5DK0B

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRGDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B01
3LV3B 4WI8A 4EVNB 1IGFH 1Z0MA 3VFTB 5L88L 3ELAT 5JOFB 1MHEA 1Y18B 1OCWH 4Q9BA 4Y4FA 2CGRL 2EDFA 3KNBA 2ZKHH 5J0BA 4PS4H 1GAFL 5E5MA 1JK8A 2J2ZA 3SN6N 3FFCE 1LK2A 1W8OA 5SV4A 4WHDA 3ZE1E 4YO0B 3H2WA 4MWFA 1OTSD 3RIFK 5DVKA 1OQXA 4YUEH 1FZMA 3WIFB 4LSQL 5CJQL 3IDMB 5GIRB 4JKMA 4O5LH 3WXVL 4X99B 4B53A 1X5GA 2Y6SD 5BVJB 4GOSA 1JZ5A 5FV2A 3VE0B 1ADQL 3MO1B 4NQDE 3IXAB 2I9LA 3C60A 3FB6A 4I5BA 4NM8L 4Z0BL 2FLRT 5I1DA 3ZKND 1QEWA 3RX5A 5DD3H 3I75A 3R8BB 1VADB 4G8FA 4ISVA 4JE4B 2H8PA 3T1WA 4KTYA 1JBJA 3BIKB 4RMRA 3ZMRA 2YEZB 3LMJH 3S96B 1HI6B 1HHJA 1ZA3B 5HDQL 1KYOK 3Q1SL 1Y6MR 5D7JD 4EOWL 4Q97A 4CVUA 4Z76A 5CJXA 1D6EA 2EKSB 1YY9D 2EC8A 2ZZUT 3A6CH 1EEYB 4RA0C 3UO1L 4ORGA 4ZODA 1V3JA 2VDRH 2UWEB 3OR7A 3ZHKA 5ESQB 4QRQA 1TPXB 4HPYH 4FNLH 2R1WB 1JI1A 5BS0D 2IPKA 5SV3A 5CGMA 4JDVA 2OTUB 4JPWL 3N9GH 5F7UA 5HGAB 1FNGA 2G5BB 1L0QA 3DX6B 3G5YB 4CBPA 1NCDH 4YIQB 2DQCL 3DI3B 1UVQA 4YXHL 1P2CB 1JGUL 4GQ9L 1D6VH 4Z8FL 5IVZB 5HI4D 3KPPB 3BD4A 5CMAA 3KPSD 5IQ7H 2EIDA 2YD7A 4GXUN 3C2AH 2X4QB 5HVHB 1F58H 5D7SL 4ENEC 2JB5H 2VLLA 4G6AC 1ZEAH 1QFWL 35C8H 5FDWB 1NLBH 5JQ6H 1SY6L 2A77L 2ERJC 5D7JB 3S88H 4PYGA 5BO1L 2EDDA 3LKOA 5JIKA 5EU7C 2V9TA 5SWSA 2O5YL 3GDBA 2O61B 3QUZB 4M62H 1FYTB 3TM6A 4LFHG 4EBQL 4NN7C 3WNMA 3NFNA 1G7JB 4HJJL 4L4VA 3BP4B 5IB3B 2Y06L 1JTOA 4H26B 1MCOL 2WV3A 1EO8H 4N1CA 1GVIA 3TV3H 5I8CA 3LKQB 4M7LT 3V4VL 5DJ2A 4LARL 3WNLA 1RFDH 1INDH 4WU5B 4ZUVA 1R3LA 2B0SL 1IGTB 1JGEA 3C6LD 4Y4KD 4C59B 3U36A 4DGVH 3L3JB 2EH8L 3PP3H 2GJ6A 3VWJD 1CGTA 1KN4L 4KU1A 1JHKH 2VR9A 5CZVL 4FQ1L 3VXOA 4P5KB 5E00A 1NCTA 5HVGB 1NGWA 3MJ7B 2DQUL 2LV4A 4HWBA 3U46B 1NGZA 2FR4B 1X6LA 1UZ6F 2QHRL 4NRXA 4OF6A 1TQCC 4G6JL 5I74B 1N4XL 1MUJA 4X7SH 3TYFB 3EFFB 4NCC1 5KANG 3FCTB 5M7QA 5JORA 1ZGLB 1WVZA 4LGRB 3V6OC 4RMWA 1MLBB 3RVTD 1T1WA 2BNUA 3CVHL 5I30L 1YNLL 4LLQA 4YAQA 1LK2B 3RL1B 5D1XA 3RNQA 5HYSB 2XACC 2WBWB 4HLZH 4P23B 1FG2A 1BWWA 3NFSL 1C5CH 3MRQB 4OFYA 1AQKH 3CLEL 4RCAA 5HHNA 3MRDA 4R97C 3QXVA 3QEQA 5E6ID 4EQ2A 4L9LA 2O5YH 1U8JB 2APTA 4GW4A 2VZUA 2IF7A 5F1IB 1H15A 3TZVD 2PYFB 4QF1A 5JW4Q 5GRJH 3UYRH 1U3HC 4DUWA 3SGEH 3QJHA 5F8QC 1NSNL 2E5EA 4I3SL 4IJ3C 4O58H 3LY6A 2C3GA 4YHPA 1KENL 1UT9A 1RFDL 4BQCA 3DUUA 3KXFB 3TF7C 3SE3C 5DJ0A 2DOCA 4TULH 5FYLL 1RJLA 3SE9H 5JHDA 3I84A 5GPRA 3QIUC 5HI5C 4YC2C 4K3EL 2PTTB 1VGEL 5EU4A 1IJ9A 4ESKA 5DC4B 3G6AB 1PEZA 4OCWH 1MFEL 3BQUB 3JTSB 4KTDH 1S9YA 3RRQA 5EOQH 4NNYB 4XPGL 1AGEB 1MRFH 4EUPA 1WLHA 2P49B 1EVTC 1I7ZA 3GMRB 3WFHB 3BO8B 3TJEH 3D18B 3QBTB 4Z0XB 5FYJU 4JFEE 5HTSA 2HJKB 4DJMA 4RGNB 2P45B 4WW2F 1K4CB 4JHAH 1T6VN 4KY1H 2NMSA 5HHME 5TQ0L 2X4SB 4WUKL 4KKAC 3VI4F 5D1ZB 3QDJB 5EUOE 1H3PH 3DO7B 2FL5A 4P0DA 2LTQC 5DMIH 4X9IA 2FJHB 4XNYL 4RISL 2DQGH 2Z93B 3W39A 3F7VB 1IGJA 2DIAA 2I5YL 5I1CH 4QY8B 3MRJB 3G5ZA 4OCYL 3BZDA 2P8MB 1I1AB 3U7YH 1HINL 1GC1C 2AABH 1AXSA 1T7ZA 3L3KB 3WO3B 3QRFM 3P73A 1SQ2N 4JANB 1AGBB 3AAZB 3QIUB 1A6AB 4UBDD 4QHNB 2AEPL 4KMQA 2GTWB 3DIFA 4GRMB 3ZTNL 2AK4B 5FYJD 2MWCA 2EDNA 1QSEA 3T8XA 2MKWA 1NGYB 2YR3A 3VFSB 5I18L 4JCMA 4QXTB 3WFEH 2KKQA 3TA3C 3NZ8A 5IM7B 4EDWL 3STBA 5ENWA 1F6AA 2CO7B 2VN4A 4Y5XC 1QEWB 3NN8B 2HAZA 4Z0BH 3D3VE 4WW2B 5F70A 3IXAA 3FN0H 1U95B 4MJID 3G6DH 4IDLA 2J5LB 3DOSA 3E6HB 3HZKB 4HUWB 3RA7H 3QEQB 3GEWB 4O5LL 1DQTA 2QTEA 4XHQA 3QQ4B 1CICA 5TE7L 3DRQB 4BSWA 3OKNA 1MY7A 3KLAB 1JI2A 2CK0H 5FKAB 1NMBH 4PY8I 4KJYA 4KROD 1J1OL 3K46A 4D3CL 4F7CB 1FZKA 1RJZA 1JPGA 2HWZL 1MAML 3BPCA 2HFGL 4WO4C 4RFEB 4F7EB 3BFOA 5JLZB 4UQ3B 3QIBB 1NUFA 1NFDF 3TCLB 4JFPA 4ORZC 3ARSA 4FS0A 4PRPA 4OZHA 4HGWA 4RMTA 4PYHA 3SGKC 5KTEL 2MJWA 2A74A 5JMRA 4LGPB 1CFVL 4PJGA 1KFAH 4CKVX 4P2QE 2VYRE 4KRPB 3VXSD 4O51B 2V2TA 3KPSE 1JPSL 4OD2B 1NDGB 1AJ7H 5F9AC 2CSPA 4WJ5B 4X4XB 4ONFH 4O9HH 3SPVB 3ULUF 3WHE0 4IRJA 2PYEB 4AJ0A 5D7IA 3HR5B 1R3JA 3MLTB 4GBXB 2DQFB 3FJTA 4N1HB 1MHCA 1QA9B 4HMCA 3HG1B 3BOVA 3HE7A 3WJLC 5KSAB 3JXAA 1HKLL 4PTTA 1FL3A 5D6CA 5KSBF 3WSQL 5LXGH 3AS3A 4OIIH 2HN7B 4P46A 1MI5A 5F7MC 1T66C 4BZ1L 5GRVK 3IDNA 5I1KH 3W9EB 5GS2H 3QO1A 4PP2B 4L4VB 2VLRE 3MRCB 1P1ZB 2P7TA 5IB5B 4K23H 3HPLB 3UJJL 5F6HI 1PJ9A 3IJSA 4K7PX 2P42B 4LSTH 2EH7H 2ZUYA 1U8IA 3S35L 4QHLA 4WU7A 3ARED 4JO4H 3VJ6A 3KLHC 5HHQA 1LD9B 4YPGA 3HZVB 4LLUA 3RWGA 3V95A 5C09B 1ZHKB 1X4YA 1A4KB 1DCLA 4A2MA 5I1DB 3MRFA 4JM2A 1HQ4A 4LOUD 5HYJD 2BNQE 3RVWD 4I0KA 4O00A 4JFFA 2E8YA 1GGBL 2GEEA 4HD9A 2BVPB 4OD2A 5EUKA 3ZE1F 2BOBB 3VFOA 2F53B 4TTGA 2P46B 1KENH 1I1YB 4J4PD 1P7KA 5GSRA 3ZKXC 3WLBB 1UB5A 3RBSA 1JPTL 4MWFB 4EXPX 1X3DA 5DXWA 4X4YB 3GNMH 3MNZB 3V5HB 4LOUC 4AH2B 1FPTH 2DICA 2RR3A 1K4DA 4OQTH 4YDJB 3HI6L 3L7FA 1YMME 3GKWL 4PJ7E 1NCCL 5KS9E 4C56E 4JY4A 3C9NA 3BW9B 4LP5A 3MJGX 1JE6A 4DAGH 5TPWH 3NCEB 5CIPA 3B5HA 1N0LA 3PF2A 2EO9A 3ARBA 4X80H 1VACA 1BFSA 3RAJH 1MLCA 2XZCH 5E8NB 4X6BB 3VWJA 3QXAB 1UQSA 2E8ZA 5J7CC 2QQNL 1U0QA 4PJIF 1MCDA 1XGPA 3QWOA 3WIHH 3QIWB 3BPLB 3C5SA 4ZFZB 3RVXD 4F15B 2A6IB 5F7DB 3EDJA 2OTPA 4HIIB 1FAIL 3GHBL 4KKLC 2FX9H 5JHLH 1I1CA 5GIRA 4UNVA 3FOMB 1DQLH 1TVHB 2OR9L 1URLA 3G04A 5MERB 1NAKL 3FQWA 5FB8B 4L8DB 3BI9X 3DNKA 4XVUD 5A2IH 1MREH 3N50A 3UYPA 5GS2D 5I8CB 3MNZA 4UB0L 4FTVA 4G8GE 2DIBA 2ZG2A 1HH6B 5J13C 3MUY1 1MVUA 5CD5C 1WEJL 4KVCL 4ODSH 2VDPL 1C08A 1CF8L 5E8EA 5ILTH 1LK3H 4XP5H 2R56H 4FQXA 4TSAL 4ZSOE 1IEAA 4GFTB 2HJKA 2YMXL 5BXFB 3RWDB 1CWVA 2W9EL 4G8EA 1SVZA 5M95B 4JFHD 4DZBA 1NBYB 2D3VA 2YWZA 3VRJA 2PKDA 3VFVA 4LU5L 3TV3L 4UNTA 2ZPKL 1ZHKA 1SYVB 4MLIA 1IBGL 1I7RA 3G5YA 4PJIB 4OZIB 1BVKB 4HS8L 4ZUTB 1DP0A 1MHPH 1E4XL 4KROC 3BXNA 5H94B 1ED3B 1I7UA 1JV5B 3IVKA 3DECA 1FNLA 1E6JH 4BH7A 3UPRA 4JFDB 4UOW1 5DHVH 5I19H 4XPBL 4KK8C 2A6IA 1IGTA 1R3KB 1EJOL 1DVFD 4R4ND 4R9HA 1OTSC 2G75A 4PG2C 1QPPA 1R3HB 3QXUA 1SEQH 2J8UF 2BY1A 5ETUB 1J0IA 3T1FA 4WWKC 4ONHA 1JNJA 4XPHH 4LLAA 4TSCH 1QLEH 4GH7B 4DKEH 3L7EA 1BEYL 3EOTH 5MEQB 1M71A 4YK4C 5LGKA 3G9AB 5I1JH 4HCRL 3D25B 3VXNB 4L9LB 5JOEA 3AB0C 4GLRH 3QZWG 1B2WH 3M17A 2BOCB 3LS4L 5E2VL 3IRZA 4IS6B 1NPUA 4JGUA 4GW4B 4QXGL 4PRHB 3HNSL 4PJXB 5T5FH 3QQ9D 3QUML 4K55A 4I2XA 2VDML 4NNXA 1RUPL 1CXIA 3GIVA 5C0DB 2WAHA 2BNUB 3O2VL 2AV1B 1S7WB 4NKDB 2FGWL 2DKUA 3O2WL 4U0QB 5MEND 1WCBA 3BVNA 3WLBA 5HHXH 1WBYB 4XB7A 5C0CA 4EJ1C 1VFAB 3S4SB 3CK0L 5EO0A 4NO2A 4WDIA 3UXFA 4NQDD 4BYHA 5BVPH 5FKAA 1YN7A 2Y7QA 3FB5A 5C6TH 3DGGB 4DZ8B 5E56A 3ZDYE 3VI4E 4JRYD 4JKLA 4KHTH 3V0WH 3C8DA 4OI8A 1BGXH 1IGMH 1IARB 3ZYJA 5F21B 4BSVB 3U2SB 4R2GB 1PGRB 3PIQB 1Q1JH 1AJ7L 4JY5H 4XWGH 3HLAB 5FGCE 2CRYA 1KIRA 1G7PB 4AL8L 1JTPA 5D70H 5KVFL 4KGLA 2ICWB 4PD4K 3T0XA 1KCUL 3MBEC 4UQ2A 1GCFA 1A7RL 1FC1A 4DFIA 4LSTL 2AJZB 4PJDF 1NAML 3ARFC 2DYPB 3CAFA 5T1DL 1UM6L 1I4FB 1Q9OA 4C57C 5DD6B 4MD0A 3QI9D 3TIEB 4EN3D 1E28A 4NZUL 5E8DL 3IFNH 4I3RL 1IC4L 1YEGH 1SJHB 2PUQT 1NC4B 1J8KA 2IH1A 5KSAA 4RGMC 3T3PE 2B5IC 1VPOL 3HG1A 4F7MA 5D7IE 3OGCA 5J13B 2Q86A 3CGTA 5BS0B 1JYNA 1XF2A 4LVNB 1B0RB 1A02N 15C8H 4ZS7L 3K4AA 4YHYC 1UB6B 4U1SB 4JO3H 4LSSL 5SWSB 4WUUB 4PJ7A 2IADA 5I75B 3TO2B 3RWJB 3AUVA 43CAB 1YPZE 4NQED 3P0VH 1W8NA 1OLZA 1A9BB 3RUGA 2D7QA 1FRGH 4J6RH 1IKFL 1OGTB 5D1ZA 2YMXH 3QJFB 3BWUC 4UTBH 5E8EB 5GGUB 5T3XH 1QBML 1FV1A 5KW9L 1RD6A 2DQJL 2XA3A 3ARDC 1A22B 2P8LA 2Y9RT 1HHHA 2R0ZH 4BA8A 2R23A 2IWGA 3QH3A 4JFYB 2B20A 1QOKA 2C3VB 4K3DL 4NHCH 1AC0A 3V5DB 3SBWA 1Q72H 4IRZL 1L7IH 2NY7H 5IQ9B 5EU6E 2DTMH 3I6GB 4OZGA 3OKNB 1JNHA 3WV0A 4Y4HC 3GKWH 3FHQA 2XN9A 2D0HA 4W4OA 4ZTPL 1LE5A 2CLVA 3DX9B 3MREB 4X6CE 4Y8DC 1A6TA 3GIVB 1QSFD 5TE4H 3LKRA 2YPLD 3A67H 3QDMD 4UU9B 1OLLA 2HKFL 3VG9B 5ID1B 1NC4A 4UV4H 3WNKA 2WINB 1F4WH 4UT6L 4TNWF 5D1XC 4OT1H 3SKOB 3ULVD 4DVBA 5AD0A 1M05B 3CVIH 5DA0B 3RI5F 2WSKA 2W9DH 4BH8A 3ABZA 3TBTA 2E7CA 3PWPE 3KWWA 5CCKL 3CZFA 4JFQB 1YNLH 4AQ1B 2GJZB 1E0OB 1Z2KA 4LVHC 4HWBL 5ID1A 4NNPH 4IOFC 3U82B 4M7LH 2FX8L 3LSOB 5T5FL 3TVMB 1AQDB 4G6ML 1R3IL 3GMLA 5HGDA 4WEBH 4RAUB 3ZYZA 2HWZH 4Z7OE 2UYLA 1H8OA 4KH2A 3C60B 5FOBA 4JQXC 3KPSA 3MLSL 1DVFC 4R4NC 5CWSA 4PR5A 1DTUA 3FRPA 2GQHA 2NX5A 2E27L 4NFCA 4Z6AT 4WWKD 2HFEA 3QG6A 1J1XH 1T1YA 4ZXBD 3VD7A 4N0CC 4OIIL 2VLRD 4POZD 3GMNB 3KPQB 1FE8L 4G8GD 1X5JA 1GL4B 1ONQA 2VXUH 1P4LA 5F44A 2BSSA 1OSPH 3PP3K 4PJXF 3FT3B 4ZUSA 1RVFH 3HN3A 4LCWA 4HEPG 1KG0B 1ZLWK 3Q3GB 3PDGA 1GXEA 1C5DA 3WFEL 5JHLL 2ZUUA 5I1HH 1AY1H 1FL5B 4F3FA 3CH8A 5JW4R 1S7VB 2X1WL 1YNKL 3DX6A 1OAXH 3U7WH 4Z7NF 1S9YB 2APWA 3U6RA 5DTFB 2AKRA 2VWEE 4MCZA 1HWGB 3JV4A 4OUOA 3UTTE 4HKXA 1ES0B 1N59A 1H3VA 1S7TA 3QPXL 1NCAH 5ITFA 2UY6A 4JFZH 2X4NA 1IM9B 1BQUA 3OG6B 1LO0L 1I4FA 4AG4H 3WFHA 4XP6H 1U93A 1T6WA 2HA1A 2AXFA 2OJEA 3CSPA 5JNYB 1E28B 2AAVA 2YPVH 2YD3A 4KI5F 3GSUB 4HUKB 1WZKA 3H9SA 4XCYB 1M7DB 4MNGB 4LLMA 2ADGB 5IMLA 2X4OA 5D7LB 4R7DB 5DK2B 4YDVA 5J11B 4QTHA 3JV4B 5D2NC 1I7UB 1JV5A 1FBIL 5E9DB 3PGCA 4TUJA 1FFRA 3OKKB 4XPHL 1Z6JT 4Y1AA 4KHTL 3QIWC 3EYVA 4V1DE 2APVA 1GOFA 4UILH 3ULVF 3HS0B 5F72S 1E4KC 3BIBX 1G9ML 3HZMA 5LQBH 4D9RD 3BHBB 1MLCB 2GUOA 3CH1A 3WD5L 5C3LD 1PZUB 4P2CG 2ZOKA 4X7DC 3ILQC 3PDOA 1N0XL 1RZ8B 4U05A 2YPKA 4X6BA 2VQ1B 3LZFL 3MJ9A 5BQ7A 4IMKA 1Q9LB 1TDQA 1WZLA 2I9LB 3FB6B 4I5BB 3ZSTA 1S5HB 4GKZB 1NBQA 4ZAKA 2CQVA 3CCHB 3MRLB 5CILL 2H2SD 2P8PB 3SO3C 5KSUB 3TA3B 1RUPH 4JANA 3VXUD 4NHCL 4Z7WA 4JPIB 1II4E 1TZHA 4NO3B 1MPAL 1G6RL 4HGMA 5FUOH 1Z5LB 1D5MA 5DK3A 3BKML 2P5WD 3ZZ1A 3OZ9L 5HPMB 3OR6A 4X6EB 4G42B 4XMPH 5EBWB 2R2BB 1GHFL 1ZS8A 4GKZA 2NZ9D 1BHGA 1G6RH 3Q5YA 1DQLL 2SEBA 3DO3A 2FR4A 2DQHL 1J10A 3SKJH 1XZ0A 3TPUB 3K7UA 4HUUB 3GJFK 3V0WL 1DR9A 5D71H 2DQGL 4ORGB 4Z77B 3L3DA 4XB8A 5JDJA 2VLJB 3CXDL 1J8HB 3P9LB 3EFFA 4J3XA 3WIHL 1EO7A 2IALB 2GJ6E 4ZFOA 4Z7UB 3O9WC 3SDDB 1KUMA 1VCAA 5EN2B 1A7BA 2XZAH 3PWNB 4M6OH 1V3KA 1KELL 1Q9WB 1AE6L 1MJUH 2VZ3A 1TVDA 5DRNA 2FECL 5CD3B 1B4RA 1XR9B 1VFMA 4DK3A 1UWEH 1BIIA 3P4OA 1JGDA 4KI5E 1QYGL 2PTTA 5EU4B 1IQWH 4LHUG 1S7SA 4Y5YA 1BPVA 5HDBE 4G8GA 3N1PC 3O6FA 5GQBA 2CDFB 3FO1B 4Y4HD 3VD3A 3MLWH 4DKAA 5GHWH 3BSZH 3BW9A 1ED3A 4JPKL 5JXED 1CLZH 1DBJH 1ROWA 1UKSA 2CH8A 1JZ2A 1RMFL 3V52H 3V5KA 4H8WC 1WWCA 3V8CA 1BP3B 4XP5L 5JIPA 1KACB 3UPRB 2PW2A 4JY5L 4DWHA 4L3ED 4XGZA 1OSZB 1FH5L 1IM9A 4GW1B 3HR5A 1DBBL 2EDJA 2DQTL 5FO9A 5ICXA 3LCYA 4NQUA 5C70A 1MJ8L 4M48L 3PHQB 1RJYB 5CFHA 4KRMB 2JJVA 4KMTH 3FQXB 5DZNA 3WIIH 2DTML 1OF2B 4M5ZH 1WWBX 3WJJA 1P4LB 3DYOA 4LSDA 4YUEL 2HT3D 1BBJA 1A7OL 1FN4B 4NQSB 1KPRA 4NQDA 4U1HA 5IBUB 3VRJB 1UM6H 3MLYH 2EDBA 2EDQA 3LN5B 3MV9E 4L8BB 5J6GB 2ATKA 1MWAL 4G7VL 3W9DA 3CD4A 3Q3GA 4EZMA 1BJ8A 5D2LA 4TPRL 2CGRH 1OP5K 2QADD 5GGTA 3S35H 1A0QH 4L8CA 4PRAB 4U6YB 3LRSA 4HIJA 4I18C 5EFIA 1NCNA 4S11A 4NOFA 1HILB 2NY6C 3AS2A 2XV6B 3IJSB 4P9HC 1NFDB 4KJPD 2GHWB 5IEKA 1BQLH 1CU4H 2AV1A 3QUMB 4PGCA 1RK0B 2IAND 4M7LL 2C4XA 2EICA 4L3EB 5I1JL 5HVFB 3KJ4B 4M9OA 4BZYA 5JR1H 3C8KA 4NUJB 4WTXA 1JWSA 2OTWA 5BVPL 3TBVA 5BO1H 1U41A 4PBWD 4E0RA 3UYRL 4RAVA 4XNQA 4XBEL 4P5TA 3VXME 1CD0A 3O0RH 4JFFE 1CE6A 1C5BH 1XCQB 4LSUL 3ARDD 2IQ9L 1M7IA 5EPMA 1BZ7B 1MFAH 4LCYB 5FO8B 4NC1C 5T3ZE 4MNQE 5KVEL 2FEDC 4RZCB 5JW3H 3SJVD 1YNTA 3BEVA 4IM8A 5GGSA 4GRWE 2XA8H 3HRZA 1B90A 1N7MH 2E7LC 1QFOA 4OF0A 4GRMA 4XMKH 4KI5D 2KPNA 4LHJB 3FO9A 4OCNC 4PRDB 5DUPL 3BPOB 3O45A 5DK0A 4JM2F 4JQIH 3QZWB 4XPGH 2NY5L 1NEZB 5KS9A 3FB7A 4JREB 5K9OB 5DGRA 1MIML 3BP4A 5IB3A 4ONFL 5E8PB 2NY6B 3AROA 1IAOA 3HUJB 4NBZB 2I24N 3QAZB 4K3JH 4Y1AE 4G9FB 4FABH 1A2YA 3IFNL 4I3RH 4JDZB 5IGXH 4ODBD 1G7LB 1X5YA 3ROLA 3GBML 1J9CT 2XRAL 4NJ9H 7FABH 4HJGB 3RU8L 1JRHL 1QSFA 1UACH 2WUCH 2P5EE 1TQCB 3NIFF 5HDOA 1ZSDB 3WL9A 4U4BA 1BBDH 4N5EC 4YFDB 4UV7L 3FTGA 3MOBH 4PJXA 4YFLI 3S35X 3WFBH 3DURB 3HI6H 4FFVD 3U30C 4O2EA 1RZJL 1CGYA 1PLGL 5I1CL 2ZUVA 2Q3ZA 3LD8B 1P84J 3D39D 2Q20A 2BJMH 5IK3A 4J7RA 2YKLL 4LF3A 4N5ED 4Z0XA 1IBGH 4WNQB 4W70A 4XBPB 4HAFA 4XPFL 4Q2ZB 2XZZA 4YQXH 3S4SG 1CCZA 1YUHB 1LEKA 1F3JB 4FFVC 4I0PC 4P48A 3GBNH 5FUOL 5EOTB 5BRZA 3PP4L 1GPOH 3JWOC 1O0VA 3I6LE 3IJHB 2I9TA 4X7TA 2FYYA 5H2BA 3JUZA 1FC2D 1HXMB 2Z9TA 1UWXK 2H6PB 3CFBB 3AM8A 1EHLH 1RJLB 5EORL 5ELIA 2ITDA 3EOYG 4R97B 1QKZL 3TPKA 2WNGA 3BKYH 3MV7A 4JZOB 2EE3A 4GLRI 4L4VD 1DSFH 2JK5B 2VLKD 5E4IA 4MJIB 4GG6B 4V1DD 1G9MH 2G60L 1OAXL 2J7LA 2OR9H 3L9RB 2Z31A 5I30H 12E8L 3S98A 3UPCA 3LKPB 2V7NB 5F6IB 3MJ9L 2XNAB 2DIJA 4ZUUA 4TQEH 5EDXA 1T3FB 3F8UB 4DKDC 2AV7B 1EFXA 4EN3B 1FN4A 4QCIB 1FFPA 2WW8A 2E7HA 5LAXA 4I3SH 1VFOA 4M43H 3SDCC 4A6YH 3I6KA 4JAMA 2X10A 2HTLC 3AS0A 2EECA 4TSCL 3GMMB 2RIKA 3I50L 1E4WH 1VB9A 1XGUB 4HK0B 2QSCH 5I1GH 5B39B 1LK3L 2ESVA 3ARZA 1C5BL 1I8KA 1XIWC 4RWHA 1F2XK 3HNVH 1KJVA 1G0XA 1TZHB 3B9EA 1VENA 4PGZA 4HAGA 1PY4A 1MEXL 4CU6A 4HPYL 5INDB 2VLMD 3B9VA 5FOJA 3I6KB 3BRDA 3D6GA 3VWKB 5J9PA 1TQBB 2IBBA 3VU2A 4LIQE 5FYKU 1OGTA 1AGCA 4RIRA 4DQOL 4ZFOL 4H1LG 3VRLE 4OBSA 4JFQA 5GJTH 2ZCHH 4J1UA 4OZGE 4P9HL 1FO0L 5JQ6L 3LHPL 4ISVB 4LHUB 2I07A 3HMXH 4XNQB 1MCEA 2VUOA 2FIKA 3HI1B 3O3AB 3SDAA 1RUKH 4KUCD 1AGFB 4YQXL 5KSVB 1ZK9A 4GKOA 2H8PB 2GT9B 1A6WH 1R0AH 4HLJA 2MQ0A 3AREC 3UBXG 4JFXA 5A2JH 2R69L 4G5ZH 5E08L 4JZNA 4UAOC 4U0RC 5D2NE 4L29B 3OKLB 3T08A 1LILA 3CSGA 3MPCA 3PXHA 4XWGL 4XXDB 5C0JB 4NKIH 2Y25A 2AQ3A 1JUFB 5FDYA 1SJVA 1DBAL 3K2UL 1ES0A 4FQJL 2P8MA 5AZ2H 3AREB 2YD2A 5C0AE 3EJYD 1DSFL 3K3QA 4OZFB 2YS4A 3OAUL 3VWJC 1F4YH 2A83A 3B9KD 3L3KA 1GGYA 2EH8H 3ULUE 1I8KB 5ADPH 2ICWA 1XR8A 3GMQA 1AKJD 3SJVA 4WY7H 3RWDA 3DROA 1JN6A 1UWGH 5DS8B 2AI0H 4IRJC 4PG2A 4H5SB 4FXLA 3NIGE 4MA1C 4I48A 4RSVA 5DD1L 3EO9L 4S0TD 2VDKH 3ARBC 3U9PH 2R9HD 1FFQA 2C4FT 1RJYA 3PHQA 3I2CH 4YXKL 5FDWA 5I9QC 3CH1B 5C09D 2QQLL 2IC2A 4PP1D 3T09A 1BQSA 1I9JL 4U2YA 3MCLH 4XVUC 1QSEE 5KVMC 1OW0C 3EHBD 5C0NC 4JFEA 2X2YA 5FYLD 2BJML 4ELMB 1FO0A 5BMFH 1U8IB 4AM0B 2EDOA 3MRRB 5JXEC 4NN5B 5GRZA 5DJAA 5KVGL 5JA9A 3HA0A 4R0LB 1ZVYA 3QCTL 5F3HA 4PV8A 4YHZH 5JHDB 1E27A 4BUHA 4GAYA 1U8LA 2CUMA 2ZUXA 5EOTA 5AYQA 1K3ZA 5F89B 5GRUH 3IJHA 2BDNL 4OZGF 3NA9L 1E4KA 2XRAH 4EI5B 5IKCA 4MMZC 4P46B 3WO4B 3OPZH 3UROR 3X3FL 3QHZH 2F19L 1CXKA 3F58L 5F7EL 5ITBL 1XGPB 3EW3B 4NDMA 4X98A 4PJEE 3T4AA 5GS0L 4IMLA 4QT5B 1SVCP 3TT1H 3PWJA 3H0TB 2JJSA 4ZDHA 5E94B 3D3VD 2WUBL 4H0GA 4JFFD 1HI6A 1H3TA 1QACA 3BIKA 2BP3A 1T83C 3HAEA 4P2YA 4U6HA 3RUGF 1FZJB 1IM9D 3FOLB 1S7QA 5KN5A 2G75B 3SQBA 4UT6H 5IB2A 4APQA 4PJ7F 2NYYD 2CLVB 4KJPC 3WXWH 1D5MB 3ARBB 4HKJB 1YQVL 5AYUH 1IL1B 3HHRB 3G5ZB 4V2BA 1SJXA 2OK0H 3N85L 1TNMA 2R4RL 3MLSH 3CFCL 1XF4A 1Q0YL 3F7YB 2AEIT 2X89D 3TJHD 5C1MB 2WP3O 5C0AD 5L9DH 4A2LA 3LQAH 4L5FH 4ZXBC 5FGSA 1QRNE 3E2HB 4FQHB 5D70L 3WEXA 3NPSB 5ICYB 1ZOXA 1R5IB 3QUYB 4IDJL 1FORL 5A40E 5DVMA 4L4TE 2CIKB 3DARA 4L3CB 4FQQB 1KBGH 2FEDD 4U1LB 2HJLA 1ADQA 3CMOH 4O9HL 5DJXA 4TVPE 2CJUH 5C0CE 4P3CL 3ULUC 5IOPA 2EYSA 4ZNEE 1V7ML 4QT5A 4OD3H 4MJ4A 2VQUA 3VH8G 3MOAH 3PL6B 1OAYL 1A6VL 3RIAK 3D2UB 4I2XE 3VFRA 2BNRA 4MAYA 1IZKA 2AJSH 3K0WA 1MQ8A 4HS3A 4TOYH 3NFPA 3LKNB 3IB4A 4S2SA 1KCSH 1ACYH 4WNQA 1NCBH 2LQRA 2RFXB 4F2MA 1VHPA 4JJHA 4YX2H 4F8TA 3DRTA 4Z5RA 2N4IA 1YJDH 3ARPA 5TDPB 3ZTNH 4RGNC 4CNIA 2X6MA 3BQUC 4X6FA 1OAZL 4CN4A 4H1LB 3H9ZA 4XCFL 4PJIA 3R1GH 5FHBL 5D2LE 3PV6B 3NMEA 1IEHA 1H0DB 5T3XL 4AEHL 5K59F 1PZ5A 2AKRB 2DQCH 1MOEA 4JRWA 3CFKB 1T22B 1MI5D 4LASL 5HHMD 1X5HA 3C09C 2Q7YA 3QIBC 3JWDH 1PG7L 3WDIA 1EV2E 4NP4L 3ZSSA 1MCBA 2VDOL 1JF1A 1F2QA 2DD8H 2AK4D 1J18A 3PL6D 3CVHA 5INCB 1GOHA 2VXTH 3MUGB 2D7PA 4OB5H 3WCYA 5C6WH 5HGHA 2ED9A 3FT4A 3MYZA 3BPNB 5FGBA 3SDAC 1LE9B 5JW3L 1NSNH 1ORQA 4Q58C 3VXUE 3V5KB 4NT6B 4XGZB 1NKRA 5IMKB 3FO9B 5IFJA 2DWEA 4HUMB 3NTCH 2NY3C 3EJYC 1X4XA 3I02A 4TUOB 3I9GH 4U7KA 5IB4A 4MA3A 4U3XA 1UH4A 3DMMA 2WWMC 3D69A 3CFJA 4PJFE 4C54A 5KSAC 3VD4A 2RCSH 1XF5A 6FABH 3QG7H 3G08B 4LNRA 4OLYH 3OSKA 1CDBA 3LD8C 2IPTL 4MJ6A 3QDGA 3FONB 1C7SA 5L7XL 5ERWA 1KJ3H 3MRGA 3V0AC 5BV7B 1K3IA 3U30B 3NZ8B 3FQNB 1TCRA 5I15L 1NGYA 5F9WC 2OR7A 2ATPA 2QQNH 4XPTH 3O9WD 4LVOB 1U42A 1NC2B 3MLUH 3QI9B 5IIEB 4ZNEA 3O4OC 1BECA 5F1IA 5IHUH 3MREA 1F6AB 3B9AA 4U1IB 5MHSE 5CEYA 4KHXL 4DUVA 4NWUL 4UU9A 2P5WE 4YGAB 3TH2T 1FLTX 1OWRM 4ODVL 1B0WA 2DLTA 3O2DA 1B88A 3VGAC 1NJ9A 4W6YB 3MLZH 4EKXA 5LQBL 5DQDH 4CVWA 3SY0A 5FXCH 4O4YL 5D5MB 3BMWA 3MQIA 4GRLC 2EE6A 2O26U 3WE6B 1T1XB 1JMXA 3RGVA 3WNOA 5CKAA 3KNBB 5J1AB 2WBJC 2A6KA 1CD1A 3UO1H 4FMFA 4N0FB 1I1FA 1YC8A 4LBEB 3VRIB 2E6QA 3J8F7 1A9EB 2HYMA 1C5DB 5E95B 4E42A 3EJJX 5GS3A 5IROA 2N56A 3GHEL 1MI5E 3U48A 3V2AR 3AXLA 4PRID 2CXKA 4OKDA 4KJQC 5C07E 4DN4H 4YNYA 4RBPK 4P2RD 1K9TA 3VFMB 1NCAL 3RWEA 4XWOC 4HMEA 3FO0H 2X4SA 1UB6A 2EDRA 4NM8H 3F5WA 1FNGB 3WFDH 3RWJA 2RHEA 3U4AA 3FN0L 4HLZG 4MDIA 4XCCH 1K8DB 4PUBH 4DEPB 1Y0LA 2MSPA 1FPTL 2ADGA 3LEYH 1T83A 3Q6FB 5E2WH 2NY1C 1XGQA 1QUNA 2GTZA 4M6NL 3MJ8B 2ZUQB 1MF2H 2FBJL 1CLYL 4XP9L 1D3CA 4HC1A 1CIDA 1PYWB 3BAEL 2HN7A 4MVBD 4C56A 3RVUC 1YDPA 4NQCB 2GSIA 1TTFA 4M6NH 1KCLA 5DJ8A 1FYTA 1MCKA 3ZTJG 3V9FA 4PRPE 4MA7L 4AIXA 4GAFB 1YEJL 3ZKMD 4M02A 3RL2A 3GGWA 1AGCB 4RIRB 5D72L 4WFGE 3MROB 4N9GA 1VESA 2CJUL 4MJ6B 5I1AB 1UADC 1FFNA 4QXGH 3O6FC 5DUBB 3TN0D 5B8CB 4UDUB 5I71C 2DJSA 2AJVL 1KJ2B 5JR1L 3CLEH 2XQYK 3OKDB 2H3NB 4OFDA 3EZJB 5HPMA 1AXSB 1H3PL 5IMMB 5IFHH 2WWKT 4QGYA 3MFFA 5F7YC 1ZEAL 3UAJD 4YHYB 3ARGD 1X6NA 3KPQA 4ZO7A 2R4RH 2DI9A 3EYUH 3SDXE 5F93C 4X4YA 4N0UE 4F7CA 5C0IA 4M93C 3GHBH 2MMXA 4H0IA 4YDJA 4JM4H 5CD5D 5DO2D 3VD5A 1WWAX 1YMHA 3N85H 1RK1B 3PDOB 4TVSa 1Z9OA 3QDJA 4KXZI 2OZ4L 3L3OA 1VGKA 1K8IA 4NJAL 5HGDB 1HH9A 1JZ6A 1BD2B 2IPTH 4R26H 4WI3A 1S5HA 4ZAKB 2C26A 5I1HL 3BEVB 3VXSE 3QEUA 2XTJC 2X41A 1VA9A 5D2NA 1K2DB 1YN6B 1MSPA 5EG6C 1KIQB 5FUZL 5TQ2L 4YDKH 3CLFL 4Q9RL 4AL8H 4LRNL 3NVQA 3H7BA 3OBAA 43CAA 4EI6A 1IE5A 5B4MD 4PJDA 3EO1B 4P2RE 3LQZA 1L7IL 2ESVE 3T0BA 5HGBA 5L0QB 2VDOH 4R4FH 3KWWB 4YHOH 4G6KH 1FZOA 5EIIB 1CFQA 3QULA 3OKYA 1A6AA 5KJRH 1D5IL 2XG4A 4DFHA 1FL6B 4AK1A 4ZO6A 4NC0B 3GHEH 3ILQD 1H8SA 1NDMB 5DQDL 3QCUH 4AM0A 4UTBL 2OI9B 2L7JA 2R8SL 1U8HA 1LQSR 1IC7H 2O5XH 3E8UL 4MCYA 4PGDB 1RHHA 2F5AH 1YEDA 3IDNB 5KAQF 4JGJA 2P5ED 2WQRA 2X9YA 1DQJB 5JW4M 4S1SL 1U8KB 5FUCC 3FN3A 3OQ3B 5DJZB 2F54A 1D9KA 1BOGA 4AIOA 3I2CL 4R96B 4YXKH 4NQEE 3EOAA 4PY7A 4WJ5A 5C07A 4ZQKA 3ZDXF 1OAZH 3MRHB 5E2WL 5IW1A 4XAKE 4ALAL 4Y2DD 3SGDH 5EBMA 3UP1A 3C60C 3X3FH 2JJWA 1KFAL 4A6YB 1KXVC 1WF5A 3KPLB 4YIQA 5T1KD 3QFJD 3RPIA 4KZDL 1BOGB 1DANU 4PJCE 4X6EA 3B2VH 3KXFD 5J11C 5E0QA 2AW2A 4LSRL 5HI3D 1CE1H 4AEIH 1AFVH 5IWLC 4G7YL 3QT2A 5BW7A 3MRPA 3B9KB 1OM3L 1WBXA 5EO9B 4CVZA 4APQB 1IL1A 1H9VA 3IDYC 3NGBB 4J3WA 3QRGH 4Y5VC 4BFIB 5IV2A 3FKUS 3CDFA 1QSFE 5B3JE 3QULB 3RWCA 5LXGL 2Y1VA 4LQFL 3PWUA 4PIRF 1U58A 1EUTA 3DV6B 2VQ1A 4PR5B 2HVJB 1KTKE 5GSVA 6FABL 4AT6B 2J8UA 5HYJA 2VABA 1FE8H 5EBLA 2YKLH 4TULL 3EYSH 3I9GL 3H0TA 1M7IB 2OI9C 1L9MA 5EPMB 4M7KL 2BERA 1MJUL 3RGHA 1I8MB 3MLZL 4F7PB 3LH2H 4J6RL 2PO6D 3QDGB 5BZWB 3QUXC 4NSKA 3MLXL 5F1KC 3REWA 1MCOH 1ZWIB 4G43B 2R0KH 4ZFGL 3SKNB 1BD2A 2ADJB 1MHHA 5KJRL 4YWGH 3UTSE 1CF8H 2JELH 4HUUA 4X83A 3I75B 2ID5A 3STZB 2SEBB 2RB8A 1RK0A 1KJVB 5CJQH 4J12A 2WUCL 1MFEH 1I3GH 2DMKA 4GQPH 5I0DA 1CVSC 5DEZA 2AK4A 5E5RB 5GRWA 2HT3C 1NUDA 4XVSH 3LEYL 3MCLL 3TIDB 1INQA 1U6AL 5DC9B 3C9NB 3VXUA 2Q76A 5I1LA 1J1PL 2B1HL 4XVTL 2GK2A 3F6IA 2AJSL 4HZAA 2H32A 2R29L 4R3SB 3TFKC 1W2KT 5TGBA 3U4EA 5EO0B 2V6HA 1YY8B 1D7FA 2HFTA 3UTPD 3DXAB 3IGAA 5KS9F 4R4FL 2VXVL 2VXQL 5EC2A 3B9KC 4OT1L 4L8BA 4G80B 1E4WL 4YX2L 5IB1B 1SEQL 3BP5B 3U83A 4FXGA 1UA6H 1JYXA 2XPGA 3ARDA 5BCAA 2E6JA 2VZSA 3FFDA 4YDKL 1D5BB 3TFKD 5J3HD 4FFZL 1LWRA 2YC1A 4XHJC 4KDTA 4NQXB 2F54B 3OJMB 2Q7YB 1UVQB 3VW3H 1I9JH 2X7LB 1A4JA 1ZA6A 3H7LA 4WV1B 5T1LD 2PW2B 5ICXB 1AGDB 2Z31C 4HKZA 5BZDA 1FIEA 4Q0XL 3F65A 4OZFA 4CJ0A 1T04A 1HSAB 3E1F1 5H2BB 2LAAA 5IHZA 3L3IB 5J6HB 4Q7DA 5DT1H 3HZYB 1N6QH 5MENA 3QA3A 2JCCB 1A4JB 4AMKL 3P40A 4JHWH 1FCGA 2BSRA 5E99H 5HJ3A 5C0BA 3P0GB 5HHOE 4PJ5B 3MRPB 1CXHA 2BSTB 4QRRB 1G7JA 3MJ9H 5I0ZA 3SDYH 5FUCE 2YD1A 3O11A 4KJWC 4IRSD 4R0LC 4ZOAA 2WBJA 5CIPH 1FSKC 4YWGL 1R24B 3CXDH 5IMOB 3VG0H 5JOPD 5FA3B 1MCWM 1IQDB 1QSED 5L7XH 3QHTC 4EIGB 4ZO9A 3RGVD 4RAHA 1I8IA 2BNQD 4HX1B 3KYNA 3UTSA 4UT7H 1BQHA 3H42L 3HE6A 3WDHA 2Z92B 2NW3B 4PJHB 4LRIA 2WLZA 1I9EA 3FQXA 5FF6B 3O8XC 4HIXH 1G7HB 2VE6B 4G9FA 4K3JL 5EOQL 1MCFA 2D0GA 4FTVB 1RQ5A 1IKNA 3MBXH 4PLOB 4XCNB 4PV9A 3CUPB 1JPSH 2ICCA 5C9JA 2A6JB 1RHFA 3P30L 5DC0A 2YPVL 2LAGB 4K94C 4Z7WB 3KYAA 2OTUA 3V7AE 1EGJH 3O8XD 3H3PL 5FKPA 4KPHH 5DRXB 1K6QH 2DI7A 3MLVL 5FF6A 3ARYA 5SX4I 1EXUA 2XNAA 4GXUM 4AQOA 4HBCH 2EDXA 4EN3A 8FABB 3GB7B 4LEOB 1U95A 4PRDA 32C2B 4FFWC 1YEFH 1TCRB 1MFDL 1GGIL 1QFUL 5HPOA 3FOLA 4OQTL 3HS0A 4K07A 4QRRA 3OXSB 3CFEB 1F11A 2FHFA 1JYWA 4LLYA 3I3EA 1M05A 4EOWH 2OM5A 2VR4A 3MSPA 1Q94A 5IEHA 5C0CD 4GAGH 1R6VA 3BD5A 1BQHG 3GB7A 4GXVL 5D7IF 5CZXC 4DN3H 1CFBA 1CFTA 5ALBH 5DD3L 3ZE0E 1FVCB 3MBEB 3BPNC 4IJ3B 3WYRA 4KKAD 3D39B 3EBAA 1U8OB 1R3HA 5ETUA 5CIPB 2FJFB 4YO0A 3CVHH 1HHGB 3DVFA 4PJGF 4R4BA 2R8SH 4PJDE 2VWEC 1UG9A 3QQ3B 2IMNA 2D31B 3K80A 1ZE3C 2NY7L 1WGOA 3RDTA 4IRZH 4S0SD 3BGMB 4LCWE 5F6IC 1NFDA 3LB6C 4D0CB 1NMCB 3C6SA 3S5LG 3WFCL 4TPRH 1B9ZA 5D93B 1T1WB 1CZ8L 5HDLA 3RX8A 4Z7WF 3BDYH 3GO1L 4F37F 3O4LE 5CJOH 3FT2B 4OLXL 2IANB 4QKXB 3TBWB 3C2SA 2EEBA 1AP2B 3G6DL 3GJFB 5JW4N 4LK4A 3RUGB 1MWAB 2W0FA 1NLBL 3NZHL 4GW1A 1WT5C 4R7NA 3EOAB 4ZPVA 2A73A 5IW3A 1KJ3L 3DUSA 4H25B 4KVNH 3IKCB 1TETH 1WTLA 4RFEA 4F7EA 5SX4H 5DRWA 5DGQA 4PRHD 3QIBA 1GIGH 3HG1D 1E4XI 3V6ZA 2QQKH 4MJIA 1U8NB 4LPWA 5J56B 4K8RD 3MA9H 5IB5A 3O3BB 1TPXC 1OB1B 2N7AA 4Y16A 3SJVB 5TDPA 4CNIB 2CRIA 1VSCA 1XGYH 3ARFD 4Y2DB 2OL3L 3WE6A 5L2JA 5BOZG 2NY2B 3QQNA 3PWLB 3QRGL 2PCPB 5ALCL 1UH3A 3VFWB 1RU9L 3C6LC 3B2UD 4Y4KC 1S9VB 3LN9A 2YPLE 4WEUD 2CRZA 1RURL 3RWHB 4NKOA 2D7MA 4HWUA 1F3JA 1S5IH 2M2DA 1UACL 2FX7L 2HVKB 1N8ZB 2XN9E 2HTLD 3OX8B 1I8LC 5C0ND 3P77B 4X6DB 4APQD 2QSQA 4M5ZL 5ACMA 3QO0A 5TH2A 1HH9B 5DJDA 4Y19E 1YN6A 1ZXQA 3UJIL 1XIWD 3C2AL 2Z8VC 5I8EA 2IBZX 1OPGH 1T0PB 3H7BB 4E41A 1S8DA 4U3CA 1FNEB 2OJZH 5DQ9B 5DRZB 1OWWA 1KIQA 3OF6A 4OLZH 3QUXB 4OZHE 3TH3T 1U91B 3OAZK 4RISH 5KSBA 1RUQL 4Y89A 1G1CA 4NFDA 4XRCA 3GSNA 4MNHB 3QFJA 1UM4L 4LLVA 1CDIA 4HIJB 2HG5A 5EFIB 3G6JB 1RIHH 4I9WE 5D7KE 1VEPA 3V6ZB 1OARL 4NO5A 1CGSH 1J1PH 2AXHA 3DX8A 4NKMA 5C0GB 5DEFA 5I6XB 1MCPH 3QZWA 5IGXL 1ZTXL 3WKML 2W07A 3QQ4A 5B22A 1LP9B 2HFFB 2QV2A 2VJXA 3BN9D 3RL2B 3KLAA 1FV1B 3C5JB 3SCMB 3DRQA 3VFPA 1V5JA 2UUDK 4LIQH 4JFDD 5DUBA 5EOCJ 5GZOD 3BMVA 1T2XA 3AY4A 3KJ6L 2R1XA 2AQ1A 1J0YA 2ZJSH 4OF5A 3V0VB 1WITA 3VDCA 4HQQH 3UTOA 1EHXA 1NFKA 1VEMA 3GNML 3T2NL 4JVUA 1INEH 3KPTA 2D03H 1JZ3A 2BZDA 2VH5L 4XWOD 1AQKL 2VL5A 4YHML 2R4SH 1FGVL 1J05B 1V3MA 4F2MB 1OOAA 4P57A 1WQVT 2PXYB 3MZGB 4G8IA 4HIHB 5HI5D 4W6WB 4OGXH 2EYTB 1NCWL 3UTQA 4KKNA 3I6LD 1FVCA 2IPUG 3MBEA 4EXKA 1QRKA 1DANT 1KEGH 1JGDB 3P11H 5DDHA 1RAMA 2CDFA 5CINH 3FRUA 8CGTA 4ZAKD 4MHHI 2D7OA 2RQ8A 1QR1B 4DTGH 1IAIL 4GBXA 3QHFL 2VDLL 4F57L 4PTTB 5D6CB 5EORH 4CVZB 3GBMH 1J05A 2VQTA 4ZOBA 5J6HA 4OLVL 4MVBC 1P84K 2MOVA 4K3DH 4D94A 3EYOA 3RTQD 4LCWB 4XH2B 4XHJD 5HHVL 2C9AA 5K33A 4BQ8A 1JF6A 1LHZA 4P3WA 1ZSDA 2ZCHL 4D9RE 1N64L 1BREA 3QEGL 1JF1B 3PQYE 1U8JA 4KKLD 3MGTB 1CS6A 1VGEH 5IJVB 1PDKA 3T0VA 4HGWB 2DS4A 1AD9B 4ONOA 3SCMA 2D7TH 2VXUL 3ZHLA 3EIFA 3MXWH 1EBAA 4Z7UF 5IHLB 4QWWD 5DS8A 1S7UA 3TNMA 1MJ7L 1YYLH 5HY9A 3KPRD 1FGNL 3OKEA 3PDDA 5CWSB 4LSSH 4PY8J 3S88L 3PWPA 4MXWH 3BQUD 3QUKB 4S1RL 1QQDA 4KKBD 1QG3A 4ODHL 4Z95H 1DEDA 3HE7D 4LVEA 2X70B 1YEDB 2VZOA 4ETQB 1P6AB 4XMLH 1R5VA 1INQB 4Q6IC 4FQCH 3GI8H 4HS6A 2OXGA 5FCUH 5DWUL 1XIWA 3GRWA 4D0DB 4X5WA 1A21A 1KN2H 3SDXA 3RKPA 4KJWD 3B9DA 4KHXH 2LU3A 1T89A 1CLZL 1DBJL 2L7UA 3M17B 1I3RA 1AIFA 3MROA 4XI5C 3ULVE 4OI9A 2NYYC 3B5GA 2ZOLB 2VIRB 4M7ZC 2QR0B 5DD1H 3SDDD 4PREA 3C8KB 3SDDA 2IJ0C 1B6DA 1MHHB 3NCFB 3PGDB 1Q9WA 4U1NB 4KQ3H 3GMPA 5IFAH 4YLQT 1BWMA 5F7KC 4XAWL 1DJSA 1S7RA 2Q87A 1X5AA 2CK2A 1EJOH 1R5IA 3QXWA 1FZMB 4Y16D 3WIFA 4CU7A 1PLGH 4NYLA 1WBXB 3SKOA 2QHRH 3T65A 43C9A 3OB0K 1K8IB 5HYEA 4U7MA 3ZT7A 1OT1A 4DZ8A 2PETA 4AT6A 1FL3B 2YZ8A 3QCTH 2VB5A 3HAEG 1A7QH 3DIFB 4XC3H 4GKSB 5F7WC 1HNGA 1A7NL 3S5LA 3QB7C 1CFNA 1BVLA 2F8XC 1S78C 5FK9A 5KZCB 3LV3A 4MD5A 1T5WA 1BF8A 3IFPB 1HE7A 3K4DA 1MHEB 3VG9C 1KJ2L 3AXLB 4LLWA 4UDTA 2ZUSA 3REVA 3WO4C 1N6QL 1A6PA 1BQLL 3NGBC 3QDAA 1UJ3A 4Y5VB 1QLRA 4PB9H 4EVNA 4RFOL 1KPUB 1JNNL 2J88L 3W11C 1BFVL 2VL4A 1CDUA 1RIVH 5FECA 3PQYD 1N2RA 4MXVF 1QFWI 2O5XL 2ORBH 4GRWF 2QKIA 3QPQC 2FGWH 4MJ5B 1KPRB 4UV4L 4O02L 4NPYB 1RZKC 5IVXF 3IAGC 2DQHH 4GRLD 2VXSL 3LN4B 2WBJD 1EMTL 3U9UB 5TDOA 5D2LF 5IVNA 3MMEA 3PWVA 4WIQA 5E5UB 4MQSB 5B39G 1C16B 4K71C 3QWRA 4OKVA 2W9LA 4WFFE 4HPOL 5T5NF 1KC5H 1PKOA 3GIZH 4OFIA 2WMPA 1TTGA 3KLHD 1CBVH 2ZKHL 5FHAL 4RGOH 4X7CC 4OCXH 2B0SH 4CUCA 3IS1X 3GUTA 2IAMD 2UY7A 4JFZL 4RAVB 4GUPB 2R2EB 2EXYD 3X12A 3OZ9H 4NQXA 3WEXB 4IRJB 3DUHA 4KRNA 3ZDYF 2Y23A 5C71A 4OD1L 2FZ3B 1HHKA 4S1QH 4MA8L 5C6PB 2Y5EA 3W0WB 5LBSH 1OP9A 4Z7VF 3PNWB 5D1ZD 4ZO8A 3H6JA 2N7BA 2HTKC 4H8WL 4HW6A 1MCNA 2P4AB 3U0TB 1TITA 3BP7B 4ZS6D 4Z7VE 4G6JH 4M61A 2Z8SA 4NKIL 1F97A 1YMHB 3LEXB 1IGCL 4X8JA 1NCBL 1MREL 3LDBC 3GRWL 1UB5B 3ZDZF 4RWYL 5HHPA 4XRCB 5D8JH 1NGPH 2VMFA 5C0DA 4BFBD 2AK1L 1HIML 2YPKB 5GISL 3QI9C 2UVEA 2DMBA 4N9GB 4QHKJ 3MOAL 4JDTH 3IKKA 3KS0H 1NJ9B 1BBJB 4PJBE 4BELD 4GG8B 3TEUA 1BFOA 1FFNB 4RFNB 1ZWIA 4G43A 1G7QB 5K93A 2D4FA 1OT2A 3T0EA 3BGFB 5BQ7B 5FA3A 3TN0C 3MRLA 1T5XA 3MLWL 1CDGA 4ZUWB 4I3GA 3T2OA 1ACYL 4LLDB 4HWZA 4B50A 3PWJB 5AUMA 2WUBH 1GGTA 1XH3B 1PZ5B 1YMMA 5L6YH 3ARGC 5KG9A 4OZHF 1BZQK 4EDWH 3GUTB 2MKLC 5EWIL 3RVXC 2OR8A 3UMTA 1ZVSB 1J0JA 4JRYB 1U3JA 4F7MB 5BW7C 2DD8L 4PJCB 1DL7H 4JG0L 2BXYA 1FVDB 4M3KB 1RZGB 2C1PA 4Y7MA 1BM3L 5KVDL 3ZE0F 5DFTA 5FYKD 5F3BA 2EE2A 3B83A 3MXVL 4OZIA 1ZHLB 5DRXA 3KYKL 3BXNB 4JY4B 4KDVA 2X4PA 4G8IB 1JF5A 4CADA 3TLRA 3VI3F 1X44A 4UQ2B 5KVGH 1I75A 3H3KA 2IEPA 3SBWC 4R90H 4GSDH 1Q1JL 4XCFH 1XGYL 3EGSA 2D0FA 4RX4D 1WSST 3ZLQC 3F7PC 2FO4A 2P44B 3DV4A 5I8OL 3GZKA 2W0PA 4MA8H 4PRIA 2VLRA 4DEPC 1MVUB 2A9ML 1KB5B 4BK4A 4H5SA 4H25A 3DUSB 2J4WH 3J7HA 4FZEL 2X89A 1MRCH 3HB3D 3D87B 5GS0H 1P69B 2N1KA 1IEAB 4I48B 3O4OB 3LS5H 4DGYH 4Y16C 2BNQA 3F7RA 4N0CD 3S36H 3S3SA 5FHAH 1EZVY 5T1DH 2FJFA 2FB4L 3MODL 2D31A 4OF7A 1G7LA 1L7TH 4R8WH 4MAUL 4MNHA 1IAII 1NAKH 3O3DA 5C0BB 3D9AL 1JPGB 4WWKA 3G04B 5B4MC 1F4XH 4RQQB 3ZKMC 3SGKA 1FVDA 4R26L 4I0PD 4AEEA 1EDQA 4YHLL 2NY5C 5SWQB 1UM4H 4WFED 4BZ1H 1HINH 1BD2E 4P59H 3H42H 1JGVH 5IW6B 2G9HA 2D9QB 4DKEL 3W11D 3LSOA 5GGSY 3BIAX 2EC9T 1T7VA 5KW9H 3UJJH 4HFUL 5DJDB 3QWQB 5IT2L 4MSWA 2ZUWA 3BKJL 1OAUL 1QFUH 3DBXA 3DVGA 3V4PH 1U6AH 4QWWC 4JPKH 4WW1B 2PR4H 3EYQC 4WW2A 5IKCB 2BHUA 1CL7I 4X6DE 4NQCA 3VXTB 3M1BB 5JO5B 2GCYA 3LVEA 1IAIM 4HV8A 4FXKA 4LLMB 5IMLB 5MHSD 3BESR 1QFWM 3D5OF 4XC1H 2BFVL 3L3OB 1GRWA 3BWAA 1FSKB 2JB6B 4HS8H 1WISA 5GSVB 3IVKB 3AAZA 2QQLH 4N0UA 4U6XB 4DVRH 2PCPA 4BFEA 3JSSA 2NXZB 4X7EC 2AXGB 4M1DL 3F12B 2VAAA 4QRPB 3V6OE 2YA2A 1GZQA 3PE9A 3U0TA 2V2WA 3BPCB 4JN1H 4K3GA 4Y4FB 4UI2A 3KVQA 4UILL 5JOFA 1WBYA 2E9JA 2HKFH 1REIA 4UT7L 1WFUA 1WFTA 4U6YA 2CKBH 4JGMA 3SE4C 4A6YL 5ESAA 4NRXB 1QP1A 4NCC2 4OLYL 1T3FA 4HULB 3WS6C 2P8PA 2IAMC 4EEEA 3NIFE 2DM3A 5FCSH 5IESL 5MP6L 4XNMB 4OSUL 3HRZB 4PRIE 5LGJB 2F74A 3RUGE 1YYML 2WIIB 4YDLC 5DQ9A 4QNPF 5DRZA 4M5YL 2OXHA 3BH9B 1AFVL 3PL6C 1JGLL 2XWBA 2NQCA 2FO1A 3DBXB 1NBVH 1DQJA 5DMGC 3CZJA 1DN0A 2C3HA 2OL3A 5ADOH 3KYMB 2PW1A 1OAQL 1XGRB 1U8QB 3AB0B 4LCCA 5HYFA 2FCBA 4YR6B 3X17A 3T8XB 2PO6C 2MCG1 2V7HA 5L2KA 1XCTB 1UCBH 1WC7B 3C5ZD 3N1QC 3KPMB 4HMDA 4JO2H 1MI5B 3KS0J 1IAKB 5F7LB 5K9QG 1HKLH 4PB0L 2J88H 1JNNH 1WFOA 5EA0H 2EIZB 1CT8B 3U9UA 1F4WL 2JIXB 3PUCA 1N59B 5DFWH 4MCZB 4YHPB 2EE9A 4D0BA 2R0KL 2R1XB 3HC4H 2VZ1A 4LF3B 4HPOH 4KKCC 5DWUH 5BZDB 5FCUL 3GSXA 1T0MA 2X4UA 3BP6A 4N90D 3LQAL 2F8OA 3V6FB 3LAFA 1U92B 1Q0XH 4WVRA 3VGDA 1KIRB 4MXQD 5DURD 3QEUB 4NRZB 1TIUA 3GI9H 4WHTB 3RNKB 4S1RH 1T1ZB 3EAKA 1KB5A 2RAMA 1A7RH 1IILE 1UYWH 5I1LB 1A7PL 4ZQKB 1KB9J 1KTDA 1AKJB 1BX2B 1HQRA 4JJ5B 2H32B 1CFVH 5GGRY 1WBZA 2B1HH 4KQ3L 1KB9K 1EGJL 3V5HA 3MRIB 3MV7E 3DVNA 1V7MH 4O2CA 4LSPL 3ULSA 5J3HC 2NXYB 1LO3L 3TCLA 5I8KL 1FO0H 5F96L 4AG4L 12E8H 3HMWH 4FQIH 2YWYA 5T3ZH 2EXWD 5E6IC 3TO4A 1PW3A 5JW5A 4KK9C 1IEBA 2JB6A 3TA3A 1A1NB 5JMOC 1NDMA 2F5BH 5B38B 5L8KB 1V7NH 2DI8A 5DEGA 5I8EB 2FIRT 4QXUH 3BPOC 1JJUA 1UKTA 1DUYB 5E08H 2FBOJ 1KLFA 3QUXA 5E94A 2Q6WB 2PYED 2DWDA 4RA3A 1S8DB 2AK1H 1FRGL 4HDIB 2YBRA 1MQKH 2OL3H 3O8XA 1WAAA 3LMJL 2PR4L 1RULL 1JHTA 1T4KB 3P9MA 4IOFD 4DN4L 4JY6B 3ES6A 1NCCH 4XCEB 1JNLL 1G9MC 5ISZB 3INUH 5LCVL 4PB9L 1LDPL 3BPLC 2IFFL 4M8QB 4MZ2A 2MHAB 1W0VA 4NZDA 4PGCB 1SM3L 4G8FB 2VC2H 3VXNA 4ODUA 3QO1B 4S1SH 3B3IA 1J8HA 2VH5H 3P9LA 4CVXA 5HHOB 5ICZB 4NP4H 3L3DB 3TP4A 1PG7H 1B2WL 4XMPL 4NUJA 4JHWL 1JWMB 3NFSH 3BX7C 5KAQG 1ZKAA 5D9SA 4F7TA 3DX9A 2ZJSL 4PLKD 3T2PA 5ITFB 1GZPA 3KYKH 3T1FB 2X7LA 5ID0A 5EU5B 3W39B 4HKZB 1NMAL 3QNXB 1Z5LA 1ZA6B 4WV1A 1ZV5A 2OP4L 2A77H 2VZTA 1RUQH 2DLIA 4G9DB 3CU1A 5I76B 4YBQC 3A67L 4QRSB 5EWIH 1BZ9B 3RTQC 1KC5L 3BRGC 3T0EE 4XAKD 4L5FL 5DRWB 2XTJB 3O41B 5DYOB 4E42B 2R0WL 4XNMA 5EH1A 3UEZA 3K2UH 5T1MB 2UZYB 1OAKH 2Z8RA 4R96A 1T22A 3DX7A 3ZT6A 2YA1A 5I8OH 3EO0B 1AR1D 1YEKH 4IOIA 5DMKB 3MRHA 1UZ6E 1BMGA 1ULVA 4YEFA 4FFWD 4OGAD 2H41A 1RY7B 1RUMH 2A83B 2R29H 1CFNB 3NBNA 1G6VK 3D18A 4K3HA 3TJEL 5EO1A 1I9RL 4Z5RB 2XXMB 4DOHB 3AVEA 1U8MB 5C0BE 4KKBC 3U9PL 4NWUH 2AERT 2X4TB 1EJ6A 2I5YH 1JCKA 4QRQB 1WC7A 2WIMA 2ADIB 1SJHA 1QO3B 4KI5C 2DQIL 2OSLB 2W65A 2MCPL 2IFGA 5JXEA 1YZZA 4K9EC 2P47B 3ARFB 1YEEH 1NGQH 1MFCL 1QR4A 1QRNB 3U7WL 1MJ7H 1YYLL 3LKQA 1FVEB 1S9KC 1JMZA 1I7TA 1CTOA 4LLYB 5EZOH 3MR9B 4HJJH 5DJ0B 4DGIL 2DQFA 3HUJF 4LKXB 1S7XB 4TNVK 5HSFA 1G7PA 1ZHNB 2OK0L 4TOYL 1QTYT 2ZP0T 1NGQL 1UXWB 3QDGE 4K8RC 3RP1A 1DBAH 3MUHL 1FL5A 5CKGA 3S96A 1KT2B 1EXUB 5T33H 1ZT4B 3FRPG 1EVUA 3BUYB 3MV9A 2XT1B 3SKUD 1AGBA 3QIUA 5ACZB 4L3AA 4AIZA 3RI5K 3DX8B 2KBGA 3QNYB 4NUGL 1N6UA 4AMKH 2DWEB 5D8JL 1Q8MA 5INDA 4LKCB 1QSFB 1W0WB 4PJ8C 2NY0B 3OTTA 1OTUC 1C5CL 4LPYA 3SE8L 1SYSB 4Z18A 3R4DA 5I18H 1NUGA 4NO3A 3G5XB 4APQC 4PRAA 3FCTA 5JPNB 2A6DB 3FHAA 2G60H 5ACZA 1MUJB 2Y5TB 1FAKT 3BUTA 3C09B 1ZANH 5E8OB 3TIDA 4AIZB 2AXGA 2F53A 3FMGH 4E9LA 2BRRH 2GJ6D 2V17H 3BKCH 3CDCA 4D9LH 1KSRA 5AYUL 1MQKL 3TT3H 3OJVC 2CMRH 4PRIB 3QI9A 5DVLA 2VISA 5CINL 2DMCA 3CVIL 1T66D 1IRAY 2ZOKB 4IIQB 5DSCB 1R24A 3C6SB 1DQML 3REWB 4PJGE 1V3LA 1JPST 3ARRA 1NKOA 1FYTD 1CE6B 1C7TA 4RBPH 3DVIA 1QSEB 1X5XA 4OGYH 5C08B 4QOKA 3QQ9C 3P3YA 5I2IB 3ZYOA 1SBBA 3FO2A 5A3ID 2Q3AA 3CFJB 3LOWA 1P53A 4ODTL 5CBAB 4KK9D 3QHZL 3P30H 1CU4L 1DN0B 1PG7W 3QP3A 4Y5YB 4AEIL 1CD8A 3SO5A 4MAUH 4BK5A 4UTAL 3W82A 3SPVA 4P4KB 1LP9E 4WCYH 1T03H 4OLWH 2EYSB 5KG9B 1N3NB 1OPGL 2QKIB 2BSED 5T3XD 2DL2A 5T33L 3BT2H 2BCKA 3T0DA 4NPYA 5KOVC 4ZFOB 3JV6B 1ONQB 3G6JE 3M45A 5GGUA 2HMID 4JFPB 4M7KH 2YC1B 1OSPL 2HP4A 3NPSC 3WL9B 1K4CA 4M1GH 3FT2A 1UWEL 1CL7L 4GXVH 1MJJB 4OZHB 5FA4B 1EGJA 4JREC 4FA8A 3DMMC 4PB0H 2K7PA 5GGRB 5GGTL 1ITCA 3D85D 2IPUK 3W2DH 5JORB 1ZGLA 4Q6YA 4N0UB 4U6XA 5SWZE 2GITA 1EEZA 2XTJE 3H9HA 3OG4B 4JJ5A 3CDGA 3O2DH 5JHDD 2QEJA 5DT1L 1F45A 2VAAB 4LCCC 5C3TA 1D5IH 1FFOA 1U91A 4QRPA 4KKCD 1QSVA 2VLKA 2O5ZH 1DLHB 4EI5D 3K1DA 1HOCA 1AGFA 2QR0A 3SOBH 3O6LH 1HCFX 3IDXH 4MS8C 4P23C 3BKYL 2YPLB 1TQBC 2NXYD 3GGWB 1PFCA 4XNZB 1VFBB 3BZFB 1S7XA 5JIHA 3R8QA 5JO5A 3SJVE 3WJLA 3P0YH 1DUYA 1BAFL 3PG2A 1CLOL 2BHYA 3VDAA 3CXHJ 2W9DL 2IMMA 5L8LB 2P7TB 1J12A 3CFDB 3VWKA 5J9PB 1N8ZA 3OX8A 4RQQA 2YPLA 4XMKL 1CGXA 2QQKL 4MA3B 4JN1L 4WWKB 5GZND 4X7FC 3C5JA 1N0XH 1A5FH 2R9HC 4K7PL 3D48R 4OLEA 4DTGL 2C7UA 5F9DC 2NY0D 1T80A 3C08H 5DJ2B 1JK8B 3TT3L 3KYMA 2W91A 5JPMA 3HC3H 3DJ9A 4LCWD 3SO3B 3D0VA 1SYSA 3BKMH 3CVHB 5INCA 1EHLL 2BVPA 5EUKB 5F88B 3VGAB 3G5VA 1DE4A 1GOGA 4JRYE 3RIAF 4HUVB 3ESUF 5EU3A 4Y19A 1PX3A 4HF5L 1QPXA 3JWDC 5C07B 1JPFB 1NGZB 4YK4B 5ABDE 1I9RH 3WMSA 1UZ8A 4H88L 2X4UB 4M3JA 4GG6A 5EC2B 1CICC 5ALCH 4P2RA 5SX5K 1U92A 5C86A 1B4JH 3D39E 2Z31B 1J8HD 2ZWLT 3S6CA 3OJDB 2FEEL 1AP2A 1QR1A 3G5VB 3X14A 3DSNA 2ICEA 4NIKB 1XF3A 3H9SD 4YPJA 5BV7C 2GIYA 3HPLA 4JFOA 5I9QB 2V2WB 5AG8A 4XH2A 5C08D 5GRJL 3DRTB 3EYOB 3QFDA 5A2KH 3ARXA 2KZWA 1OTUD 4FP8H 1NMBL 3OKMA 1AO7A 1K5NB 1WIPA 4H1LA 4TTDD 1AHWB 4TRPL 3WKNA 1U8OA 5JNYA 4TSBL 3FFCD 5E2JA 3QUZC 4Q2ZA 1T04B 1KIUA 2AI0L 2KDGA 3GSQB 5DI8B 1MCCA 4H20H 1U8PB 5IF0A 1OCWL 4Y2DA 5L2JB 1RUAH 2UZIH 3JV0A 1KPVA 2H26B 4U49A 1ZVHA 3C5SB 3NA4A 1F6LL 4ZFZA 3ROOB 4U1NA 1BD2D 4BZ2L 1RZJC 3HPJB 1BAFH 5GJTL 4OIAA 3F5WB 1MCSA 3QCVL 4U0RB 4LDOB 1S7VA 1H15B 2HLAB 1F90L 3UJIH 4NO0A 25C8L 3WNNA 4OM1H 2Q6WA 3KR3L 1RUML 3SGJC 5DUMH 2VDNH 3SDCD 3KYOB 5DJCA 2Q8BH 4M6MH 3P4NB 2BVUA 3CIQA 4PJHE 4QNPE 2VDQL 2O5ZL 5IFJB 4GRWB 5E4EC 5C2BH 3VXSA 1C08B 5ALBL 2YRLA 3LEXA 5LCVH 2IFFH 5HD8D 3ARGA 4L9DA 4IHOB 3TO4C 2FLBT 3AU1B 1T7WA 2EDHA 2Y36L 3WHE1 3GMNA 1YEJH 2CDGB 4S1DC 4XCNA 1WCQA 5C2BL 3VXUB 4ZFFB 3JVGA 1B3JA 1S7UB 1S7QB 1GC1H 3O6KL 5KN5B 3W5NA 1G9EA 2A6JA 3ESVF 4NHUB 4W4NA 5B8CC 2B1AL 4PG9B 1IAMA 3OR6B 3N0PB 1H5BB 2BOBA 3VFOB 4FQ2L 1KF9B 3DI2B 3G6JA 1TJHL 1HHKB 4NM4H 1W0WA 1I1YA 3KPOA 1LEIA 2GCYB 1U3HA 4IHOA 3T65B 43C9B 2YRPA 5L6YL 4MQ7B 3WIHA 1JL8A 2BY2A 2V5TA 4YEEA 2ZUQC 2KQNA 3EFDL 1CI5A 2W59A 5B8CA 1T0NB 1P7QB 1F02I 4D3CH 5CEXB 4X6DA 1T20B 5IM7A 1PQZB 4LAJH 4EI5A 3LKPA 2KH2B 3VJ6B 3S37X 1CGUA 4XCCL 2Y06H 5D96C 4WO4B 1ZLSL 3CFEA 3UX9B 5ILTL 2VDLH 4F57H 1I9IL 4WI6A 2Q8AH 5FO7A 5DJ8B 3VWJB 1T21A 5BRZD 1JTTA 2Z35A 4PJ8D 3MCKB 4NJAH 1N26A 1KNOB 4QHMA 3GI9L 5AD0B 2COQA 4PTUB 4G9FD 1KN2L 1S7SB 2GTWA 4QTHB 2ZNWA 4ALAH 1I85C 4ODTH 1BIHA 5H8DA 5SWZB 3K8LA 4FQPA 5AWNL 3WD5H 3U0WH 4FMKA 2UUDH 1U3ZA 3D0LB 1KELH 2X1QA 5C08A 1BGXL 1X7QB 4PV8B 4MXVE 1MIMH 5D1ZC 3EO1A 1A6WL 1R0AL 1CN4A 4J4PA 1DQQB 4DCQA 5B38G 2EDWA 4OTXL 1RMFH 4ODWB 1EHNA 1DQMH 5E5MB 5GXBB 5EOCH 1HXYA 2B5IB 4CL7A 2UWEF 3O6MH 3MRDB 4PLJD 4Y19B 1U3YA 3QDGD 4PP1C 4XBGB 1CXFA 5DR5H 3U4BL 2Y7QB 1DQQA 3I85A 4Y5VA 1T1XA 1H0DA 3R0NA 4MDJB 2BY0A 2EH7L 3DGGA 4FQXB 2E3VA 3NIGF 5BV7H 2BCKB 4RNRA 5A3IC 1C12A 4R2GC 1T2QL 4DW2L 1KV3A 2BVQB 3PHSA 4K7PH 4ZS7H 4R3SA 15C8L 3SDCA 1NL0L 1LO3H 2AGJL 2JIXA 2CLRB 3FZUD 4LSQH 4OZFH 2A38A 3ME0A 3QNYA 4HIIA 2I9TB 3WS3B 4NUGH 1DLFH 4CDHA 4KJQD 5C7XH 4XAWH 3RDTD 4KZDH 3CPLB 1NAMB 2ED7A 4PJAA 4QXUL 2DLFH 1A0QL 1DFBH 3WLWC 4N8VA 1Q9OB 3NPZB 5E00B 1XT5A 4K94L 5HDBF 4ELKA 1IT9H 5CEYB 3LIZH 4GS7B 4PJ9B 5C0EB 4LEOA 1C1EL 1CK0H 2ZNXA 4XPBH 2JJUA 2CR6A 4L1DA 5AZEH 4MD4A 2NY1D 2VLJD 3O2VH 2PTUA 4NOBA 3D69B 5D1XD 2J8UE 2ED8A 5ERWB 3TO4B 3HNSH 3DV6A 4PJ5D 1TJGH 4YH6A 1A1NA 5EO1B 2J8UB 3GJEA 4NN6C 1WICA 1XGUA 1N5YL 35C8L 5GSRB 3WUWB 4HCRH 4YBLC 4YHZL 1MCHA 5FKPB 1I1AA 1KGCE 3IDUA 1EO5A 4CN1A 4HK0A 3O6KH 1GC1L 3B43A 4OCXL 5A1AA 4ZUTA 2ILLA 4WI5A 2EDTA 1P4BH 4Y4HB 4LAQH 4P23D 4M62L 5EOCL 1JGUH 3MNWA 1IQDA 4O58L 4AYFA 1RUAL 4JFYA 3C5ZA 1I8IB 4E5XA 1CQKA 3LN5A 3LRHA 3S7GA 2DYPD 1ORSB 5FIEA 2DQEL 3TBWA 4PJHA 2V7NA 5LG1A 4KK5C 4HHAA 4F9LC 4TVPD 3OXRB 5FV1L 4YBQD 1A1MA 2RBLA 4HWEL 4NQEA 4M6OL 4Z7VB 3T0ED 1CD1B 2FB4H 3MODH 2R2EA 5F1OB 3RAJL 3OKKA 2GKIA 3JV6A 4PJ9A 2GAZB 4NO0D 2OP4H 1P4IH 2VXQH 5DO2C 4Y88A 4KK5D 5F9OL 1NAMH 1R3LB 3THML 3W0WE 1RHHB 4KK6C 2YZ1A 4BZ2H 4P4KC 1GJIA 2DL9A 4U31A 3U36B 1LEKB 4WUUA 3MOQA 4KDTC 5HBBA 1GGCL 4OCLC 4ZMAT 5CZKA 1FG9C 3BQUA 2NY2D 3JTSA 5SWZD 2O93L 3FOMA 1HYSC 1UGNA 3TBYA 4HF5H 4HS3B 3P0VL 1MNUH 4GMSH 5C0BD 2X05A 4S2SB 1RZGA 3UTQB 1A7PH 1FH5H 4JKPL 2E9WA 2R15A 3IU3B 1F4AA 2XWBB 4JO3L 3P4OB 5I1IH 3MRMB 4P9ML 4QF1B 2JELL 1UWXH 4O51A 2DBLL 2V2TB 4IRSA 2CIIB 5MI0C 3V6BR 4Y19D 3M07A 1FHGA 1W0YT 3T0EB 2GK0A 2DJUA 2R2HB 3E6FA 4D9LL 1FNHA 5CSGA 4NJ9L 1A6TB 3QIWD 2Q7NA 1MAJA 2VRAA 4JQXA 7FABL 2A1WL 2DKSA 4PJ5E 5E8PA 1RZIB 4WTWA 5IB1A 1CGWA 5TE6L 4P3CH 1AI1L 1CLOH 2YXFA 1FZKB 4L8SA 3AM8C 4KQ4L 1N5AB 3L5JA 3ROLB 4LL9A 3BH8B 2IQAB 3GSNB 5T1KA 1DBKH 1LO2H 1WV7T 5B39A 1KTLA 3BVNB 1CG9A 1FGVH 3EYQD 1CQYA 4FXKB 1HHHB 4WDIB 1WIUA 2ZSWB 5D7JC 1ZHLA 3IDJB 3C08L 2XIDA 1KULA 5C7XL 4FQLH 4NQCE 4M43L 4BQ6A 1BF2A 1H8NA 3QO0B 3BWAB 1LDPH 1KIPA 3PHOB 3KXFA 2VTFA 5B21A 3FQRB 4U1KA 4LCUB 4M8QA 4F58H 4NDMB 2Y6SC 3L5XH 3B6SA 2J5LC 1A4KA 3GM0A 3IU3A 1FNEA 4J2XA 4WUKH 4WEBL 4ODXB 1MFAL 4GG6E 3EOBA 4DQOH 1NANI 1QLFB 3O4LB 2MCPH 5CBEA 2Z8WC 3TO4D 5CSZA 4XX1E 3VFWA 3V7AG 4TUJB 3DXAE 4U1KB 3S36L 2D7TL 1UXSB 4JFDA 1AE6H 4GW5B 1NCDL 3I3BA 5GRXG 1ND0A 4GMTL 1WAAE 3FAXA 3MXVH 2X40A 3Q6GL 1RIUL 4MQXC 4KTEL 3TYGH 1FDLH 3L7FB 2M26A 3QFDB 2E27H 5EZLB 4PD4J 1YPZB 4S10A 1CR9L 3OKMB 3VCLB 4OCMC 2OL3B 4X6CF 5DD0H 2VE6A 1CBVL 2EYRA 1LNUB 3O41A 3K1KC 5T1LA 4MB4A 3U6RB 3F7VA 1EFXB 3DX7B 1VKXA 3RZCB 4E5XB 5C2UB 2EKJA 5DMKA 3V4PL 4N0YH 1IGIH 2WBKA 4W81A 1OP5H 1KPUA 5GRVL 4LVOC 1P9MA 2DTSA 1RURH 5I17B 1U8KA 5T1LB 1HXYB 2V5YA 4P5KA 1JGVL 4NKMB 2CIIA 4G6AD 2APBA 3BJLA 4X9FA 1LEGB 3QNXA 3V52L 2X09A 4AENB 4FABL 4Y1AB 4OD3L 5DDHB 3RFZC 4LU5H 3AREA 4MNQA 5IR1B 4OFPA 3T04D 4PJ5A 3NFPB 2BHZA 2CMRL 3QAZC 4L8DA 4JB9H 2ARJQ 5DI8A 2AJYH 4FFYH 1YNTB 2IGFH 4P99A 3X3GH 4I4WA 5EIIA 1P5VA 2XQBH 1PAMA 4YBHA 2NXZD 1D5ZA 3KPRA 1EEYA 5T3XE 1U8QA 3BD3A 4JKPH 3PABA 3AC0A 4JY6A 3QJHB 3BE1L 2L4OA 1DN2A 3O6LL 3MLYL 4QHUA 1A7NH 1BLNB 4IBLT 2R1YB 2Z31D 5KSVA 5FFLA 2HJLB 3SGJA 5IK3B 2FGZA 1DEEA 1RIHL 4MQ7A 3B3IB 1M1SA 1QVOA 5H35A 1AR2A 1U3HB 3NCMA 3OJDA 3S34H 3PWPD 3VFMA 3QDMA 4KGJA 3EJZC 1EFQA 4I1NB 3IFOB 2ZOLA 4P2OA 3U7YL 3ARBD 1PQZA 4HXBH 3MZTA 5HHVH 1GGUA 3VH8B 4QRUA 1KIPB 5EBWA 4WW2C 4QRRE 4J3SA 1B0GB 1A6ZB 3BZEB 2VLLB 4PJXE 5ISZD 1YEIL 2BRRL 5CJXC 3DXAA 1IC5H 2LABA 3IGAB 4JLRB 2JCCE 1QBLL 2YSSB 1D5XA 4LIQL 4P2OC 2PO6B 1ZANL 3IXTB 4UIMA 3CX5K 1BVKA 4JPWH 4POUB 3OKDA 2FRGP 2NY1B 3EYUL 3PNWA 3TGXA 4EIZC 3CX5J 5EB9A 2NY0C 5IMMA 1QYGH 5C9KA 3HE7C 1LVEA 3P2TA 5HVWA 1ORQB 3F7QA 4PFEA 1KTLB 1TJIH 3GJEB 2Z4QA 1T2JA 4OGAC 3DO7A 2BNRD 3U46A 5D2LB 2WQ8A 3VD9A 5CEZL 3N1FC 4WI2A 2Z92A 3UBXA 2W38A 3NCYP 1IM3A 5EZIH 4HUNB 2M1KA 3GIZL 4JAMB 3HAEB 2AXJA 3L5XL 1NEUA 1RVFL 5F8RC 4HH9B 4D0BB 4PLNC 4JFDE 1SY6H 1G7MA 2EYRB 4B41A 3L3JA 2AEQH 3CFIC 3MV9D 4JR9H 5IROC 4GAJL 1MJ8H 3KHQA 4M48H 4WI9A 5FYJL 4Y5XA 4JZOA 2A9NL 4IRSC 4HCRA 1VPOH 3AY4C 4L4JA 2XFXA 3VMPA 1I85A 3UTZB 4GBXC 4GAYB 5HJ3B 3TBVB 4QHLB 4WU7B 5DR5L 3VFSA 4PGBA 3CX2A 4PJEF 2BSTA 1S7TB 1YEEL 5SX5H 1VFUA 1UXSA 3SDXB 3HCVA 3KJ6H 2BVTA 2X4NB 2RFXA 5T3ZL 2CLRA 2ARJB 4CRPA 5F7NC 3OL2A 3JZ7A 4H1LH 4H8WH 5DHVB 3ZL4H 4YR6A 4PRNB 1BIIB 4YHKH 4WHYG 5IFAL 1GGIH 4IOIB 4OCSL 2FIKB 2J6EL 3HI1A 4O2EB 1T20A 3ET9F 2OMBA 2Y07H 1IGFL 4X80L 5DJXB 1HYRC 3W2DL 4JFOB 4Y2DC 3PIQA 1NCWH 2OLDA 3VFNB 2CUHA 4NRYB 2AJUH 4Z7UE 2DQUH 5IVZA 2HJFB 3MRNB 1YY9C 3MRQA 5LGJA 2IBGA 4RMQA 3UBXB 1P2CA 3UDWA 1EX0A 3VXPA 2VLJE 1SJEA 4PJFA 1IC5L 2BY3A 4P23A 4QGTA 4UQ3A 1LGVA 5T3ZD 5CMAB 5C08E 3QEHA 4QRRD 3ZDZE 1RZ7H 1EAJA 1TZIA 2H32H 5CHNB 3CK0H 3QPQD 3G5XA 3V7MA 1QLEL 4PJGB 4YBLB 4F80A 2NY3B 4G3YH 4JPIA 5A2LH 3BSZL 1BVLB 5HD8C 1FDLL 2BFVH 2H45A 3RGVB 1KTDB 4FOMA 3BP7A 3BDYL 3WUWA 5IHBA 2HFEB 3OGCB 1W72A 2CDEB 3O6FB 3CMGA 2APXA 4JHBA 5CJBA 5IUSA 2ZCLL 4JLRA 3UPAA 2W1NA 3JTTB 3TBSA 3QWOB 1SY6A 3JVGC 1TVBA 2HLAA 4ENED 5LGHL 2F19H 3MYJA 5GGSB 3X12B 4OV5B 3VGEA 3RJDA 5JDSA 3PL6A 3D25A 1DDHB 4ELMF 4QRTA 3MRGB 3MA7B 5TFSL 4TVPH 3FQNA 2J3SA 1V8HA 1A7OH 3CFDA 3LH2L 2J6EA 5EBLB 5IW6A 3UTSD 3PHOA 3VA2C 5I73B 1PBYA 5DMGD 4L3EA 4NKQB 5I1GL 3PWNA 3H9YA 4OZ4B 1DVFA 4OSUH 1HXMA 5AUMB 1TVBB 3MNVB 3OKOB 4PJBB 4N8PA 5I66B 5AG9A 3DVGB 5CCKH 5E9DE 4ELME 1RZKL 1R5VB 1CIUA 1SEBB 8FABA 1GYAA 4NKOB 1JZ4A 2EZ0C 1I1AC 3Q6FA 4M7JL 1G0DA 2NR6D 4LEXH 4MNGE 4U1GB 1LEIB 1TCMA 4XNYH 2ENSA 1ZGLM 3VMNA 3DVNB 1FIGH 2FWOB 4HZLB 4TUKH 4IRJD 1U58B 2NXYC 3UTPE 4JZJB 1LE5B 1EH9A 4QEGA 1F58L 1WK0A 5D7SH 1BBDL 1OVZA 3LKSB 5TDNB 3MLVH 3MRJA 2DQDH 1JWUB 1G6RB 4Q9QH 1OAYH 1WZ1H 1RUKL 3UZQA 4P2RB 4L4VE 2R56L 3CU7A 4MXQC 3T77A 4UUJA 4WO4D 1A9EA 3O6ML 1Y18A 1MFBL 4DOHE 5I19L 4MX7B 3CMOL 5ESAB 3O3EA 4Y2OA 4OCWL 3VFTA 3V4UH 3S34L 2FD6H 1RZ8A 1CTNA 4FTVE 3MRKA 3EDDA 4P4KA 5IBTH 4M1CC 3RWGB 1F3RB 3BE1H 1EAPA 4RGMB 3A0OA 3KHOA 5D5MA 5IG7A 4L1HA 5IBTL 2RJMA 1NL0H 3T2QA 3S8WA 3LPWA 5IF0B 1SEBA 2AJUL 5FOBB 2AJYL 5EU6D 1OL0A 4LSVH 1XGRA 3QXTA 3FMGL 4ZUVB 1FL6A 4PGDA 4HUWA 3MJ8A 2V7HB 3WUWG 5KZCD 1YUHA 5HYSG 3MCG1 3S97C 4JVWA 3WFCH 3RU8H 4XBPA 1OB1A 4Y16B 4JG0H 1FCCA 4HWZB 4XVTH 3CZFB 5DUML 3D2UA 3RDTC 1MHCB 1J86A 1QA9A 4CJ1A 4MJ5A 1WWWX 3O9WB 2JJTA 3T4YB 1MCLA 3BISA 4EI6B 3SKMB 3ARDB 1ZVSA 4LCUA