH 5AAMA 2X4PB 1XEDA 1VACA 1N6VA 3LEVH 2OMNA 3TIDB 5F89B 2ZWLT 4M8VA 3DUUB 1GIGL 3RNQB 4M93B 5IBUG 2DQCL 4JPKL 3MBEC 4JGMA 1NGXA 4KMLB 2OI9C 5TQ0L 5ICXA 1LE9B 4HWBL 3MV9A 2YPLB 3N1FC 3PGFL 2BXYA 1OTUC 1N6QH 1G9MC 1NANI 4HH9B 1Z9MA 5D7IE 3CX5J 3WHXB 3O3AB 5EC2A 2IPKA 5D7KD 3IVKA 12E8H 2C7UB 4NCDA 1S9KC 3LKSB 5KJRH 2HT4C 1S7UA 4HKBB 1U91B 4JRWA 4CN4A 3V95A 1D6EB 1HE7A 4BH8A 5C92A 3KLHD 3F7VA 4WHTB 5ISZB 2IBBA 4UMGA 1J8HE 4ZFGH 1F11A 1R5WB 4XVSL 4HFWA 4U1MB 1KBGL 2DQGL 4R2GD 5CZVL 3O6LL 2A77H 3T3PE 1NGWA 3NCEB 3F6IA 5KSAB 5F1KC 3VFNA 4R7NA 1FZMB 1YEDB 5DDHA 1JFQL 3I75B 5I1CL 4FFVD 2BVPB 3VD7A 3BPOC 4OQTL 3RNKB 4CVZB 1F2QA 3HMXA 5C6PB 5C7XL 1GIGH 4WJ5A 5IHZA 4JDZA 1MREH 2DQCH 3QZWB 5JW3L 1DSFH 4JPKH 5GGTA 3C87A 1FVDA 2DM7A 3D25A 4YFLF 3GB7B 1IMHC 5TQ0H 4JQVA 4HWBH 1RQ5A 3H9HB 5IV2B 1QFUL 4YO0B 3PGFH 4N0CC 2Q76B 2ARJB 4F7MA 2VQ1A 1KYOJ 1IT9L 1AGBA 2CDGA 1WIUA 1RU9H 3FN9A 4KI5C 1CFQA 2YN5A 3HZVB 1NFIB 3P11H 4JFPA 1GXEA 1KJVA 2UV3A 2VYRE 2X1PA 3MRIA 1SYSA 3V0AC 3GMPB 3OKDB 1MCLA 3CIQA 3LY6A 5FYJE 4PLJC 3O4LB 5AD0B 2UWEE 1O5DT 5HGDB 4XVSH 1R5VB 2MKWA 5EN2B 1KBGH 2DQGH 5GGSY 5CZVH 4KFZC 5F1NB 3SO3C 3O6LH 1KPRB 4TUJA 4ZO9A 1KLUA 2CMRL 5FDYA 5I75C 2X4TA 4V1DD 3KR3H 4BZ2L 1QSFA 1FNSL 1XR9A 2APWA 1RSFA 3QO0B 4AH2B 4M6NL 3HI5L 3ROLB 4WI6A 1JFQH 5E9DE 5I1CH 5C0IA 1CFTB 1FL3A 4OQTH 3R0MA 5E7BA 2IMMA 4FFYL 5C7XH 3ZDYE 3AM8A 3NCJH 2A0LD 5JW3H 4LQ1A 4OD1L 4HUKB 3NH7L 1X4XA 4I3RH 4JFFA 4UBDD 1ZHKA 4D3CL 2BNQA 5JDSB 3QXVA 2XNAB 2HLFD 1QFUH 4ODTL 5E8DL 1RULL 3SGDH 2FEDC 4F7TB 3NZ8A 1IT9H 5IF0A 4Q9QL 1WQVT 5DD6B 2ADGA 4BSJA 4DEPC 5DMKB 2JIXB 4OF0A 4X7TB 2EKSA 5C0AD 4NCC1 3DV6B 5TDNB 1T1WA 3FZUC 3ARPA 5DD1L 4LPYA 1U93A 1IC5L 4MD4B 5I1DB 5DMGC 4LCIL 3C60B 1EXUB 2EYTA 4P4RA 1BQSA 3I6LE 4ORZC 3PP4L 1H0DA 1T22B 4UOW1 4E9LA 5K9QG 2WV3A 1HILA 2CMRH 4LLWB 4LDOB 5FHAL 4KRNA 4PRIA 4J3SA 2HLAA 1EJ6A 4G8FB 4BZ2H 2C1OA 4AEEA 1FNSH 4WO4C 2J8UF 2EDOA 1IM3A 3SKNB 4BQCA 1Q72L 3HI5H 5CCKL 2P5WE 4UOW0 4M5ZL 4Z7UE 1HH6B 4FFYH 3TVMC 3LZFL 1MLBA 3WNPA 1LO5A 1FCCA 3C8KA 4K7FA 4S1RL 4OD1H 4XXDB 2WM0A 3NH7H 3BXNB 2ZCLH 4D3CH 2B1AH 3HPJB 3LN5B 3SDXF 4ODTH 5E8DH 1RULH 2W0FB 3CH1B 1PG7X 3U0TB 4Q9QH 1OCWL 1UVQA 1MHHB 4MSWA 2MPAL 2A73B 1M6OA 1ZLWK 4I5BA 4O2EB 5HYJD 2D0FA 5DD1H 4HAFA 1FNLA 3K3QA 5E8OB 1IC5H 4Q9CA 5F7DB 1WTLA 2P8LA 3QIUA 4MXWH 4XCCL 2IAMC 3SJVE 3REVA 1GGUA 5E8NB 3PP4H 1BVZA 2R29L 1KT2A 5D7LE 3QXWA 5DEFB 3H9ZA 3QPQD 2XYCA 5GRYA 1PQZB 5FHAH 4XMKL 2LABA 3L7FB 1JGEB 2J88L 5D9SB 1IM9B 2AK4A 2GK0A 3T0DA 1DLHA 5MEPB 1XGYH 1YEGL 2QV2A 1Q72H 5EIIB 2VL5B 1T7YA 1G7LB 4LVHB 5CCKH 2GJ6D 1WFUA 4FZ8L 3VFUA 5CJ8A 4NN7B 1QOKA 4Z7WE 3V6BR 4HWZB 4I13B 4M5ZH 1QVOB 1WTGT 1NBZA 1I1AB 5FYKD 1CD8A 2AV7A 4LLYA 4AL8L 4S1RH 5GISH 2DLFH 4Z5RA 4LDLB 2K3TA 5I1GL 4FRWA 2FLBT 1JWMA 5GGTL 3RDTC 1CGXA 4Q6IB 1NAMB 3GJFB 4FXLA 1ND0A 5ABDE 5A1AA 4OIIL 3T77A 1Z9OA 3AS1A 5T5NG 3RJDA 3WN5B 2MPAH 4MJ5B 1BVLB 1UG9A 2F54D 4MD5A 4OZGB 5GGUA 5EO9B 5IWLA 1BZ9A 3FRUA 1PKQE 3MLXL 1BD2D 2K7PA 4XCCH 5GS3A 5F7UA 2R29H 3E6FB 3DO7B 2XT1B 4NFBA 4ZNEA 2VLRB 4I0PD 1W0WB 1CBVL 3HLAB 4IOIB 2NY6B 4JGJA 4KDTA 4U2YA 4YEEA 5IOPA 5B38G 4XMKH 1G0DA 3VI4F 3VXTB 3SCMC 3VWKB 1CD1A 2EDRA 4PJEA 3L9RA 4OLVL 1OGAE 1YEGH 4J4PA 3TH4T 5TGBB 3TZVC 3KYKL 3MRMB 3HAEA 4FZ8H 3I3BA 4LPCA 4FQCL 3G08A 1G9ML 2W65A 3PL6D 3D39A 4NKMB 1MCJA 1KPUB 3HRZA 3HR6A 3LB6C 1ZVYA 4GRLD 3HE6B 1R3LA 2EYRA 4AL8H 1U3YA 1OARL 5HI5C 3GSVB 5I1GH 4MS8C 4KJYA 2HT2C 5GGTH 1SM3L 4MXQD 5ETUA 2DQJL 2Y5TA 4H1LG 2IPUK 3GKWL 2Y07L 4KQ4L 5DQ9A 1A8JH 1X3DA 1JI2A 5TDOA 2XOTA 1TQCC 4Y1AE 4EI6A 2MMXA 4GAGL 5CGYC 1E28A 1AD9A 5KN5B 2CDEA 1U3HA 4W6XB 1RZFL 5GRVL 3MLXH 4L4JA 4LEOB 4D0BA 4XPAL 3T2OA 3HNTL 3LQAC 4KPHL 5D5MB 4QRRE 3ULUC 4N9GB 2KH2B 5FUOH 4P3CL 3HC0A 4X6CE 5D1QC 3VXME 5KS9A 1A7QL 1CBVH 3ARDA 4NKDA 4TN9A 3WNOA 5IVZA 4EIGB 4PUBL 4DN3H 5ENWA 4KY1H 2EZ0C 3TYFA 1VHPA 3OJMB 2YD1A 4OLVH 3PP3K 5IK3A 4UDUB 2YC1A 3BPNB 1EBAA 1YDPB 1H3PL 5INCB 3V6ZA 3CMOL 3LDBB 3KYKH 3RWEB 2UUDH 4OZHA 1OAKL 5F1SA 3ARSA 4FQCH 4KJPD 1G9MH 3H9SD 4OLZL 1U92A 2VLJA 4DWHA 2GTWB 3RZCC 3B5GA 3NIDE 1OARH 4G42B 1S78D 3RRQA 1FG2B 1H5BC 1I1CA 3MRPA 5KS9F 3GKWH 1HI6A 4K7PY 2Y07H 4KQ4H 4LCWE 4NZTL 5T1KB 3RL1B 3RTQD 1BJ1J 2APTA 4U6YB 2PO6A 1KJ2B 4LAJH 2X7LA 4GAGH 1Z9LA 4X6BB 4XMLL 2VERN 1J05A 1QFPA 3NA9L 1RZFH 3KPSD 3CC5A 1VSCA 4BFEA 4OZHF 2H9GA 1FRGH 5B3NA 3HNTH 4KPHH 5IW6A 3LKQB 4P3CH 3B6SA 3ILPA 5D96B 4WW1B 1A7QH 2JJSA 1NUGA 3CFJB 5C8JB 3ARRA 3FT3A 4PJ9D 1FPTH 1LP9E 3O11B 5IIEA 4MWFA 3RWDA 4HJ0C 2X09A 4PUBH 3PGCB 1HKLH 2FYYA 3DTXA 1WZLA 3D69B 5D1ZD 3DSFL 5C08B 1H3PH 5ALBL 4XP1L 3BZEB 3CMOH 5GGRB 4D9QE 1CDIA 3VXUA 3TPKA 2EDEA 2R0WH 2V2WB 5K9OA 1OB1A 4MAYA 4LRIC 4MA3A 4OLZH 4NDMA 1MFDL 4OIAA 2FHCA 3HS0A 3L7EA 4G43B 1XH3A 3QQ4A 5E2VL 3ZKQD 5GZOC 1J5OL 3EZJB 2R1XB 2RJMA 2M2DA 5GSRA 2AP2A 1FHGA 3BRGC 5D1QA 1LQSR 4JN2B 4DGIL 4NZTH 1CU4L 2O5ZL 3ZSTA 5E2UL 4CMHC 1FLTX 1QFWM 2GI7A 1F6AB 4A6YL 2ADJB 5ID1A 4OJFL 4XMLH 1RUML 1G7PB 3DJ9A 3F12B 5BRZB 5CSZA 4MDJB 4X80L 3F65A 2Q6WA 3O81A 1Z9SA 3EYQC 5DZLA 2IGFL 4KK5D 3QULB 2ZSWA 1KB5A 1A6AB 2WIIB 2I26N 1GGBL 5ITFB 4RDQG 4IM8A 1A1MB 1XF2B 1X5IA 3V4UL 1EPFA 1LE5B 1PKOA 1RHHA 4QGYA 5F1IB 3L5IA 5LVEA 4YIQA 4Z95L 5ALBH 4XP1H 4TUOA 4MJ6A 3P0YL 4EI5B 4LU5H 4MJID 2H2SC 4XWOD 1HQ4A 3O6ML 1JWSB 4O9HH 1MFDH 2W0PA 1C5BL 1WBXB 4MNHB 4JRYE 4U1IB 1GAFH 5E2VH 3RWFA 3SKMB 3V5KA 1UKTA 3W39A 5JOPE 3MRGB 2GQHA 5C3LD 1UQSB 4XNUL 5A3ID 4LARL 4Z7VE 4WFED 1CU4H 5HHNB 2O5ZH 3FMGH 4A6YH 5LAXB 1WISA 3DRQA 1I4FB 4PV9A 4OJFH 1RUMH 5C0DB 3Q6GL 3FO1B 4F3FA 4LLMA 4LP5A 4X80H 4E42B 1BZ7B 4WI7A 1UM5L 1NQBA 2VQTA 1VGKA 1WIOA 3MRBA 2IH3A 3L3GA 4LRIA 2IGFH 4K7PX 1CFBA 4FTVD 2DDQH 2IMNA 1GZQA 1GGBH 3BIAX 2YN3A 1C1EH 4F57L 5GQBA 3V4UH 3U30C 5IFJB 3AY4C 3N0PB 3O9WD 4Z95H 4N8VB 3RZWA 5E00A 3RVUD 1FNGB 1F6FB 2XY2A 4QEGA 4YHNB 3CCHB 3ZKNC 1FNHA 4MYWB 5FO8B 2G5RA 2HFFB 3O6MH 1MCWM 1NGYB 3LPWA 1C5BH 4JFHE 1CIDA 2DS4A 2VLKA 2CDFB 2P8MA 1CG9B 4HHAB 4ETQB 1KJMA 3NVQA 1XGUB 3QUML 3BN3B 2HVKB 4Y4HC 1KIQA 4RQQA 1B4RA 4LSDA 1HHJB 3CDGA 5D1XB 3QUXD 5DRXB 5KW9H 5ESVB 4XNUH 3RFZC 1EO5A 4LARH 3MRJA 4G80B 5IJKA 1IGJA 5M7QA 2V2TB 4GLRH 4ZSOA 4PJCE 4Q2ZA 4J8RB 3F7PC 1NEZB 5HHOD 5C0BE 3Q6GH 4HGMA 1UM5H 4HMDA 1FYTE 3WNNA 3FKUS 3MV01 1OVZA 5AUMA 3FN3A 3FFCA 4Y2DB 3O2WL 3V8CA 2V5MA 2EH8L 5DI8B 4LSTL 3G6JE 1VKXA 1G84A 3X12B 4F57H 3BW9A 4RGND 1BWMA 1A7PL 5D93C 3RGHA 3ARBC 2W1NA 3A0OA 3HC4L 4M7LT 2GY5A 1HCFX 2EH7L 4NQSA 4G9FD 2VXQL 4B50A 3KG5A 3MLTA 2YPKA 5SWSB 4X8JA 4YZFE 2APVA 5DJ8B 5I1LA 2L7JA 3OXSA 1S7WA 2DAVA 5HDOA 4TVPD 4DVBA 2EEDA 4U1KB 4NO0D 2FHBA 5IHUL 4O2CA 3AAZB 5FGSA 2GITA 1D7FA 2OX5A 5FYKU 4NQDB 3CLFL 3QUMH 3SY0B 3RKPA 2GYSA 3T0EB 3BKCL 5JOFA 1CDBA 4MCZA 4RBPK 3KDMA 1LO4L 1VFAA 5FOBA 1O7SA 4Q0XH 3LQAL 2XTJC 5F93C 5LKNA 3EGSA 3BD4A 1U8IB 2YZ8A 4LGRB 2EKJA 4ORGA 1AKJA 43C9B 2DB8A 5JPMA 2V2XB 3KPMB 1OWRM 2P5EE 5DK0B 4JO3L 3QIBA 5IMMB 3GSRA 3P30L 3W0WA 1KFAL 3O2WH 1NFDE 3T65A 1JNHA 1XF4A 4OZFA 2EH8H 5L88L 4LSTH 3ULVD 2F5BL 5H8DA 4N90E 1N8ZB 3S35L 1A7PH 4PRHB 2JCCA 4Y4HA 5IW1A 1KB5L 2BSTB 3HC4H 4QWWD 5HHVL 5I2IA 1P7QB 2VXQH 2EICA 2J12B 1Y18B 4P5TD 3KLHC 4XAKE 1A02N 3N85H 1DZBA 4G6FD 4P0DA 4DZBB 4XCEB 1WEJL 5JW4M 5GRZA 1PZ5A 4O51B 4R2GC 1J11A 1UWEL 1XR8A 1A6TB 4DW2L 3BEVB 3DUSA 1NCCL 5IHUH 5C6WH 5IFHH 4XXCC 3DXAE 1SJHA 3KPRA 3STBA 1C16A 2NNAA 2Y25A 3CLFH 3JUZA 2GSIA 4IIQC 3UDWC 4WW2C 1IBGL 3RDTB 3BKCH 5BXFB 4WV1A 1LO4H 3Q3GA 3WO4C 2BSRA 3DARA 3LQAH 4UIMA 3FOMB 3ARBA 2W0KA 1BJMA 1Z5LB 5DEGB 3V7MA 2F8OA 3MFGB 5EIVA 1FAKT 3FHAA 3TPUA 4H5SB 4ZAKD 3QH3B 3BGAA 3LN9A 1FVEA 5DJ6B 1YMMA 5F9JB 4L4TE 1YPZB 1ZA6A 3MR9A 4XX1G 3VXQB 2BDNL 1QQDB 3P30H 5F7EL 3ARGD 1SEBA 5I8EA 1KFAH 1YY8B 3PWPB 4YDIH 5E6IA 4QXGH 3DIFB 5L88H 3PWNA 3MRQA 3QEUA 2HP4A 5EU3A 2F5BH 3OQ3B 3S35H 4ZOEA 1SHMA 5EBGA 1SJVA 4UNUA 5A16A 1QBML 1KB5H 5HHVH 5DS8B 4L8BA 1VFBB 3ME0A 4O2FA 1IJ9A 4GW4A 4CUCA 4ONGL 2Y9RT 3RX8A 4KVNH 1WEJH 2J8HA 3SKOB 3CGTA 2F53D 5ESAB 5CEZL 5DD3H 3EYOA 3WIIH 1UWEH 3BVNA 5DR5H 4DW2H 5BO1L 1NCCH 2AV1B 4WWKB 3E2HB 2NTFB 1IGIL 1WT5A 2WQRA 4UUJB 4X0KA 3O2VL 5KSVB 1JRHI 4LPWA 5IR1A 1IBGH 4WEMB 1MAJA 1CGUA 1ZT7B 2NR6D 3MA7A 1CT8B 4C56A 2Q3AA 3MRHB 2IFFL 3BEWB 1C5DA 2A0LC 4K9EC 4ZPTA 3Q1SL 2HJLB 3ETBF 1G7MB 4UBDC 4FQJL 3WUWA 5JXED 4X4YB 2HLFC 3MJ8A 3F7YB 5J13C 3IXTA 5F7EH 3QFJB 3SEPA 4GRMA 5DTFA 1EHNA 4P2RA 1AGDB 3OKLA 4H8WC 2GSGB 1QBMH 4LSPL 3LN4A 3ZLQC 1G1CA 1OAYL 1WAAE 3MJ9A 1F4AA 3OTTA 5GRUL 4ONGH 3WLBA 5EFIB 5TFSL 1G9NC 1MI5A 4PY7B 3RL2A 1TENA 3QUKA 1I9RL 5E6YA 2XPGB 4GXVL 3LMJL 5CEZH 3TBVB 4V2CB 3QI9D 3L5WB 1FZOA 4NYLA 1AIFB 3RUGE 5BO1H 2C9AA 2EDWA 4K23L 2KBGA 1IGIH 5FO7B 1A1OB 3O2VH 1L6XA 2D7PA 1JZ2A 1AQDA 5JW4R 1INQB 4RAHA 4HIJA 2P8PA 2EIBA 3CD4A 4NJ9L 3UPCA 4KRLB 2FX9L 1GOHA 2DYPA 2IFFH 4JFEB 3WLWC 4RRPA 1JWUA 3D0VB 3BD3A 2R23B 3VFMB 2AEQH 5E99L 3Q1SH 5T3ZE 3QG6B 3HPLB 2Z35B 2BFVL 1CLCA 1S9WA 4YDLB 1S9XB 2P48B 3VXPB 4F7EA 3JWNC 4IEFB 3F7RA 3CXDL 5AAWA 5D72L 1YMHB 1OTSD 3IU4L 1K6QL 3GSOB 2NY4B 4W81A 3SDCD 1F3DJ 5DMJB 4GG6B 1NPUA 5KSBA 5J6GA 3QEGL 4LSPH 3X14B 1OAYH 4XX1E 1R0AH 3CUPA 3MMEA 4NN6C 1NCDL 4Y16D 5GRUH 1UEMA 3UTTE 3E3QE 1W72A 3IFNL 4FQXB 3L3JA 4JZNB 5TFSH 1NC2D 3NFSL 3V5HB 4YGAB 3V8OA 4QTHA 4UI2A 1I9RH 1OAZL 3C2AL 3FCTA 3LMJH 4GXVH 5DJXA 1EERB 3QPQC 4R90L 4NRZB 5F7MC 3V5DA 4K23H 1I7ZA 4BQ6A 4QNPE 4PJXA 2OR7A 1QRND 3FQRB 4UQ2B 1JGVL 5F96L 2BVEA 3EO1A 4U1JA 1CF8H 4MCYB 3VH8G 5EB9A 4CGTA 3O45A 4G8EA 3N06B 2HKFL 5C2UB 1S5HB 3VXSE 4NJ9H 1S9YA 2DMCA 1AO7B 3SDAB 4PJBA 1SYVA 5KSBF 2FX9H 2NY0B 4U1NB 1AD0B 2E7HA 3GMLB 2ZJSL 4IDLA 3PQYB 5E99H 4KKNA 5JHLL 4FQIL 4OZ4A 5EUOF 4M4RA 3KPNA 4X7FC 4OT1L 1EIBA 5HVGB 1ODAA 2NX5B 2PTTA 3CXDH 1FE8L 3VD4A 5D72H 2B1HH 4PRPB 2OTUB 3IU4H 1K6QH 4PJXF 5CD3A 1B4JL 5E1HB 1NMCB 4R96A 4Z18A 1NBVL 3QEGH 1EJOL 3RY5A 1F8TL 3I6GA 3D3VB 2AVGA 2APXA 1JYNA 1D5XB 1FBIL 3IFNH 3TCLB 2Y1VA 5C0FA 3NFSH 2AABL 5BW7C 1EFXD 4L29A 1NBYB 3C2AH 1OAZH 4X99B 2C1PB 2ZPKL 3ZHLA 4R90H 1JNNL 3ZTNL 4I0PC 2I60L 5M95B 1F97A 2W07A 3IKCB 1A4KA 4R6UA 3C9NB 1DEEA 5EUKB 1JGVH 5F96H 3IU3B 3LKRB 2C5DC 4IS6B 2AJYL 3MYJB 5DRWB 2GAZA 1U58A 2HKFH 2W9LA 4P2QE 4PJFB 5BS0E 5T1LB 1N6UA 1LK3L 3PL6C 1D5ZB 1LK2B 3AU1A 1B0GB 1YUHA 2ZJSH 1QLEL 4NO2B 5E08L 2EE6A 1H3VA 2HTLD 8CGTA 4FQIH 5JORA 1T89C 5DUBB 1GH7A 8FABA 4MXQC 4OT1H 4AIZB 5C09D 1MWAB 4JY4A 4M61A 5D2NB 3MRFA 4JFDD 1FE8H 4PREA 5CSBA 1B4JH 4DK3A 4LHUB 1IGTB 1NBVH 1P2CA 1RJLB 3GJEB 3BZ4B 3TA3D 3GMMB 1F8TH 3FOLB 4PG9B 4BH7A 2LU4A 1FL6B 3ES6B 3IS1X 5DFWH 2W9DL 4KVCH 5F3HA 3DYPA 2HFGL 2PN5A 3FO2A 1MRDL 3CFIC 3KYNA 3MJ9L 2AABH 3QDJD 2VDML 3REWA 3WFZA 2ZPKH 3ZTNH 2AXGB 2I60H 1FFPA 1K8DB 2AQ2A 1LNUA 4G8GB 1R3IL 4XPBL 2OSLB 3L3IB 4KGLA 4MZ2A 3TIEA 1UXSA 1R3KB 1MFAL 3H3KA 2AJYH 2I9TA 1A2YB 5SWZA 4WFFD 4R4BB 3H7BA 1T1YB 5H94B 4KJPC 2I07B 5DD5L 5I1HL 1T4KB 4M6AA 1IFHL 1MCBA 3GO1L 1QLEH 4BZYA 5E08H 3QDMB 5JPNB 3OR7A 3MRCB 1FAIH 1S78C 4Z0XB 3QXTA 3TH3T 1U8NB 1EO8L 3EDKA 1CXIA 1I1YA 4PJ7E 5F3BB 4FXGA 3U2SA 4RIRA 2DQTL 1NGZA 4OCYL 5K93A 3RTQC 4JZJB 1F3JB 1FL5B 2IAND 1ZLWH 3FB6A 1N2RA 1OD7A 3QNXB 2R1YB 4KUZL 1AP2B 5C9JB 4G6AD 1IKFL 5J3HD 3MNWA 3OAZK 2W9DH 2FJFA 1A9BA 1HDMA 4XMPL 5D7IA 4JM2D 1MRDH 3HC3L 1XIWD 2VDMH 1W72L 3QNYA 4PB9L 2AJZA 4JFXA 1OP9A 4KJWD 1ZLUH 5EPMB 4PJ9C 3D18A 4EIZC 1HXMB 4JG1L 4IMKC 1J8HA 2YK1L 5L2KE 1IAII 1MFAH 3V6FA 15C8L 4UQ3B 4WUUB 5D1ZC 3FFDB 4D0CB 1M7IA 3G5YB 4DN4L 4KKAD 4W6YB 1FNAA 3S7GA 5IQ9B 2CQVA 2G5BB 1H15A 2ED8A 4X6DB 5DD5H 3IDGA 5I1HH 5CLTA 2ESVE 3OKKA 1RIUL 1HQRA 1BOGB 2QQLL 1IFHH 2MWCA 4U7SA 3GO1H 4H8WL 3IDNB 1YEKL 3C6SA 2UZIL 3MJ7B 5FUCC 2ATPA 5D7IF 5HYFA 4QHLA 3ZTJG 1EO8H 2ATKA 2UYLA 4GQPH 3FT4B 2DQTH 5T1MB 1LWRA 3UJIL 4FQHA 2DBJA 4OCYH 3TBYA 2ZZUT 4HD9A 1EMTL 3QDGD 2DOCA 1HZHL 1Q9LA 4B7IA 2Y06L 3WNLA 3Q6FA 4P5MB 4KUZH 5CKAA 3AVEA 3MXVL 1K5NA 5JNYA 3HUJB 2BK8A 1I1RA 5I71B 3ZHDA 2NY1B 4XMPH 4DFHA 1LILA 3T3PF 5E70A 3HC3H 4CVWA 1NLBH 1DQJB 3FQNB 4KK5C 3N1PC 5KBNC 2D7QA 2L0DA 4PB9H 5KAQG 4TQEH 3MA9H 5IB1A 1IARB 1UB6A 4HKZA 4QCIB 5KSUB 3MJ6A 4UT7L 4PYHA 4JG1H 1ETZB 2OJZL 2YK1H 4X9GA 1L0QA 2UWEA 15C8H 2XN9B 1WCBB 5MEOB 4HUXB 4M7KL 3TO4B 4ENED 5DJ2A 5HXMA 4DN4H 3DV4A 3S8WA 3TNMA 1NCWL 1N59B 4XWOC 5FV1L 3D2UD 4YWGL 1P9MA 3HCVA 3VXOB 1FZKB 1RIUH 5CZKA 3GKZA 5CIPA 2QQLH 4U7MA 4JLRB 4H8WH 1YEKH 4P23A 2UZIH 3ZT7A 1ZHBB 1V7NL 4XBPA 3FRPG 3FQWA 1QSED 5E9DA 4CN1A 1JVKA 1GZPA 1PBYA 4FNLL 1D5IL 3QXUA 3UJIH 5C0GB 2JK5B 3G9VA 2V5SA 1NSNL 4S1QL 1EMTH 4WY7H 3VWJD 1HZHH 2Y06H 5E94A 3VRIA 5GRWA 3MXVH 3RY6C 3IETB 2Z93A 2IQAA 2Y72A 1KOAA 1DN0B 5HY9B 1YEEL 3NIFE 3MRRA 5EU5A 4UINL 5CP7B 1BREA 2XG4A 1T5XB 2D0GA 4HPYL 1P6AB 4GS7C 5HI3D 5JDJA 3BJ91 2H6PA 4F33B 1ERNA 1QHOA 1S7SB 4YXLH 4UT7H 3PP3H 2OJZH 4OF6A 1RZGA 1LHZA 4NQXB 3O9WC 1YJDC 4B53A 4GRWF 4M7KH 3ZDYF 3RVUC 4L3EE 3RWIB 5J4MA 1H8OA 2WWMD 1NCWH 4YWGH 2WMPA 4BFBD 5J11C 3GRWH 3MOBH 4UT9L 4FA8A 1CVRA 2VZ1A 1RY7B 3IJHA 1V7NH 5JW4Q 1T0NB 2P5WA 4YFDB 3QUXC 4FNLH 4I18A 1D5IH 5LGHL 4Z7UA 5DJZB 1IAOB 4MDIA 4FQLH 3RY4A 1KCVL 1NSNH 3T3ME 4S1QH 2MFNA 3L3HA 1QBAA 1AGEB 4QOKE 4XNMA 3NAAL 3X3GH 1HOCB 2VLMD 4UV4L 1KB9J 1I7TA 3WS6C 1UJTA 2ICEA 4L8SC 4MD0A 3P2TA 4UINH 5EDXA 2Z31B 5IJVB 4K3GA 1T0MB 4HPYH 1JK8A 1HNGA 2YRPA 5CJBA 1WBZB 5BJTB 1T20A 2FSEB 4RGNC 2WP3T 3LSOB 1S3KL 2XKSA 5HYSB 3OAYK 1MCDA 1SVZA 3SJVA 5I6XB 4DZ8A 3OR6A 4Z7UF 5DEZA 4P4KD 5D7LA 4NQEA 2KQNA 3SGDI 4F15C 5BQ7B 1KIPB 4GJTB 1HHKB 3QUZA 5B8CB 4UT9H 2VXVH 2QHRL 4P99A 1LO3H 5B39A 2ZUUA 4EUPB 1OQXA 4NBYB 3C5ZA 5F1OB 5AZ2L 1B0RB 1GOGA 3IDJA 4APQC 1JCKA 3ECBA 3O6FD 4Z7WA 5LGHH 4S2SB 1BWWA 2NW3B 3LRHA 3STZB 3AREB 1KCVH 5L2JB 3RWHB 5GGSA 1I8MA 1QEWB 3C5JA 2BSED 5HYJB 4UB0L 4P2OA 4U6HA 4U1LA 1C7SA 2NZ9D 1AR2A 3WFCL 1YECL 4UV4H 3L3KA 1VACB 4XH2A 5EU6E 1KGCD 2E7MA 4X9IA 2VXUL 4UV7L 3MGOA 1ZA3B 1ORQA 3A6OA 4HX1A 5J0BA 1NGXB 3ULVC 5CJXA 1I8KA 1PKQA 1S3KH 2FJGA 3TO2A 4QWWC 3MV9B 1XCQB 4CDGC 2JKXA 4KDWA 2VIRA 2P47B 2IPKB 3FTGA 3ORJA 3IVKB 3DPBA 3VMNA 1RZKL 1I9EA 4ZODA 3MXWL 3GSNA 5DF0A 4NQCE 1TJGL 1S7UB 3MRKA 3SDDA 4HWNA 4MAUL 4X6EB 2QHRH 3F7VB 2IBZX 1OGAA 1VA9A 4K3HA 4FP8H 4RMRA 5AZ2H 3NN8B 3V6OC 5K59F 1EH9A 4HFWB 1KSRA 2LV4A 1JI1A 3T09A 1AXIB 4NZRL 1UM6L 7CGTA 3DVGA 3PV7A 1A22B 1NGWB 3T2NL 2DWEA 2X41A 4ZAKC 3WKML 3VFNB 2D7MA 4UB0H 3IDUA 5BV7C 4EEEA 1ZT1A 5GIRA 3WFCH 5DDHB 3RAJL 5GHWL 4K3JL 4NC1E 4LSSL 1JN6A 3SN6N 1ZTXL 3ARGC 5IHZB 4WJ5B 1H3TA 1UA6L 2VXUH 4UV7H 4JDZB 4Y1AA 4HS3A 3C08L 1FVDB 5CAYB 4N0UE 4APQA 1MHEA 1T1XA 3B9KA 4BJLA 1MCPL 2JJWA 3HNSH 2VQ1B 4QRRA 1JL8A 2H32H 1AGBB 2CDGB 4X6CA 5DLML 3VXMA 1RZKH 2YPLD 4JFPB 1JZ4A 1KJVB 3MXWH 1TITA 2I9LA 3VDCA 1TJGH 3MRIB 1OWWA 1SYSB 3WCYA 1JPFA 4MAUH 3CFEA 4GRLB 2X70A 5CIPH 3B83A 4F7CA 4FMKA 2ARWA 5ISZD 1DBKL 3EBAA 4TUJB 4NZRH 1DEDA 1KLUB 1UM6H 3MLRH 4RGOL 4Y5VA 4DUWA 1JPST 2X4TB 3T2NH 1QSFB 4JCLA 1CFSA 1ZGLB 5IG7B 2EXYD 3S5LA 4JFOB 3WKMH 2WW8A 1H3UA 3L5JA 3CDCA 3RAJH 1RZ8A 5KSAD 5GHWH 5JXEC 4K3JH 3WDHA 4DUXA 4LCWA 1BHGA 5C0IB 3I6KA 1DANU 1Q9WA 4LSSH 2KQMA 4MA1B 5GRXG 3MV8E 1A47A 1UA6H 3GMNA 3MUZ1 3C08H 4AY0A 3BAEL 2E8ZA 4KRPB 1CGVA 3BQUA 3KPPB 1CTOA 1NDGA 4YDKL 1YC7A 4JFFB 2J4WH 3H42L 2BNQB 4R4ND 2J8UB 3Q0HA 1PG7L 5FA3A 4HUUA 1MCPH 3MLWL 3NZ8B 5IF0B 1EGJA 1MVUB 1QFWL 5L9DH 3T1WA 3UYPA 3TBSA 2EKSB 4M8QA 1G7JA 1LP9A 3HG1E 1FN4A 1ZSDA 3QI9C 3H9SB 4U6XA 2N7BA 1T1WB 4AEIL 3IFPA 4ODHL 5IB4A 1DJSA 1M1SA 1F4XL 4JQIL 3U4EA 1SBSL 2W38A 4P4RB 2WBJA 4RBPH 4MLSA 3GHEL 4R7DA 2EDQA 1H0DB 2GY7B 3SDXB 1TIUA 2PYED 5ELIA 3WYRA 1DBKH 5B38A 2AEIT 3RGVA 1HILB 4RGOH 3O4LD 4PRIB 5C07E 3GUTA 1L0YA 5FGCB 2RB8A 4JM4L 2C1OB 1MAKA 1ED3A 2ZCKL 2DIAA 3E0GA 4HK0B 3JSSA 5J6HA 5ADOL 3AUVA 5DJDA 5T5NF 3EHBD 2EC8A 43CAA 2IJ0C 3X11A 5C86A 4LSVL 2OS7A 5BZWA 3SE4A 1LP9F 2BNUA 2N7AA 4N8VG 1MLBB 3S3JA 1LO5B 1OTSC 3BAEH 4K7FB 4J1UA 4M43L 4NT6A 4IDJL 2DL9A 4KMQA 2DJSA 1JGDA 3ZHKA 4YDKH 4HUWA 5DUML 1PFCA 3H42H 1WBYA 4C4KO 2F5AH 1A1NA 1PG7H 4Y16C 2FO4A 4CJ0A 3MLWH 2BMKB 3AXLB 1UVQB 3KPOA 1QFWH 2BVOA 1KUMA 4MSWB 1TTGA 4KU1A 1PW3A 1XCTA 2XWJA 2Z0BA 4YHYB 5IFAH 1XGRB 1M6OB 3LHPL 1X5LA 4I5BB 3MNZA 3ZKXC 5J9PA 4AEIH 4ODHH 3OJ2C 1ZKAA 2JIXD 4K3DH 3M17A 1F4XH 2P8LB 3QIUB 4JQIH 2P49B 3LKOB 3REVB 4BFGA 3DX8B 3GHEH 3JWDC 4YUEH 3C60D 2CLRA 4CRPA 4L4VE 1NCAL 4JM4H 4PRAA 4H0HB 4JRYA 3FJTA 2P45B 5ADOH 2AK4B 2DQEH 2GK0B 1DLHB 4ZQKA 2G9HA 2VZ3A 4KQ3L 4R3SA 5C0CA 3HB3D 3VFUB 4Z7VA 1YJDH 4LSVH 1HSBA 4N0YL 1UH2A 3MZTA 1NBZB 5TE4L 2VN7A 3OZ9L 1A4JA 3IAGC 4OM0L 3BP6A 2AV7B 5J57B 1Q9OA 4LLYB 3VA2C 4N5ED 2CRZA 4M43H 4Z5RB 4IDJH 2FH6A 3OG4B 1JWMB 3DURA 4I3GA 4JY5L 4OBSA 1T7VA 4GAYA 3UTSE 2QQNL 5B22A 3V0VA 1ND0B 3T77B 3U4BL 1X4YA 2WIMA 3AS2A 3I85A 2BVYA 3MLUL 1KEGL 3LHPH 3HI6L 4R4FL 4MD5B 5GGUB 4HJGB 1BZ9B 1KTRL 5I73B 3FRUB 3OKEA 1ORSA 4DKEL 2KZ1B 4IRZH 4LLDA 4Z7VF 1TQBC 3S96B 1LVEA 2HVJA 5IVOA 4M7LL 4ZXBA 4PJ5E 4IJ3C 3IYLW 2JTDA 4NZJA 5JHDE 4JRXE 4L8DA 5FK9A 5IOPB 1NCAH 2WINA 4Z8FL 3DUHA 1CD1B 4Y5XA 4CNIA 4PJEB 5EOTA 4KI5E 5HVHB 3L9RB 5J56B 3ULVL 2CO6B 1JHTA 4KQ3H 2HTLC 3OSKA 5IT2L 3HAEB 1ZE3C 3G08B 2F8XC 1IM9D 4N0YH 3D39B 4GKNB 4LNRA 3SBWC 5TE4H 4X8XA 5DJ0A 3OZ9H 1IC1A 4PJCA 5GS1C 5HPOA 4JPIA 4OM0H 2XQBL 5L8JB 1R3LB 2EYRB 4LCUA 3H8NA 4ACPA 1I1AD 3QEHA 4YXHL 4JY5H 4X6FA 4WFHD 3VXRE 1FYTA 5KG9A 4YAQA 4NNPH 1CLOL 5ETUB 2QQNH 2JLLA 4Y5YB 1MNUH 2CXGA 5FYLD 3U4BH 1B2WL 3N1GC 5IEKA 5TDOB 3G6JA 3RHWF 4PGBA 3SGJC 4EI6B 3QFDA 3MLUH 1KEGH 3HI6H 1REIA 1EGJL 1E28B 1AD9B 4M1GL 2CDEB 1U3HB 4YBQD 4BSWA 3WFBL 4DKEH 4S1DD 3UX9B 3JVGA 4D0BB 3KGRA 1PD6A 5HD8D 3O4OB 4M7LH 3HC0B 4PJCF 3Q5TA 3P4MA 3SGEH 5KS9B 4NKDB 4PJ8D 1AXSA 2J8OA 4Z8FH 5IVZB 3MLPA 1AI1L 4FQ1L 5ENWB 2VLRD 3TYFB 3ULVH 4R0LA 5IK3B 2E3VA 2NY6D 2YC1B 5HHOB 3V6ZB 5DSCA 3VWKD 5IT2H 4OZHB 2V7NB 4F9PC 4K94C 1U92B 2VLJB 4X5XA 3H2WA 2XQBH 4EKXA 3QEQE 4ZDHA 2V6HA 2KKQA 2P42B 5AEAA 2AGJL 4D9RD 4L9LC 4Z77A 3MROB 5H37G 2R56L 4YZFF 2EDNA 4YXHH 4RAUA 4DOHE 1EHAA 4G6AC 2P5EA 3HE6D 3D87B 5J3HC 1CLOH 2PXYA 3MRPB 5K33A 1HI6B 1ZV5A 4KK6D 1B2WH 4JM2C 1XIWC 1OHQA 2DRUA 2PO6B 2X7LB 4HMEA 1EGJH 4ZOBA 4QRPE 3VMOA 4KJWC 4M1GH 4MX7A 1J05B 1FORL 3VRLE 1CFVL 1Z0NA 3WFBH 1XF3A 3CC5B 3QAZB 3QUYA 3BIKB 3ILQD 2H9GB 2FECL 4YHPA 2A74A 4JHBA 5IW6B 3VG0L 1L0XA 2PW2A 3QCUL 5CS7A 3ILPB 5KANG 3VFOB 3FT3B 4ZFFA 5IIEB 4MWFB 3RWDB 1AI1H 3DXAA 4FQ1H 1WGOA 3KHQA 3DTXB 5HHME 1X5XA 3PGDA 4EXKA 2X4OA 4Y8DC 5FYJU 3ZZ1A 3VXUB 1NFDF 1QBLH 3CH8A 3SOBL 2GCYA 4HK3J 2C3HA 4LIQL 2PCPA 5K9OB 5FA4A 1OB1B 4MAYB 3RP1A 2QLVB 2RBLA 4U05A 4MA3B 4NDMB 4JDVA 3V4VH 3HS0B 1FFOA 3L7EB 4DTGL 5FM5M 1XH3B 4R26L 4ALAL 4WVRA 3C09C 2R56H 1C7TA 4FQ2L 4L4TA 3G04A 3EFFB 2EDLA 5GSRB 1FSKC 1Q94A 2WLZA 4LCCA 4A2MA 4P5TB 3ZDXF 3TJEL 5INDA 1P69B 1EO7A 4H1LH 4WU5A 1MJUL 3P0VH 1T80A 1KCLA 4OCWL 1P7HL 3VGGA 3JV6A 3PXJA 5ID1B 3O8XA 3EDFA 4LBEA 1FORH 1CLZL 1CFVH 5CSZB 3NCBB 4U0RB 3U4AA 4J2XA 2R4SH 1JTOA 4KMTL 2Q6WB 1NCUA 5L7XL 3VG0H 3QCUH 1CQYA 2ZSWB 1KB5B 1T6WA 4NZUL 1S7VA 4N1CA 4OFIA 4CU8A 4OFYA 4OM1L 1RHHB 3GI9L 4O4YL 1S8DA 4PJDE 4TUOB 4MJ6B 4GT7A 1RZIA 4JO4L 4LIQH 4Q6YA 4NM4L 1MIEL 5C08D 4CMMA 1HQ4B 1J88A 3AMKA 1IGYA 4Z7QE 4OLWH 3VFRA 4DTGH 3VWJC 4R26H 4ALAH 3R8QA 3MGTA 3RWFB 3W39B 3GJFK 2OCFD 4FQ2H 4HG4J 5EG6C 5DO2D 1DVFC 1MJUH 4PD4K 3JWDL 4OCWH 2VR9A 2X10A 2R2EB 4M6ML 1BMGA 3T04D 2F53B 3MUHL 3DRQB 1C5CL 4NN5B 4PV9B 3S37X 4JREC 5HI3C 5DYOB 5DJAA 1CLZH 1WAAA 3MV7E 4LLMB 4XNQA 4KMTH 4D2NA 3MRBB 2IH3B 3GSQA 3QRGL 4XZUA 5ITBL 4PB0L 3L3GB 5L7XH 5BRZD 2H2PD 4ZOAA 1GZQB 5E5RB 4NZUH 2WWMC 3RUGA 5C0BD 4OM1H 2DQIL 4O4YH 1BF2A 3H3PL 5ANME 3ABZA 1Q9KA 1ZVSA 5E00B 3RI5K 2OL3L 4JO4H 4NM4H 1MIEH 5DC9B 1UCBL 3O3DA 4GBXA 4OD3L 1I7RA 5J12C 5TE6H 1I85A 2VLKB 4EI5D 1WAAF 2P8MB 3NOIA 3ULUE 2HH0L 3O6KL 4HT1L 1AE6H 4POYA 3MRNA 4QF1A 1KIQB 4RQQB 1DUZA 4PLKD 3OAZH 3CDGB 1DR9A 2C3WA 3ZT6A 5FO9A 5FECA 3MRJB 3D1MC 4PJAE 1IGJB 3D0LA 3RUGF 4ZSOB 3JWDH 5L8LB 4M6MH 2XG5A 5HHQB 5FCSH 3CX5K 1ONQA 1EUUA 1C5CH 3QQ3B 1IL1A 4XRCA 3IDMA 3L1OL 4YHIA 3IS0X 2BNRE 2OK0L 2MTPA 3ESUF 2FBJL 1KC5L 3GSXA 4B7LA 3D5OF 3UTTA 1QLRA 3MFFA 4XP6L 4WNQA 5AUMB 1CTNA 1NBQA 3FFCB 4P4KC 3I02B 5ID0A 1ROWA 2DJ4A 2R0LL 1VKXB 3BUYA 4MNQE 4LKXA 3BW9B 4M7ZC 3TC9A 2FJHA 1OAUL 1BVKA 1TZHA 3NCYP 2VR5A 1IILE 2DQIH 1U41A 2QL1A 4NQSB 4TVSa 4G3YH 3MLTB 3B43A 1EAJA 2YPKB 3VD3A 4X8JB 3RIAK 1DVFA 4LHUG 1CICC 2OL3H 4FMFA 5I1LB 1RK1A 2ENSA 3I50L 4P46D 3OXSB 1ACYL 3KXFE 3VXSA 2XWTA 3O6FC 3VGAB 1S7WB 1UCBH 4DVBB 4OD3H 1ZXQA 4FZEL 3K1KC 2YD9A 4O2CB 4RGMB 4TNWF 2GITB 2FIKA 2HH0H 4C55A 5FKAA 3O6KH 2IALB 2VXSL 4HT1H 4XAKD 2ED9A 3ZDZE 3SDCB 4C59B 2HWZL 2YD2A 4TNVF 4IRSD 5CKGA 1V3MA 1CIUA 1AHWA 5FHBL 5JOFB 4MCZB 4XCYA 2NZ9C 3KDMB 4Y19E 1VFAB 5FOBB 1FP5A 5AYUL 1FNEA 1L4IA 4QNPF 1RZ7L 3EGSB 1KYOK 1WFOA 2B39A 1NCNA 4LOUD 2OK0H 2FBJH 1KC5H 4I9WD 4ORGB 1AKJB 4FHBD 5JPMB 1QRNB 5F9WB 4MA7H 3IRZA 3QIBB 1S5IL 4XP6H 5LQBL 4HDIA 1OP3K 4PFEA 2APBA 3W0WB 3WEXA 4OLUL 3T65B 1JNHB 2A6KA 1XF4B 4L3CA 4OZFB 2DQDL 2R0LH 4K94L 2DBLL 1M7DA 5CEZE 1BGXL 4Y2DD 5IW1B 4PGCA 3QXDA 4E41A 5I2IB 1P4IL 4N0RA 4D8PA 1DE4B 3WIHA 1B90A 3MUY1 4GAJL 2NXYB 2R15A 1PZ5B 4P2QA 2VWEC 1JBJA 4GKZB 5BS0A 1ACYH 1XR8B 3DRTA 5SWSD 1MY7A 1A3LL 3DUSB 4FZEH 3U0WL 3MLYL 2VABA 3R8BB 1SJHB 3QWRA 3KPRB 3BWUC 1I3GL 1C16B 2NNAB 2VXSH 2WWKT 4QT5A 2GSIB 1TCRA 2W60A 5LXGL 3P73A 3WHE1 2KL6A 5FHBH 1N7MH 4WV1B 4NQDD 4EN3D 1JGUL 5AYUH 2BSRB 1N0XL 3K2UL 4UIMB 1RZ7H 3D6GA 3T0ED 4AM0A 1EEZA 3P9LA 3TPUB 1OPGL 1FVEB 3E8UL 1YMMB 1MELA 2ORBL 5KOVC 1T2QL 2VSCA 3RVTD 1ZA6B 3MR9B 3WHE0 1CICA 5CFHA 4FFZL 1MFNA 4M93C 4YC2B 2QQQA 4ZFZA 1S5IH 5LQBH 1RZJC 3BPLB 3K8MA 4OLUH 1SEBB 4WI8A 5I8EB 3ULSA 5E6IB 4FN0A 2DQDH 3CFDA 3PWNB 3QEUB 4K94H 1IQDA 5EU3B 2DBLH 3CZFA 1PZUB 1HK6A 3M1BA 3TBWA 5KVDH 3T0XA 5CD5D 4L8BB 4O2FB 1OW0A 4X98A 4GW4B 4PRHD 4X5WA 2VXTL 4GAJH 1ES0A 3NABH 4LRNH 3JTTA 1N3NA 2YXMA 1P7QD 3EYOB 2GEEA 3BVNB 1NJ9A 1A3LH 5LWYL 3U0WH 2A6IA 1X5GA 3BOVA 1I3GH 4X0KB 2XXMB 1D3CA 3CDYA 3BGFB 1JHLL 5LXGH 3TA3B 3IXAA 4PJIE 3G5VA 3VH8A 5IR1B 4PJ7A 4OI9A 4YNYA 5T3ZL 5KSAC 3MA7B 2PR4L 4C56B 2FEEL 1N0XH 3K2UH 1BAFL 4PBXA 1KN2L 1C5DB 4JFQA 4ZPTB 5I9QB 1OPGH 3E8UH 3C8HA 3PABA 3CMGA 4G6ML 1ZS8A 2ZUQB 3OAYH 1T2QH 3LKNB 4X9HA 3WUWB 4E5XA 4FFZH 3DVNB 4R4NC 2FB4H 1S9VA 3EOYG 2BOBA 3FB7A 3DX9A 4G7VL 4GRMB 5F7HA 5DTFB 2YUVA 4MQ7A 4TYUA 4P2RB 2A6DA 3ARVA 2V5YA 3OKLB 1J8KA 5BVJA 3PWPD 3LN4B 2X89A 1WWWX 2VITA 2KDGA 5L2KA 5F7WC 3HZKA 3WLBB 2LAAA 3KJ4B 2JJVA 1LDSA 1MI5B 4YK4B 1XF5A 1VFUA 3QDME 3RL2B 5C71A 1T03L 3QUKB 1HXYA 5IB5A 5JQHC 5TPWL 1FZOB 2ESVA 2G60L 4NYLB 1DL7H 1GGCL 3TYGL 5LWYH 4A2LA 4ELME 4NO5B 1HNFA 1IGFL 4NUGL 1HN1A 1XGTA 2E6QA 4Y4FD 4NFDA 1JHLH 4OFPA 1R5IB 1AQDB 4N1HB 4MA8L 7FABL 1FGNL 3C6LA 4WWKD 2NY5C 5FUZL 3KPQA 1LE9A 2PR4H 5T33L 1IC7L 4ODUA 1BAFH 2DYPB 3HI1A 3O3BA 4JKLA 3RA7L 4PJFF 2C7UA 4ZUTA 4XHQA 1U8MA 1BX2A 4TULL 1BBJA 4G6MH 4Y0GA 4RFEA 3VD9A 4PJHE 1S9WB 1D6EA 3O0RL 2VDLH 4F7EB 4G7VH 2IADB 4NQUA 5L0QB 4HUVA 1P53A 3S88H 1G9EA 3PWUA 1FVCA 5KSBB 2EDTA 2XTJE 4CW1A 1G7IA 3CUPB 3UTZB 1W72B 5GS0D 3IAPA 2EC9U 3OJDA 3L3JB 5EUOB 1F2XK 1MLCA 1OM3L 2FIRT 2ZUVA 1T03H 3JV5A 3CXHJ 4QTHB 3FCTB 4PLNC 4M48L 1YEDA 5DJXB 5F71A 5TPWH 3C60C 3I75A 2RAMA 1M05A 4LEXL 3V5DB 1GGCH 1I7ZB 1E4WH 2BVPA 3VJ6B 4PJXB 1IGFH 4NUGH 2VDPL 3FT2A 5D7KE 1M7XA 3K1DA 4MA8H 7FABH 1FGNH 1RIVL 3EO1B 3DYOA 1FDLL 4XP5L 5FUZH 1I8IB 3HB3C 5A2FA 3Q5YA 2XIDA 4UNVA 1S9YB 1KJ3L 4ODVL 5T33H 1IC7H 1PAMA 2OR9L 4NKOA 1VEOA 5HYSG 1SYVB 3V0WL 4ZFOA 5KVFL 1U0QA 4G7YL 4PRNA 2XFXB 4N5EC 4TULH 4OUUA 5I8KH 4P57A 4OZ4B 5IM7A 3GMPA 4JFED 1JGLL 1URLA 3KPNB 5DHVH 2PTTB 2FGZA 4MB4A 2PTVA 2GIYA 2XQYG 2D2OA 3WIFA 4EUPG 1JNJA 2EYSA 4LLVB 5CD3B 1R5VA 5EN2A 4R96B 1RUPL 4QXTA 3A6BL 3IT8D 4WUKL 3I6GB 5TJWK 1K2DA 2C4XA 2NY4D 2HMID 4YHKL 1J0IA 3QO0A 5C0FB 4MJ2A 3DX7A 3TGXA 4AH2A 2YD3A 4L29B 1KCSL 4M48H 1ZLSH 5ICYA 4FQXD 4LEXH 1IZJA 1H3WM 1A4KB 5I19L 4XP9L 2VDPH 2R1WA 1CS6A 3NIFF 6CGTA 4KXZI 5JOEA 1G7HA 1RIVH 3BESR 1FDLH 3DECA 2GAZB 5JXAL 4XP5H 1U58B 5GS2D 3WJJC 2XNAA 1D9KA 1PYWA 1KJ3H 4ODVH 3GM8A 2OR9H 3V0WH 1JZ8A 4G7YH 4Y89A 4QOKA 2CK2A 5ICZA 4Z76A 3PDDA 1YUHB 3PNWA 4EBQL 4NN7C 1AO7D 2WLYA 3SDAD 3OKNB 1E4KC 1R3HA 2FDBP 1I1AC 2NY0D 5JORB 4Q9RL 1JGLH 4EVNB 4LMQI 8FABB 4MD4A 3PQYD 4V1DE 2ZOLA 4M61B 1UH4A 3MRFB 5DC4B 4PREB 3QP3A 1RUPH 4Q6IC 1YEIL 2NX5D 3A6BH 1P2CB 4WUKH 2A9ML 4PRPD 4BH7B 4YBQC 4IRJA 3WN5C 4S1DC 4DQOL 4EDWL 5F3HB 3IGAA 3WXWL 3S3SA 3FO2B 3HE7A 3KYNB 5HD8C 4OSUL 3D3VD 3T3MF 3REWB 2WUCL 1KCSH 4XWGL 3IDIA 1FFPB 1LNUB 4YPGA 2AKRA 3LEXA 5I19H 4XP9H 3TIEB 2B8OT 2UVFA 1QO3A 1INDL 4HGWA 4XXDA 5C0AE 1WZ1L 2NY6C 1P84K 3QQ9D 4PJBE 4C57C 3TWCL 2I9TB 5SWZB 4JKWA 5JXAH 3O41A 3VWKC 5TE7L 1RZJL 1NANH 4MQSB 5DHYA 2H8PA 2W0FA 3CH1A 2E7BA 4XT1C 4ODSL 3IDYB 4G9DA 4F58L 5LGJB 1ZGLP 3OB0K 4OI8A 4PP2A 2NCMA 1BFTA 4EBQH 5T1LD 2P44B 3W2DL 3OR7B 3FRPA 1N26A 2AQ1A 1I1YB 2D31A 5E8OA 1N5YL 3HE6C 5KAQF 4FXGB 3U2SB 2B20A 1GCFA 4RIRB 3MV11 1NGZB 4ZUVB 4KK6C 5E8NA 3FB6B 5DEFA 3AB0B 4KAQL 2QQKL 1YEIH 3QIWA 3MPCA 1MPAL 2A9MH 5BOZG 3PWLA 4MQXD 3PXHA 1UJ3A 3IB4A 3B9DA 5IKCB 3MNWB 4LHUD 4DQOH 4OCSL 4EDWH 2FJFB 1A9BB 3ILQC 1HDMB 3WXWH 5D7IB 3LPFA 2DLIA 4OSUH 1G0YR 2WUCH 3QNYB 4HEPG 4XWGH 1E6JL 2ZNWA 1DUYA 2AJZB 4JFXB 4NQCA 2Z92B 3D18B 1FV1A 1QFOA 2YUXA 2HFTA 1G1YA 1EK3A 1INDH 1LEGA 2Z8WC 3V6FB 1QSVA 4G8GD 3TWCH 1BJ8A 3WFEL 5TE7H 1RZJH 3T8XA 3CX2A 1H15B 2D03L 1KELL 1R3JA 1JJUA 3GJFA 3BPNC 5DK2A 4NHCL 2HJFB 3NA4A 2Q87A 3OKKB 1BFOA 1HQRB 1KTDA 1M71A 5GGQL 4F58H 3LDBC 3S4SA 3B5HA 3W2DH 3C6SB 1T2JA 4HIXH 4ZFOL 1U8OB 4OCRL 5GXBB 4RAVA 2CR6A 4ZUSB 4QHLB 1F90L 1N5YH 2ATKB 2UYLB 2ZUSA 4FQHB 2ID5A 4W68A 3E6FA 4KAQH 2QQKH 3R4DA 3S3PA 1I8LC 3Q6FB 1MPAH 2GJ6E 4HS6A 3HLAA 4IOIA 5EOCL 5HDBE 5BMFL 1K5NB 4N0UA 5JNYB 1I75A 4OCSH 4QXWA 4M9OA 1CFNA 4OF5A 1EX0A 1E6JH 3RIFF 5IB1B 2Q20A 3H6JA 4ZFGL 3TNNA 4HKZB 5TQ2L 5HI4D 3W9DA 3BPCA 2L4OA 5D96C 2XXCB 4K3EH 1CZ8L 5E2TL 5DJ2B 2F54E 3WFEH 4TTDD 3DV4B 3TNMB 5JIKA 2D03H 1KELH 4WUUD 1KIRA 4NHCH 1BD2E 3HCVB 4NFCA 5GGQH 3ARFA 4KTYA 1OAQL 5CIPB 4Y4KA 4ZPVB 5F7YC 4P23B 4OCRH 4XBPB 4L3ED 3FQWB 1F90H 1JPSH 1S7RA 3ET9F 5E9DB 3BFOA 1WZKA 2B5IB 1MREL 1GZPB 1DSFL 5DO2C 3G6DL 4GRWB 2P46B 1F6LL 2YEZA 3MV8A 3OGOE 2N56A 5E4EB 2P1YA 5SX5K 1AC6A 3VRIB 5EOCH 5BMFH 2XTLA 1RU9L 1DFBL 2IQAB 2Z93B 3P11L 4IBLT 2HKHL 1TNNA 3OKMB 3MRRB 5EU5B 4YX2L 5IBUB 1QNZL 1O0VA 2H2PC 3HG1A 3KHOA 5F88A 3E6HB 2NY1D 2QKIA 2CKBA 2H6PB 3EKCA 5TQ2H 1NC4D 4WFGD 1RD6A 1NUDA 3T08A 5HJ3A 2GTWA 4WWID 3LKPA 1CZ8H 1G0XA 4PY8J 1J86A 3DGGA 5E2TH 3B9EA 3THMH 2OXHA 3KR3L 1WVZA 4JY6B 3IDXH 4EXPX 2XN9D 5C07A 2X4SA 5T1KA 3TO4D 5SWQA 1OAQH 2CUIA 4PGEA 4EI5C 1UZ6F 3UTQA 3IJHB 4RFNB 5K9KB 2HRPL 1IE5A 4Z9KB 3FB5A 4O5LL 2NY3B 4NSKA 1EZVY 4PLKC 5D7JA 1MCIA 3NCJL 2P5WB 3AS3A 4F8TA 3MNVA 4I18B 4Z7UB 4LF3B 1UWXK 2J8UE 3ZTJH 3G6DH 4I3RL 4MDIB 1H9VA 3L3HB 5MEND 4H26A 4U7KA 3RWGA 1DFBH 3H9SE 4NNXA 2HKHH 3TN0A 5DJYB 2YZ1A 5T1DL 4HPOL 4LVOB 1I7TB 3MSPA 1PG7W 3DMMA 1FFNA 3D69A 1QLFA 1OF2A 2ICEB 1U8PA 5DWUL 1QA9A 4MD0B 4YX2H 1A6WL 3EDEA 1QNZH 5GGRA 1JK8B 2PYEB 3CSGA 2KZWA 3SDXE 1GHFL 2Z91A 2ED7A 2V2WA 3HAEG 3BIBX 3PHQB 4TOYL 4K8RL 3JTSA 4OI7A 3UTPD 4ZTOL 3Q5OA 3SJVB 3MBEA 5EU6D 3OR6B 5D7LB 5DMYA 3K0WA 2C3XA 4WHYG 2VUYA 4DVRL 1MFCL 4NNYA 3KPSE 1MH5B 4L4VA 4ZNCD 1U3ZA 3QUZB 5FKPB 3M07A 1AGFA 4YE4L 1NAML 4X4MA 3MODL 4OZIE 2XZZA 2HRPH 4X7DC 5B39B 4H20L 3C5ZB 4O5LH 1QPXA 1HIML 3ARWA 3IDJB 3PWVB 4NRXA 1G7PA 2Z4QA 4MDJA 3ECBB 4Z7WB 1SJXA 2ZCLL 2B1AL 1F4HA 5D1XC 4QHUB 5DGRA 4PRDA 2WNGA 1P6FA 1PSKL 4LOUC 5GGSB 2WIIA 3C5JB 1I8MB 1MCOL 3K8LA 5EO1A 4OFVA 5ITFA 4P2OB 4U6HB 4U1LB 4F37F 3UTSA 3BZFA 4F2MA 5T1DH 4HPOH 3L3KB 5DWUH 3QCVL 4XH2B 1FC1A 1A6WH 5J06A 5FUCE 1J10A 1EHLL 3MCG1 1F13A 3MGOB 4MXWL 1ORQB 1FYHB 4HX1B 1GHFH 5DFTA 1YC8A 4YHOL 2AK1L 1QR1A 2FZ3A 1CE6A 3QDHA 2Z31D 4TOYH 4K8RH 1JWSA 1PKQB 2FJGB 4S0SD 4XHJD 4Y2DC 1ZEAH 3ARUA 3TO2B 4ZTOH 4KJQD 2AEPL 3SKMA 2VIRB 1RPQA 4PJ5A 3FTGB 4RX4D 3QNZA 4URTB 5JHDA 4DVRH 1MFCH 4JRXA 1QFWI 1UQSA 4RCAA 3GSNB 5H35B 2H3NA 3BH8B 1XGYL 3MRKB 3SDDB 1Y0LA 3C5SA 4YE4H 1NAMH 3MODH 3GJFH 1OGAB 4H20H 5E95B 1HIMH 5C0DA 2DQUL 5DXWA 5GISL 2R8SL 4I2XE 2DLFL 4XPGH 3RPKA 5HTSA 5SX4H 1R24A 4K2UL 2EDXA 3DVGB 3T0EC 1MCWW 5DQDH 2DWEB 1PSKH