1NQBA

Trivalent antibody fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
VQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSSDIELTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords SINGLE-CHAIN ANTIBODY FRAGMENT
publication title The 2.0-A resolution crystal structure of a trimeric antibody fragment with noncognate VH-VL domain pairs shows a rearrangement of VH CDR3.
pubmed doi rcsb
source organism Mus musculus
total genus 54
structure length 232
sequence length 232
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA02
4CGTA 4EVNA 4LBEA 4MB3A 4JZNB 4MD5A 1BQSA 2R4RL 4QCIB 2Z8RA 1EJOH 1F6LL 2AXJA 4YHNA 2NPLX 3WNPA 3P0VH 1EAJA 3RPKA 3MYZA 4P2CG 3TT3H 3VWJD 4D9QD 3BH8A 3ARUA 1MRCH 1J0YA 5JOEA 4J8RA 3MLUL 2AABH 1ES0B 2CUIA 2PUQT 1AGCB 1TVHB 3NGBB 4L8DB 5E0QA 1YMMB 2NW2A 1C16B 1PGRB 3ILQC 4HJJH 4BH7B 5LGKA 4PLOB 4PGEA 1LE9B 3VXUA 4X5WB 1DANU 4PJ7B 3OV6A 5CILH 3MV7A 2FO1A 1W72L 4XP4L 2DWEA 1Q1JH 3G08B 2D7NA 1IAII 4NFDA 5C07D 1XR9B 4U2ZA 3MCKA 3QEHB 2HT2C 1GJIA 4IOFC 1I7RB 3VD3A 3FO9A 3C8KA 4QTHB 4K7PL 1NDMB 4Z7WA 3QHZL 4LLDB 1LO3H 3BE1L 3ARFD 4K71B 3BT2H 1CXFA 4U3XA 2DF3A 3PGFL 3MRCB 1IZJA 1UA6H 2BNQE 4OV5A 1F11B 1UH2A 1IGCL 1ITCA 3SDDA 5LWYL 2YXMA 1QSFE 4I9WD 5CGMA 2YPLB 4QYOA 4JZOB 5TE6H 5M94B 3JSSA 5GRVL 1AE6H 1K9TA 2Z91A 5CEXA 4Y8AA 1VERA 4PJCB 3LKSB 3VFNB 3FB6A 3PWNA 4R2GB 4YDLB 5ICZA 1RPQA 2UWEA 4NC2B 4MX7B 4M61B 1NFKA 1FNSL 1JZ5A 4IDJL 5CJXC 2IPKA 1LDPL 3IKKA 2B4CH 3GSXA 4P0DA 1QYGH 4ELMB 3VMPA 3TV3L 1M7DA 4HKBB 2VERN 2EZ0C 3K8KA 2N7AA 4K9EL 3MRNA 4K94H 4XPFL 4G8GA 2KZWA 3L95A 1F3RB 1IKFH 2Y4SA 4ODTH 3UBXG 4AT6A 2XKUA 2IH3B 5L7XH 3RVWD 2Z31C 4V1DD 3T3PF 4GAGL 4RFEB 4Y19A 1CFQB 3GBNH 2FZ3A 1QRNB 3GKWH 4LCUA 4ONGL 3GSUB 1XH3B 1MI5D 5K9QI 3BGFB 1N26A 3M8OH 4YK4C 1FVCB 4DQOL 5AG8A 2W0KA 1F6FB 5C0FA 1V7NH 3GMRB 2YD9A 5T3ZE 3W9DA 1K6QH 3T0EB 1YPZF 4UTAH 2FX7L 5DR5L 4I18A 5F93C 1RZGB 4EI6A 5DJZA 2RAMA 4NQDD 4S1RH 5C0BD 3S6CA 5I1KH 1U58A 1Z9OA 1CFVH 1F3JA 4QHKI 4UV4L 4QHKJ 1PEZA 1JYWA 3INUL 4U6VH 4HUXB 2P45B 3KLHC 1WAAA 3SKNA 2JELH 4QRUA 4LLAA 1Q9KB 4ZUTA 2GAZB 3QI9A 1D9KA 3AS1A 5C0AA 1ZSDB 3ARPA 1IAKA 3ARBA 2HRPL 5DD1H 4NGHH 1ZGLP 5IVXF 1XIWB 5DUBB 3IDNA 5CP7A 4GT7A 4XNXH 3OKEB 4GFTB 3HI1B 5ANMA 1KJ2H 2ZCHL 2Q1EA 3NN8A 1A6VH 4I77L 5CFHA 5FB8B 5KSBF 4JKLA 4WVRA 5T1MB 5GGUA 4MS8D 4G6JL 4XVUC 4PRHA 1B4JL 2PXYC 4M1DL 5HYIA 4WNQA 5JOPE 4KQ3L 1MCRA 1GGYA 1CVSC 3MR9A 2WIMA 1Z3GH 3K4AA 1ONQA 2NX5D 5DA4A 3VGBA 4CL7A 3V4PH 2ZUSA 3DVIA 5FUZH 5IEHB 3DMMB 4YDIL 2AV1A 4NQUA 1BZQK 1AP2A 2X4UB 3BDXA 3RPIB 1DBJL 3CLFL 2J8UF 4NM8H 3MV7E 4LL9A 5JOFB 3BP4B 4UILH 4X5XB 3WUWA 1AD0A 2DQHL 1MAMH 1C7SA 4FFVC 1CF8H 1UWEL 5EU6D 2IH1B 3VXRB 3CFEB 3S96A 2R1WB 2EE2A 4F7EB 5EU5A 1LEGA 2EECA 4LLVB 3DYPA 4Z7WE 2EDRA 2F5BL 4JFZH 4WI8A 2CDEB 4HS3B 1YEDA 4G9DB 5DO2D 5EH1A 2RBLA 4X7SL 5CJOH 4DJMA 3FQRA 4Y5VB 1JE6A 3WFBL 4ETYA 4MJID 1U93A 5ITBL 5CGYD 1YN6A 3DI3B 5DEGB 5EZIH 5ID0A 2F9BT 3H9SB 3RVXC 4HX1B 1VGEH 1JNNH 1N0LA 1OAUL 3WJJC 3PQYD 2UWEE 3M1BB 3SGJA 3HS0A 4DFHA 3EOAB 3RWGB 2LVEA 3MRRB 4I13B 3KLAA 3CFCL 5E1HB 1MRFL 3B83A 4XP9H 3VRJB 4YHKH 3UYPA 2B20A 2MHAA 4LDOB 4G8GE 4L4TB 2NY7L 2CGRH 3MLVL 1H3XA 3DETD 4GMSH 1HHGB 3SKJL 1ORSA 2ZOLB 1T6VN 2X4OB 1NJ9A 4J6RH 1KIQA 1VFAA 4Y19E 4TNWK 3VXTA 4OCYL 5F96L 5JPNA 2EC9T 4F7TA 1NMCC 4WHYG 4OLXL 3IDJB 1EHNA 3UTOA 1DE4A 1YC8A 2ITDB 5GGRY 1BQHG 5B22A 1D6VH 3T4YA 5JA9A 3ZKNC 1YEKH 2BOCB 1C1EH 1B88A 1LO4L 5KVMC 5EO1A 4OIAA 1FL6A 1G7PB 3LQAH 1YEFL 1IM3A 2I27N 5DT1L 2LE9A 5BVPL 4OKDA 2WUCL 1CWVA 1K2DA 2BDNH 3IFNL 5DRZB 5EA0H 4YWGH 3LKQB 4OZFB 2Q7YB 4BFIA 4HMDA 1PW3A 1DBAL 4MYWB 3V0WL 4LIQL 4ZSOB 3HHRB 1U8IB 4M1CC 3K2UH 4X7TB 3BP7B 5ESQB 4Y4FB 3MODL 1G9ML 2OR9H 5GPRA 4Y5YC 1ZA6A 5DQ9B 3BP6B 4WTZG 2EIEA 1QEWB 4ZFOL 1I7UB 4R0LB 2VLLB 3UTTB 1KJ2A 5BV7H 3B2UC 2VITA 2YHGA 5IR1B 2VLRD 2XFXB 4O2EA 3IDIA 5ANME 1HK6A 2XWJB 3GMMB 4M93C 3QPXL 3PHOA 2VN7A 3VWKC 4XZUB 1BM3H 1HHHB 4U7SA 2AJSH 3G5VB 2VLJA 4PRHE 1PKQB 3G6JF 4JFYB 5BZDA 5FYLH 3QFDA 2QADD 2IPTH 4GS7C 5J6HB 1D6EA 2CDGA 5GRXG 5C08B 2H2SD 1GGTA 4H25A 5DURD 3LRSA 4PGZA 4PJGA 4X4XA 4KDWA 4RGOL 5E00A 5D5MF 1IM9B 3F7RA 2ADFL 4I0PB 4PV8B 3CUPA 3UTQA 5IB3B 5KZCB 4PGDB 5L0QB 3V4VL 2COQA 4PTUB 3RA7L 1R3KA 4JM4H 3BH9A 1XR8B 5GS1C 3RAJH 4F9PA 35C8H 2DQIL 1G7QA 4NHUA 5CMAA 5E8PB 1LO2H 4NQXB 1S5HA 1BF8A 3P0YL 1VACA 3NPSC 3TN0A 4LGSB 2IAMC 3QIBD 3HMWH 3V7AE 5HYSB 1QKZH 1FNEA 2Q7NA 1J5OH 1F58L 1RZJH 2XQBL 3QG6A 2K3TA 5EOCL 4YE4H 4KRNA 1TJIL 4L3CB 4DOHB 4FXGB 3LEYH 5D7IB 3FFCB 3SDAD 1AR1D 3W81A 5MENB 3C5JB 1CGUA 4RFNC 3SDXB 2A0LD 3QWRA 4CDGC 1F6AA 1YUHA 4OZIF 4F9LC 2G2RA 3L3DA 1KF9B 5FYKL 1FE8L 2BC4B 5I9QB 3NIDF 3WXVL 1PFCA 4K9EC 2XA8H 3MBEC 4J4PA 4P5MA 4NHCL 3TBSA 3WFCH 3EOTH 3KYOA 2AXGB 4BJLA 1T7YA 3OQ3B 1N0XH 3QCTL 4UU9B 5KTEH 4LHUA 4NNXB 3QCUH 1X5YA 1T22A 5B4MD 3V0VA 2ZCLL 4KJQD 4G6FD 3MJGX 4XCEA 3DI2B 1CE6B 1FBIL 2SEBB 1NC2D 5DEZA 4WWKB 1BQUA 1A9BA 3ARDD 4WV1B 5D1QD 4L8SA 5E99L 3R4DA 2BOBB 3SOBH 4JJ5A 3KYKH 4UOJA 5DRNB 1I1YB 1CD1A 5K9JL 3DTXB 2VZ1A 3W0WD 1JNHA 3IFOB 2B0SH 3Q1SH 4FQXA 5EULV 4JPKL 3ZE2E 25C8H 5IMOB 3IDMA 5C70A 4FRWA 5EIQA 3K8MA 4NO0D 4PG2C 3VXOB 5DHVH 3C6LA 3CFBA 3O8XB 1NCTA 3TNMB 1S7TA 4NJAH 5LKNA 4X5LA 2D0HA 4S0SD 1DBML 3BKJH 3MNVB 4KFZC 1OAQH 4YX2L 4OKVB 1KYOJ 2C1PB 5E94A 2MQ3A 4MQSB 2ENYA 4JREB 4XP6H 5I74B 1MVUA 1PVHA 1MJ8L 3ILQD 4XVJH 3ROOA 5D2NC 2WQ8A 3QJHB 5IMLB 2ICEA 5JHDA 4GRLC 3MRGA 3HZVB 3QEQD 3SE9H 2IMMA 4JRYB 3RGVA 4CNIA 3RTQB 1JV5A 2W0FA 2HT2D 5I15H 4IOFD 1ORQB 1TFHA 3NTCH 3WFZA 3THMH 1Q0YL 3U0TA 2H32H 4OCXL 4H5SB 4DVRL 2BVPA 3O6LH 4HH9B 3ESVF 3KPPB 4JY4A 4KV5F 1R3LB 3LH2L 4M6MH 1ZA3A 3FT4B 1C08B 1FGNH 1QA9A 3MOAL 1A7PL 4YDVA 4WI5A 5I1LA 1T20A 1XGYH 4PJGE 4L4VA 2IANA 2BCKB 3KPRB 4GOSA 2IBZY 4LCCA 5C0GB 4RFOL 3GO1H 4LLQB 5DJXA 4PJ5D 3QR2A 4MLIA 1RURL 3VXSB 1F90H 1KCUH 1M7IB 4XPAH 3U1SH 4LQFL 3O3DB 4OCSL 4XCCH 4P4RB 4BKLB 1EPFA 1GL4B 1TETL 5F72S 4W4OC 5TPWL 1C5CH 1NGWA 5HGBB 2ZOKA 3HR6A 5KVFL 3H7BA 4RZCA 1S7SA 4G43A 1A3RH 5E2JA 5CIPB 2DQJH 3VGDA 5HY9B 4HAFA 4I3SH 1NCWH 2EZ0D 3E2HC 4HXAL 1U95B 3HMXH 2Z8WC 1MCKA 5FKPB 3KDMA 3WIHL 3E6FA 1FZKB 4NM4L 1RU9L 4M43L 3UTPE 2RB8A 4HIHB 4P2QA 5JA8B 1T21A 2OMBA 2Z31D 4HH8A 4Q0XL 3D2UA 5LGJA 3MUY1 2GT9A 1KEGL 2HFFB 2MFNA 5D7SH 1FFOB 2CXKA 2Y06H 3QG7H 4ZDHA 4XXDA 4PJBA 3BZ4B 4YHML 1OAYH 1KPRA 3U79A 1ZLSH 3WFDH 1JWSB 4JN2B 4ONFH 5IB2A 3S3SA 4H88L 4GW1B 4NYLA 4MJ5B 4XI5C 1NCBH 3DECA 4LPWA 3D1MC 3CFJB 5DD5H 5KSAA 4Y7MA 5J6GB 1YDPB 1IL1B 5EBMB 1L7IH 3B9KA 3VFUB 5IV2B 4OD2A 1KG0A 4KVNH 4RNRA 5FHBH 1P2CB 4M62H 4OCLC 3T0DA 3OKNB 3L5HA 1A1NB 3PG2A 2X70A 4XXCA 2K1MA 4ENEC 3QDMA 3N1PC 1BOGA 5D7JB 1CL7L 5J3HC 3VG9C 3MACL 4AQ1B 2YMXH 5IESL 3QQNA 3L3GA 4JFXA 3AU1B 3VA2C 1QLFA 3GFUA 5FCSH 4UBDC 4S11A 5FO8A 1KIPA 2FJGA 2HJFA 1XAUA 5C6PB 3O3EB 3LEXB 5DHVA 4ZTPH 1CXHA 4U6TA 3BHBB 1MCDA 4FHBD 1BBDL 1RV6X 1I3GH 2YD2A 3GM0A 4XVUD 4Y16A 3BVNB 5D1ZA 4XC1L 4HWBL 2PXYD 4LKXA 5C0JB 2VSCA 1SYSB 3QHFL 1PKOA 3KYNB 3U2SB 4U1GC 1HINH 3LEVL 3U0PA 1FJ1A 2GSGB 3B8SA 3WSQH 1KFAH 1TQCB 2NW3B 1EHLL 2W59A 3P40A 2W65B 1NBYB 1YNLL 5JHDE 2NXYB 4BFEA 2VWEC 4WCYH 1TMCB 1VEOA 5I76A 4IRSA 3RHWK 2OJZH 3BWAB 5TF1H 4U0RB 5E08H 3QXAA 1G6RL 3GIZH 4JO4L 4FFVD 1P5VA 3JWOL 4OIBA 4WFHD 3BN9C 2AEIT 4RIRB 2H32A 4JO2L 5FYLE 1S7XA 1BD2D 3H3PL 5I18L 5DRXA 5GZNC 1DFBH 3GGWA 1G7IB 3KXFE 2VDLH 1UJ3B 3S5LB 3KLDA 3WIIH 3EJJX 5C9KA 1CTOA 3FT3B 4AG4L 1S9XB 4J3UA 4HHAA 5C86A 3X14B 5EZJA 1YQVL 4DGIL 5I1GH 3OPZH 1N6QL 3ZKQD 4L4VE 4N90D 5EO0B 4NRXB 4AMKH 3ALWA 3VRLE 4OGXL 4XNYH 3GMNB 3RVXD 1LO0H 2LVCA 3TZVC 3O4LA 5AYUL 2YD6A 4MAYB 2VZOA 2B5IC 2YC1B 4X9BA 3U4EB 1HDMA 4PJEB 1AXSB 4G6MH 2DIJA 1P7QB 3O0RL 4BQ6A 5BXFB 5IHUL 1LK3H 3FO2B 4QOKD 1IGML 1CDHA 2ZSVA 3TH3T 4S2SA 1F4XL 3B6SB 4NQCA 2DQFA 4NFBA 5FM5O 5SWSD 3HG1B 2OK0H 1SY6L 3UPRB 1TVBB 5K59E 2HVJA 1I75A 5IFHH 3KYMB 3R8QA 3I6KA 4NQVB 4P2QE 5JXEA 1XF4B 1FFRA 5DJ8B 3L9RB 2D4DA 3QCVH 4KVCL 1HQRB 2WP3O 2CKBH 2EYSA 2I5YL 2R1XB 4F7PA 4PJ8C 1I8IB 4JR9L 4ZAKB 3AS3A 3ZKND 2HTKC 3LPGA 5E5MA 5D7LA 3CX2A 1EEYA 4GAYB 4KKAC 2NQCA 2PYEB 4PRPA 3QDAA 3R0NA 3ZO0A 1A6UL 5EORL 5INDB 5FDWA 2ID5A 1MH5A 1LHZA 1FNAA 5C0EB 1GRWA 2R8SL 1D5IL 1Y18A 3RWJA 1DN0B 5AD0B 1S7QB 5HVGB 1R3JA 5AG9A 1IC7H 5KSVB 1KN4H 3QDME 1DQDH 2Z4QB 2X40A 4BSVA 4JCLA 3MC0A 4M1CD 4WENB 2DKMA 4JQXC 2EIZA 4FMKA 4Z7VA 2IG2H 4HJGA 5KSUA 2WV3A 3VI4E 1JYNA 3VFPA 1D5XB 4U3HA 3BPCA 4JRWA 4YXKL 3EO1A 4TSCH 4LNRA 3CXHJ 3DO7A 1KYOK 3B2UD 3O81A 5IJVA 1KTLB 5HYJA 4OI9A 3TVMC 5EOTA 1QPXA 3VWKD 5HGAA 3VW3L 1RULH 2H8PA 3CH1B 3EYOB 1X4ZA 1I8MB 2IQAB 5DD6A 5I1EL 2KL6A 4ZXBA 3BWUC 3EIFA 4AYFA 2J2ZA 1BMGA 3QUZC 5C3TA 3BO8B 1BHGA 3ZYJA 1LK2A 3VCLB 5IHZB 4P9MH 4QNPE 4FQQA 4HCRL 5DJAA 2DIAA 3CMGA 4ELKA 2F54A 1WZ1L 3BXNB 1HIMH 5EPMA 3ES6B 1NCDH 2CLZB 1T1ZA 3MCLL 2DQCL 2DQGH 4LDLB 5CLWA 5JZ7C 5D1XB 1FO0B 1BPVA 2G75B 1K4CB 1NLDL 1F3DH 3LN4B 1QVOB 3PWVB 5IB4B 3REWA 3TF7C 3UX9B 1OSPL 1PAMA 4QXTA 4XAWH 4D2NA 3DX7B 2LU3A 1MEXH 3L6FB 3JV6B 2VUYA 3OAYH 1MFEH 2IAMD 1Q94B 1MFDH 2R4SL 2E9WA 5IQ7H 3RVTC 1EHAA 3QA3B 3U7WH 1C5BH 1UT9A 3HNVH 3ZMRA 3JUZA 1CBVH 2P5WD 3PHQA 3GSNL 3TVMA 5I17B 3I02B 3U4BL 1RUQL 2HTLC 2UV3A 5SX4I 3RL2A 5FO7A 4HT1L 4JZJA 4QY8A 1JNLL 5EN2A 2GHWB 3MA7B 4JFDD 1UXSA 3PIQA 2VH5L 2ITCA 1D7FA 3IFPA 4BK5A 3O9WB 3QUZA 1UENA 4Q6IC 5HI3C 3O4LE 3WKNA 3F7YA 3IF1B 3VE0A 3VXMA 2LU4A 4CU8A 1JGLH 3TNNA 5GQBA 4JN1L 3MBED 4ISVA 4D94A 3I6GA 4IRJB 2OS7A 4M5ZH 5F7DB 1I1AA 4DW2L 3NGBC 5ISZB 3MLTA 4AEHL 3C9NA 1O5DT 2EDXA 4NDMB 3QEUB 2C3GA 4NQCE 4KQ4L 1I3RB 1IGJA 1R5VB 2X4SA 4Z7WF 3FB8B 5CBAA 3OAUL 2E7HA 5EU3A 2VAAB 2X7LA 2ADGB 4YJZL 1L9MA 1MWAB 1R24B 1X7QA 3TJEH 4Y4KA 1KB9J 1X5IA 3MV8A 3KXFD 5JO5A 2VMFA 4NWTL 5FM8A 1A9EB 1UB5A 2PTTA 2Z93A 5SV3A 4Q9CA 4GW5B 4KY1H 3T0BA 3ZDZE 2E6QA 3LVEA 3MXVL 5D7LE 5BO1L 3TT1L 2E7LC 1F4AA 1FL5A 4MSWA 5IB1B 4ZUUB 2UWEF 3QNZA 4IIQB 4B7IA 4PRPE 4JFHE 2JIXA 2J5LB 2MMXA 4JZNA 4Z95L 3HRZA 3MNWB 4UV7L 4PUBL 1RUAH 1XF1A 3GI9L 5E2TH 4JVUA 1RHHB 1AGFA 3EDJA 1DZBA 4P5KA 4LP4A 4YDLC 3EGSA 3L5WB 4R2GC 2A6IA 2W1NA 1AGCA 1V7ML 3W11C 3H9HB 1J1PL 2CIIA 5M7QA 1WEJH 2LAAA 1INEL 2X4PB 4HFWA 1YMMA 3O2WL 2J8UB 4PY8I 1JP5A 4BH7A 3U6RB 2ZUQC 4PY8J 3LQZB 3DYMA 4GRLD 1UEMA 2PKDA 4XPHL 4OF7A 4Z7VE 1AR2A 3L5JA 2AK1H 2X2YA 4HEME 5A43C 3B9VA 4PJ7A 1P4IL 4AM0B 2ZUTA 3QDHA 4G6KL 4U7MA 4E41D 5I73C 3V52H 3G08A 2W9DL 1BVLB 2JJSC 5HYJE 1RUKH 4G80A 4TNWF 1E6JH 3VFTB 1BWWA 3ZKXB 3QEHA 3RUGA 4HKJB 3LKPA 5T1KB 3C87A 4MNQB 4QTHA 1KGCE 3PABA 1NDMA 4LRNL 2AQ2A 3GNMH 4LLDA 4LAQL 2G5BB 3F12A 3BGFC 2ILLA 3QQ3B 3MRCA 1OAKH 4ODSL 4Z18A 4P5TB 4O02L 2F54E 2PN5A 2WM0A 4WFEE 1NCNA 2YPLA 1KIRB 4JFPB 4YXLH 5DK0B 4JFOB 5HPMB 3HC4L 3MLZH 4ZQKB 3IAGC 4OCWL 3T0XA 5L2KB 2FH8A 3NAAL 1JHKH 1A7QH 4PJCA 3EW3B 5BW7C 2D7TH 4Y2DC 2JK5B 1HEZA 3GIVB 3O2VL 1IFHH 4G3YH 4PJHF 2DM7A 4KKNA 3RZCB 1JRHH 4PR5B 4X98A 4NWUH 4DZBB 3QIWB 2JJTA 4KGLA 1FORH 1K5NB 4LP5A 1Q9LA 5A16A 5JNYB 2BVUA 5T3XL 5TE4H 4ELMA 4ZYKB 4MA3B 4TUJB 3EJZC 1CS6A 4YHOH 3L3OB 1XIWC 1XGTB 2YEZB 3NH7H 3KPQB 1ZHNB 1FYTB 5FOBB 1QP1A 4OZGB 4PJFB 3ECBA 3PWLB 4RFEA 4YR6A 1FL3B 1BQLH 2YK1L 4KPHL 3AREC 4LPUA 3B5TA 5CEZH 3ULVL 4OGYH 3GSUA 3HC3H 1XH3A 1HOCB 3CDYA 1AH1A 3VXME 5I19L 4Q97A 5HDLA 1WGOA 2F8OA 1NEZG 1PEWA 5ID1A 3OJMB 5DLML 3TO4C 4XI5D 1FG2B 3DMMC 3T0EA 3MRFA 3BIBX 1XCQA 1YY8B 5EUOA 1T7VA 3CX5K 2CR6A 1NQBA 5L2JB 1INQB 2I25N 4YFDB 2I26N 1JPGB 4LSVH 4OQ1A 2XN9D 4EDXB 5IW1A 5KS9A 1LILA 3MNZB 3WFEH 4JRXD 4KTDL 1WFTA 4KZDH 5EBLA 3MBXL 4PRIB 4NUGH 1MFCL 3BYYA 4XGZA 4ENED 3AXLB 4OZFH 5F9DC 1H15A 5F9OL 3F7VA 5J3HD 3MV8E 3I3DA 1A47A 1ZSDA 4ZMAT 1OW0C 1DL7L 4MNGA 3QJFB 4UBDD 3RWDB 5C6TH 3NIGE 5FV2A 3LDBC 2AEPH 4MWFB 4Y5VC 2VXUH 1CR9H 4LCIH 4YXHH 3G6JB 3HI1A 2FBOJ 4PBWD 4WEUD 4WU5A 1H3TA 5F1OB 5HDBE 4WDIA 1YEEH 3K46A 3BQUB 1AQKH 5I8CB 5HVWA 2X6MA 1E4WH 3T77A 2EXWC 1OT2A 2P8LA 1A02N 4M03A 1X4XA 2X1WL 3K3QA 1NCCL 3H0TB 3EBAA 4N8VB 3CXHK 5D5MB 1IGYB 4KJPC 3SGDH 4HKXA 5IEHA 1YMME 1SYVA 3DMMA 1WTLA 4JQVC 1VFOA 1ULVA 3DRQA 5DS8B 1BAFL 2X4UA 5GRYA 4C54A 3N9GL 15C8H 4PJ7E 1KLUB 5JOFA 3BP4A 2WQRA 4EUPG 1QQDB 1IC5H 4Y5XB 2VLKD 4XNMB 4XB8A 2IFGA 4RAHA 3A6CH 2IH1A 3MJ7A 3BN9D 2BNRD 2OI9C 5DK2A 3L3JB 4I1NB 3RUGE 4M4PA 3CFEA 4PJ9B 4WJ5A 4HFUH 3T0WA 2OZ4H 4QHNB 2E27L 4F7EA 5GZND 1RIVL 1A6TA 2VXTH 4ZO8A 1MQKH 5FIEA 4ZO7A 2CDEA 1MHHA 3RY4A 2NLJB 2Q8BL 4G9DA 5EU7E 3UCRA 3EYVA 4PRDB 3TYGL 1JPFA 2OMNA 2VDKH 3WNMA 4MCYA 4OIIH 1A1MA 4RWHA 1R5IB 2RJMA 5JMRA 1MJJA 2YPLE 5DEGA 1HCFX 1N4XH 3ULUL 5L6YL 4HX1A 1JN6B 2MPAH 1ADQA 4M7JH 1Q72L 5IROA 1NGQL 4PJCE 5KJRH 3TZVD 1J1XL 1T03L 3M1BA 4YQXL 1FN4B 4QO1A 3LMJH 3L3IA 3EOAA 1ZLWH 3RWGA 1HHIB 3KVQA 5J1AB 3MRRA 3NCFB 1A6PA 2FCBA 5HHVH 1J12A 4BUHA 4XMLH 2WNGA 3VRJA 2QQNH 5FUCC 1T80A 3IXTB 4ELME 4Y4FC 4YHIB 4MMZC 3TBTA 2NZIA 4L4TA 3GRWH 1RZFH 2P5ED 3NABH 3HRPA 1HHGA 3ZE1F 1RFDH 4JB9H 3MRPA 4W68A 1I8KA 5IMMB 2X4OA 3QUKB 5BMFL 2APXA 1T1XA 2VLME 2Q20A 3N85H 2H41A 2EC8A 3PWPB 1VGKB 4DGVH 2C1OA 1OGAB 4PJGF 1QD0A 2MSPA 4PB9L 4PJ8D 3SGKC 4JQIH 3MGAA 4EIGB 4JLRB 2HTKD 4OLZH 2GKIA 4OT1H 1MCBA 3T0EE 5EUOE 4KKAD 1G7PA 4M6OL 5F89B 3KAAA 3BSZL 1U92A 2AXHA 5I8EA 4I0PC 1KB9K 1NAMB 1AXTH 3QXWA 1MCSA 4HSQA 4RGNB 1I1FB 1RUPL 3LKQA 4OZFA 2HVKA 2AI0L 3HC0A 3OAZH 2D03L 2Q7YA 4HV8B 2FD6L 2WINB 3VMNA 3S88H 3LS4H 3JTTB 4ZSOA 4Q74A 5FF6A 5B39G 1G1YA 2GQHA 2ZSWB 1U8IA 3PL6C 3UTSD 5ESQA 2WWMC 3D3VD 1EO8L 3BP6A 4S10A 4MNGE 1U3HB 4XCNA 1ZHLB 1QEWA 1I7UA 3C5ZB 4R0LA 2R29H 4RAUB 3UTTA 1RJYB 1G9NL 3SKOB 1CCZA 5IR1A 3HAEG 4Z0XB 5I71C 4PP2B 3PP3H 3RX8A 2XWJA 3TVMD 3G04B 3FOMB 3TBVA 5EWIH 1HHHA 5L8LB 4WUUB 1PKQA 2C4FT 4JGMA 3STLB 2HJLA 5J4MA 3BZFB 3E8UH 3WEXB 3H8NA 3C6SB 3PGFH 4GH7B 2HKHL 1N59A 3QUZD 3CFDB 4Y1AB 4WRLA 1KCSH 3IDGB 3OJVC 3A6BL 1HSBA 3MLYL 4BQ8A 5E03A 3MUJA 3FJTA 3M17B 4AEIH 4XHJC 3KJ6H 1AKJD 5IVZB 1U8KA 2GITB 2R0LH 4HBQA 4PTUA 1UVQB 4KROC 4NC1C 4QLRA 4QRPB 2FO4B 4OCMC 1NBQA 5JZ7D 1MIEH 2EE3A 2OZ4A 4X9FA 5E8PA 4NQXA 3IGAB 5D6CA 1LDPH 3KPSD 1UM4H 4WWKC 3I75A 4WV1C 3CVHB 1HI6B 3NFPA 3KNBA 2KBGA 3NA9L 5HYSA 1A14L 3RVTD 5I16A 3P9MB 5E8OB 3OKOA 5FV1L 1SMAA 1U8MB 1T66C 5IBUG 5CIPH 1S7WB 3QNYB 2HTLD 3DX9A 5D7IA 1GOGA 3FFCA 1IAOA 2DQTL 5AZ2H 2E7CA 5MENA 2R1YB 1HKFA 2VSDA 3C5JA 3U9UB 2XRAH 3OZ9L 3SDXA 4L1HA 5E8NB 1QBLL 5HI3D 2O5ZL 1HQ4B 3EDFA 1S9WA 2VIRA 1RJLB 1X5LA 1SEQH 1F2XK 4JREC 3ARGA 4TSBH 3RHWF 4UQ2B 5TFSH 5I74C 1EFXB 5LAXB 4E42B 3GRWA 1UGNA 3MJ8A 4BZ1H 1NFDF 4XNZB 3MZTA 3NFNB 4UMGA 1MLBB 4NNXA 4F33A 4R96B 2YA2A 1T5WB 4L4TE 1T2JA 4OAWB 3G6DL 4C56D 3G9AB 3PV7A 1SJEB 1RVFL 3RTQC 5CEZE 3BJLA 4PRAB 4FTVD 4G9FB 1MFAH 2X44D 4U6XB 1I1YA 3QFJB 2YN3A 4Q7DA 3DTXA 2KH2B 3WV0A 5M95B 4QRSB 3W2DH 4WUKH 1E28B 3VRLF 2R56H 5IMOA 1IC4H 2FLRT 3FAWA 4ZUVA 2WLYA 2HYMA 1G9EA 4BQ9A 4G6JH 3AMLA 4UAOB 2VL5A 3VXOA 4LPTA 3FQTA 1TNNA 4KMTL 3TBYA 4W6WB 3O8XA 3U82B 2JJWA 4NT6A 1B0WA 1MCFA 1MHEA 4P48A 1X3DA 4YLQT 3R06A 4OKVA 2FR4B 3DSNA 4R2GD 4IM8A 4XH2B 5EUKA 3W11D 3HNTH 1W72A 4RQQB 4ZSOE 3Q5TA 1YYMH 1Z2KA 3MXWL 1T7XA 4U1LB 2GY5A 3HZVA 1J8HB 5CWSA 5H37H 3UTTE 2I07B 1YEHL 4TTGA 2APTA 4HUUB 4U1JB 1WITA 4JRYA 4GQ9L 3VXNA 1DEEB 2B8OT 2BVEA 2FEEI 3FMGL 2JLLA 3S36H 5KG9B 3VFWB 4JFEA 4LEXH 1PKQE 1ZE3C 5ADOL 4H5SA 2EYTB 2YD4A 4MJ2A 4NQEB 5GJTH 1QRND 3KPPA 3MOBL 4POUB 4OJFH 5F6HJ 5DUML 1YA5A 3T2NH 5I1AA 1VEPA 2B2XH 3UTZA 1J0JA 1VFBA 2CXGA 4EQ3A 4GUPA 2GW5A 1H0DA 2YRPA 3RIFK 3V6ZA 1GCFA 2R2BB 4HF5H 1FAIL 4I2XA 4CN4A 3WS3A 3SDCB 4YDJA 3KGRA 3P2TA 5FGBC 1DANT 4XX1E 5HYQB 4JM2A 5FKAB 1JJUA 5IMKB 2GCYB 3V5HA 4P4KB 5F1IB 4Y2DD 1XEDA 4BKLA 3VI4F 4D0BB 5LBSL 3HZMB 2FX9H 4C58B 2DMBA 3BW9A 1U2HA 5HGBA 3DX8A 4U1HB 5D7JC 3K74B 3LN5B 4ZS7L 4PRBA 1YEGH 5CJQH 3TM6A 3X13B 4HBCH 5EIIB 4S1DC 3HI5L 4PS4H 4L9DA 1U95A 2D3VA 2WBKA 3EJZD 1FZKA 4DOHE 1BZ9A 1XIWD 2HKFL 1TZGH 5TGBB 1CFSA 2BNQB 4M6AA 5GXBB 5D7IE 4HIHA 3FFCE 4QHMA 5MENE 43C9B 4M48L 3FB5B 4QNPF 3SDXE 3ARED 3D85A 4LLUB 2HFFA 4OI7A 1FFOA 4EN3A 4K23L 3S37H 2I60H 2M2DA 3NIFE 1UZ8B 1I9RL 3BZ4A 3FZUC 3PV6B 1KPVB 1BJ8A 3QZWA 1AJ7H 2E9IA 3OKKA 2X4NA 3ILPA 2VXQL 3GJFB 4HLZG 2KQMA 2BFVH 3GI8H 1GGIH 3TO4D 4MJ5A 5AZEH 1YEFH 3DMMD 5T33H 3W39B 3U0WH 1GAFH 5I30H 3WNKA 2NXYC 3CFJA 3WLWD 5J6GA 5F9JA 1IL1A 2F53B 1NMBL 1MRDH 2DBLL 4U0RC 3NZ8B 1ZT1B 3S4SG 4XCYA 3IDXL 1P2CA 3OKNA 5C0DB 1NSNL 1VSCA 5JPMB 3VXRD 4R97B 1AC6A 5E9DD 1XF3B 1LO5B 5C0CD 3AUVA 4P99A 5AWNH 3KS0H 1ZAGA 2VDPH 4Q2ZA 4F58L 3O3EA 2BXYA 5CINH 5T1LD 1G0DA 4DCQB 4LSSH 2AK4A 3IXAA 1A2YB 3CDGB 3BZEB 2X4QB 2H45A 2W0LA 2A6KB 1KJMA 4WO4A 3BVNA 3H9SD 5GGQH 1ZLUH 1SYSA 2EXWD 1KB5L 3KYNA 4OD1L 1CT8B 3RY6A 2VE6B 5CSGA 3O45B 5DRWB 2GSGA 3MLWL 1I9JH 4KJPD 3QDJB 4N0YH 3RWEB 1ZWIA 2ADFH 2W65A 5A2IH 5HYFA 2FIKB 3PP3K 1G7LB 4EI5C 4DEPB 4NO3B 5D7KE 2B39A 5F9WC 3NCYP 4L4TD 2J88H 3UDWA 4JRYE 4NO2B 1WCBB 5F7HA 1FZJA 1FO0H 4LMQE 4JFEE 5CEZD 4U6YA 4WGVB 2NY6B 4JHWL 4EVNB 1UJ3A 1IJ9A 1WWWX 4ZUSA 4LCWB 5EOCH 1CGVA 2W0PA 3FO0H 4PP1C 3BH8B 2O5YH 3B43A 5J8OA 1EVTC 1S8DB 4HMCA 3X14A 2VDMH 4TRPL 5EO0A 3I6LE 2NW2B 2D4FA 4I2XE 5FEBA 1NCUA 1B6DA 3WL9A 3TYFA 1UG9A 5CS7A 1GZQB 3VXUB 1PSKL 5DMYA 2YS4A 1JF5A 3MV7B 4XPTH 2DWEB 5HHOB 1IEHA 3EDEA 2HN7A 4Z7VF 1DQLH 4MAYA 1N6VA 2J4WL 2YC1A 3MYJA 3OKYA 4L5FH 1YNKL 2QSCL 1AXSA 3MCKB 1U8HB 1QHOA 3FO9B 2JCCB 3C8KB 4YUEH 2FNBA 1KXTB 4KUCD 4Y4FD 3VXPA 2XWTA 1XGQA 3B6SA 1FIGH 3HG1A 4ZPVB 3UPRA 2AKRB 2HLFC 5MI0C 5AAMA 5I1JL 3KYMA 3PE9A 5FGRA 1UEYA 1I85C 2A9ML 1SM3L 1XF4A 3P30H 1N2RB 3AFLA 1A7NL 3L9RA 4QYOB 1HQRA 5GRUH 1TCMA 4JPKH 3V0AC 5I1IH 1MWAH 1JIBA 1T89A 5CEXB 2R1XA 1T2XA 1RD6A 3FB6B 3PWNB 5ICZB 1I8IA 4NP4H 4ZAKA 3B2VL 2AAVA 1Y6NR 4ZFZA 5C08D 4XP5L 2OP4H 1KIUA 5DD3L 2XZQL 4JY5L 2IPKB 5IBTH 4AK1A 3MGTA 1BX2B 2EEBA 2HWZH 5EO9B 2PYEA 4NZDA 1F4HA 1IM9D 4M7LH 3D69B 3GSXB 5F71A 5JIPA 4I0PD 1DBMH 2UYLA 3MTRA 9CGTA 5F3BA 1M7DB 5INDA 5D71L 3MRNB 1QFHA 1TIUA 5INCB 1MIMH 4JFFB 3RI5K 2VC2H 4IMLB 1EHXA 1DCLA 4YDKH 1JZ4A 5KSVA 4CUCA 4ZFOA 1OSZA 1OLLA 3HPJB 5AEAA 4PJAF 3PL6D 1FDLL 4Y19B 1NH6A 4UTBH 2WWMD 5CBEB 1PG7W 2FZ3B 4TOYH 4CN1A 4TVPL 1T0MB 5D93B 3X3FL 1CE1H 1D5XA 4HXBH 1NUNB 4OUOA 1PG7L 2XWBB 2AK4E 1KTLA 4FQLH 3G6AA 4P2YA 3W9DB 2VXVL 3AM8A 3FFCD 2IC2A 4AH2A 1IKNC 3CH1A 3EYOA 4I18B 1I8MA 1MCIA 2IQAA 4EI6B 3CNKA 5E2VL 3U30C 4NN6B 1JGEA 2AXFA 3O9WC 4R90L 5IGXL 2ED8A 3BIKB 3BO8A 3V6BR 1F3JB 2QJDA 3MLXL 2EEAA 1KCVH 2XXMB 4IRJC 3WHE0 4MA8L 3S98A 2CRMA 3SKNB 2V2XB 4XHJD 2X1OA 3RVUC 1JZ8A 3QI9B 4JKPL 4B7LA 2CLZA 4NFCA 4K3DL 4YGVA 5C0AB 1SHMA 2D7QA 3ARBB 3SGEI 1NL0L 4GQPH 2QR0B 5IW6B 4LSRL 4RX4D 4KROD 4P59H 1I1CA 1J86A 5T5FH 3P11L 5D1XA 1FO0A 2G75A 3QRGH 1JL8A 1U8OA 2DICA 2QQKH 3IDNB 5CP7B 5TQ0L 2PCPB 4OSUH 2IGFH 4WWKD 4DN3L 4X8JA 3DX7A 3NIGF 3ALPA 3NN8B 1IQDB 4MCZA 3JV6A 4X80L 4PRHB 2GJ6A 1Q94A 4GJTB 2DQEL 3N1GC 1DQML 5HDBF 4RSVA 1ONQB 1T66D 1F8TH 5C7XH 4WFGD 1WF5A 2ZKHH 4YHZL 2EDJA 3RWCB 4OBRA 1T83C 1J0KA 4LHQB 1RIHL 2DBJA 1AP2B 1FGVH 3SBWC 2EDYA 2R15A 3QDGA 2P7TB 1GHFH 2HP4A 4JHAH 1AD0B 5T3XD 3DX6A 3HNSL 1OHQA 4PJ7F 1EAPA 3UJTL 3MA9L 4HPOL 4K3GA 5F7DA 3S96B 2A77H 3E1F1 1MREH 4FXKA 3AC0A 3RIAF 8FABA 4RDQF 5EU5B 1ZVYA 5JR1H 3OGOE 1WT5A 1KLGA 2XZCH 1K3ZA 4NDMA 3PHSA 1DP0A 2PR4H 3SJVB 1I3RA 2BRRH 3HG1E 5F7EH 3DURB 3X12A 1AFVL 1R5VA 4H1LG 1IGFH 1FVEA 1M1SA 4LPCA 1CZ8L 1CL7H 3RTQD 4QKXB 1U93B 2GSIA 3MACH 4XWOC 3GBMH 1MWAA 4BA8A 5HHNA 1YN6B 1HZHH 4X99A 1I8LA 1YYLH 4LVNB 4A6YL 4WFFD 3BRFA 3WJLA 1NUDA 2G9HA 5IWLA 2ZUWA 2Y7QB 5C09D 3D0VB 4HG4J 3MJ9H 4P5TC 2VB5A 4PJCF 1WIUA 5IB1A 4ZUUA 4IIQA 2PYEE 3KLAB 3I6LD 4TULH 1BGXL 3KPRD 2FIRT 2IALB 3MNWA 3JVGC 2GTZA 3WE6A 5JUEH 5JW3H 1RHHA 4LLWA 1H3PL 4R7NB 3VXSD 2H1PL 4DKAA 4ELMF 2UZYB 3L5WA 3V7MA 5IFAL 1QFUH 2DLFL 2FGWL 1ORSB 3U7AA 3H9HA 4JKMA 2VXSL 3OB0H 5ALBL 3TWCL 5ACMA 3RZCC 1KIQB 2YPKA 1VFAB 2ZNWA 4IRZL 4RBPK 3LQZA 5JPNB 3QUMB 1P4BH 4F7TB 5HVHC 3QIWC 4W6YB 1A4KA 4HIJA 3MRIB 3P73A 4AM0A 4B5EA 1RJCA 1KN2L 1I4FA 3RU8L 1ZLUK 2J6EH 2NTFA 3T4YB 2H9GA 4FXLA 4BM7A 3UBXA 3F5WB 3VFTA 2BY2A 4JKWA 5D8JH 2DI9A 2W9EH 4HKJA 3MV9D 4XMPH 5T1KA 1FL6B 3E3QC 4XT1C 4DTGL 4KHTH 1IM3B 4OFKA 3Q3GB 2D7PA 4XPBL 1K2DB 2ARJQ 4K8RL 3UMTA 1L7TH 4DGIH 5LVEA 1NEZB 1P9MC 1T0NB 4P5TA 3DV4A 4ODXB 4FZ8H 4XMKH 4WI3A 4OFYD 5DK0A 4JFOA 3JWDL 3QAZB 2R0ZL 4E5XB 2CJUL 3CSYA 3EUUA 5AYUH 4G8EB 3BEWA 2OQJB 3SEPA 4GW4B 1FH5L 3LKNA 1OCWH 4MXWH 3E0GA 3GIVA 2DDQL 2WLZA 3IDIB 5IHUH 3PHOB 4P2RB 4PR5A 3VGHA 3WIHA 1IGMH 5D7JD 3BKCL 2GJ6E 2VLJB 3QUYA 2HRLA 3WLBB 1SY6H 3V6OA 1A64A 4Q9RL 4S1DD 1NGPL 1FLTX 1IGIL 1CLOH 3C09C 3L1OL 4MA3A 3K81A 4GSDL 1N3NA 3T1FA 3V7AG 3QFDB 1QSZA 1D6EB 4FFYL 1B0RA 2CDGB 4X4MA 1XGTA 1P1ZB 3NFSH 4H25B 5DC4B 3KPQA 2MNUA 3LRSB 4X4XB 4OZGA 4PJFA 5E00B 3PWLA 1QPPA 5JQ6L 1A5FH 1FL3A 3GMQB 5JW4N 4XCFH 3CUPB 3O3BA 3UTQB 3BQUC 5I75B 1S3KL 4K3EH 3FZUD 4XBEL 1GGBL 2QL1A 1P9MA 4X6DA 1G7QB 4NHUB 1UADC 2H2PC 5CMAB 1ZVHA 1JGVH 1S5HB 5GS0L 1VACB 1V3MA 2HFEB 1FG2A 2CDFA 1YY8A 4OLVH 4HUKB 4P23C 2NXYD 4UT6H 1OM3L 5CJ5A 5L2JA 1INQA 4LARL 1FNEB 5ERWA 4EDXA 3LV3A 3MZGB 2IMNA 1Q38A 4L9LB 4NSKA 3MNZA 1ITBB 1JHLL 2OL3L 1NAMH 4Y5XC 1INDL 2I9LB 4PRIA 1E6OL 4U33A 1EFQA 5JDJA 1NGYB 1WIOA 2R0WH 4UIMB 5K9QG 4UDUB 5DZOA 1BFVH 5MEQB 1KUMA 3KR3L 1F6AB 5E8DH 2QQLL 1YUHB 2VDRH 4POYA 5B3NA 3MJ9A 2G2RB 3QEGH 3R8BB 1R3HA 3RWDA 2W91A 4HWBA 5E6ZA 1QBML 3VU2A 4DUWA 5B21A 2VR5A 4GKNA 4ODHL 1S5IL 4OCRL 3OX8A 1KB5B 4AL8H 1AIFB 3LKOA 2IBGA 3KYOB 3P4MA 4S1SL 1QSVA 2BY1A 2L7UA 5I8CA 1FNGA 5K9KA 1T22B 1O7VA 4FOMA 3V0VB 2Z8SA 4XCEB 1W0WA 1W2KT 2QHRL 5CP3H 1R5WB 2BHYA 4ALAH 1A9BB 1WZ1H 5GRJL 1RMFH 5J57B 4L8SB 1G6RA 4KZEL 4XVTL 2O26U 5DS8A 1YJDH 2DQCH 3ZTNH 1P7QD 3D5OF 2NY1C 3U7YH 4EI5D 5E6IA 5BQ7B 4YAQA 1KLUA 2ERJC 4FQXB 4ZO9A 3HG1D 2LTQB 4XNMA 3WD5H 1YEIL 3IDMB 1P5UA 4M3KB 4K7PX 4Q6YA 1U3JA 5BS0A 2HH0L 4PJ9A 3DSFL 4CRPA 1A22B 3CFBB 2Q3AA 5FYJH 4X6CA 1S7TB 5F7FA 3CVHH 2NLJA 4LK4A 4PP1D 1RZKL 3HLAB 3Q0HA 4PRDA 4M9PA 1BQHA 1RZ7L 1RUQH 4GKSB 3IFLL 5D2LB 5DJ2A 1JPSH 1R5IA 4HT1H 3G5YA 5DMKB 5TE7H 1IILE 4WW2B 2DLIA 3ROOB 2ICEB 3C2AL 3D9AL 3MRGB 1S78C 1J1OL 2GTWA 2W9LA 1X4YA 3HTLX 1QLRA 4GAJL 2X9YA 2Q8AL 4RGNC 5D6DA 2X1PA 1FN4A 2VZUA 4YIQA 3K80A 2EDKA 4CNIB 2DQUH 1HHIA 1UM5L 2W0FB 1GC1H 1SY6A 5J1AA 2H6PB 2LU7A 3ZZ1A 1F97A 4CKVX 3IXTA 3V6OE 3UO1H 1VDGA 5I1CL 2BERA 4WTZA 1U3HC 2EEDA 3OGCA 2HLFD 3C5ZC 1ZA3B 3MRBB 4X4ME 4TYUA 4NJ9L 4CJ0A 3F7QA 3MRMB 5L9DL 3O6KL 4YO0B 1OP5H 4OZGE 4PJFE 3WCYA 4APQA 2IANB 4X6BB 1DVFB 4LCCB 5DDHA 3PWPA 1VGKA 2X89D 3TCLA 5GGSY 1OGAA 1Z9SA 3CSBA 3A67H 5I6XB 2BVQA 2E7MA 5HD8C 1U8LA 1MHPL 1SVCP 4X6DE 5FM4A 3WXWL 4JLRA 4C59B 2VDOH 5ILTH 2IWGA 1MPAH 3ZKSD 4Z95H 2WBJA 1NGWB 1A6WL 1TNMA 2ZOKB 3MLSH 5F89A 1VKXA 1PD6A 4RZCB 1S7SB 3QXUA 1NAMA 2EDHA 4G43B 3UC0H 1IBGH 1EZVY 3D39D 2HMIC 3GHEL 1YECH 5DMGC 2ATKB 1K3IA 2CMRL 1J1PH 1I1FA 3X3GH 3KDMB 3E6FB 5J13B 4PRIE 4RISH 3UZEA 1CGWA 1NLBL 2WINA 4TUOB 4X9IA 4M1GL 1T21B 3JTTA 3ZSSA 4HGWB 4P9HH 4D8PB 2DQDL 2N1KA 4G42B 3FOLB 5D7IF 3C60B 5CHNA 2EDBA 2B1AL 4ZDHB 4XXDB 4PJBB 1Y0LA 3QIUA 1KPRB 5D70H 3V4UL 2GK0B 1MF2L 3VFGH 4P46B 3SDXF 3SKOA 4HQQH 5E8EB 4PP2A 4DUXA 4I48A 4MQTB 3NIFF 4NYLB 5GGVL 3G04A 1G7HA 3OR7A 3DARA 4XWGL 4NZUL 4BZ2H 4BFGA 4HCRA 4IOIA 5KSAB 3WEXA 4OQTL 3C6SA 4DK6A 2IADB 3MV11 3O9WD 1BOYA 3QRFM 3CFDA 4Y1AA 3LD8B 4O02H 3TPKA 4Q9QL 2OSLB 2X70B 4BSWB 4IRJD 3QDMB 3KPNA 1MCOH 4OCWH 2UVFA 1J0ZA 2L4OA 3RVUD 5ISZD 3Q6GL 4HIEA 4MDJB 2BXZA 4XNZC 4R26L 5HHXH 1T04A 2F5AH 5FO8B 1UVQA 1ERNA 4QRPA 1KIPB 2FJGB 3EYQC 4HUVB 2JB6B 1OARH 1DBBH 1NANH 2VDNL 4XVSH 4OF8A 5BS0E 1CXEA 4K8RC 4Y88A 2DLEA 3MLRH 3VGFA 2AEWA 2JB5L 3CVHA 1HI6A 1CICA 3SQOH 1TJGH 5D1ZB 2R69L 3GSNA 4X6CE 4PB0L 3BZDA 4ZOCA 3DBXA 1ACZA 4XP1H 5FCUL 2XZAL 2IBZX 5E8OA 1A7OL 4NZRL 1ACYL 3U0PB 3ARFB 1FJ1B 1D5MB 3QNYA 4L8CB 3BYTA 4UAOC 4Z77A 4HPYH 4F2MB 4XRCB 3JV5A 3DVFA 5F97E 2R1YA 4EOWL 5I76B 3GK8L 4IRSB 3U9UA 5I19H 2FRGP 3DPBA 1MCNA 2MCPL 1F4YL 1HQ4A 2D9CA 1G7MB 1QR1A 3EJYC 1L6XA 5DMIL 1A7RH 3HI6L 1T5XB 4R9HA 4P9HC 3EO9L 1S7XB 1H5BC 4UQ2A 1UCBL 1P6FA 5F3HA 5DRXB 3GJFH 5LAXA 4E42A 5C2UB 1UWXH 4HC1H 1JI2A 1IC1A 1ZV5A 2AJVL 1MLBA 2AGJL 4KRPC 4YPGA 1T5WA 4HWEL 5HPOA 5KN5B 4OAWA 1KNOA 1MFCH 3SQBA 4HHAB 1TQBB 2NTSP 5EZJB 5F9OH 1KEML 5IUSA 5JW4M 2FBJL 4XWOD 4LSUH 2DM3A 1K8DB 4LU5H 4S1QH 5GS0C 3PWPE 4ODVL 5T1KD 4YHLL 4X9GA 4MNQD 1OGAE 1CLYH 1OB1B 3QFJA 4MVBC 4V1DB 5EOQL 3RGHA 1MI5B 3D25B 1EJOL 4U31A 1VPOH 1HDMB 4JM2F 1AO7D 3P0VL 3S34H 4P5TD 3HE7C 3TT3L 4L3AA 3GMPB 3K1DA 1GPOH 4R4FL 3I9GH 1MRCL 3TLRA 2AABL 4FQIH 4WY7H 2B1HH 3VH8G 3L7EA 1MUJA 5T3ZH 4PGCA 2ZSVB 1I7ZA 2BY0A 2DQFB 4NQCB 5L2KD 4NQDB 1QBAA 3CH8A 4HJJL 2HVJB 4CW1A 5KW9H 2YD8A 4P4KC 5EFIB 4QHUA 4TPRH 1BAFH 5JW5B 2R0KH 5CILL 4RQQA 3RZCD 1WBXA 1Q1JL 1GOHA 3QWOB 3QIWD 4JPVH 2HG5A 4U1LA 4KDTA 1H3UA 2I07A 2A2QT 3G9VA 3L3KB 2APBA 4QWWC 2DJSA 4HUUA 3O6FC 4M00A 1VENA 4O9HH 4KGJA 4NNPH 2E27H 1DEDA 3VJ6A 3RL1B 1ZHKB 1LO3L 3WS6A 4F57H 3GHBH 3BT2L 1EEYB 3O3UN 1FYTD 3CPLA 4UQ3A 4KKCC 3P4OB 1UA6L 1LVEA 4NQEA 3NCCB 5TQ2H 2ZUXA 2EC9U 4AJ0A 5CZKA 3J7HA 5E5UB 4OZHB 4Y1AE 4GBXC 5KANI 3QNXA 5TE6L 4YBQC 1AE6L 2F74A 4IS6B 1CGSH 5TJWK 1D5BA 2R2BA 3ULUH 4BSVB 2VO5A 4MXQC 3SDCA 3VGGA 1KXVC 4X7DC 3ZT6A 2XZZA 3RI5F 3DGCR 3VFPB 1UACH 5HYQA 4QRPE 1NC4D 5FKAA 3S4SB 2GCYA 2B4CL 3BKYH 3I50H 4LGPB 5D96B 4CU6A 3DO7B 5IJVB 1G0YR 3D87B 1RZKC 1QYGL 5FYJE 5EOTB 2CLRB 4R97C 4FQ2H 3LN5A 3S97C 4FNLH 1IKFL 2ZCKH 4URTB 4NN5B 3VA6A 4ODTL 1YNTA 4ZXBB 4OM1H 5L7XL 5FO9A 3GBNL 1LK2B 3PWJB 3GKWL 5TGBA 1NBVH 3WO4B 5DJAB 2V17H 4YC2B 4QT5A 3M8OL 2DI7A 3FB5A 3C5SB 5EPMB 3BQUD 4YFEA 1V7NL 3G5ZB 5ACZB 4N0CC 5JXAH 1UZ8A 1K6QL 2C3XA 5IJKC 5DEFA 2H2PD 3PQYB 3GJFA 2CK2A 4S1RL 1N7MH 4HC1A 1PZUB 1CYGA 43CAA 2MJWA 5I1KL 1WCQA 2NY0C 1CFVL 4P23D 5I2IA 2QTEA 3VFMA 2F53A 4U6VL 1OL0A 3F6IA 1ZT1A 4RAVA 2JELL 4GXVH 4OLWL 1CFTA 2MKLC 1MAJA 3PHQB 4LRIA 2BVTA 2DYPA 5MEPA 5C0DA 3V5DA 5JPMA 4YNYB 5DD1L 4NGHL 4O2FA 5GHWH 1P7HL 5FO7B 5CD3A 1AR1C 1EO8H 4WI2A 4JZJB 4QY8B 4FQCH 3QFJE 1VEMA 3OSKA 4XNXL 3FN0L 4O5LH 1LO5A 2C9AA 2G60H 2ITCB 1KJ2L 2A6JA 1A6VL 1KC5H 4ONHB 3VE0B 5E4EB 4DCQA 5DUPH 1CDCA 4JO3H 3CDGA 3DHMA 3I6GB 2A6KA 1I1AB 5GGVY 1WJ3A 4PJEF 3T8XA 4QRRA 3IJSA 3V4PL 2GJZA 4XAKD 5LGHH 4LSTH 5FUZL 5FK9A 1IVLA 4ONOA 3BRGC 3DIFA 2VE6A 4G8IB 2X4SB 1KT2B 5CBAB 3NCBB 4BSJA 2X7LB 4EXPX 3RWEA 4NM8L 2XICA 4J2XA 2EDNA 1JF1A 4QXGH 1MAML 3DV6A 5DHYA 2NY1D 1G7LA 1CF8L 3MV8B 2UY6A 4JGJA 3SCMA 4OI8A 5JO5B 4ERSH 3BPNB 1UB5B 2PTTB 4U1NA 2RQ8A 1CTNA 5F1KC 5F7NC 4YFLF 4JFZL 4R7DA 4OGAC 4HEPG 5ABDE 1WCBA 1FL5B 3QNZB 3SDDC 5CJOL 4WTWA 2JIXB 5C3LD 1RHFA 3HRZB 4NQEE 5E2WH 2ENSA 4LCWA 4P3CH 4JHBA 3QYCA 1MQ8A 5C0NC 3F7PC 1AGFB 2CRIA 3VFRB 3SO3C 3UYOD 1S8DA 5EZIL 5TDPA 4P5KB 5SWZA 3EGSB 2A6IB 2VN4A 4K2UH 2DQTH 1VGEL 1JNNL 2CIIB 2QQQA 3F65A 4F7CA 4HFWB 4LNVA 1T7ZA 5DURB 1PLGH 2IJ0C 1VFUA 1S78D 1GZQA 1ZEAL 5J06A 1VFMA 3ZT7A 5HHOA 4RGND 4XP9L 1L9NA 2FX8H 6FABH 4YEEA 3HE6A 4G80B 4YHKL 4F15B 3RUGB 2CGRL 1U8HA 2NY4C 3LKPB 4GMSL 4Y0GA 2JCCA 2XT1B 1MY5A 3PABB 4J6RL 1U3HD 4ZPVA 2AKRA 4FN0A 3C5ZD 5HVFB 3DLQR 2ICWI 3F12B 1A6ZB 2ICWJ 1OF2A 5F7YC 5D72H 1NKOA 1N2RA 2JE8A 5T5NF 1D6VL 3SDAB 4WUUD 1YEKL 4I18C 1C1EL 5HD8D 1UWXK 1HXYA 2FATH 2YPVH 3MUHL 4GG8A 4U7KA 3LQAL 3MFFA 1HEZB 2EH7H 3LIZH 1DLFH 1QLEH 2BDNL 4X98B 1BX2A 5EA0L 4IOSD 1L4IA 3ARWA 5EO9A 4YWGL 2IBBA 1K8IA 3W9EB 5GGTL 2Y36H 1BIHA 3D69A 1Q9LB 5A16B 3QI9C 1D9KC 1X5JA 2F53E 4NCDA 2BSRB 4UT7H 2EDEA 2HMID 4KRMB 2YBRB 3ARBC 5DMGD 3MGOA 3WDIA 5DJYA 1PY9A 5INCA 4P2OA 3K2UL 4JFFA 4FMFA 3SO5A 2V5YA 4IMLA 1UM6H 2OR9L 4G6FB 5EIVA 1FSKB 3HPJA 3N1FC 5D1QB 3ECBB 4YR6B 3BPLB 4UNTA 1EGJH 4O4YH 5BV7L 5CBEA 2W38A 1L0YA 1DUYB 2BVOA 1T0MA 1BF2A 3FN9A 3QUMH 4P3WA 1BM3L 1B3JA 3W0WB 2AJSL 2FL5B 1H8SA 2XWBA 1HWHB 2UZIH 5ID1B 5J0BA 1ROWA 4PY7A 3IETA 4XBPA 2V9TA 2AJXH 3MRFB 1XCQB 2IPTL 4NO0B 4QRRE 5EUOB 5BRZD 3X11B 4IJ3B 5IW1B 2EYRA 5KS9B 4JPWH 3BIKA 1I9IH 5CSBA 3QDJE 4JY6B 5EBLB 1FAIH 4XGZB 4MD4A 4HS8H 4JM4L 1H15B 1EFXD 3FTGA 4Z76A 3F7VB 3RAJL 35C8L 2V2XA 2UVEA 1WBYA 3FFDA 2ZUVA 1UH4A 4PJIB 3BD5A 1CG9A 1Z9LA 2QR0A 1T2QH 4MNGB 5JORB 5IW6A 3EYQD 3RDTA 3ZL4H 2C7UA 4KK6C 3HMWL 1QKZL 4HD9A 4L3ED 2PCPA 3BX7C 4K8RD 5DVOA 4RDQG 1MJUH 1RZJL 1IQDA 4FZEH 4WU5B 1Y6MR 4G9FD 4YE4L 4WDIB 3CU1A 4PIRF 3W82A 1KTDA 4LCWE 4J1UA 3T77B 4AIZA 3RKPA 2P8LB 1QNZH 3LEYL 3O11A 1JUFB 3CDCA 3ULUE 5SWZE 1DSFH 4FP8H 3O2DH 1F4WH 3SGJC 1JTTA 1CD0A 4HKXB 2B4CC 5JDSB 1SYVB 3RWCA 1JCKA 3LKRB 3HFMH 3DRQB 2ESVD 5FECA 1FV1A 4K94C 1BJ1H 5JIHA 3VXUE 1RAMA 2V7NA 3WFCL 5HHOE 2WMPA 3EOTL 1FCGA 2P7TA 2VDQH 1N0XL 3EJYD 1LEIA 1JWMA 3VG0H 5KTEL 3MJ7B 3UJIH 1XGRA 1FNHA 2P49B 3QCUL 5DK2B 2ARJB 4WJ5B 1KJ3H 3F58H 4NPYB 2WBWB 5FUOH 5I1DA 1FYHB 4E9LA 2DRUA 2JCCE 1A6TB 3DXAD 3SJVA 1MHHB 2IFFH 4KRPD 3DURA 1XMWA 4AZ8A 1OTUC 1J8HD 1FLRH 1UWGH 3SOBL 1K4DB 3EYVB 3BP5A 3QUXA 2GI7A 1JPFB 3OF6A 4Q9BA 3WIFB 3P4LA 3KYKL 4MCYB 4HZLB 1JPTH 1A1MB 2B0SL 1U8QB 4KMQA 2NNAA 3Q1SL 1MJJB 2DL2A 25C8L 5GS0D 3MV01 3ULSB 1OP3H 3PGDA 2Z31B 1BWMA 4MVBD 2Y7QA 3D0VA 2H26B 3U9PH 2UUDH 3T04D 4NJAL 1U6AL 3L3IB 4YK4B 3HE7D 5E70A 1EX0A 1OAQL 3B8YA 3LZFH 1KB5H 2IALA 1N64H 2ZUUA 4YGAB 2VR4A 3ZT5A 4L8BA 3GSWB 1UFUA 3ARSA 3TBTB 4XVJL 4JFFE 4R7NA 3Q48A 4N0UB 3MRPB 4P4KD 4LLMA 1EGJA 1I8KB 1T1XB 5DVLA 3BAEH 3QUMA 2NY5H 2C1OB 1IEBB 3MRIA 2D7MA 4OZGF 4PJFF 2DTMH 3GSVB 5I15L 4FFWC 2Q86A 1MFNA 5BCAA 3NTCL 4QWWD 3THML 3O6FD 3ZHKA 2JJUA 4RMWA 1E4KC 5C9JA 3H7LA 3O6LL 3F5WA 1HKLH 2BNQD 4L29B 2ZUYA 1CLZH 5IQ9A 1WZKA 1KBGH 4M6ML 1M05B 1FGNL 2QHLA 1JF6A 4KKCD 1QSFD 1U92B 5I8EB 4M5YH 12E8H 3Q3GA 1VHPA 1XGYL 5I75C 4RA0C 4O58H 4GBXD 4P49A 3T4AB 4LFHG 5ECJE 5BOPA 1NEZA 3HC0B 3GO1L 2A73A 1T0NA 1B2WH 1R3IH 2HVKB 4YBQD 4F9PC 3FCTB 5AAWA 1CFBA 3VFVA 1EEZA 4ODXA 3IU3B 3MRLB 4GMTH 5J7CC 5DJCB 2D0FA 4PPTA 1WAAE 1F90L 5FF6B 1KCUL 3TN0C 4XPAL 3U1SL 1PSKH 4KXZH 2VRAA 4MXQD 1SBSL 1ZS8A 4XCCL 5IW3A 5C0AE 4E5XA 1EMTH 2ZWLT 4G8EA 4XCNB 5DJ0B 4FFZH 2OQJA 2F53D 1C5CL 2J4WH 4GW4A 4LSPH 2P46B 4MAUH 2ZJSH 5DFVC 2BHZA 1A3RL 1U36A 2DQJL 5C0IA 2ZPKH 4UT9H 4I3SL 1NCWL 4JHZA 4P2RA 3HMXL 3TBVB 5LJYH 3U83A 1BD2B 1S7UB 2HJLB 1MFBH 2HA1A 3WLBA 3IU4H 3O2DA 2WUBL 1FZMB 4K7PY 4AIOA 1X9QA 3MRHB 5J12C 1N59B 4JDZB 1RIUH 2EXYC 1T0PB 5T1DH 1W0YT 2O5XH 1E4KA 1YN7B 2A9MH 1P1ZA 4EEEA 3S7GA 3EO0B 1N5AB 1A4JA 1KCRH 4KAQH 5D7SL 1HSBB 2Y06L 3QG7L 4J4PC 4OV6F 1OAYL 5B3JF 5MERA 3P9WB 1ZLSL 4HGMA 3WFDL 4D3CH 5T3ZD 4ESKA 3GMQA 4ONFL 1V3LA 4NQTA 3BESR 1U8KB 4MA7H 2B7DT 2JTDA 4U1KA 1J11A 4N0CD 1ETZA 1P53A 5K93A 1NCBL 4MJ6B 4LASH 5GRZA 5I1HH 4G5ZH 4IMKA 5DD5L 5D6CB 3K1KC 5GISH 1RK1B 1L7IL 3QDJD 3I75B 5FHAH 2HFEA 4L8SC 4KVNL 4ZFFB 1JK8A 2NY0D 3NFPB 1CGXA 3KNBB 4XBGB 4MZ2A 1LE5B 5FHBL 2XPGA 4M62L 1U3YA 1BZ7B 3SJVE 4TQEH 5I16B 1PBYA 4L9LA 4EUPA 3OKOB 4X6CF 4FQXC 5CZVH 2YMXL 4JAMA 1N8ZB 2I9LA 5CJBA 2MWCA 1NGYA 5DHXB 3DX9B 1IAOB 1TZIB 3LQAC 5A40E 4DGYH 5HHME 4UDTA 3C6LC 4V2BA 4TVPH 4UIMA 3SE4A 5EZLB 4UDUA 2XXCB 1LWRA 1MJ7H 3NA4A 4ZTPL 5MEQA 4TNVF 5DTFB 3UPAA 4U0QB 4EXKA 1I3GL 1A3LH 1S9WB 2FJFB 5JOPD 2VIRB 1NCAH 3F62A 1NDGB 1QZ1A 1KB5A 3ARGB 3BMWA 1AIFA 1OAXH 2C3VA 5DC0A 1HINL 2AJUH 3MJ8B 1FFPA 3PJSB 3WSQL 2BMKA 1KFAL 4F33B 5BV7C 3VXUD 4J12A 1DLHB 2OXHA 2ORBH 2F19L 3MV7D 4DN4H 4WCYL 5B8CA 1R5WA 3BN3B 1AGDA 2Q3ZA 5GGRB 2WWKT 3TP4A 3WHXA 2J8OA 3RGVC 4KHXH 2OJZL 4OZFG 5TF1L 3WKMH 5E08L 3GIZL 4HKZB 1FC2D 2QSQA 4LSRH 5BQ7A 3P9LA 4M6NL 2IQ9H 3MRJA 3R0MA 3U48A 3MMEB 1DFBL 1WBZA 3OR6A 3QO0B 4PV9A 5KOMC 2VDLL 3WIIL 4ZUVB 4OGAD 5HSFA 2VL5B 1AY1L 3SDDD 3FQTB 3TBYB 4JKKA 4LCCC 3EYSH 4NT6B 5SX5H 1MHEB 1OD9A 3OPZL 1C5DB 5ALCH 5C0ND 4BYHA 4AMKL 3HLAA 5I6XC 2P42B 2XA3A 3R06B 3T2QA 4YHZH 1EIBA 1OPGH 1X5HA 1H3WM 4XNYL 2V7HB 4GKSA 5EUKB 4GS7B 5D2LA 1YEJH 7CGTA 2RIKA 5DMKA 1MELA 1W72B 1LO0L 3RKDC 3HZKB 4WW2A 4X83A 1AI1H 2NY3C 1RZJC 5CWSB 2X4RB 4G6ML 2IPUK 5HXMA 5TH2A 4K3JH 4G8GD 3I2CL 1LK3L 3WNOA 4XX1G 5J13C 3VXNB 4P2RE 4RRPG 4KMLB 2OK0L 2H6PA 4N8CH 2NY4D 3AY4A 4JFEB 2VLJE 4G6AC 5B39A 3NPSB 2VTFA 4Y19D 5IFHL 2Z0BA 3UROR 4NOBA 3QB7C 2R23B 2IAMB 2IF7A 3BDYH 4NKOB 1ZK9A 1CZ8H 2M26A 3IYLW 4GLRH 5I1AB 2N4IA 2DD8H 3MRBA 3QCVL 4PD4J 3UTZB 1VFBB 3MRMA 3HAEA 4PG9A 4GUPB 1H0DB 2CKBL 2P5WB 3V6ZB 4YO0A 4OF5A 5GSVA 3FRPG 2VKXA 1QTYT 4I2XB 4X6BA 4QEGA 3IKCA 1DVFA 1X6LA 3BI9X 4TSAH 3WS3B 4YDJB 4KKLC 5KSAC 4ZNCD 1S9VB 4JFDB 3B9KC 4JM2B 2Y9RT 3LB6C 3V5HB 4XNQB 4JG0H 3LD8C 2V6HA 4EKXA 4YHPA 1C12A 1WFNA 5FM5M 4XXCC 3BW9B 1JNJA 3DX8B 1AD9B 2AVGA 4ODUA 4XTRC 3SE3A 3QI9D 1D9KD 1IC7L 4PRBB 4OZIA 1KN4L 2Y5TB 5C0AD 1CFNB 5CD5C 1DQDL 3ARBD 4KU1A 4UUJA 2ATKA 1QFPA 1S9YA 5EG6C 1X5AA 1BZ9B 5B38B 1CFSB 2IG2L 4NNYA 4TUOA 2NXZB 4DKFH 2UUDK 5F8RC 4QHMB 4TSCL 3O4OB 4HGWA 4D8PA 4Y16C 4G42A 5D1ZC 2AV7A 3FOLA 4I3RH 1MNUH 3C60A 3D85B 4PRHD 4EN3B 5LQBH 2GK0A 3QZWB 4P46A 1RULL 4W70A 3OKKB 2X4NB 5E8EA 3ILPB 4H20H 1BEYL 2DL9A 3DUHA 4Z5RB 1EJ6A 3LRHA 4G7YH 5JQHC 3MRKA 1TTFA 5GJSL 5HHPB 3VI3E 4P9ML 4YZFE 4IRSC 4EDWH 2GY7B 5F9JB 1JZ3A 2IADA 3OHXA 3VWJA 1HIML 4XCYB 1NCDL 2A74B 2DQGL 2OSLA 4OLYL 4BSWA 4H26B 3RWIA 2CRZA 4NKQB 4MDJA 4JO1H 4TUKH 1VB9A 4GRLB 4XAWL 2AP2A 3SJVD 4Q2ZB 4ZS6C 3RNKA 1U8JB 1MEXL 4HUVA 2WZPD 1UYWH 2JB6A 4LKCB 1MFEL 4E41B 1MCPH 4KK6D 4X0KB 2GIYA 1MFDL 2AK4B 3IXAB 1TQBC 3SDYH 5IQ7L 3FQXA 3MROB 3U7WL 1C5BL 1KJMB 3HNVL 4HDIB 1V5JA 4WO4B 5C07A 5HGDA 5C92A 4FQ1H 4GG6A 1CBVL 4RMQA 1CXLA 3OB8A 2EDFA 1EBAA 3WN5A 1G0XA 5IKCB 2FHFA 4JFQB 4ACPA 2V5SA 3ARFA 1JFQH 5DD0L 5D2LE 1H8NA 1D5MA 2A6DA 4L8CA 4FQHB 3PUCA 1ZWIB 1U8NB 5E6YA 3X17A 4F2MA 4XRCA 4M3JA 2LFGA 5J9PA 4MA1C 1JGLL 2YUWA 4ZPTA 4ZODA 4MGXA 4M7ZB 4MMXC 4M5ZL 3V5KA 4OLUH 4JANB 1G7MA 5CJ8A 3FONB 3OKLB 3GKZA 2LABA 1T5XA 1UB6A 4DWHA 1FZJB 5JXEC 5I8OH 4U6YB 3WNLA 1RZIB 4ZUSB 5ESAA 1JHLH 4NRYB 2LV4A 1VESA 5E7FA 4N9GA 1OTUD 2BP3A 5GGSA 3TC9A 3FO1B 1E6OH 5KN5A 3IT8D 3TJEL 5LXGH 1IEAA 4CVWA 1KENH 3S36X 3STZB 2IANE 3JV0A 4JDTH 3UJJH 4CVXB 2VNCA 1K8DA 1XCTA 1HHKA 3ARQA 3WL9B 4GAFB 4V1DA 1OB1A 3TYFB 1Z5LB 2XTJE 4HUWB 1M7XA 2FYYB 3B9AA 2CLVA 1MI5A 2HN7B 3D25A 1IAMA 2J8HA 2YKLH 1RUAL 3MYJB 4M7KH 2F15A 1KTRL 1S7RA 3KJ4B 5E2TL 3GMPA 5DJ6A 4PJXB 1NGXA 3MCG1 2AEQH 1XT5A 1U0QA 4QF1B 3VXPB 1WEJL 2XWTB 1XGQB 4NQDA 4ZFGH 3QSKB 1AGBA 1QG3A 4U1IA 5EFIA 2AK1L 4TVPE 4PGBB 3FRUB 5JW5A 1NUGA 3NACH 4OZ4A 1TCRB 5KVDH 5IBLC 3V52L 3CX5J 2X9XA 3QWOA 1LQSR 2VLJD 3FQWB 1RUKL 4J3WA 3LQMA 1E6JL 4NN5C 3K8LA 5E5RB 3VG9B 3ZE0E 5C1MB 4PJBE 4ZXBC 3WYRA 4FFWD 4UB0H 3L3KA 4ZTOH 3BEVB 3C08H 3DWTA 4Z0BH 4ZFZB 3GNML 1N5YH 3RL1A 1ZHKA 5GIRB 4KTEH 3T09A 2DMCA 3MGTB 4YC2C 1OAZH 1SMOA 4OUUB 2H3NA 1OAKL 3P4OA 2EH8H 1IQWH 3SE8H 3B5GA 1EUTA 2UYLB 1SJHB 3SPVB 5F3BB 2AERT 4PBXA 2Z92A 1T1WA 3HCVA 3S37X 4OFVA 4OZHA 1IRAY 4U1MB 1Q9WB 4D9QE 4YXLL 4EBQL 1QUNA 3MLZL 2NX5A 1WFOA 3CK0H 3AAZA 4ZFOB 1OSZB 4J3VA 1JHKL 4IS6A 4FABL 1A7QL 3BD3A 1UC6A 5IEKA 3IJHA 1HILB 3TN0D 3NBNA 3GJEA 2D7TL 4WHTB 2OR8A 3GSOA 1FVDA 1IFHL 5H37G 4G3YL 2XG4A 3LRGA 4GRWE 1JRHL 5KVEH 4NWUL 3CVIH 3O6MH 3S4SA 1MCWW 4J3SA 1KTKE 4B53A 1FORL 4HWZA 5DFVD 5SX5K 3BJ91 5HTSA 2VLKB 5TE4L 3G6AB 3UTPD 5EU6A 1JGDA 2CLRA 2BJMH 4YHOL 4AH2B 2EIBA 4GG6E 3LS5H 4JZJC 1NMAH 1A1OA 3NH7L 1U3ZA 5F88B 3QWRD 4NJ9H 3OMZA 4NZTH 3S5LG 1BFTA 1JGEB 2AXFB 5JIIA 3ZYOA 2EXYD 1BQLL 3O6KH 2F8VA 1B0GB 5E4EC 3PWJA 1IMHC 5CEZL 4OGYL 3HC3L 4J4PD 5ELIA 4MJIA 4OM0H 4R8WH 4RCAA 4QRTA 1I1AC 4I9WE 1U41A 3C5SA 2A9NH 4YGVB 1MHPH 1QFWH 2RFXA 3G5ZA 4LHUD 2Y07L 5ACZA 5A1AA 3QULA 5DWUH 3P77A 1U8OB 2CR3A 4J7RA 4PD4K 3PQYA 1UKQA 4AIXA 1A6WH 4LSVL 3QQ4A 4WU7A 4X8JB 1JMZA 4DKEH 1F3DJ 2OL3A 3WFEL 1AHWA 3UP1A 4MCZB 2GJ6B 4KZDL 4Y4KC 4NUGL 1GOFA 4F3FA 3MPCA 2OM5A 3BPNC 4OFPA 4FQXD 5C0RH 5CSZB 3NZHH 2O61A 4YNYA 5HI4D 3ULUF 5JHLH 3ABZA 4JDVA 5C6TL 2B1AH 2AEPL 2QSTA 3C6LD 3ME0A 4V1DE 2VXUL 1CR9L 4LCIL 2YZ1A 4YXHL 3IVKA 1V05A 3QDGB 5EC1B 1OGTA 4PREA 4ONHA 1MI5E 3DX6B 4HUMB 4UIKH 1YEEL 4ZD3H 1AQKL 4TTDC 4PJ8B 1EAPB 1E4WL 4NZUH 1NAKH 1P7KA 4FXKB 8FABB 4MQ7B 1CU4H 1KLGB 5JHDD 1TPXB 2AJYH 1H9VA 4NQDE 3X12B 5ICXA 2JCCF 5DZLA 4G8IA 1KT2A 1Q9OB 1FVEB 15C8L 3RGVD 3QWQB 2V5TA 4XNUH 4F15C 4Z78B 2GSIB 1BJMA 5FYLD 5HHNB 1IC5L 4X99B 3UYRH 3A6CL 1YQ2A 1MCLA 5DJDA 4C4KT 3UTSB 3D3VB 1PDKA 1RUMH 2G9HB 4HFUL 4NO5A 3HPLA 3OTTA 3OKMB 5EU7C 2F58H 4K71C 1R0AH 1MQKL 4H8WH 5A2FA 4WEBL 1JGUH 2VLRA 1MY7A 3T65B 4L4VD 2IAND 1LD9A 4I4WA 2HFGH 4OIIL 2GTZB 3WE6B 2KDGA 3NCMA 1ACYH 4OZHE 4LLWB 1W8NA 3VFRA 1XFPA 1N4XL 4GXUN 5J56B 2NX5E 2MPAL 4M7JL 1UXWA 3MJ6A 3QH3B 5KBNC 5T5NG 3RKDD 2YPKB 4G7VH 4QXWA 3FKUS 4ZG1A 2JJTC 2NY3D 1F4YH 1A4KB 4HIJB 3LMJL 1WSST 3P73B 3MREA 3BKMH 1MHCA 1JZ2A 2PW1B 3V8OA 1UH3A 2Y1VA 4FQJL 1I4FB 5HHVL 4RWYH 2NTFB 2QQNL 2H9GB 3UBXB 3PDDA 1FSKC 1RZFL 3GRWL 4P2QD 5F1NA 2PW2A 1IE5A 3KPMA 4G6AD 5CCKH 1RFDL 4JB9L 3BPLC 3RWHB 3D2UD 1CDUA 4CMMB 1AQDA 3EFDH 3QIBA 3N85L 1PQZB 3ETBF 5EZOH 3CFKA 4KUZH 1A6ZA 1PJ9A 2FBJH 4DGVL 2Y6SC 1HYSC 3PP4H 3DV4B 3K4DA 1E4XH 1T7WA 4MJIE 2ED7A 3H9ZA 2YUVA 3CLEH 4JQIL 3T0EC 3HZYB 3SDAA 1WQVT 3BOVA 1GGCH 4KKLD 4OLZL 5KSAD 3CSYB 4OT1L 1WAAF 3BEWB 4NN7B 1KLFA 4JEGB 4IJ3C 1MCJA 3B9KD 3LB6D 4LSQH 2VABA 3LKNB 4Q6IB 1ADQH 3PQYE 2DIBA 4O51A 4R4FH 1AXTL 2BSSA 5DF0A 4JPIB 7FABH 3L7FA 5A2JH 2YA1A 3QDMD 2X41A 3QUYB 2LAGB 3W9EA 1JRHI 4XTRD 5ADPH 2YN5A 2BSRA 2X5PA 3S88L 5CD5D 2YBRA 4H8WC 3CMOH 3LS4L 2DI8A 3T1FB 1N3NB 1MVFA 5D9SA 1B0RB 4HK0A 3KLSA 1IAIH 4C56B 2V9QA 1MOEA 1T3FA 4K7FA 2RCSH 1NC2A 2R29L 3ARDA 5D1QA 3H42H 2CUHA 4FTVB 4Y16D 3O3BB 5D1ZD 1JBJA 4PLJC 1DUYA 3SKMA 5EWIL 3W0WA 2FL5A 1FRGH 4X6DB 3Q6FA 3FAXA 2GFBA 4PJDA 3E8UL 4OQTA 4PRNA 2CDFB 4NO0A 1KCSL 2OXGA 1M6OA 3WLWC 4IRSD 4CU7A 5ERWB 3X11A 3LV3B 3MRDA 4NSKB 2P48B 4AEIL 5IIEA 1XGPA 3KJ6L 1M4KA 4JY6A 2R0LL 2CSPA 5DVMA 3KPOA 2O93L 4U2YA 1MIEL 3E6HA 4QXUH 2DJ4A 5FAAA 2Q6WA 4PJIA 2OTUB 2ZUQB 1BP3B 5DSCA 1UM4L 1DBKH 1WLHA 5JORA 4NUJB 1R3HB 4ZS6D 3RVVC 3QEQA 4H1LA 3P0GB 5A3IC 2APWA 2PETA 4XPGH 4GKNB 5I73B 3OX8B 2VLRE 3CZFB 3LKOB 5DFTA 5MP6H 3P4MB 2K9UA 1BVZA 1FNGB 3GUTA 2A38A 4NKIH 5K9KB 4MNHA 2V2WB 3UZVB 5TF0A 1JUFA 5IROC 5AZ2L 4BQBA 3EOYG 1OP9A 1W0WB 3O4LD 2XRAL 4JG1L 2CUMA 3QQ9C 2YWZA 5JDSA 2PYFB 5HDQH 1G6RB 3LKRA 3SGDI 3CFIC 5IT2H 1FAKT 1E27B 1SEQL 2MKWA 3R1GH 5E6IB 2VISB 3RIAK 3RX5A 4TSBL 4YAQB 5TFSL 4PJ5A 4NQCD 4D0DA 2NYYC 3LHPH 1IGTA 4BZ1L 1LEKA 1GIGH 4XC3H 4ZNEA 2FB4H 4Y8DC 4Y2DB 5BS0B 2ARJA 3TA3B 3ZE2F 5JXED 4NPYA 4KC3B 5CJXA 4X6CB 4DAGH 3DJ9A 2UZXB 4DZ8B 4OLWH 3QXDB 5HGHA 1S7VA 1MCHA 1KPUA 1MFAL 1K4DA 1ZANH 1A7BA 5FYJU 3WIFA 1BQHB 4K3HA 4DUVA 4HZLA 5DJ2B 4PJHA 3W2DL 1A0QH 3G5YB 4WUKL 1U8QA 3LN9A 5D7LD 3FN0H 2R56L 4MD0A 1EO7A 1IC4L 1ZGLB 3ULSA 4PRPD 2Z31A 4JFHD 1NBZA 1RI8A 5CUSH 2X4TA 1WVZA 3AREB 1CIDA 3OAYK 2GTWB 1MSPA 1PZ5A 4ORGA 1QLRB 2NY2B 5L8JB 2H26A 1B90A 4YIQB 4LEOB 1EXUA 1YMHB 5C2BH 2ADJB 3LPWA 1AGEA 1IT9L 4IBLT 1DQJA 3TIDB 3TO4B 2CPCA 3HNTL 3GSWA 4OB5H 1KOAA 3OGCB 4R0LC 3L3HB 1RSFA 1LP9B 1YYML 4N0UA 3S35H 1FC1A 2FLBT 3GB7B 5HYJD 1Q0XH 4APQB 5IBLD 2GYSA 2FEEL 1PG7X 5DDHB 3S8WA 3TCLB 1IEBA 1UKTA 2ICWA 5E9DB 1KGCD 3S36L 2A1WH 4IHOA 4ZXBD 2BVQB 3GSVA 3W0WE 1U8LB 5C0CB 4LEXL 5DQDH 3DUUB 4PJDE 5HJ3A 5E2UL 3TEUA 3LDBB 5GJTL 5T1LB 4L29A 4OJFL 3RRQA 2R4RH 2WBJB 3T2NL 1M05A 2F54D 4NBXB 1VKXB 3ARZA 2B2XL 4WFED 3HUJB 4M8VA 3ZHLA 5ETUB 2PXYA 3MLUH 5L0QC 5KS9E 5EU4B 4HF5L 3ZHDA 3T4AA 3OJ2C 3IDUA 3ZTJH 3FCTA 2BSTA 3IU3A 3MRLA 4N8VG 5C6WH 5DJCA 3W5NA 1ZEAH 5FA4A 4PJIE 3GSRB 1W72H 2GJJA 4XP4H 1GZPB 4PYGA 3JZ7A 5CHNB 4D0CB 2FX9L 3PDOA 5DJ0A 1FHGA 1Y0LB 3QEQE 3QIUB 2DS4A 4HGKC 2G5RA 1OQXA 1YEGL 4I48B 5CJQL 2FJHA 4HBCL 1P6AB 4PS4L 1G7HB 4K7PH 2OI9B 3OR7B 1CDGA 1J05B 3QHZH 5HDOA 1BD2A 2AJZA 1S7UA 5IG7B 3BE1H 5GS3A 1TZGL 4IOIB 3ARVA 3VFOB 4GXUM 2I9TB 5IB5B 1FZMA 2CKNA 3MRHA 4HUNB 4JDZA 4NCC1 4LMQI 3DHJA 2D9QB 1IGCH 3VI3F 3VXMD 5I9QC 4YZFF 1YN7A 1X5GA 5LWYH 3EO0A 1N5AA 3EYUL 3NOIA 3S37L 2I60L 4NZJA 3ARGC 3KPNB 1TDQA 1AJ7L 1I1AD 5H35B 2HT3C 4HIEB 4Z6AT 4UNVA 4RGMB 2BFVL 3GI8L 3U36A 1GGIL 1UKSA 1T04B 2EDTA 3H9YA 4PJ5E 5AZEL 4MJ6A 3CJJA 5T33L 1U8PB 4YBLB 3U0WL 3WJJA 4CVZA 1GAFL 5I30L 1FNSH 4ZNEE 4IDJH 3TO2B 4R3SA 4NBYB 1RK1A 3VD4A 1MRDL 4OD3L 5GGTH 1N6UA 1CICB 4ZFFA 1OQOA 3TV3H 4XBGA 3GSNB 1LE5A 4K9EH 4XPFH 1BZ7A 4Y4KD 3DBXB 2P24A 3MV8D 2XOTA 4QOKA 2X1XR 5J89A 1E4JA 1HNGA 2E5EA 1HHJB 3ARRA 5SWSA 1N8ZA 2HLAA 4PJHE 5AWNL 4GAGH 2E9BA 3TGXA 1TZIA 2VDPL 4Z77B 4ONGH 2D31B 2MOVA 3EKCA 1BVKA 5CINL 5D2LF 2JIXD 4LSSL 5EZLA 5CLTA 3O8XC 2E8ZA 2WIIA 1IARB 5DTFA 3BFOA 3LOWA 4WW2F 4X4ZA 2FJFA 4DQOH 3C8DA 1QR1B 3BIAX 5KVGL 4B50A 1EZVX 4TTDD 4D9RE 1NDGA 3I85A 5GGQL 2EO9A 2FX7H 5DR5H 5F3HB 1YMMD 1YC7A 1DUZA 2XKNA 3PJSA 1I9JL 4N0YL 4YPGB 4N5UA 1DLHA 4F7MA 4UV4H 4N0UE 1KNOB 2ADIB 3INUH 5GGRA 3MO1A 1W0VA 1VADB 4LLYA 4UZGA 5SWQA 3ZDXE 2J88L 3BPOB 5HGGS 4HKZA 2HRPH 3PL6B 3IJYA 4NIKB 1FO0L 5IM7B 4Y5YA 3MMEA 1K85A 3QO0A 4QHLA 3LAFA 5H94A 3STBA 2ZCHH 2OX5A 3O41A 4I77H 3V2AR 5K9OB 2HT4C 3RNQA 5I71B 3FO0L 1B4JH 2O5YL 4M1DH 1CDBA 3VWKA 4KQ3H 2YPLD 1KELL 2VDML 1MUJB