1P1ZB

X-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
97
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Variable MHC class I engagement by Ly49 natural killer cell receptors demonstrated by the crystal structure of Ly49C bound to H-2K(b).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 97
sequence length 99
ec nomenclature
pdb deposition date 2003-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p1zB00
3V8CA 1OAZH 3GBMH 5GGRA 4D9QD 5ESVB 5T1KB 1LDPH 3RKDD 1OB1A 3DX7B 5KVGL 3OF6D 4U6HB 1XF4B 3DRQB 3QWOB 4NO5A 3QDGB 1ONQB 1X4ZA 4Z76B 3BP4B 4UT7L 5KSUB 2ZUQC 3S37X 2VN4A 1E4KA 1M7DA 1XCTB 1LHZA 3BEWB 1DVFC 5KVEH 2R2BB 4TSCL 1MFBH 4ZPVA 5JPNA 1INEL 1F3JB 2BOCB 3W11C 4JHWL 3V5HA 1PG7H 3GI8H 2Z93A 3E2HC 1WIUA 1RJLB 2BHZA 3VXNA 3GSOA 1IM3B 3V52H 5GS2H 3S88L 4U7MA 4OCXL 1G7HB 4HIHB 1MAKA 1FZMB 1CDBA 1D5BB 2X4TB 4PP2B 4OM0H 3UTPD 2ERJC 2X1WL 5IV2B 1MRFL 2DJ4A 2DQTL 3WXWH 1IEAA 2VLRD 4LF3B 4IHOA 3H7BB 2JE8A 4P57A 5LVEA 2WINA 4I5BB 4U6VH 5EWIH 1T1WA 4FNLH 4JFEE 3QFJE 3E3QE 4UQ3A 5DRXA 4I1NB 2Y7QB 3HTLX 3D69A 2YMXH 1YNLL 3VU2A 2DWDB 4GKZA 4QHNB 4MYWB 1SM3L 3ELAT 1WJ3A 1TIUA 3ABZA 5JR1L 2I9TB 3GB7A 1DLHB 5FYLL 3SKJH 1FAIH 5T1DL 1A6AB 3LIZH 1P4BH 3PUCA 1CS6A 4Z7QE 5F8QC 4CVWA 1OPGH 1R0AH 3P9MA 12E8L 4JFYB 4LIQE 3RZCB 3T3ME 1S9VB 2WV3A 4Y0GA 4FQHB 5J11B 2ADGB 1FO0A 4XWOD 2WANA 3FT2A 4U49A 1DJSA 4QXUH 4JR9H 1X44A 4XBEH 5GRUH 4OF5A 3INUL 1KF9B 5BOZG 4R7NB 4I13B 4WU7B 3X3GH 2E7CA 4K8RH 4N9GB 1BHGA 2DWEB 2BHUA 1JYWA 1YYLL 3MLSL 1QSEA 3X3FL 1JHLL 5EO9A 3O41B 3PXHA 4YX2L 3IFPB 3K81A 4CN1A 1B0RA 4NBXB 3A0OA 4X6BA 4ETYA 1EERB 2F53D 1JWMA 3I9GH 1UH2A 4DCQB 4KKBC 5I8OL 2ESVD 3IB4A 4V1DB 3LN9A 5SWZE 3AS3A 3VFNA 1ZT4B 4Z7UF 1CU4L 1HWGB 3NCEB 4GSDH 4U0QB 3S4SG 4BYHA 2OX5A 5EZJB 4JJHA 2ZUVA 1FNEB 4FQLH 5DI8A 4PRDA 2Y6SC 5GHWL 5CSZA 2J88L 5FUOL 3O8XD 5IQ7L 2ZOKA 3HMWH 4ZPTB 3PQYD 2YD2A 3D3VA 3KG5A 5F7WC 2OZ4L 2X1PA 5D7SL 4D0BB 3WIHH 1YEKL 1G1CA 4TVPD 3U46A 4U1JB 3ZT7A 1U8KA 5C07E 1LEKA 1UXWA 3T8XB 4PR5B 1B6UA 1CFTB 2OI9C 5SWZB 4YGAB 4PRAA 4JM2F 1MJ7H 4GRLC 4M62H 3WNOA 2J4WH 4HD9A 1UEMA 3CMGA 3L7FA 3DHMA 4HV8B 1J12A 2FB4L 1ZGLA 1NGXB 4GFTB 4PS4H 3C2AL 4JG1L 1W72B 3H2WA 4H1LB 3AMKA 1G7LA 4XPGH 3N1MC 2JJVA 1U8PB 4OGYH 5D2NA 3S35X 4QRPE 5FKAA 2VOTA 4EUPG 4YE4H 4TNWF 5C07B 3H7LA 1P7KA 4U1KB 2EDHA 4J3VA 4OLEA 1UG9A 5FHAH 2FATH 4NO0D 3RWDB 2EIBA 5HHVL 1XR9A 2H8PB 4JN2A 1FVEB 2AGJL 5HYFA 7FABL 1QO3A 3M45A 1JZ2A 3S37H 3VD5A 3KPRE 1SYSA 3DIFA 2K7QA 2VIRA 2CKBH 4MJIB 4TNVF 2DDQH 1EO5A 3RDTC 3MJ9A 2DQIH 4QRPB 4EIZC 4DKFH 4PGDB 5JA9A 2MFNA 1AFVH 4AQOA 2R23B 1XFPA 4CNIA 1N2RA 1AR2A 1CLZL 1NGYB 1GOFA 1SEBA 3BKYH 4L29B 4U1IA 4OCLC 4Q9BA 5BRZA 1WIOA 1U9KA 1Z9SA 3VG9C 2X70B 3ZDYE 5BZWB 3NIDF 2A9MH 4FFYH 4RWHA 4B41A 4POZD 2YRZA 4O9HH 2EKJA 1ZVSA 3X11A 2PO6A 2OXGA 1T1ZA 3JTSB 1OW0A 2X9XA 5DTFA 2MQ3A 2P8LB 3BP6A 3EO0A 1IL1B 2VDNL 3RI5F 1MJ8L 5ACMA 2KZWA 1I7ZA 3BH8B 4YDLB 5HHPA 2F5BH 1C12B 1S7WB 4GG8B 1KLFA 4K55A 1QG3A 2HWZL 5DJCA 2ZCKL 2EKSB 4HS3A 2VITB 3OAZK 3ZKQD 4AM0B 3CNKA 4NSKB 5F6HI 3HE6D 3SKNB 4X6FB 5D7JA 4JPVH 5D1XB 3IDGA 1VGKB 3U1SH 5DZOA 1VDGA 4A6YA 2Q76B 2H6PB 4IMKA 4HX1B 5C0CD 2ZUTA 2X1XR 4HUVB 4JLRA 4WUUA 4L3EA 1JUFA 1ZLUK 1Y0LA 3TO4B 3GMMA 4MD0B 1F3DH 1NFIA 4NNXA 3QCTL 1MCPL 4PV8A 4PJDE 4RNRA 4F58H 1A6PA 3FQNB 2APXA 4JAMA 1ND0A 3UJTH 4EN3A 3H9ZA 4ZYKB 3SQOL 2G75B 35C8H 3VWJD 1R24A 4C56A 4HKJB 3U9UB 1YY8A 5T3ZD 2DTSA 1YPZE 1TZHA 1I9JL 1KJ2L 2B1HL 5I1AA 3SDXE 4K07A 1W0WA 3WJJA 1CFBA 1WWAX 3UPRA 4G8EA 5KANG 4M4PA 4LSUL 3VXTB 4NHUB 4PJDB 5IW6B 3TVMA 1EBAA 2IBZY 3JVGC 1YECH 15C8L 1LO5B 4JDZB 4RGOL 3QG7H 4OCYH 2EXWD 1I9EA 1V05A 4MJ5B 2BVPB 1H15A 5IB3A 5TQ2H 2ERJB 3QIUB 2P8MB 3BZFA 3TA3A 3S5LA 1YPZB 4S0TD 4M6MH 5HDBE 1OCWL 4XI5C 1FG9C 1BIIB 2FCBA 3DRTB 3SDXB 4D9QE 3S96B 1MLBB 4ODWA 4E42A 2E9BA 4HF5H 4CVXB 2VDLL 4NRZB 3RL1B 2D7TL 3HPLA 1UACL 3ARFA 1E0OB 1KSRA 1EO7A 3PABB 1ZANH 1ADQH 5FEBA 1WF5A 2EZ0D 2F8XC 5E6IC 5CLTA 2HMIC 2P7TA 3O3EA 1EIBA 1NBYB 3PDDA 4RQQA 5EPMB 1YY9D 5DJDA 3RL2B 3S35H 1UM5L 1MFCH 2Q7YA 3WV0A 1XGTA 1W2KT 4TQEH 5I1CL 3UTPE 3NABH 4NO3A 3REWB 3BKCH 5TFSH 3TT1L 1TVBA 2RR3A 1HOCB 1R5WB 1XF5B 2VLRE 3KR3L 1IQWL 4Z5RB 1X5FA 2PTTB 5F1OB 2VLJA 2IG2H 4D0CB 4X8XA 4HC1H 1I7TA 2WBKA 3RVVD 4M1GL 3FB5B 4RMUA 3SDYH 5H2BB 4LNRA 1LQSR 2X4SA 3MRPB 3E1F1 3WDHA 1JPTH 1NAMH 4P9HC 3QQ9D 4XHJC 5EN2B 2CGRH 2FBJL 2EDFA 3EOBA 4LPWA 4XXCC 4PGJA 4JM2C 5MEPB 4MA1C 3L5WB 2E9JA 3GGWB 3FO9A 3BOVA 2VLRB 4HGWB 5KVGH 1AD9A 3WE6B 1VFBA 1J05B 4P48A 4WTXA 5KAQG 1HILA 4UT7H 1RZIB 3HI1B 2IADB 5DJXB 1KEML 1S5IL 5DVMA 5E8PB 3SGKA 3VXOB 4OZIB 4TSCH 3T0ED 4GXVL 4EVNA 3V6FA 1INEH 1H5BA 3UPAA 1AGBB 3DURA 4JDVB 4AH2A 4UIMB 1I75A 4JHWH 3ZDZF 1KUMA 3T0AA 2IMMA 2AQ3A 4NP4L 3BX7C 1U8QA 2OR8A 3QPQD 3S88H 4OCXH 3ARSA 5I15L 3ZE0F 4ODTL 5FA3A 5GSVB 2KQMA 4P2CG 1MRFH 2F53E 2DQTH 5C6PB 4FXLA 5E94B 2XA8L 5FO9A 5C0IA 1Z2KA 3CDCA 1N59A 3VXRA 1YNLH 3O6FA 4YHOL 1JTTA 5C3LD 4ENEC 4TPRL 3UAJD 2VZVA 3UZEA 3KJ4C 5JR1H 2XI9A 2OTUB 4I9WD 4RX4D 5FYLH 3QFDB 1JPGA 4HDIB 5T1DH 3F6LA 3VXPA 5GS2D 3PQYE 5D6DC 1OAQL 3HFML 4WHTA 5F8RC 5C0BD 4KJPC 1M71A 1JHKL 4JO4L 4P5MA 1JF1A 5GZND 1T83C 2OS7A 4TVPE 1A7RL 12E8H 1T22A 2F53B 3KPTA 3P11L 1OP5K 2P45B 3WFHB 3U0PA 4CW1B 5I2IA 3V0WL 3VI3F 4BFEA 4JY6A 4CAGA 3ES6A 2HJLA 3ULUC 1D9KD 5HHQB 3UTOA 4YZFE 2RIKA 1T6WA 3TWCL 3QNYB 1W8OA 1AP2A 1U93A 5ISZE 1BEYL 3INUH 5JW3L 5I1IL 3WMSA 4QHKJ 4BUHA 2PW1B 3JV6A 3PQYB 1AHWA 2XV6B 1YYLH 2HLFC 2IFFH 5C08B 3WN5C 3MLSH 3QXTA 4LCCA 3X3FH 1JHLH 4LLQA 1WWWX 3FQTB 4ZOCA 5AYQA 3FB6B 4OCMC 3QCUH 5FYKU 4YX2H 2BP3A 3GFUA 4K3JL 2UZYB 1NGQL 3VG9B 5JQ6L 3GMNA 4CDHA 2IMNA 4GUPA 3WFZA 1IAIL 1JE6A 3JWDL 3RWIA 4X80L 1QVOB 1VADA 4LRNL 5I8OH 3S3PA 5J1AA 3VXUA 1JPST 2VL4A 1IM9D 1CU4H 4LKXA 3LEXB 5IVXB 5ISZB 4GRWE 5JIHA 1LEIA 4MXWL 4I0PA 4K8RD 4QLRA 2BCKA 1MIEL 5TDPB 3CFEA 1FFNB 5GHWH 5FUOH 3HCVB 2ZCHL 5IQ7H 3VFRA 4NQCD 3L3JB 3LKPB 1CFQA 3MRCA 3V6OA 2E7LA 2AXHA 1HEZB 1W0VA 3MR9B 4NZUL 1SY6L 2OZ4H 3ULUL 2C3XA 2RFXB 1NMBL 5D7SH 4LQFL 4XX1G 4PV9B 4M7LL 4NQXB 2BVOB 2VLME 1BQHB 3ARQA 1XAUA 2PW2A 3BQUD 2KKQA 4NKQB 4HUNB 5DQ9B 5K9QI 3G5ZB 1BBDL 3SE4C 4I3SL 4GRWB 2ZWLT 2DQUL 5TH2B 5IB5B 1YC7A 2FB4H 1K3ZA 2O5YL 3C2AH 1CGXA 4JG1H 4TUKL 3CPLA 4KI5F 3ZKXC 2P47B 3V4VL 1T0MB 5E5MA 4ETQB 4N90E 2YC1A 1PGRB 1FZJA 4Y19A 5DK0B 3SDAD 5E2TL 1H8OA 4A2LA 2E27L 4J7RA 4DKAA 3BH9A 4MD4A 2DIJA 1NC2B 4EI6B 5GJSH 4Z7VA 4I77L 5HHVH 5HGBB 5KSBF 1NGZA 5C0CE 2BOBA 3HI6L 1QKZL 2R0ZL 1X5AA 7FABH 3C09C 4DUXA 1X5ZA 3HA0A 4OD1L 4XC1L 1DN0B 4PY7A 4ZUTA 2FJFA 3P4LA 4XWGL 1U8IB 3OPZL 3FO2B 3UCRA 4ZXBA 3HE6B 5ALCL 1VFOA 2X4OA 3OXRA 1K85A 5D93B 3EW3B 2LAGB 1TCRB 1CLZH 5IW1B 1VENA 2BX5A 3ARYA 2Z8WC 4RDQF 3MRIB 3SE9L 4HWZA 4Z7WE 1R3HA 4BSJA 4Z6AT 2C3HA 3JXAA 4PRPA 3LKOB 5CBEB 4Q0XL 5FCUL 2X40A 4GMTL 1ZHNB 1VCAA 5TF0A 1S9WA 1MJJB 5E6IB 1WLHA 4HKZB 4NDMA 4KK9C 3ARDA 1G9NL 5GGSA 3IKKA 3U79A 1U3HB 2BY2A 5E9DB 5BW7C 2VDNH 3F7RA 1TNNA 1MJ8H 5D9SA 1HH9B 43CAB 2XWBA 3KPNA 4HJ0C 4WI4A 2R4SL 5JORB 3LSOB 2HWZH 2ZCKH 2EDLA 3VWJB 1F4WL 5L88L 4DKEL 3UBXA 1AXIB 4BQBA 1JFQL 3DECA 5K33A 4B53A 1I1AC 5ESAB 1S7UA 5D1ZC 1MY7A 3OR7A 3BRFA 2FD6L 4CBPA 5EB9A 1GHFL 2R1YB 3C8HA 1WT5C 3DX6B 1CFNB 2CXGA 2V7NB 4G6FD 4X7CC 4HJGA 1CIDA 2CLZB 4Z8FL 3CSPA 2WIIB 1NCBL 1A6VL 1IAOB 4Y4HD 4OGAC 4NKDB 3QCTH 4N9OB 5EU6D 1MCPH 4OZHE 5K9KA 1EXUA 3DSNA 4WHDA 4F7MB 1MCWM 4KMQA 2VZOA 3TNNA 4EUPB 4GAGL 1EFXB 3SQOH 2DMCA 5FUCC 4AMKL 3DMMA 4MA1B 4ORGA 3RVWC 4PJIE 3EYQC 3SDDD 2Y1VA 1Q94B 1DN2A 1MI5D 4QHMA 4DTGH 4PYGA 5IW3A 2H3NA 3BEVA 1KJ2H 2B1HH 4HHAB 2Z9TA 2IAMA 2YZ8A 3MLWL 3OBAA 4LSUH 4U2YA 3GMPB 2EEBA 1PQZA 1T7ZA 2A83B 4KK6D 2RQ8A 4OZHB 1WFNA 1DUZA 15C8H 2BVYA 5GRVK 4APQC 3LS4L 4RGOH 2VZUA 4PJXF 4UQ2B 3CD4A 3HC0B 4LK4A 1YN7A 4RIRA 3E6HA 2AV1A 3R0NA 4PJIB 1OGTA 4EI5D 3V0VA 4Y5VC 5CHNB 3MUGB 1MWAA 1UADC 1T03L 1OCWH 3VFWB 1UFUA 3KPQB 3VGHA 1UB5A 4OLXL 1Q9OB 2P5ED 3CXDL 4Y4FC 3LEYL 5HY9A 4YC2C 2VDLH 1TTUA 3LH2L 2J1KA 1JIBA 2D7TH 5B21A 4QOKD 1VA9A 1UACH 4G9FD 4JKWA 1U95A 2GFBB 1QFPA 4H0HB 5D6CB 3KS0H 3KLHC 1GVIA 4HKBA 4UDUB 2HH0L 3Q1SL 5ANMA 1HNGA 1EGJA 1T0NB 3QXAA 3BUYB 4N8PA 3CLFL 1OP3H 1UM5H 3B9VA 4G8FB 4F8QA 2PF6A 1KB5L 5JXEA 5I1CH 3Q6FB 3QEQA 4NN5B 4MD5B 4E41B 3TT1H 3NN8B 1P2CB 3KR3H 1IQWH 4OB5L 2YD7A 1Q9KB 3S6CA 1EAJA 3SGEI 1C1EL 3FOMA 2NY2C 4X6DA 5IMOA 5EBLA 4LLDA 3UTSA 3I50L 4OV6F 4UUJA 3TBTA 4M1GH 1MCQA 1I3VA 5FGCE 3UYRH 4FFVC 1FIGL 1MQKL 2A74B 3O4LD 4N1CA 5DA0B 3IDNA 4PRID 1Q9LA 5C0BE 4XP6L 5SWSD 5CP7A 4MA3A 3FT3B 3IDMA 2FBJH 4U3HA 5DGQA 5HJ3A 1VACA 1A9EA 4M61B 3GSNA 4JZJC 5AUMB 5IB1A 1DUYA 1JTPA 3GKWL 5I1GL 1CDIA 2ICCA 4KI5C 1KEMH 1S5IH 4BFBD 1NC4B 3DTXB 1T7YA 5DJAB 2EYTA 1G6VK 4GXVH 1AQDB 4HFWA 1ZE3C 5FGCB 1GPOL 5E8EA 5DHYB 4NP4H 1UA6L 5F1NB 5ID0A 1JZ5A 3HUJE 4ODTH 1JV5B 3TLRA 3D85A 5BVJA 4OZFA 5TF1L 4FQQA 2ARWA 3SOBL 3HR5B 4NT6B 1I1CA 1HINL 4F7TB 5I9QC 4RAVB 2WSKA 3KYOA 3BP7A 5DD1L 2KL6A 2X4QB 1IGJA 1D9KB 2XA8H 3IKCB 1INQB 2GT9B 5C6TL 3JBG7 1JRHL 5JQHC 1BF8A 3FAXA 4ZAKD 4AIZB 1AKJA 1GSMA 3ZE2F 1AD0A 1XIWA 2GAZA 4YHOH 3EDDA 5FO7B 2DLIA 2BY3A 2H32H 2PYED 4NZDA 4TPRH 3RWHB 3GSWA 2P44B 5I1DA 4L9LC 1QEWB 5IMMA 1FNGA 4P4RA 3KPOA 5HTSA 4NQCE 3RUGA 1OAQH 2YPLB 3AAZB 2VDPL 3IJSB 3QI9D 1QSVA 3HUJB 2XICA 1JHKH 4JO4H 5F3HA 1G7QB 1WBXB 1EX0A 3MJ7B 3V5KB 3NMEA 5EC2B 3MUY1 1A7RH 3P11H 5DHVA 5DXWA 2YPKB 3V0WH 4X6CA 1HHKB 3C09B 1NBQA 1IM9B 3BXNA 1P4LA 3MLPA 3VGGA 3BGFC 1A4JA 4ZO6A 5FV1L 3TWCH 1Z0MA 4PB0H 1Q1JL 4MCZA 4TOYL 2O93L 4AQ1B 1EH9A 4OQTL 1QR1A 1BEYH 5JW3H 1DQQB 5I1IH 4XPBL 5FYLD 2Q8BL 4NQCB 2RBLA 2QKIA 1QFWL 3CVHB 4EXKA 3BGMB 2FECL 4S11A 4DVRH 4ODBD 4K3JH 4IDLA 1NGQH 5CD5C 5JQ6H 3G6JE 4LPVA 5E2WL 3JWDH 4X80H 4LRNH 4F37F 1MCBA 3X14A 4D8PA 3QUZD 4KKAD 1IGCL 5IBLD 2V17L 1UZ8A 3EZ8A 2J3SA 3EBAA 4I0CC 4BKLB 1QQDA 3GMOB 2YD9A 1HHIB 3AREA 4HAFA 4MXWH 2DQHL 1FVDA 4ZFZA 1MIEH 2N1KA 1UQSA 4PJ8A 2ZCHH 4O51A 1VFAB 1M7XA 3QPXL 4Q2ZB 4XAKD 32C2A 5FUCE 2MMXA 5HI3C 3CU1A 1I1AB 2J8HA 3OX8A 2J8UE 4NZUH 1SY6H 1XGPA 1HHHB 3QUXD 1NMBH 5DHXB 4LQFH 5HI5D 5IK3B 3BWUC 4KTEL 4M7LH 1IBGL 4XBPB 3G6JB 1R5VA 1BGXL 3TCXA 3PL6A 1QLFB 4ZFOB 4QTIL 3KYMA 1R6VA 2GSIA 4XNQA 5AZ2L 5EO1B 3RY6C 1IC5L 1MCRA 4X4XA 1J0JA 4XBGB 2NW3B 2EDDA 5DD0L 4I3SH 4QCIB 2XNAA 4X6EA 4WI5A 3N1FC 5I1LA 1A5FL 4X7FC 2O5YH 4TUKH 2AXGA 4NNPL 1B0GB 3RX7A 3MLVL 3V4VH 4CDGC 4GH7B 3QT2A 1PD6A 4IOFC 2J8UB 1S78C 4MS8D 3DUUB 3OKMB 2UWEF 1KIPA 4E9LA 3BP5A 3ZYZA 1VPOL 5E2TH 3DARA 2E27H 2WBWB 1WAAA 3FB7B 5IGXL 4PJHE 5GXBB 1B88A 5CIPB 1BM3H 3QO0A 2R1WB 4I77H 1JRHI 1FAKT 3LQMA 1U92B 5T5NF 4LKCA 2QHRL 1ZHBB 3HI6H 3WDJA 1QSFD 3I75B 1L0QA 2R0ZH 4WI7A 3SJVA 1K4CA 4OD1H 4XC1H 3VE0A 3FQUB 4LNVA 4IS6A 1FGVL 3MODH 2WP3T 1U8NA 2VLKE 2CIIB 2VWEE 4Y5VB 1OM3L 1FCCA 4XWGH 2BXYA 2QV2A 3OPZH 3W0WD 1F11A 5ALCH 1I4FA 5H35A 4N8VA 4HZLA 1MI5E 3U2SA 4PJHB 3OKNA 3FTGA 4G6AD 1KCLA 4WU5A 2OL3L 4MCYB 4YC2B 3SE9H 5HD8D 3D25A 2VSDA 3H9HA 4JQIL 4RAUB 4QNPF 1WFUA 2HFFA 3QSKB 3TZVA 1QBML 4Q0XH 4HLZH 5FCUH 3SKOB 1ZKAA 4NO2B 3MV8D 4GMTH 4JQVA 4Y4HB 3VFTA 1AI1L 1K2DB 1MRDL 2AABL 3PWJB 5HGGS 4HUWB 5AWNL 1G9NH 3MV9D 5JTWA 2VLKB 2JB5L 1QFWI 3SGEH 4D94A 2ICWI 2FECI 3P4OA 1A1OA 2NXZC 2ADJA 1JHTA 1XGYH 2R4SH 5GSRA 2YN5A 1BJ1J 1RZKC 1F4WH 3VMOA 5L88H 4DKEH 3NZ8A 1BVLB 1UJTA 1JFQH 1F6AB 1MI5B 3OKYA 4MNGB 1N4XL 4ZUVB 5I1HL 2FD6H 4G6JL 1CFSB 3C6LC 1NPUA 1PSKL 1GHFH 1AE6L 5F1KC 1N8ZA 2P5EE 4BQ6A 4UBDD 4K71C 5BOPA 4Z8FH 4HIIA 5B38B 1U8JA 1NCBH 2EH8L 2X09A 1A6VH 4GBXD 3T0XA 4PJFE 1P7QD 2ATKA 5F7FA 3WO4C 3EFFB 2CUIA 2VDOL 1YEEL 5F9WB 3WIIL 4YNYB 3HRZB 5A1AA 1FFQA 1L7TL 2HTLC 1I8LC 1QBLL 4GAGH 4BZ2L 4AMKH 4JHAL 4EI5B 1NGWB 3QNZA 1AY1H 2BZDA 1L9MA 5F7YC 4PGZA 4JZJB 2UUDH 5I8CA 3CX5K 3I6KA 4LGSB 5K9OA 2XPGA 3KPSE 2P5EB 4AYFA 4LCWD 1MCKA 5DGRA 1BD2D 3BMWA 3MCKA 4LBEB 1CXEA 1MIML 3MLWH 2Q86A 4NQEA 4PJFB 3BWAA 2IPKA 2BXZA 3HS0A 4JRYE 1RZKL 2LABA 5J8OA 2X10A 4BSWB 5MEOB 5D70L 2IBBA 4L4TD 1KT2B 4FTVA 5K9QG 3ALWA 2CO6B 3ZDXF 2Q3AA 2GEEA 1PX4A 3LS4H 4X7DC 3G6AA 4XNZC 4PJBA 4FQXA 4WO4C 5LGJA 1G7IA 2V5RA 3ESVF 4YR6A 1BZQK 5IVZA 5JIPA 3O4LE 2ITDB 5DJ6A 1HKFA 4QHLA 5INCA 2HVKA 1S9XB 4NZJA 1DQLL 4RA0C 2VXSH 5I9QB 1T03H 1U58B 4KMTL 3KPSB 4MSWB 3DUSB 4OLXH 2J12B 1ORQA 4ZUUB 3ROOA 3QDJD 1YDPA 3CXDH 4KKCD 3OL2A 1XF1A 1S7QA 5CEXA 2K1MA 2A0LC 4JREB 2VDRH 4JRYB 3LH2H 4X8JB 1FO0L 4LU5L 1CXHA 4RCAA 2XWTA 1S8DB 2BC4B 4L9LB 1G9EA 2YEZB 4GW5A 2AW2A 1A7OL 3NIFF 1G7PB 1F8TL 5IHZB 1YEIL 4LLMB 3JTTB 4PJCA 3QRFM 3TBVA 3ILQD 4BFIA 1J5OL 4N0UA 3O4LB 1GGBL 2AXFB 2HH0H 5DYOA 3WFEL 2NY0C 3STLA 3CX5J 5I16B 4QRUA 3CLFH 4WW1A 1KB5H 2A73B 3DXAA 1CD0A 5FB8A 1A14L 4B7IA 1UWEL 2XXCB 1JNHA 5DMJB 5KN5A 4M9OA 1NDGB 4U1SA 3DVGB 3BGFB 3C5SA 1CLCA 1FZKB 2ATPB 2BERA 4R97C 5D2NC 4OB5H 5I1KL 5HHOD 2BNUB 1PY9A 1FE8L 1BPVA 3MXVL 4D3CL 5ESVA 5T1KA 3I50H 8FABB 3DX7A 4U6HA 1XF4A 3DRQA 2PYEE 3C60D 3L5JA 1IGML 3QDGA 2QR0B 3BP4A 4Z76A 2NY4C 1FIGH 5KSUA 3G6DL 1MQKH 2ZUYA 3QNXB 2V6HA 1WTLA 1XCTA 3BEWA 4XP6H 2NQCA 1AIFB 2R2BA 2OJZL 2ZUUA 4Y5YB 3IAPA 1F3JA 1U8HB 2BOCA 2DQDH 5GGVL 4RZCB 3VWKD 4WTZG 5DVKA 5D7LD 5DZLA 1RJLA 2Y5EA 1JNLL 5JMOC 1KBGL 1YN6B 3PV6B 1IM3A 5SV4A 3D18B 5I1GH 1G7HA 3EHBD 4HIHA 4ZOAA 1FZMA 3ETBF 3FT4B 4OF8A 1D5BA 2X4TA 4PP2A 2Z4QB 3HG1D 4ZAKB 4NCC2 5C0ND 5IV2A 3B2UD 2AJUL 2ZOLB 2AXJA 2PYEB 4LF3A 1TVHB 3H7BA 5FYLE 1OLLA 1RUML 4I5BA 1MRCL 1GPOH 1UA6H 2Y7QA 2VUYA 2PO6C 2DWDA 1KCUL 4QHNA 5I30L 4PYHA 5BXFB 2NY7L 3LS5L 4YLQT 4Z77A 5F7UA 2I9TA 3M1BB 5TF1H 3SOBH 1DLHA 3O2DA 2Q6WB 1HINH 1A6AA 1E28B 4IEFB 1YQ2A 4LSTL 2COQA 2C7UB 2P24B 5DD1H 5EUKB 2VL5B 2J5LC 2CRZA 2HT2C 3V0AC 5C6TH 1JRHH 5CILL 5D7JC 1JL8A 3RPIB 4KKLD 4JFYA 4M00A 3RZCA 1IKFL 1S9VA 4ZSOE 4FFWD 2BVEA 2Z0BA 3I3EA 3TYFB 2AK4D 4XAKE 1EHNA 3HB3D 3L6FB 5J57B 4FQHA 2ADGA 3CDYA 5FV2A 1KLUB 2VDPH 3CDFA 4M3KB 1DBBL 2DIAA 4R7NA 1Y6NR 4N0CD 2VH5L 1L6ZA 4WU7A 5EBWB 4XP1L 4N9GA 2DWEA 4XCEB 1EEQA 2IH1B 3PF2A 1JN6B 3O41A 3P2TA 2J7LA 3IFPA 1A3LL 1Q1JH 2WWMC 4TOYH 1MOEA 4TTGA 4OQTH 4ZSOB 4DCQA 4UT9L 2V2WB 3WKML 3WJJC 2Q8BH 4V1DA 5HYSG 1ZS8B 1PBYA 4P4KD 4YGVB 5A40E 3MRDB 1QFWH 4KQ3L 2LFGA 2NY5L 1JNJA 1RURL 4YH6A 3GM8A 5EZJA 1FNEA 4PG2A 1CN4A 3U6RB 5B3JE 3QXVA 4QO1A 5E2WH 4F3FB 1RIUL 3IFLH 4A6YL 3LQZA 3EAKA 3T77B 5EOQL 2VQ1B 4R0LC 4D0BA 3T0DA 1IGCH 2BSSB 5JDJA 4FQPA 4U1JA 1KEGH 1KELL 2DQHH 4XVUD 3T8XA 4Q7DA 4H8WC 4PR5A 3IDYB 1CFTA 5SWZA 2H45A 4UQ3B 5IIEB 4LCYB 3QPXH 2D0GA 2CD0A 4Z7VF 3C6LB 4HV8A 1FVCB 3W0WE 5LQBL 1UENA 3EKCA 5F9JB 3QIWC 1NGXA 4KTEH 1IBGH 1W72A 2P49B 3BMVA 4H1LA 1BGXH 4JFFD 4NKIL 3MRJB 4K71B 1ZLVK 1U8PA 4NCDA 4QTIH 3RY4A 5AZ2H 3JUZA 1IC5H 4UI2A 3NPSC 2MOVA 3MV8E 5C07A 5DD0H 4U1KA 3N50A 4J3OC 3UPCA 3RWDA 1I85A 1A5FH 2HRLA 3MV9E 3B6SB 4NNPH 2QSTA 4YDKL 2H8PA 3MLVH 2X05A 1FVEA 4M7KL 4N1HB 1SJHB 4OIAA 4R6UA 3Q3GB 4M6NL 1YJDL 2OCFD 5JXAL 2QJDA 4RGNC 1PEZA 2VMFA 2QSVA 2NY3D 5DFVD 1E4JA 3LRSB 2RGSA 5ESQB 4M3JA 3RAJL 1VPOH 3C6SB 1A6TB 5EC1B 2EO9A 1G1YA 4MJIA 3MUZ1 3TN0D 3LPWA 4H8WL 5JMRA 4IDJL 2AI0L 5KS9E 3V6ZB 5HHXL 4WCYL 4QRPA 4PGDA 3EZJB 4KGJA 3MV8B 5TQ0L 1M6OB 2R23A 3OJ2C 1RUAL 2H2PD 4MQXD 4DK6A 1NGYA 1U91B 3OG6B 2P5WD 4N5ED 4L29A 4WO4B 4KUCD 4X5WB 2B7DT 5IBUG 4KDWA 4P99A 1FGVH 5DD5L 1JP5A 2X70A 3IFNL 5BZWA 1CL7L 3RKPA 1OM3H 4JFXB 5ITBL 4PRDB 5IM7B 4UZGA 1LO0L 3JTSA 7CGTA 2P8LA 1IL1A 2D7NA 2G5RA 1V5JA 3BIKB 1H5BC 1WSST 3BH8A 3RNKB 1U3YA 2OL3H 1S7WA 2WBJC 4JFQB 4GG8A 5KS9B 3SDCC 4B5EA 4JQIH 1HYSD 4G6ML 2XY2A 3ROLB 2EKSA 4LCWE 2VITA 4AM0A 3QRGL 4FN0A 4NSKA 1QBMH 2OXHA 3SKNA 4RFNC 4X6FA 1P7QB 5FECB 5CZXD 4X7SL 5D1XA 1MRDH 1VGKA 1CDGA 2AABH 3RP1A 3ZZ1A 3ALXA 5AWNH 4L4TE 2Q76A 1W0YT 4KAQL 2H6PA 2HN7B 4HX1A 2JB5H 4U7KA 4NN6C 1CE6B 2X41A 3RY5A 2I26N 4HUVA 4WI2A 3TJHC 3TO4A 4MD0A 4PFEA 1ZA3B 3MRNB 4ODHL 5F1SA 4ELKB 3FQNA 5I1HH 1N4XH 5J6GB 1CDUA 4G6JH 4LGRB 4R97B 4LASH 4WW2B 4G7YH 1HQ4B 1Q0XL 1PSKH 1AE6H 4LCWB 1RIVL 1IGYB 4ZYKA 4K7PL 1P7HL 2G75A 4HKJA 3U9UA 4EOWL 3NH7L 2EH8H 3H3KA 3QA3B 5E5RB 3CFIC 1D6VL 3X13B 5DK2B 2VDOH 2CSPA 5EU5B 3HLAB 1YEEH 3T0BA 1VKXB 1ZT7B 5EU7C 3WIIH 2X4PB 4HZAA 1L7TH 3U83A 3VXTA 5GGTA 3MBXL 4NHUA 4BM7A 4PJDA 4BZ2H 5IW6A 4JHAH 3CX2A 3O11B 2DN7A 3MBED 1LO5A 4JDZA 2HVJB 1MCCA 4KPHH 4MJ5A 2BVPA 1AHWC 2ENSA 5JW4N 1RK1B 5C0RL 1MIMH 3QIUA 2P8MA 3AS1A 4P2QD 1FNLA 1YPZA 3VG0H 4U1IB 5HHOE 2C3VB 1RZKH 1BIIA 3DRTA 1EUUA 3KPPB 3SDXA 3K4AA 5D70H 3S96A 1MLBA 1AJ7L 3MC0A 5HPMB 1LWRA 3LKQB 5E99L 4CVXA 1EMTL 4NRZA 3RL1A 3FZUD 5J0BA 4KUZL 1DQLH 2V2XB 4W70A 1SBSH 3MMEB 4I0PC 2L7JA 3PABA 2ZUSA 1AGCB 4L3AA 1CVSC 4KMTH 2DKSA 4G3YL 4NIKB 2J5LB 5F7LB 4X6DF 3VXSE 3VH8B 1NBYA 5D7LE 2O26U 4U05A 2E7LC 3F12B 5EPMA 3RL2A 5HHOB 3JV4B 2ZNWA 3MRMB 1FO0H 4LU5H 1J8HD 5I1JL 3UMTA 2L0DA 1CL7I 3HG1E 3REWA 5FKPB 5A2IH 1HOCA 3OF6A 1XF5A 1A7OH 1F8TH 3OKOB 4Z5RA 1I9RH 1YEIH 2PTTA 1J5OH 1GGBH 3WFEH 4Y4KD 4D0CA 3OZ9L 3T3PF 3FB5A 4G42B 3HE7D 5H2BA 1A14H 1F6FB 2A6KB 1UWEH 3VWKB 2W0FB 3R1GL 3VXSB 1QYGL 3MRPA 5K59F 5D7LB 2X4RB 4L4VD 4O2CB 2OLDA 5JZ7D 1DBJH 2CLRB 5EN2A 5I1KH 1IC1A 1FE8H 2NX5E 3HG1B 2VN7A 3HZVB 4XHQA 3IU3B 3MXVH 4D3CH 5MEPA 3L5WA 3GGWA 4NM8L 2IH3B 4JJ5B 2G9HB 2VLRA 4HGWA 3RPKA 3UX9B 3WE6A 1IGMH 1ZAGA 3GIVB 4QGTA 4YHLL 1RZIA 3G6DH 3HI1A 2IADA 3C5ZD 3OTTA 1OP9A 5DJXA 3V7MA 3PJSB 3NFNB 5DMGC 5E8PA 3VXOA 4KU1A 2JTDA 5GGVH 1AGBA 1A22B 2C4FU 4JDVA 4UIMA 3MYJB 4R0LB 3BYTA 1XEDA 1RPQA 2XZQL 1JNLH 1KBGH 2E6QA 4LQ1A 5T33L 2NX5B 5IVNA 4YIQB 3FJTA 5I1EL 3B5HA 4LEOB 5GSVA 1CICC 2BSED 5JDSB 2Y4SA 2AJUH 4GKNB 1Q38A 3DVNB 3QEGL 2GK0B 5E94A 1RUMH 1MRCH 3O45B 3QIWB 4KRPC 5HGDB 1XH3B 4MXVE 2HFTA 4NWUL 3B9AA 1RUQL 1KCUH 4X6CF 3OKEB 5I30H 3MJ8B 3MRKB 1Z5LB 2NY7H 1T1XB 2DB8A 3LS5H 2OTUA 4OLZL 1QFHA 3QFDA 4HDIA 3KYAA 3NPSB 5EZIL 4LSTH 1BQSA 3E0GA 5DVLA 4JVUA 5B39A 4JE4B 1AC6A 5CILH 2F53A 4M1CC 3K80A 3WFHA 2PTVA 1IKFH 2CKNA 4CW1A 1CTOA 4RGNB 4M93C 1FL5B 4S1SL 4OV5B 4P4KB 5HHQA 1MREL 3UDWA 3QNYA 3MJ9H 2NR6D 1DBBH 2BNRD 1ZTXL 1OGAD 2VH5H 4JRXB 4LCUB 2PW1A 1H8NA 4XP1H 2KDGA 1BZ9B 4JFFE 4IM8A 3PQYA 5C08A 5I76B 1TLKA 1B4JL 3DMMC 3FQTA 4HMDA 4LMQI 3FB6A 3RGHA 3DUHA 4H0GA 4JCMA 2VAJA 1EHAA 1Z3GL 3RTQD 1A3LH 2VRAA 3MNWB 3NIDE 3F62A 1QVOA 4FMKA 1MLCB 4UT9H 3NIGE 5GGQH 2MKWA 3WKMH 2W0LA 3LOWA 1K5NB 1Q0YL 4XP4H 1GZQB 3LEXA 5EIQA 4KQ3H 2NY5H 5ISZA 2V5MA 1RURH 1AH1A 2WBJB 5CS7A 3SDCB 5TDPA 1FFNA 1A1MB 3HCVA 3RWJB 2XTJC 2Y72A 3L3JA 3LKPA 1OAYL 1FLRH 2R9HC 1NSNL 5IG7B 4RFNB 4A6YH 4P2YA 1HEZA 3MR9A 5EOQH 2RFXA 5DRWB 4PV9A 4NQXA 2BVOA 1Q9WB 1BQHA 1KELH 5EO0B 3GIZL 5AG9A 5DQ9A 5HDOA 3VXRB 4Q9QL 1WAAF 3G5ZA 5FYJE 1FLTX 3TFKD 2NY3B 3H6JA 5TH2A 5LQBH 1JNNL 4TTDD 1YEDB 5IB5A 3DETC 4U1LB 4UINL 5F1IA 3U36B 2EEAA 4NKIH 1T0MA 5BV7L 1UCBL 3OB0H 4DQOL 2YUZA 5SX4I 3EJZD 2VKXA 1TQCB 1HN1A 2AEIT 3KLAB 3MV7D 4MQ7B 4OQ1A 3P9LB 5DK0A 3T1FB 5JXEC 3SO3B 1NC2A 4FG6D 1K8DB 1XGUB 4EI6A 3WUWB 4P2RD 4C57C 5HGBA 4YDKH 4HAGA 1CGYA 4IRJD 4M7KH 4YJZL 1N6VA 5DQJB 4M6NH 1YJDH 4WJ5B 5BO1L 5JXAH 4U1NB 3EGSB 1OWWA 3DYPA 3H9SD 3PDGA 1M1SA 1AO7D 1C7TA 4XTRC 5GRYA 1DN0A 4UB0L 3RAJH 2PETA 1MWAL 5T3XL 3KJ6L 1P5UA 1ITCA 5AAMA 2DJUA 1X3DA 1NCCL 3D6GA 4IDJH 1OL0A 1U8IA 2AI0H 4GG6E 4K9EC 3FO2A 5HHXH 4WCYH 3O9WD 3HE6A 2BFVH 5EFIB 3JWNC 5TQ0H 1JGEB 4Y7MA 1RUAH 1KFAH 1TCRA 2YWYA 5IW1A 3RVXC 5HYSB 3O2WL 5DD5H 1N5YL 3LKOA 3IFNH 2A6JB 4NFDA 5CBEA 1CL7H 2R0LL 3KYKL 1J0ZA 1ZHNA 1EGJL 3RHWK 5ITBH 1MJJA 1U8LB 4WV1B 5E6IA 1LO0H 4HKZA 3VA2C 2IGFL 1DQML 1U3HA 5E9DA 1MSPA 5FM4A 1HH9A 3TO2B 3ARBD 43CAA 4GG6B 5JORA 2ZUWA 3LSOA 3QJFB 4G6MH 4JGUA 3PP4L 2OR7A 3QRGH 4XCCL 3VWJA 3D48R 4LSVL 2JJSA 1XT5A 5ESAA 4X7SH 3ZKSD 1MCFA 3V4PL 1I1FB 3BI9X 3MTRA 4Z7WA 4FHBD 5KSAD 3EOTL 2R1YA 3BDYL 4NQDE 4KAQH 4HIEB 3DX6A 2PN5A 1CFNA 5A16B 2V7NA 3MRLB 2CLZA 3MYZA 3R0MA 3UBXI 2WIIA 1LEGB 2Z35B 1WZLA 2C3GA 1IAOA 2HT3D 4PJ9D 4NKDA 1UCTA 2W1NA 3NCBB 4ODHH 1XIWC 3FN3A 4F7MA 4P2OD 3VI4F 4JO2L 1Q0XH 3GSNL 3WLWD 3BJ91 1RIVH 4EUPA 1EFXA 3GBNL 2J6EA 4N8CL 2OMNA 1MCLA 2MKLC 4KVNL 3QO1B 2D2OA 2BMKB 1EEYB 3G5VB 4MZ2A 4F15C 4EOWH 3NH7H 1Q94A 4WFFE 4JVPA 2XG4A 3T2PA 4PJBF 5EORL 1D6VH 2DMKA 4G80B 4L8SB 4NQDB 4WRLA 4HHAA 3ZKMC 5TE4L 1O7SA 2MJWA 1PZUB 2I25N 1MAML 2CUHA 3D2UD 3U0TB 1NBVL 4M7JL 1NCAL 3FAWA 3GMPA 3LEVH 3MBXH 2A83A 5EOCJ 4HMCA 5GZOC 4OZHA 5HHNB 1BFOB 1CLYL 4M4RA 1IZJA 4UQ2A 3HC0A 5C71A 5LXGL 3ARVA 1MVFA 1TPXC 4ZDHB 2RCSL 2Z31C 4PJIA 1CICB 5C0RH 2YR3A 4WFHD 3K74B 5CHNA 2R2HB 1P53A 3MUGA 5IBUB 4LSDA 3F58H 4PJCF 1UM4L 3VFWA 3DGCR 3HZMB 1RUPL 3KPQA 4NN7B 4PJ5D 1Q9OA 2IQ9L 2CK0L 4FQ1L 1AJ7H 3DYOA 4NFBA 5E99H 1F4AA 1EMTH 4Y4KB 1KCSL 5C2UB 4DUWA 1CD8A 4KUZH 3RWFB 1DBML 1P69B 1ULVA 1H8SA 2QTEA 3RIFF 3V7AG 3AREC 3KAAA 5I17B 5J3HD 3HE7B 4PJAE 2GFBA 4PJ8C 4G3YH 4HPOL 2NYYC 2ENYA 4H0IA 4UDUA 3JSSA 3LKNB 2J8OA 4XP9L 4Y2DD 4HPYL 1T0NA 3BUYA 3JWOL 2NLJB 4G43B 1U3JA 4G8FA 4IOSD 2DYPB 4NQSB 2MQCA 3FQXB 5I1JH 4M93B 3Q6FA 4OAWB 4KWUA 3RQ3A 1Q72L 3FQWB 4MD5A 4E41A 3U0WL 3PL6C 3RVUC 1IC4L 3NN8A 4YDJB 1T3FB 2APVA 1P2CA 4PGEB 3QAZC 1Q9KA 4AIXA 3OZ9H 4LGPB 4F33B 4PJAB 1XF2B 2EIEA 3I02B 2E5EA 3DNKA 2D4FA 1JMZA 4TRPL 1LK3L 3R1GH 5GIRB 1KN2L 3H42L 3W9EB 1QYGH 3MZTA 4JDTL 2A74A 4PLJC 5LKNA 3WNKA 1CR9L 4DEPC 4LDLB 1TJHH 1DP0A 2LU7A 2OQJB 3FT3A 3I6GB 4JFOB 3H8NA 1MHEB 1PVHA 4MNHB 4M61A 1KULA 4LVHB 4NM8H 4KVCL 4ZNEA 3V79C 5T5NG 1YEJL 5AUMA 1N6QL 3QUKB 2FGZA 4LPUA 5CMAB 4YHLH 1F4HA 4F57L 4DFIA 3MV11 3VGAB 3B9KC 1NC4A 3DTXA 2IPTL 5DJAA 1ERNA 4U1MB 2BNRE 1AQDA 4U2ZA 1KG0B 4RX4A 3SKMB 5DHYA 5I71C 5F1NA 2XZQH 5C0BA 3DGGB 5LG1A 5T33H 3ULVF 1JV5A 1MJUL 5I1EH 3VD9A 1E4WL 3HR5A 4NT6A 4F7TA 4RAVA 5DRNB 3CU7A 3Q2CA 3BN9D 1FG2B 2PCPB 3QEGH 4RMRA 3NVQA 2DBJA 4MVBD 3D3VD 1D9KA 3TZVC 3IKCA 2XTLA 2CDFB 1INQA 3P0GB 2EIZB 2FH8A 2GT9A 4NWUH 4JQVC 1RUQH 4AIZA 1T66D 2EE3A 3BZ4B 3OB8A 4Z7QF 3RJQB 5FO7A 1CFVL 2P4AB 4KXZI 3RWHA 5CKAA 4P9ML 2YD8A 3QXAB 5ENWA 2EDYA 1QEWA 5BQ7B 4OLZH 2CDEB 4O02L 4PRBB 3VMNA 4S10A 4ONFL 2AJZB 5EZIH 4NPYB 2D4DA 2YPLA 3AAZA 3IJSA 3T3MF 5A3ID 4UT6L 3HUJA 1J8KA 1G7QA 1WBXA 3V5KA 3MJ7A 5EC2A 4OZ4B 4PBXA 1NEZB 1UC6A 4X4ME 4JFDD 5ETUB 3NCFB 2YPKA 1HHKA 4J3WA 4S1SH 1IM9A 1KOAA 2VDKL 2KH2B 4HCRA 1MREH 3RZWA 3P0YL 5MP6L 1Z9MA 1DQQA 1ZTXH 3FN9A 3S5LG 1LD9B 2QL1A 4NQCA 5K93A 5FM5M 2W59A 5FXCH 4UOW1 2NY4D 2JF1A 2FHBA 3CVHA 1B4JH 4NJ9L 4UMGA 3BGMA 3MV7E 1WWBX 1N0XL 1Z3GH 5DFTA 1MCHA 4KRLB 3HI5L 5DVOA 3TP4A 2BSTB 2LU4A 3DX9B 1KB9K 4P2RE 5M94B 4WUKL 2QADC 4CVZB 1Q0YH 2ICWB 3MREB 4JKMA 1BVZA 5BW7A 2VE6B 4LPTA 4BKLA 2ZCLL 3GMOA 3H9SE 1HHIA 1AO7E 1OAUL 3VGFA 2H1PH 2EE2A 3MACL 1AQKL 1NL0L 2ICES 4X5XB 3NZHL 3O3BB 3O3AB 5BRZD 1VFAA 1VHPA 4Q2ZA 3WYRA 4HW6A 4XPTL 4OLWL 1OAYH 1NSNH 3T1WA 1I1AA 4MJ4A 4F7EB 4QTHA 1T89C 4YHYC 2E6PA 2PR4L 2QBWA 1HHHA 5EULV 3MV7B 5DO2C 4QRQB 1FYTE 3QIBB 4XBPA 2X4UB 3G6JA 2DLTA 1DQDL 4X0KB 5BVPH 4CVUA 3AUVA 1QLFA 3R8QA 4ZFOA 4LCIL 3JV5A 1LE9B 3GIZH 4ZTOL 3B5GA 5EO1A 3PGDB 1BJMA 2DKMA 4XBGA 4KGLA 2NW3A 2WAHA 4Q9QH 3B3IB 3H9SB 4QCIA 1YMHB 3GSWB 4XCFL 1S7XB 3AS0A 1T5XB 3MRHB 1JNNH 5IMMB 2ICWJ 5E00B 1A9BB 1KTDB 2EYRB 4UINH 3RUGB 1B0GA 2F9BT 5F97E 4F15B 5BV7H 1UCBH 5C0AD 4DQOH 2J8UA 4WUUD 3DUUA 4L3ED 4PP1D 3OKMA 2RAMA 4WGVB 3O9WB 4W6WB 1FYTB 1TZGL 3OSKA 1XGQB 2A2QT 5CD3B 1KB9J 2OP4H 2FWOB 2PKDA 4OGXL 5EBGA 3FB7A 3L1OL 4JHZA 3RBGA 5CIPA 5LWYL 2R1WA 1U92A 4EN3D 1ZHBA 4NOBA 5F3BB 1WUNT 2FIRT 4OSUL 3I75A 1G7MB 4HUUB 2AERT 5BO1H 1NUNB 5IKCB 2DL9A 3H9YA 2WWMD 3FQUA 4UB0H 1MWAH 5T3XH 3KJ6H 1TPXB 2YS4A 2Z31B 1Z9LA 4UDTB 2QKIB 3ARBB 3WJLA 2CIIA 5EA0L 1R3JA 1IEBB 4Y5VA 3UROR 1M7IB 1NCCH 3AFLA 1QLRB 2APBA 3LQAL 3ZDYF 4XMPL 1WICA 4OZGE 3TVMD 3QXUA 3SPVB 4PJHA 4WTWA 4TUOB 4DKDC 5KSAB 5DMKB 4MCYA 1AC0A 2BY1A 1K8IA 4RAUA 2QLVB 3O2WH 3AU1B 2OMBA 1N5YH 4Y16C 2R0LH 4RA3A 3SKOA 3KYKH 4NO2A 3DYMA 4JY5L 4Y4HA 4ZFZB 1EGJH 1FP5A 5LGHL 1HI6B 3TA3D 4BH7B 2BSRB 1K2DA 4GO6B 1OTSD 1UQSB 1WZ1L 3PWJA 3WHE1 4HUWA 2IGFH 1DQMH 2VLKA 4P2OB 4PLNC 1PYWB 4KK5C 1NBZB 1MCSA 4YAQB 2Y06L 4XNMB 4GAFB 4LPXA 4R7DB 4GRMB 3PP4H 4XCCH 5D2LE 2GKIA 4LSVH 1BVLA 1SJEA 4OZGB 1I8IB 5E08L 3EO1B 1F6AA 1MI5A 2ITCB 4ZUVA 4QWWD 3ARFD 3VDCA 1CFSA 3V4PH 3QDMD 5HGAB 2FRGP 3I6LE 3QAZB 3EOTH 1V3KA 4PJDF 4MHHG 4PJ5E 2FEDC 3BDYH 4ZS6D 3TJEL 2CMRL 3K7UA 3UO1L 3LD8C 5IBTL 3O3UN 5B38A 3ZHLA 3MRRB 3IJYB 4HWUA 4DZBB 3RVTD 3EFFA 2X89D 4K23L 5J6HB 1MCDA 4YNYA 3HRZA 4FQCL 3RZCC 1QRKA 1YPZF 4DEPB 4KJWC 5I8KL 1QHOA 4FZEL 4JO2H 3GSNH 4KROC 5FGSA 3SDXF 1T2XA 3GBNH 3MUJA 5D2LB 4N8CH 2OK0L 4EI5A 1YEFL 1NGWA 4KVNH 5JHDB 1WCBB 3EYSL 2CUMA 3PIQB 4R2GD 4XVSH 4JZJA 1FPTL 1QPPA 3QO0B 3D39D 5EORH 2Q3ZA 4PJ5B 4LKCB 2P5EA 5TE4H 1G0DA 3CZJA 4JKLA 1MAMH 5DSCB 3HC4L 4LBEA 3B9KB 3QUYD 1UH4A 1UKQA 1NBVH 2E8YA 4M7JH 1NCAH 4PJFA 4NQTA 4BSWA 2CRMA 5MEOA 1KT2A 5I71B 1X5IA 4I18C 5HDBF 1CLYH 4OZFH 1ZWIB 3O2DL 4TSAL 4Y2DB 5LXGH 4KXZH 2ITDA 3F5WB 5HVHB 5F71A 2OJEB 1S9XA 5GS0D 4WU5B 4PG2C 2O5XL 1UM4H 1TETL 1U58A 3KPSA 3O0RL 3QBTB 4MSWA 1RUPH 1DE4B 4U4BA 3DUSA 3LZFL 2IQ9H 2CK0H 2FEEI 4ZUUA 3N1PC 4FQ1H 4CADB 2HG5B 4F8TA 4F9LA 4MXQD 5L0QB 3VXQB 4JRYA 4X8JA 2P42B 3AGVA 4QT5B 1KCSH 2J2ZA 4WFEE 1S8DA 2BC4A 5F6IC 3TT3L 4L9LA 5ICXB 1DBMH 4TUJB 1U0QA 1FL6B 1KJ3L 1G7PA 5JUEL 1ZXQA 4LLMA 3WL9B 3JTTA 4HPOH 1URLA 4X9IA 3O4LA 2AXFA 5DHVH 4H25B 3OJVC 4XP9H 4HPYH 4KV5E 3TJHD 3JWOH 5I16A 4L5FL 1I1RA 4OFPA 5LAXA 5JNYB 2A73A 1FDLL 3O6FD 3CXHJ 4LIQL 3MO1B 2EC9U 5MHSD 4PREB 1Q72H 1NDGA 3U0WH 1IC4H 4HS6B 3DVGA 1FZKA 3HAEB 2ATPA 1KPRB 4RGMC 3D3VE 5GS3A 2BNUA 3A6CH 3Q5TA 8FABA 1I85C 4TRPH 1LK3H 3H42H 2QR0A 4JO1L 4JZOB 1ZLWH 4JDTH 5GQBA 4S1DC 3D87B 2YUXA 1CR9H 1UWXH 3QNXA 1AIFA 2F5AL 5J06A 5JOFB 4Y5YA 3QZWB 1E6JL 1U8HA 4OFIA 4RZCA 2M1KA 2QADB 1I1YB 5E2VL 4KVCH 4JFDE 1YEJH 1N6QH 4WWKD 1YN6A 3PV6A 2IQAB 3D18A 4F57H 1KPUB 3FT4A 3BRGC 5BJTB 2DTML 2Z4QA 1R5IB 4ZAKA 2A1WL 5DS8B 3A6BL 1SBBA 2ZOLA 2IPTH 3UBXG 4M6AA 2PYEA 1TVHA 4HS8L 1W72L 4HIJB 1L0XA 1WWCA 1GGUA 5FYKD 3VXUD 1T7WA 2IF7A 1HHGB 5EDXA 2GCYB 4FMFA 4OF6A 3FFCD 4MQTB 5BXFA 5L2KD 1MJUH 1WC7B 3ROOB 5FIEA 3M1BA 4YDLC 4KY1L 3RY6A 1E4WH 2IFGA 4JFDB 4AEHL 1S7QB 2Q6WA 2NZ9C 3SCMC 4HKXA 5DD6B 1E28A 1WK0A 1ZA6B 3IS0X 4NRXB 2C7UA 2P24A 1DANT 2VL5A 3AXLB 1UVQB 3K1KC 4HXAL 3RPIA 1UKSA 5D1XC 5HHMB 2DF3A 1CFVH 3TBVB 1DDHB 4EBQL 4YHIB 4P9MH 3JUYA 5EIVA 2YPVL 3T2QA 3TYFA 1HZHL 1SQ2N 2UWEE 4O02H 4RMVA 3L6FA 5IFAL 4ONFH 1TENA 2FJHB 3TO4C 1KLUA 4UT6H 3UTZB 4UU9B 3TH4T 2YD3A 5KN5B 3MA7B 1P6AB 1LO2L 4YZFF 5EBWA 1CDHA 2IH1A 4HFUL 4XCEA 1UZ6E 5IVXF 1WV7T 4AT6B 1JN6A 2NCMA 1HSAB 3T4YB 2VDKH 1INDH 3H3PL 1PAMA 4XCYB 1HH6B 3P0YH 4ZSOA 1CGVA 1ETZB 4PRHE 1AXTL 1RFDL 4QRSA 1RZJL 1H0DB 2V2WA 4KZDL 1L9NA 1ZS8A 3V5DB 3LDBB 2GK2A 5C0AE 4YGVA 4ODXB 1S5HB 3MRDA 2NY1D 4NJ9H 1PDKA 4NKOB 2Z91B 4O2EB 4JGMA 1N0XH 3U6RA 3HRPA 3EJYD 5EZOL 5C92A 5EZLB 4Y16B 2EXYC 3HI5H 4F3FA 4GRWF 3IXAB 1CD1B 2C9AA 1MFNA 3T77A 4KJQC 4HLJA 4XRCB 2VQ1A 4WUKH 1D5XB 3QIUC 1RHHB 4ZXBD 2BSSA 3O6ML 3SKUD 3AVEA 2DJSA 2ZCLH 3ARGD 3MNZB 4PRHB 1OAUH 2QQNL 5B4MD 2AV7B 3MACH 1AQKH 1NL0H 5C0DB 3NZHH 1CIUA 2Q87A 5IIEA 4LCYA 2WW8A 4Q6IB 5C0AB 4OLWH 5ADPL 2NXYC 4PBWD 5HDQL 4QEGA 1ZMYA 4Z77B 2PR4H 3C6LA 4IRSD 1FVCA 4LSSL 3SHSA 5F9JA 2I9LB 4PB9L 1QHPA 3U4AA 5SX5H 2BK8A 4DGIH 3ARDD 4W6YB 3V6BR 1DQDH 2F19L 4H26B 3MRFB 3LD8B 3MRJA 2CRYA 3X17A 4LCIH 3GHBL 3SGDI 2X2YA 4LDEB 5GGTL 5CEZL 1H3VA 4XCFH 4MAYD 2VERN 4JFEB 1KGCD 4KROB 4HMEA 3RKDC 3QFJB 1I8LA 3PWPD 3B6SA 1X6NA 1VFUA 5DRZB 3HMXA 1SJHA 4WVRA 3Q3GA 2JKXA 3DV6B 1TZGH 3UEZA 3LRSA 5ESQA 3VXMD 3C6SA 1A6TA 3QHFL 5EC1A 3ZT5A 4OUUB 4OGXH 3QDME 2ARJB 3ZMRA 3L1OH 4C83B 4HWBA 1AGFB 3L5IA 3V6ZA 3WIFB 1V7ML 1YC8A 1PFCA 3MV8A 4OSUH 2B4CC 1M6OA 5MEND 4CJ1A 5LJYH 4EQ3A 4I18B 1U91A 2XQBL 4S1RL 4XNXL 3PG2A 4WO4A 4X5WA 2DLGA 3MV9A 1IAKB 2MHAB 2M26A 3IGAB 3VJ6B 1ACYL 3GJFK 5CWSB 5EA0H 2IAMD 4JFXA 1G9MC 1F45A 2XZAL 5IM7A 5FFLA 3LQAH 1RY7B 4XMPH 4BA8A 1IQDB 3BIKA 3QDMB 3LQZB 3RNKA 3D39E 4JFQA 5KS9A 1IGTB 4W4OA 2CH8A 3UYOD 3ROLA 5D5ME 5F6IB 3TIEA 3GJFB 3S7GA 1ZGLP 2VNCA 3F7YB 1P7QA 2FYYB 2WMPA 2Y5TB 4JY5H 4LVNC 1I7UB 5FECA 5LGHH 3NIFE 1WZ1H 1ZVYA 4MLIA 3F7PC 5HI4D 1TXKA 2HN7A 1CE6A 3MLRL 4P23D 3UC0L 2Y06H 4MA7L 4WEBL 4XWOC 4OTXL 1XGRB 1NAKL 2DICA 1ZA3A 1FFPB 4J3SA 3IFOB 3MRNA 2B4CL 2IJ0C 4R2GB 5E08H 1I3UA 3O6KL 4ELKA 5J6GA 3D39B 5DDHB 4WW2A 5E8OB 4RGMB 1HQ4A 3RWGB 5D5MB 3O6LL 4LCWA 4BSVB 1IGYA 3TJEH 4OZHF 2CMRH 1CGWA 1MFDL 4U31A 3QUYB 5FCSH 1I9IL 1QBAA 5IBTH 1T20B 5B3NA 2H41A 3QA3A 5C09D 3LAFA 3B8YA 5DK2A 2VJXA 3X13A 5EU5A 3HLAA 5F7KC 1VKXA 1ZT7A 4K23H 4PJIF 4OT1L 4AEEA 2X4PA 3QUMB 4YDVB 5I8KH 4FZEH 4XH2B 2LV4A 4HEME 2JELH 2ICEB 1XF3B 3UTTD 3U48A 3NGBB 2OK0H 3L3GB 3UDWC 1JGVL 1YEFH 1P5VA 3EYSH 3O11A 4NYLB 2IANE 1FPTH 2XXMB 3OKLB 3OAYK 3O8XC 4JY4B 2HVJA 3ARWA 5MHSE 4ODSL 2XWJB 5EU3B 3GSXB 3KHQA 1D5ZB 3M8OL 3OXSB 1YQVL 1RK1A 4LAJH 1WTGT 3HC4H 1AR1D 2C3VA 3KPPA 1NCWL 2DM3A 2FR4B 4EDXA 3MLYL 3S34L 4I2XE 5DEFB 3MOBL 5HPMA 1XR8B 3LKQA 4PGBB 2R0KL 4LDOB 4OKVB 3ZTJH 4OF7A 1SJVA 3O2DH 5J9PB 3KPRB 3ULUF 3BO8B 5T1MB 5FUZL 2IANB 2R39A 2V2XA 3MMEA 3SCMB 1AGCA 4P3CL 2O5XH 1TETH 2YKLL 3O0RH 2JCCE 3SGJA 3NCCB 3LZFH 1AGEB 4M7LT 3VH8A 4B0MM 1LK2B 4XAWL 3F12A 3ULVH 3LB6D 5HHOA 4R4ND 3JV4A 3MRMA 4OF0A 3GSVB 3T2NL 3TT3H 5FKPA 1X5LA 4NM4L 4I2XB 1KJ3H 5JPMA 4WNQB 3OKOA 4XVJL 4KK8D 5JUEH 1EDQA 1NUGA 1PEWA 4CL7A 1B2WL 1CE1L 1ZHLB 5FYKE 3D0VB 3PWUB 2FBOJ 3UYPA 1PY4A 5KW9L 3S3JA 4P5TD 1FIEA 4L5FH 1B9ZA 3FFCE 4G42A 3PV7A 4OFYD 4TVPL 2HT4C 5L2KE 1FDLH 1DQJB 2L7UA 3MGOB 2A6KA 2JCCB 4LIQH 5FDYA 5FAAA 1TFHA 2W0FA 3VWKA 1N5AB 3VXSA 4QRRE 1RZFL 4GMSL 5D7LA 2X4RA 3S97C 4O2CA 4WWKB 1MCOL 3FRPA 3PWVB 2CLRA 4LLWB 4K2UL 3V6OE 2XKUA 1T21B 3VFSB 1ITBB 4U1HB 1X7QA 2EDKA 3HG1A 5B8CB 3HZVA 3IU3A 1S7RB 3JV0A 2IH3A 4JJ5A 2G9HA 4JFHD 4N8VG 3GIVA 5JIKA 4JO1H 1QFWM 4KHXL 4D0DB 4POZC 4BQ8A 2XYCA 4MJ6B 4FFZL 5DT1L 1TVDA 2FIKA 1WFTA 3J7HA 3C8KB 3PJSA 3NFNA 3RFZC 3FFCB 5L2KB 2F5AH 5GZOD 1E6JH 4QRRB 3S3SA 3MYJA 4R0LA 5E2VH 1OAKL 4LSQL 3PWLB 4RMQA 4YXHL 1FL3B 2EE9A 2N56A 1KXTB 2NX5A 3BISA 3HE6C 4YIQA 4ZUSB 5L8JB 2EDOA 2DTMH 5D93C 4LEOA 5DUPL 2A1WH 4LLVB 3A6BH 5JDSA 5D7KD 4L1HA 5DC9B 4GKNA 1BREA 3SGDH 4NGHL 2NXYB 3BUTA 3DVNA 3HUJF 1OAXL 2GK0A 1W72H 1RSFA 4H1LH 3O45A 3QIWA 5HGDA 2CIKB 1XH3A 2FGWL 4J3TA 5DA4A 4ACPA 5D71L 4WHCA 2XT1B 3NCYP 1D6EB 3OKEA 3MJ8A 3MRKA 1Z5LA 1T1XA 1JYXA 2IALB 1U3HC 2YD5A 4EZMA 2H2SD 4KY1H 1MH5B 4AEHH 4XZUB 1EEZB 3O2VL 2FHCA 1T0PB 4QHKI 2ZP0T 1ODAA 3VWJC 2JJSC 1X5GA 2GUOB 4HXAH 2B2XL 5EUOE 4EBQH 5C0FB 2X1OA 3Q5YA 4DVBB 4YO0B 5IHBA 1FL5A 3FN0H 4OV5A 3TV3L 4NWTL 2YPVH 4P4KA 1HZHH 4J1UB 1TTGA 5IFAH 2HJKB 1BX2B 1G6RB 5KAQF 3Q6GL 4UV4L 2GY7B 3F8UB 5C0GB 2W0PA 1ROWA 4KKNA 5CJ5A 4JRXA 4LCUA 2NNAB 5CJ8A 1BZ9A 2D7QA 2EXWC 2HAZA 4HFUH 4U3CA 3CK0L 4LAQL 5I76A 2WWKT 3RGVD 3VRLE 3QXDB 2P8PB 3K4DA 2XOTA 3H3PH 3PE9A 2DQFB 3ARGB 4P46D 2CO7B 5EUOB 3MNWA 5JOPD 5GISL 1MLCA 1REIA 5T1LD 1KGCE 1R3IL 1AXTH 1RFDH 3PP3K 4Z78B 1RZJH 3PWPE 4R4FL 4XMKL 4KZDH 5C2BL 4UTAL 3G6JF 1K5NA 3PXJA 1CLOL 1GZQA 5CEYB 1SMOA 4IRSB 4KRNA 5J13B 5F7EL 5CJOL 2WBJA 1ACZA 3SDCA 1YNTB 4JANB 3VXME 1A1MA 2NTFB 5EZOH 4M5YL 5HYJD 2EZ0C 2D9QB 3RWJA 4JEGB 3OJDB 4ODUB 1L7IL 3N1QC 5IG7A 4LVNB 1I8KB 4BK5A 3QQ4B 1YY9C 5DRWA 5IB2B 2PUQT 1QA9B 2HTKD 1Q9WA 3MPCA 3O6MH 5MENE 1HK6A 5DJ0B 2J8UF 4MAYB 2ESVE 3OAZH 3VFVB 1MFAL 2KZ1B 3PWPB 5EO0A 4P9HL 5ADPH 1NKRA 2F58L 5HDQH 5KG9B 2J6EL 1SM3H 4LSSH 4M7ZB 1YEDA 2Q7NA 3RVVC 4PB9H 3LKRB 1ZLUH 4U1LA 2D9CA 2F19H 3EYVB 3U36A 1YZZA 1FGNL 2I07B 4OCWL 2G5BB 3WFCL 3GJEB 3QQ9C 5B39B 1X5KA 2JIXD 5E8NB 3TH2T 2BNQD 3G04B 3KLAA 4MQ7A 3CH1B 3P9LA 4S0SD 4BH8B 5MENB 2LVEA 2HRPL 5GGTH 3T1FA 5CEZH 2ESVB 5FYJU 5BMFL 4NN5C 1K8DA 1XGUA 3WUWA 2BDNL 4J3UA 4NKMB 1TJIL 5DQJA 3ZKND 4WJ5A 4PJHF 4U1NA 3EGSA 1NLBL 4CMHB 2IC2A 1MCWW 3O8XB 5IB4B 4HG4J 4FXGB 3T0EC 4MDIB 3MNVB 3QHFH 5KVFL 1EZVX 1V7MH 5GRVL 2VDQL 5EFIA 3QPQC 3VCLB 2PXYD 3FMGL 3UZQA 2AJXL 1JGEA 5IVOA 4L4JA 2X4NA 3GMQB 3NCMA 4S1RH 5C09E 4XNXH 5HYSA 1VEMA 1S7SB 2A6JA 4P23B 1ACYH 1UGNA 1T6VN 1DBAL 5IR1B 3T65B 3TEUA 4NC1E 3MCLL 4NQED 3UTTE 2AK1L 4CU6A 1U8LA 4WV1A 4RBPK 2J88H 3CC5B 4PJEE 1WITA 3UAJC 3FQRB 3TO2A 1OD7A 3PGCB 3ZLQC 4GG6A 5INDB 3QJFA 1YEKH 4FQXD 2UYLB 1NCTA 5J4MA 3I3BA 1JBJA 4NO0B 4TULL 5C09B 5L2JB 1SEQL 2RHEA 2LE9A 1I1FA 1IGIL 4YBHA 2P43B 1QRND 3E8UL 2N7BA 4HH9B 5EH1A 3QQ3B 4HIEA 1BWWA 4H5SB 5A16A 3MRLA 3MLRH 3UC0H 1A1NB 1D9KC 1G0XA 1LEGA 2GIYA 2Z35A 3ARPA 4MA7H 3UTTB 4WEBH 5TE6L 4OTXH 1NAKH 5F1IB 4PJEB 2B4CH 3O6KH 4DGYL 5DEGB 5E70A 5IMLB 4PJFF 3G9AB 3VGBA 3CFDB 3O6LH 3EOAB 4OIIL 1MFDH 3QO1A 1I9IH 2BMKA 1EEYA 3G5VA 4MB3A 4OI8A 4YBQD 2L4OA 2AEPL 4G80A 3DXAD 4L8SA 4NQDA 5D8JL 5AZEL 2AGJH 2OR9L 4OT1H 2YXFA 4OD2B 4B50A 2E6JA 1GJIA 1T5WB 3U0TA 2C1PB 5DC4B 4HULB 3WS3B 1JGVH 3HC3L 1VESA 5HHNA 1BFOA 1LE5B 5T1KD 5ICZB 1WBYB 4ODSH 3QDGD 1DFBL 4ZDHA 3M8OH 1CICA 1YQVH 5GGUB 5T3ZE 2R2HA 5DFWH 3QG6B 1MCEA 2EO1A 4J4PD 1NUDA 5H94B 3HZMA 5C0CB 3S4SB 2HYMA 4DJMA 1NCWH 1L0YA 1JGLL 4LLYB 3VFMB 4JFHE 3MLYH 4PLKD 3IRZA 4P5KB 3S34H 3BQUC 4PBVC 4PJGE 3MOBH 3X12B 4H1LG 2R0KH 2VC2L 3KYNB 3SQBA 4Y4KA 1FNAA 2CLVB 2W0KA 1MUJB 4P5TB 3RWFA 3ORJA 5FUZH 2ED9A 3FHAA 2R15A 1R3LB 5I17A 3HE7A 4I0KA 4P3CH 2FLBT 2YKLH 5L6YL 1DL7L 1HCVA 1LNUB 1IAII 3LKNA 5TE7L 4OJFL 2NLJA 4XAWH 4G43A 3GMRB 4Z7WB 2DYPA 4NQSA 4HCRL 3SDAC 3FQXA 3HZYB 3T2NH 2F54D 4OAWA 3FCTB 3FQWA 1MHPL 2MSPA 4NM4H 4PTTB 5E8DL 4PJGB 4YDJA 1T3FA 4XVJH 4PGEA 3DX8B 1B2WH 1CE1H 1QFUL 4L8DB 1OP5H 4YPGB 1M4KA 1QTYT 3C9NB 5E0QA 2VXQL 1BOYA 5CGYD 2CDGB 3CVHL 5KW9H 4F33A 3NFPB 1BAFL 4PJAA 2R69L 1XF2A 2C1OB 2Q8AL 3I02A 4TVPH 1CF8L 4FP8L 1IGFL 5GIRA 1HNFA 4GXUM 4D2NA 3W9EA 1RZFH 5F9OL 4GMSH 2W92A 3ULVD 1MCOH 2XKSA 1JPFB 3BD3A 4DW2L 1I9JH 4K2UH 3DBXB 2OQJA 1A7BA 2G60L 3I6GA 4JFOA 5IROC 1MHEA 4MNHA 4C55A 3TPUB 2VLLB 3IXTB 1F2QA 3M17B 2WQ8A 3QUKA 4LPCA 5CMAA 5F70A 1QNZL 4M9PA 4KHXH 2E9IA 4FFZH 5DT1H 1FFOA 5EU4B 4U1MA 2GJ6D 4HH8A 1S7TB 5D1QD 1S7VB 3TBSB 1KG0A 4GQ9L 3WJLC 1SYVB 3CZFB 3SKMA 1OAKH 4ZFOL 4V1DD 4LSQH 43C9B 5L9DL 3W81A 4YXHH 1PX3A 3DGGA 2EYSB 1RJYA 2VTFA 4Y5XB 4YWGL 3RWCB 4GRWH 3BRDA 3MRGB 1FHGA 5C0JB 3IJHB 5DRNA 4XPGL 1OAXH 3F7VB 1FG2A 2PCPA 4ZOEA 4OGYL 4CRPA 5C0EB 2CDFA 4ELME 2EIZA 2FGWH 3QB7C 1EHXA 2JJTA 4RAHA 4Y4HC 3T0EE 5FDWB 5D71H 3BZ4A 3QDHA 3HNSL 5HYJE 5BQ7A 2XN9D 2VWEC 2ZPKL 2CDEA 4PRBA 2Y23A 4R4BB 1JZ4A 1NMCC 2AJZA 2CXKA 5M95B 4NPYA 3RGVB 1Q8MA 1NEUA 3DJ9A 5I74C 1OTTD 1N64L 3IDIB 3SDDC 2X6MA 4IJ3C 4KFZC 3UJJL 2X5PA 4OZ4A 1NEZA 5HBBA 3EDEA 2B2XH 1J18A 3TF7C 5ETUA 4QYOB 4JQXA 5T1LB 1KNOB 1JZ3A 4NC2B 3TV3H 2UVFA 4NWTH 3IVKB 1MFEL 3FO1A 2WP3O 4ELMB 1DBKL 5KOMC 3RRQA 3T0EB 4F80A 3Q6GH 2MTPA 1AGDB 4KK6C 4BJLA 5C07D 5DUBB 4I9WE 5F9WC 4X9GA 5HYJB 3PHOB 1LD9A 1BOGB 1CGUA 3MGTB 9CGTA 2A9ML 1F90L 3CK0H 5ICYB 4LAQH 3AY4A 4EI5C 1RAMA 1W8NA 2BNQE 3OHXB 5I6XB 3BHBB 4X4MA 3L95B 5FA4B 5GISH 4OCRL 1P6FA 5M7QA 5H37H 2BSTA 1R3IH 3DX9A 4MJID 4XPFL 4R4FH 4XMKH 5GRWA 5C2BH 4LARL 5B3JF 4UTAH 2FX7L 1BZ7B 4CVZA 1J7VR 2FX9L 2ICWA 3MREA 1CLOH 1J1XL 2VE6A 2NY6D 5F7EH 1GOHA 5CJOH 1CG9B 1F42A 3CFJB 4X5XA 3O3BA 2OTWB 4M5YH 3O3AA 5C0BB 2W07A 4X4YB 1L7IH 3RU8L 5I15H 4F7EA 2JIXB 3ARRA 3CUPB 2R1XB 2BNQB 1NFDE 2WQRA 3MV7A 4QRQA 3QIBA 4R9HA 2X4UA 4RRPG 3DOSA 2O5ZL 4X0KA 1SVZA 1OTUD 3IAQA 1Y18B 1RJCA 1LE9A 3VFOB 4LOUD 1WZKA 4P9HH 5EIIB 1WQVT 4HBCL 3PGDA 4F9LC 4L8BB 4U1GB 3GEWB 4JREC 4Y88A 3OGCB 2F58H 3B3IA 2DRUA 3H9SA 4EUPH 2J6EH 1YMHA 3BPNB 1S7XA 5ENWB 1T5XA 3MRHA 3DLQR 5JLZB 1TQBC 2QQLL 5CBAB 5E00A 1A9BA 1KTDA 1EV2E 2EYRA 5GRJL 3HFMH 5J1TC 3B9EA 4ODVL 1FGNH 4OCWH 3WFCH 1MHCB 1NFDB 3O9WA 4LVEA 1RULL 1FYTA 2PXYB 1XGQA 3N06B 3SE3A 3CDGB 2WLYA 1KYOK 1PZ5B 5CD3A 2W9LA 4WI8A 5F7NC 2HRPH 2OBGA 4HXBL 4ISVB 2FWOA 5BMFH 2D7OA 4G8IB 1QRNE 4X98B 2BDNH 4Y2OA 1TJIH 5F3BA 1DEEB 1G7MA 4HUUA 1NLBH 5IKCA 5KS9F 3EOYG 2Z31A 4UDTA 4MWFB 3ARBA 3ZHDA 1IEBA 1T2QL 1M7IA 5GS1B 5KVFH 2W9EL 1DVFD 1QLRA 4N0UE 5CEZD 2AJXH 3W11D 1IAIH 3BQUB 4Y5YC 4Y8DC 3ARZA 3IETB 3SPVA 4KTDL 4TUOA 5KSAA 5DMKA 1QRNB 1GGCL 3C08L 1JF6A 1NDMB 5SWQB 5HXMA 1CWVA 3AU1A 3CSBA 3LHPL 4K3HA 4X99B 5FGBC 1DBAH 4WW2F 3MCLH 1HI6A 2AK1H 2BSRA 4BH7A 4ZAKC 2FJGB 4P2OA 1JTOA 1PYWA 1NBZA 4QTHB 4YAQA 1HXYB 4XNMA 3ULUH 1A21A 1KYOJ 3SDAB 4R7DA 4GRMA 1HXMA 3QI9C 2UZIL 3BJLA 4OZGA 1I8IA 2XRAL 3EO1A 2ITCA 4TULH 4IOIB 1SEQH 5HGAA 1IGIH 4DZ8B 3IDXL 4GS7C 3E8UH 3BKJL 4OFKA 1WFOA 1BBDH 1EAPB 4RMSA 1MEXL 2DQUH 4ZO7A 4W6XB 4OBSA 4H88L 3MRRA 3IJYA 4O2FB 4DZBA 5TE6H 3QXWA 2I24N 5J6HA 2DMBA 3RIAK 4DGYH 3ZE1E 2D0HA 5CGMA 3S9DB 1YYML 2VR4A 1T7VA 4OIIH 1ZK9A 5D2LA 2MNUA 3EO9L 1XCQB 4ZUWB 5JHDA 1AXSA 1WCBA 2EDJA 4FOMA 2NMSA 4AEIL 3PIQA 5E4EC 2NTSP 2AEPH 2F54E 4HSQA 4PJ5A 4AL8L 5D8JH 5AZEH 1QKZH 2OR9H 1ED3B 3WUZA 3QUZC 5DSCA 3FB8B 3B9KA 5AD0B 4KKAC 1A7PL 1TITA 3GI9L 5EU6E 3EDJA 5IBLC 5J1SC 2CKBB 4KKBD 2DQCL 1R3JB 3HC3H 4WWID 1BQHG 1KTKE 1ZWIA 1MAJA 4XX1E 4Y2DA 5I73C 5IP4A 1DFBH 5LGKA 1C5BL 3ULVE 3F5WA 4CJ0A 2OJEA 3NTCL 4HK0B 2I60L 2Y6SD 3QUXC 1QZ1A 2E9WA 4ONHB 5HI5C 1K8IB 1JYNA 2F54B 5C9KA 5HYIA 5FO8B 1FJ1B 1JK8B 4G6FB 4LLUB 1DE4A 5GGRY 1JGLH 3NA4A 2QEJA 4CADA 2HG5A 4H20L 4I48B 1I3GL 5EU6B 2VC2H 3VXQA 4QT5A 4P59L 3VRJB 4DOHE 3BPOC 5ICXA 4TUJA 3RA7L 1A02N 3GZKA 2YWZA 5SV3A 1NMCB 1FL6A 5IHLB 1YMMD 4GRLD 2GJ6E 3IDYC 3FFDB 4IIQB 5L6YH 3WL9A 1DL7H 5I74B 3SDDB 4H25A 1SJEB 5F21B 5TE7H 4IJ3B 4OJFH 4V1DE 5DJ2B 4MS8C 3FONB 3MLXL 3BGAA 3QQNA 5IWLC 2HA1A 5JNYA 4HCRH 4K3EL 3MO1A 1G7JB 2MQ0A 4PREA 3OJMB 5D72L 1MHPH 2Z8RA 4HS6A 5E8DH 3HAEA 1D5MB 4FQIL 2IFFL 1KPRA 3GM0A 1QFUH 4QOKE 4DOHB 2A6IB 2VXQH 3QCUL 3EYOB 3CVHH 4G9FE 1A3QA 1BAFH 2HFGL 4X7TB 2R69H 2GJ6B 2Q8AH 4NOFA 3QHTC 1CF8H 4FP8H 5D1QB 1IGFH 2FZ3B 4TSBL 5HVGB 4JZOA 2XN9E 5F9OH 5F88B 4DW2H 3RNQB 4RFEB 2G60H 5JOFA 3VFPB 3M07A 3QZWA 3V8OA 1FBIL 4TN9A 4G6AC 1I1YA 5DVNA 3RDTD 4LHQB 5HD8C 5H37G 4Z7OF 1RUKL 2JK5B 4Q9RL 2IQAA 1OY3B 1KIRB 1QNZH 4QOKB 1JZ8A 1F3DJ 5C08D 3CFBB 1KPUA 5CJBA 5BJTA 4L3CB 5HVFB 1UT9A 4G9FB 1R5IA 5DS8A 5E4IA 2EICA 3H3BC 2IBGA 3TH3T 1RD6A 4HIJA 1T89A 2XN9B 4QRTB 4GQ9H 4PRIE 3TNMB 3V4UL 5ITFB 3UJIL 1HHGA 2APTA 5SWSE 5L9DH 4OD3L 2GCYA 5MERB 4G6KL 5D7IE 2ZSWB 4KHTL 5ISZD 3K8MA 4YWGH 2FO1A 1WC7A 4MXVF 1JGDB 3LEYH 3FOLB 4JFDA 2YD4A 5IEKB 5DD6A 4W4OC 1ZA6A 4JZNB 4MJIE 4NRXA 4NZRL 3HMXL 3AXLA 4UBDC 5D4QA 1LVEA 5F44A 1TQBB 1UVQA 3MJ6A 4GBXC 4HT1L 2JJUA 2NW2B 3TBWB 1GC1C 1DDHA 4YHIA 4AJ0A 3HNSH 3Q1SH 5GJSL 4PRIB 3VFGL 4IBLT 2ZPKH 1FC1A 5D96C 5SWSB 4HWBL 4NNYB 5CIPH 4DGVL 5JW5B 3LCYA 5LAXB 2FJHA 1F13A 1KXQE 5D7IB 3UTZA 4UU9A 2FO4B 4OCSL 5HGHB 1N64H 4YPJA 3MA7A 3UJJH 2B5IB 2VZTA 2HT4D 5GGVY 4Q6YA 4WW2C 1A6WL 3VW3L 4AT6A 4TYUA 3VMPA 5FM8A 4OUOA 3ARUA 3VFUB 1C1EH 3UXFA 1BJ1H 1HSAA 1MFEH 1KPVB 3B9DA 4Y1AD 3T4YA 5IEHB 1DBKH 5E56A 2NY6B 4Z0BL 1WBZB 3D0LB 1FN4B 4XCYA 2VLMD 1HH6A 1NAMB 2YA2A 1ETZA 1JWSB 1H0DA 1NC2D 5JO5B 2UWEA 4PG9B 2X1QA 4HQQL 3LV3B 2LQRA 3V5DA 3ARXA 5L7XL 1F90H 3ET9F 2ZZUT 1S5HA 4ODXA 3NIGF 3RJDA 1C16B 4NKOA 2Z91A 4O2EA 2YOCA 1EK3A 3BPCB 3BD5A 5EZLA 2GY5A 3GKWH 1GC1L 4Y16A 1S9YB 4K94C 5IESL 3REVB 4U0RB 1NCNA 3IXAA 3K8KA 4OCRH 1CD1A 1X9QA 2HFEB 1T4KB 2EH7L 4XPFH 4N90D 4KKCC 4J23A 4LARH 4XRCA 4CUCA 2FX7H 1D5XA 5BS0D 2FX9H 4XI5D 1RHHA 1II4E 1J1XH 5JOEA 1UKTA 3MNZA 2I5YL 5K9JL 4PRHA 4D9LL 5HVWA 3K1DA 5TGBA 2AV7A 5C0DA 1CXFA 3BFOA 2R4RL 3QI9B 2BRRL 4Q6IA 5C0AA 3ILQC 4RFOL 3RU8H 5JW4Q 1F00I 4KUCF 4GAYB 1T1YB 2I9LA 4GS7B 5CEZE 5DJYB 5E6ID 1JCKA 4N68A 4HKXB 2HMID 3Q5OA 1CD9B 1U3HD 3F65A 2O5ZH 3MRFA 4H26A 5E9DD 3SGJC 1IRAY 2D31B 1H3PL 4HBCH 3LKSA 3QWRD 1BBJB 3ZYIA 4EKXA 3L3IB 3MSPA 4DTGL 4JFEA 2QQLH 3QFJA 2WM0A 5GRJH 4Z9KB 2ZUQB 3C60C 5DRZA 4K94L 1U8OB 4XXDB 4ODVH 1DVFB 5E6ZA 5E4EB 4LVOC 4HUKB 1RULH 3DV6A 1J10A 3K4ZA 5DZNA 1YEGL 2QSCL 3AM8A 3L3DB 3D5OF 4HXBH 4OLVL 3QUZB 4OUUA 3E2HB 3NFSL 3VWKC 2ARJA 2ILLA 4C83A 5DJZB 4XHJD 1AGFA 5ECJE 2YXMA 3WIFA 2VXUL 4YHZL 3WCYA 1EO8L 1EFXD 3EHBC 4JM2D 5DR5L 2GYSA 1GGIL 2XZZA 4KDTC 4I18A 4XPBH 1C8PA 4QRSB 4GG6F 5C0NC 3B2UC 3N0PB 1IAKA 5I73B 1H3UA 3VRIB 2MHAA 1C08B 3HN3A 3IGAA 3VJ6A 1A7QL 5CWSA 3EYFB 1T2QH 3QUXB 3L3KB 3RHWF 2W9EH 1PG7W 3SO5A 1CQYA 4S2SB 1IQDA 4OLUL 1BVKB 2AJVL 3QDMA 1JVKA 4KTDH 4ZS7L 5H8DA 1V3MA 1GGCH 2YZ1A 3C08H 1IGTA 4HLZG 4DFHA 1FSKC 1X4YA 1QSFE 4MJ2A 2V17H 1EUTA 3BPOB 1ZLSL 3CVIL 1KJVB 3LHPH 2BJML 3GJFA 3F7YA 2FYYA 2AS5M 2Y5TA 1HHJB 1I7UA 2DOCA 5F9DC 1RIHL 1BIHA 1A3RL 4KKLC 1K4DB 2O61B 2X89A 3QEUB 4F9PA 4FFWC 3UTQB 3ZO0A 2W65B 3TPKA 3HB3C 3O4OC 1Z6JT 2XKNB 1XGRA 4ZFFB 3GRWA 1FFPA 2UZIH 4ENED 3IFOA 1U36A 2XRAH 3IDUA 1HSBB 5F6HJ 4N0CC 2MCG1 1EFQA 3D39A 5DDHA 4OZIE 5E8OA 3IDXH 3RWGA 2DQGL 3BKJH 1QSFB 5D5MA 4BSVA 4KJPD 3UYRL 3J8F7 3QUYA 3U9PL 5I8EB 1EA9C 1MEXH 1T20A 4FXKB 3B8SA 4W4NA 4H88H 1HCFX 5I66B 1R3KB 1EJ6A 5IJKA 4JFPB 3MLZL 4E41D 4HUXB 1BLNB 1YEHL 1YMME 3ULUD 3QUMA 3W0WB 4YDVA 1YYMH 4YBLC 4XH2A 4P4KC 2ICEA 1XF3A 3L3GA 3EO9H 4A2MA 4OLYL 4NYLA 3FKUS 4AEIH 5IGXH