5DK0B

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
b'GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRGDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B01
2JE8A 4HGKC 2VXTL 2X4RB 2HVJA 2I24N 1NJ9A 2ZG2A 4ZD3L 2XZCH 3BIBX 2YRLA 4EQ2A 5FM4A 2A6IA 3C60C 1SY6A 1K6QL 1QBBA 5J1AB 3MZTA 5DFWH 4YHIB 1N64L 2W65B 4P2RB 1GC1H 4MD5A 1KB9K 3MLYH 2R9HD 4XBEL 5CMAA 5I30L 1AGBA 2YS4A 5IVXE 3RNQA 5CCKL 2FRGP 1RIVL 5IB1B 2XZQL 1NCTA 2DDQL 3UDWC 3QIWD 1XMWA 1D9KD 4I4WA 5IIEB 1PLGH 2X4OB 3MLRH 1F90L 5B38B 4Y16B 1DVFD 3BIKB 2ZSVB 4ZNCD 5J3HC 2WM0A 3HG1B 4W6WB 3HAEB 1CFNA 3WSQH 3GHEH 4GAYA 4PTTA 5H37H 1M7IB 3EOBB 3C87A 3KPMA 4OUOA 3HR6A 3GKZA 4LSRH 4PBVC 1CGTA 1J1XL 4XPHH 4X9GA 2IQAA 1CBVL 2BC4B 2EE3A 3ZKNC 3DPBA 5L2KE 5CJOL 4LARL 5FA4A 1XFPA 2D03H 5C09A 1XF3A 1MY7A 4AYFA 4RGNB 4LSPH 5EC1B 4WTZA 4KTEL 2FEDD 2EDDA 4MD4A 4OZGE 5EO1B 4JO3H 3FOLA 4HX1A 4PY7A 4JHWH 1PSKH 3P0YL 3VXPB 2X4RA 3MBEB 1U8HB 5EWIL 2HJLA 5F7NC 5J1AA 2JB5L 4YHIA 3UC0L 2FHBA 2X9YA 4MJIB 2X9WA 5FYJD 5SWQB 2XWBB 4L3EE 1R24B 3E3QE 3TT3L 1NFDA 4YDLB 4NN7C 4BZ1H 4P2RA 4RWYL 1HNGA 4LVEA 3DVIA 4AM0B 4FMFA 4HC1H 5KOVC 2JELH 4F8TA 4EJ1C 5IB1A 4OLUH 1P2CB 1TVBA 4S1QH 1J1PH 4HJ0C 4Y16A 5B38A 4J3VA 1NC4D 2HFFB 3F7RA 2ZSVA 4UQ3B 3C5ZB 3TH3T 1G7HB 1KFAL 3HAEA 5HJ3A 3TO4C 2VMFA 2ZJSH 3QIWB 5EIVA 1YEHL 1D9KB 4ISVA 3SDCD 2BRQA 2VUYA 3EOBA 4A6YH 4ZO9A 3P4NB 4M00A 5E6ID 2VL5B 4I5BA 4LRNH 2CGRL 1IGFL 5TPWL 1RZFH 1OL0A 1YYML 1I9IH 5C1MB 4PJ8C 4RAVB 1BX2B 3ZDZF 3OAUL 1K5NB 5GS0H 2VO5A 3VI4F 3SO3C 4WUKH 5I1AB 1KELH 1YMME 1NLBL 3X3FL 3HI6L 3PABB 2ZCLH 3BEVB 1CF8L 4L4TE 1P9MA 2NY6B 3VXPA 1UWEH 4PP1C 3MBEA 1U8HA 4U1MB 1E4XH 4NIKB 4XNXH 4YXLH 3HI1B 4GS7C 4NBYB 1YEKL 4LVHC 5DRNB 1UB6B 1U8KA 4MJ6B 4M6OH 1KEML 2XWBA 1R24A 2CIIB 5D4QA 4F15B 3MV7B 3I3BA 4JZOB 4GH7B 2ZPKH 3VFMB 3C8KB 5KVFL 2RQ8A 4DEPC 1A22B 4AM0A 1OGTA 2VXSH 5D7JC 1NL0L 4MLSA 3TIEB 1IZJA 2BVYA 2ADFL 2V5TA 5JO5B 3MRRB 5FO7A 3TEUA 4NHCH 3VRLE 5L2JB 5F3HA 5HHVH 3X12B 2HFFA 3EFFB 1R0AL 4RGMB 1GHFH 3C5ZA 1Y0LB 4HIHB 1G7HA 1UB5A 1R6VA 4JO4L 1WCQA 3AROA 4PRDB 1MPAH 3QIWA 1XGYH 4JPWH 1U8JA 3MREB 4PRIA 4WFGD 4WV1C 3ETBF 3P4NA 5HHNA 5KSBE 3GO1L 1NC4B 4NBXB 1H3GA 2EE6A 2VL5A 3FOMB 5KG9B 1WWWX 4NQTA 1ADQL 5CJQL 3WN5C 1JI2A 4OFKA 1U0QA 1Y18A 2DQHH 1XGPB 1WAAA 4M1GH 4NRZB 3ULUL 1IRAY 1DL7H 3P40A 5EULV 4XNUL 4U6HA 1A3RH 4RAVA 1BX2A 5CILH 3LEYL 4LBEB 1K5NA 4UT7H 5C0ND 3B9AA 3ZTNH 2OI9C 1T66C 4S1DC 2Z8RA 3ZYJA 1S7VB 1PX3A 3AM8A 1IGMH 1CR9H 2P5WD 2WP3T 3PABA 3BEVA 3QI9C 3E2HB 1J9CT 2IF7A 4ZXBD 4HCRL 2ZNWA 3VXRE 3L3IB 1F2QA 3MRHB 1UB6A 3CLEL 2VDRL 3MV7A 1UM5H 3L5JA 2HH0H 4AMKL 4NQXB 4JZOA 3C8KA 1A21A 4X9BA 4C56A 1QRNE 2X4TB 1D5BB 4H8WL 5C92A 3V52H 3L5HA 4R97B 5CZVL 5I73C 5D5MB 5A2KH 3LOWA 2MKLC 3M45A 2JJSC 5D1QB 5E4EC 5L2JA 3X12A 5I1DB 3F12B 1ZLSL 3EFFA 1UWXH 1RUQH 4P4RA 4LSVL 1OM3H 1F11B 2UVFA 4HIHA 1JHLL 4PRDA 1QPXA 3CXDH 2EE2A 3DRTB 3HMWL 5I1JH 1I8LA 1Q0YL 3QIUD 1XAUA 5DEZA 2Y5EA 4KKAD 2OSLB 3FOMA 4F7PB 5KG9A 3WUWB 5FK9A 1CXKA 2DQTL 1S8DB 4HIIB 4K3EL 1XGPA 4NRZA 2WBJC 2ERJB 1KJ2B 2Q76B 4JFEA 4L3ED 3OKKA 3UYRH 4DGYH 4LBEA 5MP6L 5FDYA 1ZEAH 4XCNB 5DD1L 4R3SB 1KEGL 3UP1A 1S7VA 2H8PB 1AHWC 4YHZH 1S9YB 1XCQB 1DBBL 5CEZE 1SJEA 1V7NL 1KV3A 3EO9L 1I9RH 2BY0A 3SPVB 1Q72L 2EYRB 4AJ0A 3ILQC 2NY1C 3L3IA 3PXJA 3VXOB 5IVXB 2VWEE 1UG9A 2GEEA 2CKBB 4XX1E 3MRHA 3RUGE 4KQ3H 4AIOA 2P5WB 4LU5L 2EKJA 3I6KA 3O3AB 4RGOH 4X80L 2Y6SD 4PD4K 1P4IL 4NKMB 4NQXA 1KT2B 1JMZA 4ZXBB 5HY9B 4I3RL 1NFKA 3QDJE 1R3IL 2D7NA 2X4TA 1T04B 1D5BA 1FIGL 3EO0B 4JB9L 3MRQB 3ZE2F 2AXHA 3KYOB 1WUNT 4I13B 3U1SL 4JQVC 5D1QA 1NCWL 1TQCC 5I1DA 3F12A 1WQVT 3T2NL 4R4FL 5FB8B 3IDIA 4TRPL 1F11A 1QR1B 4HJJH 3WBDA 2W0FA 5CUSH 2YKLL 4U6XB 4FXGB 4NNXB 3DRTA 1DSFL 1GZQA 5L2KB 4PJ5E 3MUGB 3GHBH 4ZAKD 5FGCE 1PEWA 2OSLA 4XMLL 3TVMC 3NGBB 3WUWA 4AT6B 4OIAA 4F7PA 5IHUH 3CVHB 1S8DA 4HIIA 1MQ8A 1YNLH 1HHJB 2YD2A 3EYUL 2DLHA 1KJ2A 4OZHF 4K3JH 2FGWH 3GI9L 2EH8L 3IKKA 3V7AG 4CDGC 5H37G 5IJKC 1CDCA 3QIUB 3QP3A 5DI8A 1U8QA 2AV1B 3FKUS 3WXWH 1CQKA 1XF2B 1VCAA 3BE1H 4PJ7F 2VDKL 5EU7C 1GH7A 4KJQC 4QXUL 2H8PA 1XCQA 1SEQH 1FORH 2DI7A 4L3EB 4PTUA 1S9KC 1AR1C 3LSOB 4HMDA 3SPVA 2EYRA 2Y9RT 4JLRB 4PJEB 1QTYT 2CUIA 1HKLL 3VXOA 2HLAB 5AZEH 2ICWI 3ABZA 5IVXA 3U7YH 3VGAC 3ZLQC 5I0ZA 4EOWL 3VA6A 1JGUH 1I7RB 2HT4C 4N0UE 2FB4H 3O3DA 4LRIA 1KT2A 2VR4A 4G6FD 4NKMA 5IW1B 2ARWA 5HY9A 1NCDH 5LKNA 4DJMA 5F1NB 3VG9C 1LDSA 3NMEA 1OARH 1T04A 1RZJL 2XY2A 5T1LD 1F45A 3EO0A 5E00B 5ITFB 2ZKHL 1FAIH 5T5FL 3FB5B 3HZMB 5BRZD 3HMXH 3KYOA 5F70A 4PIRF 1U8LA 1YC7A 2DQGH 3RY5A 3EZ8A 3MV01 4NO5A 2DLFH 4YHYB 3RDTC 3JWOC 3QEGH 5FO9A 2QHRH 1AC6A 1QSVA 2NX5E 3U36B 5FB8A 3S6CA 5F9WC 1QR1A 4XVJL 3BUTA 4U6XA 4KHXL 4F9PC 4FXGA 1EK3A 4NNXA 2GK0A 4JZJB 5L2KA 4WU5B 4Q9QH 1YZZA 4D3CL 1TPXC 3MUGA 4HT1H 4AT6A 5C7XL 2IBZY 3CVHA 2UZIH 2FYYB 1S9WA 4OZGA 4LLYB 4M7ZB 3NCFB 5C86A 1KYOJ 5IBTL 3O6KH 3FMGH 4MWFB 2AJZB 4L4TB 3QHFL 2ITCB 2PTUA 5C3LD 5L88H 2AV1A 4Y2DD 1DBMH 1XF2A 3GKWH 3CVIL 4GMSL 1DR9A 5EU6E 3VWKB 4CVXB 5I71B 4O00A 3MLWL 4J2XA 3AREC 5IW6A 4L3EA 2APBA 3LSOA 2CUHA 2X2YA 1S7XB 2HLAA 5ALBL 1F4YH 4NWTH 3P30H 1M4KA 1VHPA 3K4ZA 4P48A 4U0RC 4PR5B 2NXYC 4RISH 1ZGLP 1ZHLA 1I7RA 5IESH 1T7WA 4M48H 3VWJC 1CFSB 3MRLB 5F1NA 2XKNB 4QHUA 5HI4D 1LO0L 3RIFK 5ITFA 4V2CB 3NPZB 3TLRA 3NFNB 3HZMA 4BM7A 4NYLA 4FQXC 1ZXQA 2OK0L 1N4XH 2EDKA 3LZFH 4PJAB 3JUYA 3BISA 3OGOE 2EH7H 4NJAL 1ZLUK 4TNWK 4QRRE 1OTSD 5LBSL 2A9NH 1D7FA 5D9SB 2PW1B 5I9QB 4J3TA 1TNMA 1MFNA 1J87A 3PHOB 5BRZB 4HWZA 4JZJA 1KN4L 4WU5A 5E8DH 1F4AA 1K8IB 2B0SL 2BOBB 5D2LF 5DJZB 5CD3B 2BOCB 4Z78A 1HSAA 1CL7L 1D5IL 2FYYA 4RQQB 5F8RC 1NPUA 1YMMA 4L8DB 4KKLD 4F9LC 1ZSDB 2FDBP 4GMTL 4NZUL 1AE6H 4MWFA 2AJZA 1REIA 4L4TA 3VXUE 2ITCA 4CVUA 1VFMA 4OI9A 3VXRB 3PP3K 5F93C 2I5YH 2CRMA 4X7SL 5GJTH 3VWKA 3O9WC 4EI6B 3ESUF 5HPMA 3NPSB 4RX4A 4XCYA 4DFHA 2FWOB 5D71L 3LKOB 4YHOL 1BVLB 2HP4A 2UWEB 3KYKL 4Y2DB 2X70B 1S7XA 1N6UA 4PR5A 1WGOA 3VGFA 5FKAB 2ENYA 5B4MC 1T1WB 2HG5B 5BW7A 4IOFC 2B2XH 2ADJB 3SDAB 3MRLA 5I1IH 2XKNA 4FFYL 4ZQKA 1IBGL 5C2BL 4MAUH 3D0VB 5EUOF 1RQ5A 4U6YB 5CINH 4Z7VF 3O11B 4WEMB 2AV7B 4Q9BA 5KZCB 4Y1AD 1MQKL 1MAMH 1DZBA 5ITBL 4AEIL 4I9WE 5KSBA 1WT5C 4XWOD 2NLJB 1CFQB 5D9SA 3BPOC 1JGDB 1A7NH 5JHLH 4KUCF 4MAYB 1GZPB 3DYMA 4CN6A 2FX7H 5DJZA 1VSCA 5CD3A 2BOCA 4QTHB 1RJZB 5C0AE 1GPOH 3QDGE 3HB3C 5JW4M 4M43L 4L8DA 4KMTL 1ZSDA 3U4BL 4DVRH 4GXVH 1S7SB 1L9MA 12E8L 1OAKL 4UBDD 4LLDA 4WTXA 5I1HH 3LKSB 3EJZD 2KPNA 3VXRA 4G9FD 2R0LL 4JE4B 2KZWA 3RUGB 4EI6A 5J7CC 3S96B 2OQJB 3Q1SL 4DZ8A 4XC3L 2FWOA 4OGXL 2YD3A 4Y2DA 4XT1C 3GMMB 4B0MM 1LGVA 3BO8B 4J12A 1QRNA 4MA1C 1GSMA 1RMFH 3AY4A 5FKAA 1HXMB 4QHKI 2R1YB 1KTDB 1T1WA 2D3VA 4PLJC 2ADJA 1PVHA 3SDAA 1WEJH 3TIDB 1JV5B 4X5WB 2BSSB 1II4E 4XVTL 3D0VA 4Z7WE 4POYA 1NMBH 4U6YA 5LGKA 3O11A 3QQ9C 4H1LA 2AV7A 3RAJH 1H3PL 1H3WM 3VJ6B 4HG4K 2HT2C 4TSCH 1D5ZA 1WWAX 4WFHE 3NA9H 4R4ND 2NLJA 3KYAA 2DQDH 4JM2A 1WZ1H 1JGDA 2G60L 1GYAA 1IGCH 1YPZB 2YRZA 4DGIH 3RJDA 1U3HB 4MAYA 1GZPA 1BQHA 3EYVB 1ZTXH 2GJ6E 1YYLH 4HQQL 3UTZA 1V5JA 1RJZA 3CUPB 2Q8AH 3U30B 1F4HA 2PYEE 4HG4J 4OM0H 4PLKD 3L9RB 4IEFB 4OD2B 4P5TC 4XZUB 1S7SA 4BH7B 1BWWA 1KJ3L 3VXQB 3NABH 1TJGL 1BJ8A 1YEGH 1A6PA 3MCKB 5B39G 3LKSA 3NCJL 4BH8A 3CSYB 1XR8B 3SY0A 3H42L 1S3KL 3B9VA 2H26B 1RUKH 4KZDL 4LIQL 2CRIA 5F88B 1HK6A 1NQBA 2PR4L 5IUSA 3RUGA 3S96A 2OQJA 4NT6A 4U7KA 3W9EA 3FT2B 1NGZB 4N0UB 4E5XB 3GK8L 1NAMH 2V9QA 4NO0A 3BO8A 5TQ2H 4OCWL 3SOBL 5KSAB 4YHKH 3QDJA 3L1OH 2CPCA 3ZKXC 2A1WH 1ZHNB 4FOMA 3NVQA 2AEWA 4MMXC 3W0WE 4U1NB 2R1YA 1KTDA 4JR9H 1Z6JT 5JHDE 4O58H 3TIDA 3T77A 4LPUA 2Z8SA 4X5WA 2BSSA 4LDEB 2DTSA 1UZ8B 5I1CH 2NX5B 4Z18A 2XZAH 1KOAA 3GM8A 3D48R 4HS8H 5I1LB 1CDJA 3LEVH 1ORQA 3VJ6A 4OCYL 1G1CA 2VXUH 1TXKA 4PJ5A 3VXUD 4PJXF 3V4VH 2JK5A 2BVOB 4LF3B 5GRUL 4GFTB 3E1F1 3K1KC 1OD7A 1YEIH 2PW2B 2E8YA 3BWUC 5JXED 1F4WH 3O2WH 1U3HA 4WJ5B 3NZHL 3O0RH 5CJ5A 3RGVD 3PWPE 4KQ4L 2OP4L 4JEGB 3A67L 3CUPA 32C2B 1GGUA 4PJBB 4FABL 1QLEL 3FFCD 4PJHE 3L9RA 3D87B 4XZUA 2RFXB 4JFDE 2DI8A 4OIIH 3MCKA 3U48A 4NUGL 2C3HA 1FN4B 4PREB 4YUEL 3U4EA 1XR8A 3FAWA 1I3UA 1JWUB 3DMMD 2ZNXA 1SBSL 2H26A 2YA0A 4M7LH 3G08B 5F88A 5ABDE 3S3PA 1A6TB 2NYYC 1VEOA 4ELME 4QRSB 3VGBA 4J4PA 35C8H 4KHTH 2B8OT 3FT2A 3LCYA 4N0UA 4E5XA 4OI7A 2AK4E 3LH2L 1FNSH 5KSAA 5JIKA 3MPCA 1ZHNA 1OAQH 5AAMA 2VDOH 4OQTL 4UT6H 3NIGF 1CK0L 4IS6B 1CS6A 4QOKD 1PG7H 2NY5H 2XZCL 1MY5A 4CADB 2KL6A 2NX5A 3FHAA 3P9MA 5IR1B 5I2IA 3CJJA 3T0WA 5I1LA 2BY3A 2DMCA 3MLYL 3RI5K 1HZHH 3U7AA 1F8TH 3HPLB 1AFVH 1X5FA 1PW3A 4PFEA 3T0AA 4AG4L 5FV2A 4B53A 4DKFH 1FVCB 3CFBB 3S5LB 4WJ5A 3B2VH 2KBGA 4X0KB 2W38A 5DJDA 3VXUB 1J86A 5K9JH 1CU4H 3RNKB 1RD6A 4K94H 32C2A 4Y5YC 5KN5A 3WE6B 4KXZH 3WSQL 4RBPK 4W6XB 5EU6A 3L5XH 4HS3A 2DLEA 2RFXA 2E6PA 5LGJB 2VDLH 5DZLA 4X83A 1FN4A 3FB7A 5HHXH 3QDMD 4XPHL 3RGVB 1JWUA 4ALAL 5DMKB 2JJTC 1EIBA 4UU9B 2ARJB 5JLZB 4IRSD 1A4JB 3QWQB 3DNKA 4DQOH 1A6TA 1URLA 3IFPB 4QRSA 4JPVH 1HINL 5TE6H 2D03L 2IH3B 1KLUB 3LS5H 1QQDB 2DJSA 4R8WH 4M1CD 3HNTH 5KVDL 2IPUG 4ODVH 2DIJA 5FUZL 4JO3L 3QA3A 3GDBA 5I75B 3NCCB 2P46B 3RTQD 2A9MH 2VKXA 3MRGA 2K3TA 4ZSOE 2R1XA 2DQUL 4GG6E 3O8XC 4KI5D 4QYOB 1ND0A 1FFNB 4GW1B 4NKIH 3BVNB 4M9OA 1OAZH 1V05A 4CADA 4QRRA 1B2WH 5F7YC 5T3ZE 5IR1A 5D1ZD 1TENA 5ACZB 2IANE 5EZIH 2PYED 2VUOA 4NOBA 5KSUB 4P2QD 4EZMA 1I85A 4JRXE 4KJPD 1FNLA 4BZ1L 3C6LA 4OM1L 1NKOA 4HC1L 4WW2B 1N7MH 1S7TB 1U8IA 4DVBA 4C58B 5I0DA 3DWTA 4U49A 4TSAL 5JR1L 4IMLB 1FVCA 3BSZL 3CFBA 3H9SE 3ULUC 5FHBH 1I1RA 2X4UB 4HH9A 4DTGL 4X0KA 1OSZA 3S36L 1JYNA 1OGAD 3VXUA 1FNAA 4WFFD 3RNKA 1P84K 2FD6H 3B9DA 3VW3H 2ZJSL 2OR7A 1D5MB 1CLYL 2WK2A 3FQTB 3BGAA 3B9EA 4A6YL 2MNUA 5JXEA 1QSFE 1JRHL 3OSKA 1JCKA 2XZZA 1E4XI 2H32H 3EYFB 2MJWA 3VFSB 2Q20A 2LFGA 4LRNL 3RGVA 4MA3B 2AEQL 3QCUH 1QOKA 4UU9A 2ARJA 5JLZA 4U7SA 1A4JA 2ATPB 2OJZL 3IFPA 3UZVB 1KLUA 1QQDA 1P84J 4W4OA 3I9GH 5DR5H 2XOTA 4WUKL 4IOSD 1MF2L 3JWNC 3X14B 2MQ0A 4KRPC 4Z7WB 1B4RA 4RDQF 4IRSB 1HYRC 4GRLA 1UWEL 1MHHB 3HC0B 4QYOA 4P9HH 1FFNA 4IJ3B 4YNYA 3BVNA 3GMOB 3QPXH 3PWPD 1BJMA 1UEYA 5ADPL 5EFIB 5ACZA 3VDAA 1BAFH 4M6OL 3R4DA 5KSUA 4KTYA 3DRQB 4GLRI 5DJYA 5DA0B 1QSEE 4M93C 2ZPKL 4GRWE 2VXSL 4CMHC 1R3JB 1S7TA 3O6ML 5KANG 5C0AA 4EBQL 5BV7C 5D1ZB 3QDGA 2PYEB 4IMLA 1ERNA 4RRPA 4CNIB 4CRPA 4GO6B 4K9EC 2X4UA 1BQSA 1XGRB 3KHQA 3GSQB 4WENB 2A2QT 5EZOH 2IMMA 5JA8B 4NQCD 3VD5A 2AJUH 1X3DA 2I9LB 2D7QA 2UUDK 1XGYL 3DX8B 4JPWL 3UMTA 1BHGA 1D5MA 3FQTA 2YZ1A 3OXSB 1NH6A 3KHOA 3PDDA 3WXVH 5IB2B 1NAKH 4BFIB 4O5LH 1AJ7L 2ICWB 1WITA 4ZOCA 2DQHL 4M1GL 5BMFH 2ATPA 5M94B 1HDMB 5C9JB 3W0WB 3INUL 4LLQB 4X6DF 5JHDB 2MMXA 25C8L 1P7KB 1OT1A 4Z7UB 4HD9A 3X14A 4Z7WA 1S78D 3VD4A 4IRSA 2A73B 1JUFB 4U1IB 3MRKA 1ZT4B 1T83C 1KCRH 5J1TC 1MHHA 1IEBB 3HC0A 5B3JF 2WSKA 3A6BH 3MRJB 5F21B 5CP3H 2CJUH 1FPTL 3GMOA 1CE6B 5CSZB 4JG1H 5DJ0B 4XHJD 1KACB 1J0IA 5EFIA 3WLWC 1LQSR 4ORGB 1PD6A 3DV4B 2VDML 3ZE0F 2GJ6A 3QXTA 1KPVB 1R3JA 4J6RL 4NZTH 3VD3A 4MJ2A 1H15B 1EMTH 3CFJB 3PWPB 3LQAH 4LPCA 2PYEA 3OKLB 1EH9A 1FDLH 4CNIA 1GOGA 4HF5L 5C0RL 1KENH 1FCGA 1XGRA 2G2RB 4POUB 1MCQA 3KS0H 3UJIH 4Y4HD 3OMZA 5HGDB 1BD2E 1ROWA 1CI5A 5T5NF 1N8ZB 3RWCB 3QZWG 1WIOA 5IK3A 5IEKB 3WIHL 2WUBL 4P9MH 1V3MA 2AS5M 1YECH 5IB2A 4BFIA 2ICWA 1T6WA 4NQCB 4OCMC 1ZLUH 4E41E 4BZYA 2X44D 3W0WA 3UYRL 1JIBA 2XN9D 4DGYL 5JHDA 5MHSE 5JPMA 2PCPA 2Y4SA 2Y36H 3RWGB 2OS7A 1SM3L 2IGFL 4NGHL 2IAMC 2A73A 1JUFA 4U1IA 1ZT4A 2FATH 4O4YL 4YZFF 1LE5B 1OSPL 4MD0B 4MHHG 2FBJL 3MRJA 1PFCA 2VISA 5CSZA 1VKXA 2EZ0C 2R0WH 3PP3H 3V7AE 5EO0B 3EDKA 2CLZB 4ORGA 3ROOB 4X6BA 1KTLB 5E9DD 1MJ7H 3QNXB 1JFQH 2X1PA 5F9JB 1N6QH 1XH3B 3CIQA 1JVKA 1W8OA 2VLME 3CFJA 1C1EH 3PWPA 4GKZA 1M7DA 1MI5D 2XXCB 2V17H 2AW2A 3OKLA 2LVEA 3THML 2O61B 3MGOB 3EOTL 4PJHA 4WGVB 4YWGH 3TN0A 3QUMH 4YIQA 3T4YB 2G2RA 4JFDA 1JZ6A 4ZUSB 5HGDA 4G42A 1JGVH 5EO9A 5HD8D 4X6EB 2BVEA 3GSUB 4HK0B 4HJJL 1JN6B 1HILB 1PX4A 1UACL 4XH2A 5HDQH 2BY1A 1N8ZA 5MEND 4JFFD 3S4SB 2HVKA 4PJFF 5EDXA 3CFEB 4DCQB 4N8PA 3RL2A 5IEKA 3KPSE 4TSBL 4ELMA 4ZUWA 1QVOB 4ZODA 3GHBL 5HYQB 4NRYB 5IHUL 2AK4A 5E2UH 4FFVC 5I1KL 1INDH 2EIEA 3MOBH 3ULVC 3REWB 6FABL 4UNVA 4DUXA 4ZSOB 1JZ5A 3DSNA 4HS6B 1RURL 4Z7OE 3BE1L 4GG6B 4WUUE 1F58L 2HT3C 4Y16C 3RWGA 2EEDA 1AO7D 1T5XB 1CXEA 1YNKH 4ERSH 4D0DB 1SEQL 2A74A 3K4DA 4P2YA 5EORH 2BCKA 4LCCB 1GVIA 2F19L 4LLWA 4HZLA 4R96A 4JRXB 2XN9B 3IETA 4OBRA 4G3YH 2Z91A 4MD0A 4MNHB 5GZND 4G6KH 4BZ2L 1J11A 2YPKB 4GW5B 2V2XB 3SDYL 1JGUL 4JN1L 1A3LH 1MELA 2CLZA 3ROOA 3H9SB 3QXAA 3RA7H 5C3TA 1NCDL 3IDGB 3QNXA 5F9JA 1SEBA 1T4KB 1XH3A 5ESQB 2BXZA 4RGNC 1J0HA 4LKXA 2FCBA 2BP3A 3HMXL 5E6YA 2DWEB 2O61A 3MGOA 2VXVL 4EDXB 1KCUH 5I8OL 2V5RA 5F71A 4P2OD 1QSFB 1C16B 5JA9A 3QEGL 1P9MC 4ZUSA 3MBEC 5F3BA 4X6EA 3GSUA 5JDSB 1JN6A 1HILA 3BT2H 4WFED 3CFEA 3GI8L 3WFEH 3ZKSD 5T3XH 2P44B 5D7IE 3BI9X 1QVOA 3VFVB 5HYQA 1U3JA 2UZIL 2CDFA 1JPGB 4G5ZH 3P4LA 1WICA 3V6OE 1QPPA 4MLIA 2A77H 5L6YH 1FC2D 3REWA 4U1GB 4ZSOA 1LEGB 5L88L 1SBBA 2NW3B 4HS6A 1QLFB 1DBML 5IMKB 3UPRB 1H3UA 2RIKA 4GG6A 4N68A 1PJ9A 4GAGH 5GGQH 3PXHA 2MQ3A 4D0DA 3U7WH 3C5ZC 1J0ZA 1LEIB 1CXFA 1HH9A 2IANA 5L9DH 1BOGB 4JRXA 1QSEB 4Q9CA 3BYTA 2BNRE 3O4LD 4GW5A 1DTUA 4AY0A 3B6SB 3P30L 2V2XA 2EYTB 4EN3B 3U0WH 5BOZG 2VLRE 3H9SA 3KPLB 5H2BB 2LE9A 3IDGA 3U0PA 1UWGH 4U6VH 5ESQA 4M03A 1F6AB 3EJYD 3NN8B 4XP6H 5DJAB 3OR7B 3TYFB 4RSVA 4JRYD 5FYKU 2DWEA 1KIQB 3AM8C 2X6MA 1MVUB 1FFPA 3LZFL 4EDXA 2GKIA 1QSFA 1C16A 4K7PY 2NY6C 3G5VA 5DQ9A 2XWJB 1G0XA 3FL7A 1ULVA 4NRXB 5IMOB 5KS9B 5E99H 4N9GB 1MFBL 4JPIB 1L6XA 5J4MA 1F97A 4P2OB 3VFVA 3IU3B 3O6FA 3V6FB 2D4DA 4HUXB 3B5TA 2CKNA 3QUZD 1A0QL 1I1AD 3FQRB 3SDDD 3X3GH 1PGRB 3G5XA 3ARFB 1LEGA 4L8BB 2NW3A 1AD0B 4ZFZB 1VENA 1TIUA 3UPRA 3UAJC 1Z9OA 2AJXL 4GQ9H 5DJCB 3O2DH 5ADOH 1QYGL 4TQEL 2F58H 2UVEA 3WS6A 2DMBA 1Z9SA 3EUUA 3U79A 1BOGA 1QSEA 3ET9F 3PWVA 1I8LC 2FJGB 5DO2D 3QXDA 3B6SA 2EYTA 3HKFA 3OX8B 2BHUA 4XNYL 1A4KB 1UM4H 1XR9B 4GW4A 4XC1L 4EN3A 4MZ2A 3H7BB 4IRZH 3UTPD 3V95A 4AIZB 4APQC 1MIEL 4NHUA 2DQJL 4I0PD 2FJFB 3KPLA 5H2BA 2NMSA 2AK1H 1B6UA 4MQXC 2OCFD 4UB0H 4MAUL 2HN7A 5HGAB 1BD2B 4C57C 3KDMB 1F6AA 2VN7A 5A16B 5CINL 3NN8A 5DJAA 4P23D 2VC2H 4TTDC 1LO4H 3TYFA 2OR8A 3AS0A 5CGYD 1MAML 5FM8A 3TZVA 3KLHC 3DVFA 5HVHB 2P8LB 3AGVA 2XWJA 3GNML 5TH2B 2VQ1A 2OTUA 3BWAB 4NRXA 3HNSL 4K8RL 5DWUL 4N9GA 5F1IB 4JPIA 4JRYB 2N4IA 4E41B 2FR4B 2DD8H 1EPFA 5FXCH 3WNOA 3FO0H 3DI3B 4RFOH 4P2OA 1DQQB 4UMGA 4K71B 3DGGB 3WD5H 3V6FA 3WDJA 4HUXA 1RI8A 5EOCL 3FQRA 4XXDB 3DGCR 1FJ1B 4R97C 4DVRL 2ZG3A 1OY3B 3ARFA 4NFBA 3L95B 7CGTA 5I1HL 4YHLL 1IGJB 4MDJA 4WEUD 2P45B 5F6HI 5D1QC 3QUZB 4JFZL 5DJCA 5KANI 1I1AB 3BRFA 1GL4B 3ARGD 3BN9D 3QT2A 4Y4FD 5EZJA 2YEZB 2J88H 4M5ZL 2NXZD 4GQPH 4RBPH 5DUML 4QXWA 5JOPE 3ULUF 2FJGA 3N9GH 4RAUA 3S35X 4GKNB 1T03L 3A6OA 2QTEA 3X11A 1RMFL 3OJ2C 1CT8B 3OX8A 1A4KA 1XR9A 3H7BA 2FJFA 4W70A 2ERJC 5CBEA 1WEJL 4LPTA 1Q1JL 3TWCH 1A6VL 1BD2A 1NMBL 5A16A 2VDNL 2O5XH 1MJJA 4D9QE 2P7TA 1A1MB 3WO4B 3ALWA 3FZUC 1FVEB 1KJMB 3G6DH 3KPSB 3P9WB 2P8LA 5TH2A 3QUXD 3VU2A 3QEUB 1FGVL 3BWAA 4GUPB 1FE8H 1CLOH 1N59B 3HS0B 4B41A 1NUDA 4OB5H 4DGIL 2CLVB 4PJCF 3VRIB 2FR4A 4E41A 4LPVA 5IQ7H 4H20L 2EDNA 4ZOEA 1YYLL 4YGVB 1DQQA 4RMVA 5IWLA 4LRIC 1RIUL 1W72A 3E8UH 4RA3A 1T2QH 2Q8AL 4XXDA 4OM0L 4WO4D 1ZHKB 2BDNH 3VXTB 3RVVC 3ARYA 2NY4C 1YMHB 3L95A 4I77L 3T4AB 3MFGB 2X4SB 4KROB 3MRDA 3SHSA 4ODSH 2N1KA 4ZTPH 5I74B 4C83B 3KXFD 3T0ED 3BPNB 2CO7B 3T3MF 3ISWA 3D85D 4UTAH 4FFZL 3NIDE 2YEZA 3JXAA 1AIFB 3F8UB 2MCPH 3SE9L 4OGAC 5BXFA 3KYNB 4A6YB 4XPTH 4QLRA 2OM5A 2HKHH 4GKNA 4Z8FH 5GZOC 3UROR 2J5LB 3NGBC 4JG0L 2A38A 5TDNA 3ARGB 4JZNB 1QBLH 3L6FA 2DKUA 2NY3D 4O58L 2FIRT 1N5YL 5DEGB 4KVCL 4JVPA 1CICD 3BZDA 3TJEH 3RWFB 4JQIH 2EC8A 5FM5M 1RFDH 3CDGB 5CHNB 5E8PB 3MLXH 5HHOD 2E7LA 4G43B 1A1MA 1LDPH 1MCOH 2UZYB 3QHTC 2J8UF 4YDKL 1FVEA 1KJMA 4FS0A 3AU1B 4FQJH 2GTZB 3KPSA 1LO3L 2X89A 3U82B 1U42A 1HKFA 1OQXA 3E3QC 3QEUA 4O02L 5FYLE 1K8DA 2O5YH 1S7WA 1N59A 3HS0A 3W11C 3KJ6H 5I6XB 3VRIA 1F4WL 3O2WL 3PL6D 3W9DB 3LMJL 1J0YA 3O0RL 4MHHI 4YGVA 5D96C 4POZD 2E7HA 2XYCA 3BPLB 4WUUA 1W0YT 3F7VB 4N1EA 5EA0H 1H8SA 2R2HB 3H9HB 3VXTA 4DGVH 5DFVD 3T2QA 4L5FL 2NTSP 3QXVA 4XPGH 2X4SA 4AEHH 1XEDA 1Q9KB 2BNRB 3PDGA 1TJHL 4YHYC 3JWOH 3KPOA 4WO4B 5GSRB 1UEMA 4NCC2 1G7JB 1AIFA 2UUDH 4KHTL 3KYNA 2HMID 5DLML 2VLRB 2RB8A 5KTEH 1JPFA 3B4NA 3HC4L 4JZJC 2CXGA 4BSWB 1L6ZA 3L3KB 3OKNB 4NQEE 1ES0B 3LEXB 5GRXG 3D85B 4UT6L 3BKCH 2FIKA 2ZUQB 1I7UB 4KK6C 3OKOA 2N7BA 3UJJH 3RWIB 3VFNB 5DA4A 1C08A 1BQUA 2VR9A 3V5HA 1AP2B 2J6EH 4KFZC 3RWFA 3BIAX 3CMOL 2Z93B 1FQ9C 3HE6D 5CHNA 5E8PA 1J05A 1VERA 4LP5A 1VFBB 3P4MB 2FBOJ 4G43A 4OV5B 4KXZI 3QNZA 1WFTA 4I48B 2NY3B 5ID0A 1WF5A 3VWKC 1AD9B 3P0GB 2GTZA 5D7IA 2MKWA 3HLAB 1AFVL 4MNQD 4Q2ZB 4XNQB 2YBRB 3IFNL 5HHOB 3V6OA 4L3CB 5F9AC 4Y4FC 3F58H 1TCMA 2F54D 3W9DA 5J6HB 4Y4KD 2VZUA 5BW7C 2LAGB 5ICYB 3MODH 5ELIA 4BFEA 1RK0B 2HRLA 5EIIB 1KJVA 3ZKMD 3H9HA 1MCJA 3VMOA 1IZKA 3LDBC 3PL6B 4N0CD 2DRUA 5DFTA 1H3TA 5SX4H 2VDLL 2DQIH 1Q9KA 1ZVHA 1BBJB 3BUYB 3CPLB 5LGHH 2BNRA 4K7FB 1T1YB 3MROB 4OCRH 5E2WH 3T2OA 4WO4A 2J8HA 4D9LH 4ZFFB 1G7JA 2E5EA 5I9QC 1VFAB 5TE6L 1EGJA 2BSRB 2EIZB 2J4WH 3TCLB 2VLRA 4R8WL 3I2CL 4P46B 4YBQC 5C8JB 4BSWA 3L3KA 3OKNA 3GBNH 4ODTH 2E9WA 3LEXA 3ZT5A 1IT9H 1NGYA 2Z31B 4KJYA 4X5XB 2I60H 3O4OB 3RWIA 3VFNA 1IC5L 5TQ0H 4KTDL 2Y7QB 1BBDL 4ORZC 1B2WL 1NFDF 3CFCH 2SEBA 5IHLB 4LDOB 4MZ3A 4ESKA 1VFBA 3R0NA 4OV5A 2OZ4H 4I48A 3ARQA 4KPHH 1RJLA 3NPSC 3N0PB 3ULVF 3VGHA 1IQWL 1N7ML 4LVNB 4HUVB 3HLAA 4Q2ZA 4XNQA 1KUMA 4U05A 2YBRA 1RZGB 4GAJH 3MCLL 2DQCL 5L7XH 3PWJB 4QRQB 4HV8A 3AY4C 5FHBL 1EHLH 5J6HA 2ICWJ 5LVEA 1UH2A 5ICYA 3SDAC 2FD6L 3EYSH 4KKBD 3VW3L 4LCIL 4CMMA 5EIIA 4AEEA 2F54B 4HPYH 4R2GC 4XAWL 3BUYA 1BBJA 3CPLA 3G5YB 5SWSE 3QCUL 3MROA 4K7FA 2FEEI 4R90L 4IDJH 3IGAB 4TUKL 4ZFFA 4JM2C 2VSCA 2BSRA 2EIZA 3TCLA 5B39B 4P46A 1ZVYA 4MAYC 5DTFB 5C8JA 3PIQB 1MRCH 1IAIH 2Z31A 1MLCB 2G9HB 1GGCH 1E4KA 4EI5A 4KVNH 1MWAH 4UUJB 4HWUA 5HYSB 4R26L 2BNQE 2ADGA 3CK0H 1CD0A 2Y7QA 3ZE1F 1ZA3A 2ZP0T 5DHVH 2VLKE 4NJ9H 1X4ZA 3HPJB 2VWEC 4S0TD 5MERB 3DETC 4DK6A 3S34H 3DARA 4HUVA 43C9A 1RZGA 1C5DB 4U1LA 3PWJA 4FQPA 3BKMH 5E94B 4QY8B 1AXSA 4QRQA 5AD0B 4Z95H 1P4BH 5C9KA 1IKFL 1ACYL 2R2EB 3LY6A 4F57L 5IFAH 4KJWC 3MJ9H 3P73B 2OMBA 3WXVL 1NAKL 1WAAF 3B5GA 3HNVH 2P8MB 4ZG1A 1AKJD 4G7YH 5CKAA 3PWNB 5IQ9B 3IGAA 5DURB 2VLJE 1HYSC 3RVUD 5I8KL 1CIUA 4R7DA 2EE9A 2Z9TA 1G9NC 2FLRT 4FP8H 5B39A 1H5BB 1U3HC 4R7NB 3SBWA 5DTFA 1MREH 1ZMYA 5I15H 3RVXC 2MOVA 3UTSD 1N6VA 4LLAA 2HLFC 5DYOB 2NW2B 3RVWD 1DANU 1U58B 1G9MC 5JPNB 2ZUSA 4JG1L 2ED7A 3VFGL 2NQCA 4WI4A 2ID5A 4ZD3H 1ONQB 3HPJA 3MV9D 1K6QH 2CR6A 5H94B 5MERA 4MXWH 3TCXA 1P7HL 4HKZA 4LOUD 4J4PC 1N64H 1EMTL 3LQAL 3KPTA 1A5FH 5I30H 5CCKH 5GRYA 3CDYA 1RIVH 2EDRA 3NTCH 3DURB 3Q6FB 4UOJA 4QY8A 2DDQH 1BFVL 3BDBA 1AQDB 5HVGB 2BXYA 3MRPB 2WIIB 2GSGB 4KKCC 3B8YA 1F90H 1E4JA 1MCBA 4MS8C 1J0JA 3VI3F 4K8RD 3VDBA 3RKDC 1JF6A 2J12B 1XIWD 2EDFA 3P73A 2R2CA 3OG6B 4QO1A 2W1NA 3PWNA 1J1XH 1CBVH 3G04B 3CSPA 4WWKD 3S3JA 4NQVB 1T1ZB 1KGCE 2LQRA 4JFOB 3OHXB 3MLUL 4LARH 3HZVA 4RZCB 4D8PA 2CMRL 2IQ9H 4CAGA 1X4XA 3D6GA 1NGWB 2JCCE 3EOAB 3HUJE 3DYPA 4JFHE 5DJ8B 1IC4L 5DYOA 2NW2A 3P0YH 1U58A 5JPNA 1T2XA 2QADC 5EWIH 5HVFB 1ONQA 2RR3A 4JDVB 2JB5H 3UC0H 3UTSB 4G6ML 4Z7NF 1ZLWK 3VE0B 3TT3H 1D5XA 1S5IL 4L1HA 3DHJA 4RWYH 2Y5TB 4FTVD 1NGXB 3ARZA 1FZMB 2IWGA 1OB1A 3GEWB 3Q6FA 4W4NA 5DZNA 2E6JA 4YWGL 1AQDA 3FCTA 2WIIA 2GSGA 4CJ1A 1WIUA 3TJHD 3EBAA 1WK0A 1KIRA 4QHKJ 3GJEB 2AEPL 2M1KA 4HJGB 3QNYA 1KFAH 2DS4A 3BP4A 2HFEA 3C6LC 2RGSA 3QJHB 3BKYL 4G6JL 3CH1B 2VLKD 4NQEA 3CXHK 4H0GA 5CLWA 1IAMA 4LKCA 2CGRH 1IGFH 5TPWH 1A6ZB 3G04A 1U92B 4FQLL 4DKEH 1YYMH 4JY6A 1T1ZA 3MUHL 3P0VH 5IBUG 4JFOA 2OL3L 4HGWB 3GMRB 3MLTB 2HJKB 3K2MC 4WU7B 1YNKL 5C0BE 2DOCA 3ROLA 3LKRB 4HPOL 3BP6B 5EORL 4OSUL 4P2CG 3FT3B 5E2TH 3I85A 3EOAA 3QHZL 1NLBH 5IVXF 4G3YL 3X3FH 3HI6H 3OXRB 1CF8H 1JGEB 2APTA 3U46B 3CXHJ 1YEEH 2AQ1A 4LHQB 3GSXB 4O51B 1ZHBB 4JDVA 5EB9A 1YEKH 5ENWB 1KEMH 2VQUA 1NFIA 3VE0A 4OCSL 5LXGL 4ODBD 4H88L 5KVFH 4W4OC 4G9DA 1NGXA 1FZMA 1UXSB 1NL0H 3RVUC 2NZ9C 1BREA 2ADFH 3D0LB 1ITBB 3ES6B 2XFXB 4GRLC 2JIXD 1BMGA 1ZWIB 2C1PB 4U33A 2FECL 3BT2L 1P5VA 2OBGA 5SWSB 1R0AH 1P6FA 3STLA 2W59A 4HJGA 3MX0A 4J23A 5T3XL 4PB0H 1VACB 4JO4H 1DQDH 3WNMA 4G8GD 4RFNB 5J12C 4OZGF 3J7HA 5F6IB 5FOBB 3QJHA 1JF1A 2OTWA 3CH1A 3GO1H 4KRMB 4HKJB 3MO1B 3MOAL 1S7RB 1ADQH 1CQYA 5CJQH 2A77L 1A6ZA 2GW5A 3EYOB 3EDDA 2BNQB 3ULUH 2F8OA 4M9PA 3DIFB 3FFDB 1AGCA 4HGWA 3MLTA 2HJKA 5GGQL 4Z77B 1GJIA 3LKRA 2VLKB 3FT3A 1MCLA 4R6UA 3OJMB 2DQFB 2PTTA 3T3PE 1MHCB 3GIVA 3VFTB 3Q6GL 3U46A 3RQ3A 2F74A 5CWSA 5D1XD 1JK8A 4PJGF 4TVPL 3V2AR 3U0WL 2E9BA 4K7PL 4QRPD 2Z8VC 4ZUUB 3Q2CA 1ZHBA 3MACL 5FF6B 2G5BB 1DBJL 3CLEH 1UWGL 4I18A 1PAMA 4P4KC 1NAMB 4AMKH 5GJSL 4JKPL 4PGEB 2YD1A 3MXVL 4PG9A 4H8WH 3LPFA 3WMSA 5GGRY 5CZVH 43CAA 3D0LA 2WWMC 4NZDA 3ES6A 2XFXA 5E2VH 3WDHA 4DW2L 1FYTD 1ZWIA 2C1PA 4IJ3C 5SWSA 2X41A 2O5ZL 3H2WA 5GISH 2V5YA 5EBWB 3GSNL 2VLJB 5CD5C 1VACA 1JHLH 4JDZA 1KXQE 2I25N 4O2CB 3HMWH 1BF2A 2D0FA 1Q0YH 3ESVF 5FOBA 4Q7DA 4UIKL 1NDMA 3QEQD 3MO1A 1ZE3C 1ITCA 5BV7H 2DQTH 3EYOA 4K3EH 4UILL 1QFPA 4NPYA 2BNQA 4G8GB 4NNPL 4K9EH 4X4ZA 3FFDA 1FNGB 4RMWA 1CDIA 2VKWA 5MP6H 5CJXA 1XGQA 2F58L 2VLKA 1MCNA 3JWDL 3FQXB 4XMPL 5GRJH 5DD1H 1KEGH 4OZIE 2JJUA 3PGDA 2DQFA 2C4FT 1MHCA 4ETYA 2AAVA 2B1AH 4HIEB 1V7NH 2YD7A 4P3CL 3EO9H 5E4IA 1Q72H 3X13B 3VRLF 3T0DA 2Y23A 3VFWB 3FTGA 5E7BA 5FF6A 2G5BA 5D7SL 4ZS7H 1WBXB 2E7CA 4HUNB 3V4UH 4UB0L 5INDA 3RZCD 1NAMA 1WV7T 4LNRB 4PGEA 2B39A 2NY2B 4I3RH 2VC2L 2V7NB 4QRPB 3IS1X 3WS3A 1R3IH 5KSBF 1FIGH 2X7LB 4JB9H 3F5WB 5F7EL 3LPGA 4MXQC 4OUUA 2XTJE 4DKAA 4ZS6D 3U1SH 1NCWH 1DN2A 1BQLH 2RJMA 1ZAGA 1SVCP 3LB6C 4HFUH 5EBWA 4TRPH 2VLJA 1JI1A 2ENSA 4QCIB 2BVPB 2P24B 2YKLH 1R3LB 4O2CA 1DSFH 3O41B 2DBJA 4AL8L 4LQ1A 3IDUA 4Z7QF 3K8MA 5FHAL 3RY4A 2YXFA 3SQOH 3FQUB 2AXJA 3L3DB 3QZWA 3TH4T 1J88A 3EYUH 2ZZUT 2APWA 1JWMA 1MFCL 1CLZL 5A3IC 3TN0C 1FNGA 4OI8A 3QEQB 4L4VE 4TN9A 2VDKH 3FQXA 4AEFA 2J88L 4QXUH 1SY6H 1DQJB 4Z6AT 3N85H 5D2LE 1C12B 1MCPH 3N9GL 3U2SB 4F7EB 4RWHA 5HYIA 2EXYD 4HIEA 4X7TB 4KGLA 1HKLH 3X13A 4KK8C 2EDJA 5DRXB 3VFWA 8FABB 3F6IA 4EOWH 5C6WH 4OT1H 1V3KA 3C2AL 1WBXA 3TA3D 4ZFGL 2V5SA 3CZFA 1R3HA 1NCNA 4P5KA 3LN4A 2O5XL 2V7NA 1ED3B 2X7LA 3D9AL 2ZKHH 3G6DL 5T5FH 1HH6B 4JM2F 4QEGA 3RZCB 1FE8L 3V8CA 4MDIB 4JFQB 4QF1B 4OB5L 1OAYL 4MVBC 2DM3A 4XVJH 4QCIA 2BVPA 2P24A 4GOSA 3T04D 4EDWH 1BM3L 2NY7H 4KHXH 1R3LA 3O41A 3E8UL 5EUOE 4E42B 2D2OA 2GIYA 4JREB 4D3CH 1A47A 4U1HB 3QIBA 1FIEA 3FQUA 3L3DA 4KDVA 4A2MA 2AQ3A 2BDNL 3BDYL 1IGYB 4ZMAT 1JNLL 1CG9B 2JCCA 3HUJA 5B8CB 4ODSL 1FL6B 2EDTA 1YQ2A 4C4KO 3MA9H 3RUGF 4XTRC 4XPFL 1EUUA 4NQDD 3VXME 4Y5VC 3QCTL 4XNZB 2R39A 3FRPG 3CVIH 2VL4A 4GMSH 1A7PL 1DQJA 4FXKB 1S7UB 4XPTL 1C12A 4IRJB 3MLWH 3MOQA 4U1KB 2HKHL 1YEDB 3U2SA 2H32B 4F7EA 2VRAA 5IBLC 3MTRA 2A83B 4PLOB 5ALBH 2IFGA 3QH3B 5HPOA 5DRXA 4WVRA 2VB5A 4WW1B 4S1RL 2L7JA 3I02B 3SGJC 1OOAA 1J10A 1RFDL 5LCVH 4M3KB 4AENA 1UWXK 5MEQB 1KTRL 3LRHA 4P0DA 3UTOA 5GS1B 5HHME 3N1QC 1ED3A 1LDPL 2NR6D 4FQJL 1HH6A 3TFKC 2BERA 3QQNA 3G5ZB 1W0VB 3TA3B 2OK0H 2AKRB 4LSQL 4P3DB 2ZUTA 4MDIA 1XT5A 4JFQA 3LQMA 4QF1A 5JZ7C 3MV8D 5LBSH 1UXWB 1FVDB 2HTKD 2H9GA 2J8OA 3HZYB 4LLUA 1GOHA 3L3HB 1HNFA 2PN5A 1SMAA 4E42A 4U1HA 2B0SH 5C0BA 4FQIH 5EA0L 1CL7H 1D5IH 1IGYA 1UT9A 4AEHL 5B8CA 4GMTH 3ALXA 1FL6A 4NZUH 4G6AC 1T0NA 3GIZH 3OKDB 4Q9RL 3HG1E 1FZOA 4X7SH 2AABL 5E95B 5L0QC 1S7UA 3I6GB 4Y5XC 4IRJA 5DMGD 4U1KA 5GGTA 1UH3A 1YEDA 2H32A 1LD9A 3O6FC 4XWGL 3BQUD 4NQDB 1JNNL 3KYKH 3QH3A 2A0LD 3UJJL 1NGPL 5BZWB 2XICA 2QLVB 4YO0A 2R4RL 2J6EL 5E03A 3GGWB 1TFHA 5MEQA 3VG0H 4Q97A 1NC2D 4FFYH 1IBGH 4KDTC 1I1FB 5BS0D 3OAZK 4EXKA 3WS6C 4N1HB 5I19H 1EHNA 4LSSL 3MLSL 3VH8G 1W0VA 5H8DA 1MQKH 1RUMH 4P3DA 3WHXB 1IEAB 4N90D 4AEIH 2KUTA 5GGVY 5J57B 3F58L 1UXWA 4MJIE 3IDXL 4D9RD 4EN3C 3HZYA 5IOPA 4KRNA 4OD3L 4YPJA 1MAJA 3L3HA 1DBAL 3KLSA 2VLLA 3C60D 3NCYS 4WI3A 2WWKT 4HMEA 1LP9E 2PTVA 4M43H 3PF2A 1TTFA 3BPCB 1OAXH 4KMTH 3V5DB 4OZIB 4PJXE 2DQIL 4FHBD 3U4BH 1M05B 1L7IL 4RFEA 3S37L 5HBBA 5F7MC 3TZVC 1OAKH 1UQSA 3OKDA 4KWUA 4AK1A 5IGXL 1U8OB 4PGCA 2R0LH 2CDEB 1WJ3A 4CKVX 2K7PA 2KKQA 2PXYA 3U9PL 5C2UB 3Q1SH 1VB9A 4R0LB 4XC3H 3HE7B 2WV3A 4OGXH 1IT9L 5J9PB 1BFOB 1WCBA 4PRNB 4JKMA 1JNHB 2DN7A 2Z92B 4UOW0 5J3HD 4BFGA 5BZWA 2OXHA 5FYKL 5TQ0L 3ARFC 4KU1A 2BSTB 1OPGH 3GGWA 3CFCL 4NZRL 4QXGL 2W91A 3RPIA 5JIHA 4ZFOA 5DSCA 5DHYB 4XVTH 2OZ4L 2RAMA 1I1FA 3NFPB 2RCSL 5IFHL 3ZKND 3TP4A 4N9OB 1YDPA 5LG1A 1H3PH 2C4FU 4IOIB 3KNBB 3WNKA 1IEAA 1B88A 3VXMD 2AJ3B 1NC2B 2BJML 4KUCD 5AAWA 5BS0B 1FO0A 1EHLL 4M8QB 3PWUB 1KB5L 1RUPL 1J8HD 2G60H 4XCCL 1YNTB 1S9XB 4PGJA 1A1NA 1ZLWH 4BSVB 1Q9WA 4NQUA 5MEOA 2I07B 5M95B 4BKLB 3WIIL 1IAII 3SKMB 5FYJE 5ICXB 1IAKB 4J3WA 5T3XD 3BPCA 3V5DA 4OZIA 3QUMB 5D2LB 4HWEL 5ILTH 3BJ91 3OAYK 1KJ3H 5HVHC 1TJGH 4IDJL 1GAFL 1S3KH 1U8OA 1IAIM 4KZDH 4MB4A 4LIQH 2CDEA 1XCTB 4AQOA 1LK2A 4HJ0D 5DRZB 5ACMA 1GC1C 2YSSB 4DUVA 3HE7A 2FO4B 5IWLC 1IAIL 1UZ6E 5J9PA 3GK8H 3SDXE 1BFOA 3VD9A 4PRNA 3SOBH 1JNHA 3TO4D 3CK0L 4M1DL 4OLZL 4JHAL 2BSTA 4F7MB 2R4SL 4TVPD 4EIGB 5EIQA 3WFCL 5DHYA 5CP7B 1QA9B 1L0QA 1ZS8B 2VDPL 3ARWA 3RVTC 3BH9B 1U8PB 3C08L 4PJ8D 1N2RB 3KNBA 3GSVB 4OFIA 5A1AA 2MPAL 4MXVE 4OCYH 5EUOB 1NBVL 1R5WB 1RSFA 1IM9B 4Z7VB 2AJ3A 1NC2A 3BKML 2ZG1A 3E6FB 2C3GA 3NH7H 5FCSH 4M8QA 4NC1E 3PWUA 2UY6A 1KCSH 1S9XA 1RHFA 4PP1D 4KC3B 4BSVA 3V0VB 3K1DA 1IC1A 2FNBA 3NZHH 2K7QA 3BDXA 5JIIA 3VXMB 1FLRH 2OP4H 1CGUA 4KQ4H 3SKMA 4L4VA 3RU8L 5ICXA 4FABH 1IAKA 5D5ME 2E7LC 2W9EH 3IDYB 3WO4C 1J8HB 3QUMA 5GPRA 1TVHB 3HNVL 5D2LA 5F9OL 3OG4B 3SN6N 1PG7X 4NUGH 3T1FB 5D7JD 4J3OC 1RHHB 1XCTA 5JMOC 1UKTA 1ODAA 2YSSA 3ARPA 2FO4A 5T33L 4PP2B 2XWTB 5I15L 1OCWL 4XBGA 3LH2H 4OFYD 4JRWA 4LCUB 3HRZB 3P3YA 3JV5A 5IMMB 2LTQB 1PKOA 4OQTH 4WFGE 2CRZA 1CK0H 1RK1B 4F7MA 5FIEA 2NY0B 4KROC 1AI1L 1DUZB 5CP7A 1P5UA 1NCAL 3TO4B 2PO6B 4MXWL 4AH2A 3L3OA 4X4ME 1N2RA 3N1FC 1YN6B 3GSVA 1QLRB 1A5FL 5EUOA 4F58L 3BZFB 1T66D 1IM9A 4QHLB 4S1DD 5F7WC 3NTCL 3CCHB 1UJTA 4C59B 4U2YA 2E8ZA 4WRLA 2P5WE 4AG4H 4N8CL 5C0GB 3QI9D 4WI7A 4V1DD 4HLJA 4PJ8B 1H0DA 4XVSH 3H0TB 3V0VA 3ARDA 2WQRA 2EDHA 5GS0C 4OF3A 3VXMA 1E6JH 1QFWL 3UJTH 1T1XA 3IF1B 1UVQB 1KB9J 3P9LB 3RP1A 4UDUB 2VH5L 1JZ7A 3D39D 1MFEL 3T1FA 1ZA6A 4Q0XH 4GS7B 4ALAH 5I66B 1RHHA 2R15A 3V6OC 4N5EC 1CDUA 1HINH 4TULL 4ONHA 3C5SA 3JVGA 2IQ9L 4DEPB 1BZQK 2DQEL 5ISZD 5D7JB 3BPLC 1NEZG 2PYFB 4LCUA 5KVDH 5E8NB 5FUZH 3U9UB 5IMMA 4XP5H 4D2NA 4YK4B 4HIJB 4WDIB 2GTWA 1KULA 2E27H 2Q6WB 1RK1A 2DLTA 5SWZD 2DQUH 5E8OB 4FQ1L 3JBG7 2VXQH 3M1BB 4GBXB 3V6BR 1JPTH 1DUZA 1VGKB 5F6HJ 2PO6A 2WBJD 2ZUUA 2HWZL 4XMKH 2W65A 2QSCL 4WV1B 4PJEE 4OM1H 1YN6A 3KPRD 4J1UB 4PJHF 1SHMA 3BZFA 4QHLA 1HQ4B 4L1DA 1HCVA 4K3GA 3CCHA 4ODHH 2QL1A 3ZT7A 2IH1B 4GKSB 3S4SG 1LP9B 4TSAH 5IIEA 5JR1H 1EERB 3BSZH 2X4OA 1J12A 2ZUQC 4PJXB 4YXHL 3JV0A 1MHPH 3CU7A 3H0TA 1I3GL 3T65B 4DTGH 3ARBC 4ELMF 3S36H 3BIKA 2NY1D 2OI9B 3ILQD 2A6DB 1XF5B 1TCRB 4RIRB 3VA2C 4QNPE 3HG1A 5AYUH 5IB4B 3NAAH 2XNAB 3IF1A 1PYWB 4LGSB 1TQBB 3QI9B 1CLYH 1M7IA 3LAFA 3P9LA 1JRHH 4V1DB 2CIKB 2XPGB 2K9UA 4GXUN 1DVFB 4ETQB 1I3RB 5GIRB 4OLYL 5EBMB 1IMHC 2QSQA 3PP4L 4I0KA 5I66A 2AEQH 1ZANL 3R06B 4DKEL 2BC4A 3P0VL 2BVTA 4TUOB 5K59F 2OJZH 3UTTD 3FONB 2COQA 5HGHB 4ONFL 3D39B 5EC1A 3MNZB 3BP5B 2H2SC 3BMVA 2PYFA 3OPZL 3HZKB 2DWDB 5E2TL 1MF2H 4QRTB 5E8NA 5EO1A 3U9UA 3QB7C 2F53D 5I73B 1T89C 4HIJA 4WDIA 4J3XA 1WZMA 1YY9C 2C3WA 3B9KC 2Q6WA 1YEEL 4U1SB 5E4EB 5E8OA 2IADB 3O2DA 1LK3L 3TVMD 3WJLA 5JIPA 5JMRA 4NUJB 3VDCA 3M1BA 2H3NB 5TFSL 1J5OL 3OKYA 4GBXA 4BSJA 1VGKA 5ADPH 4MJIA 5SWQA 1CFVH 4UI2A 4JGUA 1U95B 3QO0B 4IMKA 2B20A 1OTUC 4P46C 5BZDB 3DYOA 2MHAB 4J1UA 1Y6MR 3MRIB 4KJQD 3TBYB 3O6MH 1EDQA 4EBQH 2Z31C 4GKSA 1P2CA 4HHAB 1E4KC 1LP9A 1A7BA 4EI5C 3PGCB 1MNUL 3GSOB 4M7JL 5ETUB 4PJXA 4PRAB 1AR1D 3T65A 4XVUC 5DC9B 3RIAF 3IDJB 2GSIB 4UQ3A 5HTSA 4A2LA 3JWDC 1XF5A 4RIRA 3PGFL 1AHWB 4PB0L 4LLVB 1DQDL 2XNAA 2BZDA 1D9KA 1PYWA 2HT4D 1RPQA 1YQVL 4PJAE 1BPVA 5J8OA 2CIKA 2XPGA 1CDYA 1NEUA 4I2XE 4X98B 1DVFA 4ETQA 1I3RA 1KN2L 5EBMA 2HYMA 5GRVL 1AJ7H 3SDXB 4GG6F 4Q6YA 3A6CL 3R06A 5BRZE 4K55A 2LABA 4TUOA 3FONA 3SDCB 3INUH 5HGHA 5ALCL 3RDTD 2YA1A 2MQCA 4PJFE 25C8H 3I6LD 4HWBA 5E6IB 3MNZA 3BP5A 3CZJA 5I1AA 4NKOB 3HZKA 2DWDA 3RBGA 3CFKB 5DT1L 3EAKA 3BRGC 1TZGL 3NCMA 3RIAK 2CSPA 4H1LH 3EW3B 4U1MA 4U1SA 4YEEA 4JAMB 2IADA 3KPPB 3OQ3B 3MV11 3EDEA 2G75B 5DK3A 4NUJA 4MB5A 3HI1A 1FPTH 3REVB 4KGJA 4YX2L 1JPSL 2R29L 5DRNA 3PV7A 4MJ6A 2CIIA 3UZQA 5FV1L 1U95A 3CC5B 3QO0A 4PRPD 4M6ML 2UWEE 3VFMA 3SBWC 2MHAA 2VDMH 3MRIA 1I7ZB 1QHOA 4J6RH 4NNYB 1G7LB 2FH6A 3TIEA 5HYJD 1JHKL 2EDLA 4X8JB 4HHAA 2QQQA 3PGCA 5JO5A 5E2VL 3ARED 3GSOA 1AQKL 3MRRA 1GGBL 5ETUA 1C5CL 1Z9MA 2VAJA 4HF5H 4ONGH 4PRAA 5C0RH 1IM3B 1MH5B 5IJVB 3JV4B 3IDJA 5GISL 4XI5C 3NBNA 1Y0LA 2NXYD 2W92A 2VTFA 4DK3A 3MREA 1G6RL 5DD3L 3WYRA 4BUHA 3VWJD 3WIHH 2WUBH 1OD9A 4X98A 1T2JA 1NC4A 1Z3GL 4ZPTB 3DI2B 2LV4A 5JOFB 2P5ED 5BV7L 3SDXA 3MUJA 5HI3C 1T7ZA 4TOYL 4FQXD 2XKUA 4K9EL 1J0KA 3SDCA 2AJVL 2RBLA 2CRYA 1FP5A 4L9LB 5E6IA 5E5UB 5GRJL 4XNMB 2FO1A 3EIFA 4NKOA 4GRWF 3CFKA 1N0LA 1SM3H 5D72L 2IGFH 2PUQT 4NGHH 1T0MB 4PB9L 2B1AL 3C9NB 1OW0A 5F44A 4O4YH 1OSPH 5HDOA 3RDTB 4JAMA 3KPPA 2G75A 2FBJH 4K2UH 3CX5K 3PV6B 3ZYZA 1C8PA 1XGTB 3REVA 1NBQA 1X9QA 5F1OB 1TETH 2QBWA 4ZS7L 5FYKD 5C07D 3V4UL 3QG6B 1MHEB 4LP4A 1I7ZA 4YGAB 3KJ4C 3BYYA 4NNYA 1LNUB 3O9WD 5D5MA 1I8IB 4MJ5B 3THMH 5T1DH 5IJKA 3EOTH 4PRPB 1IM3A 1MH5A 1BQLL 3JV4A 1CDBA 3FN0L 3B43A 4HFUL 2G5RA 1UACH 2V2TB 5HYJB 4PD4J 1TITA 5B4MD 3MUY1 2H45A 3OF6D 3OAZH 1CXIA 3AREB 3BX7C 3EYQC 4IOFD 1A2YB 1E6OL 4TSBH 1YUHB 3B83A 3MXWH 4ZPTA 3SQOL 3W5NA 4NWUL 4K07A 5D7KD 4X4YB 5JOFA 4PJDE 3CFDB 3ZL4H 2NXYB 5D7LD 2VIRB 4CUCA 1YPZE 5I1KH 4Y1AE 2Q76A 4JDTL 4M02A 2YD4A 3RBSA 6FABH 4CU6A 3VWJB 4LGPB 5EH1A 1RURH 4L9LA 3TYGH 2ZOKB 1F58H 4XNMA 4XCNA 4R3SA 4PV8B 2YK1L 1SY6L 5FOJA 4KAQL 1S9YA 3N85L 1T0MA 1I7TB 4XCEB 1MCPL 5IBUB 2F19H 3C9NA 3H3PL 5FGBC 1YC8A 4X4MA 1BVKB 2V2WB 4BZ2H 5TJWK 3M17B 2D7OA 1MJ8H 1IGIL 3HB3D 2Z0BA 2CKBA 3ILPB 5T1KD 4OT1L 1IKNA 2P5WA 3SDYH 4JN1H 2XV6B 3O3AA 3QG6A 1MHEA 3CGTA 3SCMC 4ZXBA 5TF1H 1R3KB 2DL2A 1F2XK 1WIPA 2ZUXA 4G9FE 3OBAA 1E28B 3MRQA 3SJVD 1KF9B 1LNUA 1I8IA 1DLFL 4MJ5A 2VN4A 2VXVH 5I8OH 5KVEH 4G7VL 2APFA 2W07A 2OMNA 3OWEA 1HE7A 1NSNH 1FH5L 1JWSB 5AUMB 2V2TA 4X7EC 4EDWL 3O9WB 2NY7L 5D2NC 2D0HA 3G6JE 3GI8H 4PY8I 1A2YA 4Q6IC 4PLJD 3ULSB 5JQ6L 1YUHA 5KW9L 4Y19D 1CYGA 1BGXL 5GS2H 2P8PB 3PQYD 4X4YA 3CFDA 1T20B 1FG2B 1HHJA 3H9ZA 3QQ9D 2XG4A 3MA9L 2HT2D 3QIUA 3QQ3B 3VWJA 4LNVA 4YXKL 5IB5B 3I75B 4ZAKB 4ENEC 3ZZ1A 4PJBE 3QPQC 4L9DA 3KGRA 3IJHB 2GY7B 1EEYB 1MLBB 1I7TA 4XCEA 3KYMB 5DK0B 3TV3L 1ACZA 4IBLT 4JKWA 1MFDL 3VFUB 2L4OA 5HGBB 4D0BB 5FAAA 4JLRA 2V2WA 4PJEA 3OAYH 3UBXG 3M17A 2PETA 1EEZB 3QJFB 3ILPA 1ZLVK 1SJVA 3MGAA 3Q5TA 4N0FB 4P5TD 3ULVL 3TBSB 3BH8B 5LCVL 5IW1A 1QP1A 4CVWA 1TMCB 5KVGL 1R3KA 3MJGX 2XA8L 4X4XB 1E28A 5E00A 5EN2B 1MWAB 4HXBL 5JUEL 1CL7I 4WEBH 3FB5A 3ULUE 5D93C 5T1KB 4YFEA 1A7RL 4G6FB 5F9DC 2I9TB 5DHVB 4WHYH 4I2XB 2X40A 3U36A 1JWSA 5T1LB 5AUMA 4Z7OF 3WLBB 1MFBH 2O93L 2H41A 4PJ9C 1DJSA 4I18C 2ZUVA 5AYQA 4FQIL 1W2KT 2AXGB 2P8PA 4PJFB 1A0QH 1CXHA 1T20A 1FG2A 4LLYA 2EKSB 3KR3L 1ZGLM 3QQ3A 1DN0B 5C08D 3RRQA 3I50L 4FQCL 4B7LA 2F8XC 3GIZL 4ZAKA 4FRWA 1BFTA 2AJXH 3IJHA 1EEYA 4ZUVB 1QYGH 1MLBA 4TQEH 4CVXA 3D2UD 5DK0A 1NCCL 4FQHB 3MJ6A 3VFUA 4RFNC 4BYHA 5HGBA 4D0BA 1U2HA 3IDMB 3WFHB 1EEZA 2I27N 3FFCE 4N0RA 4XNYH 6CGTA 4XC1H 3BKJL 3CH8A 1MRDL 4V2BA 5GGVL 3OZ9H 3TBSA 1MIEH 3BH8A 2DQJH 2YC1B 1CFSA 3T3ME 3VG0L 3HTLX 5FM5O 1AGDB 5D7IF 5CJXC 4X4XA 5EN2A 1MWAA 3NFNA 4HK3N 2BK8A 5I19L 2NYYD 4YEFA 1DE4B 4P5TB 1NDGB 3RWHB 1RUML 3KLDA 1DLHB 4PJAA 5K9KB 4I2XA 3GNMH 4PV9B 5T1LA 2E9IA 1C7TA 1TTUA 1BZ9B 2PW1A 3HNSH 3QFDB 4K8RH 5DWUH 3WLBA 2GYSA 4FZEL 3VRJB 3PHOA 5BRZA 1BJ1H 4C55A 4L8SC 4QOKE 5I76B 4TNVF 1PDKA 1K8IA 2BOBA 1X5LA 1SJHB 3VXSE 2AXGA 4PJFA 3AMLA 3IAPA 5B3NA 3ZKXB 2Q7NA 5EOCH 4RQQA 3PHSA 3R8QA 4D0CB 4X9FA 1OAXL 2EKSA 1HI6B 2CR3A 5AG9A 4ODUB 1DN0A 5IHZB 4IM8A 4J7RA 1C5BL 4FFWC 4YHLH 1I9JL 5GGUB 4JFZH 4ZUVA 4MMZC 3IAQA 3WFZA 3MJ9A 4FQHA 4X6FB 4M5ZH 5IV2B 1F42A 5DUMH 2AEIT 1B9ZA 3LKOA 4HKBB 1BVLA 3WJJA 3IDMA 2UWEA 1EZVX 2X70A 3O6LH 1T03H 1UM6H 1X7QB 2H1PL 4I3SL 3WIFB 4MSWB 4PYHA 3D2UB 4FQ2H 1IJ9A 5FYJL 3PDOB 2HG5A 4FNLL 1OPGL 1HHGB 2FX9L 3QDME 2GUOB 4PRHE 1Q1JH 1AGDA 5DJXB 1CTOA 1YEJL 2IBGA 1A6VH 1VEPA 1KXTB 2VDNH 1G9EA 3RWHA 1NDGA 1A6UH 1DLHA 1GCFA 2NCMA 4KUZL 5K9KA 4UOW1 4PV9A 5F89B 1CFQA 1FGVH 4PJDB 3QFDA 3VRJA 4OGYL 2P49B 3RWJB 3ZHLA 4Y1AB 1QO3B 3DROB 4KI5E 4H20H 3O8XD 5IG7B 3LD8C 4ZOBA 2IC2A 4QTHA 1SJHA 4G80B 1RIUH 4BQBA 2NY2C 4P2QE 5DMYA 5C0CE 1HI6A 4ODUA 5EOTB 5ILTL 2P4AB 4OKVB 4HBQA 1IFHH 4I77H 1B4JH 4Y8AA 5GGUA 5GGSB 2ICEB 3ULUD 4FFZH 5MEPB 1FSKC 4X6FA 3SE9H 5HYSG 5IV2A 4P3WA 4G8FB 2QV2A 1OGAE 4HKBA 1Z0MA 4WFFE 3GMMA 5TGBB 1QEWB 2YD9A 1X7QA 2EDWA 2GITB 2WMPA 3QIBC 4PS4L 4TPRL 4G9FB 3WIFA 4JG0H 1INEL 5KVMC 3P77B 3D2UA 2B4CC 1HXMA 4U3XA 4HIXH 1IAOB 3TPKA 5EBLB 1N5YH 1HHGA 4NOFA 5DK2B 4O2FB 4KVCH 8CGTA 4DN4L 4Z7UE 1JV5A 3P4OB 2GUOA 1X44A 4NP4L 4K94C 4NDMB 4Y5YB 1CLCA 4HW6A 5EC2B 3IKCB 1JE6A 1RU9L 3G6JB 4YDKH 2EDQA 1LO3H 1EFXD 1ORSB 2ZCHH 3WCYA 1DEEB 5F89A 4O02H 4KRPD 3BGFB 3NH7L 4PJDA 1T7VA 1KCSL 1HHIB 1YPZA 1AC0A 5DQDL 1BWMA 3AS2A 1FAKT 1KJ2L 1QO3A 4Y1AA 1A6WL 3EYVA 3LMJH 3LVEA 4MNGB 1UCTA 2IG2L 4G80A 2R0KH 1FLRL 2JLLA 3EFDH 2QEJA 2PNDA 2W9EL 3OTTA 4OD2A 4NO2B 4OKVA 4N0YH 1FBIL 4BH7A 3VXQA 1PZ5B 4L5FH 4NKQB 3CSYA 3TBVB 3EZJB 3D3VD 1TJHH 2FX8L 2P47B 5GGSA 2ICEA 2WBWB 5MEPA 4WGWB 1J8KA 1NGZA 3NACL 4G8FA 5DLMH 4ACPA 3HC4H 3W82A 4NQCE 3SEPA 1QEWA 4JREC 3FRPA 4G9FA 4RAHA 2WP3O 4OLXL 1SJXA 5FDWB 3P77A 4U1NA 1FYHB 2EICA 1LHZA 5B8CC 5DK2A 4OJFH 1LWRA 4MQ7B 4LCWD 1UZ8A 3CMOH 3VXSD 4LSUL 1KPRB 1NCBH 4N1CA 2KZ1B 5C0DB 1S9VB 5EC2A 1NUNB 3IKCA 5E0QA 3G6JA 3MRCB 1FLTX 4IRJC 1ORSA 2BVOA 3K7UA 4LF3A 4XP4L 4LPWA 4KY1L 3CVHL 3WUZA 2PW2A 3IFNH 4JKKA 3JSSA 3VH8B 4LHUG 4XVSL 2YN3A 3NIDF 3TT1H 1EFXB 3KVQA 2VZTA 2Y72A 4WHYG 3PJSB 1E6JL 4GXUM 2C3XA 4PJCB 2YMXH 2Q7YB 4PJBA 3UJTL 4DN3H 1MCDA 2AJSL 3V5KB 3WLWD 4NO2A 5C0JB 3VXNB 5H35B 3ZT6A 3GM0A 1KIPB 5DZOA 4PREA 2F15A 2IBBA 1A7QL 4Q0XL 2QQLL 5DQJB 3ZYIA 4PRHD 2IFFL 2BFVH 3R0MA 5SX5H 1FRGL 3G08A 1OTTC 3FFCB 2EYSB 3RL1B 1PZUB 4M93B 3I2CH 4CMHB 3DMMB 1ADQA 3EDFA 4XP5L 5BV7B 4LGRB 5FDWA 3BMWA 2E27L 3MRNB 4IS6A 4FMKA 2YRPA 4HMCA 2R2BB 4LQFH 1IC5H 3SKOB 4KTDH 3MGTB 1MCFA 2VXQL 4MQ7A 1BBDH 1JPTL 2BVUA 3KAAA 3MNWB 1KPRA 3DHMA 3IAGC 5C0DA 1H3XA 3O2VL 4M61B 5C0CD 4XMKL 2XN9E 3MRCA 1LO2H 3DUUB 3QUYC 4QOKB 4UTBL 2PXYC 1JRHI 3GMLB 1VFOA 2WUCL 3MNVB 4HCRA 1AXIB 1IQWH 4YPGB 4TTGA 4GSDL 4ODHL 3HPLA 3VXSB 2IAMD 3U6RB 2NZIA 3MCLH 2DQCH 3VH8A 1MHPL 3S5LA 3FO1B 4KDWA 1PY9A 4DZBB 2H2PC 1EFXA 1JZ3A 4JHBA 3UBXI 5AYUL 5F7DB 3WE6A 2EZ0D 3QAZC 3NAAL 4LCIH 3V5KA 3VMNA 4LEXH 4NKDB 5C0JA 3VXNA 5E9DE 4ZNEE 4KK9C 4JM4H 5H35A 4LLMB 1X5AA 5LGJA 2VR5A 1KIPA 1FHGA 4IHOB 4XAWH 5C09D 3FQWB 5DQJA 4GRWH 5D70L 5E8EB 5DMKA 1MI5E 4R90H 5M7QA 3FFCA 5JORB 4TUKH 3V9FA 1V3LA 4OF8A 3RL1A 3QDAA 1T0PB 1GIGH 2IH3A 4YLQT 1WFNA 2B5IC 3GSWB 4HSQA 3QDMB 4LCYB 3DMMA 4PRHB 5MENE 4JFFE 5DMIH 3QDHA 5DC4B 1NLDL 3MRNA 3WFBL 4R26H 2R2BA 3SKOA 2GCYB 4GW1A 4P2RD 1NJ9B 3MUZ1 4FFVD 3MNWA 1U6AL 1CFVL 4M61A 3RWEB 3ULVD 3RTQB 1DFBH 3DUUA 4QOKA 3GRWA 2ITDB 4WW2A 4Y16D 2HT3D 1AO7E 4M5YH 4YPGA 3HE7C 3VXSA 4LIQE 4XBPB 3U6RA 1D3CA 4P2QB 3KLAB 5C0CB 3FO1A 3S88L 5J6GB 4X8XA 2IPKB 1JMXA 2HTLC 2QKIB 4UV7L 3EDJA 2XTJC 5F7DA 2VNCA 2IAMB 2E9JA 1IKFH 1VEMA 1ACYH 3SE3A 4NKDA 1CFNB 4F57H 4GAYB 4LLMA 4KK5C 4PTTB 1WTGT 4NN6C 2DYPD 3EYFA 1J7VR 4IHOA 3VFSA 1OGAB 3VGGA 3FQWA 4ODXB 5KS9E 3FT4B 4MA3A 4NN5B 4RGND 5E5MB 3T8XB 3SE4A 3RX8A 2IQAB 4RA0C 5DF0A 5I8KH 5C6TL 2EXWC 5EU3B 3PUCA 5J89A 1XF1A 2WLYA 3GSWA 3MBED 3QDMA 4LCYA 4WI9A 4PRHA 4WFEE 1MCSA 2QHLA 4NQSB 1GXEA 1K85A 1DBKL 5CEXB 4PY7B 2EDXA 4H25B 2GCYA 1MCEA 5SV3A 3MZGB 1CGYA 2HJLB 1L4IA 3VFGH 5I16B 2AGJH 1FNEB 4DAGL 3MJ7B 3DRQA 3RWEA 3RTQA 4ZUTB 3V4PL 4UDTB 1NFDB 2ITDA 5AWNH 1JYVA 3N1GC 3IXTB 4XBPA 3SO5A 1W72H 5D1ZA 4JJHA 3C5ZD 1Y6KR 4P2QA 3KLAA 3MBXL 5C0CA 1ZLVH 4ONGL 5J6GA 1BFVH 5CZXC 1EVUA 1NBZB 2IPKA 4NFCA 4PRID 1TVBB 3GSQA 2QKIA 3O4LE 5CEZL 3O81A 1L7TL 4XAKD 1N0XL 2ORBL 2I9LA 3BD3A 2IAMA 3DX8A 1EBAA 5HJ3B 3OXSA 4ISVB 5HSFA 4M7LT 1OGAA 1OLZA 4ODXA 3FN3A 3FT4A 3T8XA 5E5MA 4I5BB 5BO1L 4JRYE 1HDMA 5C9JA 4LLQA 4WNQB 1DQLL 1E4WL 2NY6D 5EU3A 2Q86B 1P7KA 2DYPB 1HN1A 1WLHA 3MLUH 4Z7UA 3ARDC 4YFLF 2BHYA 2CMRH 5HI5C 5CJ8A 4NQSA 3LPWA 3QXWA 5CEXA 1UGNA 3IDYC 3MV7D 1IEBA 1IC4H 4QWWC 4H25A 1P6AB 1Y6NR 3STBA 4K2UL 1NEZB 5K33A 4OBSA 1FCCA 4C56D 1CE6A 3Q5YA 4MA7H 5I16A 1EV2E 5DJ0A 1R5VB 1TETL 4RMSA 1FNEA 1ZGLB 3MJ7A 4RMQA 4ZOAA 2HRPL 1G9NL 1U8KB 1LO5B 4G6MH 4ZUTA 3DV4A 3GBML 4UDTA 5FFLA 2L0DA 4K23L 4PPTA 3UAJD 1CD9B 3U4AA 1KPVA 3JVGC 1S5IH 1H15A 1UJ3B 2WQ8A 3IXTA 2W9DL 4FG6C 1OGTB 4LVOB 4HULB 4UT9L 2BNUB 3W2DL 2LTQC 15C8L 4KZEL 5T1DL 4PJGE 4OAWB 1NUFA 1MIML 2B1HH 1NBZA 3D25B 4KMQA 1G9ML 5FO7B 3MA7B 5F3HB 2NY0C 1FZJB 3RWCA 3UTPE 2AEPH 4APQD 4XP9L 1UB5B 2PO6C 4HWNA 4U7MA 1U8JB 4JFED 4MQXD 3MXWL 4PRIB 4Y4HB 5LJYH 1KXVC 5HHNB 1CXLA 3BKYH 4NQCA 3ZL4L 1FV1B 5LAXB 4G6JH 5L8JB 4M3JA 4TTDD 2X10A 5JXAH 2PKDA 1Y18B 1X5JA 2LAAA 4WNQA 4LPXA 4AZ8A 4FQLH 3KLHD 2F5AL 1U36A 4U6HB 2Q86A 3B8SA 3TYGL 2DYPA 2OL3H 2NTFB 1AY1L 1TZHB 3I3DA 4HPOH 4OSUH 5E2JA 3QHZH 5GHWL 1LE5A 3P11L 1QBMH 1ZT1B 5C0IB 4I1NB 1NEZA 4N8VG 4JO1L 1MJ8L 2YN5A 1R5VA 1BFSA 1ZGLA 5EO0A 2VYRE 3HCVB 5FGSA 1KTLA 3BESR 1LO5A 5A2LH 3EHBC 5TF1L 4OCSH 5E08H 5LXGH 1F3DJ 5D1QD 4C56B 1UJ3A 4H88H 4UV4L 2BNUA 4XPBH 2AQ2A 1JTPA 1WBZB 1JGLH 3MYJB 4YK4C 3F7PC 4OAWA 5KVEL 1QKZL 5IVZB 3T4YA 5E9DB 3D25A 2AP2A 3HFML 3MA7A 3OB0K 1NSNL 2YUZA 4HK0A 1B0RB 3WJLC 4P59L 1FZJA 1MI5B 3DVGB 4P4RB 3S4SA 4GBXC 4DCQA 5F7LB 2IEPA 4GLRH 3GJFK 3KG5A 4XB8A 5F7FA 1EGJH 4YDLC 4NRYA 3MCG1 5DD5L 4IMKC 4Y4HA 4ELKB 2JCCF 3HUJF 1UADC 3WHE0 1HXYB 1FV1A 5EUKB 5LAXA 1HQRB 4UAOB 5MENB 5FK9B 4JFFB 3GB7B 3MOAH 2OTPA 3FZUD 3KPNB 1PY4A 4APQB 1H8NA 3A0OA 1AR2A 4JFEB 3UO1H 5DMJB 3OKKB 2NTFA 2AERT 1T5XA 2RHEA 2R9HC 4YBLB 1TZHA 2YUWA 2AXFB 4LCCA 2CD0A 4X6CE 3QIWC 4PBWD 3LRSB 4Z7QE 1O5DT 2KQNA 1D9KC 2XN9A 1FG9C 1F5WA 1TQBC 4MNHA 1ZT1A 1SJEB 1EX0A 3Q6GH 5F1KC 5C0IA 2YPKA 1DVFC 1AO7B 4HLZH 4TVPH 5L8KB 2D7TL 3SE8L 5KBNC 4K7PH 4U4BA 3RVVD 3HCVA 2NY4D 3MACH 3I6KB 1DBJH 3KXFE 1G1YA 1T4KA 3T0EE 5GJSH 4JKPH 3S7GA 4WEBL 4JFXB 3DJ9A 3MXVH 1T22B 4B50A 2D9QB 1WBZA 4JANB 2D7PA 3MYJA 4OGAD 4Z0BL 4JGMA 5I8EB 4EXPX 1BIIB 5IVZA 3ZDYE 4OTXL 5E9DA 3BW9B 1WWBX 4MQSB 4ZNEA 5L2KD 1KBGL 4DW2H 5GZOD 5JDSA 4DFIA 1B0RA 3ELAT 4S1SH 4HFWB 1MI5A 3DVGA 2FEDC 2O5ZH 3IDIB 1MJUH 4KV5E 2W0FB 4M62L 3GSNH 4F15C 1GZQB 3L5IA 1LVEA 3K74B 3IFOB 4ELKA 1HXYA 1JPGA 5EUKA 5HHOE 1HQRA 4UIKH 2OJEB 4JFFA 5MENA 2JB6B 3GB7A 3KPNA 3PHQB 4APQA 3S97C 4UILH 4OIBA 1QNZL 1QLFA 2VZVA 5IMKA 5CIPH 1UKQA 4NNPH 3CX2A 5GS3A 5DI8B 1U8QB 3W11D 4RGMC 4LPYA 2AXFA 3JWDH 1LEIA 4XMPH 3MLVL 4WI2A 3ZSSA 1TNNA 3LRSA 4RNRB 5E7FA 1HWHB 4PTUB 1JPST 3GRWL 3BD5A 4P3CH 4RMRA 1AO7A 4CN4A 3DTXB 3CFIC 5IB3B 1R5IB 3D18B 3DX7B 1MAKA 3OZ9L 5CBAB 5CJBA 3BN3B 2F8VA 1B3JA 2FJHB 5EOQL 3SDCC 4WWID 5D7SH 3O3DB 1U3YA 2YPLE 3O4LB 4NM8H 4E0RB 3K2UL 3V0WL 2EDYA 3WNNA 2WLZA 5E6IC 4KRLB 3OR7A 4JFXA 1G84A 2O26U 1T22A 3QCVL 3LS4L 4JANA 1KIQA 5I8EA 2DM2A 1MVUA 5F7EH 2NY4B 1BIIA 3C6SB 1U8LB 3BW9A 1OW0C 3E2HC 4HUUB 2IMNA 4NO5B 3IRZA 1Q0XH 5J11B 5FO9B 5IMOA 5KS9A 4HFWA 3ZDXE 2D31B 3KWWB 1YMMD 1LMKA 4KK6D 1E0OB 4GAFB 1X5GA 3C8DA 4NC1C 2GK0B 3IU3A 1RAMA 2ZCKL 4L4TD 3IFOA 3FB8B 4AL8H 1CE1L 3T3PF 5FHAH 4JO2L 5E24E 2OJEA 2JB6A 1S9WB 2VITB 3PHQA 3Q48A 3VWKD 4OZGB 4OLWL 4X9HA 4L8BA 1AD0A 4ZFZA 1MFCH 4RX4D 1CLZH 4MNQE 3SDDB 4XPAL 4IIQB 4UINL 1A7OH 2F54E 1Z9LA 2R8SL 4RNRA 3MC0A 3P2TA 3AS1A 5IW6B 3O6LL 1UM6L 2D4FA 2FHCA 3DTXA 3OKEB 5IB3A 2VAAB 1R5IA 4FQ2L 5C6PB 3D18A 5HDBE 3DX7A 2WW8A 4AIZA 5CBAA 1ZHLB 3FHQA 5LWYL 4PJGB 1JL8A 5DVNA 5D96B 2FJHA 4Q74A 3C2AH 3HI5L 3O4LA 4E0RA 4ZFGH 1J1OL 5HGAA 3KDMA 4L9LC 4QHUB 2DF3A 4OQTA 1INQB 3D9AH 1A6UL 2BSED 4I0PB 3Q3GB 1M71B 3S35L 3C6SA 4NYLB 4YBQD 2C3VB 3O3EB 4HUUA 1F4XL 1KYOK 1QG3A 5GRVK 4YDIL 5C0NC 1IC7H 1KPUB 2CO6B 2QJDA 4P23B 2D31A 1OAYH 5F1IA 4JRYA 3QULB 3KWWA 4X9IA 1NGQH 4GRMB 1IKNC