4B53A

Crystal structure of the isolated igg4 ch3 domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
EPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords IG GAMMA-4 CHAIN C REGION
publication title Crystal Structure of the Human Igg4 C(H)3 Dimer Reveals the Role of Arg409 in the Mechanism of Fab-Arm Exchange.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4b53A00
1BAFL 1KTDB 4YHOL 4KK8D 4M8QA 3VCLB 5FK9A 5L88H 3O3DB 2NY3B 5IFAL 3GMNA 4KVNL 4PJBB 4RWYL 5CP7B 2NQCA 3MXWH 5C9KA 4WFHD 5EIVA 3GRWA 3NCJH 3V52H 4JM2D 4GW1B 2D31B 1NJ9A 4S10A 1RZFH 4XAKD 5CD3A 3W39A 4DEPC 5CGYC 3MRNA 1LO4H 2BNRB 2QSTA 4G6ML 1QFWM 1NGYB 5CJOL 5KSBF 3KYKL 4M6MH 1BEYL 5IG7B 2P5EB 4MS8D 3GJFH 2UV3A 3OJ2C 3U0TB 5GGRA 4HWBA 4WEUD 3STZA 4K3JH 1HHHA 3MUHL 3BH8B 2H32H 1QBLL 3P30L 2E5EA 4HAFA 4KRPD 4F57L 3QB7C 2VITB 4I4WB 2FECI 4LLUA 3ILPB 5J7CC 1ZLSH 4MX7A 3PABB 2V2XB 2RBLA 2UZIH 4LCYA 3HE6C 2Q8AL 4L29B 1FZJA 4ZQKB 3QUYC 1F2QA 1OAZL 3MUGB 2DM2A 1MFAH 3B6SA 5BO1H 3GKWH 3WIFA 3SKOB 1JI2A 4JDVB 3A6BH 4JRXB 4Z7VB 4PIRF 5JPNA 5DR5H 5JO5A 1XF2A 4YO0A 5FFLA 4MHHG 2ADGB 4MNHA 3H9HB 5FOJA 4J3TA 3PWPD 4PJ5B 2YC1B 4MCYA 2Y4SA 2DQEL 2X05A 1AHWB 3QCUH 3V4VH 3BP4B 1YEGH 1F4YL 5DJ2A 2O5XH 3NCBB 2Z93A 3D1MC 4LKCA 4OZIB 3L9RA 1BECA 5IM7B 1IC5H 2FJFB 4WDIA 4NZRH 3DVNB 4JFYA 4NOFA 2XY1A 1WTLA 3HA0A 3EDEA 3S4SA 4KI5E 5HGDB 5ALCL 5FB8A 5IF0B 4YBQC 3T0AA 4HWEL 1C5DB 4LPXA 1NH6A 1AGDB 3K7UA 4RDQF 4G9FE 2YPLB 4PS4H 1E28B 2CXKA 3QQ4B 3CGTA 3EZJB 3FAWA 1UJTA 5HVHC 3MRBA 4PRNA 3T4AB 2P8PB 3BWAA 1F3DH 1U8QB 3DI3B 5F1IB 2AJUL 4LARL 4WNQB 4B50A 2WBWB 2VZOA 1KSRA 2WUCH 4FFYH 2APVA 3RPIB 3K2UH 2R2EA 3QUZC 3BP7B 5AUMB 1A7RL 3GHBL 3LKSB 2BJML 5BV7H 1PDKA 1IM9D 1J0YA 5F96H 1X5FA 1MEXL 1LD9B 4H5SA 4PJIA 2XA8L 3QH3B 4LLMB 5IMKA 1FO0L 3UCRA 1PBYA 2EDKA 5JW4N 2DQGH 1J5OH 3CLEH 5J3HC 3O45B 5MENA 3B9AA 1H3VA 3T8XB 3WHXA 3U2SB 4XB8A 4LNVA 5HI5C 1MELA 2AW2A 4JANB 1WWWX 4FHBD 4QWWC 4QXTB 4NKIL 1T1WA 4XPFL 3O81A 1DBKL 2AXHA 3HC0A 3PL6D 1NCNA 1TZGL 3MPCA 3E6HB 3FO1B 1T04B 1REIA 2Y07L 2Q76B 3D2UA 4C4KO 4PY8J 4F7TB 3HNSL 2XTLA 3OV6A 2YUWA 2ATKA 5E8OB 4LLYA 4QTHA 2YA0A 2FIRT 1DANU 4AIOA 2ZOKA 5KVGH 1CE6A 3MFFB 4NT6A 3IF1A 4NNYB 4K55A 4ETYA 3DGGA 4HK3N 4JFZH 5TF1H 4TNVF 2BY3A 3IJSA 3DVFA 3MYJB 3FOMA 3GBNH 1YN7A 1VGEH 1NGWB 2V9RA 1OLZA 3LKOB 4MDJA 1C12B 1HOCB 2OR9H 4K3EH 5K9QI 3G5XB 3MLSL 2NY1B 5KW9H 4QXWA 3C6LC 2W9EL 3QJHA 3GJFB 2DQDL 4X8JB 5E0QA 5DVLA 2NY2B 1YPZF 3BPCB 2H32B 1VHPA 3D25B 5F88B 2B7DT 4RAUB 3VI3E 1I9JL 1FNFA 5E8NB 2PYFA 5AYUL 3S36X 2Q20A 4KQ4H 3MCLL 1TIUA 1A64A 1BBDH 3WYRA 1JYXA 4IDJL 3L3DB 1CBVL 4IJ3B 1OSPL 3IFNL 3MLRL 1JPST 1YA5A 4LPTA 1FL5A 5GZND 4DN3L 4RNRB 1U3HA 4EKXA 3FKUS 1UWGL 1FVDA 2Q7YA 2QKIA 3LPWA 4PTUA 4W6YB 1B0WA 4PLKD 4OLZH 1OP9A 1EZVX 3IVKA 1UM6H 1EUUA 2OTWA 2CK0H 2VDMH 3C60D 4P2OB 5HHNA 1PLGH 3A6OA 5IKCA 4NNPH 4F33B 5HHXL 4HIHB 3CX5J 4GRWF 2R8SH 1T83C 2W60A 2YMXL 4WY7H 5FOBB 1WJ3A 3IDIB 4I2XB 3OAUL 4L3AA 4G6KH 3DO3A 4MA1B 3GUTB 1JFQL 3MRPA 3BEWA 4M7KL 1AR1C 3DV6A 2Z0BA 4Y19A 2PUQT 5D1XB 1CIDA 4S1DD 3D3VE 3LQAH 4NBXB 2VAAA 1CTNA 2FHBA 4P2RB 1KACB 4I0PC 2AEIT 5TH2A 1JPFA 1I7UA 4U1LB 1RY7B 1FHGA 4GRLC 4ZUVB 3FQXA 4D9QE 3PDOB 3BPNB 1QRKA 2WIIA 5DHVA 5IB3B 3GNML 4YJZL 1HILA 5DT1L 4E41E 1NEZB 1X5KA 5DHYA 2Z31D 1MCHA 1XF5B 3VXTB 5LXGH 1BF8A 4JFDE 2PNDA 5BV7B 2MWCA 3HLAA 2QLVB 2OTUA 3ECBB 5GGTL 3S35L 3VFRB 3T0EA 3V0VA 4M61B 1JV5A 3VWKB 2EIBA 4KKBC 1J05B 5F3BB 3BKYL 1A1NA 1VEPA 3QEQB 1UVQB 5MP6L 3WKNA 2VOTA 3JV0A 2PYEA 4P2CG 2H3NB 3IU4H 4H0IA 3GB7A 1J8HD 3CX5K 1OAQL 2F5BH 1NBVL 4LLWA 4MJ5A 4ORGB 4EI5B 4CADA 4OQ1A 5I8CA 2BVQA 3SOBH 3TVMC 3IDMA 2Q1EA 5I1EL 2B5IC 2EYTB 4KK5D 3U0PA 3O6KH 3P3YA 2YK1L 3VGAC 4AENB 3B9DA 3OKOA 1LEKB 4UNVA 3E3QE 1FFRA 1YPZE 4HK0B 3W11D 3TN0B 4LSUH 1Y18A 1U8KB 1F4WL 4HD9A 1EVTC 2F58H 1JE6A 5SV3A 4P23B 1M6OB 2QJDA 1ND0B 3WXVH 4M6AA 5ISZA 3OKNA 1AKJA 2RCSL 4XCCH 4JZNA 1IGMH 5E5MB 4PRHA 1IZJA 1T7ZA 3BGFC 3CFBB 1KJMA 4J12A 3TESA 4GT7A 5EBGA 5CCKH 2WINA 3MXVL 5HSFA 4KHXH 3QUXA 4X6FA 4LSDA 5DUBB 3MRIA 4XCEB 2B4CL 2DL9A 5EIQA 1R0AH 1PKQB 5DD3H 4WW2A 4GKSA 3RI5K 5I9QC 5EZJB 3ARGC 5CJ5A 2K7QA 4X5WB 5EZLB 2JCCB 3C2AL 4KRPC 4YEEA 1Z3GH 4OCWL 1OCWH 3SE4A 3D85B 2EE9A 1HN1A 4OT1H 3L3HB 4R26H 5IW1A 2I9TA 1DR9A 1D5ZA 8FABA 1HHKA 4TUKH 1WAAA 1U3YA 3ROLA 5MEQA 1LP9E 4Y4KC 3QNXB 3TCLA 3OF6A 2YSSB 3BJ91 2QEJA 1Q9KB 5IHLB 3PHOA 4WI5A 1WBYA 4HH9B 1EEYB 1FH5H 1U8PB 3F12A 1HHGA 2J4WH 5J11C 1AQDB 4ZDHB 4KK9D 2H41A 1N8ZA 4ZUSB 4NN5B 4MJ6B 1ZLWK 2P43B 1ORSB 2XN9D 4HDIA 4KRLB 4Z5RB 3TO2B 3KPOA 3QFJD 1QLEL 4YPJA 4EN3A 3TIEA 3ALXA 1OGTA 3MJ7A 4OQTH 3TO4A 5ESAB 3O6FD 4WHTA 3VFMB 2EH8H 2DLFL 4O58H 4QRRB 2X4OA 3UYRL 3V9FA 5HGBA 1BX2A 1FNSL 3TBSB 5F7WC 1TJGH 1M7IB 2D7NA 2C26A 5E56A 2FD6H 4O5LH 4TVPL 2AJVH 3VXPA 4PJIF 4U33A 3ZTJG 3IDJB 1JGUH 3VRLF 5CJQH 1KTLA 4OCRL 4OV5B 4LP5A 3EDKA 2O61B 4YK4B 2VDRH 4MD4A 2MCPL 3MV8E 5C0RL 2WK2A 3T0DA 1F4XL 1S7VA 2V5SA 2HN7B 4Q6IC 1KB9J 3LV3A 4O2EA 3BMVA 4RIRA 4OCYH 2I25N 3QXUA 4RA3A 4OUUA 4LLVA 1DQMH 4YDJB 2UY7A 2FECL 1ES0B 3SDXB 3CVHA 5EIIB 1QG3A 4ZPVA 5MERA 5D7JC 4F7CA 1N0XH 6FABH 5DJCA 4ODXA 5E5RB 2YD9A 4DGIH 4KKAC 1CE1L 5T3ZE 1J1XL 1R5IA 2FYYB 3T3ME 4BQCA 1WIOA 4HCRA 5BRZB 2EZ0C 5J9PB 3DMMA 2XPGB 4JZJB 4PBWD 5DRNB 4N0FA 3ARBC 3BIKA 3FB7A 3D18A 4GXUM 3DYOA 3FONA 2XY2A 1UKQA 2YD4A 1S8DB 5B4MC 5LBSL 2AK4E 2FX8H 3V6OC 5GS2H 4Z8FL 1S7SA 3BOVA 3D39B 2P8MB 4WI6A 1QBBA 4PJ7A 5DTFB 5CIPH 3DECA 3HFMH 3TZVB 4Z7WB 1OAKH 1JGLL 3O2DL 2BOCB 1U8JA 1Q9OA 5FO9B 2DQTL 4G8IB 1S5IH 1MSPA 3NPZB 2VLJB 4GUPB 4E0RA 3W82A 3VFPA 4N5EC 2GFBB 4NPYA 5GGVH 3IRZA 3I75A 5E94A 5A40E 3AS3A 3FRPG 3WE6A 3S37L 3QDMD 4Y5VA 5IT2L 4EDWL 2VL5B 3KYMA 3MRQB 2X5PA 3V5DA 5HGAB 4MD0A 1KB9K 2NY5L 5FHBL 2G60H 1FYTA 1SYVA 4LMQI 3INUH 1WC7A 3QISA 1EERB 5L8KB 1OAYL 2NY6D 4XX1G 3U4BH 3Q6FB 3IETA 3DHJA 4J4PC 3MV7B 1OF2B 4QLRA 4X6BA 5C0FB 2PN5A 3KR3L 1MCWW 1P7HL 1P4LA 1CTOA 1JJUA 1RZFL 2C7UB 3U30B 3MRDA 4UT6H 4XMKH 3PWNB 3N50A 2DICA 1CXEA 5GZNC 3RHWK 4WW1B 1X4ZA 4G80B 3EGSB 1FNLA 2IGFH 4R96A 4M6ML 1UA6H 3ZDYE 1YY8A 2VXUL 4PLKC 4K3JL 2AKRB 3NCFB 4WHDA 4FQQA 3RDTB 1MHCA 1UT9A 4CN4A 4PJIE 5E4IA 3O2VH 3IXTA 4UBDC 1ZLSL 1MCIA 2HT4D 1YEEH 2J8OA 3HNVL 2CLVA 2M8XA 2UZIL 2CRYA 3GKWL 5BO1L 3SGJC 1RZIA 5SWSD 4X7TB 3A6BL 4HIXH 1SBSH 3ARPA 1YN6B 5E9DD 2NY3D 4PY8I 3EJYD 3OHXA 1GC1C 4W68A 4XI5D 3C5JA 1AY1H 3CLFH 4G8EB 1X6NA 1BZ7A 3CUPB 1K3IA 4J3SA 3RVTD 1YEGL 4HGWB 2A9NH 3RWDB 2O5XL 5JW3L 3KVQA 5JR1H 5GGUA 1H0DB 5IJVB 3DUSB 1V8HA 2OR7A 5ILTL 4YHLH 1H3PL 1MCKA 5BS0E 1AXSB 1IGJB 3LPFA 2BNRD 1XF4A 4BZ1L 1D6EA 5EU6A 4KUCF 4YBLC 3LCYA 1IM3B 3LRHA 4KPHH 3G5YA 3KXFB 4OF7A 4C57C 3EOBB 2VXQH 1M7DB 5CEYB 1F90H 2FJGA 1J11A 5DQ9B 4PS4L 4NDMA 4JLRA 3THMH 5DJ0B 4Y1AB 4HZLB 3L3OA 1NEZG 4MMXC 4JO2H 1R3LA 2Z4QA 2FWOA 4GAYB 1QQDA 2AV1B 5C92A 5D7KE 3U0WH 3V4UH 4HLZH 4KRNA 2XWBA 1HSAB 4JRXD 4Z0XA 1NMCB 3K2UL 1P7KB 2CH8A 5KOVC 3KPPA 4X4XB 3RA7H 1A3RH 3RWGA 3LSOA 4M7LH 5BV7L 2ZUYA 4PJ5D 3IDYB 4UTAL 3OPZH 5IEHB 1QRND 5EU5B 4M3JA 4NKOA 2HTKD 1Q72H 4PY7A 5DHXB 3I3BA 2YRLA 4TVPD 1RURL 3W11C 2Y25A 5CIPB 5SWZA 2AJZB 3BN9D 1MCFA 1FG2A 2GJJA 5HY9A 4K23H 1QHPA 5DURB 2RIKA 3H9SA 4XNQB 4ZAKB 5EO0A 4U1JA 5IIEB 3QPQD 1KB5A 4KJQD 3BQUB 3QXWA 3SDAA 4GMSH 1VSCA 3GGWA 4WW2F 4G43B 4B0MM 1NBYB 1KBGH 1CDHA 3VXUD 1ZE3C 5JIKA 5L7XL 1JZ3A 2YPLD 3IAGC 1UXSB 1S5HA 2UYLB 5B8CA 5ICYA 2X9XA 4HF5H 4WI2A 3FCTA 3LKQA 2VWEE 1T5XA 3CC5A 3W0WA 4KDTC 1IGYA 1WAAF 4OLYL 2GTZA 4D3CL 1JZ7A 4WI8A 4I18B 3H3KA 1KLGA 1WITA 3QI9A 5DA0B 3R06B 5B3JF 1I7TA 4PD4J 4PV8B 1U8HB 2NXZB 3RWIB 5I71C 1PG7L 4JFZL 3QFDB 2YD8A 1NAML 2CDGB 3H7BB 1BWMA 3UPRB 1JRHH 3GBNL 1CGTA 1G7IA 1VGEL 4AIZA 5CEXA 5HYEA 2IPKA 3GMRB 2X4QB 4X7EC 2OR9L 4MNQA 1VFUA 1AQKL 2YUZA 1I8MB 1Z9SA 3QWOB 3P0GB 4R97C 3TJEL 3WS3A 1GRWA 3OX8B 2W92A 4KKNA 1NLDH 5CWSB 1DZBA 3BKJH 3T0EE 1P6FA 4WFHE 2C4XA 1UH2A 2MKLC 3VXSD 5C08A 5DSCB 4P3DA 3T2PA 1F11B 2HFEB 4NUJB 4U1MB 4XAKE 2V2TB 3LN4A 3B9VA 3I6LD 3DHMA 4LL9A 4LLDB 4DGYH 1OGAB 3WJJC 5FM4A 3L95A 1S3KH 4C58B 1GOFA 1BD2B 43C9B 2CIIA 2WAHA 4HIJA 4JPIA 3IFOA 1RJCA 4WWKB 1JTTA 1T66C 5IR1B 4UDUB 2A74A 1WTGT 5L9DH 4JPWH 3C5ZD 4DAGH 1CFSB 1SEQH 4K7PY 3ULVL 3DXAA 2CK0L 3CFJB 1P84J 1PLGL 2OQJA 3DX9A 4Y7MA 5TDPA 4NKMB 3PGDB 1G7LB 1VADB 4PD4K 1FAIL 4UU9A 4XPHH 4PRPD 2BVPB 3KYOB 3QPXH 4HFWA 4YEFA 3W9EB 2CIKA 4ZFZA 4M1GH 1Y0LA 4Q9QH 4OBRA 3LKRA 1ZGLP 4G6KL 1NCAH 4PJCF 1T21A 3ARDB 2R2HA 1I1AB 4HUUA 3IFPA 2NY2D 3PWPE 4V1DA 5KVMC 4K3GA 4XWGL 5ANME 3SHSA 4L4VB 4LGSB 4ZOBA 3JUZA 2B1HL 3CSPA 5F6IC 5FYJH 3F58L 4KMLB 4M5YH 2BNQB 3ILQD 2DMKA 3MOBH 3B83A 1JF5A 4I48A 2HLFD 1J0JA 5LGHL 5E03A 2R4SH 4PJ7F 4QF1B 2FH6A 3H9ZA 4K71B 4ZTPH 1OP3H 4MJ4A 1FFOA 2BFVH 4JG1H 3P9MB 2BOBA 3FRUB 1JRHI 4NP4L 3KPRA 3MODL 4EIZC 1UKSA 5F9WB 2EE6A 2WLZA 3F7RA 3OKYA 5KG9A 1FL3A 4CN1A 4PJEE 3DNKA 4P2OD 5F7MC 4HKZA 4NWTH 4J7RA 2EDBA 5IVZB 1BOGA 1IAMA 4XCFH 1P84K 4Z78A 5C0BA 5FGSA 1I9EA 4WHYH 2F8OA 4U6YA 2HAZA 5C0IA 4OZ4B 1KJ3H 1BJ8A 1KPVA 2F5BL 2GK2A 3TBVB 12E8H 2H2PD 5CBAA 2X70A 5B38A 2YWYA 3HS0B 5IROC 3O3AB 3ZE0E 1CVSC 4S2SA 3SOBL 5D1XD 4FTVA 2RR3A 4OIIL 3EDJA 5E6IC 5E2TL 3VXRB 3BE1L 1ONQB 3MRLB 1KELH 4N1EA 3AREA 2ADIB 3MLWH 3MA9H 1NCWH 3KJ4B 3UEZA 5ICZA 4LSUL 4FQ1H 2QQKH 1TCMA 2YZ8A 3TPKA 4PJHE 4CMHB 2XXMB 1NEUA 2FEDD 2K3TA 4DTGH 3RL2B 5LCVH 3TBTA 5JPMA 5DUMH 2A6JA 4S11A 3NAAH 3GO1L 3O9WB 4KKCD 2OZ4A 3RBSA 4GG6B 3WXVL 2ICCA 1IEHA 2VQ1B 4XCCL 1JTOA 2I9LB 3T1FB 5BOPA 1IGML 1NCDL 1KEGL 3UTTA 4GAFB 5C0AA 4C4KT 3ZKMD 3ZTNL 3B3IB 4L8DA 3DX6B 4RWHA 5DK0B 1A4JA 5FCSH 4CGTA 1DLHA 1S7XB 2CLRA 3QEQD 2AJSL 4AIXA 3B8SA 3HMXA 4MB4A 4PJ9C 2F15A 4PRIB 1G9MH 5DJZA 3RIAF 1R0AL 3LDBC 3BP6B 5DD3L 2VZSA 4ZFFA 3I84A 3SJVB 4EI6A 4JHZA 1MJUH 3B5GA 4EI5D 1AI1H 2GK0B 3LRSA 3UTZA 1A1MB 4NQSB 1Z3GL 3PWLA 1E4JA 3FTGA 3JSSA 2HT4C 4JQXC 1T4KA 4UT9L 4OT1L 5EWIL 3OKLA 3OKKB 4N0YH 4PJCE 2N1KA 4UIMB 2GT9B 4GXUN 3LH2H 1DN0B 2GEEA 4UAOB 3BW9B 4TUKL 3LOWA 3O8XB 2F54B 1MJ7L 3EYFA 5GQBA 3WFHB 4UILH 3VFOB 2NY3C 2WWKT 5ADOL 3EJYC 2JB6B 4Y5XB 4XI5C 3DSNA 4ZUWB 4PGEB 3SKMB 4LCCA 3BHBB 3UJTH 2FX9H 1TMCB 1U6AL 3N1GC 5JA9A 1U2HA 3ES6A 2R1YA 3HE6A 5DEFA 3QUYA 2GJ6A 3EO0B 4QGTA 3O11A 3QDGA 1LO3L 4ODBD 5LAXB 2DOCA 3K0WA 4FXKA 4LFHG 4ZNCD 1I7ZA 2NW3A 4NO2A 4AQ1B 2EH8L 4XBEH 2HFTA 4TNVK 3ZT6A 4O58L 3DX7B 3I2CH 3NFPA 5JA8B 1CF8H 3BZEA 4X4ZA 3WUZA 2ORBL 5E70A 5C0DA 3MRKA 4M02A 2EDRA 1MVFA 4MDIA 3GSQB 3QWRD 43CAA 2LTQB 3D85D 1S9VA 3GSXA 3KPSB 3P11H 1SVZA 4Y2OA 4O5LL 1KJVA 3GEWB 1NL0H 2AJVL 1KGCE 4NQEB 5C09E 1JGUL 1JWMA 5CJQL 1P9MC 2AP2A 4H1LH 1RZ8A 3RNKB 2XRAL 3WMSA 3MLTB 2APWA 2FHCA 3DROA 4YQXH 3KYNA 1UENA 2O5ZL 4DFIA 5IHBA 1CT8A 4KJYA 5F3HA 1UJ3B 2VLKB 3K8KA 5IMOB 3VXQB 1WK0A 1AHWC 1WVZA 2HTKC 1DQML 1PAMA 3UC0H 2Y23A 4AEIL 5DRXB 1LO0H 2ENYA 3REWA 6FABL 1FYHB 2W0PA 3QUZA 3I50H 3QCVH 3VWJC 3OG6B 2YBRA 4DGIL 1OQOA 4QRRD 1PYWA 3DO7A 5F7EH 3QIUB 5J1SC 2BDNH 2VO5A 4YHZL 3QRGL 5GIRA 3DURB 2PXYD 1A8JH 2ILLA 4LDEB 4U1IA 1S7QA 4N0UB 2FX8L 4NFDA 4WJ5B 3TBYB 1DFBH 3C8KB 4DUXA 4HUMB 4YAQB 3FAXA 3QXDB 3HFML 2GHWB 1J8HE 5D4QA 3CH1B 4QY8B 5GGSA 2IMMA 5AWNH 1M71B 1S5IL 5ESQB 2V7HB 1G84A 2B0SL 4PG9A 1RU9L 2W59A 4PGDB 7CGTA 5CMAB 4XPGL 4MCZA 5GGVL 1KT2B 5T1LA 3FOLB 3D0VA 4NO0B 3B9EA 4OZFG 4MSWA 3VGFA 1HIML 2FSEB 5I1AA 4RGOH 3OJDA 2CR6A 2EDLA 5C9JA 2QSQA 2G60L 2ZJSH 1W72L 1T5WB 3HI6H 5TPWH 4P3CL 1MHEB 4QOKA 4AG4H 5HHQA 1YEFH 3LEYH 5GSRA 1H15A 1AC6A 1JP5A 5BQ7B 1ZS8A 4U1NA 5CGTA 1BHGA 4HSQA 5T5FH 1RK0A 2NCMA 5BRZD 1WEJL 3QQ9D 4BH7B 3HZYA 4LHUB 1X7QB 3GK8H 3ZSTA 1O7VA 2P5WB 2ICEA 3WNOA 2D03L 4DJMA 3D39D 5KZCB 4XNYH 1FE8L 5JLZA 4XP1H 3TZVD 1B90A 2JJTC 3I9GH 4OZGB 3VXNA 3WO4B 3ZKNC 5E99H 5DUPL 4ZS6D 2VLJD 5DJXB 5C0EA 4P99A 3KPTA 4WIQA 1G7MA 3VGBA 5SWZE 1WCQA 1SJHA 3L7EB 4LSVL 4YLQT 2FJHA 1YEEL 4Y16B 2M2DA 1P4IH 4QYOA 1MUJB 2IBGA 1NC4A 1JWSB 3G9AB 4ZTOH 1FC1A 3NFSH 5TGBA 1NSNH 4BK5A 4KZDL 4QXGH 1W8OA 2NY1C 1J0ZA 4MA8H 1F58L 2HLAB 1SBSL 3TV3L 3WFDH 1SJXA 2F8VA 2FL5A 4JAMA 5D8JH 2VDOH 4W6WB 3MV7D 1NFDA 3CLFL 2QSCH 3GM8A 3I02A 4TPRH 5B39A 1W8NA 3ILQC 1H5BB 3FFCD 1MJJB 4OGXL 4G8FB 3S98A 2XN9E 3IRPX 1NGXB 1ZWIB 3OZ9H 4YR6A 3QFJE 5LVEA 3HI5H 4OB5L 4PRAA 2G2RB 4H1LB 4IJ3C 1AD0B 4NCC1 1E4WH 1JYWA 5EPMB 1FZOB 5CSZB 1IGCH 5JIHA 1A5FL 4M43L 5E08H 4CDGC 4JDTH 5DJ8B 4KPHL 3PNWB 1C7TA 4R9HA 3RGVD 4YDKH 2XICA 3DRTA 3GSUB 2VXQL 3MUJA 3RDTD 3QG7H 1JIBA 3BEVA 4GRLA 1XGYH 3RZCD 3QAZC 4PJXA 3EYOA 3TJHC 3TPUB 5KVEH 2OCFD 2DM4A 3DUHA 1XGTA 4XVUC 4G9FB 4X4MA 1VFBA 3PP3H 4DN4L 3SE3C 4ZXBB 3FQTA 3LD8B 3X11A 4N9GA 5CJ8A 4FQXA 1U2CA 5JMRA 5L0QB 1INDH 4KTDH 2AK1H 2H2PC 2BC4A 4M7LT 4AEHH 5KN5A 3EJZC 1AP2A 3U9UA 3TNMA 5D1XC 3RA7L 4LFHD 3DX8B 1A3RL 2A73A 3UMTA 5C0ND 5ITBL 2NY0B 4GKZA 5FYLL 4H25A 1Q72L 4XNMA 2AXJA 2AXGA 3G08B 1EFXA 4K94H 3PXJA 4CW1A 2NZIA 3BPNC 5I8EA 3SDCA 1N5YH 4YHMH 4D0CB 4GBXB 4DQOL 3MRGB 3BESR 2HJKB 4U1SB 3CFKA 2FEDC 3B9KB 4TOYL 3JTSB 4UNTA 2UUDH 1H8NA 4GMSL 3TVMA 4OKVB 3SKNA 4Y5YB 3VDAA 5JOFA 1KBGL 4OI8A 3KXFD 2DQIH 1AFVH 5I8KH 1YMMA 1G0YR 1U8LB 1EAJA 3AMKA 5HYQB 2VSDA 1J0HA 2AJXH 1BIHA 4PTTB 3VWKC 4XGZA 4Y1AD 1DQTA 1JF6A 1ZHNB 1A2YA 2DB8A 1RULH 2HP4A 1ZTXH 3KAAA 5GS0L 5KSBB 1FIEA 1BBJA 5A2FA 4MNGE 4D8PB 3S3PA 3T77A 4IRJB 4LKXA 1VFAB 4OGAC 4YFEA 2YD1A 2VDLH 3SE9H 3P40A 1BFSA 4MWFB 5FM8A 1FZKB 3QDME 2R23B 1NDMA 3RNQA 4PGZA 3WXWH 5GS2D 1XCTB 5ACMA 1UFUA 1GAFH 4I3RL 3ZT7A 3HE7B 4NQXA 3O4LA 5DYOA 3TN0C 2I07B 5H2BB 4OCXH 3MRJB 1NLDL 4HPYL 3BKJL 4JM4H 4ZAKD 4P23C 4PJAA 3ARGA 5FO8A 4NJ9H 1WFNA 2OJEB 4EVNA 3BQUD 4PBVC 1NPUA 3V95A 2BERA 4HX1B 3KLAA 2NW2B 3WEXA 3O3EA 4L3CB 5EUKB 3L3JB 5EORH 3LN5A 1TJIH 3VFVA 3VRJA 5HI3D 1IKNC 1X5JA 1DN2A 3OBAA 5DI8B 3B4NA 5FO7B 1TVDA 4GRWH 1S9WA 5CS7A 4RGNC 4RAHA 2EE2A 3G6JA 4Y4KA 4X6EB 3S5LA 2FDBP 5DJYA 1QPPA 1RJYB 3C9NA 1EXUA 4ZPTA 3CSYA 4JRYB 3G5VA 4JPWL 4U7KA 1QSVA 1SJVA 1PX4A 1SEQL 2LV4A 3M1BB 2NXZD 4NO3A 1PSKL 1IILE 4JHWH 1EPFA 3STLB 1EHLH 1ZHBB 1JNHB 1T89C 2CDEA 4XPHL 1E4XH 3QPXL 5JXAL 3PQYA 4P57B 5SWSE 4OJFH 5HYSB 4Q9QL 4PB0L 5GRXG 4B5EA 5ALBH 1NCAL 3WIHL 2I26N 1BQHB 1JHTB 5E9DE 2GUOA 3FQRA 1MQKH 4D9RE 2ZWLT 1MFNA 3Q1SH 4AM0A 2HWZH 5C0AE 4R3SB 3MLUH 2DKMA 5FYJL 3H3PH 4U7MA 1K4CB 4PRDA 4R0LC 4M5YL 1U8IB 3X13A 5L6YL 4NN5C 3MOBL 3HPJA 3RPKA 2EYRA 3LPGA 4O02L 2CUIA 2D7OA 2FB4L 1X5GA 3S3SA 4DZBA 4CN6A 3PG2A 4MJIB 1OGAD 2BNRE 4KK6D 5DEZA 1HHIB 3D0LB 1BD2D 2W07A 2AV7B 4LF3A 2MHAA 1QBML 4ZTPL 1SMAA 1F4AA 3NACH 3JWOL 5GJSH 4JG1L 3LQAC 2XZAH 4Q6IA 2AGJH 4R7DA 5C6PB 1RPQA 4E41B 1MCCA 4L1HA 1E4KC 4RMQA 4FQ2L 2QQNH 2J7LA 2NY4B 3GRWH 3DYPA 1B6DA 4IRSD 3BP5B 4NWTL 1ED3A 5D7IE 3VE0A 4BUGA 4JFDB 5D7JA 4NM4H 3GSWA 3EOYG 4EBQH 4CVUA 3OAYK 3QYCA 4OFVA 1KJ3L 5IVOA 1CLYH 12E8L 4Z7VE 3VD3A 4K3HA 1QLRA 4YK4C 5FGBC 3IDGA 1PKOA 3ARDD 2XA3A 2EDHA 1I1AD 3IU3A 3ARBA 4IHOA 4PJ5E 3SGDH 1OAXL 4HWBH 1BFVH 2V7NB 2OL3A 3RWHA 1A3LH 1QRNE 2JF1A 4CVZB 5JW5A 1KELL 5KSAA 4L9LB 4TVPE 3RL1A 2BNQD 2R56H 2ZCHH 3FB8A 5F1NA 3RVWD 3P77A 3SKJH 4OZIE 2DQHL 5T3ZH 1MH5A 3MA9L 1NCWL 5KBNC 4MAYC 5LGJB 4FQ1L 1EMTL 2QQKL 4UTBL 2Q3ZA 5BVPH 3RJQB 4F15C 4DTGL 5LCVL 4BM7A 4AYFA 2OSLA 4GRMB 5DUML 3O4OB 2ESVD 1CFQA 1KF9B 1YPZB 3K1DA 3P4NA 3VXUE 4NRXA 3JBG7 4N8CH 3BO8A 1I8KB 5DVNA 5KAQF 3V5KA 5J56B 2YPLE 4NNXB 3HZKA 4POZD 3TA3A 2PTUA 1E4XI 5D9SA 1YECH 3QQ9C 4JZJC 2BRRL 5D2LE 5FYLD 4ONHB 1T2JA 3PXHA 1MF2H 4I0CC 2V5MA 2HG5B 1JL8A 4H20L 1DVFB 5J06A 1A7QH 3NIGE 5DC9B 1YZZA 4WFEE 3L3KA 2DYPA 1G6RH 2O26U 1MFCL 2EXYD 2GJZA 4J4PA 3ULUL 3AB0B 1FPTL 1A6ZB 4OFYD 2RQ8A 2F74B 4LHUG 5TQ2H 1NFDF 2QV2A 4N0YL 3UAJD 1EAPB 3BI9X 3U7WH 2YEZA 5F7NC 4GRWB 1FGNL 5GS1B 4M7JL 3MRHB 1YNLH 3RVVD 2BVYA 3LQZB 4OZHA 4CL7A 5DVKA 1T7XA 1CICC 2XFXA 1M05B 3FZUD 1XH3A 2D4DA 1CXLA 4P4KC 4XBPB 2E7MA 1I1RA 5I16A 2D4FA 1RK1A 4XCYB 1G7JB 1U58B 3O9WD 3VXSE 1UWXH 3MYZA 2FX9L 4XP9H 2GW5A 4NC2B 4XXDA 1CG9B 3I6LE 1Q0YL 2I60L 4PJXF 1MFDH 3EBAA 3U30C 3DBXA 4I13B 5DQJA 5INDA 3SGJA 3MOAH 1YEJH 1IEBB 3P4OA 1U41A 4QHKI 3AS2A 1CL7L 2Y7QB 4U49A 4WV1A 1XGUA 5K9KB 2ITDA 2IQAA 3K4DA 4PJGE 5GXBB 2GYSA 1U91B 3I2CL 1CF8L 3SGDI 5IK3A 4ELMA 2CLZB 3ZYIA 3JWDH 3SJVD 3RDTC 4PP1D 5CHNB 1WBZA 4XX1E 3HG1A 4H1LG 3RUGA 1I4FB 5E8DL 1IGFL 4PRPE 5I6XB 3P11L 3B2VH 1RJLB 1FORH 1A7NH 3V4PH 4NCC2 1NL0L 3HC4H 1CGUA 4FQHA 4JKMA 3GHEL 3VFNA 3ZDXE 3EKCA 4HJGA 2P7TA 3MGOA 3U4EA 1J86A 3O8XD 4NUGH 1ORQA 2F54D 3GMMB 4E5XB 3VFUB 4YNYA 4FNLH 1D6VL 4YQXL 3WFBH 1NBZA 4Y2DB 5E8EA 2X10A 1BJMA 2YPKA 5C0NC 1L7IH 4HWNA 3ORJA 1D5BA 1TJHH 4TTGA 4U1GB 2H1PH 2P1YA 2P49B 3O6LH 5TQ0H 3F5WB 5FHAL 3MV8B 4RQQA 3UC0L 5HI4C 5CD3B 3NN8A 3W39B 5KVFH 5DMKA 2AVGA 3IFLL 3UYPA 3L6FA 5I1IH 3I50L 4YGVA 2FR4B 3CPLA 1WT5C 5F7EL 2BDNL 3STZB 1HHHB 4MD5A 2XZQH 5HDBF 2IALA 5FYJD 5DD1H 4FA8A 1IFHL 3ZDZE 4IOFC 1EV2E 4LLUB 2PW2A 4MX7B 3KPSD 3UTSA 4WCYH 2X1QA 5CBEA 1DFBL 2CDFA 1UEMA 2JK5A 4LCYB 4NQED 3ULSA 1FZJB 1U9KA 5L2KD 5FKPB 3WIIH 2VN7A 3B6SB 5F1SA 2AK4B 1U8NA 2NX5A 4K9EL 1NFDE 3QUKA 5AWNL 3HHRB 2E7CA 3T0BA 1I1YB 2VZTA 1NMCC 3P4MB 4PGJA 3GI8H 4HV8A 1XIWC 4PJAF 5JO5B 4EIGB 1XF2B 2BSTA 1H8SA 5FIEA 1T0PB 2P4AB 2OXHA 3ZT5A 1BF2A 2VDNL 2VLKD 4MNHB 4KJPD 1IAKA 3IDYC 1WZMA 4XPBH 5DJ2B 4LPVA 5IW3A 2ZOLB 2BHYA 4KDTA 1E6OH 4LKCB 1CDIA 3L9RB 1KIQB 2EKSA 2ZJSL 1F2XK 2I5YH 3EJJX 2BCKA 1G6RB 1RZJH 5TPWL 4JFOB 4WDIB 3G6JF 1EZVY 4CDHA 5D2NA 4ZAKC 4AG4L 2FATL 1YEFL 3LEYL 3BD3A 5JIPA 1Z5LA 2KQNA 5FB8B 3BQUC 2BSSA 2VDQH 5BZDA 3OXSB 2YHGA 3QIUD 4P5KA 1EO8H 1O7SA 5T33H 5T5FL 4CU6A 4X4ME 4G8GA 3WUWA 3GSOA 2H9GA 2R29L 5HI3C 2G5BB 3C6SA 1C08A 5SX4H 3I6GB 3IKCA 2K1MA 3RWEA 3GK8L 4PRNB 3QEQE 3MC0A 3BWAB 1Q0XL 2D3VA 3FB6B 1LK2A 3OB0K 3X3FL 4XNYL 5CSBA 2C1PA 4XMLL 2Z8RA 3MUZ1 3IXAA 5DHVH 3HUJE 4NGHL 4D0DA 1ZK9A 2BNUA 4LRIA 4I18C 4YXHH 3MNWB 3I6KA 4X6CE 4UOW0 2EC9U 5E99L 5C6TH 4G7VL 3VXOA 5D6CB 4GG8B 2R2EB 3PJSA 2NXZC 4TSCH 5EBMA 4CVXB 4HULB 4QRPA 4QGYA 1XR8A 2H8PA 4JCLA 2RFXA 1P4IL 3WJJA 3HI1B 4NO0D 3HTLX 2E6JA 4UV7H 3OWEA 4PJIB 5IHZA 3NFSL 5FXCH 1NSNL 4TSBL 5DC0A 4QXGL 2QHRH 4RDQG 4JY6A 5EDXA 3QNYA 5EBWB 5MENB 4Y88A 1JHKH 3WHXB 2KZWA 1KPRA 4WO4D 3WFDL 3ULUD 2N7BA 5C0CD 3OG4B 5D8JL 4U05A 1T22A 5DC4B 3WLBA 2J5LB 5EU4A 1GYAA 2QSCL 4C56D 1GGCL 4X7SH 1T1WB 5HYSG 3HC0B 2BZDA 3OZ9L 1V05A 3G9VA 5DD5L 5HHOA 5A2JH 4LEOA 3RIAK 4OFDA 4KK6C 1PVHA 2VH5H 4LHUD 2Z92A 2P5WD 1F6AB 4QHLA 4YXLL 1A6VH 1G9NH 1IGCL 5KZCD 2ATKB 4I0KA 1P4BH 1NCTA 1JUFA 4O00A 1PKQE 4QTHB 4WWKC 1QOKA 3CFDA 4YDKL 2ZOKB 5BW7C 5IB5A 1CE6B 2FRGP 2ZG1A 4NT6B 3IF1B 3Q5TA 3ZE2E 3DGGB 2WP3T 1XGYL 4NQDA 4YHPB 3ARVA 1TTUA 2ARJA 3FOMB 4Y16D 4KI1A 1GSMA 1YN7B 2PTVA 3W5NA 4IDLA 3CFCL 5M95B 4MDJB 4ZD3H 4P2QD 4WFGE 1J10A 1CD0A 4H88H 1INDL 4KTDL 5GISH 2AK1L 3R4DA 4R4ND 4DUVA 1GH7A 1L6XA 4ZO6A 4AEHL 3QJHB 1XGRB 2O5YL 4AL8H 2E27H 3AAZA 4WTZG 1L0XA 1EEQA 1ADQA 3ULVE 2FGZA 5SX4I 3P73A 3G6JE 3RVWC 5CILL 5D93B 1S7UB 5DVMA 3LEVH 4ELKA 4FZEH 1HZHH 4YHML 3MACH 1MFEH 4MQ7B 1M7XA 3U46A 1KLUA 1A6WL 2EDEA 4W6XB 3BUTA 3DARA 1HYSC 1FL5B 3U7AA 4PBXA 4MZ3A 4K71C 2JELH 1U3HB 2EYSB 1KXQE 2I27N 1FSKB 5E6IA 1AFVL 4POZC 5F9WC 1Q9LA 1EH9A 4AZ8A 3IVKB 4O9HH 2MNUA 1O5DT 2OTWB 3PQYE 4G42A 5BJTB 5HHNB 3D87B 2JJWA 3MCG1 5EN2A 1CD1A 1AE6L 5IFJA 1KG0B 4K3DH 2W60B 4ZSOE 5I15H 1MOEA 2R4RL 4FXGB 4S1SH 4OZHF 1D5XB 2EXYC 4M9PA 5ECJE 4C83A 2GCYA 4M6NH 3MRPB 3BEWB 3DV6B 2VDLL 3SE9L 4OBSA 1RZKL 4Y19B 3V6FB 2VLRA 2WIMA 2VAAB 3BIAX 4X98A 4XMPL 4LNRA 5DGRA 3CX2A 2NY0D 2YD7A 1MCDA 5TH2B 1I7UB 1W0YT 1N2RB 3WXWL 5HTSA 3RVVC 1MIMH 1GGUA 1GAFL 5J6HA 4PJ9A 1R5WA 1PJ9A 4Q6YA 1GZPA 3BPOC 5DHVB 2PO6D 4GBXD 4DCQA 5E4EB 1YYLH 4OCXL 1RZGA 1OD7A 1X5XA 3TH4T 4JM4L 5F7UA 1FGVL 1HXMB 5DHYB 3TNNA 4NJ9L 4EZMA 2IADA 3O9WC 2MTPA 4ELMF 2X1PA 3HMWH 1GHFH 1K6QH 1X5IA 4JQXA 4LPUA 5BRZE 4A2MA 3HLAB 3DTXA 4PLJD 1JN6B 1JI1A 3U6RA 2OTUB 5T3XE 3MA7A 3T0EB 4I3SH 5EORL 1TJIL 3B8YA 3RUGF 3EZ8A 3V0VB 1FFNA 4F7EB 5HPMB 3MBEC 4HWZA 4JM2B 2EDWA 4XVTH 2X4NA 3L5IA 1KTDA 3U79A 2Z35A 3NIDE 2XG5A 4JGMA 2W0FA 1VFMA 3VFGL 5CP7A 3GBLA 3GB7B 4PYHA 3NA4A 5EU7E 5C07E 2VLJE 4MJ5B 4IRJD 4KROC 3CSGA 2B8OT 4CADB 4F2MB 5I8CB 3LEXB 4JHWL 5KTEH 1NANH 3IDMB 3KLHC 4BSJA 4WRLA 1UZ8A 4HCRH 3DIFB 3OGOE 3U0PB 1E4XL 4U6HA 4GQPH 4X99A 4QHUB 2ADJB 1NGYA 4UAOC 4OJFL 3BKMH 4HMDA 3HE7D 1JVKA 5IG7A 2P5EA 4YFLF 3RX5A 1PG7W 3IS0X 1Y18B 1MCWM 3SEPA 1MQKL 3CH8A 1CK0H 2YKLL 1OTSD 5ENWA 3MV7E 4Y5XC 3BSZH 1BAFH 1MCBA 3FFCE 4IMKA 2XQBL 1B9ZA 4TTDD 5BZWA 4IS6B 5ISZB 3STBA 4D0BA 3UTPE 2V2XA 3FO0H 4IMLA 4PRHB 4RWYH 3PWPB 4HS6A 5IB1B 1P9MA 5IBUG 1FLTX 1KJMB 3HRZB 5DFVC 1MRCL 4P4RA 1QA9A 3F7YB 2RB8A 4YIQB 4X6FB 3FJTA 3MRIB 5GJSL 2XZAL 4G6MH 4JRYD 4WW2B 1A4KA 3OB0H 1VEMA 2X1WL 1NUNB 2QQNL 1AHWA 2MMXA 3REVA 3BP4A 3ARWA 1F6FB 2JJSC 1L7TL 2LTQC 1JNLH 1WLHA 3DJ9A 2E6QA 4NM4L 1N4XL 4K7FB 4MAUH 5IW1B 3P30H 3OTTA 2I9TB 4PJEB 3E8UH 8FABB 3D5OF 1P7QA 5JHDA 1HHKB 2HJFB 5HGDA 3VWJA 5IF0A 4B53A 1C5DA 1CLYL 2F9BT 4OGZA 5ADPL 1Q9WA 2AQ3A 2Q8AH 3TCLB 3EDDA 1TCRB 1OAZH 4XNUH 4UOJA 2C3XA 1WBYB 5TE6H 3KPMA 3SGKC 3QQ4A 4HWBL 1I85A 3F12B 3RAJH 1A3LL 4LDOB 3OAZH 1N8ZB 2W9LA 4Z7NF 2ZCHL 2R56L 1U8QA 1INQA 1C5BH 2ED8A 3MLVH 5T3ZL 2Z9TA 4HDIB 2LE9A 2H2SD 1HHJA 1I8LC 4GO6B 4MJID 4ELME 5BVPL 4EN3B 3TIEB 1F4YH 1OGTB 2K7PA 3LB6D 3MJ7B 3NPSB 5IJKC 3TO4B 3MJGX 5AUMA 3KXFE 1NANI 2BVUA 2N56A 2X4OB 5HGBB 1BZQK 4KKLC 1NLBL 1GZQB 1PEWA 2C3VA 4E41D 5ALCH 3RVUC 1YECL 3NCMA 1TZIB 4J3UA 4HWEH 5C0JA 3QH3A 4LLMA 2NY4D 3BAEL 4Y1AE 2Y5EA 5TE7L 1MF2L 3KGRA 5HVWA 1J88A 5GZOC 1P2CA 1WGOA 2NTSP 4WU7A 1FBIL 3QXAB 4JFDD 2Q8BH 3S4SG 3VXPB 1GOGA 3T8XA 4NC1E 5ACZB 5DF0A 1FG9C 1KTLB 1SJEA 2ZG2A 1IL1A 4JANA 4QXTA 3QSKB 2AJUH 3U1SL 3SY0A 1GIGH 1JCKA 5DFWH 5TQ2L 3E6HA 1CD8A 1T04A 1S7VB 3LV3B 2Q76A 1BQSA 1QSEA 4RIRB 1I1FA 3IAQA 1A7RH 4OUUB 1YNLL 5L8LB 4LSRL 4U2YA 2BJMH 2CUHA 1QBAA 5K9JL 1J0KA 3RI5F 1KCKA 1MEXH 3PHQB 4ZPVB 1PFCA 3ARFD 1G9MC 2ARJQ 3UJJL 3CDCA 4F7CB 1TNMA 5JQHC 4PJCB 2JJUA 2V2WB 3QG6A 4WUUE 4NNYA 4ODXB 5H8DA 2EO9A 2MOVA 4BFEA 4CU7A 3FN0L 3MLXL 1NCCH 3UTSE 5T1KA 2DLGA 4LLAA 1PQZA 3L1OH 1NGWA 2MQCA 3DMMB 3LKOA 3AM8C 2P45B 1G7PA 3BIKB 1EFQA 3FB7B 3D18B 3FONB 4XPFH 4NKIH 1YEJL 1WZLA 4WGVB 5E8PA 1S7SB 1S7RA 1TZGH 2VZ3A 1DVFD 2R2CA 1PX3A 4X8JA 1DDHA 4BSWA 4KVCH 3HNSH 1VDGA 4GLRH 3WLWD 4RAUA 4LGPB 3WO4C 1KB5H 3JWDL 3LKPB 4Z77B 5I1KH 3VI4E 1I3UA 4E0RB 1MREH 3VFPB 3K74B 4NPYB 4MXVE 3TF7C 3V4PL 2J8UA 1FORL 3L3DA 2BHUA 4Y16C 1VKXA 4JFFA 2UWEA 5IVNA 5D2NE 4HHAB 5GRJH 4JJ5A 3D9AH 4MHHI 1K85A 3KYMB 1T6VN 4RNRA 2A6DA 3V5DB 2CKNA 4NUGL 4APQA 2J8HA 3VRIA 5SWQA 4FNLL 4G6FB 1WC7B 3TC9A 3WFBL 5C09B 1XR9A 3MLSH 1VB9A 2VZUA 5F9AC 4D9LL 4EDXA 2IG2H 4HBCL 2IAMD 3IETB 1G6VK 5HPOA 1TJHL 2B2XL 4URTB 4X6BB 3ROOB 2DQDH 1K3ZA 1H5BC 3AY4C 4HIHA 3K8LA 3MV01 3ARUA 4H26B 1P4LB 5FOBA 4X0KA 3SE3A 2MKWA 2VERN 1OGAE 4I2XA 1BVZA 1NCUA 1DQLH 1BD2E 1BIIA 3G6DH 4YDLC 4GQ9L 1A22B 2AQ1A 1HQ4B 4RFOL 3VMOA 5I1IL 4I9WE 4IDJH 4R96B 3HAEG 4Z0BH 5J1TC 3BRFA 1OSPH 2XTJD 3FT3B 1YY8B 3MLRH 4QRPE 3ESVF 4G6AD 4P2RA 1B4JL 4FQCL 2XZQL 4NKDB 2DQFA 4FQQB 3T2QA 4DK6A 4ZUVA 5EOQH 1ZOXA 4J2XA 3E6FB 3IXTB 2HKFL 4YZFF 1AXTL 3MV9D 1TQBC 1UGNA 2CLVB 1HK6A 1NUFA 4ZXBC 1I9IH 3LD8C 2VKWA 4KH2A 1ZVSA 5T1MA 5DJAA 2HTLC 5L0QC 4C54A 2FZ3A 2MJWA 2YMXH 2BMKA 5D71L 3GI8L 2C3WA 1A7PH 3ECBA 3OAUH 5D5MA 3TT1L 3F8UB 2Z8VC 5HHOE 1T7YA 3RTQC 3OHXB 4LAJH 5KVDL 2YR3A 1JFQH 2NY0C 3QHTC 3VWKA 1A6PA 4M7KH 2BNQE 3FQWB 4M8VA 2R0KL 4MXQC 5F3BA 1BZ7B 2BHZA 1OLLA 5E00A 1UVQA 5IVXE 3FN3A 1E6OL 1A3QA 2I5YL 4GBXC 5FF6B 4GLRI 2ESVE 3B9KC 1XF4B 4LLQA 5AZ2L 4ORGA 2YUVA 5EU6B 4JR9H 2VDQL 4PYGA 3G5YB 4YUEL 2HFFA 4Y5YC 3CK0H 5F93C 3NA9L 3MZTA 4PLJC 4Z7QE 4PREA 5I66A 5FYLE 1HEZA 2FJGB 4QKXB 4NDMB 2HRLA 4JLRB 1LEKA 2BSRA 4HK0A 2VRAA 3BFOA 5T3ZD 3TN0A 4F9LA 2H6PA 1U8KA 5GGTH 1UXWA 1R3LB 4BUHA 3CSBA 2Z4QB 2FWOB 4P23A 1P5UA 4N8VA 5EO9B 4YXHL 3FQUB 1ND0A 3BDYL 4FFWD 5A2KH 1QUNA 2NXYB 3O3UN 4UDTA 4NQVA 3MGTB 3QHFH 5HYIA 1OAQH 3LSOB 4HK3J 1IKNA 1NBVH 1MFBH 1AD9A 1UZ6E 2ARWA 4NZJA 3P9LA 4PY7B 3AC0A 5I1EH 1X5AA 5SWZB 3LS5H 2QHRL 3OB8A 1FG2B 2L4OA 1JHKL 2XNAB 1P53A 2VR4A 5EO0B 1KB5B 3FB5A 2WQ8A 4X5WA 5EZLA 2JCCA 3SDAB 2EH7L 4JJHA 4U0QB 3JXAA 4JO3H 4TTDC 4ZUTA 1F4WH 4Q7DA 1DUZA 3QUMA 4X7SL 3PWVA 5J13B 2DMBA 3KS0J 4ZMAT 1ZLUK 5ICYB 2A2QT 3FCTB 1MPAH 3LKQB 2GSGB 3V0WH 4P5TC 1T5XB 2AXFA 4TNWF 1A6VL 3X12A 4KDVA 3ZSSA 2YSSA 1IGYB 2NTFA 4YE4L 3V6ZA 2GTZB 1N59A 1EEYA 1U8PA 3MXVH 1KLGB 3MGAA 3QI9B 2ITCA 3O6FB 1OT2A 1AQDA 1LK3L 4N9OB 1I7TB 4R0LA 3VGDA 2B4CH 1LEGA 1YEKH 4F80A 1IRAY 5FKAA 3MJ9A 3CVIH 1R5VA 2G75B 1G7IB 4P46C 4AIZB 1MI5A 2IPKB 3C2AH 4EUPA 4ZD3L 5KSUA 3VFMA 2XOTA 5F7DA 2X4SA 3N1FC 4GW4A 4H88L 1JGEA 4WI9A 5DD6A 3ESUF 1A9EA 2QADB 3WS3B 1F13A 3SPVA 3HMXH 5MEND 2E27L 3DRQA 3W2DL 1J1OH 1E4KA 3NH7L 4F7MA 1M7IA 1HCFX 4WEMB 4L4JA 3BIBX 2Q3AA 3HB3C 5EZOH 1SYSB 5ABDE 4M9OA 1MLCA 4S0SD 5AD0B 3QO0A 1GVIA 1HZHL 2IH1A 1MFEL 2DD8L 3D2UD 4EOWH 4KTEH 4XP5L 3VH8A 5FGBA 3PDDA 2CIIB 4RFEB 1YC8A 4HIJB 4JPIB 3IFOB 4JN2A 1OVZA 2FLBT 5I1CH 2HN7A 5FYJE 1ZLVK 5IESH 3CZJA 4PJDA 3X14B 5J8OA 2R69H 3DXAB 4O2FA 1KNOA 2LU7A 2NR6C 3WJLC 2NY4C 4J8RB 2OQJB 4IOSD 1ES0A 5TDPB 4K94C 3SDXA 4MAYA 4U4BA 5EIIA 1RUQH 4UU9B 4K3DL 3RWCA 4G6JL 5L2KE 2DN7A 5I15L 4HFWB 3W81A 4S1SL 2CIKB 4ZFZB 4KJWC 1Y0LB 2F5AH 1AIFA 5FGRA 1GXEA 4M6NL 2FYYA 4HW6A 1CR9L 4KZEH 1T21B 2R2HB 4L3EA 1URLA 4OCRH 5J9PA 1CGVA 1KEML 4HUUB 3IFPB 3WNKA 1T20B 2XPGA 4JZJA 5DRNA 4MNGB 1LHZA 3ZTJH 5AYQA 3NCYP 3Q3GA 5C0RH 3MMEA 1P5VA 4OCSL 5E1AB 4ENED 3TBWA 1DLFL 4ZYKA 2CKBA 1MIML 5DTFA 2BVOA 3O41B 4OI7A 4Z7WA 5L8JB 3QDMB 4OLUH 4LPWA 4G8IA 1YYMH 1YUHA 4NM8L 2APTA 4GUPA 3O4OC 1U3HD 3E3QC 5DRZB 2UZYB 2Y9RT 2GFBA 2EDFA 3DOSA 5J1AA 3HMWL 1FFOB 1K6QL 1CZ8L 2BOBB 2NY6B 4QRSA 5ICXB 4GAJL 1FL3B 3WV0A 4I3SL 3UXFA 2OXGA 1J1XH 4ONOA 2J8UF 4HKZB 1MCLA 1CICA 4XHQA 2IANA 2UWEF 4XVTL 5CJXC 4CU8A 1MCPH 1Q8MA 3MFGB 1BOGB 1K4DA 4N0RA 1KXTB 1DVFC 2RGSA 2YOCA 2WBJC 3T04D 4P4KA 3CVHL 4Z78B 4Y4HB 1KCSH 3R1GH 4U6YB 3AGVA 1CFNA 1KPVB 4JQIH 3AB0C 5C0FA 2X70B 5B38B 3EYQD 5HYJA 4Y19D 3MLZH 4S2SB 3O2DH 1HWHB 4BQBA 4HCRL 2I24N 4GOSA 3CDGB 3EYUL 5GS1C 3AREB 3TYFA 3GIVA 4FG6C 3EGSA 2JJVA 1RAMA 4L8CA 2EXWD 4KV5E 4A6YA 4Q58C 3ULUE 5C0CE 2AKRA 3RDTA 1N26A 5FHBH 3RWJA 4ODVH 3TBTB 2A6JB 5JPMB 1PZUB 5FEBA 4C56E 3BSZL 1FRGL 3ZE1F 5E9DB 1OAYH 1DE4A 3FO0L 4X4YA 1K2DB 3EOTH 4PR5A 1CIUA 3EO9H 3T0ED 3UTTB 3TIDA 3T2OA 4OLXL 5C0AB 2KZ1B 1FFQA 4OQTA 3KR3H 2P5WE 3VMPA 1GCFA 3EYSL 1QSFA 2EIDA 1DLHB 2CLRB 4X7DC 5F7HA 4KUCD 5DJZB 2PYED 4OZGE 4L1DA 3UTOA 1W0VA 4KDWA 1RUPL 4JN1L 2XACC 4PUBH 3PIQB 4G8EA 2A6KB 2C4FT 5D5MF 3B43A 3LRSB 2LU3A 2VXUH 1BMGA 5I6XC 1T4KB 5IJVA 1JNLL 3OKLB 4P2QE 3O2WL 4BKLB 4MAUL 1IGJA 2GITA 2W0LA 3E8UL 4UV4L 3A67H 1NQBA 2M26A 4IM8A 4HT1H 1IM3A 5D7IB 3HNVH 1WT5A 2A0LD 1T80A 2D0HA 1NBQA 4F37K 3EOBA 3EYFB 2X4RB 4XNUL 4Y2DC 3TM6A 5TE6L 3GMPA 4PV9A 3RAJL 1P1ZA 1GPOL 4U1GC 5C70A 3SBWC 3T3PE 4LCCB 5ISZD 1U93A 3MROA 1AKJD 2VXSH 1C5BL 2V9TA 1FNGA 3MLVL 3ES6B 1YEIL 3HE6B 3LQMA 4KRMB 4PRHD 5DEFB 3C5SA 3NIFF 2AV1A 1QRNB 1B88A 3QDGB 5JW3H 4FXKB 1HSAA 2NW3B 1PZ5B 3LAFA 4NO2B 1XIWA 3WKMH 3QUXD 4X4XA 5ILTH 1H3PH 3NFPB 1UB5A 3BZEB 2J8UE 1FC2D 4BZ1H 4JFFE 2UWEE 2KUTA 5EU5A 5C0DB 3IT8D 4HJ0D 5T5NF 5IOPA 3VXUB 4J3XA 43CAB 5CIPA 1S9VB 3GSXB 1ACZA 3I85A 1LE9A 7FABH 1KJVB 2Q8BL 3JV6B 4X6DA 5MEPA 1JWMB 1QFUH 4MQTB 5D2LB 2W65A 2AJ3B 1TZHA 1G7QA 5J12B 4ONGL 1T0NA 4MQXD 4G43A 3DROB 1HQRA 3KYNB 3OF6D 1ZEAL 1GIGL 1CT8B 4KJYB 2JCCF 5F3HB 5F70A 4TVSa 1UXSA 5GRWA 3AXLB 3WL9B 2EEAA 1IE5A 1A1OB 1X9QA 5DO2D 3IDNB 4UTAH 4TQEH 4JKKA 4EN3D 3SDYH 5CLWA 1RURH 3REWB 3TO4D 4PV8A 1G1YA 1U8HA 3QUZB 2HMID 3Q2CA 1II4E 3QFDA 1BQUA 3OKEA 4Y4FA 3MREA 4NHUA 1NCCL 5DZOA 4OKDA 1X5HA 4PPTA 4O4YH 3L1OL 3P9WB 1WZKA 3SCMA 5GIRB 4Y89A 1F5WA 1VERA 4R2GB 4U1IB 1S7QB 1LNUB 4NJAL 3VXSB 1I8MA 4M00A 3WDHA 5L7XH 1E6JH 4LVOC 5KSBE 4X7CC 5FGCE 4N5UA 4KVCL 2YXMA 1MCSA 4Q2ZA 4YWGL 1KB5L 1JZ6A 5I1KL 3FFDA 3ZKQD 1KCRL 4PG9B 1FCGA 5E95B 1F11A 1MREL 2HFEA 4NUJA 4OLYH 1IEAA 4PJGB 4U1MA 4D3CH 2ZSWA 2V2TA 5AG8A 1DQJA 3C5ZB 3GSNA 1ZT4B 5I75B 1B6UA 1JMZA 5D7LA 3MSPA 5T1LB 4JO4H 3D0VB 3KDMA 1CLCA 3K2MC 1PG7H 5GRJL 5IBTH 3GMQB 3D9AL 43C9A 4Q97A 1NAMH 3ZLQC 3U9PH 3OJDB 3KPNB 2VC2H 5E2JA 2DBJA 5C9JB 4PRPB 3MRFA 3KJ6H 4WWKA 3MRMA 5E7BA 3TYGL 5IR1A 5BW7A 4GW5A 1QLFA 4JKPH 3GMLB 3VJ6B 2C1OA 5HHQB 1AQKH 1CVRA 2IH3B 2YD5A 4XB7A 3JWDC 5GSRB 1H15B 4RBPH 5HVGB 2IG2L 3CFJA 2J5LC 3TJEH 1ZS8B 4U1NB 4NKMA 3PGDA 3D69A 4PJDF 1G7LA 1VADA 3JVGA 5I0DA 2BVPA 1NGZA 3DMMD 3RU8H 1C5CL 3HAEA 1SVCP 5A16A 1D9KC 4HQQH 3HZYB 1DQLL 3SDXF 1H9VA 1TDQA 3MRRB 1IMHC 4NN7B 3QWQB 1ETZB 3G6DL 2WMPA 1QR4A 5CGMA 1Q1JL 5JLZB 4Z0BL 3GFUA 4JRYE 4RZCA 3EFDL 2X89A 4L4VA 4NO5B 2DM7A 2EDXA 2QBWA 2X1OA 5C0EB 5EOQL 4WI7A 1G7MB 2KKQA 4F7PB 1SJHB 2FJHB 1GL4B 1A0QH 3ULVH 1NC4B 5AAMA 4QF1A 1I9IL 4Z7WF 2ED9A 4JZOA 2VXTL 5TGBB 4CMMB 1FAIH 1FYTD 4HKXA 5DDHA 2BVTA 5BXFA 1KGCD 3GIZH 4G6FD 4J3VA 1QO3A 5C09D 1A7PL 2FL5B 4JAMB 1AO7E 4ISVA 4Z7UA 5HHPA 1NFDB 2ICWI 3I02B 1CI5A 5B39B 3R8QA 4YHKH 5D6DC 1EEZA 3GSVA 4XWGH 1PY4A 5D93C 4JG0L 4YR6B 2B1HH 4MJIE 5HD8D 2EDOA 3F58H 4PRAB 4RGMB 3OQ3B 1KIRA 1XZ0A 4JE4B 2WNGA 4HMEA 1U3HC 3O3AA 4N0CD 5LGHH 1NKRA 4JR9L 3CK0L 1EA9C 3DRTB 3VXRA 1S7TA 2CK2A 1NAKL 2CRIA 1MI5E 4GRLB 3VGGA 3NCYS 2DI9A 1WV7T 4NRZB 2MCG1 4NP4H 1MCQA 2HRPH 3MODH 3VG9B 3MLPA 1VFBB 1RZJC 3ABZA 2VIRA 4RX4A 3FQTB 4FQXB 3RJDA 1VPOL 5EH1A 2BC4B 2AAVA 3IJHB 2VWEC 2I9LA 4ERSH 1AP2B 3TNMB 1H3XA 3HUJB 4WVRA 2R1XA 3QHFL 2A73B 1WBXA 5C3TA 1MFBL 4GKZB 5EOCJ 3MBEA 4X6CB 3F7VB 5IBLC 3GKZA 4P9MH 2ICWB 4RRPA 4H25B 4XNMB 2AXGB 4OIIH 1EFXB 3SDCB 5EA0H 5E2TH 3BE1H 4PRIA 1VESA 3LS5L 5B38G 2EXWC 3HNTH 5E4EC 2EDQA 1ZAGA 5T3XH 5L2JA 3CFKB 3NBNA 1W0WA 2DWDA 4IBLT 4PJDE 3BZFA 4HUKB 1JNJA 5EU6D 1CXKA 5FUZH 2J3SA 3TVMB 4JO3L 3D48R 1FDLH 3QZWA 4KK8C 2DJSA 1I75A 1FVEA 1IC7H 3PWUA 1YMMB 2C4FU 2C3GA 2ZUQB 1HSBA 1DBMH 3GO1H 3T0EC 3RGHA 1HI6A 2OL3H 1DN0A 2V5RA 3WO3B 3BW9A 3C8HA 1Y6KR 1NAMB 4XGZB 2WM0A 4JM2C 1MPAL 1NCDH 1FNEA 1KEGH 3V0WL 1A2YB 1WFTA 2HT2D 4L3EE 4EXKA 3ZTNH 3OR7A 3MOQA 1FZMA 4U3XA 2JB6A 1BBJB 1IJ9A 2RJMA 4ZUWA 3V79C 3T77B 3ARTA 2R9HD 4LKXB 4PGEA 2AJSH 4R4FH 3HC3L 2NXYD 4MS8C 1OL0A 2OZ4L 2QR0B 1YEKL 1JZ4A 3CVIL 4GRWE 3EO0A 4HUWB 4M93B 1NDMB 3RNQB 4OF6A 1TTFA 1AGFB 3WHE0 5DRWB 4LSSL 4FP8L 1G9NC 4UT9H 3K81A 5EWIH 5DYOB 4ETQA 3DX7A 4J1UB 5SWZD 5M94B 1MWAA 1VA9A 1FL6B 4K8RH 3BN3B 3HMXL 3UBXA 1J1OL 4YHNB 4PJAB 5EOTA 4EVNB 1RD6A 2JJSA 3SDAD 5EZOL 5K9OA 1MJ7H 5KSVA 3QR2A 4LCUA 3FN9A 3WEXB 4NYLA 2Q87A 3O3EB 5ADOH 1KC5L 1FIGH 5IHUH 3VFVB 4XT1C 3VRJB 4XBGB 1QVOA 4JFXB 1S9WB 1U6AH 3MCKB 4KTEL 4EOWL 3MLTA 4X6DF 2E3VA 3G6JB 3S5LB 1CQKA 2XTJE 3NFNB 3C9NB 2UVFA 3F6LA 3SGKA 5I1CL 4ZPTB 1LO3H 3CSYB 1JZ2A 3G5VB 4WW2C 3VXQA 3QI9D 5IESL 3PGCA 1R3JA 3QJFA 5J11B 2R69L 3FT4A 5A3ID 2CSPA 4NO3B 3UJIH 4FQIH 4AY0A 1GOHA 2ORBH 3MV9E 1RUQL 3T0WA 2PXYB 1I8LA 2CDEB 3MNZA 1WQVT 3UDWA 5JNYB 5IJKA 1VCAA 1FFPA 3PQYB 4MNQD 5GRYA 2F5AL 3UP1A 4QT5A 4MQXC 5EG6C 5DS8A 2QADD 4KZEL 4ZSOB 1CLZH 4JFQA 5DWUH 2VLLA 3BGMB 2XRAH 3H2WA 3JWNC 4AM0B 2VAJA 5DFTA 4JFEA 3FO9B 1RUKL 5I19H 4PRDB 2O5ZH 3LS4H 4WJ5A 5C08D 3TBYA 3ZHDA 3HPJB 4OD1L 3SDDA 4YAQA 5DJDA 1Z9LA 1OWRM 3CH1A 4QY8A 4DZBB 1LGVA 4OLUL 4EN3C 3NPSC 1YYML 4BFGA 4LF3B 2V7HA 5ESQA 1I8IA 3TO4C 3ZL4L 3KPLA 1HCVA 4PGDA 1EHXA 4M4PA 5CMAA 1S7WA 1KJ2A 4UZGA 4AEIH 4KMTH 4Q6IB 2VABB 4R7DB 1KT2A 3MJ8A 2VLMD 2Y36H 1FVCA 3DYMA 3M17A 4ZG1A 1UB6B 2FSEA 3DXAD 3QIBB 1BGXH 4EXPX 3MX0A 3VE0B 4F9PC 4YHZH 3QRGH 4N90D 1MCPL 3PL6C 2PR4L 5D7JB 1F42A 4U1HB 3GSWB 3VXMA 2B1AH 4HLJA 3GDBA 3L7FB 1KCSL 3QQ3A 3R1GL 4JQIL 5BQ7A 3NABL 3MUY1 2QHLA 1QLRB 2Q86A 2YRZA 3OKDA 3W5MA 3MLZL 2OJZH 3CMOH 3IU3B 4V1DD 5IB2B 4UT7L 2OL3B 3RWHB 5JDSA 5IFHH 4ZO9A 3OXRA 4L8SB 4KY1H 5C07B 5JW5B 2B0SH 1RU9H 2DLEA 5KSAB 3RL1B 3FB8B 5F1NB 4XPGH 3P77B 5I1GH 1MH5B 4XWOD 4J3WA 2JB5L 4CKVX 3VFTA 1ACYH 5EU3A 3HR5A 1HIMH 1OHQA 4V2CB 3UZEA 2A83A 1KLFA 4HC1A 2OSLB 1RMFL 4ODVL 3U36A 1KENL 1CFQB 3MLYL 1W72H 4JO1L 3BUYA 3P4NB 4OZFH 4P3CH 3BO8B 5C8JA 5H94A 2X44D 3TH3T 3HZKB 3TA3B 5FYKL 2ENSA 3DMMC 3EOTL 4X6DE 5FAAA 3EO9L 1FN4A 3FFCB 4I77L 1XGQA 1WEJH 3L3KB 2DYPB 5C0BD 4Y4HD 4OFKA 1PGRB 2GJZB 2D03H 2R0LL 2EECA 4GFTB 1XMWA 1IVLA 1ZVHA 1TFHA 2CMRL 4PUBL 1FE8H 3QBTB 1MJJA 4R7NA 4Z7UF 5F6HJ 3RGVB 2VE6A 3NZHL 5DUPH 1CFVH 1RZ7L 2G2RA 5DMYA 1AD0A 3RZCB 1ZGLB 3C60C 1X6LA 3ARED 3VRLE 5CSZA 1G0DA 1TLKA 3A67L 3LY6A 4LSVH 4P9HH 5HHVL 2E9WA 4HT1L 2XFXB 5KAQG 3O0RL 5MENE 3PNWA 3UO1L 3ARQA 2BRQA 1XH3B 3ARYA 2P8LB 2YN3A 1RK1B 4M03A 4KZDH 5D1ZB 1F58H 3TPUA 3JTTA 1U0QA 4GS7B 1RSFA 3TV3H 1DSFH 4S1DC 3WS6A 2VXSL 4G9FA 5AG9A 3LVEA 4TNWK 4D9RD 4HIEB 4JEGB 4AEEA 3UTTD 4ZXBA 2F53A 5C0AD 3BWUC 5DQJB 4OGXH 3P4OB 1KIPA 4WV1B 1XGUB 4X5XA 1KN2L 2ITDB 5SX5K 3WKML 2CO6B 4OB5H 1QHOA 1J7VR 5I1JL 1CFBA 3RTQA 4KQ3H 5B39G 5IK3B 4ELMB 4YH6A 4LHJB 2Z31C 1JBJA 1A5FH 4M43H 1EVUA 1QFPA 2LVEA 3HG1B 1AGCA 3RUGB 4D0CA 7FABL 5CGYD 3MRGA 1F00I 4U1SA 3B9KA 4FQHB 3JTSA 3VFNB 1QFUL 2EIZB 1CGYA 3GZKA 2W38A 4HKJA 4JFPB 3WSQL 4DN4H 4OKVA 4G9DA 4Y5YA 3HR6A 4YNYB 3HZVA 1G7HA 5FDYA 4LCIH 4LIQH 3G5ZB 1UH4A 2BY1A 5HYQA 5JXEA 2YPKB 1ZANH 1L9NA 2D7MA 4PB9L 1D5BB 1L4IA 1JHLH 1HINL 4GMTH 4X80L 1TXKA 4FZ8L 2IWGA 3ZKXB 3SO5A 2H45A 4RQQB 4WUKH 5ITBH 3HE6D 4KK5C 25C8H 5GGQH 3NN8B 3QUYD 4LDLB 5FYLH 2GJ6D 1R3HB 4TQEL 3S96A 3QDGD 4P48A 4Z95H 3SDYL 2GTWA 5ETUB 3L6FB 1KFAL 1T1XB 4YGVB 2PCPA 1IQDA 4DQOH 1ZT7B 4MQSB 3CPLB 1ZLWH 2EDJA 5E2UH 4FFZH 3KHOA 1OTUD 4TOYH 3CXDL 1FZKA 1ADQH 4O4YL 2Z8SA 2R23A 4Q9CA 4H8WH 2IALB 2MPAH 4WUUB 1NCBL 2HT3D 4UQ3A 2WBKA 3UX9B 3UTSB 3B5TA 4JHAL 5CBEB 2CDFB 2I07A 2JK5B 3PWJA 1E6JL 2DMCA 3S7GA 3ULSB 3N0PB 3DV4B 3QXVA 3QEUA 4Z7UE 4MB3A 1W72B 4FQPA 4YBQD 1U8NB 2NX5B 1KULA 3QUKB 1AC0A 4OZFB 3E2HB 4Y19E 4HX1A 2DWEA 4HV8B 2NW2A 4WFED 5GS0H 5I1HH 5EUKA 2BSTB 3L3JA 2AJYH 1YJDH 5DI8A 2NLJB 4JO4L 5FO7A 4M1CD 4FMFA 3GJFK 5IBTL 4P5TA 4F3FB 5ID0A 5F7YC 3U9PL 3WNLA 2VC2L 4NWUL 1NGPL 2XG4A 4F8QA 1F3DJ 2EKSB 3KJ6L 5GRVK 4GJTB 4LBEB 5D2NB 4JKPL 4PLNC 1F45A 4WI3A 4I3RH 1NFKA 3EYVA 3M1BA 1FCCA 1BZ9A 4ODHH 3QUZD 5CLTA 3SDAC 3PGFL 3FHAA 5D96B 1QFHA 2WSKA 2X4PA 4JDZB 1LDSA 5BZDB 4HPYH 1JNHA 4P5KB 2X4UB 4OLWL 4P46A 5J13C 4G8GB 3WUWB 1PY9A 3RU8L 2H9GB 1LEIA 3WFZA 2JIXA 4KK9C 4HQQL 3C6SB 4R2GD 1QD0A 3RWEB 4R97B 4GKNA 4YHYB 3QNZB 1KCUL 5J3HD 1LK2B 2C1PB 1TVBA 2PYEE 1AJ7H 5C0GA 3IXAB 3NZ8B 4PGCA 4D0DB 1AGBA 4W81A 2BNUB 5F7LB 2ATPA 1VFOA 4R3SA 3QEHB 3QI9C 3O6FC 2WANA 3WN5B 3VXOB 4QWWD 5A3IC 5I76A 1U8IA 3PJSB 3UTQA 2BSED 4UI2A 4G5ZH 4LAQH 3D3VA 5FYKD 2GAZB 4QRPB 5GHWL 1XR8B 2H8PB 5FA4A 2RFXB 1IAOA 3S5LG 1A0QL 5T1LD 1PSKH 2FNBA 1D7FA 4IRSB 1RVFL 4NSKA 1KYOJ 2AI0H 4JY6B 2QADC 3QNYB 3RP1A 5EBLA 5JXAH 3GIZL 4E41A 1KPRB 4QOKD 4PB0H 1A47A 1B0RB 1T22B 3WJLA 3WLBB 3WIHH 5GSVA 5ISZE 2FEEI 2ICES 1HXYA 3GSRB 4LQFH 4PRHE 4YHKL 5I1DB 3DUUA 2D0FA 4FRWA 2X1XR 1IT9L 5HHOB 4LEOB 3NGBB 4HPOH 4LVHC 3EFFB 5L6YH 3X3GL 1YMHA 2CRZA 4O02H 4QHLB 2UVEA 4HJJH 5IVXB 2FB4H 5HHMD 3BD4A 1OQXA 2V7NA 3CFDB 1KIUA 4E42A 3GMOA 5IB5B 2ESVB 3OJVC 1QBMH 1CXHA 3PP4L 3WNPA 3JWOH 5JOPD 4RAVA 3UZVB 5IV2B 4HAGA 1UH3A 2HRPL 4YPGB 2ARJB 2E8YA 5LGJA 5I73B 1T3FB 4FQ2H 1WWBX 4OAWA 1NC4D 1ZA6B 4XHJD 4GRMA 4IOIB 5TDNA 1WAAE 2HVKB 5INCA 1CXFA 5B3JE 1TNNA 5EUOA 1ZA3B 4MLSA 4ERSL 4NNXA 3AAZB 1KYOK 1EHNA 2HJLA 3QIWB 4P59H 3ETBF 4PG2A 3HCVA 1RJZA 1K5NA 2ZKHL 1JMXA 3P73B 4P9ML 3JZ7A 5CJXA 1JGVL 2HG5A 2Q6WB 2CQVA 1DVFA 5CZVH 1YEDA 4OTXL 2WBJA 1OAXH 4XWOC 4ELKB 2P48B 4KAQL 5EA0L 4PJ8B 1I3GL 3ZO0A 2EDTA 3HNTL 5T3XL 5LJYH 2E9JA 2DQHH 1AR1D 3BDXA 4D2NA 4NHCH 3CJJA 1OT1A 5FUZL 3RWFB 1EMTH 3MNVA 4YDVB 4UTBH 4AH2A 1SM3L 2A6IB 3C8DA 1FDLL 5E6IB 5H37H 1BQLH 5DGQA 2NY6C 1IC7L 5SX5H 5K93A 1DBML 1CDGA 1EHAA 2OL3L 3MRHA 4GRLD 2VDPH 2E6PA 1CDBA 1MIEH 1CD1B 2AEQH 3QDJA 5EC1A 3T08A 5IFJB 5H35A 1T0MB 1T2QH 2BRRH 2X41A 2J6EL 5DJ6B 4B7IA 4Y4HC 1MAMH 1G7JA 3PV7A 4FQXD 4C83B 1OW0C 4H20H 2GCYB 3S34L 1LP9A 4R4FL 2V9QA 5FM5O 3DVGA 1CG9A 4KI5F 2VLRB 1H3GA 1MFCH 4X98B 3WBDA 5ID1A 3ULUH 4LNRB 2DDQH 4QNPF 1FPTH 5F8RC 4GAGH 5DK2A 4KKBD 2Y7QA 1P6AB 3AREC 5TDOA 2AABL 3OGCA 2X7LA 1EFXD 5J6HB 3SDCD 5LQBH 2PETA 1R5WB 1WUNT 4U6TA 3CFEB 4X9GA 5GJTL 1FGNH 4K8RL 5IGXL 4M7JH 1RZGB 1S9XA 2CLZA 2CPCA 3MJ6A 1R3IL 5E5UB 3TNNB 2IADB 3TVMD 4U1KB 1VGKA 2B4CC 1RJLA 1V3JA 2SEBB 1A6AB 3DTXB 4LASL 1YMMD 3U6RB 2IF7A 1FIGL 5IHUL 4KGJA 1FFNB 4Q0XH 4HWZB 3RVTC 3GMMA 4E5XA 1Q0YH 4PJ7E 2I60H 3VFUA 1KN4L 2Z35B 2NZ9D 2VXVH 4Y2DA 3RFZC 2W0FB 4UINH 4XC3H 5J6GA 1CL7H 1PW3A 1ZHLB 4HEME 2XKNA 2P24B 1N7MH 5FA3B 1OB1B 3SBWA 5BOZG 2LAAA 4ODSH 3F5WA 3MV8A 3UJIL 5I18H 1IQWH 4FQIL 3MR9A 1UYWL 1IZKA 3J8F7 1UZ8B 1JNNL 4U6HB 4M62H 5D70H 4X99B 4I3GA 4MVBD 1JWUA 4U6XB 32C2A 1FYTE 1ERNA 1IGFH 5E8DH 2WV3A 2FR4A 1D5MB 3O4LD 1MAJA 3FMGL 2OP4L 5KANG 4W70A 3V7AG 1CFTB 3GHEH 4HUVA 2BX5A 5L2KB 1CLZL 3IGAA 2QL1A 5DWUL 1V3KA 3K80A 2FBOJ 1GC1L 5ENWB 3QRFM 3FT2A 4NCDA 2CD0A 3ARGD 4PFEA 4WFGD 1TITA 5I19L 1D6VH 5BZWB 4D0BB 4LCCC 1CYGA 3LS4L 5CZKA 1VACB 2LAGB 5I2IB 4IMLB 1JGDB 3WDJA 1ZGLM 3ULVD 4HS6B 3AMLA 3ET9F 5FKPA 1A14L 2AK4A 4NOBA 4P4RB 1QA9B 5FHAH 3OMZA 1T7VA 1I1YA 5F6HI 1OY3B 4Y4KD 5DEGA 3P4MA 3BN9C 3FQNA 4AT6B 2ED7A 3H42L 3RRQA 5GGVY 4KMTL 4XVJH 3OJMB 1OTUC 3IFLH 3QPQC 4W4NA 1A4KB 2Y36L 4KJQC 3F65A 4XVSL 3REVB 2HT3C 2FO1A 2DIBA 4TRPL 2HVJA 1BGXL 2DLIA 2ZOLA 5EFIA 3H0TB 1KIQA 2XWTA 3VI3F 1MLBA 2VQTA 1Z6JT 3I3DA 1G6RA 4QRTB 4JFOA 4HS3B 3J7HA 1F8TL 1IFHH 2J12B 4M5ZH 2B1AL 3OKMA 4DKEH 4OF3A 1FV1A 3PQYD 1P7QB 1CU4H 5JHDB 4OV6F 3VWJB 1M1SA 5J12C 1T1ZA 5IMLA 4JCMA 3OXSA 1Q9WB 5D7SH 4QNPE 3M8OL 5EO1B 2H26A 2OJZL 3CMOL 1OAUH 1UG9A 3L5WA 3KPMB 4K9EH 2G5BA 2F53E 5IFHL 3I6GA 4KY1L 2APBA 3LN9A 4M1CC 5JUEH 4WU5A 3N85H 5IB4A 2FBJH 1INQB 3FB6A 5I1GL 2VDNH 2A77L 1ITCA 3GBML 4HXBL 3RQ3A 1C16A 1HHJB 1ACYL 1QEWA 4JY5L 1ZSDB 2DAVA 1CL7I 3MNWA 1N64L 3ALPA 5EU6E 3KPQA 5D6CA 4GG8A 4XNZB 2CJUH 1BFOA 4CVXA 2OI9B 1DQDH 5E2VL 4WO4B 4OCNC 5C0CB 5MEOA 2ADFH 2FATH 2C3VB 4RSVA 3HI1A 3BVNA 3TT3L 1E0OB 4O2CB 5C0JB 4R4BA 4R2GC 3QIBD 4C56B 3ZYZA 2YRPA 1NC2A 4LP4A 4L9DA 3ELAT 4PJFA 1P2CB 4WU7B 4BZ2H 5EBWA 5D7JD 2WLYA 4HWUA 3FL7A 4IIQB 2R29H 2OK0H 2NMSA 5T3XD 1RIHH 1SJEB 3BPLB 2NY5C 4Y8DC 4XPAL 1Q0XH 3C6LA 3WD5H 1IL1B 4KKAD 3X3FH 1N6VA 3WUWG 4XMLH 4NGHH 3SY0B 1YNKH 2EZ0D 3ME0A 4NRYA 3C5ZC 1L0QA 1D9KA 3ARBD 4P3WA 1CLOH 5I75C 2DKUA 4G7VH 3WFCH 1CFVL 5B4MD 5C07D 1QSEB 3P0YL 1I1FB 5KSAD 1D5IL 2Y06H 1F6AA 4P9HL 4Q9RH 2QTEA 5CZXD 3H9SE 3IAPA 4P2QB 1K8IA 1DBBL 5BS0A 2DQCH 3H9YA 1IC4H 1NDGA 3QG6B 4TSBH 4HG4J 1MJ8L 4ODUA 4YHPA 4N5ED 5CD5D 3MQIA 1BVKA 1DSFL 5T1KB 2NY2C 1SY6A 1LE5B 1PQZB 4I5BA 2CUMA 3G6AA 3O3BB 3TA3D 1G7PB 1QKZL 1C7SA 4ZFOA 4L4TA 1GGCH 4YGAB 4NN7C 4QEGA 5E8PB 1T83A 1S7RB 3W0WE 4Z7OF 2DJUA 3BH9A 3ZYOA 1QZ1A 1XGRA 3UTPD 2HLFC 5DD5H 4JB9L 4K8RD 5CEZL 1DDHB 1HDMA 2DYPD 4BSWB 1BREA 4KQ3L 1UM5H 3AU1A 2ZPKH 2WWKO 4LSTH 5EUOF 4J4PD 4YXLH 4P49A 3W9DA 3OR6A 4MA3B 4BH8B 5D6DA 4YDIL 5B22A 4FQLH 3QUMH 1S7UA 4I0PA 5D72L 1U95B 2XZZA 4MQ7A 4JGUA 4LSPH 2J8UB 4CJ0A 1VKXB 5ESVA 4JFFB 2UWEB 1DQQA 4U6VH 4MNQE 4JJ5B 4P2OC 4XHJC 4U3HA 2A6DB 1D3CA 1BOYA 2EYSA 1JZ8A 2K9UA 2WWMD 4LCWA 4APQB 1JPSL 1MRFH 2DJ4A 3CFCH 3VRIB 5SWQB 4LCIL 4LIQL 1XR9B 5EOCL 5F72S 2HH0L 1JYNA 4EDXB 1ZANL 3ZHLA 3QAZB 5DLMH 5BJTA 5FECA 4MA1C 5D1ZD 1JHLL 1QTYT 2Q7NA 1JTPA 4GMTL 4JY4B 4KFZC 4KU1A 2O5YH 4XZUA 4UBDD 5C08E 4ESKA 3EHBD 4BQ9A 1LO5A 1KG0A 3CD4A 4HG4K 4HS8H 2W1NA 4WUKL 1SEBA 4X0KB 1YQVH 3MJ9H 4FXGA 1D5XA 25C8L 5GGQL 1BVLA 2JKXA 3ALWA 3T2NH 1OTTD 3AFLA 4NQCA 1TETH 2E8ZA 4EUPH 1BIIB 3LKNA 4ODWA 4RGMC 5CILH 4MZ2A 4Z95L 4CBPA 1I7RA 2PO6B 3V6FA 3Q5YA 1A6WH 2IPTH 3BKCL 3IJYB 1FNHA 2VLME 4XPTH 5E2UL 4FFZL 5FDWA 1LP9F 2G9HB 1ADQL 4FFVD 3DXAE 2DQFB 4H8WL 2MPAL 1N2RA 4G7YH 2WQRA 4KKCC 4OF5A 2VZVA 2FEEL 4N90E 3HG1D 5IMMB 5BV7C 3VG9C 5HJ3A 5TE4H 4LEXL 5BMFH 3PV6A 4K7PH 2ZP0T 4KTYA 3CNKA 1GJIA 2VTFA 3ZKMC 3IDXH 1HXMA 1ZVSB 2ERJB 3KHQA 4FQXC 5T1MB 5DJAB 1AE6H 1ZKAA 2FZ3B 4OF0A 5AZEH 2BMKB 2R4RH 3EO1A 4V1DE 1JN6A 5I1HL 5FGCB 5D5MB 2AJYL 1YJDL 4F7EA 3A0OA 5HPMA 1KUMA 4EI5C 4JM2A 1FNAA 4XC1L 1QACA 1RZKH 5DQDL 5E00B 3G04A 4XMPH 3SDCC 1XF3A 2UY6A 4DOHB 4LLQB 3S6CA 1IGTA 4XCNA 4ODHL 1Y6MR 2DBLH 4F2MA 5ITFA 3LEXA 4OM0H 1UKTA 2HKHL 2HFFB 3KPRE 5FUCE 4RMTA 5IEKA 3DIFA 1FGVH 2FO4B 4PREB 5I66B 3BZ4B 1HEZB 1RHHA 2ZUQC 4Z7OE 5JTWA 2QQLH 4QHUA 4WUUD 2ADJA 1N6QH 2BSRB 5F9OH 1QP1A 1C1EL 2H6PB 3UTSD 2CKBH 1UXWB 5EUOE 2BXZA 1TPXB 3C09B 2NZ9C 5C0BE 3S35X 1AJ7L 4R8WL 4XP4H 4HIIA 4N8VB 2NX5D 4IS6A 4TUJB 2Y5TA 3HZMA 4FTVE 4UDTB 4NQVB 4G5ZL 4LAQL 3VFGH 3PWPA 5ANMA 5IB1A 5CSGA 3NOIA 3T3MF 3HRZA 1AD9B 5E2WH 2ZNWA 4M93C 4RGNB 4GSDL 4MVBC 1KPUA 2VMFA 3P9LB 4DZ8A 3F7YA 3L3IA 35C8H 1C8PA 1CGSH 2YPVH 4YIQA 2ZG3A 2GKIA 4B7LA 1YDPB 2AI0L 3RVXD 3L5XH 4OGYH 4HH8A 2VISA 1WIPA 3FB5B 1MHHA 1JF1B 1V7MH