6PAZA

Oxidized mutant p80i pseudoazurin from a. faecalis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTIHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
molecule keywords PSEUDOAZURIN
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 6pazA00
4DPAX 2VW7A 1OE1A 3GYRA 3FYIB 1L9QA 2IWKA 2P80A 4DPBX 4HAKA 2WO2B 3ASNB 1BQ5A 1NIBA 1ASOA 8PAZA 2GIMA 3G5WA 1ET5A 3NSFA 2VM3A 2XX0A 2VMJA 1M57B 5AZUA 3CVCA 1J9QA 1W6WA 5D4HA 3T9WA 3PCYA 3CDZA 1J9RA 1PNDA 3CVDA 4E9QA 6PAZA 4A66A 2EINB 3N55A 1GS6X 4BK5C 4BDVB 4DP8X 3RYMA 4N8UA 4A67A 3PAZA 1J5CA 1AACA 2HLEB 2GSMB 1X9RA 3ZDWA 1ADWA 2PPCA 4UANA 2NRDA 2CAKA 4TXVB 1ILSA 1XB6A 1OCOB 3SBRA 5B1AB 5LDUA 4FAAB 2VSMB 1NTDA 2BO0A 4GXFA 1NWPA 3V9EA 4A2GA 4G72B 3CG8A 2PCFA 2YAHA 6PCYA 3FPYA 4KO7A 1N68A 1ILUA 2YXWA 2H47C 1WA1X 2XVBA 3FSZA 3AG3B 4FA7B 3S3BB 2HRHA 4E9YA 1NIEA 3PAVA 3FSWA 2UX7A 2CBPA 1AQ8A 1A4AA 1AAJA 1JZJA 3L45A 1HAWA 4DP0X 1ZIAA 2DWTA 4A2DA 1X9UA 4EF3A 2QDVA 2VSKB 1PF3A 1ET8A 1JXFA 4BXVA 2HX8A 1IBYA 4ENZA 2HX9A 1TU2A 3NYKA 1A3ZA 1SFHA 2BW4A 2X87A 4F2EA 2IDTA 2FWLB 3S3CB 5I26A 4E9SA 2BZ7A 3TASA 1BXVA 4KNSA 4A2FA 1IUZA 3FQ1A 1MZYA 1RKRA 2XXGA 4A68A 4A2HA 4E9TA 2UXFA 2IDQA 1CUOA 4KNUA 5A7EA 1XB8A 4E9RA 4GYBA 4YVNA 2XWZA 1J9SA 2YAEA 4BWUA 2AZUA 3NP4A 4AZUA 1PNCA 1A4BA 1F56A 2GC4C 1V55B 2PP7A 1GY1A 2IDFA 1RCYA 1MG2C 3OMAB 2GI0A 4DP6X 3EH4B 1DYZA 3HB3B 5I6PA 4AKPA 1UATA 3NSDA 1ZPUA 2FTAA 2XX1A 3QJUB 3H56A 4AKOA 4NB7A 4HHGA 1JVOA 1KV7A 2X88A 2BP8B 4GP5B 5I5IA 2YXVA 2FQDA 5B1BB 1BXUA 1GS7A 2XYBA 4GY4A 1JZIA 4QKTA 3IN0A 3FU9A 2GHZA 3T6VA 1BQKA 1JVLA 3QPKA 4E9XA 1EZLA 1WS7A 1AS7A 1URIA 4Q8BA 3SBPA 4YVUA 1SF5A 1OCZB 3MBWB 4PCYA 3FYEB 3H4FA 4YSAA 1XMEB 4YSRA 4W1TA 1AZUA 1PLCA 3UGEA 1SJMA 3FSVA 2B08A 1DZ0A 3KW7A 3NJGA 5B3SB 4NAJA 3NJFA 3NT0A 1J5DA 1E5YA 2UXGA 1W6LA 1NPNA 4HALA 5ANHA 1ZDSA 4DP2X 1T5KA 4GP4B 1KDIA 4KOCA 3TBBA 1NDTA 1ZV2A 4KO5A 3ZBMA 2RACA 4YL4A 1IKOP 1OE2A 2PPDA 1RZPA 4DP5X 3ZX1A 1E67A 4HCGA 1A65A 3ABMB 3FU8A 2BHFA 2AZAA 2W88A 5B7MA 1JXGA 1AOZA 4YSTA 3X2QB 3ABKB 4WTQA 2YAQA 1PZCA 3WNJA 2BP8A 2Y69B 2R7EB 1V10A 1SF3A 3AY2A 4ZK8A 4L0PB 2ZONA 2TSBA 2WSDA 1PAZA 1NPJA 2HXAA 2AFNA 2EILB 2H3XC 2WO3B 2VN3A 4KOBA 3TU6A 3QJQB 4F2FA 3FU7A 3EF4A 3C75A 2BZCA 1KGYE 3JT2A 1JZHA 4YSEA 7PCYA 4K9JA 3UADA 4DPCX 1E5ZA 1ET7A 3FT0A 1SDDB 5F7AA 7PAZA 1NIFA 1MDAA 4AKQA 5I6KA 3ZIYA 2UX6A 3NJNA 1WS8A 1IBZA 4X4KA 4QLWA 2ZXWB 1ZDQA 2XXFA 1CYXA 1L9SA 2FT8A 2PPAA 1OF0A 3AZUA 2HZHA 4DP7X 1SHXA 2OJ1A 2LLNA 1NWOA 3GXUB 1TKWA 2CUAA 2QPDB 1L9OA 1NIAA 2VM4A 5TK4A 3JTBA 5D4IA 3QJRB 2JXMA 3T6XA 4W9ZA 1CURA 1PCSA 1FFTB 3IN2A 1BYPA 2E86A 4GP8B 1ASQA 4JKNA 2UXVA 3WNIA 4HZ1A 3AG2B 1FA4A 1L9PA 1JZGA 2ZWNA 3FU7B 2PPEA 5FC9A 2PPFA 3KW8A 3FQYA 1OCRB 4RH4A 4YSDA 1VLXA 2IH9A 1SHWA 5PCYA 4PAZA 2EIKB 2IWEA 2YAFA 5AFAA 4DP9X 2I7SA 3NJLA 1KCBA 5PAZA 1JERA 1AG6A 1I53A 2DV6A 3UAEA 1PLAA 2JKWA 3ABGA 2QDWA 3EH3B 3FPXA 2J56A 2FQEA 2YAOA 3CDZB 1KBWA 4F7KA 4HCFA 4BDVA 4CSPA 2PCYA 2MTAA 3NP3A 2EIMB 4UF7C 5B1JC 1JOIA 2QT6A 2YAMA 3AW5A 1N70A 3QJTB 3QJVB 1M9WA 1TEFA 1ZIBA 2YQBA 2N0MA 2DWSA 3ASOB 3OM3B 3AG1B 3FS9A 1B3IA 5D4JA 2BP0A 4YSPA 2I85A 3IEAA 3PPSA 3OMIB 2Q9OA 4YSQA 1GY2A 1YLBB 2XLLA 1PMYA 2I7OA 2R7EA 2QPEB 1FWXA 2BP0B 1BYOA 4WKXA 2CJ3A 5IY5B 4KO9A 3MX0B 4BWTA 3U25A 3V9CA 2XU9A 4G71B 1R1CA 4G7QB 1PY0A 2BW5A 1KBVA 1ID2A 2XUWA 3NSYA 2IWFA 5I6OA 1KDJA 3IBOA 2GB2A 1GSKA 3AG4B 3PXLA 2PLTA 3DIVA 2FT7A 2J55A 3TA4D 1QNIA 4HHWA 5I6MA 1AZCA 2DYSB 3TBCA 3WKPA 3NJIA 2GC7C 2J57A 1A4CA 1L9TA 1AANA 1MZZA 4KNTA 4YSSA 3PLYA 2AANA 4BXSV 3BQVA 2W8CA 1J9TA 2VW6A 4DP4X 3GDCA 1BAWA 4G70B 1JZEA 2IH8A 1IC0A 5B7EA 1OOWA 2Q5BA 1V54B 2JFCA 1KYAA 1WAEA 2GBAA 3DKHA 4E9VA 5F7BA 2FJSA 4UAHA 3S3DB 2BWIA 4A2EA 3CVBA 3OMNB 3ERXA 2Y1AA 1AS8A 1SFDA 2IDUA 1PZBA 3CZUB 3BVDB 3IE9A 1ETJA 3UAAA 1CC3A 3X1NA 2PP9A 3WI9A 1KCWA 1ASPA 5B1JA 3H4HA 3OD3A 1GR7A 1QLEB 1GS8A 2XV3A 1HAUA 3NJHA 1W8EA 2VW4A 2HRGA 1AS6A 5I28A 1AZRA 2XV0A 3D12B 3UABA 2TSAA 2IDSA 1A8ZA 2OV0A 1OE3A 3X1EA 2MRYA 1NZRA 2YARA 3QJSB 1BQRA 4M4RB 4DP1X 5B1KA 1NIDA 5AKRA 3WKQA 3OQRA 1AIZA 2IAAC 2H5UA 4Q89A 3HEIB 2B3IA 2A3TA 3DTUB 4AI7A 1E30A 2OCCB 4P5RA 4JHUA 1GYCA 1CYWA 2XV2A 2FNWA 2DY2A 1WA0X 1NINA 1L9RA 3WIAA 2CCWA 2FQGA 3FSAA 3QQXA 3N2JA 3NSCA 2BWDA 4MFHA 1E65A 1SNRA 2FQFA 3S8GB 1AG0A 4NERA 4YSOA 2J5WA 9PCYA 1NICA 1PLBA 3FQ2A 1GW0A 5I6LA 2FT6A 5I5JA 3UACA 5EHFA 1EHKB 4N4YB 5I6NA 5TK2A 1XB3A 1JXDA 2DYRB 1WA2X 2YAPA 5E9NA 4BWWA 3ABLB 1SDDA 3NJKA 3SQRA 5B7FA 3EH5B 1BEXA 1JZFA 1AZNA 3X1FA 3X1GA 1RZQA 2AVFA 2CALA 3EHBB 3X1BA 2HX7A 3PAUA 3WG7B 5I5MA 1OV8A 4JHVA 4YSCA 4G7RB 2EIJB 4E9WA 1OCCB 4M3HA 3NJMA 4HIPA 2ZOOA 1AR1B 4CSZA 3T71A 1QHQA 1M56B 1PZAA 1MG3C 3NJJA 2P80D 4G7SB 1BXAA 2UXTA 3T6ZA 3SBQA 1TEGA 3S8FB 1AZBA 3T6WA 4P5SA 2PP8A 1HFUA 4HCIA 4YSUA 4AX3A 4KO6A
chains in the Genus database with same CATH superfamily
1U3HD 2GI7A 2IQAA 2WQ8A 5CKGA 3TJPA 4RGND 5DD0H 3DVIA 2B0SH 3ZKXC 4QHUB 4DERA 4DPBX 1JRHL 4LPUA 2NYYC 1I3RB 1ZSHA 2CXKA 3TT3L 2QQLH 4CDGC 2P9RA 2W92A 1LEIB 2AK4D 1HNGA 2X4OA 3ASWA 3BC9A 3WD5H 3PWPE 2VM3A 2DQUH 2UY6A 2GAZB 1QA9A 2WGXA 2YPLD 3CSGA 1QLFB 3O45A 2GIYA 3ARED 2A6JB 4NM8L 5SWQB 1I7TB 3AWFA 2ATAA 3IVKB 2KPNA 1BFVH 2XQYK 4OQ1A 4XBGA 2G2NA 1DQKA 1OAYL 5CGBA 2XWBA 3DDGA 3MLUH 3TL5A 5AW1B 2CDFB 4UQ9A 4JO2L 5J12C 3QZMA 2ESVD 5ISZA 5C09A 3S37H 1RI8A 2EABA 5ALCL 2F7PA 1C12A 4JW3A 3N9GL 1VDGA 3COOA 5D1XE 1UB5B 2AEPH 5ESAB 1S7SA 1GZHA 3TO2A 1F58H 3QIBC 2A9BA 3WKMH 4YFLI 3I84A 1YYML 2WC7A 2VZUA 1MAMH 1QX1A 5HD8D 5DHEA 4M6NH 2R83A 4OV5A 5GHWL 2WQVA 2HFEB 3GFUA 2IQ9H 4PJHE 4AY0A 1ETZA 2W0PA 5DRWB 3G6DL 4J3UA 4LOUD 3US9A 5L8LB 4YH6A 1OZTG 1CLZL 1FHGA 4XBEL 1KTCA 1Q9WA 3CU1A 5FYJL 1ZK9A 1IZJA 1D9KA 3RURA 3GMNB 4MA8H 4NENB 3M1BB 3G08B 4A2DA 1IJ9A 2RHEA 3RA7L 2CRMA 4JJ5B 4L1DA 2EUZA 1E8ZA 4PH8A 5JOPE 1G7JA 1JNJA 3LHAA 2X87A 3WHE1 2QHLA 4D7BA 4HUVB 1NCAH 5GJTH 5E2UH 3U9UB 4QMEA 3UBHA 4YHOH 5K5YA 4PYGA 3WL9B 4AH2B 3M17A 3PGDB 3ESUF 4G6JL 3ME0B 4K94L 1UA3A 3VI3F 5KYXA 2IEPA 4LLAA 5I16B 4GQQA 4Y5YB 1QQDA 5BO1L 4DVBA 4JVUA 4RSVA 2BIQA 3FUNA 1Y7VA 4N2IA 3STLA 2YAEA 3FCTB 1BJ1H 3NP4A 4LOUC 4K0OA 2WPGA 3C6LC 1KJ2A 1RCYA 1MG2C 3OC8A 5C0IB 3V5DB 4KFZC 1H6FA 3WFHB 3EH4B 2EVJA 5GPRA 1MFEL 5HVWA 3NCYS 3GNML 1IAIL 4XAWH 4WW2A 4KTYA 4K5PA 2Q1EA 4Y4HB 1ORQA 5CNHA 1IARB 1RLWA 1WVZA 2R1YB 3A3YB 2BP8B 4GP5B 3FO1A 2FQDA 4WDIA 1MNUH 1SXBA 2CNZA 3NVQA 1GS7A 5C3IA 5AAMC 3KWWA 1LO3L 2UUDH 3FU9A 4OLYH 1XGUB 3T6VA 1NCDH 4NC0B 1FO0B 1J0KA 4F91B 3U7AA 1EZLA 3VTAA 1AS7A 2UZYB 4Q8BA 5IOPB 1SF5A 3EBIA 4DOHB 5A3IC 1N0LB 3ZYZA 1JZDC 4YWGH 4KKQA 2W95A 3K3QA 4FLQA 5ICUA 2NZ1A 3FRPB 1I8LC 5I30H 4MMXA 1AKPA 4X0NA 4XVUD 1GOHA 1OB0A 5I1IH 43C9B 5IEHB 2YD8A 1DJXA 4L29A 1Z9PA 1B88A 3GHEH 3QUXB 4HALA 5ANHA 5EBWA 4AVHA 2QVKA 5E03A 5HTSA 5IVZB 3ZR5A 1KDIA 1NDTA 4XODA 1JV5A 1IKOP 1CLOH 2EDQA 2NZ9D 3FTSA 3LKRB 3OKDA 2Y36L 1YEKH 4XPAL 3TBSA 2UV3A 5C0CD 5FK9A 1Z9SA 2NY5L 3FU5A 3EYOB 5DHVH 4TQEH 3TOPA 3NN8B 4XVSL 3N1GC 3OKEB 1JHKH 4JHWH 4GO8A 1KWKA 3H6JA 3OG6B 2XZQH 2ADGA 5KVFH 5D2NA 5C97A 3RUGE 1YPZE 3KPOB 4N90D 1TMQA 4N8PA 4OF0A 3AUWB 3WIFA 5ESQA 5LLIC 3F7QA 5I1HH 3SKOB 4D94A 4Z3GA 2XWCA 4D9RD 4ZMQA 3QUZA 5F71A 1UT9A 3QIUA 4ODUA 3WHXA 3EGDA 5C0BD 1GYWA 2VIRA 4GW5B 5JDSA 1XF2B 2X0VA 3IS1X 5ITBH 2SEBB 4AE0A 1X4ZA 1A9EA 5ESVA 4JFVA 4FQXA 3FTVA 4X0KB 4L1HA 5DF0A 4QRQB 5FO9B 3L9BA 1YNKL 2DKSA 2VLRB 3BMWA 4XPGL 4Q4EA 5I0DA 2GW5A 4WJG3 5BMFL 4L0ZA 1W91A 1GZQB 2R0WL 4YGVA 4TOYH 4OM1H 1NIAA 3JTBA 3DOSA 2NUTB 4NUGL 3RRQA 1HEZB 3IPBA 4N6RA 4PV9A 4BH8B 5J5EA 3OPZH 4NWUH 1ASQA 1OQOA 1WYJA 3OF6D 3ZDZE 4Z78A 4OIIL 5A1AA 4QTIL 1HWHB 3O9WD 1VACA 5DCCA 1P5UC 3NFNA 4JJOA 1U8JA 3SE3C 4AUUA 4RH4A 1XH0A 2IGFH 2J3SA 3VAEA 3AU1A 3C60D 1ZT1A 3MXWH 1A4KA 4HIJA 2CK0H 2J20A 4IBUA 2E6QA 2DQJL 3NJLA 1R3IL 1MUJA 2IG2L 4H26B 5KSAA 2JKWA 1CCZA 2JSFA 3TZVC 1KXHA 2DYPD 2P5WE 5ITBL 1J1OL 2XQBL 4WWOA 4XNZB 1I7ZB 4HIXL 3VTTA 1P4BH 2XOTA 5LG6A 4LSDA 5IG7B 1IX2A 2WQRA 1KTKE 3T65A 4AVIA 5T3XH 2H6PA 3WJMB 2WXPA 3ZDYF 2EAEA 4XCCH 5I30L 1K8IA 4J4PD 2VH5L 1E4HA 1VKXA 4PJEF 4N2KA 1G0XA 4HD9A 2J2ZA 4OCWL 4UIMA 5CGMA 5D4JA 1QPPA 3IEAA 5KYXB 1Q72H 1ZGLP 4YHOL 1ZD6A 2EDXA 4J3OC 1TCRA 5FCUL 1ID5I 2EKSB 1TIUA 2V0AA 3BPLB 2D0FA 1RPUA 3E9UA 1FHNA 2GSGA 5LBSA 2UVEA 2BM3A 2ZKMX 3OLGA 4XP5H 2CKBA 2I7OA 2QHRL 2Y36H 1J8SA 5CGTA 2ITCA 1M7IB 3H8NA 1BQHG 1OGTA 4ISVB 5CJ8A 2Q10A 4RRPM 2H6OA 4NC2B 5F0JB 4G11A 3V7MA 1KENH 4PJCF 4F80A 3CIQA 2ZCKL 2OPCA 4JAMA 5CJQL 2XN9D 2ZOKA 5CWSB 5J13B 3JWOL 2OMXB 5JW4M 5B3NA 5EOCH 3D39A 3PXLA 3BVNA 2BX5A 4WFHE 3BPNB 3VWJC 4GG8A 3RNQB 4LCCC 5F9OH 1YEHL 2Z92B 3S4SA 1RURL 1P5VB 4U4IA 5IM7B 1K6QL 1JNHA 2GC7C 2H2SD 3QSKB 3ZTEA 3DRQB 3LSOB 4I5BA 3HI5L 3VFPA 1VFBB 4TYUA 5I8KL 4AMKH 5KANI 3FOLB 3HI1B 3MNDA 1NCOA 3WJJC 2YMXL 5F3HB 5HI3C 4NQVA 5I1JH 3JVFC 4DP4X 3MRPB 2BHUA 5GRZA 5K1NA 1W80A 3LOWA 3NQIA 3ML8A 3R0NA 5L2KD 5AD0B 3BXNB 4PS4H 1IC0A 4X8XA 2QTVA 5KANG 2NDGA 2GK0B 3KM2A 4KJWC 3NCEB 2ARWA 4QRPB 1H5BA 4G7VH 3MRBB 2CCVA 3FUKA 3GXPA 1SZNA 3K1DA 5DRNA 5FO2A 2GBAA 3KWWB 2YMTA 4DK3A 1OP3H 1BAGA 2QKSA 1O9VA 1OP9A 1T1ZA 1U92A 4N3TA 1TZHA 3O45B 1CLOL 4UV7L 5EWIH 1OM3L 3BVDB 1G0DA 3PABA 4F7PB 4OJYA 4RQQB 4EDXA 4NQEA 4HA1A 2NZ9C 4AJ0A 3D18A 2MPAH 4HJTA 3H9YA 2NSXA 4MD5A 1A2YA 5SX4H 2G9KA 5C6WH 1CTOA 2I25N 3MV8D 2TSAA 3B7UX 1G7QA 5F7KC 3DHUA 4B60A 1R4XA 3ELAT 4IS6A 5IJKC 3ZGHA 3K4AA 3HBGA 4KK6C 5AKRA 3O6LL 4UDUA 3D07A 3Q8AA 1RZKL 4XC3L 5IV2A 5FHBH 4IOSA 2A3TA 3EJYD 4MA8L 5DU7A 2L7JA 4AI7A 1KIQA 3LHPL 4WHTA 1VFOA 5A3ID 3QRGH 3LXAA 4M7JH 4ENEC 2VDOH 5HYFA 4J6RH 1DVFC 1C9SA 4QWWC 5AL0A 2HCZX 2DD8H 1GHFL 2RFXB 4F20A 4PJGF 2OYPA 4PY7A 4TULH 4PJ9B 5AKVA 3UTQA 4OD2A 3W2DH 4AQ1B 2I9LA 1PLBA 1FL6B 2I60L 3DVGA 4RDBA 1ACYH 4OY9A 1EHKB 3RWFB 4WW2B 5BVPH 3ATFA 3ZTNH 4KDTC 4WZ9A 3QIUB 3W9DB 1LE5B 4U1GB 1I31A 5I0YA 3Q2VA 4G6KL 3MV7B 1TQCB 3KYKH 1U3NA 2BOLA 2COQA 3CFEB 3JWOC 4M7KL 2H1PL 3MOBH 4BFJA 4Y5YC 3I6SA 2J71A 3LIZL 5DT1H 2G3MA 2C4XA 3Q5YA 3FB6A 4MS8C 3NCMA 3VH8B 2IANB 4TLSA 4I89A 4HEPA 5CGYC 1QD0A 4UQAA 2OZ4H 1IGYA 3RQ3A 3D69A 1GRWA 2YPKB 3FAWA 1AMYA 4OTXL 4L4TB 3R7QA 3WS6C 3ZQ9A 2EUXA 5GGUA 3FDWA 7TAAA 5DHVA 2VGLM 3QFJE 4AMKL 5L4IA 4HG4K 2N56A 2WBXA 2WYHA 5E5LA 4HOXA 1QHQA 5DEFA 2N3JA 2ZSWA 2PW1B 2BSSA 1WAAF 2J88L 4YPGB 4Q6IC 2IPTH 1KIPA 5IBTH 1UWYA 5AOMA 2FJGB 2X42A 4N2MA 2VW7A 4HIHA 3GYRA 2ENSA 4XMVA 1L9QA 3L1OH 4FQ2L 1GW6A 4WCYL 1E8XA 4LHUG 2IV9A 2NW2B 3CFTA 4JN1H 1O0VA 2F1EA 1MJ8H 8PAZA 1ZLWK 5IKCA 2W91A 5BUPA 2IF7A 1N0XH 4UYPA 1A1NB 4HOZA 4PJFB 2BVQB 3ARXA 4WFFD 5EULV 1G1OA 4IGBB 4YHNB 3DIFB 2YD4A 5D4HA 1KCSH 2CA4A 1RUMH 5BV7B 3CVDA 4FP8H 4R3SA 2ZUUA 2LLLA 3QXUA 5J1AB 1J9CT 3QUZB 4N8UA 4TL5A 1D9KD 1INDL 1SVBA 5FUCE 3PV6B 4CN1A 2DQTL 4H1LA 4UT7H 1OP3K 3DDFA 3NUKA 1X9RA 3GHBH 6TAAA 1EFQA 3RNKA 43CAA 5D7JA 5E1AB 5B1AB 4BZYA 2OZ4L 1MRFH 1P6WA 3H9HB 3BKYH 1NCNA 5IREA 3BT2L 4JFDA 3ARBA 5TDNB 4WW1A 5EU7C 2COVD 3IM1A 9CGTA 4RMSA 3AG3B 4E9YA 5AOZA 3FH5A 3O6LH 3K6NA 2WBJD 4NHUA 4R5VA 3PHQB 3VFOB 2Q76A 5GGVL 2LVEA 3N85L 3HMWH 1ZIAA 2WWMC 5DGRA 5FOBA 3L5WA 5IB1B 1HSBB 5JORA 1F02I 2BDNL 5EOTA 5EEWA 2CR0A 1OGAA 3ZHFA 2HX8A 1XGTB 3U0TA 4ZBJA 4P9HL 4E68A 4ENZA 2L3BA 3NYKA 4EAEA 3O3EA 1G7QB 4LSUL 5SWSA 5F97E 1E42A 4HWBL 2ZKHH 3S36X 1I8KB 1U8JB 2HT3D 3IU3B 1J87A 4KVPA 2R2EB 2Z8VC 3MBEA 2FSEA 4GBXC 5BPPA 3MRBA 3IFLL 1S7TA 4UOJA 1EHNA 3MC0A 1BFVL 3QUYA 1AKJD 2GPZA 1A6UH 2UXFA 3LH9A 4UV4H 3QEQA 2PO6A 1XB8A 5GZNA 5A2JH 4YVNA 3P77B 1ACXA 5F7FA 1GGCL 1RULL 4ADJA 1BQSA 3FCUB 5ES4B 2AZUA 1QKZH 4IDJL 1OPGH 4OLXH 1BAFH 4LLQA 2I5YH 1ZLUH 2Y06H 2ORBH 3FUDA 4Y1TA 4DP6X 5I6XB 2G60H 4W9HC 5HD8C 3K0WA 4IRJB 1DYZA 4W6WB 4F8NA 1SXCA 4NKIL 3BKCH 1UWEL 2XTJB 1XSIA 3MZTA 3PIQB 4LDOB 1HZHL 4MHHG 2G0LA 4NKOA 3WJLA 2EXWD 5BNXD 5BXFA 1BMGA 1GMIA 4I3RL 1IO4C 1CFVH 3SPCA 4JG1L 2Y7SA 1JNNL 5TPWH 2CLRA 2FB4H 4NQDA 4PG2A 2XQ0A 3FUJA 4X8JA 3A67H 4TUUA 5EBGA 5T3XE 2X70B 4JRYE 1KLGA 2VDNB 4GIPD 1OCWH 4GNKB 4UOW0 3L16A 1NMAH 1BVNP 3MBWB 4OFKA 5E2VL 3WIHH 3QHTC 2WLLA 3D18B 4ILDA 1XMEB 1J8HE 1H8SA 5HY9B 2PR9A 3ARUA 4M5YH 4PD4K 1U8IB 2MIZA 3NACH 3MGOB 4NFBA 1CDGA 1WH0A 2I9LB 5L8JB 4FLHA 3F62A 5AW6B 5FYJD 3BRGC 3HN3A 2L7EA 5I0WA 5KYWA 1XF5B 3ZL1A 5E6RB 1I7UA 2DW5A 4ZFGL 2AVGA 5KN5A 3LIUA 3QIBA 2ZCHH 3HG1D 2RACA 3V52H 4P5TA 1UM4L 2XPGB 4QPEA 3VXSE 4AGQA 5I8OL 1RUML 4L1TA 1Z6JT 1VHPA 3BH4A 4B6ZA 2PN5A 3MUGB 2EKSA 1DJHA 1XXFC 3Q1SH 3UG5A 4F1SA 4YSTA 3WN5A 4PRHE 5EBLA 3W0WD 2WCSA 1DQVA 2G5BB 3L4TA 1YEDA 2BVEA 5D5MF 3S35H 1MAJA 1KMGA 3ZE2F 2BS71 3UGUA 1U91A 4X98A 4PJ9A 5IQ7H 3IGAA 1QLEL 2J8UB 4PJFA 3O41B 4FXKC 2R0KL 4QUOA 3TU6A 4HFWA 4AYFA 4KQ3H 3DI3B 4HETA 4KU1A 2A1WL 2HJLB 4YDKH 1EEQA 1LE5A 5EO1A 4PG9A 3UADA 4QI3A 5CWSA 4GRWE 2Q2EB 3PV6A 4N2LA 1SEBB 4HLEA 4KGJA 1I8IA 2UX6A 1OSPL 2F5AH 4HIHB 5IROD 1QABA 4BSWA 1NCAL 1H6EA 3HNSL 2E7MA 1T89A 3HS0C 2X6AA 4YO0B 4OCNC 2CO2A 2C1OA 2Y23A 5ID0A 2HJKA 2FNBA 1H15A 4XXWA 2QPDB 3GZPA 1AYRA 3RA7H 1AY1H 1IE5A 1AR1C 4JRXB 2HKFH 2EUVA 3UAFA 4MAZA 4M4RA 4WW2C 4ZNEE 2P5WD 5D7IB 5MEQB 2UZIL 1I8UA 2ODHA 4BZ1L 4R7LA 2GG1A 1VIWA 5TF0A 3IDJB 4LT7A 5F7EL 5AVTB 1M53A 1CN4A 4Y4KB 2JKLA 3G9AB 5D7JD 3CX2A 4XE5B 4WKZA 5FC9A 2YA2A 5DD3H 1L6PA 2E9IA 4X6DB 4EDXB 2CMRH 2E27H 1BJ8A 4K9EC 4WY7L 1BWMA 2H1XA 1FH5L 2HLAB 4Z8FL 2NXYC 1JFQL 3HUJB 3NIFB 3QNZB 5FYKL 4BE6A 1I3GL 2JV6A 3QJFB 2MOVA 3VI4E 1CIUA 4XCCL 3U7YH 3PDOA 2OXHB 3FPXA 3QEQB 3HS0B 4QJ5B 1UD4A 2HTLD 4XNQA 5CJOH 1A6VH 2FO8A 5H37G 1V27A 5IMKB 4YDLC 1TVBB 4PCSA 4ANVA 5CBEB 4NHCH 4O2CB 4NUMA 2KC0A 1HL5A 5B1JC 1IM3A 2WIMA 2Q6WB 3V4VA 4UNVA 1M1XA 2Y6TE 5I24A 2O5ZH 3KGUA 4Q0XL 5H35B 5F7DB 3EJYC 1ZHNB 5CLZA 4DKFH 4GT0A 1IFHH 4F9PC 5CCGE 1X9LA 3UTTD 1X5GA 1UWGH 3ENEA 3PP4L 3RU8L 4C4UA 3TJHC 3DRTA 1WE5A 3GUTA 5EF3A 4GRLC 2I85A 1E9QA 2K7QA 4KX9A 3KLHD 3N04A 4PGCA 3NRFA 2K70A 4QOKD 1EAOA 3OKKA 4Z0BH 3OLIA 3M1BA 5F0MB 2NSMA 3RLSA 3QULB 5MENE 1QO3B 3QC5X 2CQVA 5GGRY 4ZOBA 5DSCA 1OKEA 4WY7H 3VA6A 5HGGS 1NGQH 4ZMAT 5JHLH 1IQWL 2OMWB 4Z7NF 3LH8A 2OTUB 2YMXH 1QRNE 1R3IH 1X7SA 3GIZL 3TH2T 2AQRA 4MAUH 2HKHL 4KJWD 2OR9H 3AB0B 3ET9F 3IFOA 4QYAA 4ZUSA 4GUPA 2J55A 2QKIC 5JW4N 4MXWH 4OU3A 1UYWL 1AZCA 3F6LA 3UEQA 1MHHB 1ZMYA 1TQBC 1UD2A 3MBWA 5HYJE 2CPUA 3HAEA 2K8QA 4RGNE 3VO0A 2P7TB 1U91B 1PG7W 4X98B 5FDWB 3LEVL 5I9QB 2AEIT 1OAUL 3O0LA 5DJ2B 5CZVL 5HHMB 1GGTA 1YJDH 4Y2NA 5B7EA 3VWKD 1A6ZA 3E6FB 4JG5A 5E70A 2LQRA 2NT1A 3Q3GA 3FUEA 2K6ZA 4HDIB 3CFQA 4JZJB 4R4FH 5AVWB 3UBXB 2A6IB 2NXZC 3L4VA 1J5HA 4M00A 4S1RH 2L7UA 2FRGP 4UTAL 3EYSL 4CU6A 1R17A 3FONA 4Z7OE 3CVBA 3N41B 1XGUA 3MUZ1 1LWJA 3UJIL 1CC3A 2BFGA 2PP9A 1CGYA 4S2SA 4WAFA 3OD3A 4Y9BA 4JQIH 3DJTA 3MSPA 5JPNA 4YBQD 5LXGL 3W5NA 1OWWA 2Y1ZA 4X6CB 3PWLA 3T3MF 3B9KD 4I77L 2LFEA 3CVHA 5EZOL 1OGAB 2NX5B 3E80A 3IRCA 4J3OD 5CJQH 3BGMA 2IDSA 5D1QA 2GUOA 4CMHB 1P4BL 4WI8A 3SGEH 5B1KA 1I8KA 4XR8C 3HEIB 3DOIA 2B3IA 4RWYH 5CUSH 3CV5A 1NSNH 4H88H 2JB5H 1XFPA 4GAYA 1K6QH 1OTUC 3MJ6A 3MRCB 5E00B 3TBSB 1YYMH 5FKPA 5DK2B 5F7MC 4JRYD 1Z3RA 1V8HA 1JWUA 3L4CA 3FTWA 1HHJB 3BPOC 4XH2B 3CUPA 2CH8A 1QFUH 5JZ7D 3NCJH 4LPTA 3MRGA 1WWWX 4PJAE 1A5FL 3CFKB 4N68A 4YSOA 4Z7UF 3CIAA 3C2AL 2APBA 5LDSA 4TLTA 4JFDE 2ITDB 4X2UA 3A47A 1T83C 2W9EL 3UCQA 3K80A 5L2KB 3MLXL 1B90A 2RIKA 5DS8B 5I73C 3LNIA 3IAPA 4JRYB 2CPCA 4BRVA 3NZ8A 1U8HB 5GGTL 4YZFF 1GZPA 4OZGE 4KAQL 1RIUH 3JTTB 3CXHK 3OKDB 2IOMA 5FHAH 5KG9B 2HFEA 4AK2A 2EYSA 2OMYA 1I1FB 4JPVH 5JQ6H 5KJRL 3IVKA 4LOVA 3X1FA 3X1GA 1CFQA 1KC5H 1PX4A 3VFTB 3Q06A 3EHBB 3BZEA 3LPWA 4XI5C 5BMFH 2VZ1A 5A2FA 2JCCB 1D9KB 2NX5D 2KH2B 5FW6A 2P1YA 1FIGH 1MCOL 5I1KH 4NAQA 4H2CA 2WVVB 2JB6A 3UBXI 3MJGX 3KVDD 1U6AH 2A73A 3BDYH 2DQHH 4JY6B 4Z7NB 1PZUB 4UMSA 1PEZA 2DBLH 5HP5A 1RZ7L 1WGOA 2HN7A 3MJ8A 3MV9B 3O6FC 3JXAA 5DC0A 3T1WA 2O5XH 4I2XB 4RISL 5IVXA 5JHDE 1UA6H 3OAUH 3QULA 3W9EB 5I16A 3IKCA 4Y5XA 5AW7B 1T5WB 5T1LD 4F33A 1MJJB 5JW4R 3B5TA 3AY4A 4XCFL 1VB9A 1ND0A 3NFNB 5T1MA 1NIBA 3WYRA 4AQEA 5J11B 1CDHA 3RTLA 1W72L 3KYMA 4LESA 1ET5A 3GKWL 4I18A 3MBED 5F9DC 4KQ0A 3QNFA 4W9DC 4PPTA 1XIWB 1E7VA 4XP6H 5B22A 3ULAB 1MUJB 2HT4D 1TNMA 3WFCL 4P4RA 5FWQA 4JM0A 2ERJC 1P84K 2HH0L 1QWUA 1ZTMA 3OKKB 4MAYA 4N6QA 1WJ3A 2O4EA 4ONOA 3UTSB 3R1GL 3U4KA 4LDEB 3HE6C 4JB9H 3KLLA 4QD2E 3LH2H 3T4AC 2AABL 4N85A 5FDWA 4LSRL 3FUIA 3Q2LA 3HCVA 1QBML 3E0GA 1DVFA 2JIXB 2NW3A 2D4FA 5KSBA 3RVVC 4LQFH 4JLRB 4DCQA 1FFPB 3SDYL 2DBLL 3EJQA 1S8DA 1A22B 1I3UA 1Q4NX 3IDNB 2F53E 3FPYA 5I74C 5D7IE 1ZLUK 1IE4A 1P84J 5LGJA 3ARFC 4OLUH 2LW3A 3H2WA 4OB5L 5DVPA 2BCKA 1DLFH 1EA9C 3GXDA 3LXUX 4QXTB 3BVUA 1JTOA 3IDGB 1ETA1 1OGSA 2HT4C 1JZJA 3IPFA 4OGZA 5CZXD 4GG6B 1WV7T 4DTGH 1TR7A 3GZOA 3V0WH 4GAJH 1G84A 2MEJB 4ODBD 1CU4L 5GXBB 2G5UA 1TDQA 2F7RA 5DHYB 5IT2L 5AG9A 2H0EA 2AXGB 1T4KB 4ZTOH 5F9JB 5DZAA 2NY0B 4HBQA 4WI7A 3G5VB 4ELKA 1JCVA 4QRTB 3H7BA 3QHZL 4M8QB 2LU5A 4G9DA 3JZ7A 3QO1A 2JWYA 3F6IA 4X9IA 1MCRA 4WVRA 3ZXAC 2EUWA 1DJGA 2PXYD 2XFGB 5GGRA 3OGOE 4P99A 1GIGL 3ESNA 3MVSA 3OR6A 3RFZA 3W0WA 2CKBB 2GC4C 4CVZA 4MQ7A 2PCFB 4HIEB 4Y4KC 3D1MC 3CFJA 1M1XB 4YR6B 1IL1A 1B6UA 1S3KL 2C4FT 1DEDA 2IH1B 3MYJB 4MA7L 4V33A 5JA8B 1HXYB 1P6AB 2D7OA 3CLFH 4FZ8H 1RZ8B 2C3WA 4F5CA 4HHAB 4UINH 4P2RE 5C0FB 3KPOA 1N2RB 2V5YA 5DVNA 5D7IF 3L4WA 5GGSA 3ARBD 3QDJA 4ODSL 2OX5B 5IOKA 4AQZA 4ZFOA 1OM9A 1RZJH 3W39A 4LCYA 3GPEA 5IF0B 5DK2A 4DKAA 3SBPA 4LASH 3P3TA 5CINH 1PFCA 5DO8A 2WLKA 3EFDH 1WDAA 3L48A 3EGDB 4MJHA 4QIRA 2VZ3A 4B41A 2L04A 3MUHL 1IM3B 3M8OL 3FN9A 5FA3B 1XSOA 4MD5B 4MRCA 5EUKA 1G6RA 4JRWA 2WXKA 5GRJH 3VXRB 1J5DA 1JJUA 4X0KA 1W6LA 3BHBA 2LGNA 1NOLA 4LSQL 1ZDSA 4DP2X 1MIMH 4MA1C 3ARBC 4AYDC 3V8CA 1N4XL 2X89A 2J72A 1X4YA 5E8DL 3NZ8B 5DI8A 5HVHC 2PPDA 3FC8A 4A39A 3MNZB 1XHHA 3FBKA 2UZPA 3NQKA 4NWUL 3TTYA 4L8CA 3V0VB 4ALAC 1DE4A 5F3BA 3BPLC 5I1CH 4ZW8A 3T2NH 2DQEL 3FQXA 4YC2C 5GRYA 4NEHB 5HHME 5EA0H 1HQRA 2CIKA 2DLFL 1WG3A 5IMOB 1BIIB 1E40A 3MRJA 5HYSA 3KM1A 2OSWA 3P3UA 3WNNA 4C4KT 4F2FA 3NIGB 4OAWA 3WFBH 4BGLA 5BVPL 3VU2A 2BZCA 1KGYE 3BYYA 5JR1L 4KMQA 2ZOTA 4WO4B 3P2TA 3U9PL 1PZSA 1T3FB 4LF3B 2Q86B 3E6HB 2A6IA 5GISH 3KD4A 3LDBB 4HSAC 1E4WL 4M48L 4X7FC 1AGEB 1MFVA 1R34A 5HSFA 3KVPA 3KCPB 5FIEA 3VVWA 3BPNC 3MJWA 4U6XB 3TZVB 1UOWA 5FO7A 4F7PA 1FP5A 1UKQA 4S1QL 4ZUWA 2ADYA 4FNQA 2XN1A 3DGGA 4RBPK 1CYXA 3RWGA 2NY1D 3OKYA 4FG6C 2DB8A 2ED7A 1G6RL 4LVEA 2MQ3A 4OZGF 5TD4A 5HVHB 4I13B 4XCYB 1M7IA 1AQMA 1WFOA 2OXGB 5B38B 1TJMA 5E9DA 2VM4A 2DLGA 5TE6L 5JUEL 2IPKB 2CIIA 1RZFL 4FQIL 3Q6FB 1YJDC 4JR9H 4I3GA 4WI9A 5EUOE 2A6DA 4PM1A 4Z7UE 3NH7L 5AW2B 5CEXA 3OGCB 3HLKA 5GSVA 3RIAF 3IDIB 4BJLA 4JDEB 1CFSB 1VRSA 1SXAA 1UD8A 4NRZA 2YN3A 1JZGA 4FQHA 5CS7A 4NJAL 1HCFX 3REWB 3TV3H 3GRGA 3KYMB 1SHWA 3QVAA 4HV8A 1CICD 1UZ8B 2ICCA 4NQCA 3DUSA 2WVSA 4U6HB 2I7SA 1F90H 4CNIB 4NN5C 2AI0H 5EC1B 2QDWA 4ODXA 2WXLA 3S34H 4M1GL 2A83B 3KG5A 2FEJA 4N22A 1YMHB 1K8DB 3CHPA 1YQVL 5B39G 4C8XA 5L7XH 4DO4A 3OR7B 3PWJB 4RZCB 4ANXA 1PLGL 2AQTA 4P0DA 4F7KA 1P4IH 4PY8J 5KS9B 3Q7JA 1CGVA 5IB3A 3K71A 1HZLA 1T2JA 1XMWA 1NBQA 1J0YA 4LQ1A 1BOGA 3TXAA 2AV1A 5KVGL 1JF5A 3VYNA 4G9FE 1YPZA 2JJVA 2WSPA 3HC3L 2C3XA 1DVQA 4Z76A 4FNLL 3LMJL 4KRLB 4M93C 3FFOA 5AOLA 3BFOA 2N01B 3JT0A 5F7UA 4P3CL 3WXWL 1AXIB 4YX2H 1ECZA 3PV7A 5D1QE 1UXSA 4OZIB 4N2OA 1EZVX 2DQCH 4IRZL 2E9JA 5DEZA 4PJDB 5AOJA 3QEHA 4M02A 1SUHA 1F3JB 4P57A 5JIDA 1NCHA 2QVTA 4XNMA 4DVRH 3JWNH 3P54A 1EDYA 3ZE1E 3JYBA 1JUFB 1Z7JA 4U1GC 3VXMB 5GS1A 4PRDB 4YK4B 3O3AA 3UCRA 5IV2B 5IY5B 3QYCA 1QRNA 4UQ2B 5EOTB 3L5XL 1RUKL 1F6FB 4X42A 1KBVA 1CFQB 4WFEE 3BP4B 1I3GH 3NEOA 5BOZG 4IBZA 3IBOA 4L9LC 1WC7B 1J1XL 1ZS2A 2F53D 4X4YB 1BZ7B 2KLRA 2P5ED 2VABA 1HDMB 3ZPDA 1I7TA 1WWCA 5IF0A 2MCG1 4JFEE 1U93B 3V6FA 3H3KA 1GC1C 1RJLB 2WN2A 4KFMA 2AXJA 3RGVD 4UDUB 1LK3H 1DBML 1NEPA 1L7IH 3PLYA 5F2FA 3PDGA 1DQQB 1ZVYA 4BXSV 1CXKA 5D7JB 4P23B 1W72A 4Y16D 1LJMA 2HWZL 3LCYA 3REVA 4AE1A 4DZBB 5I18L 5E2UL 1V54B 3IU3A 4ZMTA 2YKLH 4PD4J 2AQSA 2X4TA 3WTSA 4BQ8A 1T0NA 4Q9QH 1NBYA 1T6BX 2YXMA 1JZ7A 4EJ1C 4OD2B 1DVXA 3EO9L 3ERXA 3I9AA 3K5SA 4OGXL 4JHAL 1U8OB 4YAQB 4FULA 3HC4L 4F2MA 4HS6B 5B1JA 2N4IA 2CDFA 1IGMH 3HN8A 1A7RH 4PBVC 1H8OA 3QIUC 1J1XH 3T2QA 1IEHA 2XV0A 3IAQA 3DX6B 1I85C 4WU7B 1MW2A 1FLTX 1E6JH 4J7RA 3TYGH 2ODIA 3GBNL 3L3GB 3QJSB 4LL4A 5KYWB 3RDTB 2VXVH 3MNMA 4L9DA 5E7BA 1J86A 1YMMA 3RX9A 3Q6FA 3KPQB 3VI4F 3V4PH 1XVSA 1JK8B 1P7QD 5IWLC 3LZLA 4KRPC 3MXWL 4FTVE 5GGTA 3SZ6A 5DHVB 1DE4B 4YUEH 4J3OH 3VDCA 2GBVA 4QXTA 3PWPB 1J5OH 1U41A 3CD4A 3Q1EA 1KXQA 5DJZB 1TTUA 5ISZE 1G9MH 5CJOL 2XPZA 4JN2A 4YLQT 3HRZC 1AC6A 4FXLA 1QLEH 5GGVY 5IQ7L 5MERB 5EDSA 3J2PA 2VR7A 3CH1A 5HI5C 4ZTPH 1B4JH 4EI6B 3IDXH 3CZSA 3FQ2A 5E2WH 2K4AA 1G1KA 3G9VA 1A1OB 2XG4B 3HAEH 4NYLB 4ZI8A 4Q9QL 4KUCF 1WT5C 2VC2B 7CGTA 2BFVH 1XB3A 4WO4A 3TH3T 2EE9A 3GTVA 4QRSB 1KXTB 3FULA 4ELKB 2W9DL 1ES0A 3CN3A 1UWEH 3D2UB 1INDH 3RWDB 3BAEH 3G6AA 3NRPA 4LKXB 1W0WA 2XA8L 5DD5H 2DTML 3ZHDA 2Z93A 2FBRA 1BFOB 2CALA 3MOAL 3ECBB 3LZFL 4UT9L 3RFZB 1WICA 3K6IA 3KYNB 4KY1H 4N28A 5E6IB 3FB7A 2WUBH 1X6NA 3DYPA 5DD1L 5DRZB 2FO1A 1I75A 4J3OF 4P2YA 1QI5A 4MDRA 3UBXG 3B4NA 4B95C 3ZE0E 3P4NA 4Y4HA 1M2VB 4KK9D 1HKFA 2XJLA 2K9UA 4AMXA 3P30H 5DC2A 1AO7D 2OP4L 3GIVA 4HUUA 3QAZB 1U33A 1WZ1H 3O6FD 5ELIA 1JMXA 4NM4L 3L3OA 4KRNA 5IMLA 3L3DB 4RLDA 1F45A 2VO5A 3WGUB 4JG1H 1H3WM 3MRDB 4JM2A 3ZHKA 2IMNA 4JO3L 5C8JA 1D5MA 1U30A 3BP6B 3VYPA 3GI8L 4BA0A 1DUZA 4HWEL 4Z7WB 3M7OA 5D71H 2XZAL 4EUPG 1JPSH 5D6DA 1JL8A 4ZO6A 2AQ1A 1L7TL 1BIIA 3VFUB 1JHTA 3B2VL 4ODWB 3B5GA 2OAAA 3BVVA 2CBQA 4PJEB 4L0YA 4QJ3B 5EIVA 3KNBB 2JKIS 1AYOA 4QEGA 4GBXB 2CRIA 4F7EB 4QRRE 4BDVB 1FFNB 1UEYA 4ZX3A 2PTTA 1L5GB 2CHDA 1X6LA 4X6FB 3SCMB 1J5CA 1VGEL 1RFDH 3P4LA 1XZWA 4KZDH 3OL2A 1NEZG 1T7YA 1SJEB 2CAKA 2Y7QB 3BESR 2IFGA 5E23A 4OFYD 1J18A 1FNSL 1NWPA 2EIZA 3O6ML 1WK0A 2HJKB 4AC2A 4G72B 3DVNA 4KI5E 1ZS8A 4Y5VA 5AZEH 4AGOA 1G5GA 1NMBL 3KXFD 3KPSE 4KO7A 2DBJA 3DK0A 4QWWD 2KHAA 4OLWL 4XMTA 4FI7A 1E9OB 3FSWA 2H8PB 5AVUB 5D7IA 1KB5B 3PL6C 4N20A 1PSKL 4Y1SA 5DR5L 1D6VH 1SYVA 4F57L 2KPWA 2XFXB 3WEXB 4E41E 4PRDA 4AZ8A 3N40P 3RVTD 1JD9A 3POHA 2Y5TA 1KB9J 2WOBA 5EOQH 1DBKH 1ET8A 2N59A 4K2UL 4K3GA 4OSUL 4QCIB 2MPVA 4P23C 1AKJA 3FQTA 1DN0B 1ZHNA 3IJEB 5ANME 3SDDA 5CCKH 4G5ZH 3B9KC 3IJ9A 3AU1B 5HPOA 1E90A 3C5JA 3B37A 3S98A 3V4VL 1RU9L 4F8OA 4BSJA 1BGXH 1HQ4B 3LVTA 2XVGA 3DUSB 1WPCA 2ZUQC 3D2TA 1AQKL 3CLFL 4I9WE 4XTRC 5FX3A 3WGVB 1HE8A 2AHIA 4W9CC 5E51A 5C2BH 4PRPB 1EHLH 1YEEH 2Q20A 3FOMB 5BVJA 3GMRB 3VCLB 5IMKA 2R0LL 4L23A 1J9SA 2Y22A 2IC2A 4S1SH 1QR1B 1D3CA 3G5XA 1WAPA 1DQDL 1S7UA 5DRXB 3WY2A 4OCRH 3O4LD 5TQ0H 4TQHA 5AB2A 4DN3H 2DMHA 4G8GB 4JFEB 4JHBA 3DO7B 3IT8D 3HB3B 1UATA 1BWWA 4WU7A 1QEWB 1QSEB 2H1PH 1NL0L 1QQDB 3W0WE 3QO0B 5F7DA 4DSYA 3I50L 4RISH 1T7ZA 4NIKB 4TVUA 3B7YA 3RL1B 2OTWA 3D3VB 4NCDA 1C08A 3SO3C 3T3PB 2X6UA 4FG0A 2ZG1A 3TCXA 3BZFB 5B1BB 4PJIB 2VDKB 1H15B 5ILTL 3H1ZA 1CO1A 3O41A 4OCSL 2W9LA 1FZOB 4QAWA 4NZRH 2K9FB 1BD2E 5DJAA 1XD0A 5DJ0A 5EC1A 5F1NA 5C0AD 1WS7A 4L3EB 3S9DB 3WNPA 1DL7H 1A64A 4U6TA 5GRWA 3A6BH 4MYWB 3ZK0A 1EDHA 4KRPD 2E5EA 3MTRA 2BC4B 2AXWA 3CN0A 1HYSC 2D31A 2J6EH 1DZ0A 1C5CH 4J23A 1EHLL 4GAGL 2CGRH 4JFQB 3RP1A 3MKGA 1Z9NA 5M95B 1SPDA 2AV7A 4KK8D 2EO9A 1CK0H 3CGTA 2W9EH 3K72A 4HUUB 1W72H 4U1IB 3QNZA 1WP6A 4PJ5B 3EYQC 4DGVL 1OT2A 4A6YB 3I50H 2VABB 2P5WA 3N43F 3VX0A 1ZCRA 2K4WA 4XB7A 1FFRA 5H2BA 1EJ6A 4X6CF 1WZAA 4AK1A 3ULVL 3EUDA 3JV4B 3UJTH 1T1YB 4FLRA 1SF3A 5E1HB 4OT1H 3PY9A 4YOKA 3U82B 2TSBA 4D0BA 2NX5A 3D3VD 4HAGA 1F2XK 1NC2D 4YHYC 1M2VA 5FW7A 5I1KL 3ZSSA 3OKEA 2Y3NA 3RZCB 2VJ8A 3GSQA 4MS8D 2NXYB 4PJFE 5DEGB 3WSQL 3QXAA 1CE1H 2ITEA 3M86A 2HLAA 4YSEA 3CBRA 4YZFE 1ES0B 2EDLA 2PTTB 1L5GA 1T1WA 3MRKA 3HE7D 2HT3C 2LFGA 2Y07L 4L3AA 5EZIH 3ZIYA 1CGWA 4E42A 1J1OH 3HFML 4UWQB 1PDKA 5JQ6L 3GK8H 3O6KL 3S5ZA 1U8OA 5CD3A 2DIEA 4XOAA 1XDTT 3HZYB 2OJ1A 4G8IA 4NS0A 3QQDB 3FOLA 4JZOA 4Y8AA 3AVEA 1XXDC 3SYCA 3TN0C 3U1QA 5F1IA 3X14B 2XHNA 5AZ2H 2MKWA 4NQDD 4EKJA 4MZ2A 4J3BA 1JE6A 1GL4B 1S7QA 1BFSA 3JZYA 1PIGA 1P69B 3D6GA 4O2EB 1IC5H 4W9ZA 5D7JC 2FEEL 2R9HD 5DUPL 5BV7C 2ZSVB 5JDJA 2RH0A 3DV4B 4PRPD 3GMPB 3WEXA 4MXQD 1RUPL 2VQTA 3VM7A 4B9JA 3CHOA 5F1KC 1ZXKA 3KBFA 3UTSD 2R4SH 1CT8A 1I1YB 3R19A 4N0UB 1PG7X 3OXRA 5C09D 4G7VL 3U2IA 1I3VA 4LPXA 4MQXD 4YDNA 3SPJA 1OCRB 4XB3A 3B6SA 3VXPB 1ZS8B 5D1QD 3BGAA 5PCYA 3OXSB 4EIGB 5LCVH 5KTEH 4L8DB 4OLZH 5PAZA 1NFDA 4FKHA 3S97C 3C9NA 4IBSA 2HKHH 3ZRFC 5BZDB 4JVWA 3AT0A 1Y6NR 1UWFA 2YQ3A 1VAHA 2DMBA 2EQDA 4LDCA 2J6EL 4UUJB 5C6TH 4CMMB 1ACCA 1FFNA 1OPOA 3U30B 2WLMA 3HBZA 4U1LA 5HHXL 3MRRB 1VKXB 1IMHC 3NP3A 2ICEC 3BVWA 3F00A 4B3VA 4EBQH 3KJ4C 4OJDH 3QT2A 1N70A 4GW1B 3ZKMC 1N5AA 1JAEA 5DJ8A 5EOQL 1T4WA 3HAEG 1TQBB 3HCVB 3MLXH 1Q0YH 5T3ZD 3JWNC 2VRAA 2PCPA 3DMMB 4DGVH 4ZZFA 3W37A 3VWKC 1FORL 4KZEL 2XG5A 4JANA 3NIDE 4EQ3A 2O6DA 1L0XA 5T33H 4X6CA 5D2LA 3UTQB 1D5ZA 3LS4L 3IAGC 4YDMA 2A38A 1YLBB 5JMRA 5I19H 1PMYA 4QRRD 4M1DL 2P49B 4KWUA 1DQDH 2BC4A 2VDRL 4C56D 1MQ8A 3HRZA 4Z7NE 5I15H 3U25A 4ZOCA 4NZUH 1WFTA 4NI6A 1R1CA 4P2OC 2V7NA 1BVLB 3MACH 4GKOA 4NXKA 1DBMH 3UYRL 1CMOA 2OZ4A 1WFIA 2A9NH 2XYCA 3EG9A 3NK3A 4IHBA 3KYNA 2DN7A 3RTQD 5B8CC 2FECI 1RD6A 2CNYA 5FAAA 1BZ9A 1PX8A 1CICA 5L88L 1XH3A 3MRFA 1UCTA 2RGSA 3CMOL 4IBLT 1EGJL 4PJ8A 3FFDA 5IFAL 2YSSA 1YEIH 2KLSA 5EBMB 3IF1A 5DMYA 3TBCA 4HGKC 4NLHA 3J27A 1AJ7H 2NNAA 1YSOA 2BNRA 1JZ5A 2NY3B 3GUFA 1QSFB 3QH3B 3CMGA 3EJZD 2QLYA 4JFEA 3FQUA 4F7MA 2DQHL 4AT6B 3WDHA 4HJEA 2OMZB 4HPYL 4NP4H 4I4WB 5KSBB 2R4RH 2EYSB 3U0PA 3DHMA 4JX0A 3PE9A 5E1GA 3CHRA 2V9RA 1AMXA 3FQRB 5B38G 1H8NA 2OMVA 2QQKL 3WE1A 5G4NA 1DBBL 5D7KE 1KYAA 1LK2B 1HHIB 2HKFL 2FJSA 3EYUH 3HE7C 4EZJA 1LO0L 5B1CA 1SFDA 3TGXA 3ZTJG 4N0YH 1UGNA 2IWGA 3WS3A 5T5NG 1XR8B 4KHXL 2GHWB 4GBXA 2VDMH 4M62L 3WI9A 3MLVL 1JD7A 1O7DC 4I0PA 5C07A 1H5BB 5EOCJ 1TVDA 4AYBA 3BKML 1VEMA 1MJUH 1QLEB 3MRQB 3QUYC 2APVA 1IEBB 3BZ4B 5E5UB 2GJ6D 2Y5TB 1AZRA 3HVDA 3QRBA 1DANT 4YR6A 4QGTA 5I1GH 2V7HB 2ZKWA 4OJFL 5F9AC 3IKCB 4Y5XB 3X1EA 1KF9B 1BQRA 4QF1A 1OWRM 3IGLA 1NH6A 2ADJA 4IOFD 3P0YL 3VFWA 2A74A 5KBKA 4OTXH 5E2WL 4ZUUB 3SJVA 1RXLA 1MVUB 4RESB 5T8IA 3TEZA 1E30A 3H42L 4JFSA 4N2FA 5ERWA 2ENYA 2P8PB 3LTVA 3HMXA 2FNWA 2PABA 4PRPA 2WBJB 1FJ1A 2XQBH 5CN2A 3BN9D 2PWFA 4WGVB 3B6SB 2X2UA 1RUQH 3GK8L 5FUZH 3UTSA 1GZHC 3F2LA 2IPTL 5IBTL 4PP2A 4WEUD 1SY6L 4M7ZC 3DO7A 3LZOA 4D0CA 1NC4A 3W9EA 1U95A 1EJFA 5FYLE 1CLYL 3HG4A 3P11H 2Z7ZA 1GW0A 1V7ML 3IMVA 1WLHA 4FX5A 4GS7C 5EHFA 3FQTB 5AL8A 2YBRA 1PD1A 2IDCA 1S5IL 4GT7A 4XAKE 4DCQB 4B9PA 2DQIL 4WUKL 3VGBA 1SJHA 1UOVA 4BWWA 4XMWA 1W8OA 4LF3A 4GKZB 3TVMA 4DGUA 1ESOA 1RPQA 2G2RB 1QLRB 1QBLL 2WXGA 4P5MA 1FVEA 3MRIB 3GO1L 3V0JA 2IFFH 1WIUA 3I75B 1NFAA 3PWVB 4D8PB 5CMAB 4M8RA 4QXUH 4DW2L 2ENJA 1RLBA 4Y8DC 1BPLB 4J6IA 5CP7B 4FZEL 4WWID 2W60B 3QDMB 3VJ6A 4ZMOA 1F8TL 3PAUA 1HQRB 3SKJL 4L9LB 1CDUA 4MNQA 4B53A 4AIOA 5M7QA 3C6LB 2CJUH 4MJ5A 2XBTA 3IETA 5IFHL 4R84A 3MLTB 4HKJB 1FG2A 3G04A 2YGVA 2NW2A 4PB0L 2CJTA 5LBGA 1F90L 4Z7VA 5H8DA 4EVNB 5IHZB 1DDHA 3GXMA 4YDLB 2YPKA 5DI8B 4YSUA 4AX3A 3T0VA 3LXCA 2AEQL 1I1YA 3DSFL 4IBVA 1CLYH 2DWDB 1IILE 4RETB 2DWEA 1NBVL 4IEFB 4JO2H 2V33A 1UG9A 4I0PC 2H2SC 4MNQD 2IGLA 4AITA 3G5WA 3TFBA 1CYGA 2HG0A 1RZ7H 4NN6B 5D2LB 4OKDA 2DJSA 3BKMH 3VRIB 1HHKA 5K69A 1NFKA 4PRNA 5D9SA 2HJLA 4N2AA 4JKMA 3ZL4H 4A66A 1FF5A 3FU6A 4ELDA 4FD0A 4G9DB 3MXVL 5GZOC 5KW9H 3RAJH 5F88A 5BS0D 1SXSA 3DJ9A 2P5WB 1DTUA 1PPIA 2ZOWA 4NRZB 3UP1A 2VSMB 4EN3A 3KLAA 3WN5B 1PZDA 1HKLL 3OB0K 4K3JH 5AB1A 2QLVB 4BUQA 3JWDL 3NTCH 4CUCA 1UWGL 2PCFA 2O72A 2YAHA 5EC2B 4W9KC 1G7HB 1CDCA 1DFBL 2XVBA 2EDBA 1GGIL 5IMMA 2DQCL 1E3XA 3FFCE 4GRLD 3CHXA 4OZIA 4KKAC 1M7DA 4UM8A 1NIEA 5J6GB 3PAVA 5CCKL 2UX7A 3NIDB 3UG4A 4J4PC 3TT1H 5BRZE 3QXAB 1FUNA 4M6OL 1RVFL 1IC7H 2CGYA 1A21A 5FYKD 3ARDD 2FIRT 2H26B 5E2VH 2XN9A 1A6WL 3HI5H 4G59C 4OLYL 2W65A 1JYNA 5KSVB 2BW4A 1QI3A 1DO5A 4HXBL 3II3A 3OKMA 1CE6A 4NJ9L 4HV8B 4FQ1L 1UCBH 4NQCB 4P9HC 3TWYA 4AG4L 1KTRL 1NA8A 1CXHA 4R7DB 3WFDH 2FJUB 5D70L 4FNSA 1IAIH 5T1JA 3ZE1F 5JPNC 3FTGA 2IDQA 1C12B 1J8RA 3PGFH 5IVOA 1MWAA 3ESPA 2R8SH 2F8XC 3SE4C 1CIDA 1K4CB 5I17A 5HDBF 4BCYA 2Y3AA 2D4DA 3C60C 3ARDA 1OLZA 4G2AA 2G3ZA 4HPOH 2YD7A 4ZTOL 1S7RB 4HU8A 2AK1H 2YOCA 3W11C 5I8EB 1CVRA 5E8NA 3VD1A 3QUYB 2C8NA 2CJSA 2PXYC 2FTAA 1U95B 2VDQH 3WKML 3UPRB 4MA3B 5EN2B 3NG5A 4XHQA 1BM3L 1NLBL 5C9JA 2YEVB 1EUTA 1BEYH 1U58A 4CW1A 4TS6A 2A1WH 35C8H 2CLVA 3A6OA 5DS2A 1R19A 5HY9A 1VGKB 4WGKA 3U46A 4Z5RA 4U7MA 4MDJB 1E9QB 1JG9A 4R26L 1R24A 2XJKA 3QPKA 2OXHA 3F7LA 2XPYA 1F41A 4RDQF 4YQXL 1OTUD 3BAWA 2X2YA 5AW5B 3TIEA 3X3GL 3STZB 3GEWB 4F7CA 4AM0A 4GW5A 4NGHL 1Y6MR 4MVBC 1JV2B 4WCYH 1XF4B 4Z23A 4YDVB 3ME0A 1WZ1L 1ETZB 2AJ3A 2CUHA 3ARGB 4MJ5B 2ZYRA 1W16A 5AKSA 2GEQA 3ZUNC 4DT2A 3BN9C 1INQA 2RB8A 1SGKA 2O6FA 2ZPKH 5GS0C 4K94H 1P4LB 2A74B 3TYFB 2DMGA 1AD9B 5DURB 4BK4A 3NFPA 5FEBA 1OE2A 2JJWA 2VITB 3ROOB 2LLGA 5L0QC 1PVHA 3HZVB 5DQ9B 1A65A 1D2PA 1RHHA 1II4E 3G5ZA 4GUPB 4F8PA 2PNDA 4F37K 1ECYA 4R0LC 1EHAA 2FX9H 2BSRB 3AQYA 4HUVA 1KBGL 5JXAL 1HL4A 1OAYH 5FF6B 4HC1L 4FL4C 4IM8A 1AIFA 1CFTA 4L0PB 4QT5B 4NUJB 2ZONA 1MFAH 2D03L 4LSRH 2P7TA 5ITFA 2NYKA 4PVMA 5JO5A 1IVTA 2XNAA 3O2WH 2EILB 4G6MH 1XGPA 4WNSA 4B7IA 1SLUA 2X6CA 3VFMB 4ZMWA 1C1EL 3HS9A 2DI8A 1NAKH 4XVOA 4YDIH 1JS4A 1MQKH 2C1PA 3L3HB 1ZT1B 3WFEH 1J5IA 4FQQA 4MMXB 4U6HA 2K45A 4K8RD 3GM8A 3QEGH 2PR4L 1BF2A 5EORL 3QNYB 1A7NL 2XA3A 3GBDA 1RU9H 3WUZA 4LRIA 1F3JA 2Z65C 2ZZUT 3N85H 2XXMB 4U6YA 3VJ6B 3ECBA 5LUMA 1NCUA 5DHDA 1LO2L 2LLNA 4NBZB 1NWOA 1MFDH 3QNXA 5EC2A 4BYHA 1LEGA 1MCPL 1S2EA 1LDPH 3A4EA 3MKKA 3G6JA 1S9KC 2CR3A 4DUWA 1P1ZA 1G9EA 1PCSA 4EPSA 2WOYA 3S37X 1OW0A 2H3KA 3MROA 4B9IA 3SOBH 1OK8A 4LP8A 2R23B 3GTNA 1QAWA 2BMKB 5HYSG 2GKIA 5FKAB 4A55A 3RIFF 4MLSA 3VI3B 3HB3C 3EW3B 1L0YA 3GHBL 4TN9A 3VXOA 1JZ6A 3T8XB 1FCGA 3MR9A 4LGSB 1VLXA 1QSFD 1NCDL 5HPMB 4Y2DC 5I5RA 1YNTA 1DUZB 1FE8L 2Q7AA 4WSJA 2JKRM 5I74B 4R7DA 1AR2A 2AQQA 1KCBA 1JERA 4DFHA 4Q9CA 3N06B 4LP5A 2ZX8A 3MCG1 1LO4H 3ES6A 3F01A 4FQXB 2WK2A 5HI5D 2FQEA 4OD3L 1P1VA 5DMIH 2WXOA 2BRRH 2GK0A 1ED3A 2R69L 4TVPD 5EORH 3UDWA 5KSUB 2MTAA 4N24A 1XBRA 5ADPH 2P5PA 3D2UA 3O2VH 2V3FA 3HW7A 2YD3A 1L7IL 3DGDA 4FQCL 3QJVB 4BKLB 4WI2A 2J4WL 2QHRH 2R56H 4PJFF 1QBBA 2CO7B 2I60H 4W9FC 3HN5A 5F7YC 4E5XG 2A0LC 2P4AB 3S3PA 5T1KB 1NEUA 1U8MB 3EDDA 3INOA 5FGRA 1IC5L 3BAYA 3VFUA 5KAQG 2ILLA 4PJAF 2LVCA 3HNTL 3WFDL 4L4VE 1MWAB 5IB5B 1C5DA 2Q9OA 4P2RB 5BZWA 4IS6B 4KTDL 4N2CA 3RPKA 4X6CE 5CCHE 2X4TB 5AYQA 3I85A 2D0GA 1TFPA 4ICWA 3DROA 3MFFB 4AENB 1U92B 3VG9C 3VD3A 1OIOA 4PRID 1J0ZA 4LSVL 4A7VA 2CHZA 1I1FA 1MSPA 1PW3A 4K07A 5DQDL 1FBIH 5DZPA 3TWCL 3BFQG 2YD6A 3WOVA 3CQFA 4N8VG 4D3CH 4KHTH 1RIUL 4OJEH 2YPLB 4DQOH 2YJQA 2D03H 1G43A 5HHNA 4M43L 1XAKA 1GSKA 2WKOA 3ARZA 4JFFE 1Q0EA 4DUXA 5IBUB 2GJ6A 4RGMB 2XTJD 1AQKH 3UC0L 5AENA 5FDYA 3BLBA 2BY2A 4HHWA 4Y19E 2NUPA 2DL9A 3C12A 4FQ2H 2EDJA 4F7EA 4N1HB 4GBXD 5J8OA 3WKPA 1FH2A 2UYLB 3VD2A 3KPQA 2L4OA 1T04A 5HHOB 4KNTA 4LGPB 1CFNB 4YSSA 4PJEE 4UQBA 3A6BL 2OYMA 2O5YH 2VLKD 4Z7OF 3DJSA 3L6FB 3P69A 4E5XA 4YLBA 5F8RC 5I76B 1AKJB 3P3RA 2X4NB 2XKSA 4G80A 5DQJB 2A9MH 4TUOA 5HDBE 1H3PH 2Q5BA 3Q2WA 3TX4A 5BV7H 4ZS6C 1BZ8A 2BLFA 1P0SE 1Z5LB 2VKXA 3NIGE 4QRUB 4LMQI 3T1FB 4UAHA 1R24B 1XL4A 2CUIA 1IAOB 3S3DB 3UTZA 1A7PL 2FEDD 4NQEE 2P8MA 4NQXB 5SWZD 2H8PA 2K3TA 2CK0L 3QFGA 3QQNA 2WMPA 4LLDA 3NZUA 4J3OG 4LSSH 3TIEB 3DETD 5JHDA 3FT3A 5TF1L 5MEPB 2YQGA 2YZ8A 3ARWA 4ZZKA 4YHPA 1PCXA 1AFVH 3CFEA 4BHUA 4H8PA 3D12B 3OZLA 3APFA 4NNPH 3B7TA 5D7LD 1IBHA 4N8CH 2CHXA 4XAKD 4I2XE 1S7VA 4MJID 2MSPA 5DZOA 1YCSA 2WLZA 3K8MA 4G6FB 5FA4A 4FQJH 4LQFL 5I2IB 3ZIMA 1NC2B 3RI5K 4IGBA 4YHNA 2KYIA 5CZVH 4JHUA 5ICZB 2KZWA 2Z7WA 4MMZA 2ZNWA 1S7WB 3CC5A 3GXFA 1TFHA 4XP1L 4B5ZA 1U8QB 1KJVB 2XZQL 1NEZB 3HZ3A 1WZMA 1XL6A 4ZAKA 3BQUB 1B6DA 2WZPA 2VDLB 4JL2A 1JFHA 2FHBA 4DGWC 3TCLA 4B50A 1AO7B 4MNGB 4Z18A 1AHWB 4M9OA 1D6VL 4GAYB 1LO2H 4U1JB 4TQ8A 9PCYA 2A99A 1KNOB 4GEIA 3BUDA 4IKLA 4GQ9H 1T7XA 3D33A 3RX7A 4YXHH 5DHYA 2DJUA 3SKNA 3GT6A 3BKJL 5I6NA 1GJUA 2HUHA 4GEJA 3OKMB 2X1WL 3QI9D 1U58B 4CW1B 2YAPA 4OFIA 4JPKH 1HZKA 1VGKA 1LWHA 4PB0H 3VD7A 4PJDF 3RIKA 4ZT1A 1AZNA 3C60B 4NKQB 4R0LB 3SZKC 4MNQE 1ZLSL 4OLEA 4XNXH 3Q13A 3RUGF 2IVFC 1OV8A 2V2XB 4IRJC 4G7RB 4X8CA 4D2NA 1K5NA 1TPXC 1HSBA 1I85A 3QS2A 3IRZA 2JELL 1AXSB 3DVFA 3JUZA 2NYYD 3AGWA 3LZPA 5DUPH 3S3SA 4FFYL 2DMKA 4WNQB 3TFKC 5DMGD 2VNCA 3IFPA 2MWCA 4RWHA 2H32B 3B2PA 3QDGD 4OF7A 1E5UI 2V2TB 2VR5A 3UYPB 3RWEB 4ZFOB 1KIUB 4HIXH 4WI6A 3P77A 5IHHA 3NEEA 5BOJA 1NUGA 1S7XA 4KUZH 4PJ5E 1WBXB 4WFHD 4Y4FC 3G5XB 4UILH 1DVFD 2E7CA 3MMEB 5GRUH 3AUVA 3NSFA 3ZE0F 1PS3A 1FVCB 3ZDYB 2F61A 4QHKJ 4XP9H 3JBG7 4NOBA 5EF1A 1QEWA 4I48B 4OCWH 2NR6D 2R29A 2HPOA 1BQHA 1MFBL 4XP4L 4E9QA 3VFMA 3RY6A 2PKDA 1KYUA 3LY6A 3NESA 2WYTA 5JHAA 4JO1L 1HN1A 1E2VA 4CN6A 4UANA 5KJ7E 3UJIH 2M2DA 3BX7C 4PWFA 3TEXA 4GRWF 4KROD 3KCWA 1HOEA 4PRIA 3EXLA 1G9HA 2JH2A 1IGML 2XWBB 2J1WA 3RWIB 3VFVA 4HAFA 3QBTB 4NO0D 4UQEA 5C0CB 4ACPA 4MJIB 4QYOA 3QZNA 5DJDA 4HKZB 2RMNA 3OKLA 1P4UA 2VAAA 3FSZA 1E43A 5FUZL 2HT2D 2JXMB 2ZUSA 5HGHB 12E8H 2HRHA 4HPHA 1CDYA 2D7TH 2WXMA 2IAMD 2YLHA 5D5ME 3V4LA 4CU7A 4FMFA 4F7TA 3WMQA 3VI3E 1F3DH 3L45A 5LN8A 1PZ5A 3HKFA 4H0GA 5EO0A 5A6MA 1F4XL 1SBSL 5DFVC 2DWTA 1X9UA 4AV5A 4HBCH 1QUNB 3BSGA 5EMYA 1OSYA 1FNHA 4AUJA 3LKPA 4TNFA 3CBKB 3DGGB 4LPCA 1RZIA 3I6GB 2PW1A 4GW4B 4LHQB 1MCWM 1S7VB 1NMAL 2ZWSA 5EG6C 1L4IA 4I0CC 3RIFK 4GG6A 3RKDC 1NDMA 3CSPA 3SKUD 2KZKA 4LLVB 4KH2A 4P4KB 4E9TA 5JOEA 2VZVA 3LRSA 1YZZA 1IL1B 3MYJA 4GXUN 1Y1DA 4PFEA 4X7TB 3TS8A 3MLRL 3BAIA 3VGDA 2O26U 1ORQB 3MCLH 1YMHA 4A6YL 1ZPLA 1JI1A 3B8SA 1BQLH 2HVKA 3SGKC 1EFXD 3LZNA 4W4NA 3LN5B 1NGWB 3GJFB 2X4UB 4TRPL 3QDJB 3GSNH 4AKPA 1UUNA 3NSDA 5GSRB 4LCUB 4ZFZA 5DLMH 1XIWC 4JO8A 2BP3A 3GO1H 4NB7A 4ZYKA 4UAOB 5E6UB 2HKAA 4BFEA 1A8JH 3EFOA 5EU4A 1RY7B 1E3FA 3S36H 1SDAB 3CFDB 4ZSOE 1BXUA 1JZIA 1RERA 3T09A 3DTDA 4PU2A 3UZEA 5GS0L 4U6VH 2D7MA 1J8HA 1A7BA 2CJUL 2APFA 3RZCC 3SDXA 4N0YL 4XPFH 4HYTB 3GMPA 1QBAA 1WBZB 3FN0H 1T1WB 3BWUF 1KGXA 5L9DH 3DROB 3ZLQC 3WE6A 3KW7A 4QRBA 1UACL 5J3HC 2E8YA 1N5YL 2UXGA 3ARFB 4AGLA 2VC2L 5FK9B 1N6UA 1FV1B 1NPNA 4JCLA 5TGBA 5LXVA 3SDAB 3NFSL 1H19A 3Q6GL 2G2PA 4PJHA 1G7IA 1RK1A 5F21B 2VDRH 3P1VA 3ZE0B 4GRLB 3ZT5A 5JW5B 4PRHA 3NIDF 4TNEA 4DNLA 5HHOE 1HOCB 1ICTA 3HZMA 1TO4A 4OQTH 5DFWH 5F44A 1S7QB 3RWEA 3UC2A 1X5KA 4Y9FA 1E0OB 1RZFH 2ORBL 3C8HA 2QTEA 4IMLB 1NDGA 4W9EC 3MNVB 2KL6A 4ODUB 1RUQL 3IMWA 2WP3T 4L4JA 5EH1A 1V10A 5GRVL 3LKRA 2R27A 4N5EC 3BWAA 2HRPL 5KVEL 4OBRA 3CVIL 3GMLB 2GEEA 3F7VA 1F8TH 2HXAA 1OQXA 4K9EL 1MI5A 4NBXB 5IQMA 2NR6C 4PUBH 1F4YL 3VG9B 3HOGA 3O3BB 4N8VA 5FS5A 2VXUL 3JT2A 4PJAB 4NO5A 5F7AA 2FWOB 1T0NB 1IBGL 1B4TA 2IALA 1CD1A 2PO6C 2Q8AL 1TT6A 4KGLA 1D5ZB 4NN7C 3AB0C 3LNEA 2CIIB 1Q0XH 4U1MB 4K5OA 2WMPB 3MNWA 2XXFA 2FX7H 3CCHB 1Q94B 5DJ6A 2XTJC 3AZUA 4PHXA 1WZLA 4JRXE 3ZE2E 4L8BB 3VXRD 4DGYH 3T2LA 1CZ8L 4K8RH 1L6XA 3KWVA 2SEBA 3OKLB 1IGFL 1QFPA 1T66C 2NCEA 1MFNA 1FL3A 4ZUWB 2DQEH 2QSQA 5F0LB 3RGVC 4DUVA 2DM7A 4FN0A 2I24N 1FFTB 4WNQA 1KFAL 1D7CA 1ZHKA 1FYTB 4J27A 3ZZSA 3E7JA 3O3UN 4ZNEA 2EDNA 2G3XA 3D51A 3VW3L 5DZJA 1TUPA 1JGLH 1MAKA 4N5ED 4K3HA 1MCHA 3FU7B 2PPEA 5AOKA 5KVDE 1I7UB 1HEZA 4MA1B 2CKNA 1QFWH 4N6RB 3QUKA 3Q5TA 2B77A 4C56E 5I1EL 4W9JC 3FO1B 1I4FA 1M6OB 4P59H 4N0FB 2NCMA 3D39D 3GSNL 4GUCA 1H3VA 1WBYB 1SEBA 3WO3B 2YWZA 1VEPA 4HFUH 4Q2ZB 2R2CA 3MRHB 1QRKA 1I53A 4L5FH 3I6LD 1SYSA 4X9GA 1LMKA 4OKVA 3ML9A 3ZL4L 4F7TB 2BZDA 2Z31D 3AS2A 1N8ZA 1ODUA 4TKWA 1VENA 4U3XA 3STBA 1JOIA 4NKMB 4AOFA 2O6CA 1JRHH 3LN5A 1MPAH 4KI1A 4XC1L 1AE6H 1MHCB 3ZN6A 1V3JA 3GSRB 4GXUM 2UY7B 3SQOL 1OL0A 4GAJL 3I2CH 1TEFA 5CIPH 3UP6A 3RL2A 4K5LA 4M7KH 3SGDI 3HR5A 1G94A 4MMYA 5IB3B 1R5VA 3K71B 3HAEB 1QFWM 3VW3H 2X4SB 3CZKA 5INDB 2IBBA 2XWDA 1BYNA 3KJ6L 3CPLB 2IH3B 4CGUB 2H6PB 2RJMA 1GC1L 2VUKA 1HJCA 3RVWC 4TULL 3BAJA 4HDIA 5FYJE 2E9GA 3ZT6A 1B4JL 1OOAA 3MJ7A 4XVTH 3LRLA 4MS6A 5I73B 1K9TA 2J73A 4LPWA 5D1XB 3AGVA 4H20L 3P9MB 5DWUL 3ETSA 1W15A 2BDNH 2XZZA 1JPFB 2BOCB 4HK3N 3QEHB 4MTMA 5I75C 3DGCR 3OHXA 4L8SA 4FXGB 3CU7A 1XGRA 3HE7B 4R9HA 5IP4A 2GJ6E 3HC4H 2LT9A 3LN4A 3LQZA 3IFNH 3PUUA 1AOHA 3HG1B 2ITCB 1OAJA 3IFLH 3KPNA 1RJYB 3QDGB 3AG4B 4ZS6D 3GF8A 2VTFA 5C7XL 2V7HA 2AK4E 1BW8A 4G7YH 3VUAA 5A16B 4WKZB 3RDTC 1CE1L 4E36A 2VLRA 3O6FB 1BZQK 4L05A 1QKZL 1KPUA 4G8EA 2X4UA 3PFQA 3UYPA 3O6KH 4FXKB 1IGCL 3GSUA 1EO5A 3I75A 1FV1A 1C7TA 1RUAL 2NY2D 1RJLA 3EDFA 4V1DA 5TGBB 5IIEB 1QHPA 4EI0A 1JGDB 2JFCA 5T1LB 5JOFB 2F8IA 1X5FA 2WBJC 4H4NA 4NO5B 4RMBA 3D87B 4K7PH 4P23A 3DPBB 1U21A 3C5ZC 5F1SA 1E2WA 3IMSA 4ZFQA 1EBPA 4G1EB 2B4CL 2XZAH 2AC0A 4M4PA 3TV8A 2DQGL 4FFZL 3ARDB 1DQTA 1NAMA 3EF7A 4PBDA 1H3TA 5HHPB 4RAVB 1PKOA 5I28A 2AJYL 3L95B 2H0JA 3OWRA 2XIDA 3WY3A 4TSAH 4ZMLA 3QJHB 3TT1L 5FB8A 4EN2A 2WXRA 4XRCA 3EYVA 2B3RA 5DA4A 5B8CA 3DA0A 4K71B 4Q89A 3WN6A 1KB5H 5C08B 4NZRL 1NCBH 3DTUB 1G6VK 3V4UL 1A3RH 3HPLA 4IBWA 3TN0A 5ETUB 3NTCL 1K4CA 1JN6B 5I17B 2QR0B 2QFPA 4DHLA 4X7TA 1A6ZB 1UD3A 3E6FA 3VACA 2BNRD 5J56B 3AS1A 3QQXA 1DBJL 3O0RH 3F58L 3V4PA 3CQQA 3PWUA 3S8GB 1NANH 1QYGH 4UNUA 4Q14A 3QZOA 1KIQB 4FJYA 4MWFB 4S0HA 4XBEH 3WLWD 2N7SA 5ECGA 3AREB 3UACA 5I5JA 5E9DD 3ZZLA 5GIRB 5IESH 4KX7A 6CGTA 4XBPB 4UTAH 3RL1A 3PDDA 5DEJA 2PWEA 3L3JA 1DO6A 5E9NA 1DJIA 4Z7QF 1OP4A 4PLKD 3CC1A 4DEWA 3TJEL 4DKEL 1UFGA 4HJ0D 4M5ZL 3AU0A 2J21A 1KB9K 4PW4A 3SYAA 3BWUC 2VDPB 1DN2A 1JP5A 1XR9A 2FYYB 4WUUD 2NLJA 4XOCA 1G9NH 1FLRH 1T0MA 4NO3A 4PJGE 1U3ZA 1AIFB 2QEJA 4IRZA 4NNPL 2ALWA 2CBMA 4M61A 1GVIA 2QGDA 1JYXA 1RQ5A 4XXCC 2H26A 1ZT4B 1FE8H 3BISA 3Q44A 1BA9A 3EJPA 3K4ZA 4B9YA 2GITA 2D0HA 3L13A 3T71A 1EMTH 3ZYIA 2P80D 4N2GA 3VXMD 4EOWH 4G5AA 1TO5A 2ADFH 3M6DA 1A9BB 2W59A 4H40A 4LRNH 3NFPB 1KTDB 2PP8A 3G5VA 1ZLEA 1X5ZA 3GIZH 3RFZC 2W07B 5B21A 3MRGB 2ZWYA 1ZOXA 4H13C 4M6OH 4N26A 1WFNA 4AYEC 4ODWA 4NN7B 1VESA 5GZND 3SKMA 4HVBA 4QTIH 4ZMNA 5FPIA 4R7NB 1CPUA 1HIMH 3EJUA 3PL6B 4HH8A 1CBVH 2MCPH 4AJWA 4ZW7A 5FYKE 1NOAA 5C0ND 1THCA 4F1ZA 5DUBA 1GCFA 1D5IL 3L4XA 1P9MC 1H8LA 4OF5A 3WEOA 4CMHC 2EZ0C 1IAMA 1SDYA 3D30A 1O9WA 1UCBL 3TBWA 5F6HJ 1A0QH 4NUGH 4P2QA 3ABZA 4TLUA 4X5QA 2PYEE 2AGJL 2HLFD 1MREL 1A66A 1XCQB 4LPVA 3WLBA 4R5XA 4Z7WA 1MCSA 1GS6X 3P0VH 3RYMA 2BERA 1F00I 3ARBB 4NKMA 3M46A 3PAZA 5LG1A 1AACA 2BVQA 1YYCA 5DVOA 1KC5L 2NRDA 4FQLH 2F1AA 1OPGL 4OLXL 3VQ2C 5K9KB 2A77H 4FXGA 1NAKL 1EZVY 3PXJA 5H2BB 4A2GA 4ZFFA 1P7BA 2W1NA 1F6LL 1YNTB 4QXGH 2AXHA 4B9FA 3BZDA 2NY5H 3KYAA 4L3EE 5LQBL 5KBMA 3WTTA 2YRBA 3INUL 5GISL 5ALBL 1DVTA 1KBGH 3S3BB 5JXAH 3UPRA 3VRJB 1IQDA 3W56A 4Q6YA 4BUHA 4N8VB 2CBPA 3L7FB 3LNDA 3U1PA 4ABQA 2A9DA 2BOBB 3LB6D 1VF5C 3NPSB 1AAJA 2XC8A 1JPSL 3C09B 2ESVA 4GPVA 4UYQA 5A2CA 2WNGA 3ILQD 4HLZH 2CWRA 1EX0A 4B9GA 1EXHA 2VERN 1AY1L 2VSKB 4PJCE 3CX5J 5EU6A 1XT5A 5IEKB 5EEXA 5EEZA 1MREH 3DO4A 2X9YA 4HJGB 4EUPA 4HKXB 3R8QA 1KB5A 1IQWH 5D2NE 5IROC 3MR9B 2VRQA 3MNWB 1KEGH 2PO6D 2BVOA 5K39A 1K2DB 5CINL 3MLZL 3STZA 5K1VA 1MCNA 1S5HA 3MCYA 4WTZA 1H3PL 4N2NA 1AI1H 2D3JA 2OCJA 3ZRCC 4P5TC 4A2FA 2EVFA 1IUZA 1QPKA 2EDKA 1G6RB 2FD6H 3T3ME 4A2HA 4L8DA 1CUOA 4S1RL 4YHLH 3C2AH 4ODTH 1ETB1 4F9PA 4LPYA 3BKJH 1JFQH 2V5MA 2VLJE 2GCYA 5AZ2L 4CA4A 4DFIA 3GLEA 1JHKL 1XZ0A 4HIIB 1QLFA 4JHWL 1HHHB 2ID5A 2ADFL 4PY7B 3HZVA 4N0UA 4FXKA 5I6PA 2YO3A 1I8MB 2F9BT 2OCFD 3II1A 5DJAB 4U6XA 5DJ0B 1N9PA 5F1NB 5C7ZA 5DEFB 1MCJA 1QMUA 3LQMA 4PCKA 4YHIB 3LX9A 4P2QE 3KEHA 3RVVD 4M1GH 1EWHA 4NNXA 2MQCA 3ULUD 4AJYV 2X4RB 3CZJA 3P4MA 1EGJH 1CB4A 5E4EC 5FGSA 3S96A 5IFAH 3O2DA 4IDLA 2GJRA 5CHNA 2EDYA 2IADA 4P2RA 4MJ6A 1UB5A 1URIA 1ZLDA 4GSDL 1J7VR 4JO4H 1MDTA 3FYEB 4L4VB 4JPIA 4G42B 3SDXE 1E4XH 2R23A 4NI3A 3S88L 5EU5B 1N67A 3MI6A 4KXDA 1LEKA 4HH9A 3V7AE 2X4NA 4G80B 5TDPB 2APXA 3LQAH 4HUMB 3R4DA 3VGAC 3ZDZF 5J1AA 2VR6A 2PWDA 3G08A 4C55A 2B20A 3WS6A 3MGOA 1I1AD 2R1WA 5IQ9B 3WEMA 4TOYL 4D0BB 4XAWL 1YYLL 1HINL 2V9QA 3MLVH 4FFWD 5E1AA 2W88A 3RUGA 2VQ1B 1UH3A 4XPTH 1AOZA 3F05A 1Z3GH 5JIKA 1RZ8A 3MROB 4OIIH 4P2AA 3FF7A 3O8XB 2BP8A 4EKXA 3MJ7B 3L1FA 5E94B 1RK0B 1TJHL 2BSDA 1RP8A 4NDMB 3WDIA 5E4EB 2WSDA 4KKCD 4TL4A 4E5XB 4U7SA 2NQCA 4AQ1C 1KNOA 1HKLH 4K3JL 1MCDA 1Q9KB 2VZSA 3C8KB 3EJRA 5KYUA 2GYSA 3S5YA 5H94B 1KZQA 3PG2A 1ITCA 3BE1H 2B8OT 2M8XA 3MGTB 4H0LC 1T1YA 3VFOA 5LQBH 1MHEB 5JPMB 2YRZA 1NIFA 3BD3A 2YWYA 2QFRA 1BZ9B 3QORD 4PG2C 1UHVA 2ZXQA 2QGCA 4ORZC 2DRUA 3RNKB 4ZPVA 43CAB 1UD6A 3TF7C 3X14A 4Z1PA 2X6MA 4BSVA 4HIQA 1TTGA 2VDQB 5BV7L 5IB5A 1AC0A 1ZDQA 3O2DH 3S34L 4BD4A 1NCCH 5J06A 2AQ2A 2OA9A 3NCFB 2Y5QA 4NRYB 1IV8A 2UY6B 2VJ0A 3TBTB 4XNUL 1AHWA 5HI3D 4EBQL 3LKOA 3ATEA 4NZ8A 1DUYB