5DK0B

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
206
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRGDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 35
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0B01
3I3BA 4Y4HB 1UM5H 5CHNA 3H9SB 5E2WL 4HT1L 3T0EC 4OQTL 2W07A 5IMMB 3BQUB 4XNYL 2QKIA 3EDKA 5C0DB 1F3DJ 5E4EC 2Q76A 3BIKB 1RUQH 2BVEA 3BW9A 3C5JA 4PPTA 1MI5B 4LVOC 5L9DL 4RIRB 3LQZB 4ZUUB 4ELME 1JCKA 2HWZH 2H41A 3BZDA 4UU9A 4K94C 4GXVL 3GMMB 5KZCD 1L0YA 3GKWH 4CL7A 1LO3H 3W11C 2HTLC 1MH5A 3DSFL 4HFUH 4U6YB 2XN9B 2FH8A 3QDMD 5JQ6L 1TVDA 4IRSB 3L3KA 5J11B 1KIRB 4POUB 4O2EB 1CIDA 1RMFL 3B2UD 3LS4L 2ZZUT 2IPUK 4WFFE 5C07B 2YEZB 1RJLA 4JQXC 5IBUB 1MNUH 4U0RC 1TJGL 1W8OA 5GS1A 3V6OC 1MWAH 1LE9B 3VH8G 4NO3B 5BVJA 1ZA3B 3VW3L 1WK0A 4ZDHB 1FZJA 1K6QL 2J4WH 5C0GA 4JQVC 4HH8A 4OGYH 1T1XA 1Y6MR 1L6XA 1DLHB 4ODVH 4OV5B 1U58B 3MXVL 3IF1A 2GJ6E 2Y6SD 4P57A 4BKLB 5FCUH 2IQAB 4HW6A 4JHZA 3EO9L 5DJCA 5FK9A 4EUPB 1DP0A 1MLBA 1X4YA 2YUVA 4ZG1A 3LKRA 5HHOE 4I18A 4N0FA 3TCXA 1FQ9C 5DJ2B 4MWFA 3D25A 1AGDA 3DUUB 4HMEA 2YK1L 3OJMB 2WBJB 2AK4E 1MCKA 3OB0K 3QQ9D 1I3VA 5L7XL 2VISB 3T4AB 3D87B 1A9BA 1EDQA 1E28A 1FFQA 1U8LB 3JUYA 4X83A 5IT2H 1JHKH 5LGHL 3EAKA 1IGIH 4TVPH 3BVNB 1DDHB 4JY5L 2NY0C 4XXCC 3G9VA 3OAZK 3UAJD 3QBTB 3EOTH 3EJYD 1WFTA 3L5IA 4YHML 5D7LA 5F7DB 3G6JE 2C3WA 3LD8C 4I3GA 3K46A 1JPFB 4TUOB 5CSZB 4YJZL 4HFWB 4JZNB 3F7QA 1BEYH 3FMGL 3OKEB 4I1NB 4P5KA 1E6OH 1OGTB 3HI1A 1UB6A 2BMKB 5GS0C 3O8XC 5IESL 2AS5M 3ARFA 3NOIA 4E0RB 3CCHB 5GISL 4ONGH 1JK8B 3DO7B 2BDNL 4J4PD 5DJ0A 4Q2ZA 3VCLB 1A6TA 4U1HA 4Q97A 1KACB 3TNNA 2Y6SC 4M93B 3PXJA 5F6HI 5I8KL 1W0VB 2AK4D 3PWJA 3TVMC 3PGDB 4JDTL 2X89D 4BK5A 3OKMA 1RUPL 3DTXA 4WI2A 1VGEL 2WM0A 5JHDA 3GBMH 3IGAA 4LFHG 5D2LB 1RZ8B 1DVFD 5IKCB 5JW5A 4PJ8B 2JIXD 3U7WH 2DN7A 5I73C 2NYYD 3VFVA 4MAYD 1NFDE 5HBBA 1XCQB 2Z8WC 4N5UA 5DK0A 3F6IA 1OGAA 3VMPA 2J8HA 1ADQH 1T6VN 4MDJA 1P7QD 1GYAA 4Y4HC 2R2BA 3MRQA 3VXSD 1OWRM 1A1OB 1AGBA 2HVKA 3NIGE 1VFUA 5E4EB 2WP3T 4PG2A 3CMGA 4R2GC 3V7AG 3MV8D 1U6AL 3FOMA 1MAJA 1U93B 1UKTA 4N1EA 4ZUVB 3V7MA 4J6RH 1WCQA 3EOBA 5CIPA 4FNLL 4I0PC 4OCLC 1JF1B 3D2UA 3BZEB 3H9HA 5JW3H 4RA3A 3FN3A 1DLHA 3MRIB 3QIUB 2P7TB 1BX2A 3M17A 1HHIA 1A14H 4N9GA 2AVGA 3MCG1 5C07D 2Z4QA 3P0YH 1MFNA 4POZD 1FLRH 2R0ZL 5F1KC 3TZVC 2ZG1A 1IKNC 3BGFB 5C2UB 3MLSH 4LDLB 5TE4H 4KJYB 1MFDL 5E08L 2YD4A 3LB6C 5HHXL 2E6QA 1NLDL 2CDFB 5JHLH 4CVXB 1FO0H 4X7DC 4H5SB 5AWNH 3SDAA 1Q0XL 1JP5A 3WMSA 3BQUD 3R8QA 4Y5VB 3HC0B 1MLCA 2NXZC 3EOAB 2FYYB 3HKFA 3KXFD 1J05A 3QCVH 1YN6A 3C08H 2DF3A 1TZGL 3SPVB 2WAHA 2N1KA 1WQVT 4M1GL 3WJLA 3UO1L 2B1HL 4JFXA 3VFTA 3AM8A 4QRPA 3HC3H 3ZYIA 3NFSL 3T3MF 1BQLL 3DHJA 5E5MB 1H3PL 2A6DA 2X1QA 2P5WE 3MRKA 5GRJL 3A6OA 1JYWA 3HG1A 3BGMA 1RURL 4BQ6A 1U8PB 2OTPA 3I50L 5CP7B 5DJAB 4GSDH 5BXFA 1Q1JL 3BN3B 1V7ML 1B0GA 3F12B 4U6XB 2ESVE 3RX8A 2A6IB 4DKEL 1QFHA 3TFKC 1YNLL 3WLWD 4LHJB 4F7TA 2QHLA 4WUUE 4OBSA 4NKMB 3QPXH 2MCPH 3BD4A 3QT2A 3SQBA 1KF9B 4JKPL 3CLEH 1FL6B 1KN2H 5DRNA 1OARH 5F7HA 4PGEA 4LRIC 4O9HL 2ENYA 3OAUH 4NQTA 5IR1B 1HWGB 2YKLH 5IM7B 1ACYH 4PBWD 1DBJH 1IM3B 3HE7B 2JKXA 4PJHE 3NZHL 3O6FB 1CU4L 4QRQB 3O11A 4R90H 5I1GH 4NZRL 3LKSB 2EH7H 5C70A 3P9MB 1M7DA 3KJ4C 4KROC 4WVRA 1TJIH 1YY8A 3OPZL 5TF1H 4YR6B 5H8DA 5CEZE 1XIWD 1D5ZB 2O5XH 5LQBH 4GG8A 4MDIB 4H8WC 3CMOL 1IAOB 2NW2A 4FMKA 5JIIA 3THMH 4PJBE 4CVZB 1F4YH 4D9QD 3RWDB 3NCYP 3IETA 3RNQB 2HP4A 1TVHA 4XPHH 4ONHA 4WI9A 1U8PA 5J89A 4ELKA 3F7YA 4FQLL 43CAA 2ZNXA 1C08A 1U91B 2GUOA 3V2AR 1B0GB 3F12A 1WC7A 1I7ZA 5DMIL 2A6KA 1XGYH 2CDGA 4KTEH 2VDKH 2IAMD 4IRSA 3EGSB 4G8GB 4GFTB 4JFED 4OGXH 2AGJL 4XP5L 5CEZH 3AS1A 5GHWL 3WFHB 1B9ZA 4HIXH 4HGWB 4NC2B 4OJFH 5IEKA 1ZA3A 5F9DC 5HI3D 1T2QH 4P23B 4XRCB 5DYOB 1NUNB 3W81A 3ULSB 1DCLA 3IRPX 2OI9B 3RP1A 2A9NL 3ES6A 4NYLB 2ORBL 1CLYL 1G7LB 1T7YA 5BOPA 2IAMA 2I60H 5J6HB 4R7NB 1QBML 1IM9D 4EDXA 4DAGL 2XIDA 3LRGA 4ISVB 1J0YA 3JTTA 3W2DH 4L29A 2F74B 2P5WA 5MEQA 4HZLB 1I7TB 5EO9B 2EH8H 5EZLB 4P46D 1R3IH 3IJHA 4J3XA 3VXNB 2P8MB 3MLUL 2C1PA 2DWDB 1FH5L 2Y7QA 4QRPE 3GSQB 3LKPA 1SBSL 1IAOA 3MR9A 1FZKA 4G7YH 1DDHA 1KB5H 2ZUVA 4HCRA 4OUOA 3ARED 3VWKB 5L2JA 4GKNB 4CJ0A 4MXQC 3O8XB 3C9NB 1W72B 1CICA 2NY0D 4ZPVA 3CU7A 1WFNA 3N0PB 2FZ3A 4PRBB 3NH7L 4GRLA 4ONFL 5L2KD 4P4RA 5A3IC 5J1AB 1UB6B 2BMKA 1FNGA 1T5XA 5I74C 4QYOB 2EYRA 5EU4A 4N8CL 5I1KH 1KTDB 1S5HB 2AQ1A 7CGTA 1G7IA 1ZS8A 2CIIB 1D5IH 4DQOL 4LCIL 3OHXB 5I8EB 1KJ2B 4JM2D 1JMZA 4Z7NE 3MBXH 2BHYA 4JJ5B 1CT8B 4ETQB 2ERJC 1WF5A 1LK3H 3ZE1E 5E56A 3LMJL 1D6EA 4LVOB 1HSAA 2DMBA 3I2CH 2ICEA 3SE9H 1BD2E 4ZFZA 5F7FA 5JHDB 2LFGA 2VQTA 1J0HA 1LO2H 3MZTA 5IESH 3PGDA 1XGPA 1FVCB 2UUDK 4ONGL 1KULA 5GS0H 3TZVD 3D3VA 2ADJB 5DRWA 3QXDB 2A83A 3OF6D 3J8F7 1BAFL 4MAUH 1TPXB 5GS1C 5HXMA 1UWEL 4P9HC 5HHME 3IETB 2LV4A 4LLDB 1UWXH 4M6NH 4PRHD 1U8IA 4X6BB 1VKXB 3P77B 4KUCF 3T2OA 1MFCL 3QIWA 1B2WL 4WCYL 3KPLA 5HDQH 1IBGH 5E8DL 3RVUD 2YD2A 3EO1A 4ZAKD 2VAJA 4YWGH 4LP4A 1S7UA 3IDIA 6FABH 1JN6A 5D7JD 4AT6B 1T5XB 4WI6A 4CMHC 4LHUD 1M1SA 3QUZA 2VITA 1BBDL 1ZA6A 4FXGB 4YDIL 4UB0H 5DJYB 4QWWD 4F58H 3VJ6B 4GAYB 3KPQB 3SKOA 3CFDB 4J8RA 3RL2B 3IDXH 3ZL4H 2VDOL 4HV8A 1G6RB 3B8YA 5HHPB 2Q7YB 1CLZL 1ZLVH 5TDOB 2NY5H 3P73A 2BOBA 4ERSH 5BS0D 4HUXB 4MMZC 2X42A 2X09A 4IM8A 1MFAL 3GJEA 3T3PE 3OKDB 3O6KL 4M9PA 3UBXA 5K9OA 2YPKA 4YQXL 2OS7A 3ETBF 4OCNC 3L7FB 1A14L 4Z7OF 2KH2B 2W38A 3RGHA 4HIIA 1FIGH 1U3YA 1U8QA 2RJMA 5CKGA 1HHKB 3GSXB 3JWDL 5F8QC 5DD3H 1OTUD 4G6ML 2A73A 2I26N 4U6TA 4HWZB 5INDA 1L0QA 3RBSA 1GAFL 4MVBD 2N56A 1NLDH 5FO9B 2HRPL 1N8ZA 5C6TH 4HS6A 1JIBA 3BWUC 1KBGH 3KPOB 4JREB 2YEZA 2DB8A 4QRPB 1V3KA 4JFEE 4L3ED 4MNGE 1LK2B 2WNGA 4XC3L 2JK5B 2YPLA 1OLLA 2WWMC 4MX7A 1JWMB 4YO0B 1NJ9B 2VLKE 4PIRF 4RMSA 4DOHB 5FYJU 3DROA 3QCVL 2XZCH 2G5BA 3C08L 5FF6B 4X4MA 1CLOL 5DMYA 3ZTJH 3LHPL 4MNQA 2SEBA 3TIEB 1SBBA 4NFBA 4P5TA 4JO1L 4MQ7A 4Y5YA 4APQA 2Q3AA 2Y06L 3QUYA 4HUMB 4D0DA 2CLRA 4A2MA 4AIXA 5TQ2H 4Y5XA 3U0PB 1NMCC 2HN7B 2FLBT 3TN0B 4PJFE 3VMNA 4LCCC 1T89C 5GRJH 2VLKA 3BAEH 4UT9L 5ITFA 1YPZB 4P3DB 1FL6A 3KXFE 3BI9X 4LBEB 4WRLA 2JJSC 4CU7A 1QBAA 4R6UA 4R4BA 3MBEB 2AJUL 3UBXG 1NCBH 3VWJB 7FABL 4X9FA 1DQQA 2DJ4A 4GO6B 2W9LA 4ZSOB 2DQGH 2OTUB 5TDNB 1W0WA 1IGMH 5EBLA 1TZIB 2FX7L 5GGVY 3WLBA 3VDCA 3G6DL 1NEUA 2XQBH 3OJ2C 2B4CH 4YLQT 2VR5A 2YUWA 3UTTE 3FB6A 5D7LB 2KZWA 5DQJA 3ECBB 2WMPA 3FT4A 2X1OA 4ZYKA 5CJ8A 5IMOB 4HAFA 4UOW0 4Y1AB 4GAGH 3BGFC 1MI5E 4HS8L 5D72H 5FYJD 2E7LC 4MCYB 2WW8A 1ZT4A 2FECI 2BOCA 2EE9A 4ENED 1X3DA 3GKZA 1RU9H 2GCYA 4NHCL 4WEBH 2NYYC 4FFWD 4KQ3L 2H2PC 2FR4B 2Y23A 5D1XB 3DECA 3W9EA 4POZC 4HZAA 4J3SA 3DIFA 3PP3K 4YHZL 3DVNB 2A9ML 2XRAL 2YA0A 4I2XB 4ODTH 4NHUA 2PTTB 4MNGA 5F6IB 5IEKB 4HBCH 2K7QA 4YIQA 1OCWL 3P0VL 4PJ5A 4PP2B 3VD4A 4I0PD 4YHNA 4YHPA 4F9PC 3CMOH 3GI9L 2W0FA 4OZHF 3QO1B 4WGWB 1ND0A 1WT5A 1TCMA 4QHMB 5D4QA 5DD1L 4KKBC 1BFOB 1SJVA 3SDYL 3L95A 1RJLB 3IAQA 5GGRA 1EEUA 1NSNH 1I1AA 1HIML 3NA9H 2IANA 3SKMA 1FNFA 3O9WB 2Z8SA 2R2BB 3NACH 5I8CB 4JGJA 4ZSOA 4TNWF 4OD2B 1UH2A 4PREA 4YDKL 4FZEL 3MJGX 3PJSB 1LO0H 2DOCA 5D1QA 4RWYL 1RAMA 3RWCA 4MJIB 3U30C 1MCLA 1XH3A 3H9SD 4P59L 4XVUC 1T2QL 2BCKA 1XCTB 4D0BA 1NGZA 4KY1H 2NW3B 4HZLA 2Q1EA 4CN1A 2VERN 1S8DA 5GPRA 3ZE2E 2DQEL 4HJ0D 2CGRH 3C5SB 1Z9SA 5JXEC 3QDGA 4D8PB 4G8FB 5D2NC 4UBDD 1CGUA 2VDNH 5DJ2A 1F4WL 2YN3A 4MLIA 1F8TH 4PY7B 3SY0A 4OUUA 5I74B 3DRTA 1FNHA 1QBMH 4ZXBA 5ALBL 4PJCE 4XPFH 4YHYC 2IPTL 5GZOC 2Z92B 1MIEL 3SE8L 3N9GL 5J13B 3HZMB 3FFCE 1TZHB 3D0VA 5HGHA 1BVZA 4KJQD 1Q8MA 1VFBB 3NCJL 4JFFE 2HG5B 2CDFA 4PB9L 3VD9A 1JE6A 4XTRC 3T3ME 3U0WL 5HGBB 5F1OB 4WDIB 4IJ3B 3BKML 4HXAH 1NFIB 1JI2A 4FTVB 3PP4L 5J8OA 1QD0A 5EPMB 3AUVA 3L95B 2XTJC 5IJKA 3QDAA 1H3VA 5EBLB 3IXTB 1I9JH 1JF5A 1PG7W 2AEIT 5FAAA 4KHXH 2LU4A 3BHBB 1NCCL 2IQ9H 2Q8BL 4NP4H 4MGXA 5DJCB 4XXCA 2ICEB 5EIIA 3X17A 1M71B 3BDYL 5KJRL 3GHBH 4Q9QH 2YWZA 1IQDA 4FQCL 1E6JH 1MVFA 1NGWB 4RFEB 1BD2A 1GHFH 1R24A 1R3LB 3DETD 4Y2DB 3VDBA 5MENA 1DE4A 3KPRE 4LLDA 1FG2A 4MB5A 1RZ7L 2DLGA 3EYUH 3G04B 5IP4A 2GJJA 1X5LA 5T1MB 1YEJH 4YUEH 1CXFA 4JHAL 5HHNA 1WBXB 3DVGB 3EYVB 1ZKAA 4YAQB 5K9QG 2EC8A 3BVNA 3KPPA 5ISZD 1JFQL 1XZ0A 5E1HB 3O0RH 4MD0B 4Q0XH 4RQQB 1QG3A 1UCBL 4UTBH 4MDJB 2AJVL 4HMCA 3IDIB 3H42L 3RU8H 2W9DH 2OR7A 4JKLA 4Y16C 3F58H 3EDJA 1XF5B 1R3KA 3Q5TA 3BP4A 2WUCL 1GGBH 4ZOCA 4Y4KD 2X4SA 3NAAH 3GSNB 3LDBB 3MV7B 3K4ZA 4AT6A 2EYTA 4JY4A 4WU7B 1OD9A 4X99B 4HWNA 5CJOL 2J8UB 1NEZB 2IANB 2RQ8A 4NM4H 3VG0H 5EOQH 4Q2ZB 4NQCD 5DVNA 4WO4B 4QHLA 3L5JA 4LSPL 4JRYD 1XGQA 4GBXA 4L3EB 3A67H 4GW4A 4LIQH 1T0NA 2X4PA 3GMNB 4XBEL 1J8HE 3MFGB 2FX9H 2BSED 4NNYB 3TA3A 3WSQH 4YXLH 3L3GA 2UZIH 5CAYB 5CZXC 4UB0L 5FKAA 1EAPA 2GSIB 2FJHB 2D31B 4I13B 4LRNH 2NW2B 3PGFH 5E99H 2VQ1B 3RPKA 1BQUA 3GSOA 5IVZB 2LU3A 4DFIA 1F45A 4PJ8D 5HYFA 3C2SA 3MRJB 4Y5XC 5D6DC 2XA8H 1HOCA 3CH1B 3H7LA 2YN5A 3L3HA 1GSMA 3CFJA 1VFBA 4WY7H 4NOFA 4LCUA 1EVUA 3OMZA 3V95A 1UA6L 5I1JH 2QQKH 4YBQC 3WS3B 5FFLA 5B22A 2Q8AH 1F11A 1YNKH 5FYKU 5E9DE 4MXVF 1D3CA 5GRVL 2X7LB 1FIGL 4D0CA 1MCOL 3ULSA 1JGLH 3FFCB 4C4KT 3H9HB 5EBMA 3NGBB 3MMEB 2B0SH 4FMFA 3SJVB 1JNHA 3CVHA 4X6CA 2XTJE 4TPRL 4Y4KA 2YSSB 3DGGA 4HH9A 4L4TA 4OCRL 1A0QL 4LNRB 3TN0A 1IFHL 3O6LH 1RK1B 1U8HB 1NGXB 4IOFD 2VLKB 5ITFB 3B5TA 1WFOA 5DJDA 3QFJA 2NR6D 1UXWB 4WWID 5IVXE 4BFBD 2AJ3B 1VA9A 3MUZ1 1CFTB 2XZCL 4OQ1A 5DWUH 3IJHB 3VXNA 4BUGA 1IC1A 1AXTL 3MV8B 5KS9F 4KKNA 1OOAA 2AERT 2AJZA 4G6AC 2GJ6B 1NFDF 5K9KB 1RZIA 5CEXB 3ARGD 3KVQA 4WUKL 5CEYA 1KTLA 5E8PA 1ORQB 4XNXH 1S7WB 1INDH 3T4YA 1RIVH 1C5CL 3D0LA 5E1AB 1CYGA 2X4NA 3WJJA 1KJ2H 4MAYB 3PV7A 4L8SB 4PJ9A 1L9MA 1RZKL 4XP1H 2Q87A 1IAKA 1K2DB 4HQQL 3NPZB 5CD3A 3MA9H 3D48R 1Y0LA 1E6OL 2NTFA 5CBAA 4CGTA 5E5MA 2ZSVB 2AJXH 4NQDD 3JZ7A 5AYUL 3OTTA 3VXMA 2XY1A 1KJMB 5C09D 5BW7A 4OT1L 4G43B 5F9OL 3QQ4B 2B4CL 1FL3B 4YPGA 3DVNA 1PX4A 1G9NH 3OXRB 3W39A 1O7SA 4FQHB 4XVJH 4XCNB 2VXQL 3WFCL 4YFEA 3SN6N 3V4UL 2DMCA 1R5IB 2NY3C 4K94L 4IOFC 4Y89A 1L6ZA 2DM4A 3TBTB 1NCAH 4UV4H 3QB7C 4JM2F 4WU5B 4X4XB 4JLRB 5I66B 1T66D 1FO0B 1Z0MA 4HKZA 2ICWI 4KJPD 3SKMB 4YGAB 3S3JA 1FE8L 2B7DT 1A1MA 3EYOB 1OVZA 2HJKB 1I85C 2BC4B 4YC2C 1HINL 3ZDZF 1HYRC 3RRQA 35C8L 5TJWK 1AE6H 2H45A 1PBYA 3IDGA 3S3SA 3S9DB 25C8H 5D1QB 5JORB 2FIKA 3MREA 4FP8L 3MV8E 5GS3A 2GJ6D 2I07A 1NMAL 5TGBB 2ZCLH 1AO7B 2VXSL 3VFSB 3KPRD 4NYLA 5CWSB 4KPHH 2BERA 3MCLL 1D5XA 1RJYB 3SOBH 3N85L 3ARYA 4MA8L 5HYEA 1QACA 2Z35B 5FHBL 4MA3A 2J1KA 1AR1C 1QTYT 1P1ZA 4N0RA 4A6YA 4NPYA 2GFBB 1WBYA 4MA1C 4YXHL 4DJMA 4KXZI 4Z7OE 2Z31C 4HKBB 43CAB 4Z77A 4LSTL 4KY1L 1O7VA 5T3ZE 2F54D 5SWSA 3UTSE 3TF7C 1YEEL 2KQMA 3QFJB 5TE4L 2N4IA 3ARDA 5AZEH 3CNKA 5E6ZA 1TQCB 3B9DA 4LKXA 2A0LD 4RGNB 5L0QC 2IPUG 4PY8J 1TNNA 5JOFB 5CD5C 2DQJL 4EEEA 4X6EB 5I66A 5ALBH 2BHZA 5CEYB 5FV2A 5C09B 5I1AA 1JWUA 4Z7WF 5EOTA 4Y0GA 4PV9B 2QHRL 3CSBA 4QKXB 5HJ3A 2DD8H 4X0KB 3RY6C 4I48B 2ARJB 2OP4L 4QRUB 2EDYA 4NZJA 4Z7UB 4Z7VF 3ZKND 2XNAA 3EJZC 4RFEA 1FJ1B 4Y4HD 4ZO7A 1MOEA 3TC9A 3PQYD 4JPKH 4KK5D 5FK9B 1CK0H 4I5BA 3L3OB 4KKCD 3HZVB 3RGVC 1XF2B 2FB4L 1RPQA 1YJDC 4JZJA 4ONOA 2VE6A 3RWGB 2P8MA 2X4OB 5D7JC 3LH2L 1I9JL 4ONHB 2PYED 4X4ZA 4KHXL 1ZT1A 2DLHA 2UWEA 3PIQA 4N0UB 1J8HB 1YNTA 1ZLSL 4A6YH 4BH7B 1OM3H 2PN5A 1K3ZA 4Z6AT 4X80L 1Q9OB 2GUOB 2RR3A 2HAZA 4OF6A 3TNMB 4JKKA 1YNLH 5F1NA 1E28B 3VE0B 1NCDH 3AC0A 4KK5C 3IU4H 1MFEL 3O2DH 1QOKA 5F9JB 4NM8L 4PRDB 3QIWB 2NY5C 3OV6A 1V3LA 1XF5A 2VLRD 4P5TD 2XZQH 2QTEA 3CFEA 1OPGH 2YR3A 1A6WH 4L5FL 5KW9L 4G9FD 5AZ2H 3MCKA 4KRMB 2EO9A 5I8EA 1JGEA 4NO3A 3QEQD 4IDJH 3ES6B 1N2RA 5J3HD 2IH3A 1SYVB 3P4OA 5DJXA 2LVCA 2BNUA 3ULVH 3I3DA 4YDLC 2PR4L 1AFVL 2BP3A 1NGYB 2W9DL 2H32A 3LVEA 4GAJL 4GBXB 4JFOB 4L3EA 1S7XB 5C9JB 3VCLA 3S37H 2JJVA 1NAKH 4F8TA 1TJIL 3NIDE 1H3TA 4HPOL 3OXSB 2FSEA 5ICYA 3FB5A 4MCYA 1IT9L 4J12A 1A7OH 3VRIB 1CFVL 1TJHH 2DKSA 5EA0L 4FFZL 1BQHG 4ZQKA 5T3ZH 3STLA 2I9TB 4NBZB 5EORL 2X4OA 4XPHL 3WN5A 1MIMH 3VFNA 3HE7C 5LAXA 4ZXBC 1M6OA 3AY4C 1Q9OA 1OP9A 3F7RA 2NY6B 4F7EA 4OLZH 3O9WD 4G5ZH 5BRZA 1K9TA 3NGBC 3PWPE 5TH2A 5F1SA 3WD5H 5HPMA 3H3PL 4FTVE 3FHAA 1OHQA 3GUTB 5GHWH 1CG9B 4JO3H 2ZUYA 5D96B 5KS9A 1SQ2N 3KYMA 4NQCE 4O5LL 3MO1A 3U4AA 4DKFH 5HDBE 5ADOH 1SM3H 4IRZH 1YEFH 4D9LH 4GT7A 3ZYZA 1U93A 3NN8A 1NFKA 3PDOB 3HRZB 6CGTA 3HB3D 3MV7D 3QHZH 5IVXA 2V9QA 1GZQB 2PKDA 1KC5H 1NJ9A 4S1QH 3KLSA 4PJ9D 3PDGA 4PJCF 5ECJE 4L4TE 2XACC 4N0YL 1REIA 5H2BB 4PGCA 3QXWA 1AJ7L 4U1NA 1OP3K 43C9A 4L3CB 5IW6B 2YMXH 2C7UB 2DBLH 3OKMB 4BZ1H 1QSEA 3FB8B 4LCWA 4LK4A 1LQSR 5IMLB 2C3HA 3GSWB 1SBSH 1WGOA 1OAKH 2EE3A 4Q9RH 4OZIB 5ENWB 1U8NA 3OKLA 1WCBA 1VFMA 3TH2T 4U49A 3V5KA 2ZUTA 1AXSB 1PSKL 1IEBB 4AYFA 1A9EB 5DRZA 2HG5A 1V05A 1AKJD 4WHTB 4HEME 3ILPA 4P2RA 1Y0LB 5CBAB 1OGTA 3SDDA 5EWIL 4ZOAA 1TTUA 1HSBA 3GUTA 4FABL 4JFHE 4R2GD 1MCRA 3FOMB 1D5IL 1V7NL 3B2UC 3FQRA 3W0WB 2VLMD 4MQXC 5GSVB 1RIVL 3E3QC 1KCVH 2HTLD 1KCKA 1MFDH 5E08H 4PLKD 3VXRA 4XC1L 1EXUB 5I1IH 4ORGA 5D1XD 5E6ID 4JANA 2Q7YA 2EXYD 5HHPA 3IS0X 3UJJL 4JO2L 4KXZH 1RFDH 1IZKA 2YUXA 4OIAA 3I85A 3HFMH 1SJEA 4PGBA 3DTXB 1NANI 2GAZA 5C0CB 2EXWD 2VNCA 4OLEA 4XWOD 1C7TA 3MGOB 3DYOA 5KVMC 1ZSDA 4M6OL 3KHOA 4XNZB 3PL6C 4OT1H 1U3JA 4OLWL 1S5IL 5HD8D 2DRUA 1ZWIA 3P11H 4BSWB 5GSRB 1F4XL 2QSVA 3QDJE 3L3DB 4MQTB 1QO3B 4QXTA 4LCWD 1MCWM 3QHTC 4QY8B 1LEIB 3GSXA 4NQUA 5EUOE 5DJZB 1I9EA 4W6XB 1Z3GH 3L1OL 1BQLH 1ND0B 3QUXD 3IDUA 3C60A 1S7QA 1Z6JT 1A8JH 3G6AA 5IFJB 5D93C 1AD0B 2AXGB 5F7MC 4H25A 5FYLL 2BY1A 5HI4C 1OQOA 4RFOL 5GS0D 1I4FB 1ZLWK 4O2FB 1MAMH 1JPGB 3BPNC 3RVWC 3K2UH 4HC1H 3FT4B 4ZYKB 1NMBH 4OZIF 1MWAB 1FDLH 3KJ6H 4Z7WE 2WIIB 2Z35A 1ZHLB 4NCC2 3MV7A 3RUGA 3GRWL 1CL7I 1JYNA 3U1SL 3EFFB 35C8H 4XPTL 4JVPA 3EW3B 5DLMH 3H2WA 3DUSB 4UAOC 4KK6D 1UM5L 4P3CL 5FA4A 1URLA 4EOWH 5IVXB 1IGTA 5EBWB 3BP7A 1U0QA 2AABL 5ETUB 2OL3H 1NMAH 5KSBE 2VXSH 3I6KA 2ESVD 3BFOA 3K1KC 4RMRA 3SOBL 1UH3A 2VRAA 1LO3L 3F7YB 4OFKA 2MNUA 3EUUA 4OZ4B 4JGMA 4CW1B 1YEDB 1KIPB 4G9FB 3LN5B 4RRPG 5L2KE 3ZHLA 1DLFL 4YXHH 4EN3B 4HPYH 3BQUC 3KGRA 2E7LA 4JRXA 3ROOB 1JRHL 3BH9B 4TSAL 5MHSD 4NQDA 4WW2B 4FQ1H 1EMTL 1XGTA 1ZHKB 2IAMC 5TF1L 4OLYH 4QY8A 1SYSA 3CCHA 1JK8A 1V5JA 3MRBB 3TV3H 1X5FA 1UC6A 2E27L 2ATPB 4QGYA 4NO0B 4XWGL 5E2TH 1A6AB 3U82B 4F15B 3GIZH 4OLVH 4CADA 5D1QD 3RTQD 1J10A 4XCFL 3DMMC 4XNUH 3DRQB 4U6HB 2DTML 1I1YA 3GZKA 3SBWC 4E5XB 2LU7A 2P43B 3ZSTA 5ADPH 1BOYA 1EXUA 2JTDA 3CZFA 2OJZH 1KB5B 4UT7H 5DZOA 4PTUB 2KKQA 3GO1L 3SDXE 4NQSB 2X4UA 4KJWD 1RJZB 4PS4L 5DK0B 1I7RA 5D5ME 2Y06H 4LDOB 4NUGH 1P2CA 4MNGB 4H88H 1FZMB 5C0JA 1ZANH 4NZTL 3S88H 3WKML 5HGHB 5KVFH 1DBBL 4UT9H 1RUAL 4GKOA 4JO4H 4XPAL 2IANE 5IBUG 3W0WD 2Z8VC 5LGJA 1VERA 2A77L 4HGWA 4X80H 1FCGA 4OCSL 3L3DA 5KVEH 2HT2C 4IHOA 5ACZB 3UPRA 4GQ9H 3L5WA 3R0MA 1IC5H 1JBJA 2UWEF 1MFEH 1FL5A 3FN0L 4X6DB 3FT2A 3P4MB 4TSCL 1F3DH 5ESQA 4WI4A 5FKPA 3VGEA 2XWTA 5I16A 4Q7DA 4LP5A 4HJJH 4U3XA 5FA3B 2NNAA 1R5WB 4GG6B 1ZHLA 4LU5H 4KZEL 2NY6C 4PRPD 1N6QH 1X4XA 3QXAA 1X5AA 1MEXL 4ODHL 2X44D 3BKJH 4ZS7H 5K9QI 3GBML 2F74A 5CHNB 1RIHL 5KOVC 4QRTB 1RU9L 1T5WB 3K80A 2O26U 3QP3A 5D8JH 4DVRH 4P49A 1DUZA 4M7JL 5KANG 1D9KB 5E8NB 2QSCL 3DVGA 4M9OA 4XI5C 1T0PB 5IMMA 5DVMA 4OFIA 1NAMB 1TDQA 3SCMC 4IRJB 2DTSA 4LCIH 4PR5B 3U7AA 1P2CB 5K33A 1Q72L 2NZ9D 2OBGA 1BWWA 5ESVA 3P0VH 3QWRA 4KVNH 5IEHB 5T3ZL 1G9NC 1K3IA 1IGYA 4G8EA 3OKKB 1GXEA 3FQUB 3T0XA 1MIML 5EPMA 2CRYA 4TVPE 1LVEA 3U83A 3V6ZB 3ARVA 2V2TA 1T4KA 2H26A 2RCSH 3CXDH 1CGSH 3VD5A 3NN8B 1ZT7A 2IWGA 4G5ZL 3GNMH 1FFNB 4RMUA 4X8XA 3T1FA 4ISVA 1G6RH 4K8RL 5HHOB 2YD6A 4X5LA 2XKNA 1YC7A 5MEQB 2R4RL 5IJVA 2FWOA 2QQNL 3VFMA 4YZFE 1KNOB 5C86A 2D3VA 4K71B 3OR7B 5IFAL 1QVOA 1X44A 5HHXH 3KNBB 5EDXA 4DFHA 2QKIB 1ZLUH 2X1WL 1Q0XH 5DVOA 3ARBA 2APFA 3KPNB 4FQXD 3QUXA 3ZHDA 1BD2D 2HTKC 4MJIE 4FQQA 1CZ8H 2PCPB 2EXYC 4IIQC 1CDGA 3W9DB 1FV1A 1XIWC 2AKRA 2C4XA 1BBDH 4QNPF 4Z7VA 5DD5H 3U7YL 3FN9A 3VI4E 1LEGA 3JVGC 4V1DA 3T0AA 1Z5LB 5CKAA 2XTLA 5JO5B 4KV5F 3UO1H 3CXHK 2FDBP 4JG0L 4BSVA 4JGUA 5IW1A 1A2YB 1EA9C 4Y2OA 1LE9A 4G8GD 4J3WA 1ZTXL 4ZTPL 1YMHB 1G7QB 4J4PA 1IKFL 3TVMD 2YPLD 1CFSB 1NC4A 3L5WB 3IDMA 5JQ6H 2YPLB 4P5MB 1HI6A 3CUPB 4IOIA 1T4KB 5B38B 1MRCL 4YQXH 3FT2B 1NCCH 2YSSA 3DGGB 2VWEC 3ARDC 3TA3C 3R0NA 4ZODA 4YPGB 3VXOA 4DOHE 2N7AA 4CNIB 2ADJA 4WTZG 4FXKB 1QA9A 2FWOB 3VFMB 4WFHD 3X14B 5A2KH 1QO3A 3VFRA 1RIUL 3BPCB 4R8WH 3H3BC 4HIEA 1UGNA 5EU7E 3UJJH 2EIBA 3MV9E 1A7RH 1X5HA 1B3JA 1RULL 4HBQA 4OB5H 3L3HB 3T0EA 1OAYL 1HK6A 1ACYL 4OF8A 5F3HA 3WIFA 3V0VB 4PJEE 1JGDA 2HJLB 1U8JB 3KXFB 3MRHA 2YK1H 3H9ZA 1CR9H 1CLOH 1LEGB 4JRYE 4WHYG 1CBVL 1KTKE 4OCXH 2J6EH 1ZVSB 2Q6WA 4AIZB 1TTFA 3OPZH 4Y2DC 5I1DB 2RFXA 1JHKL 4JHBA 2PXYA 3M07A 1CGVA 1GZPA 1I3RB 4HDIA 4JCLA 2JK5A 2MTPA 2AQ3A 2YXMA 3MSPA 3GMOA 4LIQE 5JQHC 4F57H 3O3AA 5FGCB 4KMTL 1BJ8A 4DKDC 1NUFA 4RMVA 4LLYB 1PYWA 3CDCA 1TVBA 4RX4D 4LSPH 4BM7A 2GTWA 2VB5A 3D2UB 2R23B 3BZEA 4GRLC 4PJ7B 5KG9B 1BEYL 1FZKB 4FQLH 4RAVB 1WZMA 3NIFE 3TBWA 3QIWD 3HI6H 5C2BH 3WSQL 3L3IA 1OD7A 5A2IH 3ARWA 1FFPA 5GISH 4KTEL 3S35L 3I02B 1QSVA 4OGXL 2BK8A 1TENA 4EBQH 5C07A 1DQTA 1HXYB 4MSWA 1YDPA 2XPGB 4NKOA 4NRZB 5L8JB 2ID5A 3MNZA 1DQJA 2VAAA 5IBTL 4HUWB 2RHEA 2YUZA 4LLQB 1SHMA 5B39G 4E9LA 1II4E 3TZVA 3V5DA 2EDEA 2GI7A 4Q9CA 4U1SA 5I8KH 3VXSE 1JGVH 1H5BC 3PL6D 4PRNB 1DEEB 2HT4D 1M4KA 5CCKL 5DT1L 4X6EA 4L8SA 4Z7VB 4LF3B 2DIAA 4RGMC 2CMRL 4AK1A 4JJ5A 4K3JL 3MRCA 5DJ8A 1EPFA 1KJ3L 1JGDB 5DQJB 1EJ6A 1ORSB 4RNRA 5I8OH 2ZOLB 2Q8AL 1UZ6F 2HH0H 3HNSL 4HJGB 3W2DL 3X12A 3MFFA 4XXDB 3SKNB 3IFLH 2I27N 4HCRL 1J18A 1FSKC 2ARWA 1HXMB 2G5RA 3OZ9L 3MLUH 4PLJD 2ZSWB 1U9KA 5HVHC 2VLJE 1VGKB 1NGQL 1FYTB 4LSDA 3HPJA 4OLVL 4U1GC 3IDYC 3LV3A 1X5JA 2H6PA 4RBPH 3QHFH 1T3FB 5FDWA 5IOPA 3VXUB 4C56E 5I2IA 5DMKB 2P8LA 5FYJH 1HWHB 2DQCL 4PD4K 5E6IC 3MV7E 3ZTNH 1Q9KA 1IILE 3EKCA 4KAQH 2F15A 2OM5A 1J0KA 5DWUL 4GW5A 1N5AB 1QR4A 1DL7L 1GOGA 2GSGB 1S9XA 2F5BL 2BC4A 5GRZA 2J7LA 3U36B 4P5KB 2ZWLT 1EUTA 4KROB 5TDNA 3V8OA 4PJHF 1F4HA 4R96A 1QNZH 5EZIH 1KN4L 2MWCA 3KPMA 4XB7A 1CD1B 5F21B 1I1AB 2WUBL 2DQEH 3KPSA 4UAOB 3WIFB 2B8OT 5B4MC 3KPQA 1OSZB 1RUAH 2D7TH 3UJTH 1LK3L 1FAIL 4OIIL 2VUOA 5FYKL 4FQXB 1RZKH 5D7LD 1QRND 1F4WH 2NY4C 4LLMA 3GMPA 4OCSH 2DAVA 3ULUL 1FNEA 3EYSH 3G5ZA 4RAUB 1T2XA 2AK4B 4PJBB 1P5UA 1PKQA 1WBYB 4PY8I 3PL6A 1IC5L 3NCJH 4UIKL 3DX6A 1MAKA 5J12B 2PYFA 4G6JL 4HWBA 4JRWA 4HAGA 2G75A 3K4DA 3B3IA 2HJFA 1TVBB 2ERJB 2XQYK 3ULVD 1NBZA 3T2QA 4NN7C 2DYPB 2VH5L 2D03L 3PGCA 4OCMC 4RAVA 4EN3D 3BKMH 2VLME 3PWLA 4M62H 1TVHB 1OTUC 4LU5L 2YZ8A 5E9DB 1ZSDB 3TP4A 1QKZL 4HFWA 1RIHH 4DVRL 5B8CC 1QLEH 1LO5A 3QNXA 4LFHD 2Q8BH 3T08A 4NP4L 1AI1L 2C5DC 2DMKA 2BHUA 1GRWA 1QR1A 5D6CA 4UQ2B 1QEWB 2ADIA 1EEYB 4U3HA 1XIWA 4P2OB 3HAEB 4XX1G 1JF1A 1GHFL 4W68A 3QUKA 5HHVL 5HGDB 1JUFB 2AV1B 3RKDC 1RZ7H 3QIBD 1M7DB 3HRZA 4GUPA 5J9PB 5C08A 4MQ7B 5A2JH 2K3TA 4UDTB 4GRWE 1T0NB 3BMVA 5JLZA 3SDXB 1VFOA 2F53D 4ZO6A 1P4LB 2EICA 3MPCA 1NGWA 4YEFA 5HTSA 3CX5J 3QUXB 4KUCD 5INCA 3I75B 4M5ZH 3L5XH 1DE4B 4JN2A 1U2HA 1QPXA 3RU8L 3SDCB 4D9RD 1Q38A 1OGAB 1OW0C 2EH7L 4DN4H 1PKQE 5EO9A 5EZLA 3OX8A 1QFWH 1D5MB 1RZFH 1MREL 4NT6B 3GSQA 3CSPA 3S34H 4U1JB 1T2JA 4NQCB 3TBSA 4JDZA 4BUHA 1AGCA 3IFOB 5F88B 2E3VA 4HK3N 3VG0L 5ITBL 3ISWA 4PG2C 3PWNB 3RWIB 4MA7H 2QJDA 4PRAA 1T03H 1G7QA 4FTVA 1WIPA 3PWPA 4PJEB 1CXIA 4TULH 3TCLA 2P8PB 3GSRB 1HILB 1CZ8L 2BNUB 5C0CE 3QULA 4FXLA 2YD3A 5JW4M 4AL8L 1NGYA 4JFOA 3WL9B 4IOIB 5CEZL 4GRLD 4MJ5A 1CT8A 4ETQA 2CLZA 4N68A 5C6PB 1NDGB 3RL1A 5IHUH 3LHPH 4NWUL 3VXOB 2PW2B 5FCSH 4KHTL 4GW4B 3LQAH 3OAYH 2VDRH 1ZTXH 3GB7A 2KUTA 3V4VL 2B4CC 4ZS6C 5TE6L 5C6WH 5CSGA 4HF5L 3ULUC 3IXAA 2AXFA 1N4XH 2C1OB 3MRDA 2ZUUA 1CDCA 5IK3A 1P7QA 1VPOH 5DRWB 1BGXL 1DEDA 4A6YL 4PV8A 1AQDA 5JW4Q 2DQFA 1F42A 3E6HA 3V0VA 3UTQB 1ZWIB 4U2YA 2PYEA 5I1HH 3RQ3A 1XR8B 5I17B 3R06A 4OAWA 2CDEB 2AP2A 5L8LB 1RIUH 5SX4H 3AM8C 4ZFOL 1VACB 1FVEA 4XNQA 2IPKB 1B88A 4BFIA 5BO1L 3FQWA 5AZ2L 2GIYA 4QHKI 1GZPB 4HDIB 1I1RA 3UAJC 3NCEB 3FQNB 2IADB 3HI1B 1MCSA 5CJQH 2OLDA 2IAND 4ZDHA 3O3AB 4NN5B 1MCJA 3MJ9H 2ESVB 1CR9L 2VZUA 4PJFB 5GGSB 4GAJH 2WBWB 2AV1A 4JG1H 3QQ9C 3ARRA 3DVIA 2IQAA 1U3ZA 4PG9A 4YHZH 4JFDA 3QDMB 4HUXA 1KEMH 1O5DT 2Z9TA 2A6KB 1EEQA 4N8PA 5B3JE 4NKMA 1CFVH 3ZKQD 1F6LL 3DX9A 2H2PD 5FGBA 1QRKA 1OCWH 3MBXL 2YC1A 2NY6D 2D7MA 5DHVA 2XZAH 1G1YA 3VMOA 4B0MM 5ISZB 5C3LD 1P4IL 4K23H 3BPOC 1DQJB 2WBJA 1DVFA 5FO8A 4QO1A 4PJ8A 4EI5A 4YHOL 1K8IB 3R8BB 5D7LE 2MQ0A 1OTSC 2AJYL 2FJGB 3P4NA 4O4YL 1D6VH 5CILL 1E4KC 2HRLA 5INDB 3IFOA 5F88A 4PRHB 2Q20A 5SX5H 5ESVB 4AG4H 2W92A 3B9AA 4O2CB 1CS6A 3VI4F 4Z78A 4S1SL 4L8CA 5I71C 4JFPB 3IAPA 4M93C 3IDJA 5EU5A 4ZUTB 4XXDA 2R8SL 3B2VH 4Y19D 3VG9B 1E4XI 1WEJL 3WDJA 3T0DA 1K4DB 2VDQH 4JCMA 1HNGA 4K2UL 1SJHA 4K94H 3ARFB 3VU2A 2Y36L 5D7JA 5H35A 3RWDA 4YBLB 3Q2CA 5DI8A 1JNLH 3JV4B 5GRVK 2DQUL 3X3GL 3MJ9A 3L6FA 3RWEB 1WC7B 1WBXA 1YEIH 3SEPA 2IPTH 5C1MB 1FZOB 1HINH 1MIEH 5FM4A 2JB6A 4ELMF 3JWNC 1N5AA 2QSQA 4IRSC 5IMKA 3AB0B 3UCRA 3MC0A 1CFNA 3T77A 2Y5EA 2ARJQ 4F58L 3OL2A 2C3GA 4R2GB 1N7ML 4GQPH 1S9XB 3HG1D 4L9DA 1IEAB 1T1YA 3LN4A 5IIEA 1ZGLP 1YYML 1LD9B 3F5WA 1A3RL 1X5KA 4X98A 1CF8H 4KI1A 4UDUA 3O2DA 2UV3A 5MP6L 1H8SA 3HI5H 2PYEE 2E9WA 3IJSB 3OSKA 3WHXA 5FYJL 3LKOA 5I1AB 3O4LD 4BZYA 1N8ZB 2XN9E 2JJSA 3KS0H 3CDGB 1UZ8B 4QLRA 1S9VB 2RIKA 3QA3A 4FABH 3GHEL 4NN7B 1HZHL 4BQCA 5L6YH 1SY6H 2B2XL 4HK0A 2KBGA 4W6YB 4D94A 3FCTA 4PJDA 1GGUA 2VE6B 3HG1B 1T04B 2SEBB 3R4DA 3BGAA 1NBZB 1CXKA 4K7PY 3LKQB 4YDJA 4GAFB 3UC0H 3MQIA 2HFFA 3L6FB 3QIUC 3QNYB 5KSAB 2NXYC 3D85B 3SGKC 5JW5B 4OSUL 3O9WC 3D69A 1XF4B 4D2NA 3H42H 1EO5A 4PR5A 1A7PL 4BYHA 3RZCC 3D39B 1G7IB 1ZS8B 2EO1A 3EFDH 2R29H 3BUYA 1NUGA 2WINB 5D1XC 3LZFH 2ADGA 5DVLA 4OF7A 2IJ0C 3TESA 4MS8D 4M62L 1ITCA 1NL0L 4JDVB 3TBYB 3RDTA 4NM4L 2W60B 3S5LB 5SWZD 3CPLA 4G7VL 3AGVA 1A6UL 4JPWL 3CVHB 1VENA 4KC3B 3TM6A 5EUKA 4P2QE 2ZUWA 1OM3L 5CZVH 4JFPA 1FDLL 3KPRB 1R5WA 4GG6A 1I1YB 1N0LA 2HT4C 5EB9A 4TRPH 3TPUB 5CSBA 4HX1A 2UZIL 3EBAA 2FO4A 3BP5B 2VXTL 3DI2B 4JFQB 5TFSH 3QQNA 4YR6A 2FATH 4UT6H 4N9GB 1EFXB 5INCB 1EERB 5FXCH 3TIDA 4PD4J 4GG8B 3PUCA 5KVDL 3WNPA 5EO1B 3JV6B 1RZIB 3Q3GA 3P3YA 1I8MA 1U8LA 4JFYB 5D93B 2XA8L 5KOMC 4X7SL 3T4YB 4W6WB 2I25N 3F62A 1P4BL 3BKCL 3U4EA 4P2YA 3O6FC 3EYQD 3C2AH 5AD0A 4APQC 1ETZB 1RSFA 1JRHI 3KPOA 2AXHA 2GTZB 3S36L 2V7NB 4GMSL 2Q86B 1SEQL 1NAKL 4FQ1L 4Y4KC 4HPOH 1EMTH 3D18B 3CU1A 3DO7A 2OJEA 3BWAB 4LSUH 3SKOB 1A7OL 4FS0A 2B0SL 4KKCC 2EDKA 3D39E 4J3VA 4GRWH 3OR6A 1WISA 4MJ2A 5KSUA 4TPRH 1CI5A 4E41E 2BOBB 4OCRH 4POYA 1X7QB 1J8HD 3F7VA 3O6LL 1IFHH 3A6CH 3GGWB 2AAVA 1HI6B 5EORH 4Z0XA 3GIZL 4P2RD 4H0GA 1DJSA 3GJFA 4P2QD 2HLFD 1EHXA 2PO6A 2DI7A 1MF2H 1R3JA 1P7QB 1YMMB 2PNDA 1J8HA 1YNTB 5BV7C 5HDLA 3REVA 2C1OA 3MRDB 4A2LA 5CGMA 4P2QB 1N5YL 1G7MA 4K9EH 4MD5B 3GO1H 3V0AC 4P59H 4L4VA 1RUQL 4KK8D 3EYVA 5T33L 4NQEB 4YAQA 1FV1B 4NCDA 4OFPA 4PGDA 5ADOL 1SM3L 4GG6F 3D0VB 2OI9C 3LOWA 3QJHA 3TA3D 4KMLB 3QPQC 4HS6B 4TUKH 5MEND 3QZWB 4WFGD 5CJXC 5HDOA 2D7OA 4HFUL 3QJFB 1VHPA 2VLKD 4P2OD 4WI7A 3MCKB 2D0HA 2IPKA 2Q3ZA 5E00A 4QEGA 5B8CA 5BVPL 3DPBA 3HPLA 4TNVK 3P4LA 3WXWL 2F5AH 3BT2H 3KWWA 3HE6B 3FFDB 3N9GH 3RI5F 1AJ7H 5SX4I 5K93A 3WHE1 5I1HL 3D9AH 3QUXC 2YMXL 4AH2B 5B38A 1DN0B 2H32H 3BHBA 1AR2A 2Z4QB 2VLJA 4FFVD 4PB9H 1HHIB 5JXAL 5FOBB 4PJXE 3U46B 1G9NL 2XQYG 3ZDYF 1EZVX 4OF5A 3KPRA 1GC1L 2FHBA 1HQ4B 2OSLB 1GH7A 4LCCA 4Z0XB 4ZOEA 3GBNH 5ISZA 2BVQB 3MRMA 2BVTA 3T2NH 1MEXH 4ODHH 5ESAA 1KIUA 3STLB 5KBNC 3WNOA 4XWOC 5DURB 3MNVB 5K59F 4S11A 4YBHA 3D5OF 4KI5C 3GMRB 5KAQG 4EQ3A 3Q0HA 1BOGB 1U3HD 5D1ZC 2I9LA 1QRNB 1FIEA 3GMMA 2VAAB 1XZ0B 4V1DB 2D9CA 3LIZH 1VSCA 1YN6B 2WWKT 1PFCA 4DCQB 4ZUTA 3N1FC 3FO1A 4WI5A 4OV6F 1B90A 3BP4B 3RWCB 2C3VB 1WAAA 3E2HB 4M61A 1XMWA 4M6MH 2F8VA 4OGZA 5J1SC 1EBAA 3W5NA 1HHHA 4YUEL 3DNKA 4JFFA 4WTXA 2J8UA 4CDHA 4N1HB 3O0RL 1FN4A 4S1RH 3GNML 3GRWA 1D9KC 4AG4L 2ITDA 3K7UA 3UTZA 1PLGL 1ZT1B 2UWEB 1SY6A 5DJAA 1KT2B 5DMGD 5BXFB 3K2MC 3U48A 1DN0A 5T1KD 5ID1A 1A4JB 2VLRA 4K8RH 3IKKA 4LNRA 3GGWA 4LHQB 3TBWB 3QDGE 2ZSWA 2E8YA 5B38G 1CFQA 3WLWC 3TFKD 4ZO9A 3O41A 2EDFA 1EGJL 1FNSL 4ZAKA 3HPJB 1P4LA 1EUUA 3RGVD 1CDUA 2O93L 3H6JA 2Y07H 2W9EL 3AFLA 4AEEA 1NLBL 5HGAB 5F1IA 3KR3L 2YPKB 5ENWA 3T0EB 5IM7A 1U95B 3L7FA 5DJZA 1AO7E 2XOTA 3VGFA 1AD9B 1S7WA 3V5HB 2NY2B 3IFNH 3GI8H 4NFDA 1T7VA 5EOCH 3RNKA 5BQ7A 3TT3L 3PQYA 4HXBL 4AM0B 4G9FE 5HYQA 4WFHE 2OP4H 3ARGB 3MV9A 1A22B 3KPSB 2D9QB 4YX2L 5J11C 5IFHH 1KXTB 3OHXA 4F2MA 1OWWA 3U4BH 3HLAA 2DM2A 3C5SA 5ICYB 3T04D 5E8EA 1OW0A 5ICXA 1FGVL 2ZUQB 3S4SA 1A02N 1A6ZA 5JIHA 4HLZG 1IAIH 4WY7L 1MRCH 5GGQH 1HH9B 1F6AB 3RZCB 1W0YT 3HUJB 1VADB 2HYMA 4P23D 4CMMB 2GK2A 3S3PA 1OAXH 2XG4A 3RY4A 4WW2F 2DS4A 5D7IE 3ZE0E 3ZKMD 1BMGA 3B8SA 4JFEB 1T80A 2BSSA 4UU9B 4WUUD 1CGXA 3A6BH 5GGRY 5FGBC 1PGRB 1LE5A 1DSFL 4EUPH 1BIIA 4M1CD 1XR9A 3RWJA 1OAUH 3X3FH 4YHKH 4EN3A 2DKMA 3TT1L 4Y8AA 3OGOE 5EZJA 3HAEH 3UC0L 4HEPG 4OKVA 3O3EA 4U33A 2FGWH 1JZ6A 4OSUH 3FQTA 5IG7A 1U8MB 3CAFA 3RVVD 2HVKB 2HKHH 1XIWB 3BE1H 3C6LB 2CR3A 2PR4H 2ZOLA 4CVWA 1QYGL 3NCYS 4LPYA 1Z9MA 5DUBA 3MV9B 4JFQA 3ECBA 3NTCH 4JFDD 2N7BA 1C12A 4LDEB 1INQB 2Z93B 2VLLB 1HH6A 2IBGA 4F57L 5D1QC 4NJAH 2LQRA 2HJFB 1KJ2L 4JPWH 4K3EL 1IE5A 1DBML 1QLFA 3I50H 3BJ91 2EYSB 5HHQB 3EZJB 3C09B 4KI5D 2EDDA 2BY2A 2V17H 4F7CA 4XCEB 5DC4B 4TRPL 3PABA 4U0QB 5E8NA 3C9NA 3HTLX 5E94A 3KG5A 4Z8FH 3DIFB 4NT6A 4I3RL 2FATL 1Q9LA 3S35X 1X5IA 1XGUA 2PF6A 3H3PH 1G7HA 4IS6B 4JFEA 2X4TA 3ILQC 3UDWC 1S3KL 3STBA 4RMWA 3RAJL 3BX7C 4JKPH 3WXVL 1OARL 3MA7A 4LAQH 2BVOA 1K8IA 5FDYA 2X4QA 2MHAA 5C09A 1YEFL 1H15A 1JPSH 2FYYA 3UROR 4D9LL 3IDGB 3UPRB 4ZO8A 4W4OA 2FJFB 4R97B 5BV7B 5DS8B 1P4BH 3BKCH 4JFHD 3ARFD 2NX5D 1X7QA 3V6ZA 2V2TB 4Q6YA 4LHUA 1AP2A 2GITB 3QEQE 1KJ3H 4I2XE 4QRUA 4D3CH 5FEBA 3HNVL 3B9KD 4EVNB 1INEH 4YGVB 3C6LA 3KYOA 1PZUB 1RZJL 1YMMA 3NFPA 5FA3A 5DHVH 4UNVA 1F00I 2VLRE 2R4SL 5F7NC 4LSUL 4YFLF 4JPVL 4G42B 1RJZA 5HD8C 2P44B 1BJ1J 3THML 3MYJB 4H1LG 1F4YL 4NQEA 5EO0B 1UWGH 4JY6B 3HMXL 5I1EL 2CK0H 4L4VB 4TYUA 1DN2A 4WWKC 4NO2B 4LLAA 3ROLA 4DTGH 4EXPX 3LD8B 1MQKL 1AR1D 3MUGB 2VSDA 2DQCH 5FM5M 1CGSL 2P46B 4NRXB 3V4PL 4KAQL 2VDKL 5MEPB 3KLDA 5F9JA 1WVZA 4PRAB 2R2EA 1XR8A 3AS3A 1P6FA 1KPUA 2RBLA 1XR9B 3QG6A 2OTUA 3QWOB 4KH2A 1JHTA 4NSKB 3ULVE 4M3JA 4J1UB 3BD3A 1U2CA 4BSVB 4Y4FA 5IW1B 3OB0H 5GGRB 4PJCB 1J1PH 2PW1A 1B0RA 1GOFA 2H3NA 3QDGD 1YMHA 3QPQD 2FL5A 1NBVH 4L9LB 4XC1H 2E9BA 3ZYOA 2D7TL 4F3FB 2IG2L 4NNXA 3GJFH 1OB1B 1U8OA 3MLYL 5SV4A 3BPLB 1OT2A 5ISZE 2XNAB 3SO3C 1I8IB 3QCUL 5E5RB 1D9KD 4XBPA 3X11B 1AIFA 5DFVD 3GB7B 5I75C 5D70L 4PLKC 3ULUH 2K7PA 2YA2A 1K5NA 5HY9B 1KELH 3GJEB 2APXA 2KDGA 3VXQA 5C8JB 1INQA 2Z93A 1DFBL 1D9KA 4K3GA 4X4XA 3EO0A 4NNPH 5D96C 4NQXA 4YK4B 1U3HB 5HHQA 2PETA 2EE6A 5D7KD 2MQ3A 4XB8A 1GC1H 5F8RC 1FBIH 4XHJD 5I17A 4NUJA 1WWWX 4P48A 2VKWA 4Z9KB 3K2UL 4WJ5A 2AEPL 2DI9A 5IGXH 2LTQC 2EXWC 5CP3H 4S0SD 3RWHB 1ROWA 3MLVL 4WGVB 3B4NA 1B4JL 1JYVA 3DROB 1A6TB 4Y8DC 4CDGC 4MS8C 3UDWA 3UTSB 4ZFFA 2GY5A 4LASH 5GGSA 4F9PA 3SKJH 2CLRB 1HCFX 1CDIA 1YN7A 1BJMA 3VXTB 4LPTA 4ZD3L 1A4KA 1RULH 4NO5B 5IB4A 4ZTOH 1FZMA 5C0JB 4UQ3A 1IQDB 3S37X 4PRIA 5IROA 5F1IB 4RFNC 4HG4K 5IW6A 4X7FC 4PY7A 3SY0B 2JB6B 2LAGB 1KLFA 4HKZB 3SDAB 1AFVH 5C08E 1PLGH 5F44A 1WWCA 1CBVH 2OL3A 1N64L 3AVEA 4G80B 1HXYA 3MR9B 4MSWB 1JPST 4NRZA 4QXUH 4XPGH 5J1TC 2LE9A 2P5WD 5TDPA 4AMKH 2E9JA 4MCZA 4AENB 3TZVB 4R26L 2NY2D 2VC2L 4LSSL 4ZFGL 1TJHL 4CKVX 5EUOA 4FFZH 5I1LA 5JHDD 1IBGL 5KN5B 1KIQB 4XWGH 5E2TL 1CE1L 2DQHL 3K81A 1KSRA 3L3KB 5EU5B 4F2MB 3H3KA 5D2LE 1CCZA 4QRQA 1EO7A 2LVEA 4F7PA 3HI6L 4Y16B 5IHZA 4I5BB 3PDOA 4LOUD 5GRUL 5E2UL 3GI8L 4NDMB 3TT3H 3VXRB 3ARTA 4EI5C 3FZUD 1IGFH 4KTYA 4OQTH 1DTUA 3QYCA 4PS4H 5E6IA 4YHYB 5D1XA 4KGLA 5SWQB 3CIQA 3HAEG 4JKMA 5MENB 3GKWL 1KXQE 1T04A 43C9B 3DMMB 2YC1B 1A4KB 4K07A 4UIMA 2ZG3A 4X6CE 1BBJB 5EZOH 2OQJB 3UJIH 4EUPG 3OG6B 5I6XC 5IEHA 1RZKC 2D31A 3BPNB 1NPUA 5FHAH 4EIGB 2HKFL 1AY1L 4JB9H 5KVEL 3Q1SL 4DUWA 4HUWA 4MD0A 3P4NB 4LLQA 3HZKA 1MJJA 1MCEA 2WQ8A 4H20L 2XV6B 3ABZA 5FYJE 1F4AA 2H9GA 3QNZB 2VXVL 1KUMA 5B3NA 3C60B 5T5FL 1ZT7B 3ZKXB 4XP4L 5ALCH 4OGYL 4WHTA 3QWQB 4WV1B 4YXKL 1L9NA 2CKNA 4N5EC 5IB3B 1LNUB 3LS5L 3A6BL 5HVGB 4ZS6D 1NBYA 2MKWA 4O2FA 1YA5A 1S9VA 4JN1H 3S5LA 1CVRA 1WSST 5BO1H 4LVNC 1ZGLB 1DQLH 1G7LA 5CLTA 3MRKB 1NGZB 1Q9WB 4WUUA 4Q9RL 1A6VH 4DZBB 4KZEH 3TYFB 1X6NA 4OTXL 3QHFL 1UJ3A 4PTTB 4F7PB 5D5MB 1JWSB 1NFDB 5KSBB 1I9RH 1GC1C 2OK0L 3QUZD 2EKSA 2DKUA 5D8JL 3SJVA 3WNLA 2VXUH 5CZKA 1P69B 2OZ4A 3RNQA 5IQ9A 5M95B 5DEFA 2JCCF 2ADFL 3G5VB 3UBXI 5LAXB 3CK0H 3VRJA 4KJWC 5MERA 1UVQA 2V5TA 5TDOA 2HFFB 5ANME 5KSAA 1CFNB 5LGHH 3BIKA 5EFIA 4N8VB 2AKRB 3D1MC 4HS3A 4QRSA 2WUBH 4EI6A 2K1MA 4JFYA 1Q72H 4P23C 4DGVH 3V79C 3EOTL 1OAZL 3O8XA 3GSOB 5IVZA 4KRPD 3FONB 1BBJA 4J7RA 2MHAB 1C5BH 1H15B 4JFFD 5DGQA 1JV5A 1HOCB 1BWMA 5IKCA 3FMGH 2JELH 2E7CA 5K9KA 3MA7B 1T21A 9CGTA 4PBVC 3P4OB 4NJ9H 4OZFH 4O4YH 2RCSL 4XI5D 4MCZB 4AENA 3C5ZD 4HWZA 4NQED 1UZ8A 4IEFB 3WUWG 3QXVA 4YNYB 1HEZB 2Z31D 4WV1A 4G6KH 3MRBA 5DUPH 3T65B 1KJVB 1KCUH 3WXVH 1X5ZA 1CL7L 4MAYC 3DRQA 5C92A 2YPVH 1YMMD 2UWEE 2ATKB 4JQIL 4M7ZB 4U1KB 5FYLH 2F58L 2IALB 2JJWA 1FHGA 2ZG2A 1MJUH 1MHCA 1QKZH 5LG1A 3LRSA 1ZE3C 4LSRL 1IQWL 3X3GH 1KCSL 1FVCA 5ID1B 4NN5C 4N90E 2BSTA 1IM9B 2WV3A 1AI1H 5TE7L 2VDPH 1EHAA 3MUGA 4GMTH 3CFIC 2X10A 3EJYC 5EN2B 1UM6H 4G8GA 1UB5A 3CGTA 2APWA 4GOSA 5DLML 1RZGB 5FUZL 3U7YH 4HJ0C 3REWB 4ODTL 3CZJA 4UIMB 1JGUL 2FRGP 3MRHB 4W70A 5CEXA 4KI5F 5DXWA 1EJOL 2IC2A 1UJTA 2AABH 4EI6B 1FNAA 3BPLC 3T2PA 5A16A 4QRRD 4JG0H 4OI7A 1YYMH 3HNTH 3FHQA 1DQQB 1G6VK 3EO1B 1BZ9B 3SDYH 2CO6B 2O61A 2AV7A 4MVBC 4TN9A 4B53A 1CXEA 3EOAA 4NZUH 1XGQB 5ACZA 3NACL 2Z91A 5MI0B 3TO4B 3A0OA 4QHLB 1I9IL 3NIGF 4DUXA 5ESQB 1CDYA 1OTTC 3PP3H 3E8UH 4IBLT 3P4MA 3P0YL 2P24B 4MXVE 1UQSB 1MREH 1TXKA 4ODXB 4UDTA 1R3JB 1TPXC 1U41A 1H3GA 1AQKH 3P73B 2C1PB 1IC4H 1AHWB 2JE8A 4FN0A 1PG7L 4G6AD 1NBVL 1BVKB 3MRFB 2H1PL 3PGCB 3UBXB 4JN2B 4XCNA 1P6AB 2F19L 2APTA 4NQXB 5E7BA 1I8KA 2C4FT 1N3NB 2X41A 4G6FB 4RIRA 4ZFOB 1H3WM 4TULL 1UVQB 1G0DA 4Z7UE 5JW4R 3O6FD 3GSVB 3SE8H 2D2OA 4AL8H 4I0CC 3DV4B 2YA1A 1OAQH 5I30L 3MRPB 2P4AB 1N0XL 2EZ0D 5I15H 5IHUL 3HPLB 3QQ3A 5F97E 1WTGT 1JN6B 1JV5B 2OR8A 3QRFM 4EQ2A 5GSVA 3L9RB 4K8RD 3C6SB 1PW3A 3KDMA 3TGXA 5EZJB 1UWXK 3OKYA 4N0CC 3UTSA 4ZFFB 1Z9OA 1HE7A 4YBQD 3UTPE 2CUMA 3LCYA 5GS2D 1U58A 1VPOL 3VFPA 4HIHB 2IFFH 3DBXA 4AZ8A 3T1FB 2E7HA 3GMQA 3PJSA 4PJFF 1PAMA 3JUZA 1JZ4A 1UYWH 2NNAB 1V7MH 2KL6A 4M43H 1MWAL 3E1F1 1EVTC 2PO6D 1UT9A 5HHOA 1AKJA 3N1QC 5DVKA 5GRWA 1T1WA 3TJEL 4C83A 3WDHA 4PRPB 3MV9D 2EC9U 3OX8B 3VRIA 2R69L 1T6WA 4Z77B 3MXVH 2VABA 4DW2L 2BJMH 5D9SB 3UEZA 4E42A 5EULV 4KQ4H 4X6BA 4HJJL 3U6RA 1IAIM 4ZTOL 4U31A 4FA8A 5DT1H 3BKJL 1JFQH 5C0BD 2MKLC 5CJQL 3O4LE 1ZMYA 4OLXH 4Y4FD 5E00B 5F6IC 1S7UB 3SO3B 2NY4D 3B9KB 5I8OL 3C8DA 3QULB 4Z78B 2XXCB 5I19H 1G9EA 3MACH 1NCNA 3NAAL 3KPTA 2NX5B 3SCMA 1KLGA 3J7HA 4AMKL 4IIQB 3IFLL 3TO2B 5TPWH 1FL3A 2NPLX 2O5XL 3OZ9H 4V2CB 1HCVA 1MCPL 1MRDL 1FFNA 5D7IA 5ANMA 2XZAL 2F54B 4PTUA 5GJTL 2VLRB 2WK2A 4P9HH 4U7MA 4FQHA 3MOBH 5ERWB 3SE3A 2G60H 1UQSA 2Y1VA 5IK3B 1OL0A 4MNQE 3CXDL 1G7JB 2HMID 2BVUA 4Q74A 3CX5K 1XT5A 3F65A 4U1NB 2BDNH 1FCCA 5DHVB 2P5WB 4IRJD 4R4BB 1ODAA 1DUYB 4TTDC 1J1OH 3B5GA 3U79A 5IROC 5HHNB 3RUGF 3SDAD 4O58L 3W9DA 1M6OB 2DIJA 1H0DB 3VDAA 2YBRB 5BV7H 4K2UH 1I3GH 2MPAH 5E5UB 4JDTH 1ZHBA 1OSPH 3CDYA 1AO7A 1VGEH 3FJTA 2ORBH 1JUFA 3FQWB 3VH8A 5E2JA 5F89B 3BESR 3Q6FB 3SGJA 1DQDL 4GRLB 3WXWH 3LPWA 4DAGH 5DEGB 2CPCA 1KCRH 2VJXA 4XAKE 3D9AL 2C3XA 4HWEH 1XCTA 1NEZA 3ZT6A 5T5FH 1PY4A 5C9JA 3PF2A 2XTJB 1PYWB 3B83A 4RAHA 4M7LT 5SWSB 4Z5RA 1ONQA 2GK0B 2VL5B 1A0QH 2D03H 1MHEA 2NLJA 1CF8L 3GBNL 4OZGE 1E4WH 5ERWA 3WFBH 3GEWB 1OTSD 2DLIA 1IGCH 4X6FB 1NKRA 3DO3A 4LL9A 5GRXG 5JMRA 1S9YB 3NH7H 3FO2A 4IHOB 1JL8A 3SDCD 3AAZA 5FYLD 3BEVA 5FECA 5JPNB 3SE3C 2MJWA 3WUWB 5GSRA 1MPAL 3MLTB 3VFOA 5LXGH 3VGAB 4X0KA 1QFWM 3B5HA 1FORL 1INDL 3HMWL 3U30B 5IVNA 1MJ8H 5L88L 4R8WL 1W2KT 4O2EA 4C56A 2JLLA 2JIXB 2X40A 3RX7A 2EEBA 12E8L 5ICXB 2XKNB 4KFZC 3HZVA 5DJ8B 5AEAA 1YJDH 1H5BB 3C8KA 2H8PB 2A0LC 2P49B 2NZIA 3TPUA 4QRTA 5JR1L 3RHWF 4RZCA 5BS0B 5CMAB 4FOMA 3L5XL 1FYTE 3H0TA 5D1ZB 5CGYC 3FT3A 3DUSA 5CUSL 2EEAA 3FCTB 3TNMA 4DN4L 3NABH 3CVIH 5HGGS 3ZO0A 2J6EL 4ZXBB 4L4TB 4YH6A 4IDLA 4IOSD 5IUSA 2XFXA 4NO5A 3S34L 4OFYD 3NFSH 2H6PB 1FFPB 3UTSD 4JY6A 5ACMA 1OLZA 2BNQB 3O4OC 1MFCH 5L2JB 1NDMB 3R06B 3SDDD 3L7EA 4HIJB 4KMTH 1NCAL 4G7VH 2W9EH 4NO2A 4BJLA 3VXUA 1A1NB 8FABB 4XVTH 4KDVA 5JOPD 1FVEB 1KCSH 3CFBB 2YXFA 1T0MA 3VI3F 3NMEA 4K7PX 1S7SA 4HSQA 1ZGLM 4OZIE 1A7BA 3SE4A 5CINH 1P7KA 3FRPA 3ULUD 4XNZC 4TVPD 3S35H 1X6LA 1I7UB 5TFSL 4MYWB 4URTB 3UTOA 4EBQL 1NEZG 1CD1A 3HZYA 5FB8A 1Q94B 4QRPD 2BCKB 4LPXA 1I85A 1CWVA 4G9DA 3CLEL 4PG9B 4MQSB 5EC1A 3RWFA 3MROA 2FGZA 3N85H 2GW5A 1GPOL 4HF5H 3O6KH 3DARA 4PJDB 2D7QA 3O2VL 2CMRH 3IDNB 3SGDH 4K3JH 4OUUB 3VXQB 4R90L 4TVSa 3BQUA 3OKOB 4RCAA 1ED3B 1EAPB 5D71L 2Z92A 4OCWL 2PYFB 4HHAB 3DV4A 3ROLB 4JRYB 3LPGA 1U91A 1RHHB 4ETYA 5DMKA 5TH2B 3T0WA 3UTTB 4HCRH 1W72A 4BSWA 3EGSA 1PG7H 1NC2A 4XH2A 2OMNA 4C55A 3ULUE 4NUJB 3U36A 1PDKA 2BVOB 4H26A 2J88L 1NFIA 4JR9L 5J57B 4JFZH 2CIKB 4Z7NF 1Q0YL 5T1DH 3FFCD 5I18L 4W81A 1ZK9A 1LDPL 2ZUSA 3ZSSA 1GL4B 3O8XD 2H9GB 4P5TC 4Y5YC 3QDJA 5DFWH 5KZCB 1AGBB 3WIIL 5H94B 3FRUB 3UMTA 3MGTA 4I9WE 3ARGC 3ZKNC 4OZFG 3RKDD 1FGNL 4FG6C 4PLOB 1IGIL 3JV0A 3QG7L 3FO9A 1YY9C 5JLZB 3V9FA 1IGTB 5EBWA 1XFPA 3PL6B 3HHRB 4KZDH 3H9SA 1FAIH 1CLYH 5HYJA 4K3EH 4PJXB 5CJ5A 1A3LH 1DBMH 4WO4C 3WUZA 1XF1A 3OKLB 1AC6A 1NCBL 4X6DE 7FABH 1B0WA 5IJKC 1X5YA 1A3QA 2ZJSL 1U8IB 3IJSA 3P77A 1RHHA 3MRRB 2VWEE 4UV7L 3D3VD 4HIJA 2EH8L 1N6VA 4LKXB 2PTTA 2F8OA 3QNXB 4OM1H 5CEZD 3SDCC 1S3KH 4HG4J 3Q5OA 1R0AH 4L1HA 5C0IB 2EE2A 4JY4B 4WU7A 4X9BA 4GKZA 4WO4D 1KG0A 3QH3B 1NCUA 4RWHA 1KB5L 2COQA 2OR9L 4PJ9B 4YFDB 1MQ8A 5K9JH 4PJ7F 1GGTA 3IS1X 3TO2A 1TTGA 4IDJL 3K8KA 3Q6GL 2A74A 1A6AA 5D7IB 3QDME 4MX7B 4YO0A 5DEZA 4GAYA 4X6CB 3O6ML 1QLEL 4WFFD 4PJ8C 2R1YA 4PJIA 4M8VA 5ELIA 4F33A 5DRXA 1YYLL 4ZPTB 1GGYA 5D5MF 5I19L 3OQ3B 2NQCA 3CLFH 4GKSA 3LKRB 1XF3A 1QSFD 5FKAB 5C0BB 4EZMA 4Y4HA 2ICCA 3MLZH 3TEUA 4JPVH 2XPGA 2X4RB 2D0FA 1RHFA 1XF4A 1S8DB 3V6OA 2ITCA 4PP1C 3P9LA 1S7RB 3QO0A 3MRGB 4KK9C 3KNBA 4WHDA 1DUZB 4XRCA 1RY7B 4FRWA 4P9ML 2R9HD 2XYCA 3KPNA 2Z31B 4XMKH 5C3TA 3MBEA 3C6LD 4DTGL 3TBYA 1F5WA 1MJ7H 4LEOB 4OLZL 3UTQA 32C2B 4ODWA 1HDMA 4U1LB 3RVTC 1T7WA 3IU3A 4S1RL 3MLWL 2VMFA 3LQAC 3C87A 3UX9B 3WO4B 4FZEH 1A7NH 1JPFA 2R56L 1ZVHA 4P4KD 1LO0L 4TUOA 1A1OA 5F70A 4B41A 3NCMA 1QFUH 3B6SA 3BP6B 1HZHH 3FB6B 4GBXD 4KDTA 2WQRA 4L29B 3OJDB 3MODH 4IRZL 1SY6L 3SO5A 3L3JA 3IF1B 4P57B 4BKLA 1ITBB 2MMXA 3DX6B 3IYLW 4R0LC 2IG2H 2R2CA 4MNQD 3O6FA 3QHZL 1RI8A 3EOBB 1NLBH 4MA7L 2BNRD 4S1QL 1S7XA 2EKSB 4WTWA 4PB0H 4P5TB 4Y5YB 2VLJD 3ARPA 3QDMA 4CMMA 4YDVA 4ZPTA 4HKXB 2B5IC 2YRZA 4P99A 3W9EB 2GEEA 3GMRA 5E95B 3QUMH 1LEKA 4R4FH 4LVHB 5E2WH 4G6FD 1BZ7A 4JE4B 4KVCH 4OD1H 3MZGB 3EYOA 3LQAL 4ELKB 5L9DH 2VDRL 4BQ8A 4ZFOA 2HWZL 3VXPA 4I8DA 3KPSD 3WFDL 5F3BB 5DF0A 1H3PH 4KRNA 4P4KA 3C60D 3DSFH 3RPIB 4PJHB 2NY3B 1A6UH 3WV0A 1VACA 4CADB 2AEPH 4K3DH 1CQKA 1XGRA 3RVXC 1D5BA 4S2SA 5EWIH 3MBED 4E0RA 1R3KB 3HLAB 1OP3H 2GQHA 4WTZA 4Q9QL 1J0IA 2R0KH 1OGAE 3SDXA 4MA1B 2E6JA 4ZUWB 3VW3H 5CIPB 1V7NH 5KAQF 4OFDA 1JWSA 1NFDA 4G6MH 3WDIA 4WIQA 5IHLB 4ORZC 2R0WL 3MRIA 4OD3L 2P42B 4FFYH 2A6DB 4NN6C 2M26A 5KVDH 3R1GH 2QEJA 4YHKL 4C4KO 2EEDA 4LLYA 5GGUB 3HUJA 4M7LH 5DRXB 4XCCH 4N90D 4WNQA 4X7SH 1LP9B 1FNLA 3VXRD 3WNNA 5L0QB 2A38A 2QR0A 5HGAA 4Q0XL 4NNYA 3TA3B 5LJYH 4FXKA 2W0PA 4FG6D 3IKCA 3CX2A 3MJ9L 4J23A 2BXZA 3W5MA 1EO8H 1RZGA 3G9AB 3REWA 3F58L 4U7KA 1J11A 1G9MC 3BIAX 2ADIB 4RGOH 2WUCH 3QFDA 3PE9A 3SGEI 5IT2L 3AREC 2ICES 2QQLL 4K7PL 4OZIA 1HKFA 3I6GB 3TN0C 2R9HC 3BDXA 3O81A 5HGBA 2ICWA 5DJYA 2VZSA 3BAEL 3IU3B 1BM3L 3ILPB 1SYVA 4HC1L 2HVJB 3CC5A 3DETC 1MCIA 2EDTA 2G2RB 3QA3B 4I77L 1KTDA 4MJ4A 1YY8B 4NO0D 3PXHA 5CINL 2AJYH 4M02A 3U1SH 1UG9A 5FUCE 3SDAC 4MD4A 1QPPA 4PJIF 1KPRA 4FQJL 2FX7H 1VADA 4OZGF 2D7PA 2BX5A 1PG7X 1TETH 1IGFL 4S1SH 1N5YH 5SX5K 2ILLA 4K9EL 3ZYJA 5GRYA 4RX4A 2D7NA 2I9TA 4CVZA 1S9WA 1LHZA 4QOKB 4WFED 4HS8H 5F7YC 3SJVD 2UYLA 4R3SA 5T1KA 4PJ5D 1XGPB 4H1LH 3O2VH 1CD9B 3QO1A 4NCC1 4GRMB 4JAMA 1JNLL 5A16B 4QOKD 4XP9H 4NHCH 3RA7L 5FHAL 1BZ7B 1UM4H 4OKVB 5DRNB 5F3HB 1IVLA 4KRLB 4WWKA 5D1ZD 2ZUXA 3EJJX 4TSAH 2J5LB 2AEWA 3BT2L 3EDFA 5DDHA 1U8MA 5KSAC 3FQNA 1EFXD 4PREB 2VQUA 1JZ2A 1AC0A 5DJXB 1VEOA 4OZFB 1K8DB 5IB1A 1TQBB 4XAKD 2AQ2A 5I1CH 1JPGA 1CN4A 3BZ4B 1L0XA 2WBJD 2X6MA 1UWGL 1WT5C 4Y4FC 4RDQG 1QHPA 2B1AH 4DEPB 1YEKL 5I18H 1CICC 2DTMH 2GKIA 5JDJA 1ES0B 1YZZA 4FNLH 1HYSD 4QCIB 1ERNA 1K5NB 1QLFB 4DKAA 4M7KL 2XZZA 3DRTB 3BP5A 4U05A 3O2WL 2EKJA 4WFEE 3SJVE 1L7IL 1MCBA 4RWYH 4P46C 4M1DH 1TIUA 4EI5B 2VIRB 3VFNB 3SE4C 1DBKL 3CK0L 4PJGF 3FB8A 2ZCHH 4JHWH 3MRQB 3CFKB 4I9WD 1OP5K 4X7EC 2QSTA 4UNUA 5JO5A 1A7QL 2QR0B 2FBOJ 1Z5LA 5JHLL 4LVNB 5T3XH 2J8OA 2M1KA 2BNRA 3QXTA 4F8QA 4Q6IC 3QUYD 4XP1L 4PUBL 2OYPA 2R2HA 1FNGB 4HQQH 1V8HA 3O45A 5D70H 5DTFB 1G7PB 4O02H 3VWJA 2BNRE 4NJ9L 4XBGA 3INUH 4BQBA 2AJXL 2XT1B 1KGCE 2ZJSH 5I0DA 2A73B 1S5HA 2B20A 1T83A 1IEHA 4TUJB 3V0WH 3BZFB 3NFPB 5FOJA 4DGYL 4L1DA 5B21A 3E0GA 3WNMA 1T1XB 2C4FU 2B1HH 1YEGH 3EFDL 3HC3L 5ID0B 1I8IA 3QFJE 2G2RA 1KCUL 4G42A 1NGPL 3GMNA 1CL7H 2BRRL 4K3HA 1M7IA 1N6QL 4L8DB 4WCYH 3K0WA 1NBQA 3AROA 4UV4L 2DWDA 4OI8A 2HA1A 4LCWB 5IV2B 2Y7QB 4M6AA 3N50A 3O6MH 4QHUB 2EDJA 3MUJA 4GSDL 3DI3B 2UY6A 1RK0B 2X4UB 2DBJA 1CIUA 5TE7H 1Z0NA 3GSVA 4AEIH 3DVFA 2V5MA 5DA4A 3HE6C 3IFNL 1E6JL 4G80A 4IMLB 4RGMB 1KTLB 3HN3A 2UYLB 4R3SB 4XHJC 4F37K 3CH1A 3ESVF 1AH1A 5HI5D 4HLZH 1IGJB 5BRZE 3IDXL 3PWUA 2VDOH 2GYSA 3IFPA 3CD4A 4LEXL 4BZ2H 1KN2L 3NZ8B 1CGTA 1I4FA 2CIIA 3KLAB 1T7ZA 1F3JA 5DA0B 4F3FA 5KVGH 3RI5K 1DBJL 2EDQA 1MJ7L 4N0UE 4MHHG 1LGVA 3C2AL 3QDGB 1LMKA 1N59B 5C0GB 5IHZB 4WO4A 3GMPB 5E03A 3MJ7A 5HGDA 2P5EE 4J8RB 4U6VH 1JNHB 5I9QC 1GJIA 3VJ6A 4GMSH 1A47A 1N64H 1GGBL 5DHXB 4GJTB 3U46A 2R4RH 1IC7H 3BO8B 4JZOB 5EU3B 2NLJB 2VC2H 3BRGC 1OT1A 2VABB 5AZEL 1NAMH 3ULUF 4DUVA 5ILTH 1YDPB 4HUKB 3I75A 1OAUL 3X3FL 4LCYA 3BEWA 4WI3A 2DQJH 1BP3B 2OL3B 1MH5B 1PY9A 1LILA 2XN9A 1WIOA 4PRNA 2XWJA 2EDXA 4YXLL 2HFEB 1M7XA 3P40A 1AD0A 2QHRH 1U8QB 4Y2DD 1CDBA 2HKHL 3QUML 2NY1B 3FO1B 3RDTD 4AQ1B 3MREB 3MFFB 4L8BB 5HHMD 1KJ2A 3QUYC 5C07E 3IFPB 2DQIL 4KKLC 4JPKL 4XPBL 3K8MA 1R3LA 3GIVA 3JTSB 1N2RB 3LH2H 3WL9A 2R0LH 2F53E 1MLBB 1G0XA 5GGVH 5IF0B 2VOTA 2V17L 2QQKL 1NCWH 3T09A 2OSLA 4M43L 5CJBA 4D0BB 1G7JA 3ULVC 4UTAL 1LP9A 3ALWA 1MCNA 1FC2D 3OKDA 1J12A 4XHQA 3D3VB 4KTDH 1W0VA 5CZXD 5DFTA 4X4YA 3IU4L 3G6DH 4L8DA 2CUIA 4U1MA 5DK3A 1CICD 3BKYH 4GW5B 4KKAD 4H1LA 4Z76B 1BECA 5I0ZA 2BJML 3TBSB 4ZQKB 3C09C 1MCQA 3GSNA 5KW9H 3RDTB 3VFGL 5I76B 2VZ1A 1T0MB 4NKDA 4OB5L 4ZSOE 1AD9A 2VDMH 3V5HA 1T21B 1TZHA 2BVYA 4TQEH 3DX7B 3OKNB 5DQ9A 2EIDA 4MZ2A 4MAYA 4ONFH 1S7VB 2WIMA 1AXTH 5HJ3B 1AGFB 5LBSH 3PWUB 2HLFC 2ZSVA 4I48A 1J5OH 3SGDI 4Y16A 5TGBA 4G8GE 5KTEL 5LKNA 1HQRB 3DGCR 3KLAA 4HUVA 1JVKA 2I5YL 4APQD 3LIZL 4QTIL 3BD5A 4HBCL 1A21A 3HUJE 4R97C 2F53A 4X9HA 1OAZH 3NVQA 4L8SC 1KB5A 5EU7C 3QXAB 3D6GA 1WJ3A 4EIZC 3N06B 4QRRB 4NRYB 4FHBD 2L7JA 1RD6A 3WFEH 2CK0L 5T1KB 1Z9LA 3LRSB 2FEEI 3W39B 4RGND 1M71A 1F6AA 3RZCA 2DWEB 4QXGL 3MRJA 5EIQA 1LO2L 3IGAB 4QTHA 3P0GB 1MQKH 4Z7WB 3HCVB 2OX5A 2BSSB 3BO8A 1O0VA 4K71C 2ZP0T 2Q86A 2CKBA 3MYZA 4MAUL 5J06A 1BIIB 5T3ZD 1UWEH 1S7SB 3PHSA 4YE4L 4YEEA 4QHMA 4DVBB 2A1WL 3QNZA 4M6NL 4PJAB 2W0FB 4J2XA 4Y19A 1E4JA 1BREA 1A5FH 5A2FA 5BV7L 2CGRL 3OKKA 3PQYB 4Z7VE 1I3GL 2MPAL 1OSPL 1K8DA 4R0LA 3MMEA 3VFSA 3JWDC 1Y6KR 2R1WB 2VDNL 3VGDA 3O3UN 5JPMA 1I8LA 1KTRL 2CQVA 4LSRH 5A43C 4LRIA 4C57C 1H5BA 3C8KB 4LKCB 4YZFF 2NZ9C 4QHKJ 1FE8H 4L8BA 2PXYB 3HA0A 4G3YL 5CMAA 3UYRH 2G9HB 2BOCB 2NY1C 5EOCL 4PJFA 2GT9B 4HXBH 25C8L 3HS0A 2GJZA 2P5EA 4JM2C 4G8FA 1AGDB 3DUUA 3EOYG 4KKLD 4L9LC 2OZ4H 2VIRA 3JTSA 3G5VA 1ZHNA 4P3WA 3JV4A 2AJZB 4TOYL 4MDIA 2GJ6A 3PIQB 4N0UA 1T1ZB 4XMPH 3U0WH 2BSTB 4UZGA 3ARDB 4NZDA 5DD0L 5TDPB 3QZWA 4U1JA 4X6CF 1YEKH 1MFAH 1HN1A 4HKXA 1E27A 4DCQA 1QQDA 3K3QA 1HYSC 3VRLE 1PSKH 3I02A 2BVPB 3CDFA 1LE5B 2IGFL 2X70A 1KXVC 4F7EB 2XA3A 2W59A 1DL7H 4BA8A 2F5BH 1HHHB 3QIUD 3VI3E 5HPMB 1BFOA 3UPCA 4FQ2H 5E0QA 3TCLB 1G7PA 4PJGB 1QNZL 5EZIL 4PJEF 3MLRH 2CLZB 1KCVL 1GAFH 3HE7A 2HT2D 3CFJB 3OF6A 3BYTA 4LASL 1SEBA 5EU6E 5T3XL 1XAUA 1TCRA 2DLEA 3SKJL 3BMWA 5E6YA 4P2CG 3V6OE 5GJSH 3RWFB 3EO9H 1J0ZA 3G6JF 4ZD3H 2NW3A