1P1ZB

X-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
97
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Variable MHC class I engagement by Ly49 natural killer cell receptors demonstrated by the crystal structure of Ly49C bound to H-2K(b).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 97
sequence length 99
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p1zB00
3NIGF 4FXGA 3BYYA 2ADIB 4NRYB 2EDEA 2X4RA 1NFIA 3ALWA 3LS5H 5IHZA 1BWMA 3VXMA 3ZTJH 2EC9T 3S35H 3GHBH 5T1LA 1CXLA 3LKPA 1KJMA 4YLQT 4MAYC 3FO2B 2K7PA 4X6FA 1KBGL 4NO0A 2ZUSA 2VUOA 2E9BA 4G8GA 3MFFA 1DQDH 2H6PA 3D0VA 3VG9C 5HDQH 4L4TE 3ARFD 4Z7OE 2H2SD 4N0CC 4O02H 3OKKB 1JGLH 1DANT 2DYPA 3T2NL 4BSVA 4KZDH 4MXWH 3DNKA 3IDJB 4RWHA 4K3EL 1PDKA 3NAAL 3ULUE 5FUOL 4ZS7H 4D3CH 4NRYA 5J13B 4AIZB 4LSPL 3TCLB 5GIRB 3L3DB 3FO2A 3ZHLA 1RULH 3L5XL 4ZAKB 1FORH 5HVGB 3RQ3A 1RJZB 5E08L 5FUCE 4RWYH 3ISWA 3KPTA 1NGQH 1DQTA 1I8MB 1J8HD 3T77B 2OTPA 1KV3A 4JCLA 3QWRA 3SE4A 3LEYH 3OKKA 4HWBA 4U1SB 3G5ZB 4V1DD 1AXSB 2C5DC 4Q9CA 3OPZH 4KTDL 2UWEB 3T0DA 2P1YA 1YNTB 3UTQB 2VLJA 4LLDA 3IDXL 1GOHA 2VZSA 4JE4B 4AIZA 4D0BB 2E27L 3TCLA 3LIZL 1K4DB 3L3DA 2NXZD 5IVOA 5E6ZA 3FMGL 1OAQH 1E4WH 1NFDB 3MV01 5E2UH 4BFEA 4CN1A 1FQ9C 2J6EL 2QHLA 4XAKD 1RJZA 2M1KA 5IB3A 4GW5B 5L2JA 2DTML 2YEZA 1QSZA 1FDLL 3T77A 1RHHB 1CDCA 1KPUB 5D5ME 2XZAH 3OXSA 3N50A 2QQKH 4O9HH 1JI2A 3G5ZA 1LP9F 1AXSA 4UNTA 4X5LA 2ZSVB 1UKTA 2NY4D 3AC0A 2E7LC 4UINL 2ZUWA 2UWEA 3MLRL 3BJ91 4MXQC 5JW4N 2QBWA 5B38B 1M71A 1TDQA 1YNTA 3T3PF 3UTQA 3D3VE 3IB4A 1MRCH 4RMVA 1UJ3C 4WEMB 4APQB 4D0BA 1AI1H 2D7QA 1SJXA 3SPVB 3GJEB 1YZZA 4M6MH 1NFDA 2FHFA 2ESVE 4U1HB 3BI9X 2P5WE 4GW5A 4PJAE 4HCRL 2XY1A 3SQBA 1JZ4A 4KVCL 1PLGH 5JOEA 1IARB 1KPUA 3S36H 1T0MA 4GRLB 4HUVB 3IDMA 3HZKB 5EO9B 3FZUC 2ZSVA 2BFVL 2VH5L 5LKNA 3FN9A 3DMMB 1VGEH 4UT7H 5B38A 5I1JL 2V17L 3MOBH 2HWZL 4APQA 2Y36L 2Y06H 4LLMB 3SPVA 3GJEA 4P3CH 4MCYB 5C0CB 4JQVC 2CRIA 3MRPB 1T66D 4PRHD 3BRFA 3O9WC 4U1HA 3DTXB 1RJCA 1MPAL 1GAFL 4RRPG 4IBLT 3QUYB 5JQ6L 3UZQA 3EO9H 3B9KC 3D1MC 5EN2A 4NKOB 3O3AB 1GGTA 4GRLA 5E5RB 2XWTA 3AGVA 3HZKA 4CU7A 4NM8H 5D1QC 5EO9A 4R2GC 1J5OL 3BD4A 2A6KA 4I3SH 3FQXB 3SEPA 3QISA 5KG9B 1EV2E 4OSUH 2A0LD 4OZ4A 5HD8C 3FRPA 4XPAH 2Y7QB 3L3KB 4OI9A 1WC7B 1XEDA 4LLMA 4QRTA 1A5FL 3DROB 2GI7A 1DSFL 3FRPG 4S1QL 2ZUTA 1Z3GH 43C9B 5HHPA 1HCFX 4Y4HC 3DTXA 1ZHLB 3HZMB 3KHOA 3SGJC 1W72B 2PN5A 4JFDD 2ZCKH 1JV5A 1FCGA 5ILTL 2YN5A 4M43H 4KMQA 4XPFH 4GG6B 5F96L 3O3AA 1CZ8L 3HA0A 3TNMB 3QXAA 3DYMA 4L1HA 5HHVH 4XCFL 2FX7L 1TJHL 4Y16D 5KG9A 1Q38A 4JVWA 2J3SA 1KJ3L 1ZXQA 1R3HB 3EOTH 2K3TA 4XNZB 3CK0H 3T2PA 2Y7QA 3L3KA 3V4PL 1W8NA 3R06B 2AK1L 4WWKB 3I85A 3DROA 2CK0H 4KU1A 4BFBD 1IRAY 1CR9L 2FGZA 3MACL 43C9A 1N5YH 5D2LE 5EFIB 1N6UA 5IVXB 4Q9BA 5JXAL 1ZHLA 3CAFA 3HZMA 1W72A 4FFVC 2HH0L 1WWAX 5D1ZB 3BHBB 5IB4B 5FB8B 3DVNA 2VABB 3QNXB 1JZ5A 4GG6A 2DBLH 4X9GA 4WDIB 3TNMA 2F15A 3EYOA 5T3ZD 3G5XB 4Y4KC 1JRHI 2R4RL 3OSKA 4Y4FB 1G1CA 1BFOB 3P4MA 5FGCB 2CR3A 1FP5A 1BQLL 4M02A 1R3HA 1VPOH 4QHKI 3U83A 4WWKA 4KK8D 4UV7H 1G7HB 4QF1A 3VFSB 4QRRB 5L6YL 4PR5B 5EFIA 3JUZA 5DGQA 3SDCD 3IAQA 4YDIL 2GT9B 5KS9E 1KB9J 5FB8A 2BHUA 2VABA 3QNXA 1HYRC 1F3DH 1U8OA 4WDIA 5CS7A 3TBWA 4KHXH 3BQUC 1UA6L 4L8DA 5JOPE 3O6KH 1VHPA 2ZUUA 4DOHE 1YEIH 3CZJA 4CL7A 5FFLA 3G08B 1BFOA 4WGVB 3UJIL 3MNVB 1LGVA 3O4LE 3S3PA 3C5SB 3LD8B 4XVUD 3D48R 4MSWB 1GL4B 3VFSA 3KYKL 5CILL 1HHHA 1R3KB 4QRRA 1UKQA 1BJMA 3MV9B 4URTB 4NP4L 3RJDA 2X2YA 1CLZL 3VDCA 1W8OA 1JP5A 1A3RL 2GT9A 4UB0H 4X6BB 4P3DB 2Q1EA 4X7SL 4ZO9A 4X83A 1PX3A 2YD6A 1F90L 5C07E 1UWXK 5DK2B 1AGCB 5HYSB 3GK8H 5T1DH 5FYJD 4HWBH 1MHEB 3BGMB 2XRAL 3G08A 5DD6B 4TOYL 2PW2B 3MNVA 2BY1A 5D4QA 3AM8C 3SE8H 3QIWA 1EO5A 3HE6C 4KRPB 5D7LE 3C5SA 4P4KD 3ZHKA 1CBVL 1FNFA 2Z92B 2XICA 1YEEH 2FEEI 2HFGL 4HKXB 1NAMB 4LMQE 4MSWA 4DKEH 4OF5A 1GYAA 1MRFH 3MV9A 1I9JH 5D96B 1TETH 3TH3T 4UI2A 1KT2B 5BV7C 1M7DA 5I19H 4MQXC 3GB7B 3DETD 2EH7H 4X6BA 5AZ2H 1GGUA 4P3DA 1IKFH 2R23B 1N0LA 5CZVL 1HH6B 1WV7T 3KYOB 1RUQH 4D9QE 5HYSA 3OJMB 3X11B 5DD6A 4R4FL 4BFIB 1R0AH 3RX7A 4EDWH 1PQZB 3BIKB 4I3GA 5HYSG 1KN2L 2HRPH 5KSAC 2IANE 2FX9H 4Z9KB 2Z92A 4F37K 3QIUC 4W70A 3ARBB 4J6RH 4HKXA 1CDIA 1NAMA 4OKVB 2IPTH 1KCLA 5K9QG 4Z7VB 3QCVL 1KT2A 1XGUB 3D9AH 1EA9C 3C2AH 4GH7B 4XBEH 4AG4H 1VFAB 3O6FB 5IVXF 2APTA 3VD9A 3CXDH 4PRDB 2FEEL 1HH6A 1J7VR 3KYOA 5DD5H 5CMAB 5C7XH 4EZMA 2VDNL 5GSRB 5KTEH 4RGNB 1W0YT 4BFIA 1PQZA 5TF0A 3BIKA 1HSAA 4NQEE 5DA4A 4FQXC 1HWHB 3TVMD 1BVKB 4TULL 3IFPB 4XCCH 2EXWC 2Q6WB 3ARBA 3ZYOA 3N1FC 4NNXB 3CH8A 3KHQA 2BSTB 4Z7VA 4H8WC 5HHMD 2BNQE 2Q8AL 4PJFE 4RFNB 3QJHA 1XGUA 1CGVA 1HHKB 1VFAA 1HXYB 3BEWB 3ES6A 3QUXD 4S0SD 3O6FA 1P84K 3QI9B 3DX8A 4XXCC 4NKQB 4HKJB 4K7PL 2BDNH 2QJDA 1SYVB 5CMAA 4P0DA 4PJHA 4PRBA 3QSKB 1A0QL 4GBXB 5GSRA 4KVNL 3W0WD 3E6HB 4J4PC 3ULVH 1BVKA 5T3ZL 5MI0B 4AIXA 4QRUB 2B1HL 2Q6WA 4OLWL 4PJEF 2AJXH 3VXTB 3ETBF 5HYFA 4K7PX 3LS4L 4NNXA 5E9DA 2BSTA 1N2RB 1B0GB 2NXYB 3G6JB 3QQ9D 3KPRE 3G6AB 3O3BB 4W6XB 1HHKA 5TQ0L 3BEWA 5LCVL 1IGIL 1TXKA 2ERJC 1AY1H 4FOMA 2W92A 1KXVC 4HKJA 5D2NE 4JLRB 2H2PD 3VXRD 1BD2B 3B4NA 4NO5B 5FOJA 1UJ3A 4DGVH 2F8OA 2WV3A 3KJ6H 3NIDE 3NOIA 1C16B 3PNWB 5ITBL 2HVKA 1QR1B 5CGYD 1FNEB 5T33L 3PWNA 4BELD 5CUSL 3B8SA 4F9LC 1IKNA 1EEZB 4TQEH 3IU3B 4K2UH 3CX5K 4LCIH 3VXTA 4CGTA 2DBJA 1CFBA 1N2RA 1B0GA 4KUZL 2OYPA 1WLHA 2SEBB 1YJDC 3G6JA 1SJEB 3JSSA 3DBXB 3G6AA 1JWUB 4NWUL 4Q6IC 1VERA 3EJJX 2CO7B 2HT4D 2IH1A 4TVPE 2FNBA 1CTNA 2VN4A 2BNRA 3DGGB 3BOVA 4JLRA 4X6CE 2UZIH 1FC1A 3VXMD 3P0GB 2WLZA 4NO5A 2RCSL 4JPIB 1NBVH 1A7QH 3QQ3B 3H9SB 3ROOB 4NN5C 3BKJL 4F9PA 3BESR 3PNWA 4XP4H 1FNEA 4JQVA 1SBSH 1YPZE 3PUCA 4G8GD 1G9NH 3FOMB 3H2WA 1N6QH 4M7KH 3VJ6B 4V2BA 1EEZA 3RZWA 3IU3A 3VXSD 4Z95L 1IEHA 3FO0L 4HWEH 3B6SB 1WUNT 5D71H 3WKMH 2SEBA 1SJEA 1MIMH 4KJPD 4Z6AT 2R8SL 1BECA 1JWUA 2AJYL 4OLXL 5FHBH 2F5AH 2VLRB 1NCWL 3DGGA 1DN0B 3IFLH 3SCMC 4WI4A 3JTSB 2CIIB 4JRYE 4TUKH 1NLDL 2NX5B 4JPIA 3DWTA 4FABL 4MXVE 3P9LA 3QQ3A 2ZCLH 4JDVB 3ROOA 4NKMB 3U7WH 2C3HA 1SM3H 2R39A 3UC0L 1R3LB 3I6KA 3FOMA 4Y8AA 5FYKU 1ITCA 3VJ6A 1OY3B 3LH2L 4ODSH 3LKSB 3QWRD 4OIBA 3WXVL 5HYJE 1TQCC 2OSLA 1K5NB 1YUHB 15C8H 2JJVA 2CR6A 4Q6YA 3QHFH 3S98A 5C09B 1LK2A 1CE1H 1NDMB 2VLRA 3SKMB 1DN0A 4AYFA 1MQKH 3FO9B 3G5VB 3UTSB 4IRJD 2CIIA 5IEKB 4FMFA 2X9YA 2NX5A 4MJ5B 5EBMB 3T08A 4WFFD 3MBXH 2PYEB 4JDVA 5J89A 5FYKE 1C5BH 1T3FB 4I0PD 3KPNB 3O2DA 2OR7A 3SQOL 1EJOL 1R3LA 4ZAKD 3OKMB 1WZ1L 2I60L 3CFCL 3FFCB 1S5IL 2NZ9C 2EEAA 4LFHD 2D9CA 3PWPA 4LQFL 3LKSA 2JJTA 2BVUA 1AIFB 1JN6B 4YHKH 4JREC 4G6FB 3RVUD 1JZ3A 3LKRA 1VSCA 4TPRL 1I9RH 4J3OC 5H37G 1NDMA 5TDNB 3SKMA 4OQTA 4F8TA 1UM4H 3FO9A 4LSQL 3UTSA 5IEKA 1URLA 3V52H 1RZJH 3X12B 1ADQL 5HPMA 4N0FB 3IDYB 1MCJA 1SMAA 3O0RH 2Z8SA 2Q7YB 3KPNA 4XNXL 5DZLA 4PJGF 4IMKA 2XN9A 4MD0A 2YRPA 4WO4C 2WBKA 2BX5A 4HT1H 2MQCA 4KV5F 4P9MH 3QJFA 5GS0C 1AIFA 4HIIB 3OAYK 4Q2ZA 2CRYA 3BP6B 2X4TB 3BQUA 1DBBH 2RBLA 4DVRL 1MJJB 5TDNA 4QHKJ 5EUOA 4DTGH 4KKLC 2BOBB 4OGYL 1VFUA 1J8HE 3X12A 1I9IL 3BW9B 3BGFC 2A9NH 2QSCH 4F57H 2R0ZL 1A21A 2GQHA 4ZFOB 4PJIE 2I25N 3OHXB 1JNLH 1ZVHA 2D0FA 4HUWB 4M61B 5EWIH 5EOQL 4OCWL 4S11A 4F58H 4H88H 3LMJH 4GRLD 5SWZE 5E99H 4JFQA 1HYSD 3HC4L 2X4TA 3A6CH 2VXTH 1MJJA 1ZT7B 4FQJH 2OS7A 4I18B 1P4LB 3DMMD 1J0KA 4JGUA 4LGPB 2BSSB 3H42L 2BOBA 2EEDA 1U3JA 5F7EL 3W39B 3BW9A 3QIBC 4G8IA 1TZGH 3FB8A 5C0CD 1NMCC 2ZKHL 4NQDB 1FE8L 4PJ9D 1YQVH 4RMSA 5E7FA 1OP5K 3NFPA 3QUYD 4LLVB 4HUWA 4M61A 1UWXH 3QBTB 1QP1A 3KDMA 1RZIB 1FSKC 3NABL 4RGMB 5D7JC 4XZUA 4GXUN 2OXHA 4Y89A 1CS6A 3C5ZC 1U2CA 4YGVB 3DV6B 4LKCB 1KB5B 3MXWH 4YDLB 2XTJC 4I18A 3PWJB 4G42B 1KEMH 4MDIA 2BSSA 2MJWA 1IILE 3IAGC 1H15B 1NCNA 1CIUA 2NY5L 4X6DF 3W39A 3SDDC 2XXCB 3RHWK 1MRDL 4OZFB 3BKML 4NQDA 3MJ9A 4WI8A 1JYWA 5DLMH 3RAJH 2AJZA 4CU6A 3AAZA 3PV6A 3L5WB 4K9EC 4LLVA 4M7ZC 4BKLA 2WQRA 5FO7B 1RZIA 4QXGH 1FC2D 8FABB 4OTXL 4K3DH 4UU9B 2JK5B 3AU1B 2C3WA 1FNLA 5CP3A 4YGVA 3DV6A 1KB5A 2W60B 1OGTB 1U8LB 4PRHE 5HHXL 3PWJA 2BSRA 4G42A 4HQQH 1IMHC 1XIWD 1M7IB 4HPOL 5DVNA 1H15A 2AJ3B 4YQXL 2FCBA 3QAZC 1QLFB 2E6QA 4KPHH 1V7MH 4KRMB 1CGSL 5IOPB 2NY6C 1JNNL 2XG4A 3PIQB 1NCAL 4ZQKB 5J3HC 2Z31C 2AJVH 4PJ7F 1KGCD 5FO7A 5HGDA 5D1ZD 8FABA 1U0QA 4ZSOE 5ACLA 2PCPB 4UU9A 1HHIB 4BQBA 2JK5A 2HLFC 5IGXH 5DEGB 1CVRA 4YXHL 4Y4FD 1U8PB 1UKSA 2W60A 1U95B 1WT5A 4EOWH 1M7IA 4JFDE 2DL2A 4TVSa 5DQJB 1TTGA 2AJ3A 1ACYL 3FT2B 4UT9L 3PQYB 3CX2A 5BW7A 5IW1A 1RSFA 2AQ2A 3P30H 4NRXB 5DSCB 3GHEH 1IAOB 3UYRL 1FFRA 5B21A 4B7IA 5HPOA 1EAJA 3S37H 1N0XL 4ZMAT 1TPXC 2DIJA 2BVTA 1BJ1H 3IS1X 5E8OB 4OI8A 4UTAH 4NCDA 1T6WA 1HHIA 2WZPD 5DEGA 1Z9LA 1OTUC 3ZSSA 2AV7B 1U8PA 1K85A 4G43A 1A2YA 1CLCA 5D8JH 4HUUB 3ZT5A 4ZODA 3WFBL 3ARTA 3KAAA 1MI5A 5DQJA 1QEWB 2I9LB 3MYJB 3R0MA 1I3GH 1MFCL 3FT2A 2Y23A 3GMOB 1F58H 1GPOH 3TFKD 4ENEC 3PQYA 3Q6GL 4ZXBC 1D5BB 4NRXA 5DSCA 5I18H 4ZTOL 3RNKB 4GQ9L 1IAOA 3IT8D 1E4XH 1C5CH 1IAKB 2GTZA 3O2DH 2EC9U 2DIBA 5E8OA 2DQDH 4Q6IA 3WDHA 2O5XH 1RZFL 2AV7A 5L9DL 5H37H 1CD0A 2UZYB 1EMTL 1NL0H 4MA7L 1A3LH 4WI6A 2VZTA 1L0QA 1ZGLA 4BQ6A 4HUUA 4KHTL 1A6WH 1DANU 1QEWA 2I9LA 3MYJA 2ED8A 4NJ9L 3VD3A 1KSRA 1KCVL 2NY7L 5GHWL 3GMOA 3RVWD 5EORH 1FNSH 4R97C 1C5DB 3LZFH 1D5BA 4HIEB 3NGBC 3C87A 3IJHB 4JPKL 3M17B 5F9AC 2EDTA 2CDEB 3ESVF 3PGDB 1IAKA 4GRWB 3HPLB 3LKQB 5DQDL 1IAMA 5JR1L 3FO1B 1IC5L 4JRXB 1HH9B 5J11C 5DDHA 3BUTA 4DUXA 3SDYH 2ATKB 2ZOLB 2VDLL 5ISZB 3EYQC 2OI9C 3K46A 3NCEB 1Y6MR 2DQHL 5F88B 4OZGF 1X44A 3HFML 1H3TA 1MREL 4OFVA 3OF6A 3MRKB 1SY6L 1F6AB 2AI0L 4EBQH 3E8UH 1C5DA 4JO1H 3ZKSD 1QVOB 3G6DL 3VE0B 4PRIE 4ERSH 4TTDC 5DEZA 3IJHA 4PREB 4YBLB 5CCKH 5FYJE 3PGDA 3UAJD 3ZKQD 4Y5YB 5CP7B 2O5ZL 4PJXB 3REVA 4UT6L 3ZKMC 3LKQA 2P5EB 2X4NB 3MR9B 3VRIB 4JN2B 1LO4L 2V5MA 4JRXA 2KL6A 3RTQB 2OR9L 1U42A 1HH9A 2NYYD 4YXLL 2LFGA 1FLRL 1MCCA 4PYGA 4Q0XH 4RGND 4IDJH 5HDBE 1I8IA 4N1EA 2B8OT 2X4PB 5F88A 3L3HB 2VLLB 1UZ6F 1MVFA 4LOUD 3WN5B 3ZKND 5IBLD 4NJAL 2Y6SC 1BVZA 3MRKA 4F2MB 1F6AA 1VEOA 2DQGL 5C0DA 3HE7C 3KPSB 2I5YH 4M1DL 4PREA 1M05B 1FN4A 4XMKL 1A7OH 1C1EH 1TVDA 5IMKB 4Y5YA 5CP7A 2IBZY 4F8QA 2XA8L 4K3GA 2D4FA 2R1XB 1ZEAH 2X4NA 3MR9A 3QFJA 3QI9D 4PTTB 3ARXA 1IQWL 4JN2A 5DC0A 4KQ3L 4HPYL 2FD6H 3RTQA 5BV7H 1I8KB 4I2XE 1OM3L 3I3BA 3U7YH 3DXAB 4ZOBA 4R7DB 3MRIB 4WU5B 4XPHL 4YHIA 3RDTB 5I1DB 3W2DL 4WHTB 3JWDL 4GBXD 1FHGA 4LEXL 1A7PL 4LHQB 5E8EB 4QRSB 2EIEA 4MJIE 3L3HA 2VLLA 3W5NA 2J7LA 3UJTH 3RY6C 3WN5A 4EDXB 4F2MA 3W11C 4P23B 4D8PB 3GMQB 4U1LB 3UYOD 4KJQD 1U8MB 3WHE1 4PB0L 2YD4A 2NXYD 3RWFB 2YHGA 3BDYL 3RGVC 1BZ9A 5D72H 1H8OA 3U30B 5FYLL 5GRVK 5IMKA 4JFFB 3MJ9H 1G9MC 2R1XA 4PTTA 4UAOB 2F58L 3GGWB 4LIQH 3MLVH 1I8KA 1J0IA 4JZJC 5LJYH 4R7DA 3JVGC 3MRIA 4P5TC 3RDTA 1BD2D 1UWEH 5HGGS 1BIHA 1EUUA 5I1DA 1FPTL 4WHTA 2OL3L 3CFIC 4KK9D 5HHME 5CP3H 3GDBA 4MB4A 1MFEL 1G7MA 2PTTB 3NPZB 4G6AD 5K9QI 5JXED 4OGZA 4K8RD 3K7UA 1A1OB 4ELMB 3MBEB 3OAYH 4EDXA 3NCJL 3DI3B 4S2SB 3GMQA 3QQ4B 3TN0B 4U1LA 1U8MA 4XPGH 4G9DB 3RWFA 3CVHB 3V6FB 4OQ1A 2QQLL 3T0EB 4JFFA 4B41A 5DMGD 4A6YH 4YFEA 1N59B 3NZHL 3OJDA 3RY5A 1BOGB 1C7TA 3GEWB 2EXYD 4NQCB 1UZ8B 2IMMA 2VUYA 1U41A 5I1EH 3LQZB 3OB8A 4AEIH 1XGYH 3TJEH 4KC3B 4OF3A 4O2EB 5L2KD 3EFDL 4NHCH 4U2YA 3H9SD 2PTTA 4F80A 2C7UB 4AEFA 1IZJA 2QKIB 4ELMA 1A1OA 5DUPL 1LK3H 3MBEA 3CVIH 3MPCA 4KMTH 4PYHA 5CJBA 3LKNB 3QQ4A 3TN0A 2XKNB 2H9GB 3L5HA 3BKYL 4HSQA 3ULUC 3IDUA 2Z8WC 3WJLC 3V6FA 3VGFA 2Y72A 3T0EA 3KGRA 3ZE2E 1F3JA 4IIQC 3N0PB 2OK0L 4LHUB 3REWA 4Z7WE 1QRKA 1BOGA 2YD1A 1ZOXA 2WBWB 4NQCA 5C0RH 3FL7A 5BO1L 4NT6B 4PJXF 4UZGA 3TA3B 3TO4B 3UBXA 1A1NA 3LQZA 1WZLA 2DMBA 3C2SA 4LARL 5FUCC 1LP9E 4O2EA 5ALCL 2RB8A 2VXQL 4FQCH 1OP5H 3UBXG 1KIPA 4ZS6C 4NQTA 3DO3A 4HWZB 1KJ2B 2QKIA 3MLZH 4PS4L 3QCTL 1V3JA 4TYUA 5KVEL 5GSVB 2EECA 3LKNA 2IGFH 2LU4A 2XKNA 3ALPA 3VXME 1KC5H 5GGQL 4U1KB 3WMSA 1B2WL 5KVDH 4P2QD 5CWSB 1JFQH 4LHUA 4Y88A 3SGEI 5C09D 4JPVL 4EIZC 1NFKA 2LTQC 3OWEA 3JUYA 4G8GE 4YXKH 1BQHA 2X7LB 3TO4A 3TA3A 4MA8L 1OQXA 4LHUG 2DRUA 3UTSD 2NY2D 2IH3B 3V6ZB 4LU5L 1OCWH 3X17A 4IRSA 4ZO6A 1IT9L 1BQHG 2PYED 3KG5A 5HI3D 5GRUL 4K7FB 5DTFA 4HWZA 4OB5H 1KJ2A 1OPGH 1A6TA 5FUZL 1YNKL 2Y9RT 3MJGX 5FF6B 3AREC 1CK0H 3RFZC 1O0VA 3FFCD 3UTZB 1S9KC 5GSVA 5IEHB 2V7HA 2P8MB 4MAUH 3BZFB 2FIRT 4X7EC 4JRWA 6CGTA 4HG4J 1I1AD 2FIKB 3DURB 1IC4H 3QPXL 4UOW0 5ALBH 3DSFH 4U1KA 4G6FD 3MRDB 4NN6C 3TBYB 4WW2C 1ZT1B 5CWSA 4P5MB 2ZJSL 4KKAC 2OXGA 3SN6N 1V3MA 5GZOC 2X7LA 1JJUA 4D9LH 2X4OB 4R4ND 3CUPA 3WO3B 2IH3A 4L5FL 1MLBB 2XI9A 3ARDB 4S1RL 3WE6B 5DJCB 1EAPA 4PUBH 2XWJA 3OKDB 4MMZC 4K7FA 1MHCB 4UOJA 1FO0L 5FGBC 4I77H 2WINB 3BKCL 2N1KA 4WFGE 3VFGH 5F7FA 4IMLB 5FF6A 1QYGH 3UTTA 3ZTNH 4FRWA 3UTZA 3P0YH 5F8QC 5IEHA 3W81A 2P8MA 2CLZA 1KJVB 1OSZB 1QR4A 3BZFA 2OTWA 3OQ3B 1I7UA 3DURA 3OR7A 1ZKAA 4K3HA 4JKMA 4QXUH 2LV4A 2MCPL 2X6MA 4WFFE 1UCBL 3TBYA 2EE6A 3TZVD 3RKDD 5HI4C 1BMGA 4CVWA 4LCCC 4L4JA 4QXWA 4GRWH 2CLVB 5FM8A 1CU4L 1WFOA 4PRPB 2VDPH 1ZSDB 3WE6A 2J88H 5IBUG 5DJCA 3SOBL 4Y5VB 3OKDA 1P4BL 3P77B 5GGVH 1MHCA 4IM8A 4M6NH 2C3VB 4ZXBA 4P46B 4IMLA 4DKAA 1T2JA 2UWEE 2IC2A 3L3JB 4H1LH 3PWUB 1UFUA 1KJVA 4RAVB 1G7PB 4FNLH 5C2BH 2HJKB 4D9RD 1WITA 2B39A 3BPNC 4K8RL 3IVKB 3RWCB 1JHKL 1QQDB 3TBSB 2VMFA 3VWKB 2ZPKL 1NFDE 4NUJA 4HS8H 1QLRB 2CLVA 1R3IH 4OLZL 3STZB 1LEGB 1OAXH 3QXVA 4ETYA 4B53A 3P77A 4I13B 2C3VA 5L8KB 2H26B 5CKAA 2XV6B 4PLOB 2AP2A 5T1MA 3L3JA 2X09A 3PWUA 1AQKL 1B90A 2VL5B 2JKXA 4BJLA 2VAJA 1NLBL 4RAVA 1G7PA 4OM0H 4M1CC 4KK5D 5E2VL 4NUGH 3IVKA 2E9IA 3RWCA 3CCHB 1QQDA 5GS0H 3VWKA 3H8NA 4XB7A 3SGDI 2D2OA 1LEIB 5F9OH 1X4YA 1A7RL 5DJ2B 1PG7L 1QLRA 3KPPB 3STZA 2Q87A 4XVJL 5KVFH 2F53B 1LEGA 2J8HA 1QD0A 1A47A 4DW2H 2GHWB 3HAEG 3M8OH 2AABL 4QLRA 5F97E 1T0PB 4OF6A 5DWUL 2H26A 2Y1VA 4FQHA 3ULVF 3FCTA 3F7VB 5D6CB 4LPYA 4JY5H 3CMOH 1D5IL 5IESH 1CDGA 2VL5A 4U0RB 4LSTH 3QRFM 1AXTH 5TF1L 1Z6JT 2LVCA 3IGAB 1IGCH 2IAMC 3BT2H 3QEUB 5C0CE 1FG9C 1CD1A 1LEIA 2ZG1A 3WFDH 5DJ2A 2R69L 5C0IB 3I2CH 3QP3A 5HVWA 1NBYA 4JM4H 2PNDA 5HHOD 1OP3K 2F53A 3F6IA 3KYAA 5F6HI 1MCHA 3MLWH 3NFSH 3V6OA 1OWRM 1IM3B 4C56B 4L3EB 5D6CA 3I75B 3BZ4B 2CK2A 5J12C 4L8SB 3BH9B 3GSVB 5DO2D 1FGVH 3L3GB 3K4DA 3IGAA 1QBML 4WCYH 3WXWL 3QEUA 4U6HB 2W0FB 4M48H 1VA9A 4RA0C 3KXFB 3WFHB 5C0IA 5AWNH 1UWGL 1KTKE 4N5ED 1U92B 5IWLC 4J23A 1NJ9A 3EYSL 4YK4C 4QNPF 3VGHA 2ATPB 3HTLX 3RY6A 4GG6E 3U2SB 3WD5H 1Z9MA 3DARA 5T3XH 3PQYD 3NTCL 4R26H 2A6DA 1NCDL 1JPTH 4C56A 4Z7NF 5CINH 3I75A 3BZ4A 1CLYH 5SWQB 1MWAA 3DRTA 4HC1H 1S3KL 3V0AC 1J88A 3U1SL 4K9EH 1A6VH 4AM0B 2EYTB 2VR9A 4U6HA 5ESQA 1NSNL 2W0FA 1NUGA 4EN3D 3M07A 1MELA 4ODTH 3CLFH 3WFHA 5IVXE 2NY3D 2UVFA 1KN4H 1MCWW 3U48A 4EQ3A 2PKDA 2CDFB 4H5SA 3KPLB 3C6SB 3ZKXC 1U92A 4JM2F 1DZBA 2GJ6A 3VCLB 3QUZD 3THML 3DOSA 4FFYH 1JYNA 1RJYB 3UJJL 1KCRH 1N8ZA 1L7IH 3JWOH 4KTEH 4KUCF 5FDWB 5CFHA 3MA9L 3LQAL 5FGCE 4M62L 1MH5B 5SWQA 4GMTL 3VGAC 4S0TD 1QLEL 5EZIH 3QDHA 2H41A 4U3CA 3MLYL 1I9EA 3BAEL 4AM0A 1JPSL 3OX8B 4DKFL 2EYTA 4RFOL 4QRRE 1LDSA 1P9MA 4GXVH 2CDFA 3A6BH 4L4TA 3KPLA 3C6SA 4ORZC 5F1KC 4I5BB 5IK3B 3WIIH 5K9JH 4ODWB 5EIQA 2A74B 1OHQA 3S35L 3GHBL 5KJRH 3T0XA 1BOYA 1PY4A 1KLUB 3B43A 4AJ0A 5FDWA 5JA9A 3DHJA 3MV11 3JWDC 1MH5A 3RUGF 4GAJH 1S7VB 4IIQA 2KQNA 4YHOH 1X5FA 5EOCH 1I1FB 1LO3H 2FGWH 2FYYB 2D7TH 4RGOH 3NZ8B 1DQDL 1KXTB 5K9OB 4Z0XB 4CMHC 4NQVB 1NQBA 2YD5A 5DHYB 1JF5A 3OX8A 2X5PA 3FQUB 4O02L 3GJFK 1JGLL 3Q2CA 3HI6H 4HXBH 1F5WA 3AFLA 3MV9E 4MXWL 5ISZD 4KZDL 1QFUH 1CE6B 1R24A 3K8MA 1GC1H 3UX9B 1GZQB 1KIRB 1L0YA 3OJVC 4FZEH 4KDTA 4I5BA 2QHRL 4DZ8A 4MB3A 2C4FU 2P42B 4X7FC 4DQOL 4ZS7L 4D3CL 1E28B 2A74A 1S7SB 2PXYC 3BO8A 4JZNB 3ECBB 1OGAD 3GBLA 1XH3B 3S3JA 5I1CL 2HAZA 1PEWA 4ZNEA 1S7VA 1CYGA 3D3VB 4TTGA 1AJ7H 2P5ED 4AMKH 1I1FA 3MZGB 1FORL 3SDXB 3NZ8A 4RWYL 3RTQD 5K9OA 3WLBB 2VR5A 4LCYB 1OLZA 3LEYL 3EHBD 1DVFB 1I7TA 1S7UB 1CE6A 1GZQA 1UYWH 3OPZL 3QPQC 2JCCF 1VFMA 5HGAB 3MRJB 1NBQA 2D7MA 3HI5H 1HHGA 1E28A 2PW1A 1S7SA 3W9DB 4DAGH 3ECBA 3KPSD 4LLUB 4MMXC 5D2NC 4XCEB 3HG1B 1XH3A 2MMXA 2G60H 3K80A 1YNLL 5E4IA 1OAQL 5BMFH 3D3VA 2O61B 4OJFH 4F7TB 5F6IB 3SDAC 3FQWB 4XBGB 2C9AA 5D6DA 3DXAD 1C08B 3PHQB 4L3AA 4I9WD 2XZAL 4FG6D 4DK3A 4Z7VE 2QQKL 4O9HL 3NPSB 4PJAA 2VISB 3VGBA 5JZ7D 2G2RB 5DJXB 4PJCB 1MVUB 4LVNB 1MCDA 1EPFA 3MRJA 3WNKA 5TFSH 3HAEH 5B3JF 4P23D 1I1CA 4R3SB 4DFIA 4OV5B 3W9DA 2R2EA 3O2WH 4G6MH 4LLUA 1AI1L 4XCEA 4LSVH 3HG1A 4HAGA 4UQ3B 5SWSB 4M6OL 3TT3H 4C83B 32C2B 4XGZA 4RGNE 2R4SH 3AXLB 4JFFD 3MO1B 4PGCB 4X99B 1HQ4B 5IFAH 2O61A 3OKOA 3WLWC 4CBPA 5I6XC 3FQWA 5T5NF 4XBGA 5IHUH 1FVDB 1C08A 3MX0A 3PHQA 4HEME 1PLGL 5A2JH 3S36L 5ESVB 4OBRA 2VISA 2HT3D 2G2RA 5DJXA 5DRWB 5CJXA 1T4KB 4PJCA 1MVUA 1WICA 1G7JB 1LWRA 1Y6KR 3U7AA 1VGEL 5ADOH 1QUNA 5FM4A 4M6AA 4YHPB 4R3SA 5BOZG 2ARWA 3TN0D 3MOBL 3MRMB 4WFHD 2Y06L 4YO0B 1AFVH 3T0ED 4UQ3A 32C2A 4P3CL 4NOBA 3UEZA 3AXLA 3MO1A 4PGCA 4OKDA 4X99A 1HQ4A 5AD0A 3NACL 1WIPA 2WBJC 3OGOE 2VQ1B 4E41B 1V7NH 4NQCD 1PY9A 3HKFA 4IOIB 2VLME 5KSVA 5JA8B 4BA8A 5KSBB 4KQ4L 1J0JA 3X13A 3PL6B 5ESVA 3CDCA 1RZGB 1D9KD 1LEKB 2ZUVA 3G6JE 4BZYA 4NM8L 5I8OH 1CGUA 4F37F 5DRWA 1T2QH 4I3SL 4DVBB 1EVUA 3K1DA 4OSUL 5CLWA 4XPAL 2AAVA 2XIDA 1RU9H 3IXTB 3MRMA 4Y1AD 2EKSB 2H8PA 1YEGH 5GGRB 1BD2E 1TFHA 2VXVH 3B9VA 3TH2T 4K07A 4YO0A 1Z3GL 2DM3A 4YZFF 4MA1C 3P2TA 3O45A 1NANH 4M7LT 2BRRL 5E8DH 3BWUC 3GIZH 5L8JB 1MWAH 4IOIA 4IOFC 3TA3D 5KSBA 1G9MH 2VIRB 4FS0A 3SDXF 4XPFL 1RZGA 3HZVA 1LEKA 3U46B 5HHVL 4AQOA 3HCVB 4DVBA 3EOBB 3HE6B 3EOTL 1CXHA 3IXTA 2EKSA 4TN9A 4DN4H 1PGRB 2CK0L 4KXZI 4RMWA 5L2KE 3H9SE 3RIFK 1N5YL 3VGGA 2X9WA 4ZG1A 3RWDA 2CLRB 2I24N 1WQVT 5B4MD 4WGWB 1FL5B 2VIRA 3UZVB 3VW3L 1AQDB 3ULVD 2DQIH 2P49B 3G5YB 1KPVB 5HHQB 1IE5A 3RWIB 3HCVA 1BWWA 4W4OA 5DJDB 1YEHH 1PW3A 5GS2D 2VLRE 3U4EB 4U7KA 2BRQA 1RVFH 5IFJB 3WNMA 1VPOL 3MLSH 2NY1D 1EEYB 1P4IH 2NX5E 4UV7L 3HLAB 4B50A 2PTUA 1FG2B 2I26N 1T89C 4YHYB 2F8VA 4XNQB 3ULUH 1OP3H 2WP3T 2W9EH 2CLRA 5DEFA 1AGFA 5F6HJ 2PF6A 1FL5A 3V9FA 1QSEB 4PGBB 3WUWB 4NN7B 1EEQA 2L7UA 1HQRB 3ARDD 2CKBH 2ITDB 5I75B 3NIFF 3G5YA 4LPVA 4KHXL 1KPVA 5I8EA 5HHQA 3O6KL 3TYGH 3RWIA 4MCZB 3ARSA 1YEIL 2UVEA 5GJSH 4P2QE 2VDQH 2XWBA 3AMLA 4FQXB 5DJDA 2VXUL 3LDBC 5F7HA 3TP4A 5C09E 3B3IB 3WDJA 4BH7B 3U4EA 2NXZC 5C07A 1A7NH 3G9VA 5IFJA 2CO6B 4YNYB 4NDMA 4OZHB 4PJ8B 3UTSE 1FGNL 4QO1A 1EEYA 1LO2H 4M03A 1GGCH 1FG2A 4B5EA 2WNGA 2PYEE 3D39B 2IALA 4UIMA 5CZKA 1UEYA 4EI5C 4MVBD 4FN0A 3RU8L 4BQ8A 3AY4A 4UB0L 3FFCE 4HJ0D 3GSNB 1MHPH 2WSKA 4PRPD 3WUWA 2QQQA 3L5IA 4E5XB 1HQRA 2R1YB 5GGSB 3U0WL 4K3JH 5MERB 2XTLA 5CJOH 5D70H 4MCZA 3GK8L 3ZYJA 4R0LC 5T1DL 4P46D 5D93C 1YY9D 3B3IA 4XP5H 2DKSA 3SE8L 3ZDXF 4BH7A 1A4KA 2BHYA 3CZFB 4YNYA 4OZHA 2O5YH 2ARJQ 2IADB 4PJ8A 3BPOC 1TJGH 3QDGB 4K94H 1YEEL 4GKZA 2F54D 4DKEL 5MENB 2R0LH 1JUFB 3D39A 1MRFL 3CMGA 3BWAB 4JM2D 1FZOA 5AG8A 1JGEA 1TETL 4JFXB 4KDVA 4LRNH 5I19L 3LEXB 4JY4A 5ERWB 2EH7L 5EIVA 1IKFL 1DBMH 4LPWA 4KUCD 5FO9B 2R1YA 4OAWA 3VI3F 3QUMH 4ZUSB 1RUQL 2IQ9H 2JELH 4RISH 5MERA 1MJUH 3X3FH 5DJAA 1R0AL 2BZDA 5ICZA 2HRPL 3VWJB 5M7QA 1T66C 2FX9L 2IADA 3QDGA 1JGDB 3EBAA 4J6RL 2KKQA 1KEGH 2IPTL 5HVHC 1JUFA 5DQ9B 3BWAA 4GUPB 2VYRE 3F65A 2Q8BH 4HGKC 3D9AL 3C2AL 1AGBB 4XBEL 3LEXA 3BIAX 5ERWA 3HMWH 4AG4L 1MCSA 4QRQB 4MQSB 1KCUH 1HIML 2BNQA 4XC3H 3CXDL 5GRJH 1DR9A 5EG6C 5DD5L 5CEXB 1I75A 3EJYC 1GZPA 1I85C 4L4VB 5I1AA 3F7QA 5DD0H 5KTEL 3ZE1E 4DZBB 1NUNB 4JB9H 4FQIH 4CW1B 2ID5A 3VWJA 4YHZL 5DVKA 1RHFA 3GJFH 4XCCL 1XGTB 4NQSB 4RMQA 3GRWH 3JWNC 1JGDA 1ZVSB 1FZMB 2DWEB 2ED9A 3T3ME 5DQ9A 1REIA 3FTGA 4GUPA 5BXFB 3B8YA 1N64H 3O3EA 4NQDE 5JIPA 4DN3H 3K3QA 1AGBA 4IRZH 1II4E 3SCMB 5DMYA 1RI8A 4MB5A 3IXAB 4OFPA 1AO7B 2APVA 2DICA 1IEBB 5HY9B 3T65B 2BDNL 5CEXA 2P46B 4L4VA 5GISH 3TESA 4DZBA 4L3ED 4QXTB 2GKIA 3ULVL 1B0RB 4CW1A 2MPAL 1XGTA 4N0CD 4D94A 4F7PB 1ZVSA 2BVQB 1ZLUK 1FZMA 3O8XB 2AJXL 2A77L 2DWEA 2NQCA 3MOQA 1EHLH 1DQMH 3KXFD 5IB2A 1SYSA 2J5LC 2GFBA 2OJZL 4QGTA 3VXUD 1MJ8H 2J6EA 3IXAA 4EUPG 1AY1L 2BJMH 1JL8A 2YUVA 2ILLA 1IEBA 3T65A 2QADB 1T83A 1UC6A 1CFNB 4LLAA 3TM6A 2R15A 2LABA 1QRNB 2NY0C 4O2FB 4KK8C 4DGVL 4S1SH 3KJ6L 4J3SA 1D7FA 1B0RA 5I76B 2CQVA 5C0FB 4J3WA 3OKNB 3O2VH 1CN4A 3I6LD 4F7PA 2BVQA 3SDCC 2MKWA 3CIQA 3O8XA 4HS6B 4WUUB 5E6IB 1INQB 4MNQB 1H3PH 2W59A 5DUMH 3VFTA 5JW4M 5CD5D 1CIDA 2FJHB 4K23L 3H9ZA 3HRPA 4RDQG 3HN3A 1X5GA 3T8XB 2O93L 4RZCB 5DHVH 2UZIL 1MFAL 3B83A 4PRAA 3WBDA 1F2XK 1I7ZA 3CNKA 4JDTH 1NBVL 1E4KC 4O2FA 1A7QL 1MCWM 1NGYA 4LAJH 5L0QC 3LPWA 5F9WB 2BY2A 5F89B 4WO4B 4XP4L 5I76A 3TV3L 1OAYH 1N6QL 4M7KL 4G5ZL 4AQ1B 1UENA 3T2QA 4HS6A 4WUUA 5E6IA 1INQA 4HWEL 4MNQA 5D71L 3PQYE 3WKML 5HBBA 1K3ZA 4D0CB 4Z78B 1MIML 2EYSB 2FJHA 2MSPA 4MXQD 2FATH 4N9GB 5FHBL 5MP6H 2OJEB 1T04B 3RHWF 2AW2A 4XP1H 2X4UA 4OBSA 5AYUH 3KLDA 1JHTB 3IFLL 3C8KB 2KZWA 3GI9L 1XFPA 4HX1B 2NTFB 3QNZB 2J2ZA 2ZCLL 1RZKH 3U7WL 1SM3L 4PTUB 1AR1D 1ZA6A 3ARFB 4X4XA 3KLSA 5INCA 1FL3B 5IVZB 1HNFA 4OCNC 2Y07L 5DVLA 4WUKH 1DUYB 3Q48A 3K0WA 3DETC 3CDYA 5CEZD 4ODSL 2CMRL 15C8L 1EZVY 3V5DB 1F4XL 3FT4B 4N9GA 3QHFL 2OJEA 1T04A 4POZC 5E6YA 1TENA 4RIRA 2WP3O 1JHTA 4GKSB 3C8KA 1MQKL 5E0QA 4N8CH 4HX1A 2NTFA 2ED7A 4PBXA 1XF5B 2UYLA 3U79A 3MBXL 2NZIA 1C5BL 3BE1L 2J8UF 4XXDB 3WV0A 4PTUA 3ARFA 3S8WA 2OTUB 1FL3A 4HGWB 5DA0B 2QR0B 1DUYA 3K74B 5CJQH 3V7AE 1EVTC 4V1DB 3QB7C 5D1QD 1DVFD 4R2GD 4YHKL 4HFUL 3V5DA 5GZNC 2EIDA 2VITB 3FT4A 2WANA 4G6JL 2FB4H 1QBBA 3MJ8B 1PG7W 4LKXB 4GKSA 1F3DJ 4JHBA 4JRXE 2VDRL 3SDDB 1CXEA 5FDYA 5E2WH 3V52L 1EO7A 1RZJL 3DO7B 1XF5A 3GMLB 4Y19B 3C60C 4KI5D 2Y4SA 3O0RL 4Y4HD 5ISZE 2RQ8A 4XPTH 2Z91B 3GFUA 4WV1C 4XXDA 1T89A 1E6OH 2XXMB 1HEZA 4HGWA 3NH7H 3U9UA 2QR0A 2EE2A 1PSKH 4NZDA 4HT1L 4JQXC 3FB6B 4P9ML 3EKCA 3DUUB 4V1DA 4P2CG 5C86A 2NY4B 4Y2DB 3GSRB 1TZIB 5F9JB 2AERT 1FV1B 4YBHA 3U82B 1RIUL 4PJXE 1A6UH 1F4WH 2IPUK 1EHAA 4KJWC 3O41B 1KBGH 2P5EE 2YD2A 4DTGL 3F62A 5BZWB 2R2BB 1KLGA 1KCKA 2IJ0C 1CI5A 1UQSB 1IAIM 4Y19A 3VXQB 2A9NL 2DLGA 2QSCL 5SWSD 1CGWA 1Q0YH 2Z91A 4F57L 1CG9B 1X5XA 3T2NH 4FFVD 1GGYA 5IQ7L 4K3EH 2UUDK 3I3EA 1JNLL 4YFLF 3FB6A 5EWIL 4J12A 3ARYA 5JIHA 3LMJL 4Y2DA 4NNPL 4UILH 2E7BA 3GSRA 1KYOJ 1TZIA 3KPSE 5F9JA 5E99L 1FV1A 3GIVB 2H2PC 3A6CL 3C09C 2VXTL 3O41A 4GS7C 4M93B 4FQJL 1CQKA 4GSDH 2R1WB 1F4HA 2R2BA 3L5XH 1DBJH 5IMOB 1DN2A 3DXAE 3SKUD 1UQSA 4U49A 4JZOB 3VXQA 1NGZA 3VA2C 1TZGL 4N8PA 4OD2A 1CG9A 1H0DB 2UY6A 3N1PC 1YEJL 3O3UN 4RMTA 1YQVL 3WDIA 3H3PH 4E41D 5K59F 5A16B 4CADA 2FR4B 2HT4C 3PL6D 2H1PL 3L5JA 1Q94B 4Q7DA 5FM5M 2P8PA 3GIVA 5MHSE 3LIZH 2W65B 4EUPH 1WAAA 1HOCB 4JFFE 3AROA 1DDHB 2Q3ZA 4I4WB 2GYSA 5L7XH 1KEML 4Z7UB 2R1WA 2J6EH 4MWFA 2HG5A 3TYFA 4RMRA 5IMOA 2F19L 4XCYB 4JZOA 4KK6D 4NO3B 1VENA 1FDLH 4EXPX 1F02I 4TVPH 2G5BB 1H0DA 3WIFA 2ZZUT 4D0DB 5GQBA 5JO5B 5DLML 3B5HA 3RAJL 1BBDH 2OX5A 4ELME 4ZOAA 4LCWD 2DQUH 4QHLA 4KJPC 6FABH 2OZ4L 2FR4A 4QXGL 4BQCA 4DEPC 4JJ5B 1QFWH 1RD6A 4KY1L 4K3DL 4WFHE 5EC1B 5JHDB 5DJZA 5LGHH 4DK6A 1PAMA 3T0EE 1I8LA 2XKSA 2W65A 1NUDA 1HOCA 4ZSOA 1DDHA 1FYTB 5EULV 1G7LB 3HE6D 1H8NA 4I4WA 4HQQL 2R9HC 4HD9A 4NQCE 5EU6B 3QWQB 4MQ7B 4HUXB 4G7YH 4FQ1H 4XCYA 3AS0A 4NGHH 5T3XE 4H25B 4NO3A 4KVCH 3LB6C 3GM8A 1DQQB 1V7ML 5EPMB 4JFDA 4MQXD 4D0DA 2M8XA 5JO5A 3SE4C 3IDGB 3Q1SL 5ESAB 1B4JH 2YKLH 3DECA 1D6EB 1KFAH 1CFSB 3V0VB 3S9DB 1FNHA 1YMHB 4B0MM 5HYIA 5EC1A 4Y1AE 3V4UH 2FBOJ 5JHDA 3OBAA 4Y16A 3GMMB 1R5VB 5J13C 3MGTA 5JIKA 2OI9B 1UGNA 3P11H 2FDBP 5AEAA 1G7LA 3GKWH 5KSAD 4TNVK 2NNAB 3DUSB 4AY0A 1Q9OA 5I1KH 5EU6A 3T1FA 3R4DA 4EOWL 1JZ7A 4MQ7A 4HUXA 5HI5D 3E1F1 4ZAKC 4HH8A 2LQRA 4H25A 3H6JA 2ICEA 3DV4B 1UXSB 5EPMA 1AP2A 2HP4A 3GHEL 3IDGA 5ESAA 3LHPH 4CJ1A 1JPFA 1AD9A 3QA3B 3QO1B 4P48A 4BSWB 4DKDC 5A43C 1J5OH 1AKJB 1D6EA 4X9HA 1CFSA 1QO3B 4KTYA 3RVUC 1XF3A 1QSED 1YMHA 2P48B 4UTAL 5FYKH 4O51B 3M1BB 1R5VA 3U4BH 2HFFB 3L6FB 5DD3H 1QFHA 3MXVL 2HMIC 4FQXD 5D8JL 5FOBB 3C9NB 2NNAA 3DUSA 2QSQA 1ZLUH 2XOTA 3S37X 2EXWD 5DFWH 3BX7C 3C08H 4OZIB 1CT8B 1GPOL 1NPUA 4AH2B 3DV4A 1G0XA 2VNCA 1ORQA 4XB8A 3SDCA 3GBMH 1WWWX 3VFWB 3QA3A 3QO1A 4PP2B 1TJHH 1QO3A 2FWOB 1PZ5B 2OM5A 3CSBA 4JCMA 2DQDL 2E8YA 3HUJB 3BPLB 5DRNB 4TSAH 5DRZB 4JKPH 3RVTD 4O51A 2WW8A 2HFFA 4UBDD 4TSBL 5EZOH 5F21B 3LRHA 4D2NA 4J4PD 5D7IF 4APQC 1NL0L 3PABB 4KZEH 1A3LL 1E4KA 3C9NA 4P4KB 3ZDZF 3SY0B 1JI1A 4ONFH 1BHGA 5JXAH 1CL7I 1A6WL 3TC9A 4OZIA 1CT8A 5ICXB 3QDGD 1S78D 4Z7UF 3BEVB 1J1XH 5EORL 1FNSL 1T22B 4HLZH 5MEND 3LZFL 3QH3B 3VXPA 5DI8B 4QYOA 3VFWA 1G6RL 4GRLC 4PP2A 2YPVL 2FWOA 5I71B 1PZ5A 1HYSC 3U9PL 3EDJA 2ENSA 4N0YH 4JZJB 3HUJA 5DRNA 5B39B 3DMMC 3QNYB 4XBPA 3WL9B 3SDYL 4ZTPH 3BD3A 4XTRC 3W9EB 4CU8A 1QKZH 4HZAA 4P4KA 3EFFB 3SY0A 1BJ8A 4NNYB 4CVZB 4PRPE 4WI7A 4JVPA 3SGKA 3BEVA 1T22A 4EBQL 3E8UL 2OR8A 4JO1L 4LLQB 3QH3A 3VI4E 3EAKA 3D85B 1UA6H 5CCKL 5IFHH 1VCAA 2FBJL 4JFOB 3FFDA 4PGEB 4OD3H 1TMCB 1F4AA 4C4KO 2GIYA 2B0SL 3JV4A 3WL9A 1Q9WB 2EE9A 4QY8A 2QQNL 1JRHH 3TVMB 4Q0XL 5F3HB 4IDJL 1JTPA 1KG0B 4XNMB 3EFFA 5D9SB 1X5YA 4NP4H 4FXKB 1N5AA 4PPTA 4ALAH 4NNYA 4CVZA 1A3RH 2EDRA 3EYVA 4X7SH 3FQRA 4JGMA 1PJ9A 1I3UA 5F7NC 3QUXB 1U8JA 2I5YL 3D85A 5E7BA 3IF1B 1LDPH 1A7OL 3KNBA 2G75B 1N4XL 1C1EL 4JFOA 4PGEA 1F00I 3N1GC 3SCMD 4TOYH 4GLRI 1KCSL 1AO7D 1IQDB 1S7TB 2FD6L 5BV7L 3SO3B 1G9NC 2BXZA 3W0WB 4NWTH 3U7YL 4XNZC 3S97C 4HMEA 3TVMA 3LPFA 4WWKC 5F3HA 5AAMA 1KG0A 3S7GA 2QSVA 4LVEA 4FXKA 4HBQA 3UJTL 3GMRB 5AZEL 3RWGB 1L0XA 1INEL 2F53E 2VSDA 3O8XD 1G84A 1SEBB 5CZVH 1MCPH 1ADQA 3QUXA 4N8VB 3V6OE 3IF1A 5CD3B 5D72L 4BYHA 2G75A 4Z5RB 2ZOKB 5EBWB 3P4OB 4NPYB 4M1GH 4G3YH 3LEVH 3VXRB 3VFMB 4LIQL 4Y4FC 1DQJB 1IQDA 1S7TA 3MLVL 4UNVA 2CSPA 3W0WA 2QADD 3MRHB 4TSCL 3X3GL 2NPLX 1UWEL 2IBGA 4J3TA 1QRND 1G7QB 1NCCH 1IEAB 4TUJB 3CSPA 2YSSB 2ZUQB 3V95A 4RQQB 4XWOD 5CGTA 2V2TA 4ZOCA 4N8VA 2V2XB 3TJHC 5CD3A 1JWSB 4Z5RA 4C56E 1JNJA 1EX0A 3SBWA 4L3EE 3P4OA 4NPYA 3D2UB 4A6YL 4H8WL 4N8VG 3VXRA 3VFMA 1DQJA 3JV0A 4KKCD 2FHBA 3MA7B 3K8LA 4HIJB 2UV3A 4O00A 5I1EL 2HYMA 4LSSH 2XFXB 4PGDB 4AEIL 3TJEL 3CH1B 2N7BA 4JPWH 3LD8C 3KXFE 1M7XA 3ELAT 4MHHI 1IEAA 4QOKD 4WO4D 3VXSB 3VFVB 1LP9A 4X7TB 1CGTA 1LK3L 3CLEH 1TJIL 4OFYA 3KPQA 5GS0D 4RQQA 4X9BA 2V9RA 2RIKA 3EZJB 3LVEA 1W0VB 3HI1B 3ZT6A 2WIIB 4XPBH 1RZJC 1JWSA 1A0QH 2DM7A 3N1QC 4YC2B 1K4CA 2CH8A 3D2UA 5C0RL 2FJFB 3I6LE 2K9UA 5T3ZH 1S5HB 4HIJA 4UTBH 4PGDA 4KRPC 3QXTA 4IEFB 4WEBH 3HMXL 4FQCL 4N90D 3MCLH 3RVWC 3V8OA 3VXSA 4Z7OF 1U3ZA 5LQBH 3O4OC 3MLZL 3VFVA 4YPJA 25C8H 2ZNWA 4GXUM 2IGFL 3HI1A 3V79C 1KC5L 3Q5TA 2H32H 2WIIA 3ULUF 1JTTA 3WO4B 5I74B 4I3RH 5KVDL 1MAMH 2ADIA 1JFQL 4BK5A 1BZ7B 2HFEB 4IRJB 4RSVA 1YJDL 2AEQL 3RZCB 5T33H 2W1NA 1S5HA 4H0GA 5E03A 4F15B 4I0PB 1OCWL 5EA0L 1PFCA 3FKUS 1MIEH 1P7QB 4YHLH 3S4SB 3HNTH 1Q0XL 4NOFA 3ARBC 3ME0A 4OB5L 1OPGL 4QTIH 2HJFB 1AHWB 1CK0L 3V0WH 5D7JD 5ITFB 1WTLA 3K8KA 4JY6B 4MAUL 3C5ZD 5EBGA 3IDJA 3O6FC 1IC4L 1P84J 5F70A 3DSFL 5A3ID 5FA4B 3UDWA 1LE5B 1ZV5A 4GAFB 5DJYB 4ZNEE 1BZ7A 2HFEA 4AK1A 4IRJA 1NKOA 1HZHL 3RZCA 4RGNC 1IBGL 5GIRA 1QPXA 4D9LL 3SDDD 3U0TB 3WS3B 4I0PA 5FYJH 5CEZE 2AQ3A 4Y19D 3B9AA 4LOUC 4PUBL 4ZAKA 2XA3A 4RFEB 2XZCL 5IBLC 3S4SA 2XZQH 1ZWIB 5FEBA 3R1GH 1XCQB 1I8MA 3VFGL 5D5MF 1QYGL 2AJYH 1AHWA 3ZTNL 4G6KH 3S4SG 4RFNC 2R56H 3P0YL 3TIDB 4U1SA 4LFHG 1T21B 1H3UA 1Q9LB 4HJJH 5E2TL 2KQMA 4Y2DD 3ARUA 1NLDH 1DCLA 2GUOB 4KGJA 2CJUL 5CSGA 5DJYA 4WW2F 4XT1C 2KZ1B 2C1PB 1G1YA 1GVIA 3N85H 1S9VB 3SDXE 1KIQB 2LVEA 4AEEA 1K4DA 3U0TA 3WS3A 2VDPL 3ILPB 2J88L 3TO2B 1IKNC 5GGVL 4R90H 1ZWIA 4O58L 1DQLH 5J3HD 5EZLB 3CX5J 2Z31D 1XCQA 1MFBH 4OFKA 1YN6B 2NXYC 3VGEA 3OB0K 1RHHA 2AJSH 4LASH 3TIDA 1T21A 3T4AB 1Q9LA 2NTSP 4OLVH 2HLFD 1GH7A 4FNLL 1DL7H 5C2BL 5C6WH 1YQ2A 2GUOA 4KI5E 3HG1E 3GKZA 3BGAA 2J12B 4HK3N 4QCIB 2C1PA 4HS8L 2MTPA 1UEMA 3H7LA 3EYUH 3MUHL 2VWEC 3SQOH 5B38G 5C6TL 3F7RA 4F9PC 1R3IL 3QEQB 5JXEC 3QRGH 4F7CB 3PDDA 1OAXL 3TO2A 4PJ9B 4X98B 3NCBB 4XC1H 2J8OA 4PJCE 4R7NB 5C3LD 3QFDB 5M94B 4NKIH 5F93C 5DRXB 5SV4A 4HUVA 2BY0A 4RBPK 4P99A 1OAZL 1U8IB 1GSMA 1X4XA 2B5IB 4OM0L 1OTUD 1F3RB 5IQ9B 2OLDA 2EXYC 2LU3A 4NUGL 3ZE0E 2FZ3B 4CVXB 1ADQH 3U6RB 3DMMA 4F33B 5SWSE 5GS0L 4G7VH 4QCIA 5F9OL 4ONGL 3BVNB 3L7FB 1YEFH 3ZKXB 5IV2B 1GHFH 4XNXH 1WIOA 4OCXH 4MZ3A 2B4CC 1QNZH 3QEQA 4MCYA 1A4JB 4P2OB 4F7CA 5C0CA 5KVFL 3QEGH 5IG7B 1B4RA 3MRPA 2YN3A 3FAWA 4PJ9A 3M8OL 4ORGB 2IPKB 4X98A 3EOAB 3QUYA 1WJ3A 4NZTH 4R7NA 1TTFA 3D0LB 3QFDA 4JY5L 3OXRB 3CMOL 4NKOA 5IESL 5DRXA 5F1NB 2ICES 4LSTL 1AXTL 1DFBH 1U8IA 5IQ9A 5JHDD 3FQXA 1SY6A 2J1KA 2F9BT 3UMTA 2FZ3A 2XG5A 1IGCL 5KBNC 3BT2L 3CFJB 2MFNA 1XIWB 2V5TA 4XNUH 1FYTD 3L7FA 4HFWB 5IV2A 2GSIB 1AGDB 2R0ZH 3WFDL 1WC7A 3MJ6A 4E41E 3G04B 5EU6D 4JM4L 3C8DA 5D2LF 1A4JA 4P2OA 5KSBE 5IG7A 2VKWA 3B2UC 4X80H 4ORGA 1FFPB 1MHHB 4LP4A 3NFSL 3D87B 1YYLL 2B7DT 2BHZA 2IPKA 3EOAA 5DF0A 3ZDXE 1U6AH 2JJTC 3DRQB 3HC4H 3OGCB 3D0LA 2X40A 3OXRA 1WFUA 1NGWB 3T0WA 5F1NA 2AEPL 4U33A 4C57C 1XMWA 3KLAB 3QZWB 3TWCH 1FGVL 1ZTXL 1TNMA 2AV1B 3EJZD 5SX4I 2EDQA 3CFJA 4M48L 1XIWA 4GAGH 4HFWA 4E42B 2GSIA 1AGDA 3R06A 2ZKHH 5AWNL 1T1WB 3VI3E 4OCYH 3MZTA 1CICB 1T03H 4IMKC 1T1XB 1ZANH 5IVXA 3WD5L 1F4YH 1FFPA 1MHHA 4ETQB 5KS9F 4R26L 4ZO7A 2OL3B 4ZFZB 1FFQA 5D1ZA 3BHBA 3ZKMD 5IB4A 1JPTL 3BISA 3OGCA 1L6ZA 4XP9H 5CINL 1AKJD 4OUOA 1B88A 1CLYL 3QDMD 3V7MA 5KZCB 3VMOA 4HC1L 3G5XA 1KLFA 5CKGA 1MSPA 1P2CB 3RY4A 3QO0B 3KLAA 4Y4FA 4X4ZA 3OKYA 4K9EL 4DJMA 2AV1A 2NY5H 3VD7A 4XWGL 3T1WA 3MJ7B 4PJEB 4R4NC 1XF1A 4ODTL 3BKMH 2MHAB 4E42A 3IDYC 1JVKA 1KN4L 1IGTB 3F5WB 3AB0B 3LV3B 2EDXA 2Y6SD 1W0WB 1G7HA 4HW6A 2R2CA 2CIKB 3VXOB 4FFYL 3FRUB 4OT1H 4PR5A 2JTDA 1T1XA 4UV4H 1KCRL 5GRVL 3HE7D 1U3HB 4PP1C 1L7IL 3JWOL 4CRPA 3WFEH 4ETQA 2MNUA 3ROLB 4ZFZA 5HYQB 5E1HB 1S7RB 3RI5K 2CUHA 1C8PA 1JWMB 5EZIL 1B6UA 4I0CC 5FHAH 1CGXA 3QO0A 1QACA 3ARQA 1ZS8B 4G8EB 3OG4B 3MJ7A 4PJEA 1T6VN 2MHAA 4YFDB 4GXVL 4HS3B 1GOGA 1IGTA 4Q9QH 3A6BL 3QHZL 2JIXB 1NCAH 2BNUB 3W11D 2FEDC 3WIIL 2CIKA 5K9JL 1QSEE 3VXOA 1R3KA 5KANG 3FRUA 1MCBA 5GGTL 3RGVD 3ROLA 4HAFA 3OV6A 2V7NB 3D25B 3VRLE 4GAJL 1HI6B 1JWMA 4J1UB 4U1IB 4YHOL 5EOCL 2FGWL 2WWKT 3CFKB 3CPLB 2D7TL 1AGCA 5DK2A 4RGOL 3MRQB 3DI2B 1BX2B 5EZJB 5EU4B 4P5TD 4OZHE 3CXHJ 3PGCB 3GBNL 1U8KB 1UB6B 2DWDB 1MHEA 1ZS8A 3BGMA 1CXKA 4G8EA 4I18C 4ZDHB 3S96B 4NRZB 2PW2A 3MRLB 5CSZB 1K8DB 3KYNB 1ACYH 3ARGB 4PD4K 3D39E 4HXBL 3HI6L 1XGRB 1QFOA 1QFUL 4MNGB 4HS3A 2P24B 1J1OH 4NC2B 2JIXA 2BNUA 3RIFF 3WYRA 1U91B 1RMFH 3B9DA 3FOLB 3GB7A 4RGMC 2APXA 4M4PA 3D85D 2V7NA 4O4YL 2R23A 3D25A 1OARH 2EDNA 1CF8H 4AMKL 3CFKA 3CPLA 1BX2A 3NCCB 5EZJA 4YDLC 5EU4A 3X11A 4JG0L 5JW3H 3PGCA 1U8KA 1UB6A 2DWDA 4LQ1A 4ZDHA 3S96A 3QDGE 1EXUB 4NRZA 3MRLA 1K8DA 3KYNA 3ARGA 1KTDB 1MFCH 2GITB 3CDFA 5MENE 1ZLSL 2MCG1 5IJKA 1XGRA 3E2HB 1UYWL 4EQ2A 1Q1JH 4OKVA 3RBGA 3SJVB 2AXJA 4PJFF 5DS8B 3HI5L 1L9NA 1MEXH 4DAGL 1I7RB 4MA1B 4YDKH 3ET9F 1FO0B 4PRDA 3ULSB 5C71A 3FONB 4OJFL 2KBGA 1GIGH 1EIBA 3TT1L 3TNNB 2EKJA 1WT5C 1EXUA 1NC2B 2X1QA 5E00B 2GITA 4ZS6D 3IDIB 1MF2H 3GM0A 3IFPA 3GI8H 5F1SA 3VFUB 2VDOL 5BW7C 1S8DB 2WK2A 4GW1B 1CTOA 3SJVA 3P9WB 5DS8A 5DJ0B 1A64A 1MJ7H 4LGRB 3L3IB 4ZNCD 2BSED 1R3JB 2BCKB 1HXYA 1JMZA 4G6ML 1P6FA 4L4VE 5E8NB 3QI9A 4LSVL 1ZA3B 5DO2C 3HB3C 3UPCA 2R4SL 1K3IA 4X9IA 5IFAL 3FONA 1SYVA 2AXGB 3TNNA 1ZLWK 2XYCA 4GBXA 4PJGB 5IHUL 3QXDB 3ZLQC 3NIDF 3HFMH 1MREH 1NC2A 3E6HA 1SY6H 3IDIA 4Z7QE 5D7KD 2G5RA 3WEXB 4OCRL 4QRUA 3ARED 3VFUA 1RQ5A 5EO1B 1S8DA 4GW1A 1E6JL 2O5ZH 4OFYD 4XH2B 1EDQA 5DJ0A 1AO7E 4JHAL 1D5ZB 4YEFA 3L3IA 1KELH 3O3BA 1R3JA 2BCKA 3KR3H 4LVHB 1RJLB 5E8NA 3VFRB 1AFVL 4YXLH 1W72H 5I30H 3VA6A 4KKAD 4X6CF 3VDBA 4BK4A 1VDGA 3D2UD 5GZOD 1N7MH 4WFED 5ID1B 1WWBX 3T0AA 1OSPL 1ULVA 1OT2A 1BD2A 3BDXA 2AXGA 5L2KB 2P5WD 4ODBD 4PJGA 3B5GA 2C4XA 3QXDA 4XI5C 1JF1B 4FHBD 4P5KB 1UXWB 3EDDA 1JYVA 1XT5A 1C16A 3RNQB 5FECB 1QR1A 1NKRA 3PDOB 4POYA 1YPZF 3SKJH 2DQGH 5JXEA 4RDQF 3OB0H 4W81A 4L8BB 3WEXA 5I8OL 5C0BB 2ZG2A 4XH2A 2XA8H 3MLPA 1QBLH 1WISA 4PFEA 5IP4A 1D5ZA 4LBEB 1B6DA 3DBXA 4P2RD 3SKOB 4U05A 4KGLA 1YEGL 1LVEA 1RJLA 5TDOB 2J4WH 1NGPH 3RX8A 1QRNE 4KI1A 3W2DH 3WFCL 3OAUL 2D03L 3BN3B 3BDBA 4N5UA 4HZLB 5D7SH 3GIZL 4MXVF 5KOMC 1MWAL 5L2KA 3H9SA 5F7KC 1KULA 1JF1A 1RUKL 1G9ML 1UXWA 4WUUE 3RNQA 5FECA 1NMBH 3PDOA 4MNQE 4I1NB 4HK0B 4A2LA 5JUEH 4N9OB 5DMKB 1T7YA 4L8BA 5B8CB 5IHLB 4RBPH 5C0BA 3B6SA 5BZDB 1FL6B 5IJVB 4QT5B 4LBEA 5IM7B 4DN4L 3SKOA 4P2QB 5TDOA 5A2IH 4ODVH 4X6DB 4C58B 1MFEH 3JTSA 2NY2B 3WIHA 4HZLA 4BZ2L 1MNUH 3RZCD 4WY7H 4HIXH 4NKMA 1SJHB 2YD7A 2DF3A 1UH4A 1D5MB 2DQIL 4HK0A 4PJ5B 1P7QD 4OFIA 2YZ1A 5DMKA 5HJ3B 4PLKC 4WJ5B 2KH2B 5B8CA 4JO4H 5IT2H 2FECI 4X7DC 4I48B 1YEHL 3EGSB 1I1AB 4YBLC 4YDJB 3SE9L 2DJ4A 2F74B 1CWVA 1K5NA 3E6FB 4O5LH 1YUHA 4QT5A 4M1CD 1RVFL 4Y5YC 2HFTA 1MCNA 1UM6H 5IM7A 1P5UA 2VRAA 3NA9L 3F7PC 4P2QA 1A02N 1FAIH 4PG2A 3RJQB 1P4IL 5C09A 3RTQC 4EI6B 5I1HL 1MFDH 4OM1H 4N90E 3ULUL 3G5VA 3RVXD 2W9EL 4MJ5A 5EBMA 3WHXB 1HN1A 4S1DC 2PYEA 2EDHA 4PJ7B 1T3FA 1L9MA 1D5MA 1OLLA 2CKBL 3WN5C 5GS1B 3OKMA 3BKYH 4U2ZA 5HJ3A 5BRZB 4WJ5A 3FFCA 3TYGL 4ISVB 2IBBA 1SVCP 5GJSL 1WF5A 1V5JA 2VDQL 4I48A 2OK0H 3EGSA 1I1AA 1VFBB 4YDJA 2F74A 4U31A 1V3KA 3E6FA 1JN6A 4P49A 1NAMH 5LAXB 3TZVB 5BO1H 4OGAD 2IAMD 3DLQR 4JJHA 1LO2L 3KS0J 3MLTB 1GGCL 4EI6A 2V5SA 4WTZA 3RL2B 1RUMH 4OLYH 5SX5K 2FECL 3RDTC 7CGTA 4HXAH 4NYLB 4NFDA 3WHXA 4WTZG 4N0FA 5JZ7C 2VAAB 1MHPL 3DVGB 2WWKO 5KVEH 4PJ7A 2Q7YA 4X8JB 4V1DE 4PJIF 4P23C 3QG7H 4OF8A 5CEYB 2NW3B 5CJOL 5D70L 5GGQH 4ISVA 4M7JL 1T7WA 4ZPVB 4HIIA 1QZ1A 4XP5L 3U30C 5IVNA 4LVOB 5LAXA 3R8QA 3BP6A 3TZVA 2O5YL 4MA8H 1G9EA 1XF2B 4K94L 4Y19E 4LU5H 4XAKE 1SEQL 5IMLB 4H26B 2WIMA 4NYLA 5GRUH 1J87A 3ILQC 4NZUH 1I4FB 4LRNL 3FHAA 4RNRB 2HT3C 1JGUL 2MOVA 2CDGB 3BFOA 3NN8B 1UM5L 2A73B 2AXHA 3QEQD 1IAII 3ZDYE 4DGIH 4DUWA 3KLHD 3MBEC 4OCLC 3QUML 4ZFOA 3C6LB 2IQ9L 1V8HA 4RISL 5CSBA 5JTWA 2ARJB 1Z9SA 3M45A 5CEYA 3OHXA 2NW3A 3TN0C 1W2KT 1M6OB 5KOVC 1IM9B 3R8BB 4ZPVA 3MOAH 3T0EC 3NCYS 3VG0H 5KVMC 5SV3A 4LPCA 5DFTA 3TF7C 1FBIH 3JTTB 5D7LD 5IB1B 1RK0B 1ZT7A 5MEQB 4XP6H 3Q5YA 1YEDB 1KEGL 1P4LA 2Z8VC 4MNHB 1XZ0B 1BLNB 1DEEB 3VMPA 2WUBH 3C5JB 4LP5A 4OLEA 5L88L 1IVLA 2Q8BL 3EO1B 3SGEH 1I4FA 4GRMB 3ZTJG 4RNRA 3HMWL 2ZNXA 3NN8A 3QDJB 4P2OD 1KCUL 3P40A 4XC3L 1QHOA 5D1XB 5GRJL 4JAMB 3OJ2C 3BJLA 3BP4B 3C6LA 3SE3A 2ARJA 2BXYA 4D9QD 2MCPH 1M6OA 2QSTA 3INUL 1WAAE 4JB9L 1SHMA 5HDLA 4FQIL 1IAIL 4LKCA 5CBEB 4OZGB 3JTTA 4Q58C 3GRWL 1RK0A 5IB1A 5MEQA 3VH8B 4M5ZL 3TO4C 1YEDA 2F5BH 3TA3C 1XZ0A 1BLNA 1DEEA 3JWOC 3C5JA 2YPLB 4QRPB 1N64L 5HHOB 3EO1A 4IRSC 4ZPTB 4GRMA 2AK4B 4IRZL 5TQ2L 2HA1A 5C92A 4OZFA 4JAMA 4NHUB 5C70A 3BP4A 4OZFG 3L5WA 5GISL 4K8RH 2HLAB 3IJYB 3CFEB 5E56A 2E8ZA 2NR6C 3AU1A 4Z7UE 3LSOB 4OZGA 4OLZH 5C0ND 1XAUA 5B4MC 1Y0LB 1OGTA 1U8LA 3VH8A 1EHLL 2QTEA 1I1YB 4HHAB 3MODH 2YPLA 1DQML 4QRPA 5FYLD 5HHOA 1S9YB 2WMPA 4XAWH 2AK4A 3VH8G 4ZUWB 2W38A 3L7EB 1CFQB 1QLFA 1CICD 3IRPX 2YWYA 2PXYD 5IOPA 1IGFH 1DBKL 3PIQA 5JHDE 4ZQKA 2B4CH 2X4SB 2CXKA 1BP3B 5E2VH 1CGYA 4UIKL 1TVBB 2HLAA 5E70A 4S1SL 1FYTE 4K71C 5KZCD 2VZVA 2PCPA 1WZMA 3S6CA 4DWHA 1A7RH 1GC1C 1PG7H 3LSOA 5EU6E 3O2VL 2PO6B 2I9TB 1EK3A 1CVSC 4EN3B 2EDKA 4XVJH 3ZT7A 2NY3B 1U95A 3CJJA 1Q72H 1QA9B 4M3KB 1TTUA 1G0YR 5IBTL 2AABH 3ZMRA 1MCOH 3QPQD 2APWA 3ARDC 1NDGB 3QUZB 1S9YA 4ZUWA 2D9QB 3L7EA 1CFQA 4OFDA 3WIHH 1TCMA 5T3ZE 2B1AL 4P59H 1U3HD 5DD1H 1EFXB 2BC4B 2X4SA 3EW3B 2H3NB 4AEHH 1TVBA 4JDTL 4WENB 3S34H 5TPWL 2RGSA 2V5YA 4BUGA 1ZLWH 1JK8B 12E8L 5DGRA 1EBAA 3O11B 4PJDB 4QEGA 4UNUA 2C26A 2CRZA 3SDAD 2R69H 1OAYL 2PO6A 4MVBC 5B22A 2I9TA 4EN3A 3QCUL 5GGRY 4HJ0C 1OOAA 1J10A 1O7SA 3NFNB 3SGDH 4NC1E 1QSFB 3QUZA 1NDGA 4OQTH 2FX8L 4Y5VC 2HVJB 1XGQB 2FATL 4U7MA 3VXNB 2JIXD 4PJBB 3QDME 4XP1L 1LD9B 1NC4D 4P46C 1YY9C 2JJWA 4WI9A 3RNKA 5KAQG 1IGJB 1N3NB 4GQPH 1EFXA 1U8QB 1OF2B 4H20L 5EDXA 2DQEH 2ZWLT 2EEBA 4FZ8L 1VESA 2D7PA 5FYJU 4WI3A 1X5ZA 2VKXA 1HK6A 3WLWD 1JK8A 4U3HA 2FH8A 3O11A 3SKNB 1GJIA 4HUMB 3BSZH 3VWKC 4AT6B 3MGOB 3WSQH 2ZUYA 5JW4Q 2LAGB 2DLFL 4WUKL 4OZIE 4XHJC 1EGJA 3ARGD 4UDUB 4U1GB 1JTOA 1UB5B 4HKZB 1BREA 1FFOB 2A2QT 4YHMH 2D0GA 2HVJA 2PR4L 1RY7B 3VXNA 2X10A 3TBTB 1LD9A 4HIEA 4YE4H 1OGAB 1A9BB 4MJ2A 1RFDH 1S3KH 3HUJE 3M17A 1JPST 3V7AG 4FFZL 2CDEA 1IGJA 1N3NA 4KRNA 1OF2A 4HIHB 4N8CL 3HPLA 3IS0X 5F71A 4JRYD 3NA4A 3RIAK 4ZFFB 1NAKH 3FO1A 3WJJA 2WBJD 5J8OA 4XMPH 4XMLL 4MD5B 2EIZB 4AT6A 1X5AA 1GGIH 3KYMB 2ATKA 2ZOLA 1JF6A 1DLFH 5ISZA 5CJQL 4TNVF 1I1RA 1U2HA 4LPUA 1K6QH 2VXSH 1NFIB 5HYJD 1UB5A 2VZ1A 5EU3B 4QKXB 2YC1B 5AUMB 2IBZX 1FFOA 5T1LB 4V2CB 3LKPB 4HULB 1FIGL 3V6OC 2FB4L 3SJVD 1QVOA 3VE0A 1OGAA 1A9BA 1OL0A 4NIKB 3UZEA 1QBAA 1F2QA 3GSOB 5KN5B 4PJXA 3MLYH 2HKFH 1WEJH 2P5EA 3VRIA 1GXEA 4RFOH 4ZFFA 4MD5A 3IU4H 3H7BB 3ZZ1A 4YWGH 5FYKD 4YUEH 4IOFD 4TRPH 1E6OL 3KYMA 4FTVB 3LY6A 3NH7L 3LKOB 5C1MB 1PSKL 5ADPH 1TVHB 4OI7A 2Z4QB 1NC2D 3NIGE 1GGBH 2X4PA 5KANI 2ORBL 5EU3A 5JIIA 2JB6B 2YC1A 5AUMA 3VD4A 1INDH 1A6UL 1F4WL 2QLVB 2GJJA 1J1PL 3BUYB 4KROB 4L1DA 5F7WC 3KPSA 4Y5XB 2Y5EA 1M05A 3GSOA 5KN5A 5GGSY 1MCLA 4L8SC 1WIUA 4EVNB 1BM3H 2RR3A 1YDPB 3T09A 1J18A 1EEUA 1Q0YL 5T5FH 3H7BA 2DLHA 3DXAA 5DZOA 4WU5A 4FTVA 1F8TH 3LKOA 5GGUB 2QHRH 4PJDF 1TVHA 1TITA 2Z4QA 1IC7L 4N1HB 2Z93B 1KB5H 3OTTA 2A6IB 4IJ3B 4QRSA 5E8EA 4DQOH 5I73B 5EO0B 2VLJB 4UILL 2JB6A 4LLDB 5LXGH 4S10A 4D8PA 4P23A 5I1CH 2DB8A 3BUYA 4GSDL 4Y5XA 5KVGH 1DBJL 5IB3B 4OZFH 3A67H 1OAKH 4PJBF 3W0WE 3FB7B 5SX5H 2WLYA 2DQJH 5L2JB 1QFWI 4HF5H 2YEZB 4XHQA 4EVNA 1E0OB 1RV6X 2JJSA 3GGWA 1YDPA 3OXSB 2OBGA 4LF3B 3MRCB 4L9LB 2IG2H 5H35B 3I3DA 2L7JA 3BXNB 3H3PL 3WNNA 1P9MC 1OTSD 5GGUA 5H94B 5CD5C 1D9KB 5C08B 2Z35B 4HBCH 2Z93A 2A6IA 2HRLA 1M71B 5EO0A 5J1SC 1HWGB 4J3UA 3QUKB 5SWZD 1CCZA 5E94B 5IIEB 1J0HA 4N0UB 4S2SA 5C0BD 2VLKB 1YNLH 3O3DB 3GZKA 4Y1AB 5L7XL 3VXRE 4G9DA 2CKNA 3PHOB 3ZE2F 3CVHA 3FB7A 5F3BB 3GSXB 4Z7WF 3NCFB 1N59A 1P5VA 4EI5D 2YMXH 4H0HB 2HT2D 1MOEA 3EZ8A 5D7KE 1T0MB 1UZ8A 4LF3A 3MRCA 4TVPL 3FJTA 4L9LA 4Z0BH 3IDMB 2QV2A 5H35A 1BBDL 2BERA 2ICWI 4XVTL 1S7QB 3BXNA 1BFVH 2MKLC 1PBYA 2DQUL 2WUCH 6FABL 5H94A 1D9KA 5C08A 2Z35A 2C7UA 2DN7A 1QFWL 4KDTC 4OV6F 2VDKH 5LGHL 3T3PE 3PGFH 4BM7A 3QUKA 5E94A 3MLXH 5IIEA 1DUZB 5DVMA 4PB9L 4N68A 4N0UA 4M6OH 2VLKA 3TPUB 3O3DA 2H9GA 7FABH 1A6AB 4WFEE 4Y1AA 5C0AB 5CZXC 3PHOA 3V4VL 1MAJA 4XRCB 2V5RA 5F3BA 4G7YL 4FQ1L 3GSXA 1AR1C 2EYRB 4NGHL 5C9JB 2D0HA 5EN2B 1TQBB 2HTLD 3GSUB 3RBSA 4NT6A 2XWTB 3VXSE 1S7QA 1B4JL 2YKLL 3MREB 2A6KB 2XQYK 4DGYH 4A2MA 1KFAL 3B2VH 3BIBX 3O6MH 4OGXH 1JZ8A 5MEPB 1X3DA 1ETZB 3I50L 4DUVA 4OZ4B 4P2RE 5FKAB 3V4UL 4PJ5D 1KIUA 1L7TL 1DUZA 2FLRT 3HHRB 4K94C 4QRTB 4X4YB 3P11L 5LWYL 1P7KB 3UPRB 3TPUA 3MTRA 4RRPA 5HHPB 1A6AA 2HKHH 5C0AA 3GKWL 3I02B 2NY1B 5GGVY 5I1KL 3NACH 3OZ9H 4XRCA 4M5YL 3MLUH 2EYRA 1JV5B 5C9JA 1RUAH 4KQ4H 5A2LH 5JQHC 2BY3A 1AE6L 3MYZA 5D6DC 3GSUA 2D4DA 3CC5B 3QXAB 5C0GB 1DVFC 2W0PA 3LHPL 3V6ZA 3MREA 2NCMA 5MEPA 1ETZA 4ONOA 3K1KC 3EJYD 5FKAA 1A3QA 3QXUA 1CFTB 5FYKL 5GJTH 5BRZD 1EGJH 2A9ML 2V9QA 3U4BL 2FH6A 4X4YA 1UACH 2YK1H 5DD3L 1P7KA 3K2UH 3UPRA 1K9TA 5ACZB 3I02A 2FIKA 4KI5C 2B2XH 1FRGH 3I9GH 2BRRH 3MRDA 3STLB 1CLOH 3RRQA 3C08L 2AVGA 1ZT1A 4P5MA 5F6IC 3DVNB 4PY8J 1RZ7H 1F45A 3GBML 3CC5A 2FO1A 3EYOB 4LPXA 2X4OA 5C0GA 5BJTB 5EH1A 1MLBA 1T7ZA 2EO1A 3ARDA 3NPSC 4QWWC 5E5MB 2X1PA 3P4MB 5FGSA 5CJXC 2CGRH 4LVNC 2UZXB 3T2OA 2WINA 1CFTA 5EBLB 4TSAL 2UWEF 4JKPL 2PYFB 5EZOL 5FCSH 1OSZA 4QF1B 4RX4D 5ACZA 2YPKB 4KZEL 4P9HC 5DT1H 4ONFL 4BZ1H 2F54B 3STLA 1NFDF 4Y0GA 1CDYA 4JM2B 1H3GA 3BZDA 3VW3H 1J1XL 1U8OB 4PBVC 3RA7H 3EDFA 1DLHB 3TBWB 4L8DB 5BJTA 4PRPA 1OTTC 3ORJA 2Z8RA 1ZSDA 1YYMH 5E5MA 3BRDA 4MQTB 4UOW1 4Y5VA 2DD8H 2XT1B 4N0YL 1V05A 5LBSL 5F1OB 4FFWC 4P46A 5EBLA 2PYFA 3C6LD 2NY0D 4XX1G 2P44B 2P8LB 4LRIA 4ZTPL 4QTHB 1HDMB 4HEPG 1IM9D 1HHHB 1QKZL 2YPKA 4GOSA 2HJKA 2XQYG 5ABDE 2EDDA 2F54A 4X7CC 3TBSA 2EDWA 4JM2A 3TGXA 2BVEA 1T5WB 2E7HA 1H5BB 4X8XA 4KXZH 5IW3A 1DLHA 4OIIL 4TNWK 3PL6C 5IFHL 4OCSH 3QHTC 4HWNA 3UO1H 4OD3L 4X6EB 2VXUH 3QDJD 3RUGB 1CDHA 5D1XD 3QIWB 1IGMH 1M1SA 4PLNC 1EHXA 1FGNH 3LPGA 1ERNA 2P8LA 4QTHA 1HDMA 1JRHL 5BQ7B 1ITBB 4KK6C 1LO0H 5J4MA 3RU8H 4ALAL 4F7MB 1M7DB 1EHNA 3CCHA 3I84A 3QEQE 2EIBA 1OAUL 3MUY1 1T5WA 1H5BA 2GW5A 2YPLD 3KPPA 3U0WH 4QRPD 4PRID 1LDPL 1KOAA 5CLTA 4ZFGH 2AK4D 4X6EA 1KENL 2ZSWB 3L1OH 4MAYB 4W4OC 3RUGA 3HPJB 4E9LA 1DEDA 2WWMD 2VDMH 4NWTL 3FB5B 3F7VA 3FAXA 5BQ7A 5DMIH 2XNAB 35C8H 4CNIB 3VG9B 2OQJB 3O4OB 4M9OA 5FGRA 4F7MA 1X5HA 1L4IA 5GRYA 3PDGA 2JCCB 1OW0A 3CVHH 5DC4B 4ODUB 3DX9B 4HDIB 1MCPL 5I1GH 2VC2H 3VXUB 3QEHB 4LSRL 4POZD 4GG6F 4JKWA 1JYXA 2YA1A 4M1GL 3RWJB 4G3YL 2X89A 2KUTA 2ZSWA 3LEVL 4MAYA 1RZKC 4UDTB 3HPJA 1HSAB 1RIHL 1IM3A 3FB5A 5TE6H 4L3EA 1VFOA 3SO5A 1CXFA 5HI5C 4L8SA 2XNAA 4CNIA 3PWVB 1YMMB 2OQJA 3BH9A 1NCCL 3GSVA 3L3GA 3QJHB 4MJID 4YHYC 4NC0B 2PO6D 1R5IB 2JCCA 3ES6B 4ODUA 3AY4C 3KXFA 3DX8B 3DX9A 1HIMH 4HDIA 5GZND 2D31B 4NN7C 3VXUA