6PAZA

Oxidized mutant p80i pseudoazurin from a. faecalis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTIHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
molecule tags Electron transfer
source organism Alcaligenes faecalis
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
total genus 33
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 6pazA00
2GI0A 2YAFA 4Q8BA 2DYRB 3UACA 3X2QB 1BQRA 2JXMA 4L0PB 8PAZA 1M56B 4EF3A 3QJVB 1A3ZA 2PP9A 3IN2A 2EIKB 5I5JA 1YLBB 4CSZA 4DP5X 1CURA 4KNUA 1WA0X 2I7OA 1NINA 1FFTB 2XV3A 2PPEA 2HRHA 2YAMA 2CBPA 4DP6X 4YL4A 5B1JC 4TXVB 4DP2X 2GC4C 3OM3B 1RKRA 1PAZA 1JZEA 3QJSB 2J56A 1IBZA 3T6ZA 1ZIBA 5B7MA 2IAAC 2BP0A 2IDUA 2J55A 2N0MA 1HFUA 2FQEA 2HLEB 3NJNA 4A67A 4DP1X 4UF7C 1OCOB 2HRGA 3T9WA 2RACA 2XU9A 2XUWA 4DPBX 3NJKA 1EZLA 1L9QA 2YAHA 3IEAA 1BYPA 2CJ3A 4YSQA 4BXVA 2R7EB 1PLBA 5I6NA 2BP8A 2J5WA 3ERXA 3WNJA 5B1JA 3CG8A 3NSFA 4YVUA 2BWIA 2OV0A 1GS6X 1J9SA 1BYOA 3C75A 3FSAA 4UAHA 5B3SB 1B3IA 3S3DB 2AANA 4DP0X 2PCYA 2LLNA 3S3CB 2ZOOA 3WG7B 4HIPA 1IC0A 4KNSA 4F7KA 4YSPA 3EH4B 1OCZB 4KO7A 3QJRB 3NJIA 3S8FB 1KV7A 1NIFA 5D4JA 3SQRA 1MZYA 2IDFA 2OCCB 1CYXA 1RZPA 2HX8A 3CDZB 3PXLA 4YSOA 3NJFA 3X1EA 4JHVA 1ZDQA 3FQYA 5I26A 4YSCA 1GR7A 2AZUA 1AZBA 1A4BA 2FT7A 2HX9A 1T5KA 3NT0A 3UGEA 3NSDA 1PNDA 4BDVB 3CVDA 1GYCA 2FNWA 5B7EA 4E9XA 1WS7A 3FSZA 2B3IA 2FT8A 2NRDA 3FYIB 1AAJA 1IKOP 1ZPUA 2CALA 3FPXA 3FU8A 1L9PA 5I6PA 3N55A 4A66A 1N70A 1SNRA 5I6OA 3GYRA 4A2HA 1J5CA 3NSYA 4G7QB 1W6LA 2PCFA 1BQKA 1N68A 2BP0B 1GS7A 4GYBA 1R1CA 3AG2B 1KBVA 2JFCA 5AZUA 2IWFA 2IWKA 3NJLA 1WA1X 4KOCA 4P5RA 4G70B 2PP8A 4K9JA 5A7EA 3EH5B 1TEFA 2PPAA 1AS8A 3IBOA 1PLAA 3T6WA 2VMJA 3BQVA 1JZGA 1E5ZA 1GS8A 1J9TA 2E86A 2XWZA 3AY2A 2X87A 2B08A 1E5YA 2GHZA 4GP4B 4GP5B 4HALA 4HAKA 4WTQA 1J9QA 2IDSA 1NIDA 3H4HA 2XV2A 2WO3B 1BXVA 4WKXA 2UXTA 2VN3A 3TBBA 4AZUA 5FC9A 4Q89A 1V54B 4JHUA 1PZCA 1NTDA 1PMYA 2DWTA 5TK2A 2XVBA 1V10A 2Y69B 3S3BB 1AZRA 1MDAA 2AFNA 1JVOA 1OE3A 3TBCA 2BO0A 3ABGA 1BQ5A 3NJHA 2AVFA 4A68A 2HZHA 3QQXA 2MTAA 1NIEA 2H3XC 4GY4A 2IWEA 4QKTA 1HAWA 4HZ1A 1CC3A 2Y1AA 1NZRA 2GBAA 3T6VA 4HHGA 2IDTA 3ZBMA 1JZHA 5E9NA 4PCYA 1QHQA 3SBRA 5EHFA 3FU7A 2DV6A 2GC7C 2PPFA 3MX0B 2FQGA 3QPKA 2BW4A 2ZXWB 1NDTA 2UX6A 3AZUA 1EHKB 5LDUA 3S8GB 1AZCA 2YARA 3OMAB 5I5MA 3AG1B 1XB3A 1UATA 1VLXA 1RCYA 3ABLB 5AKRA 1OE2A 4GP8B 2H47C 1SHWA 5IY5B 2IDQA 4HHWA 3WI9A 4HCFA 2GIMA 1E67A 2DWSA 3FU9A 4M3HA 1OV8A 2H5UA 3PPSA 5I6KA 1SDDA 3NSCA 3FQ2A 1OE1A 1W8EA 4MFHA 1J5DA 5PAZA 4E9RA 2TSAA 4KNTA 1KCBA 1KGYE 2BHFA 2FWLB 4CSPA 3TASA 3UABA 3DIVA 1BEXA 2QPDB 2YXWA 2ZWNA 4F2FA 3GDCA 2BZ7A 1ZIAA 1FWXA 3JT2A 4W9ZA 3UADA 2W8CA 4YSRA 2VW7A 4FA7B 3FSWA 4BWUA 2BWDA 3V9CA 1M9WA 1JOIA 2MRYA 1L9RA 2I7SA 4DP4X 2YXVA 4KO6A 3H4FA 1KDIA 1PZAA 3KW8A 1OOWA 7PAZA 3FSVA 3NP4A 3FPYA 2EILB 2QDWA 2EIJB 4YSSA 1AS7A 6PCYA 1KYAA 4YSDA 3ABMB 1DZ0A 1J9RA 2W88A 2XX1A 2XYBA 1JZFA 1A8ZA 3WKPA 1XMEB 3HB3B 5D4HA 3AG4B 1SFDA 3TA4D 3TU6A 1AACA 1ET5A 2Q5BA 1FA4A 2IH8A 3PAVA 3SBQA 4G7RB 1BAWA 4UANA 3ASNB 4YVNA 4E9YA 2X88A 4G72B 3PLYA 2UX7A 1URIA 2FTAA 2PPDA 2EIMB 4P5SA 5I6LA 4X4KA 3FU7B 6PAZA 1NICA 3OMNB 2XV0A 2XLLA 5F7AA 4G71B 1CYWA 2VM3A 5B7FA 2PLTA 1AIZA 3X1GA 3CDZA 4DP7X 3ZDWA 1W6WA 1AS6A 4NERA 1GY1A 3G5WA 4AI7A 3ZX1A 2QPEB 4BXSV 2YAOA 1OCRB 1JERA 2OJ1A 2UXGA 3L45A 1AQ8A 4ZK8A 3WNIA 1ET8A 4E9SA 1XB6A 2JKWA 5B1AB 4BK5C 3QJUB 2AZAA 4AX3A 1GW0A 1WAEA 2VM4A 5TK4A 1L9OA 3WIAA 1OCCB 1GY2A 3UAAA 3FT0A 3X1NA 3X1FA 4F2EA 1M57B 4HCIA 1ETJA 2I85A 2R7EA 3T71A 3V9EA 4NB7A 1WS8A 2P80D 1A4AA 2PP7A 4W1TA 4YSEA 3SBPA 4YSUA 4ENZA 1KCWA 1XB8A 1I53A 4E9VA 3NJJA 3OMIB 4YSAA 3FS9A 2YAPA 3D12B 1PY0A 1JXFA 4DP9X 3WKQA 1ET7A 3OQRA 4N8UA 1OF0A 4BWWA 2FQDA 4M4RB 3OD3A 5AFAA 5F7BA 4N4YB 1JXGA 1PCSA 4AKQA 2CAKA 3X1BA 4E9QA 1ILUA 3MBWB 2UXFA 1PZBA 1IUZA 2XX0A 1MG2C 4QLWA 4A2DA 1AANA 4AKPA 1L9TA 1ZDSA 2EINB 3QJQB 1ILSA 1KDJA 3IN0A 4A2EA 1ZV2A 2P80A 3PCYA 2HXAA 3GXUB 5B1BB 2DY2A 4KO5A 1GSKA 3H56A 1QLEB 1E65A 2TSBA 1X9RA 5I5IA 3CVCA 4PAZA 1RZQA 3CZUB 2HX7A 4A2GA 1AG6A 1TU2A 4G7SB 4E9WA 2J57A 3DKHA 4KO9A 3AG3B 2A3TA 2BW5A 2UXVA 2VW4A 4YSTA 4FAAB 1L9SA 3BVDB 3EHBB 2QDVA 1JXDA 3ZIYA 9PCYA 3QJTB 3NP3A 1F56A 3FQ1A 3U25A 1BXUA 3CVBA 3T6XA 3ASOB 2YAQA 1JZIA 3KW7A 4RH4A 3EH3B 2Q9OA 3PAUA 4KOBA 5D4IA 1JVLA 4GXFA 2PPCA 2VSMB 3NJGA 3UAEA 4DPAX 4DP8X 1CUOA 2IH9A 1SF3A 2VSKB 3NJMA 1NWPA 1BXAA 1SJMA 5PCYA 1HAUA 2FQFA 2ZONA 3FYEB 4A2FA 2BP8B 1AZNA 1SDDB 2GB2A 1ASQA 1TEGA 4HCGA 1PF3A 4E9TA 5ANHA 1ADWA 3ABKB 7PCYA 1AG0A 1PLCA 3NYKA 3N2JA 2CCWA 1SHXA 1NPNA 1DYZA 1KBWA 4JKNA 1X9UA 3HEIB 1MG3C 1V55B 1AOZA 1SF5A 1SFHA 1A4CA 2CUAA 2VW6A 1NPJA 3PAZA 1WA2X 4DPCX 2QT6A 5I6MA 2WO2B 1PNCA 1NIAA 2FJSA 1AR1B 2WSDA 1ASOA 2XXGA 3JTBA 1IBYA 2YQBA 1MZZA 2XXFA 1ASPA 1NIBA 1A65A 3EF4A 1QNIA 2GSMB 2FT6A 4BWTA 1NWOA 4NAJA 4AKOA 1TKWA 3DTUB 1E30A 5B1KA 4BDVA 3IE9A 1AZUA 5I28A 1JZJA 2BZCA 2YAEA 1ID2A 3AW5A 2DYSB 3RYMA
chains in the Genus database with same CATH superfamily
1GOGA 2HLFC 2VDNL 4PGDB 2F6AA 1UD2A 2H6UA 4G80A 4GQPH 4N2EA 1F4WL 4YE4H 2AQQA 3LZRA 1WAAF 2SEBB 4RMVA 3QUZD 3S37H 1NL0L 3SE6A 2D7NA 4TVPH 4UQIM 4NN6C 4I77L 3CQQA 3UTZB 1CURA 1XCTB 3QFGA 1N8ZA 4PUBH 1QR4A 3GB7A 1DLFH 2Y23A 2FEDC 4JN2B 5DZ9A 3VFGH 3BCFA 3MNWB 3JWOH 2QLYA 2LU4A 5D7EA 1UXWA 4D9QD 3T0EB 2AK4A 4UOZA 4ODHH 4PV1C 1M1XB 2D0FA 4GINA 3HZVB 3AU1B 3JV4B 1KBGL 4XMZA 4BUHA 4KTDH 2P7TB 4JG0H 1IBZA 3MA9L 1ZIBA 2F5AL 2BP0A 4YHIB 4GI8A 2IH3A 2YA1A 5AVVB 2CA4A 3MLZL 3BKCL 4XH2B 4P2QE 4RAHA 3VFRA 1KB5L 2VXQA 3QULA 4KK5C 4YSQA 3IDIB 1UJ3C 3NRPA 2BP8A 4XCYA 3BEWA 4OLYL 4BH8B 1TF4A 3VRIA 2PCFB 3SPCA 1AGDA 4LKCA 2F74B 3C75A 1JNLH 2RIKA 1VJSA 5LBVA 2ZOOA 1BECA 5E2TL 4MSWB 3QIWB 4ZX3A 3CFBA 3EH4B 2YK1H 3TV3L 3U4EA 3V0DA 4MHHG 5IT2L 1CK0L 2XY2A 1E9PA 3U1SL 2R1XB 1NLDH 1BVLA 4I13B 1A7RH 2F53A 2G9KA 4NUQA 1U8IA 4HS6B 2VR6A 3DNKA 4LNRB 4G6ML 4XP6H 1W8OA 4FE9A 4WW2C 3T4AB 2NY3C 1T4KB 5DK2A 3WS6A 1HIMH 5FV2A 4PG9B 2B14A 4EBQL 2PNDA 1HL4A 3PJSB 5M94B 3NFNA 2D8KA 4EE2A 4XMKH 4PJHE 5IB2A 4LU5L 4NPJA 4ZUSB 4DGIH 4D9QE 4R5TA 2CIIA 3QWRA 3TT3H 4RMQA 2WSPA 3RDTD 1J86A 3B34A 3CUPA 3FQNA 4JPKH 1G7MB 3SJVD 2DQIL 4X5XA 4EI6A 1LEGB 3CDGB 3BUYA 4OSUL 1H5BB 3W82A 2BJMH 1OB1B 5I75C 3UBFA 3IDGB 1XO8A 2FK9A 1WGVA 1J8KA 1JPTH 5D71L 4K9JA 1IGMH 5SV4A 2ID5A 1G6RB 2BOLA 3VXPA 5A7EA 5LUMA 4FTVD 1PLAA 3O2WL 4N2NA 3SYOA 3T6WA 3BQVA 4OD3L 3LN4A 4GSRA 3OXSA 5J57B 2IH1B 2H32H 2X4SB 4CADB 1N0LB 4F57H 4K71C 1DUYA 5CCKH 4XZ4A 5HTSA 2F1EA 1GCFA 3WFHA 3JV4A 4JO4L 1FO0L 3DO4A 2GTZB 5F7KC 4Y4KB 1S78D 4P46B 1MIEL 2V37A 2ZZUT 3ZW3A 3ATDA 2JXMB 3U0TB 1JI1A 2KBGA 2EVGA 4AZ8B 3N44F 4WGVB 4OLUH 1PEZA 4TS6A 2AJVH 4F33B 2YGOA 1V10A 4LVHB 4OD2B 3LV3B 5L6YH 4RGOH 2ARJA 3EO0A 5E5MA 3UAJC 5HVHB 3HC4H 5F7LB 3WSQH 3FQWA 5DTFA 1KC5H 3OKEB 1R6VA 2HN7B 5J1AA 3L4CA 2YFNA 3R06A 3QUMB 5FO8A 1U3NA 2WGNB 3P4MA 1SN0A 1HZHH 2WY3B 3ARRA 1QHQA 4N6RA 4WEEA 1EEUA 4JQVA 3D4GA 3WE1A 4Z7OB 1MWAH 1LE5A 3ELAT 1ES0B 3TEXA 3LVTA 1RIVL 1HI6B 1NM9A 1DBKL 2VITB 2VXUL 3QNYB 1GJIA 2Y4SA 1IC5H 4DCQA 1G1CA 1XEDA 3B2VH 2XJLA 4Y1AB 1DVUA 5AL8A 1TQCB 1Z7JA 3WL9A 5HJ3A 4HT1H 1JZDC 5CLYA 1CXKA 1WJ3A 3K6NA 5MEQB 1E0OB 1B2WH 4GMSH 4KDTC 1CIUA 5IHUH 3U7YL 4OSUH 4RAUB 4XO4A 5LWYH 4Z9KB 1S6NA 1XSOA 4FQXB 1CLOH 4JJ5A 3B3BA 1IE5A 4TL4A 5GGUB 1V8HA 1S7RA 4IS6B 5DLLA 2X3CA 2XWTA 4MJIA 4HDIA 3IM1A 5FF6B 3LQAC 3PIQA 1PL3A 5TDNA 5C08B 1FNSL 3QDGD 2TRHA 2O5YL 1JZ3A 2AGJL 1B0GB 2H9GA 5IVXF 2OCJA 5EZIH 3WTYA 2WLNA 2D73A 4PJEF 3W5NA 3MUGB 3DVFA 5EO9A 2JVUA 1PGRB 5F93C 1QPXA 3HPJA 4NQVA 1QI3A 2BXYA 4OU3A 4NNXB 4Y2DB 2BFVH 4RGMC 2D0HA 7PAZA 5L88H 5BUPA 5JQ6H 3A3YB 2IGFL 3GMQB 1T6VN 3KXFD 3TEWA 4P4KB 4PJIB 3AXLB 2RTTA 4XN2A 3F7YB 3TH3T 4MB4A 4POZD 1DLFL 2GQHA 3LZFH 2YD0A 4NQUA 3QO0B 3HB3B 1AHWA 4ZW6A 1U3HC 2ADIA 1MFMA 5HHPA 5ALBL 3DMMC 5KWYC 1WV7T 2B5IB 1IGYA 2QSCL 1S9YA 2NZ9C 2FTAA 2FE0A 4YO0B 2B4CL 5JZ7C 1BBDL 3D4CA 3HW7A 2X42A 4FXGA 1XDTT 2WGXA 1UOWA 1FUNA 1Z9PA 2F19H 2BSTB 5SX4I 4IGBA 4CBPA 2A73B 3GKZA 4G9FA 2O5XL 3VD5A 3JTTB 2MCG1 4LSTL 3CDZA 2KC0A 4JBSA 3VI3E 1SEBB 3BPNC 3ZRCC 5HGGS 1Z66A 1LO2H 3C5SB 4NO2A 3HCVA 4MA8L 1SBSL 2OYPA 1OCWL 2QSVA 3UDWC 4PS8A 1CLYL 2WP3O 4ZK8A 3WNIA 1N67A 3DRQA 5BZZA 4IMKC 4O2EA 1JGEA 3OKYA 4X7TA 4H8QA 3KYMB 2BM3A 1NFKA 5F96H 4BK5C 5GZOC 2X44D 3LKNA 3GSWB 1EGJA 2H8PA 3ZKND 2MFNA 4LHQB 3UYOD 3X1NA 3QNFA 4I0PA 3MLWL 4TF4A 5K93A 3ZYIA 4KX8A 1QO3B 3T71A 2FJHB 3VD7A 1WISA 2QFRA 1JAEA 1HH9A 5FFGA 1TZHA 1THAA 5DVPA 1GHFL 2Z92A 2BSTA 2WXNA 3UJTH 4GKSA 4EN3B 2CH8A 4XC3H 3ARPA 3BWUC 1AD0A 1CS6A 4IK7A 4KUZL 4YS4A 4FQ2H 4NZDA 4D9RE 4FD0A 4X6EB 3ESVF 5FFLA 4YO0A 3BKYH 1K4DA 3QXVA 1CR9H 1VEMA 4WV1A 3VH8G 5IMLA 3JYBA 2VKXA 1SQ2N 1OAYH 5I17B 1BQHG 1D5XB 4E9QA 1ILUA 3KH4A 5AYTA 4JPWH 2UXFA 5L4JA 4BFGA 2I60H 4ZPVA 1F1AA 4TNGA 4AKPA 4NM8L 4WO4B 3SYPA 4YLCA 3DUUA 4YAQA 2X0UA 1IEBA 3NMEA 1YMMB 5BVPL 4L18A 3T2NH 2HJFA 3FO1A 3CN2A 4L9LB 2XWDA 4OZHA 5I5IA 4WUUD 4KU1A 4X4XB 5JQHC 1RZQA 4CVUA 1RZGA 3WJMA 2K3HA 3X3FH 2NY0B 3SKMA 4CSTA 1TU2A 3APNA 2JKLA 3KLQA 2VDKH 3CVHH 5CD3B 4MVBD 4LLUA 3FN0H 5IW3A 4ATTA 2WN2A 1IGCL 3QEQD 1YEKL 1OZUA 3QARA 3WIFB 4PWIA 1F3DH 4PV8A 3GGWA 1MAMH 1MNUH 4LPCA 3BXNA 4O5LH 4HQQL 4OCWL 3FOMB 5T1KB 3MQIA 3GSNB 3PNWB 5CP7A 3G7TA 1SM3H 3DYOA 5C0GB 1Y18B 4HIXL 4UQ2A 1SBBA 5JR1H 1KN4H 4ELME 2XWXA 3SYCA 4XBGA 3L2LA 1G0YR 3TF7C 3ARBC 5L8LB 3FUHA 1XF5B 5J4MA 3VWKD 5ICZA 1WAPA 3NIDF 4YX2H 3O3EA 4J6IA 2QQNH 3B8YA 4GRLC 4WWKD 4M7ZB 1SYSA 1SVCP 3UTQB 3L48A 5FWQA 5ANHA 4M1GH 1XH0A 1ZGLB 2PR4L 4GSQA 4U1GC 4NQSB 5E9AA 1XSIA 3KPOB 2YD5A 5TE4H 3F12A 3E8UL 3KJ4B 4ZOEA 1UCBL 3VGAB 2H1PL 2G75A 5H8DA 1H8LA 4P2YA 3TCLA 4ZXBA 2R83A 2XSKA 1K3ZA 3DROA 5D9SB 5IJBC 2ZXEB 1Q0XL 1CR9L 1KXHA 3SE9L 1Y0LB 4PD4K 3NUKA 3H7LA 1IGTA 1IKNA 4FOMA 4G1MA 4L9LC 3H42L 1A6VH 1RUKL 4WI7A 1HNGA 4N0CD 4UZUA 5CEXB 1MZZA 1BZ9A 4JHZA 2Y0SA 3UO1L 4R90L 2MQ0A 4Y9EA 1ASPA 5JLZA 2P8MB 3EF4A 2QKIA 3LDBC 4U0QB 3SPVB 3QXAA 4DK5A 4IHOB 5BVPH 3SE3A 4YQXL 1DSFL 1LLAA 4NX0A 4GQRA 2X1PA 2CUIA 1IM3D 3GMOA 3PQYA 4RIRB 3WGVB 4UZGA 3P9LA 2IPKB 2DJUA 4IDLA 1HWGB 3BAKA 3MLWH 1I9JH 5CHNA 5T3ZL 3N0PB 3GKWL 4J39A 3UACA 4K7PY 1OGSA 3SBWA 4G7YL 4S11A 4L0PB 5DHYA 2IWGA 3QORA 3O0LA 3DHMA 1Z5YD 2WM0A 4LCYA 3U6XA 4BJLA 4FNSA 4G6FD 4GG8A 4KUZH 1XGQA 2HG5A 4O5LL 4P5TC 4HIIB 2X7LB 2XV3A 3WD5L 2GEQA 2PPEA 2OMWB 3U30C 4YL4A 2QQLH 4M7ZC 2NR6C 1EHLL 1M05B 2C9PA 4ZXBB 1LO3H 2F18A 2NXYB 1RKRA 3ECBB 4F24A 1IVLA 3L3DA 2C7UA 4WW2A 3CFIC 3EGXA 4YNYB 1QBBA 2XVKA 5C2BH 4TSBH 3QUMH 5FUCE 1F02I 2Q2LA 5EZLB 2IDUA 5MI0C 5I75B 1TQTA 3NJNA 3CD4A 3NH7L 5JMOC 4CW1A 2MTPA 2WTOA 1PZ2A 3T9WA 5IQ7L 1A7OL 4OFPA 3Q8FA 4XVOA 3HMXA 3IEAA 4P9HH 1BYPA 4WENB 1XBRA 3K2UH 4J2XA 2WVVA 2AP2A 2ZKHH 2DQJH 2BNRA 3NSFA 4YVUA 2MCAA 5IB1B 1D7DA 1BG1A 3EJPA 4ZNEA 2J20A 2NW3A 3TGXA 3JTSB 4R0LC 4DKFH 4WNJA 1T4KA 4Z7IA 2X7LA 4FEMA 5GGRA 1JGLL 1WHPA 4H4NA 2DQEL 1EAQA 3ASWA 1L0XA 5I16A 4M6NL 4PJIE 4RQQA 4AYSA 1YY8A 1LDPL 4RMRA 4DZBB 3UYPB 3CN4A 3AAZB 5T5NG 4HPYH 3T8XB 3TXAA 5GJSH 3C09B 3E6HA 1OM3L 2BVOB 1U8MA 4HXAL 1CYXA 3KWTA 3O9WC 2VLRB 4L05A 3RIKA 3DGDA 1BYNA 1J48A 3RUGA 1QLFB 3CFDA 1E7VA 3UYRH 5CIPH 1O9ZA 3CFBB 1ZDQA 3FQYA 3PG2A 4ODUB 5CD3A 2P5ED 1PEWA 1XT5A 3GMOB 1T5KA 2YO3A 1NJ9A 3QYNA 3JWDL 4IIZA 3S35X 3WLWD 4L9LA 4PIBA 1A3RH 1TZ8A 2EDLA 4Y5VC 5HGDB 5ITFB 4KRPC 1X5AA 3QUHA 2EABA 2AEQL 1AJ7L 3BKJL 1GJUA 5BVJA 4FLQA 4OCSH 4DUVA 3MLVL 4DGVH 3BAEH 3TURA 3DX6A 3VXRD 4E0RB 4Z7WF 5C71A 2BSCA 5MENB 5T3ZE 4CADA 3MRDA 1OGAB 3GSOA 4NZTH 2ODHA 3EDKA 3ZT7A 5C6TH 3NSYA 2J6EH 4MDIA 2J4WL 2P47B 4RRPA 4UTAA 4JRYB 4P2OB 4AUYA 4BSWB 5FM4A 2ZT9C 4J3OF 5JXED 4FL4C 4JGJA 4KJWD 5I1GL 5CAYB 3QCTH 2FEEI 4H0LC 6FABL 2VR8A 1OKEA 3H42H 1RPKA 3FUMA 3NIFE 4ACTA 1FNGA 3H0TA 3MCLH 2C1PB 4M6ML 1FRGH 3WDIA 3BQUD 1KEMH 1SZNA 4B96A 3GXMA 1UXWB 2JKRM 4MDJB 4NHCL 5DJYA 1JWSB 2AAAA 4I9XA 4P99A 3L3OA 2K7QA 5C0CA 2CA3A 4S1QL 4LVNB 4GP4B 4LNVA 3N42F 3H4HA 3S36X 1KFAH 2V9RA 3G9VA 1I8AA 3RJOA 4PRHE 2WBJC 4Y9GA 3N0AA 4NO5B 5FC9A 3AM8C 3L3JB 1TXKA 1O6VA 2CBTA 4G9DA 1RZKL 4JHUA 5DJZB 2ICWB 2JCCE 1KYUA 4UQ3A 3WXVH 5CEZH 5SWSD 2VDOH 5FEBA 3PGDB 3DMMD 3MU3A 4QY8B 4BRJA 2FBJH 4CVZB 1RU9L 2J1XA 2BO0A 1BQ5A 2EDFA 3FQTB 5CF3A 2AQPA 3KLHD 3HCVB 3NJHA 4FNRA 2Z93B 4HC1L 5DYOA 3LH9A 3DRTA 4GRLD 4F93B 1S7XA 3HB3C 4K3DH 3BO8B 4QHMB 3U7WH 4ZI8A 2GBUA 2IMMA 1MF2H 1WWWX 1JZHA 3MGTB 4PHXA 1SM3L 4PJDF 1M4KA 4D0CB 1LTXA 3EDEA 3WTXA 4JGNA 4UINL 4HU2A 2GC7C 3ECUA 4MAZA 2DTSA 3KPSA 1E40A 1KGJA 4U1NB 7TAAA 4KGJA 2IAMA 1PX8A 4KGLA 4X6CE 2EYTB 2UYLB 2XIBA 5CJBA 1T5XA 4AITA 2YD8A 3A5VA 1AQDA 1S7UB 4AT6A 1VLXA 5EIIA 3K2UL 3MO1B 2K9UA 3KG5A 2F7RA 4QYOB 2ICEA 3VDCA 3EG9A 1MFCH 1PD0A 5J3HC 1A6TA 2XPGA 3FO9B 2ZUXA 3PPSA 2F53E 3ULUF 3RVWD 3LRMA 4YHPB 2PYFA 4EN3A 2W65B 1AMYA 4ZZFA 1NDMB 3CU1A 2N59A 1S3KL 3MNVA 4ZS6C 3T2OA 2UZPA 4PV9B 2W07A 3NIDB 3PL6C 3NQIA 1P9MA 4OQ1A 1BEXA 1NEUA 3DGGA 2H4EA 4BIKA 5TQ2H 1F6AB 4JANA 2ZUQB 5C8JA 1TSRA 1S7TB 1QBMH 2A83B 4DZ8A 2DIAA 3H8NA 4OB5L 4EXKA 4YHML 2M8XA 3Q8EA 5FCSH 3HI5L 5DHVH 3JT0A 1YMHB 2RMNA 3CSYB 3V9CA 4B3EA 2E9WA 1SRDA 1J11A 4NO3A 2IFFH 5D1XC 2PO6D 3VWJD 4J3VA 2Z35B 5I0YA 5CGMA 1ADQL 3F7RA 1OOWA 2AVGA 3CHRA 3MC0A 1EO8H 4G59C 4X98A 5T3ZD 3T1FA 2EXSA 3WIHH 3K80A 5T33H 1IBGL 4YSDA 2CU9A 4I7ZC 4MVBC 4XPAH 5HD8D 5J06A 3AT0A 3VGGA 1UA7A 3B3IB 3IXTA 1JTPA 3K91A 5BS0B 1HZHL 3V4VL 1DFBL 1SLUA 4LLMB 4LIQH 5JA9A 3RZWA 3HR5B 1HHHB 4ZMOA 1DO6A 3OC8A 2WWKT 4UANA 1D9KD 1HWHB 3CZNA 4JFTA 1BD2B 1ZHNB 3PLYA 4K71B 4KKBC 2NNCA 1AE6L 1YDPB 3DJZA 1B0IA 1QFUH 1SUHA 2KL6A 5D8JL 3QO0A 1LK2A 1DBBH 2X53A 1BOGB 3MKGA 4U1LB 1ZVHA 5SX5H 1CG9B 2OKMA 3NIFB 4WCYL 5GS3A 5B7FA 4LBEB 5IEKA 1FVDB 3L1EA 3LHAA 1NC4B 1NEZA 3S2AA 4N90E 4Q97A 1B0WA 3IETA 4U2ZA 2UUDK 4M7JH 4XMPL 1BQUA 5D1ZI 4GQQA 4AM0B 1ET8A 5DMYA 2ZXCA 5ES4B 4FFZA 5CIPB 4MXVE 1R75A 1NANH 4OZIB 2XBTA 2VLKB 2C9VA 3BQUA 4HJ1A 4IU3B 2CPCA 5D2NA 4BELD 5CIPA 4CC0A 1NDMA 5K59E 4WUUA 3BVVA 3TPKA 4XAWL 3NCJL 2LABA 2CHXA 4L3EB 3STZB 1J8HB 2PTVA 2C1OB 2LFEA 4ZX6A 5K9JH 1S7RB 3SBPA 1SUJA 3IPEA 5ADOL 5T1LD 2AXGA 4R8WH 4U1LA 1QLEL 4RFOL 5HVFB 3IJ8A 2APVA 2KT6A 3X3FL 5F9DC 1QLEH 4FNUA 1FZMB 4ILDA 4N4YB 4U6VH 1I9RL 3P0VH 5IROA 1CO1A 4ZQTA 2K6YA 1EXHA 1T5WB 3QQ3A 3F65A 1OT4A 2J8UB 5FHAL 4IBZA 3T2NL 1EEQA 2V7NA 3HFML 3LHPH 3TYGL 4D0CA 5BS0A 3HHRB 2YS4A 4ODBD 4W9JC 3IN0A 2EVHA 4EI5B 2IQAA 5IQMA 5JORA 4X98B 2WHVA 1FL6A 5KVFE 1QZNA 2R15A 2WNWA 3S98A 3V4LA 1KOAA 3ESOA 4XBPA 2WXIA 4NI3A 1CLZH 3QWOB 4KMLB 1SJHB 4GAFB 4L1TA 2XFXA 3FFDB 1L9SA 2FWSA 2VLLB 4GAAA 3RU8L 5IMKB 1FN4A 3QJTB 4N2IA 4FULA 1Q9KA 3BZ5A 3MLRH 1ZVSB 1EQWA 5F88A 1UXSA 3ILDA 3MFFA 3U25A 4MX7B 1QRNE 1RJLA 3TN0A 1KTRL 3SDCB 3ES6A 4GT7A 3QJHB 4U1KB 2PW2A 5D2LE 3DYMA 1BWWA 3B1UA 4I77H 1ADQH 3VI4A 1Z9MA 2B1HH 4LQFL 3BUIA 4LK4A 1KBBA 3L81A 5KVFL 1UC6A 5CFAA 2G3XA 5DJYB 3ARFA 2CO6B 4N3TA 2ZX5A 5E9DE 2VSKB 3NJMA 4ZD3L 4JB9H 4OLWH 5DJ8B 3VRIB 1QFOA 2C1PA 3TFBA 5IWLC 2JQZA 2Y07H 4QTFA 4LZKA 3L4UA 3QEHA 1AZNA 2EDRA 1TJHH 5E00A 3V4PB 4W4OC 3FBQA 1CJYA 4E9TA 4HS3B 3QORC 1D6VL 2ZXDA 3ZZQA 1R5VA 1A2YB 1FLRL 5DUJA 1HNYA 2QR0A 3VXPB 3MNDA 2VLMD 2X2JA 5CINL 1FSKB 1KBPA 1QSFA 4WFGD 1SF5A 3ZTDC 1BMZA 4G42B 1T0MA 5IHLB 2D9CA 4AXWA 2DIEA 3US9A 3G6JE 5DI8B 4ABVA 3UTSB 4LHUA 2X1WL 1BQLH 1FH5L 3KPLB 4KDVA 1T66C 1GA2A 1SXBA 3B6SB 1FAKT 3H3PH 5ABZA 2GHWB 2WO2B 2UWEE 5TF0A 1QNZH 2YXFA 4GAJL 2EE2A 1ZHBA 3JTBA 2XWRA 3GHEL 4E5XA 1RPQA 1RZ7L 3QJHA 4FQLL 4U1KA 5IJDC 1S7XB 4JS7A 5FB8B 1YEKH 2GSMB 4YLBA 3EYVB 3I75A 3DTUB 4HXBH 5DC0A 5DK2B 3UAJD 4Z7WB 3TC9A 5EU4A 4J4PC 43C9A 2E9GA 2WAHA 1UB6A 2LW3A 4EUPG 4H25A 1HKFA 4Q8BA 2Q86A 4NP9A 2JCCF 1GHFH 1VPOL 2C3XA 5EN3A 8PAZA 3KXFB 2AQTA 3T0BA 4X4ZA 2NW3B 2ZCKH 4XMTA 5IMOA 4HOWA 2MIZA 1CD9B 3IU4L 4L1SA 4DP5X 5LNGA 1G4MA 4JG1L 4J3TA 4BCZA 2ADFH 2EZ0D 3ETTA 3GO1L 4YPGB 2ATKB 5HDBF 1ZTXL 4TQIA 2CCLA 2I07A 5B1JC 1ETZA 3CVHA 4HZLB 5CKAA 5DQJB 4Y16C 2F74A 2H2PC 2P46B 4IRSC 3V5HB 4W4NA 1RURH 4MMZA 4UI2A 4AQ1B 3DX2A 2XVGA 1G9ML 35C8H 4QRAA 1GGCH 1MELA 3IDIA 4OQTA 4ZUUA 3I6LE 5C08D 1BJ8A 5IVZA 2J56A 1GXEA 5D7JB 3T6ZA 2CRZA 5FKAB 2A9NL 3IDYC 4X4ME 3WIHL 2Y7QA 3IMWA 4OD1L 4Y5VA 4WWNA 4LVNC 2AXGB 3F84A 4UT6L 3VXNB 3EYUH 3FFCB 3WEAA 4NCC2 3CVHL 3GRWL 1XGQB 5FYKU 4U3XA 2OSLA 1IC5L 4PJFB 5ICUA 2OMZB 3C2SA 5F3BA 4L5FL 3IAGC 4QWWD 4DKAA 1J0IA 2WYTA 4O00A 5HHXL 3SDDB 2JQMA 2ZIDA 3T0EA 3MUZ1 1WZ1L 3VJ6A 4NN5C 3SDYH 2OTWA 4JRXE 1UVQB 4HK0B 4HIPA 1LO4H 3CQFA 3KCPA 1QX1A 3DXAE 4PI2A 1XTLA 2CK2A 4Q9QH 4C58B 4DGVL 1UWEH 2VXVH 3ZT6A 2WWMC 2ZJSH 3B37A 2VABA 1Q9KB 2IGTA 3VTAA 2HX8A 2CLVA 2NY3D 5EU6A 4EZKA 1H6FA 1KTBA 5FGCE 3RY6A 1QWNA 3EOAA 4TSAH 4JHVA 5CZXD 4ZMPA 1ZOXA 5I16B 1FFPA 4Z7UF 5FYLE 3JWNG 1WE5A 5I1GH 2EIBA 1AY1H 1WRFA 1EGJL 2XQ0A 4YK4C 3OGOE 1NBVL 3ZE0E 3ILQC 1FL6B 1O75A 3JTSA 5K9QI 12E8L 4L8DB 5D9SA 5C08E 4OCYL 1P1ZA 5GHWH 1TQBB 3IMTA 4Y16B 3TIEB 7FABL 1BX2B 4PP2B 2B8OT 5E99L 1EJOL 3ATAA 5F0MB 5E6IB 4U1IB 4A66A 2AQ2A 3TTYA 3DPBB 3VRLE 3AADB 4Y19D 1A47A 3UG3A 1YECH 3WKNA 4OM1H 4D8OA 1NLBL 4PRAA 1V05A 2R69H 3RGBA 3UC2A 1DL7L 2NY6C 2W0FB 2L0DA 3S6CA 1MCWW 4KX7A 4LRNL 1E4JA 5KSAD 3UTQA 4TOYH 5KANG 4TUKH 1PS3A 3EJSA 5D1QC 2BZDA 3V6BR 4GRMA 5E8OB 3VXSB 4S1QH 4WFHE 3MBXH 2WKOF 4WFFE 3GSNL 2JJTC 2MQGA 1TEFA 2O6PA 2XI9A 3CXFA 4BQ9A 2X9WA 3S96B 3QRGH 5K9KB 3UJIL 5HDRA 5D1ZD 2OMYB 4ZMLA 4N1CA 2B08A 3ARYA 1EA9C 2CHNA 5AW3B 3OHXA 1OF2A 1MI5E 1SJEB 1HXMB 3ETBJ 4GNKB 1IC1A 4RDBA 4I3GA 4MCYB 3BSZL 4F3FB 3ULVF 3KLKA 2HJLB 5J12B 2WIIA 5C0IA 2DWTA 1FNLA 5EUOE 4Y0GA 2W1NA 1OVZA 4OJFL 2VR4A 1EXUA 2FSEB 3KR3L 3Q1SH 4RX4D 1NMBL 3U4BL 3IETB 4C4KT 2CGZA 1QFWH 2HZHA 4HMCA 3QXAB 1M7DA 4CAGA 4F9LC 2ICCA 3LIZA 3LMJH 4NCDA 3ZOAA 5CJOH 3DV6B 3WNMA 3C8DA 1MCRA 4IKNA 1VEOA 5CZXC 1CG9A 3ZTEA 1KBKA 1BFSA 3DUUB 1AGCB 4JY5L 4P57B 4YAQB 1G6RH 5K1JA 4JO1L 4U4IA 2B1HL 4F7CB 4ETYA 3EXJA 1DJIA 3G5XA 4S0SD 2WNGA 5DYFA 1DDHB 3BT2L 3GJEB 1U2YA 2J4WH 4FQIL 4HUUB 2L7JA 4LKXA 3TJPA 2WPGA 4MJHA 1ZANL 2YD7A 1M6OB 5BOZG 3MX0A 1Q0YH 4QYAA 5GIRB 4GI6A 4PJXF 2CRYA 1RIHL 3PGFH 2ZOKB 3LZNA 2BSRA 2GIMA 1QD0A 5KVGH 5I8CB 1HH9B 1PY4A 4ADGA 5I2IB 2WW8A 5AW1B 4M4RA 3FT1A 4I48B 3H9ZA 3U79A 5AW2B 3BOVA 5D7LA 4NFDA 3UG5A 1WEJH 1NEZG 4PLKD 3PHOA 5I74B 2Z35A 4P3CH 5T3XE 4XOAA 4JDTL 1KJ2L 4Q4IA 1JL8A 3VX1A 4DW2L 2QQQA 3PDGA 2FJUB 1T22A 3DDFA 1AFVL 3ATEA 3L08A 1Y18A 4UQ2B 5IB4B 4H1LH 3O2DH 4R90H 4XODA 4U6XA 4G8GE 1C16A 3VWKB 3R7RA 1A6ZB 2ZWNA 4TUJA 3RFZA 2BZ7A 5D7LB 1KJ3L 2HCZX 4AENB 5HBBA 3CZLA 3G5VB 2W07B 3TZVC 4MDJA 5JUEH 3AQYA 4JFQA 3FH7A 1WF5A 2YRPA 4XMXA 2PWGA 2VN7A 4JDZB 3SOBL 3D07A 3S88H 2ZE0A 1DQTA 2HTLD 4G8GB 4FABH 2PWHA 3KW8A 2OFQA 2AJSL 1E8ZA 4F37K 2ICEB 3TP4A 4DF9A 2NTFA 4K7FB 4X80L 3G5ZA 2GK2A 1NKRA 3HE7B 2OQJA 2DICA 1UM4H 4LCCA 1PAMA 2OMNA 4BUGA 2ZUQC 3DVGB 4OFKA 2DM2A 4XMPH 3U2IA 3L3IB 1MEXH 1UHVA 3S35L 2Q7AA 1OP5H 1MQKL 1MAJA 4Y1AE 5F9WB 1HJBC 2G5UA 4KK8C 4V1DA 4X4KA 1FNSH 3IAPA 1TJGH 1F58H 4JZJA 3SE8H 4PWFA 5AWNL 1K85A 2WVUA 4HG4J 4JDZA 1AZVA 2OMXB 3DSFH 3T2QA 4J1UA 5IK3B 1FVCA 3ZYZA 1BAFL 1RZJC 2KZ1B 2HFTA 5EBLA 4F2ME 4Y8AA 2AITA 2XNAA 1DN0B 4JAMB 5BXFB 2PCXA 4BKSC 1OTSC 2NZ9D 5E6ID 1OZTG 3RX8A 2FX8L 1G7PA 2O26U 3QO1A 4YDLC 2QEJA 3F6LA 3VFUB 3MR9A 4OKVA 4YK4B 4HDIB 4ORGB 2FO4B 2XN9D 3IB4A 3P3YA 4BHUA 1CF8L 2PYEE 3E0GA 1INEL 4PJ9B 4CJ1A 1IM9D 2FIKA 3QZWB 4GO9A 4JY4A 4QXUL 1HCZA 3UAFA 1JCVA 1MCEA 2Y72A 3GO1H 4RAUA 4KMTL 1TLKA 4PLOB 4NIYE 5D5MB 4ODWA 2Y2WA 2R7EA 2JKIS 1OPOA 2CUHA 2WQAA 1V27A 3LKSA 1TNMA 2PP7A 4U7KA 2VDQH 1YG9A 4MQSB 4QGTA 5LVEA 2CO3A 1WD8A 3QNZB 1XX9C 3TESA 5I8CA 1S7SB 3ROLB 3U48A 3SJVE 4FFZL 2GT9A 4BFEA 1RK1A 2EECA 5EEXA 1T21B 1UCBH 3EJTA 3E8UH 3M7OA 3GUFA 4EAEA 4HIJB 1BVNT 1OF0A 1XL4A 5AFAA 3OD3A 1MVYA 3PP4H 3SDAD 4PGBA 5EZPA 5AB0A 1JXGA 1PCSA 3GXFA 5AOKA 3WLBB 4XHJD 2KPWA 3ARVA 4XI5C 1M3IA 2F19L 2BHUA 4F7CA 4KRPB 4IU2B 3LAFA 2X0WA 2KPNA 3E80A 4AEFA 3ULUD 1LYQA 3PCYA 2WZAA 4PJIA 2HRPH 5DDHA 5ID1B 3EBGA 4PBVC 3UP6A 4AC4A 3AY4C 5I8KH 2P52A 1J1XH 1MH5B 2ZNWA 4Y5YC 2BP5M 1A4KB 3AQXA 2NDFA 4OZHF 1KCSL 3QDHA 1MREL 2F1AA 3SGDI 2O5ZL 1MFBL 1YEJH 4PJ7B 5HPMA 1JXDA 3LKPA 3N1MC 1KPVA 1T1YA 4PJEB 4PVLA 4UNVA 5BJTA 2C8NA 4IHOA 2WB1A 4JFEE 3RGHA 3RNKA 5IVOA 3S7GA 1K2DA 5LO7A 3LKOB 4ZS7L 3MREA 4MJ5A 3EH3B 3ISRA 3TO2B 5CN3A 1T6WA 4CMMA 3S88L 4AQ8C 5AAWC 2NYYD 2VQ1B 4D9LL 3PXHA 4DKEH 1PZ5B 4GW1A 2BRRL 2YGVA 4ORZC 3BDYH 3S96A 5K9KA 2VDLH 1G4RA 3DROB 5AVWB 4X6FB 4Z8FH 4V1DD 4FYSA 2BSSB 4KAQH 4HW6A 5CR8A 5FKAA 2DI7A 2OSXA 1EAOA 4B9PA 1XL6A 5KG9B 5HVHC 5HYJA 4OTXL 7PCYA 4WU7B 4BSVA 1ERNA 2GITB 2CCWA 4KITB 1O9VA 2RB8A 3KPQA 4FJ6A 4K55A 2NT0A 1DO5A 4MLIA 1KBWA 2DH2A 1X9UA 4W81A 2R2HA 1GOFA 1WYJA 3FTGA 4PY8J 4Y88A 5DUBA 5LQBH 1G7IA 3F7VA 3BKMH 3INUH 4LARL 4ZTOL 1BJ1H 3MRCA 5D1XA 3GM8A 5EBMA 1NCDL 5HXMA 1A6PA 5DD3L 1QW9A 1RUML 2IANA 3UGXA 2GKIA 3PJSA 4P5TA 4G7YH 2VM9A 3UTSD 1DVTA 1P7QD 3K5RA 3KXFA 4M00A 3W11C 5IWLA 4P2AA 2N3JA 5I6MA 3BRGC 3JYCA 2YK1L 3TV3H 2E7BA 3FN3A 1NFDE 3M17B 2HRLA 5LN4A 2FJSA 5FYKE 3U2JA 4APXA 1AC0A 5AWNH 4AQEB 4EKXA 3HG3A 3GS4A 4JRYE 4DOHE 4HJSA 4A7GA 1G5GA 4HSAC 1EFXA 1J5OL 4MJ5B 4AQAA 3F58L 4P23C 4ATWA 4M5YL 1FFQA 3FQWB 1TKWA 4PJDB 4BKTC 3HNTL 5I28A 3VD1A 5KUKA 5FR3A 1NCBL 1WITA 3QFDA 4PLJC 4XXDA 3H9HA 4F8QA 3U4KA 3UJJH 1JGVL 1Q9OA 3X2QB 5C09B 1OGTB 2JXMA 4NN7B 2HTLC 4OZHB 4P5TD 3V7AG 2FD6H 4MJ6A 4KRMB 2H0PA 1N9PA 3VYPA 3M45A 5I5JA 3BPOB 1A9EA 3UPCA 3D9AL 1IAIL 2FB4H 4IKKA 4OR1A 3OZ9L 1JJUA 4XXCA 5IZ7A 1NGYA 2IQ9H 1HQ4A 4Z7VA 5JUEL 5B4MC 3A0OA 1Z6JT 3GMLA 2WYZA 3OAYK 4U7MA 4FQCL 1MW2A 5HGAB 3S3PA 4D0DA 5GGVH 1DEEA 5LNEA 4Y5XC 5DUPL 2P4AB 3CH1B 1ZE3C 3M8OH 1A6UL 4KAQL 5KBDA 3D25A 2MHAA 5A7BA 2PWFA 2YPLA 1WFUA 3U0WL 3AU1A 4WW2F 1B3JA 1U6AH 1RP8A 2BVQA 3BGMB 1NBZB 4FTVB 2ARWA 3DLQR 2XU9A 1TZHB 1GTFA 3QIUB 4XXWC 3T65A 4N8VG 2EDYA 5F7UA 2R7EB 3WN6A 4CL7A 3MRRB 3P9WB 3VI4B 4ODWB 2FBRA 3GRBA 3ZJAA 4GSXA 4HX1A 5IQ9A 5LKNA 5BUGA 1FO0B 3BLBA 2VMDA 1U8QA 2BY1A 5D96B 5LXGL 3ULVH 1C08B 5C07D 1OLZA 4Y2LA 3QQ4B 2AJ3B 5D6CA 5FKPB 4JFFD 4KK9C 3NACH 3RWCA 2BCKB 1HL8A 3OC5A 4ZFZB 4LF3A 5C3TA 5I1AB 1VFUA 3R7QA 2VL5B 2CCVA 1T3FB 4F20A 4Q2ZB 4LSQH 2XWBA 3WKMH 4JAMA 1C5BH 4N2MA 2JKJA 3WV0A 3CDZB 3PDOB 2RCSL 3NJFA 4JUSA 1E42A 4J1UB 4E5XB 1HWWA 2CJUL 1VESA 4YDIL 1ZHBB 4XWOD 1F0LA 4WQOA 1RJZB 3IF1A 4BDVB 1XF2B 3C9NA 1WICA 5JNYA 3FSZA 1T3FA 5LBGA 3TNNA 3MRFA 2V17H 3BEWB 4NN5B 4QRRE 3QQ4A 2C3GA 1VFAB 4PJFF 1C08A 3GYRA 1JDAA 4AOFA 4QCIA 4M7LL 4BSJA 1ORQA 1P9MC 2H3NB 4OAWB 1MRFH 1RERA 1E5CA 4CC4A 1W6LA 4TQHA 4OM0H 3EYFA 1UASA 1GSMA 4HX1B 4WV1B 4JFYA 3U82B 1VZGA 3LKQB 3PWVB 1CWVA 4EN3C 1G7LB 3V4PA 3LX9A 4BZ2H 5I1JH 2DJ4A 3CC5A 4DN4H 3B9VA 1TZGL 5DRNB 5E1QA 5JHAA 2QQKL 4Y9CA 4F57L 5F1IB 4Q58C 1YC8A 2AKRA 2P44B 4KMQA 1YVLA 1A21A 2BY2A 3MNWA 1VACA 1UOKA 1CLZL 4FQ1H 4LXFA 1O5DT 3LPWA 3AY2A 4UYQA 1GYUA 1ODAA 4L8BB 4WTZA 3CAFA 4U49A 5TQ2L 1G9NC 1T1XB 3GINA 1E6OH 1QFUL 4YH6A 1K4CA 4J6RL 2ATAA 1G6RL 3MJ7B 3B5TA 4NQCA 5FYJE 2F5BL 1KLFB 1RJLB 3TN0B 4F92B 1TCRB 4F27A 2HAZA 4MJIB 3V0JA 3KPRB 1IBDA 3T8MA 5IMKA 1F6LL 4M1GL 3L3KA 1IEAB 3VSTA 4JFZL 1PSKL 2WBXA 3H1ZA 3SKNA 4B0MM 4WGWB 5AD0B 3FCSA 1YQ2A 1LK2B 4GW4B 3CXDH 2QFPA 4MZIA 4K15A 4CU7A 2P5EE 4H1LG 4JQIH 3H9SA 2HWZH 12E8H 4KJYA 2CLZB 3VFNA 3NTCL 1EO8L 5CSZB 2ETWA 4OF7A 4BM7A 1JHLH 1GZQA 2WV3A 3WD5H 2C4FU 3O2DA 2BSRB 4UTBA 4NKIL 4NBYB 2A4CA 2VT0A 2RA1A 2VUKA 2VLRE 4FERA 1RUAH 4X9FA 5EOCH 5CZRA 3SBRA 3U6XS 4OZIE 4NO0B 3CBRA 4XO9A 2EDDA 3BWAA 1KJVB 1JMZA 2NT1A 1Q38A 2X28A 4HKZB 1EEZA 1UB5B 3HNVL 4KV5F 1II4E 4LSVL 5IKCB 4XNXH 4B7IA 3HJ0A 4IMKA 4N90D 3AG1B 4NGHH 1KFAL 3GJFB 3KE0A 3M17A 4UIMB 4IOSA 5AKRA 4ZUTA 3MBWA 1RZ8B 3ARBD 4HCFA 1MCPL 5HHOA 2D31A 2YUZA 4FA6A 1D5BB 3ZRFC 4BHUI 5F7MC 4WWKC 3RZCD 3BD3A 1TQUA 3NSCA 5I66A 1JNHA 1E3XA 4M7JL 5CJXA 5JIIA 1NC2D 3LEXA 4R96A 5E8PB 2ENJA 3IDMA 3I2CL 4KY1L 1R46A 4NT6A 5IBLD 2A7BA 1KTLA 1JPGB 4HOXA 1ND0A 1WWCA 3E2HC 3RL2B 5LAPA 2E0PA 4GAYB 3WFBH 1NMAL 1GVIA 1RJYA 4FKHA 3RX7A 4OLZH 2QPDB 5ESVB 3NZHL 3NGBC 1MHEA 4YHPA 3LIZH 3OX8A 1PDKA 5I66B 1I7ZA 1ZIAA 3O6FD 5IHZB 4NWUL 4KQ4H 4KZEH 3RWFB 3GNMH 1ZA6A 3QIBA 2Y3NA 5IEKB 4K2UL 4PJ8B 1HCYA 4UINH 2ZKMX 5T5FH 3UJJL 3TO4D 3RVTC 5K9OA 4YDIH 1SN2A 3GPSA 2YFOA 4GXUN 1XD0A 2DDQL 3CMGA 4OLVH 1MN4A 2DWXA 2V7HB 3GTVA 3HN8A 3LNGA 3ZKXB 2CKBB 3BT2H 3BAWA 4PJAF 4JMNA 3RWHA 1DZ0A 4YHZH 1JRHI 5BRZB 1I3GH 1BZEA 4W9DC 4OZFA 4BEIA 3SDDC 3B9KD 3ARZA 2V2WA 3U9UB 3TA4D 3DO3A 3HG5A 4U1SA 3WENA 1CICC 3C5XA 3LQZB 2HT3D 1I1YB 1A7PL 2YPVL 3MOBH 3N43B 4R4BA 4YWGH 3UX9B 3QUZA 1TQWA 2KYIA 4JY6A 5HGBA 4YVNA 4WY7L 2D03H 2CLZA 3MV9D 1JHKH 1SY6H 2WINB 1LEKB 3PWLB 4HMDA 2F54E 4KHXH 4XC1L 3MRJB 1IAMA 3FONB 1U33A 4IOFC 4Z7QF 3MODH 4UQDA 3HHMA 4HS8H 4U3SA 5K1NA 1X5JA 2R69A 2AJZB 4G71B 3B7YA 2VM3A 2F61A 4J28A 3IGLA 4S1DD 3MBEC 2ZUUA 3V6ZB 4DP7X 4I0KA 3F7KA 3ZDWA 2EE3A 4NO5A 4N85A 2BCMA 2VOTA 1A6VL 1RUKH 5SWZB 3L9EA 4GRWE 1AQ8A 1R5WB 1JZ5A 1SYVB 1RLBA 1CU4H 2EXWC 3IJYA 1UGNA 1SMDA 3NIGB 2WWNA 1OARL 3LEYH 2FSDA 2IC2A 3FT9A 3KLDA 1VACB 5JXEA 4A63A 4FQLH 5E2UH 1Z5LA 4MQTB 3AXHA 4XP9L 4DNLA 1IIKA 2Z8SA 1T89A 1NCAH 4J2QA 4LSUL 2ITDA 4UV7H 2D3JA 4JG0L 1IEHA 2BJML 3FNKA 2YGPA 2KZWA 4FMVA 3P4OA 4W93A 4XCYB 5KBPA 5AVZB 3WFHB 4G8EB 4YBQD 3NCBB 4EO5A 3GSQA 4FKKA 4NYLB 1HXYA 3ZXAC 1ZLWH 1OIOA 2XPGB 4FYTA 1ZGLP 2FO4A 5CJXC 1X44A 4HJGB 5JOFA 3EYFB 1I3UA 2V33A 4AIZB 1NGZA 3IXAA 3T0XA 4ZJ9A 3G6JF 4NM4L 1Y6KR 1PY0A 4BKLA 1CFSA 2A0LD 3HTLX 3L5XH 3M7FB 1KENL 1DBAL 1HYRC 3IMUA 3CBKB 2G60H 4YGVA 3HZVA 2CRIA 2R2BA 2ZWYA 4Y89A 5DQ9B 4ELKA 1ODUA 1C7TA 4L4TE 3O3AA 4MS8C 2D2CC 1IUZA 1IFHL 4TQ8A 3WUWB 4A2DA 1AANA 3CMOL 3H2QA 3FH5A 2YXMA 2EINB 1LQSR 1SOQA 1VADA 1A1NA 2YA2A 4EQ3A 2I69A 3B43A 4HF5H 4DKFL 3Q8BA 5GRUH 1VFOA 1VHPA 2Z93A 4JLRB 4GG6F 3FN0L 3REWB 3O6KL 4KUCD 5IHHA 5KYUB 5E2VL 5C92A 1I82A 1TJHL 3KEDA 4DZBA 2XZCH 3WGUB 1T1ZA 3HOGA 4XC3L 3ZIYA 4AE1A 4TRPL 4BCYA 1JRHH 1LO5A 4GLRI 4OGAC 4X6CF 3EADA 4PWGA 4Z7WA 5ICXB 1I3RA 2FEDD 1K5WA 1Z0MA 3PWJB 2B9AA 2CGRL 1JZIA 1P84K 4A04A 3OZKA 4RESB 3KW7A 4OFVA 2VLJD 2OTUB 1R24A 1WCBB 2BNRB 3S9DB 4ZQKA 1KXTA 5C97A 3ZKMD 3BP6B 4OGYL 3RDTA 1M2VA 4H88H 1IC4H 5DURB 3QIUA 1JGDB 3QJZA 3IJYB 3VI4F 4LP4A 1INEH 4YHYC 3S5ZA 2IGFH 1SYVA 5DD3H 1G5AA 1QFWL 2ALWA 1HEZA 5CEZD 1G9MH 5J12C 1F6FB 1IKFL 1TEGA 1S7VA 1PLGL 4DGUA 3HUJE 3SDXE 2JJUA 2DTMH 3PXJA 2H6PA 3KYKL 3AM8A 4KJWC 3NAAL 3ECBA 3DDGA 5K39B 4BA0A 1OXYA 5FM5M 2CDFB 3PWPD 4KTEL 4RRPG 4DEWA 2DMBA 3QFJE 1CDYA 4HUWA 5MENA 5E00B 1LK3L 1Q72H 2G0KA 1J87A 1MY5A 2AJXL 4RCAA 1A9EB 5TF1L 1TIUA 5SWQB 2YMXH 4IMLB 5ISZB 3P54A 5FGRA 3EHBD 1CFQA 1N0XL 2YSSA 4MS6A 5KOMC 1Y7VA 1CDIA 4O02L 5B8CA 2WSDA 2DLGA 1WH0A 3BZFA 1ASOA 1LP9F 3HHSA 4ZPTB 3MGAA 3V5DB 3ZQXA 2E47A 1DUZB 5K59F 5JDSB 2C9UA 2QSQA 4L3AA 1OARH 3LEYL 4JM2C 2N56A 3CLWA 5FM5O 1DSYA 3TWCL 3QWNA 5TE6L 5IR1B 3BWSA 2P8MA 2FHCA 3S37X 1N2RB 5G5DA 3UYPA 1OSZB 2O6CA 3W0WE 2VKWA 1ZK5A 3VXTB 4J7RA 3T3MB 2OMTA 2YAFA 4WW1A 3CGTA 3OLEA 3O8XD 2V9QA 4ZD3H 2BLFA 1JHLL 1ADQA 2VDRH 3K2IA 5F7YC 3JV5A 4AMKL 5IVNA 1TMCB 4C54A 3KHOA 2V3DA 3VD9A 4FFTA 2OR9H 4QXTA 3G6JB 2EVJA 1VKXA 2IQAB 2WVVB 4GIAA 4N2DA 2NY1D 3L5XL 3FQXA 5EC2B 2WIIB 4TN9A 5C0IB 1MQ8A 1MOEA 1G7IB 3F7VB 2BY0A 2ADGB 2X4OB 3WIIL 2DYPA 5EN2B 3V55A 3QI9B 4TSCL 2BS9A 3WFDL 4XCCL 2OMVA 1UUNA 2QMKA 4Z0BH 2YIHA 1NDGB 3A4AA 3UERA 4XOEA 1FAIL 1PJ9A 1IQWL 3FRUA 1OTUC 3GSXA 5AVQB 1J9CT 3GLEA 2W9EH 3VWKC 5E2TH 3INOA 4N2CA 3CFJB 1W2KT 3BSHA 3NN8A 1GC1H 2CNYA 1B2WL 1HDMA 4A67A 4ADIA 4X6FA 1J05B 4UF7C 1XGTA 4UTBH 2Z7WA 1E4KC 1RHHB 3ZQ9A 5F6IC 1MREH 3VFOB 3FT2B 3GSRA 5JA8B 3RQ3A 1UTDA 1KYOJ 1PJWA 4QRUA 5KVEH 4ZZKA 4WTZG 4M8UA 3BZ4A 4W9IC 4I5BB 1E2VA 3FQRA 3R1GH 1N6QH 1ZEAL 3PWUB 4PJGA 4NQEB 2QVKA 3LIZL 1H15A 3WHXB 1HHGA 4KNSA 4HUVB 3NFPB 3ARGA 3S36H 4X9HA 3QJRB 4F5CA 4JFDB 3VRLF 1CDGA 5D4JA 1W72B 4TNEA 1C8PA 4K3EH 3SGEH 1XF3A 4K2UH 4ZMXA 1YRKA 1OAJA 4M1DL 3F64A 2BNQE 3EOBB 1BZ7A 3HS9A 4WEMB 3P02A 5CJQH 2UZYB 1PZDA 1K8DA 2KUTA 5HYEA 5JO5B 3OKKA 3MGOB 4ONGL 3RVVD 3JV6A 2AZUA 2EC9T 2FT7A 5JDJA 3UIZA 4G83A 1B4JL 2A6DA 1ZKAA 1O0VA 1PBYA 1FVEA 4FFZH 2PCPB 3SCMC 1GYCA 2Z6FA 1OHQA 2A0LC 3SN6N 4ZMYA 5DSCA 5HYSB 1D6EA 4PP1C 2ZNXA 4BZ2A 5CO1A 4FQIH 4U6VL 3V4PH 1W72A 2FT8A 2AEIT 5A2KH 3R4DA 4OIAA 4JFDA 3PJLA 3PV6B 1D7FA 1RH8A 1C1EL 4KPHH 3RKDC 4EI5C 4JM2A 2OTWB 3CSTA 3C2AL 3EOYG 3VJ6B 4QRPA 2B2XL 5I0DA 4FHBD 4LPYA 4XMVA 1MFCL 2BSDA 3A22A 4AL8C 3Q5TA 5GRYA 3UZVB 3ILQD 1CFNB 4PG2A 1OTUD 4H5SA 2Z7YA 1CLYH 4OCWH 4HUWB 2BK8A 3HRZB 5EC1A 4AUJA 4NQXA 2AJVL 3VXNA 4ZO7A 1QOKA 4P23B 1IQDA 3ZHFA 5JW5B 2PPAA 1GIGL 5KANI 1DANU 1JNLL 2QVTA 2WKOA 3P11H 1YYML 4S1RL 1TCMA 3VFPB 5L4MA 4QXWA 3V6OC 2GJPA 5JHMA 1NDGA 4TNVF 2ENPA 2G9HB 5HJGA 3ZRSA 1BXVA 2XV6B 5J6SA 1OSPL 4JO3H 3QXDB 3RA7L 5EN2A 5ETUA 2BFGA 4Z18A 5GHWL 4KKLD 4POUB 3HKFA 4PRIE 3VB8A 4NDMB 4ZAKA 4TLTA 4BH7A 3AUWB 1TZIA 4NZTL 3EBHA 3B9DA 1FVCB 4G9FB 5I73C 1OE3A 3MA7A 3PV7A 4M7KH 2DD8H 5DHVA 3M07A 4MBRA 4UILH 4GY4A 2H3XC 1E8YA 1A6TB 2IV9A 3APDA 1BQSA 3U2SB 4JVPA 5IB3A 3IFNL 4Y5XB 2GBAA 5J9PB 1YECL 1OSZA 4RMTA 5B3JE 4FLOA 2X70B 4LU5H 4UDUB 1HSBA 2HVJB 3HAEB 1YEEL 1R5IA 3FU7A 4F7PB 2AC0A 2R2EB 4Q9BA 1ZHKA 1YUKB 2CJSA 4GKZA 1J1PH 3IU3B 2AS5M 4K7PX 4N2BA 2ZSWA 4HHAA 4JHAL 4NPKA 5DJ2B 2E27H 5DFTA 3BP4B 4NOBA 4M48L 4UNIA 5C0AB 3RILA 1MVUA 2EKSB 1F4YH 2FEJA 4P4RA 4WHCA 4GW5A 4PJAB 4S10A 4DN4L 4I3SL 3WXVL 5CEZL 4GKSB 4RWHA 3ZUCA 1S9KC 3CFCL 4GOSA 2V5RA 2AJYL 3UTSA 1TR7A 4UBDD 5IF0A 1HX0A 5JW4Q 1IAII 3U1PA 2VZOA 5E6UB 5L9DL 3SYAA 2H9GB 4MAYB 1JV2A 1P5UC 4JKKA 4AV4A 2ZOLA 2V2TA 1U4EA 3DTXB 4UU9A 2Y7LA 5H2BB 3EOTL 3Q01A 4G43B 1BVKB 5E94A 1KGYE 1MI5D 3EH1A 1UJTA 2BHFA 2NSMA 2P8LB 2CDGA 4JJHA 3G6AA 5GGUA 1S7VB 3FUEA 3KBPA 2IOIA 1N10A 3OHMB 4G8EA 4NKQB 4A37A 4ANWA 1FYTD 2AEOA 4ANUA 2VZ3A 3BP7B 4OFQA 4DGIL 1BSIA 2MKLC 2PN5A 3C60D 4G6AC 4JG1H 2XQBH 1X7SA 2F68X 3ZR5A 3QDJE 1YSOA 1MEXL 4QLRA 4MCMA 4XP1L 1X4YA 5I2IA 5CCGE 2WBJD 1X4XA 4QMEA 4CN4A 1AR2A 4IGBB 2AK1H 4JO2H 1PLGH 4FRWA 3TWYA 2ESVE 5DS2A 2Q7YB 3BAEL 1EWHA 2Y3AA 4DCQB 4I4WB 4XX1E 4NQCD 1OPGL 3QPXH 4LCWA 1FN4B 3BYYA 1JYVA 3ULSB 4D8PB 3I50H 1FGNH 3CK0H 1RZIB 4R4ND 2AJZA 1NLBH 4PGZA 3U0WH 3MRHA 4TPRL 4XN1A 3TZVD 4TNWK 5EOCL 4PRPB 3KVDD 3S8WA 1K6QH 2NX5D 1LO4L 4HAFA 5C0JA 3MDJA 1A66A 1AGCA 3UTTD 1CGSL 2BC4A 1W91A 1XXDC 3OKNA 4FFWC 4AY0A 1BM3L 4X8JA 4JFED 1WTGT 2OXHA 2HN7A 4N24A 3RIAK 4JRXD 5HHXH 5J1AB 2EIMB 2E7DA 3ELQA 2ZKXA 3DX7B 4NWTH 3SCMD 1ZMYA 2C9XA 4AGPA 1N64H 4NRXB 4RMSA 3N1PC 5I18L 5AG8A 1N12A 4X6DF 5EO9B 2J6EA 5F7AA 3ARDD 1JPST 2Y22A 3MRGB 2H26A 1SVZA 3TWCH 4UTBL 2JNZA 3QZPA 5AZEH 5HYJB 5IGXH 3MV8B 1GGIL 2NUTA 5AW9B 2A74B 5LCVL 3JWOC 3P40A 1I85A 4NNPH 4O2FA 4WKZA 4FHKA 2X2UA 4LL4A 4AIZA 2ADJA 5C0FA 2CM6A 3GHBH 4WTWA 1N6QL 1XB6A 2GJZA 2EDKA 2FYYA 3IAQA 2IH1A 5I1KH 2MKWA 3L3OC 2GFBB 4LGSB 4Q6IC 3MPCA 2NNRA 1OCCB 5DHMC 2UY6A 3QCTL 1ZLSH 2AI0L 4FFYH 4GBXB 3PS6A 1E3ZA 1M57B 4F2EA 4Y19E 3ZYOA 4NM4H 4TTDD 4AGMA 3GXPA 3KLAB 3Q05A 1T1YB 4KV5E 4PJEA 4YSUA 2FLRT 3AACA 4ZDHB 4PRPE 2OSYA 3OTTA 5DMKB 5IVXE 1NCWL 5F7FA 3W2DL 5EO1A 4ZSOB 1D5IL 2D7TL 5I76A 2K45A 5FA4A 2HUEA 3QIWD 3QCVH 2BVPA 1HEHC 2MCPH 3DPBA 3DV4B 3DX7A 4NQEE 1KCUL 1NBCA 1U2CA 4OCLC 5F7BA 3NFNB 3ZE0F 3W9EB 1PG7H 4C83B 1ANUA 2R23A 4TNWF 3ULUC 2WXHA 3X13B 4RDQF 4FI7A 2OMWA 3AT9A 1A1OA 2RFXB 4PS3A 1QBLH 3MJ6A 4N6RB 5AALA 5JIKA 1MCNA 4I1RA 3LSOA 1FE8H 1FFPB 3JV0A 3WLBA 3QUMA 3W0WB 5ACZA 2X09A 2A4EA 4GKLA 3L7FB 1GJWA 2YGQA 1QG3A 3H56A 3BSZH 1F4WH 4MD0A 4OZFG 4LEXL 2VABB 5DT1L 3M1OA 3ZDZF 3ARQA 1T21A 3IJSA 3LDBB 3RVUD 4M29A 3VU1A 1X5LA 4Q6KA 1IO4C 3LXBA 1I8IA 4E9WA 2G30A 2J57A 4DUWA 3VXUE 3RTQD 3P11L 3EFDL 3BVDB 3ZTNL 1A6WL 5F72S 4MMXB 3ZK0A 5FDWA 2OXGA 2GK0B 1ZVNA 2NNXA 2MCMA 1FV1B 5D4QA 1KPUB 4HSCX 4LQ1A 3BPCB 1I8KA 4MYPA 2QKIB 3O4LA 3GXIA 2ICES 2OMZA 2J8UF 4MCZA 1VSCA 3PAUA 4BK5A 1QYGL 1WZMA 2WQWA 1KBGH 2G5BB 3SOTA 1IEAA 2PPCA 3RY6C 3VRJB 4JRWA 1N0LA 4LCWE 1PZUB 2L4OA 4IRJD 2BHYA 3K71A 3FCTB 2OLDA 3L3GA 1PDKB 3RVTD 2HJKB 3TCLB 5SWZE 3DARA 1LP9E 4S2SA 1FZOA 1EJOH 3F85A 3MBEA 2Y7OA 4N1HB 3W56A 2P7TA 1S8DB 1TYEB 1PF3A 3LVEA 2OSWA 3O3DA 1ADWA 4W68A 1AMXA 4GIPD 4LCIL 2YWZA 4ACPA 5JYLA 5IG7A 1SHXA 3AMKA 3H6JA 3PWNA 2HT2C 4JKLA 1KELL 4N0FB 2B59B 5F7DA 3IDXL 3K3QA 1KGWA 2D7TH 4Y4HC 3UBXI 3VD4A 3O3EB 1XCTA 2D3NA 3G5YA 2P28B 4YDJB 1AO7E 2WLMA 4OLXL 4I2XE 5ICZB 1E4HA 1DHKA 3FTZA 2XXCB 2J2ZA 4HF5L 2CNZA 1MFAH 3SKOA 1ORQB 3J27A 4OAWA 4F7PA 2G3MA 1LJMA 4ZMAT 1RZKC 2BDNH 4R7NA 4N0YL 3ARTA 1U3JA 3EBIA 1B9KA 5E1IA 2ZXGA 4XB3A 5T1KA 3UTSE 4BZ2L 2EE0A 3GMPB 3GTTA 3PABA 5E4EC 4EJ1C 4I8DA 1NIBA 1A65A 2WWKO 2BS8A 5A2FA 1JRHL 2EDTA 2FT6A 3CVIH 4R84A 2M2DA 4NAJA 5CBAA 2F53B 1QVOA 4NO0A 4RBPH 3JBG7 4GO8A 4OCRH 1ID2A 4X0KB 3UXFA 5GS0H 3ZKXC 4L4VD 2DBLH 3GSVB 1TU2B 5GXBB 4OZGF 5HI4C 2DYRB 4M03A 4QRPD 3E7JA 1BQRA 4JCWA 1E5BA 3TT1H 5I1KL 1XZ0B 4PR5A 2E5EA 3QWQB 1A3ZA 4JE4B 4LPVA 4X9YA 4TVPD 2E59A 1XCWA 4HIHB 3B2PA 1AO7B 3PABB 4KRNA 1U8OB 4LSDA 1NFIA 1C16B 2X4UA 3CZKA 5I1AA 3KS0J 1ITBB 1J5HA 3D18A 4OJFH 2J1KA 3N41B 4DSYA 3IDNB 2JE8A 2CM5A 5LAXB 2ICWJ 4UM9B 2CRMA 1NPUA 2WUCH 2G2NA 1NOFA 2HKFL 1KZYA 2V2TB 4Z76B 3PRZA 5IVXB 3ZN6A 3WEMA 4CC4C 4F15B 3H53A 1GZHC 3FU6A 1CZ8L 5IP4A 2A77L 1RUPL 3GI8H 4TUOA 3GTNA 2CMRH 3LQAH 1FGNL 3DURA 3OL2A 4C47A 3LIUA 4AYFA 2YD9A 4CNIB 3O3DB 5INCB 4XPHL 2MHAB 3DJ9A 2XZCL 3EGSB 2B16A 1JHTA 2X1QA 2Y6TE 1DCLA 3CFTA 1UKTA 4K4KA 4NRZA 3T08A 1PLBA 5C1MB 3MRMA 3WNJA 5E08L 4HA1A 4AMWA 4MXQD 1QUNB 2FGWH 3GMLB 5HJBA 1J9SA 3FCTA 5DSCB 2AANA 1PQZA 1FVEB 1VCAA 5KSUA 3WCYA 5EF1A 2IXQB 2YJLA 5AOIA 5JQ6L 5JPMA 1JGEB 3TJHD 3P77A 2CQVA 1OCZB 2XCMC 3D3VA 1NFIB 2X4UB 1E6JH 3D7PA 4QHPA 3NJIA 4N9GA 4ANKA 4JG9A 1C1EH 3U1QA 1DR9A 3KH3A 4FMFA 3FB8A 4FG6C 4LLVB 5T33L 5LGKA 1IFGA 2CO7A 3RJQB 1F86A 3AU0A 5DUMH 4JZJC 1AKJA 2G3ZA 3GI9H 4WTXA 5HI3C 4XB8A 1EGJH 4MKTA 4HOZA 3VDAA 3CZGA 4HUVA 3JZYA 1UQSB 5IBUG 1GR7A 5KOVC 1A4BA 4DTGH 1QLFA 3MLVH 1QLRB 2UZIH 3GBNH 4AEEA 2HJLA 5IIEA 3GM0A 3LPFA 3W1ZA 2DQGH 4PJBB 3B9KC 2P3YA 3C6LB 2JB5H 4WWPA 3ARGC 1T04A 1D6VH 5E51A 3BZ4B 3FYIB 1EFXB 1IKOP 1HXMA 1REIA 2DQGL 3GRGA 4I2XB 3SKUD 2BCKA 2HFGL 5F7EH 2X4NB 5D1QE 4X6BB 1KZQA 2GTQA 5I6PA 4YXLL 5DD0L 1N70A 1CMOA 3VFOA 1SNRA 3VFPA 4XPBH 1QR1A 3GHPA 4CJ0A 3FQUA 3JQOB 4QRRB 1KTKE 4G7QB 1MJJB 4D0BB 1P5UB 5IB1A 1LGVA 2IANB 1X9QA 3ILEA 2WQVA 4MD4A 4PJCA 3QPQC 4U6HB 3GXDA 1GKOA 4I89A 5E1GA 2J6WA 3TZVA 2GEEA 5LDSA 4F7EA 4PSRA 2SODB 3MUGA 5EO1B 3JXAA 4I85A 4PVMA 1AFVH 2VMJA 1KC5L 2FX9L 2DWEA 3I3EA 5DJ0A 4K9EL 1CLOL 1CVSC 4UILL 5EEYA 3QDJB 4F91B 3F00A 2L7UA 3O4OC 2Y24A 4FQQA 4M1CC 3UGUA 5JXAL 3L3DB 2VIRB 3S36L 2HG0A 4OLZL 2J25A 2ZPKL 1ZK9A 2XV2A 4ZSOE 3HBGA 5JW3L 3MHZA 4KKAD 1XIWB 2R4SH 4AZUA 2GY7B 5HYSA 4PWKA 4IS6A 2XN1A 3D87B 1QABA 1KIQB 3PWPA 2W60B 1JPFB 1YEGH 1KTDA 1YN6B 2AFNA 3THML 3PUCA 3FZUD 4PBWD 1H19A 3QORB 1F11B 3QISA 5DXWA 3QC5X 3GUTB 1EK3A 5DHYB 1UFUA 1MCPH 1TJIH 4EXPX 1KPVB 5BJTB 2C3HA 3ARGB 2DIJA 3PQYB 5E9NA 2OX5A 1A4KA 3MRKB 3QUZC 4L4VA 4X5WB 1W0VB 4ENED 4AMXA 2PPFA 3N43F 1DTUA 3JSSA 4QTIH 4C56E 3AFLA 1X5MA 3BCDA 4OQTH 1G43A 4JM4L 4LESA 5E23A 4AQAB 7CGTA 5DDHB 3D3VE 3K0YA 1U2HA 3PJNA 1DQLH 2VLJA 2AK4D 1E6OL 3GSUB 3O8XC 5I9QC 3TVMC 3BPLC 5FK9B 3RY4A 4FI8A 3EAKA 1YQVL 5BO1H 4MZRA 5GS0C 5ICYA 3ESMA 1LEIA 4HXAH 3EYQC 2DWSA 2E8YA 2NY2D 5TH2B 3H2WA 2DI8A 4M8VA 2RHEA 1HOEA 5JPNC 3GMMA 4LCWB 3EF7A 3OG6B 1QEWB 4HIJA 1Z9SA 1XV8A 3C60B 3ORJA 3X11A 5DUBB 1W8EA 1FL5A 1RK7A 5EIQA 2PXYB 4BFJA 3P0YH 1T80A 2DEXX 1H8SA 4M1DH 4WU7A 5DRZA 4D7BA 4AV0A 3GS7A 4MA7L 1D5MA 3KGTA 3ARUA 3VVWA 4XZUB 3RWDA 4U31A 1M2VB 1CK0H 3CN1A 4HKBB 3VQLA 2AXHA 3WNOA 4HBQA 2FJFA 4P46A 4OF3A 2BSSA 1PYWB 5F71A 3ZDYE 2YSTA 2P5WA 3D9AH 4ODSH 5KYWB 4OLWL 3BN9D 4WDIA 2VWEC 5FOBB 3SGDH 4OF5A 2ZD0A 4I18B 2BWDA 5CP7B 4BA8A 4M93C 1UB6B 4XBEL 4XPGH 3DJTA 2XWEA 3F04A 2AV7B 4KO6A 4UU9B 4WKZB 5T5NF 5E99H 5IR1A 5EIIB 4YZWA 1DN0A 1JF6A 3B2XA 3FHAA 3LKPB 4U0RB 5CUSL 4G5ZL 3TPUB 1YY9D 3RNQA 3CHSA 3OB8A 4LLUB 1EDQA 3MRGA 2D9QB 4A7GF 4ZYKB 5GRVK 2H32A 1EZVY 2GJ6B 1XMEB 3A67L 4U33A 1JI2A 4XCCH 4ZYKA 3MJGX 1G1KA 5IBTH 3GMRA 3PL6A 1YYMH 4S1RH 4HXBL 5KS9E 2XVLA 4JFFE 1I1FA 1YN7B 3Q5YA 4QHMA 1WD9A 2R1YB 4IU2A 5I6LA 5KSAA 3GHEH 4LPTA 4JM2D 2O6DA 3WUZA 3FU7B 2ZUTA 3ZMEA 3WHE0 4ZS6D 4ZTOH 15C8L 2CDFA 2LFGA 3SO5A 1O7SA 1CQYA 4NKDB 1R3IL 4ES9A 3ZE1F 3SPJA 5IJKC 3GLZA 3ULSA 2H6PB 4D8PA 1AIZA 4V33A 4NCC1 4IEFA 3RPIA 1XF1A 1E4XI 4AG4L 4DKTA 4N6QA 3WJLA 3K74B 1HKLH 2B7DT 1WWBX 4U6YB 3POHA 3W39A 5J0BA 1KENH 4NC1C 2Z8WC 4XVUD 3CJJA 5F7NC 4E9SA 2ISDA 3VTMA 1I8MB 3RVWC 5GQBA 1JWSA 2K8MA 2Z1PA 4YXHL 3OKOA 3L1OH 4AX3A 5JIQA 4KZDH 3R0NA 1B4LA 3OPZH 1AGDB 1S78C 4LKCB 1L9OA 4NEHB 5SWZA 5L2KD 4N5EC 2BFVL 1VGKA 2G9HA 3BSZA 3KWXA 1FNGB 2AJUH 1XF4A 2FB4L 3OKMB 1D3CA 4JY4B 1HCVA 3I9PA 3S0PA 4B3VA 5ITBH 4M1CD 4KKCC 1LO5B 3VA6A 2WUBH 2FD6L 1M2OA 3QUXB 1SPDA 5TH2A 1P53A 4OKVB 1I9RH 5ICYB 1J0ZA 3PE9A 3QDMB 1G7PB 1U91A 1WHOA 4QT5A 3C08L 2ZOLB 2WQXA 4LOFA 1DVXA 4N8UA 4KKLC 2IDCA 5F6HI 3L9RB 3SDYL 3LS5L 2CAKA 3I6KB 2G2PA 3RI5F 2OMXA 2VAAA 4P5MB 1G0XA 2MPAL 4QRPB 3LQZA 3P73B 4XPTH 4E5XG 5KYXB 4IRSA 1NJ9B 3DXAD 3NA9L 4OFYA 4OGXL 5AVSB 4L4VB 4X5WA 2H32B 5ID0A 3EO9H 1WEJL 3VQ1C 1KDJA 1ZV2A 2P80A 4AH2A 1T2QH 3LNEA 2LHAA 3NVQA 2F53D 2DYPD 4FFYA 4XMUA 1MFBH 4J3OC 3FCGA 4OIIL 1HSBB 1YAIA 2HVJA 1UM6H 3SY0B 3D08A 1CPUA 2EEXA 2NTFB 2WK2A 4B9IA 3ZMNA 3TF4A 4K23L 4Q6YA 1H3VA 2XZAH 1MJUL 1A7BA 4LMQE 3P2DA 4HFUH 3F83A 1A0QH 4OI9A 1J18A 1R3LB 2B39A 2ESVD 3BLPX 1JZ7A 4L0YA 5IHZA 2XKNA 2X4QA 1MIML 2FWUA 1Q94B 4OF0A 3CBJB 1F3DJ 3LKRB 3ZLQC 1K8IB 2V3EA 1FIGH 2NR6D 4U1JA 1CFMA 2X05A 4RBPK 3NJGA 1F42A 1PD6A 4XRCA 5FYJU 4FQCH 3QSKB 1AIFB 1D5MB 2NY7H 3EIFA 3UAEA 3DHJA 4RSYA 4RZCA 1LNUB 4OLXH 1SF3A 4NI6A 1RFDH 5F21B 5CXPA 3VGHA 2DMKA 2MNWA 5FO7B 2E7LA 2V6HA 4U6XB 1NFDF 4XN4A 1ASQA 3FT2A 2EP6A 2VXTH 3QCUH 3E6FB 1PLCA 3L3HB 4MKMA 2JQAA 1MNNA 2BERA 2HFFB 1J7VR 4EOWL 2X10A 1OT1A 1X5FA 4QF1A 3L3HA 3FQUB 4RAVA 4A2LA 1H0DA 1MHHA 1MKFA 3WIHA 1NGQL 3QYMA 3FO2B 3GJFA 1JS4A 3QUYB 3SQBB 4GG8B 2WKLA 1BD2A 5I1HL 1AQKL 2FZ3B 5FO7A 1FNFA 2EDWA 4HKZA 1TPXB 2RH0A 4PFEA 3D0AA 2QLVB 4KQ4L 4KZEL 4PJBA 4PRAB 5I1HH 1W0VA 5D7LD 3ILPB 1VFMA 2DM3A 3VXMD 2AHIA 2CO1A 2EE9A 1U8CB 5BRZA 1KIRA 2DQEH 1X3DA 3QNYA 4OJDH 1ZLVH 3BUQA 4L8SB 1G7JB 2YJQA 4NJ9L 1P7BA 2CUMA 5FW7A 2WSKA 1B90A 1UT2A 3FB8B 2OW6A 1AZUA 1NUFA 2NUPB 4N2AA 5IFAH 3QG6A 1BZ9B 3GT6A 1LILA 3QB7C 3EJCA 4WSGA 3OHXC 1DJSA 3RZCC 2F9BT 3KPRA 4NC2B 4FQJL 2NZIA 4OJYA 3QJVB 3V4PL 4H7VA 2WJ7A 4TVPE 4HG4K 3ML9A 3P9MA 2EIKB 5C8JB 5IBLC 1YY9C 3SZ6A 5CEZE 3NFPA 3RBSA 2Z8VC 5LNDA 1FNAA 3AMLA 4NRZB 3ETBF 5FYLL 2Q8AL 4H8WC 3QDJA 3L9BA 1BP3B 1FDLH 4DP6X 1DVFA 2CBPA 3KPOA 1FLRH 4IOIB 4YWGL 1FHNA 3VYOA 5KSBF 3B2DC 2PYFB 3SIKA 1OPGH 3EJJX 4OB5H 2VJ8A 2IBBA 3WFEH 1R3HB 4JDTH 3GSRB 1NCCH 1EDYA 3EFFB 1IKNC 4EZLA 3KPNB 5HHOB 2XTJD 3B8SA 4FQ1L 4LSPH 3GXNA 3QDMA 4CN6A 4E41A 1O7DE 3SDXF 1JGVH 3KNBA 3IDGA 2WN3A 1WPCA 1DE4B 3NESA 4UIMA 3WDHA 2ZAGA 5DGQA 4GQ9L 2X4NA 5I6NA 4AQ1A 4KHTL 5B38B 1EEZB 1UB5A 1B0RB 3OAZH 4ZRGA 1A3LL 3V6OA 3ARWA 4KI5C 4JW3A 1DVFD 1GS6X 3QI9A 1GZHA 2VCOA 4HFUL 4J3BA 3T0WA 2C4XA 4J3UA 4OUOA 3RWJA 1CL7L 5BW7A 1GZPA 1AIFA 2PCYA 2O61A 5HDLA 5I24A 2OL3L 1CE6A 1RMFH 2F5AH 3FQXB 1B9ZA 3KLHC 3NZHH 3MCKB 3I9GH 1L6ZA 1KCVL 2AABL 5A2BA 1AE6H 3BH8B 4OCXL 1MRCH 1MZYA 2GI7A 5C0RL 1MCSA 2IDFA 5DYOB 4O02A 2QPFA 2NMSA 4Y5YA 5IW6B 4UQEA 1FZKB 2OMTB 2E6PA 4R4NC 4JVWA 3CFKB 3UGEA 5KYUA 2F54B 4UIKL 3O3UN 4WFHD 4Z7OF 5KSAB 3GXTA 3PHQB 1QUNA 1YYLL 5E4IA 4U2YA 1DUZA 1K4CB 3L5WB 5IQ9B 4M7LH 1CDCA 2MJWA 3BEVB 3VXMA 3L3OB 5C6WH 4UTAH 2MEJB 1JZ2A 2NY5L 3NABH 3QI9C 1FIEA 5C0EA 4MA1B 3FT4A 5ANME 3S4SB 2A6IB 2CXKA 2WBJB 5LGHH 2VE6B 5DRWB 2H3KA 3WEXB 2WVSA 3OBAA 4A38A 4YPJA 2JFCA 4X0NA 2FX8H 5DJ6A 5E8NB 2BWQA 2QPUA 5DC2A 3E1ZA 4P5RA 5E4EB 5CILH 1DEEB 1U3HB 4Y1SA 1KXQA 1AZZC 5LHDA 3Q13A 2H0FA 1WZ1H 4R7VA 1NUNB 2VAJA 2DQMA 1HL9A 4P8QA 2Y7MA 4QD2E 3SKJH 4IM8A 4CSZA 4E0RA 2GHZA 5DLML 5I1CH 5DWPA 3OF6D 4KROB 4R0LB 2EDBA 3NG5A 2RD0A 4XMKL 3BPCA 4FZ8H 1MJ7L 4N8CL 5E8DH 1ETZB 3CVHB 1OAUH 4HZLA 3V0VB 3V5KB 1J1PL 2ZYIA 3IF1B 5HHVL 1AGEB 3BUPA 4XTRD 1D5ZA 4DEPB 3NAAH 4GRWF 5AVYB 3OG4B 3ECQA 3OJDB 2EE6A 3D06A 1NCGA 3BI9X 3X14B 3QFDB 1A6AA 1P4BH 3TBCA 1IAIH 2WNKA 1FL5B 4JN1L 1Z9SB 3C60A 1TMQA 4DQOL 2G0LA 1FSKC 4NP4H 3V6ZA 4XPFH 2XFXB 2LV4A 3FFDA 4JN1H 2XG4A 3PWPE 1E4WL 1EJ8A 2Z3FA 1BBJB 1MRDL 1X7TA 1FIGL 2NY6D 2AJ3A 1QTYT 2ICEC 4KXZI 4UMGA 4APXB 5IB3B 1RAMA 4A1RA 4YDZA 1U92B 2WANA 2DI9A 4BE6A 1D2OA 1RZFH 4OLUL 2R1YA 5I0WA 2VXQL 5FV1L 1QFWM 3F7YA 3NJVA 4R4FH 2YBRA 5GISL 3AXLA 3S8GB 2LU7A 2YARA 3OMAB 2AXJA 1XEUA 2YUWA 3M88A 5CLZA 1T1WB 5A1AA 3QDGE 2B59A 5DF0A 4QIRA 3ZZSA 4Y4FA 1N5YL 5DQ9A 2Y7NA