1NQBA

Trivalent antibody fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
VQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSSDIELTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0-A resolution crystal structure of a trimeric antibody fragment with noncognate VH-VL domain pairs shows a rearrangement of VH CDR3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords SINGLE-CHAIN ANTIBODY FRAGMENT
total genus 54
structure length 232
sequence length 232
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA02
25C8L 5I30H 3LH2L 1VERA 1BFVH 5D7IE 1NFDB 3UTTD 4PRPE 1LK3L 1VGKB 1WV7T 4ZNEE 2XWJB 4UAOB 4JFDB 1S7TA 2H32A 1O5DT 3AAZA 4ONFL 4YEEA 5CJQL 1FPTL 4AYFA 3IFOA 1LO2H 3NCFB 1YY8B 4UT9H 1P84J 3CDYA 5TDNA 3K2UH 1OCWH 1U8LB 3PE9A 3AM8C 1WGOA 1T5XB 2Z93A 4XX1E 3RY6A 1NFDE 4KKLD 3VD9A 4Y4FC 4AEIH 1DUYB 1QPXA 4KQ4L 4XMKL 1U3HA 2BNQB 3IFPB 4KZEH 3HMWH 3FQTA 3GMQA 3RGVC 4MD5B 3TPUA 2O5ZL 2Y5EA 2G9HB 3MJ9L 2J8UF 2ARJA 5DJ8A 4APQB 3ZDXF 1K4CB 3EO1B 4UV7H 1P4IL 4YR6A 1UVQA 3HTLX 3S7GA 3OF6D 4TUOB 5C08A 4NO5A 2DQUH 3WS3A 1HN1A 2Q8AH 4ONHB 4AENB 2D3VA 1CGWA 1LO4L 3B9KD 5DK0B 1OP3K 4ZOAA 2MPAH 1WISA 5IW3A 1CDCA 3PWUA 4PRPD 5JMRA 3QO1A 3GK8L 3CX5J 3DV4B 1KGCE 1L0YA 5FF6A 3G6JA 3UBXA 4X9FA 1J18A 1MVFA 1FFOB 1YC7A 2ILLA 4I3RL 2W65A 1S9XA 4OT1H 5E2TL 3RL2A 1CTNA 4XXCA 4O51A 2PYFB 3OKOA 4XCYB 1AO7B 3AY4A 3IDUA 2IBZX 1I8IB 1A3QA 4MA3B 4ETYA 5K9OB 3FT2A 1EK3A 3OB8A 1MIEH 1CLOH 1DLHB 4I18A 2OP4L 4EN3B 3PHSA 3DXAD 2BNRA 2K7PA 2VLKE 3LN5A 4IJ3B 5EU4B 3UTSA 4P4KC 5FB8A 2VC2H 3G5XB 3MJ7A 1AKJA 4O5LH 1JHTA 4N8PA 1INQA 5SWZB 2D7NA 4HPOH 2J5LC 3VI3E 1YEEH 4JKPL 2F54B 3GHEL 3WYRA 2M26A 4CAGA 4PLJC 1SJHB 3HB3C 4CVXB 5KSUB 4S1DD 3GSXB 1V7NL 5F6IC 5KZCB 1SHMA 1UCTA 2H45A 2BERA 4M7JH 5B38B 4POZC 5JA8B 1JZ2A 5ID0B 5KANG 1NDGB 3OKNB 1QG3A 3TJEL 1ZT1B 3O8XD 1IEAA 4EJ1C 3F12A 4IMLB 4ZG1A 1CN4A 4K71B 1XR9A 4RGNC 4RSVA 2DLIA 3K8MA 2IFGA 4LNVA 1D9KC 2XPGA 4RFEB 3T8XA 3VFGL 2NX5B 1KELL 4RMTA 4MA7L 4GRWE 1JF6A 3RWEA 1YEGH 1PG7L 2GJ6D 5FKPB 3FB8B 1A9EA 1TCMA 3I50H 3TBTB 3LQAL 4MJ6B 3M8OL 4H20H 4JFFA 5GGRY 2DYPD 4U6VL 1N5AB 4JFEA 2W07A 4N0UA 5D1QB 3JV5A 4OZGB 1E4WH 1TIUA 2LTQB 4OBSA 1P7QB 4L9LA 3LS5L 2E6PA 2WP3T 4QRUA 1LEKA 1A6TA 3U48A 1CLCA 3DJ9A 3V5DB 3D85D 1KPVA 5I1IH 4ONGL 4NM8H 1ITCA 4MMXC 4NN7C 2IQ9H 4FZ8H 1UC6A 2W9DL 1A4KB 1AP2A 2VDOH 4G42B 2AJYL 3WFHB 1AGBB 3GSWA 3MV8B 5SV4A 4DVRL 1R3KB 4JO3L 2X1XR 1AQKH 4L3EB 4BSVB 4G3YL 2Z31C 3GFUA 3QULB 4PJGF 4PJIF 3WSQL 1MLCA 1II4E 3IGAB 3QDMD 3T09A 1T6WA 2J8HA 4HKZB 5E2JA 4HKXA 1SJVA 3T77B 3UYOD 5FECA 2DLHA 2F9BT 4FABL 3Q6GH 4MQTB 5GGUA 4PJ8A 3CGTA 1KXVC 4FFZL 1AXTL 3X3FH 2E7LC 2NY1B 3MOQA 3O4LB 3OX8A 5I1JH 2BOCB 3LHPH 1A6UL 3U0TA 4DUXA 1T03L 4Q9QL 3G6DL 5GS1A 5ENWB 4P23A 5HGHB 1AGEB 3N1FC 3ZTJH 3CFCH 2VDNL 3HC0A 4ZYKB 3D48R 2P8PB 3CXHK 3QUXD 1A6ZB 2G75A 3GIZH 5CILL 2CUHA 1NAMH 1GGIH 1LD9B 1K8IA 4JZJA 3O4OC 5DUBA 3AXLA 1ZHNB 1P6FA 4U1MB 1AIFB 5DUMH 5HHMD 4FA8A 4MD0A 1QYGH 3UX9B 4Z7UE 3EO9H 3MOBH 1S9WB 1C12A 1AGCA 3AREC 1VDGA 3FOLB 2HT3D 4X8XA 1EFXA 4C56E 4TULL 2VAJA 1QNZH 3VFWB 1XFPA 1BOYA 1YA5A 4EUPB 2Y7QB 4X6FA 2FWOB 4GW4B 3GUTA 1J1XH 4PR5A 4WIQA 4UMGA 3WIIH 4MWFA 4TOYH 2EXYC 1BP3B 3RWGA 3IKCA 4TSAL 5DD1H 3CMGA 3O6FB 5KVDL 5C70A 5H35B 4PGDA 4EKXA 2IH3A 4NQDD 1FNAA 2J88H 1BM3H 3GO1L 4HQQL 3T0EE 2PN5A 2V2WB 4EDXA 3REWB 1DBKH 3L5WB 2MQ3A 4PG9B 1TZHB 3BSZH 3MRPA 3Q3GB 5IBTL 5DJ0B 5C0EB 1I1FA 3U2SB 1LNUA 1KG0B 3HI1B 3T0EA 3SDCB 5GRYA 5T3ZD 4IDJL 3MLPA 1CFSB 3V7AG 3BP6A 2IQAA 1QSFB 5JPNB 3D39B 1FGVH 3VJ6B 4MAYB 2X1WL 3JWOH 4FXGB 1WTGT 4JKWA 5IVOA 3TZVA 3HE7D 1BEYH 3VWKD 3Q1SL 2P24A 2CUIA 1TETH 1G7QB 1KLUB 4TUKH 4QY8A 3RDTC 4Z7WB 5EZJB 2AKRA 3PQYA 4ZD3L 5F88B 2P5WD 1FSKB 2DLGA 3GNMH 4Y5VB 5A43C 4H8WC 3S8WA 3DETD 3KPRE 3G9VA 5T3ZE 3QHZH 4X98A 3LRGA 3D85B 3TWCH 4FQHB 3U7WH 1JMXA 5GS2H 2HJFA 4M1CD 2ZKHL 4IM8A 4M93B 5HI4D 3Q6FA 3O9WC 1QSEA 3MGAA 4WI6A 3R0MA 3W0WE 1DQDL 3FCTB 3R8QA 4LFHG 2VN7A 5KSBE 4P49A 1Q0YL 3VFMA 4OI7A 4P46D 4PGBA 1OM3L 4X7FC 3O2VL 4KRNA 3C6LD 2C1PA 4OD2B 3OJDB 5CD3A 4ZPVB 43C9B 3TA3A 3C5JB 1YEFL 5EO1A 2XG4A 2VDRL 1N7MH 1FZMA 5EFIB 4EN3C 3CDFA 1PZ5A 4OLYH 4HHAB 4RGNB 2YEZA 4H25B 1EO5A 5I0ZA 3AMLA 2JCCB 5ANMB 4KJQC 4UDTB 2KL6A 1U0QA 3BMVA 3MMEB 3ZTNL 5KS9B 5JOEA 1WAAF 4NP4L 1E4WL 1P1ZA 4JQVA 3VG0H 5ESAA 3RFZC 1P5VA 1HZHH 2QL1A 1C5CH 3CH8A 3FFDA 3MRBB 4QRPA 5I66A 4GG6B 2OXGA 2P42B 2W9EH 1NMAL 3HFMH 2CJUL 1YEFH 3ARWA 5C0ND 4KXZH 1FVDA 4FFVD 4W81A 3MJ6A 5FV2A 2HTLC 4YIQB 3BZFB 1BJ1J 1G7PA 1FBIH 1PGRB 3K1DA 5A3ID 2BFVL 3H9SA 3C5SB 1UWXH 1ZGLB 3QQ3A 5I8KL 1YECL 2XXMB 4R7DB 3C60A 4OCSH 3F62A 4P3CL 3SDXB 5IBLC 2CQVA 1JHKL 3L3JA 4PJCB 2AK4E 1NMBH 3QDJB 3TH2T 5ADOL 2FNBA 2NX5E 3RU8H 2X4QB 4EI5C 2JLLA 4F7MA 4IOFC 1KENH 1RUKL 1BJ8A 1WWAX 2A6KA 4KROD 3VWJC 5CZKA 3GRWL 3D2UD 5MEPB 4XP4H 3TBSB 4XGZB 1UJTA 4G8IB 3CDGA 3HG1B 4OZFA 3DARA 1S7RB 5D5MB 5C07D 4XNZC 2Q8AL 1J87A 3D0VA 3J8F7 4D3CH 4K7PH 4X6CB 3ZSTA 3JVGC 1Q94A 2CMRL 3B9KA 5DSCB 1DQTA 4JVPA 4TNWF 4LRNL 5IVXA 2F54E 2GJ6E 2VLRE 4ZTPH 3ULVD 1B4RA 4W68A 4UILL 1Z0MA 5INDA 1CIDA 4LIQH 3TBVB 2Z92B 1G0XA 1IAOA 5IROA 1OAZL 5C0FA 5GGSB 2VR9A 1NSNL 5JZ7C 1UKSA 3BQUD 5A40E 3KYMB 4WRLA 3ZSSA 4DQOH 3IU3B 2HFGH 3TH4T 4QHMB 4QXUH 3LB6C 4K9EC 1CDJA 2ZUTA 3HC3L 3CSGA 1HHHA 2XWBA 1B0WA 5KN5B 4KK6C 1U8KA 3MA7A 3TM6A 1X5JA 4L29A 3LEXB 3V6FB 1AD0A 1E6OL 3VXUA 5IK3A 3RKDC 4HK3J 4MD5A 4JFZH 5IR1B 2G9HA 3ALXA 1I3GH 1YEDA 1TVHB 1UG9A 5CSZA 4GRLA 3DVNB 1S5HA 4JZOA 4KUCD 1HH6A 2DJ4A 4ZOCA 4XNQA 4OJFL 4ZS7L 2I07B 4KK9C 3EZ8A 4XPHH 4XWOC 5EO9B 4X4ZA 1IGYA 1TTGA 1SYVB 4ISVA 1XF1A 1FLRH 4X80L 1U92B 5E2WL 1KTLA 4PJHE 5INCB 1ORSB 3MRQB 4HWUA 1OVZA 1RIVL 2B0SH 3MRLB 5LJYH 1KBGH 4R4BB 3GM0A 1Y6NR 1MFAH 3O41A 5I1JL 1QBML 3W2DL 4IRJD 4F7PB 4M9PA 1JGDA 3VXMD 4YHLL 3WNPA 5ICZA 1TPXC 4RA0C 1CK0H 1T1ZB 1R5VB 2CLVA 4OM0L 1DLHA 4U1SA 1LEGA 1UEMA 2VERN 4QHNB 1AO7D 3O45B 2AK1H 5JIIA 1INDH 1L6XA 3B9DA 3L5XH 3ISWA 4CVWA 1INQB 1QP1A 3AS0A 3MZGB 4DK3A 4ZFGH 4NN7B 1IZJA 2J4WH 3FO2B 5LG1A 2FECL 4NZRL 1UFUA 2GY5A 2BJML 2VYRE 2Z31B 2LTQC 32C2B 1S7UB 2FJGA 1HSAB 4X4ME 3RUGA 3QQ4B 5ID0A 2VDRH 3BOVA 4YGVB 1MAML 4FOMA 1T89A 2E6JA 5E6ZA 4M43H 3DBXB 4Z76A 3BIKA 1ZHKA 4YE4L 4NKIH 1DZBA 4PRHA 5E8EB 2ADFH 1D5BB 2C7UB 3RZCB 1CVSC 1GZQB 3V52H 2HKHL 5C0CD 3V8CA 3P4NB 4M61B 4OIAA 1NC4D 5C3TA 1A5FL 3OJVC 1MRDL 1DCLA 3QIUC 3B3IB 4C83B 1NANI 3QFJA 4WO4D 1JRHI 1UQSB 5F97E 2VDLL 3CH1B 3K2UL 4KKCC 4S1SH 1IT9H 4LSTL 1QR1B 3L3GA 3N50A 1A1OA 5TE7H 4QRUB 1IAKB 2ADGB 5FIEA 1U3HC 1F4WL 4DZ8B 3OXSA 4F7EA 1ZT4B 1EHLL 1OTTD 4DGVL 3FRUB 1ORQB 2P43B 3BN9D 4HIXL 4PTTB 2G2RA 2R69H 1AGBA 5FO9B 3FN0H 5GSRA 1EVUA 2XTLA 4OZFG 3KPRD 4WWKD 2MPAL 3HNVL 4NO3A 5BO1L 2DQIL 5ALBL 5HHOE 1KB5H 5CJBA 3VFSB 4OLYL 4MCYB 3BP7A 4HK0B 2CIKA 3CZJA 5F96H 4OV5B 1LK2A 2A73B 1EAPB 3GRWA 1KV3A 5D9SB 1HHIB 4ZUUA 4LCCC 2CRMA 4LLUB 1OQXA 2WW8A 1NFDF 5EC2B 3SGEH 5DC0A 3EO0B 4PJ8B 3O6FC 4RX4D 3VH8G 1I9RH 4J3WA 2DQEL 3PL6C 3MNWB 1INEL 2D9QB 2FJFB 3QEGL 2W9EL 3VWJB 5I17A 5EZOL 1YUHA 4OQTH 4QWWC 5GS1B 4IHOB 4HJ0C 3QNYB 4P23B 3VCLB 4D0CA 1T2XA 3S96B 3RDTA 4Z7VE 3ARFD 3LMJL 4TVPL 5DGQA 5C1MB 3HC0B 1NC2B 1URLA 4CW1A 4ZYKA 2ZUSA 1XH3A 2J5LB 4OFPA 5ACMA 3NA9H 3DSFH 2CDEB 4TUJB 4NQCE 1YZZA 4NNXA 2RQ8A 5EBLB 5IQ9A 4RAUA 5DUBB 1OD7A 2J88L 4GBXA 4AEHL 4ORGB 2MCPH 4DTGL 4KUCF 4GO6B 4L8DA 1ROWA 1NBYB 5I9QC 1MHPH 1D5IH 3PJSB 3RWDB 1FL6A 2V5RA 4HC1A 1KT2B 4GXVL 1ETZA 3MJ9H 3EYFB 3TN0C 1B0GB 2ESVB 5DJDA 2HJLB 1YDPB 3LKRA 4PR5B 4U1GC 1G9EA 4L4TD 1PKQB 3N1PC 5TE4H 1NLBL 1QA9B 4XP4L 1U95B 4H8WL 5FOJA 2NW3A 3ULVH 1C5CL 4YFLI 5DHXB 1FGNH 4HXBH 3D25B 4M1DH 2FATL 1U3ZA 3O9WB 2E9IA 3CU1A 4C55A 4WUKH 4K7FA 4MLSA 4MVBD 1MWAL 1I9EA 2AV7B 3BI9X 2HKFH 5J3HD 4IRJA 3EFFB 4V1DD 1TZHA 2YSSB 5I19H 2NTSP 2X4TB 3GB7A 5I6XC 1LNUB 3BKYL 4YHOL 4R90H 4ZO6A 4Z0XA 1KCRL 1EVTC 2CDGB 1K3ZA 1RFDL 4C57C 5DFWH 1KTRL 1L7IH 4U6HA 5DHVB 4PFEA 1A6WL 1W8OA 3BKML 2XN9A 3TZVB 1TCRA 4QRQB 1RUKH 5IW6A 1G7QA 1QACA 3NMEA 1ZTXL 4KUZL 2DM2A 2RGSA 3GKWL 4PJFF 2FECI 4FZ8L 2H32B 4IIQA 4JG1L 4JLRA 3WIFB 4ZFFA 3D69A 4E42A 1JZ6A 3IFOB 3VGHA 3CFKB 4PB9L 3GIZL 1IFHH 4DKEL 2OQJA 1T0MA 3JUZA 3QIWD 5H37H 2OL3L 4Q0XH 3RVUD 4FQHA 3OAZH 2VRAA 4JO3H 5KVDH 3MTRA 5GISH 4HV8A 4Y2DD 3X12A 5GRVL 4NNPH 1UACL 4GKNB 3QWRD 4IMKA 4KRPB 1V7MH 2MWCA 4L3CB 4GKOA 2C26A 4NPYA 1PG7H 2EE9A 5JDJA 4YK4B 4WTWA 1ZT7A 4NSKB 5I18L 4LSPH 4K3GA 1I3RA 2XY1A 3FO9B 5DQJA 3DMMC 3QFJD 5CJOH 4NO5B 3QEQB 5EO1B 2BC4A 4R9HA 5T3ZH 5FUZL 1FE8L 3KPSB 5J1SC 4JEGB 5EUKA 1GOFA 2ATPB 2GHWB 3FFCD 4ELME 4PBWD 4JE4B 5EORL 1Q8MA 1F3RB 1T66C 1NGZA 4NFBA 3LIZL 3QXDB 1FFOA 2YKLH 2EO1A 3SKMB 2WWMC 5FYJU 1AFVH 2YPLB 2VLJA 1OY3B 2UUDK 4UDUB 1S7XA 5J0BA 3N0PB 2YD6A 2FR4A 5EZIH 2K1MA 2OMNA 1MJ7L 3WO4C 3O3DA 5CEYB 4K94L 3AGVA 3WFCL 5J1TC 1AY1H 5BO1H 1ZGLA 5DI8B 1OLZA 5DYOA 5IVZA 4JRXE 3HZMA 4M43L 4PRBA 1NL0H 3W0WD 3IS0X 5FDWB 5F1KC 3VXRB 4LPWA 5HI3C 1AFVL 4U3XA 4F8QA 3Q5OA 5CKAA 3CLFL 2DOCA 3H9HA 4NQDA 3WJLA 2V7HB 4H0HB 1FCCA 3PL6A 1SYSB 1IQWL 3T0EC 1KJMA 5EU3A 1DBAL 2IH1A 5KW9L 3VGGA 1JPGA 4ODWA 4LQ1A 1TETL 3QIWA 4LCWE 3S35H 9CGTA 1NUDA 5DJYA 3ULSA 3ULUD 4KHXL 1MI5D 2QR0A 1CFQB 4OCWH 2D7TH 1A7PH 1JPFA 1OT2A 3PWNB 4JFQB 4N68A 1DN2A 2MNUA 5DJ6B 1OL0A 5D5MA 4Q9BA 4ENED 2FX8H 1R5IA 4R4FL 1QSVA 3PP3H 3QEUB 1JYXA 3UP1A 4F15C 3EO9L 4HT1H 1N5AA 2D31B 1Y18A 1QVOB 1X3DA 1IGTB 4LARH 5FYJL 3SKJL 3BZEA 3CFJA 3CLEH 1TQBB 1PYWA 5CINL 1VKXB 1S3KL 2JB6A 5E9DD 4TNWK 3WXWL 5DZNA 4QNPE 4FXKA 2V5SA 3QQNA 1CBVH 3D9AL 4NKIL 3ARZA 4LQFL 2GY7B 1JWUA 4AEIL 1FRGL 4LSQH 1J0ZA 1DBKL 4P5KB 2VABB 1QRNE 4HJJL 1H9VA 4XVJH 5JOFB 1N6QL 1HKLH 5DA0B 1HE7A 1S9YB 3ZL4L 5HDLA 4RFNC 3B9KC 1G7HA 2W59A 4U0RB 5BOPA 2P46B 3LEXA 4MJID 2IAMB 4PYGA 3JTSA 1MI5E 4KV5E 3KLAA 1GYAA 2UZIH 1ACYH 1K6QL 2EYSB 4HKXB 2R1YB 4KI5F 4O2FB 5F3BA 1FVEB 5I16A 1WBZB 4F9LC 4XNQB 5I30L 1I7ZB 1NDMA 3FTGB 5IFAL 1DLFL 3HHRB 1RU9L 3SGJA 3PWLB 4HCRL 2DWEA 4WI3A 5D7SH 4WU7A 3ALWA 2EEAA 4GAGL 4XNUH 4PRIE 5FAAA 1T80A 3OBAA 4G6KL 5T1DH 1RHHB 2GTZA 2OTWA 3HNSL 2V2XB 1ONQB 3HAEB 5I76A 1H3XA 5HVFB 1QEWB 3QEQE 5FUCE 3O41B 1QBBA 4ZQKA 5IFAH 4NQCD 1PW3A 1U42A 3IJSA 3RX7A 4LKCA 1IT9L 1IAII 3OR6A 4U1LA 2NY3C 3QCTH 3TIEB 1MCPH 4MS8C 1E27B 2DQFB 4O4YL 3MBEA 3O8XC 5LAXA 4LCWB 5JOPE 2QQKH 5GHWL 4ZUTB 1M6OB 2AJYH 1B90A 3MV7B 3SDDA 5ADPL 4MCZB 3R8BB 2VN4A 1RZKL 3RWGB 4OM1L 4NQXB 2VDKL 3BT2H 4PJEB 3O6FA 3UEZA 1CLZL 1VADB 5CSBA 4CUCA 4HFUL 1AC6A 1J5OL 1IGJA 2K7QA 5DRWB 3OKLB 1O0VA 3CX5K 4RQQA 5DD5L 1RHFA 3FL7A 4LEXL 4FQCL 3H7BB 5AZ2L 1H8SA 4Y0GA 3FMGH 1I1FB 4JO4H 4JRYE 2I60L 1Q9WA 2LQRA 4Y1AE 5E8NA 5HHNB 3RVTD 3BFOA 4HXAL 2IANB 3MBEC 5J06A 3CXDL 3O3AA 3PGCA 1FNEA 4PBVC 2VJXA 3VJ6A 5EPMB 2AI0H 4XBGA 3S3PA 4BK4A 4DGIH 5CBEB 2G60L 1OP3H 5C6TL 4UILH 4YK4C 1EXUA 1CDBA 3L5IA 3NCMA 2OTPA 3GGWA 3ZZ1A 3NIDE 5C0BE 5HYSA 2VLKB 4JGMA 2P44B 5CJXA 1JZ3A 2DTSA 1XF5B 3CFBA 3OPZH 1OSPH 4G8GE 1NBZB 4MAUH 2H2PD 5F89A 5ADOH 4Y19D 1HDMA 3CMOL 1J0JA 1CTOA 3S5LB 3UZEA 1CICD 1PLGL 3MV8E 4E41A 1UZ6F 1R3IH 3HC4H 4NWTL 4X98B 3MYZA 2DI8A 5FO9A 3WUWG 3HG1E 5GSRB 1I7TB 4M4PA 2PYEB 3GK8H 1FH5L 3MUY1 4GRLC 4L1DA 4OGZA 4PP1C 3RWCA 1OAYH 5FKAA 1SVZA 1QSEB 5CSGA 5GS2D 3PP4L 5FM5M 4MCYA 1A1NB 2X1QA 1NEZB 2A6DB 2R2EB 4MA1B 2EDYA 5IEKB 2AK1L 1X9QA 3MROA 1OSPL 4PGBB 2FX7H 5ICYA 4HIJB 1T1WA 5E08L 4LLUA 3U1SH 3QUXC 1G9NL 2P5EA 5D7LA 1UJ3B 2ADFL 1R3HA 5FK9A 4HS6A 2VZVA 4YPGA 3ARGC 3SE3C 2Y06H 3MBXL 5E70A 1ZAGA 1SBSL 5EWIL 4YWGL 4XPTH 5FO8A 5E8DL 4XP9L 1OOAA 4CDGC 1IKNA 1Z6JT 5JXAL 1IM9A 5AWNH 3VRJA 3TA3C 2CO7B 3MLSL 1BVLB 1YN7B 3C6LA 1FE8H 3RPKA 5C9KA 3BH8B 2NCMA 5E00A 2JCCF 3VXSE 2EDOA 4PB0L 4G6AD 2JB5H 3WXVL 4YAQB 3LH2H 3VE0A 4LGSB 3OKEB 4EI5B 4JFDD 3TH3T 4FQLL 1HOCA 4PJBE 4PY7B 4YQXH 4AMKH 4PS4H 1KT2A 2BVPB 2PW1A 1ETZB 1VFOA 3QA3A 1J0HA 2EYTB 1VA9A 4JN2B 1IKNC 2AK4A 5JIKA 5FUOL 1K2DB 2ZSVB 4OKVA 4BSJA 5LBSL 4JZNB 3VXSB 2UWEF 4Y16C 3BGMA 2I26N 4S1RH 3B6SA 3TYFA 5EUOA 2CLZA 1HSBB 4QHKI 5BS0D 5HDBF 2AV7A 1AGFB 3F8UB 2PTTA 3JV0A 5B38G 4TVPH 3RDTD 1KJ2B 2X42A 1R24B 2JK5B 5AYUL 5E08H 2BHYA 3QXTA 4G8IA 1UB6A 3SY0B 2KQMA 4HMEA 4MNGE 4OLWH 3VRIB 4QRPE 3DETC 5GRJL 5E99H 3B9KB 4U0RC 2ITDB 3AS3A 3UMTA 3NPZB 3LY6A 4HSQA 5T1MA 4X83A 2X09A 3MRJA 4OZGF 1RIUL 4RAVA 5BRZB 2XFXA 3OB0K 1HXMA 1FO0B 2R1WB 3BVNA 4XT1C 5DS8B 4M7LH 5HDQH 4PJBF 4MDJB 2NY2D 4K23L 4NO2B 3T1WA 3IDIB 1S7QB 4L8BB 4P46C 5CKGA 3QWQB 2AXFB 2E7CA 4QHMA 2A2QT 3TT1H 4WHYH 3EGSB 2ZNXA 4JGJA 4C59B 4YHIB 1EZVY 2DBLH 4G8EB 4HV8B 2W0PA 1WVZA 4LVHC 4EN3D 3L95B 1T5WB 1MY5A 4OCYH 3MA9L 5IK3B 1BZ7A 5KAQG 4KJQD 4NSKA 2BHUA 3FT4A 5C8JB 3V9FA 4RCAA 2DLFH 3F65A 4YDLC 3DGGA 2MQ0A 1A0QH 1U8MA 4YEFA 5HYSG 3MODL 3IYLW 4NDMB 3WEXB 5J9PA 1BQLH 4BFEA 1HINH 3LD8C 2E27H 4KMTH 4HT1L 2PYEE 4FFWD 5SWSB 5JR1L 1T1XA 1F11B 5L8JB 2O61A 4LLMA 5EUKB 3LQZA 2HP4A 3FONA 1KTLB 3HNTH 1EJOH 4I48A 3IETA 5MENA 3J7HA 5A3IC 3L7FB 1EUUA 3NCEB 5ADPH 3OAYK 1F4WH 1U8LA 1KULA 2H41A 2XQBL 3QXDA 3MX0A 2OX5A 1BFOB 4D9LL 3WLWD 1F2QA 4ZFOB 5FGSA 2Q76B 2V17H 5FYLD 2R0ZL 4QXGL 4D9RE 2EO9A 1EBAA 5GGVH 3PABA 3ROOA 2YD9A 1EEYA 2ARJB 5DJ8B 5MEQB 1P7QD 3KS0J 4EI5D 1CR9L 3U6RB 3KPSE 4K94C 1ZKAA 1EH9A 3NCBB 4P2OD 2Q7NA 3BO8A 2V5MA 4TPRH 5GZNC 2GUOB 2YC1B 5EU7C 5C7XL 4K3HA 1N6QH 4M1GL 1RD6A 1DQMH 7FABL 2P7TB 4DEPC 1RZJL 3HZVB 3DV4A 4LVOB 3WHE1 4J3XA 4P5TD 4RNRA 3UBXB 1JGEB 1VSCA 2O26U 5E1AB 5DJYB 3ULVC 4PRIA 2J8OA 2R2HB 1OAXH 1HCVA 2VLLB 3WFEL 2FHBA 4XCYA 1ZHKB 2WZPD 1BX2B 4MNQA 4UQ3A 2BXYA 3DUUA 4EOWL 5ESQA 1YEGL 5E8EA 2R0KL 3HCVA 3LQAC 5T1KD 1T21B 1KC5H 2WIIA 1K4DB 4PJFB 5I1CH 1H8OA 5A2IH 4K55A 3LB6D 1XEDA 3U36B 1MJ7H 3VXRE 4I3RH 4N0FB 4KK6D 4XPBH 1WCBA 3QEHA 1N64H 3BZEB 2FSEA 4M93C 1OD9A 1C1EL 4LLQB 3ILPA 1KBGL 1L9MA 2CLRB 3LIZH 3MXVL 5L9DH 5DQ9A 2XTJE 2OBGA 1RMFL 1ZT4A 4AJ0A 2MQCA 4WEUD 1F3DJ 2OLDA 5B38A 2DL2A 1WSST 4PJCE 3KYAA 4QHUB 4D9QE 2HN7B 2FBOJ 2PTUA 2HFEB 4LNRB 5JOFA 4JHWL 5DR5L 4XWOD 4OLXL 4BZ2L 2Y06L 5HY9A 3B5HA 4HK0A 2BY2A 3JTSB 5C0BB 4XC1H 1YEHL 5BZWB 1HHIA 2F5BL 1BHGA 4HIEA 4H5SA 3X14A 1Q0XL 2IFFL 5IB2B 1S78D 3S88L 3BPLC 3GMOB 4QOKE 1OB1A 1I7ZA 1NDMB 3QDHA 5IEHB 5C0DA 3WL9A 1FG2B 1QSFE 5A2FA 5CS7A 3MNWA 2DQJH 4PJ7E 4IRJC 3GJFH 5D1XC 1DBAH 3IXAA 4WY7H 3SGEI 3MRMA 4Y4KD 4IHOA 2B20A 3V5DA 3C87A 1A2YA 5FCSH 3PIQB 2Q7YA 1WIOA 2C3GA 5ETUB 3CFCL 3GBLA 2BVOB 4LMQI 1TJIH 4JY6A 2YRZA 1WTLA 4DKEH 3SDCD 4ZOEA 1J11A 1LQSR 4BSVA 5LXGH 1QLRB 2NY6D 3IU4H 4MAYD 1MVUA 4OD3L 1NCCH 2IMNA 4F2MB 4JVUA 5CEZE 1LILA 1NBYA 3MV7E 2QQQA 3ZO0A 1BVKB 3NACL 4LKCB 3W9EB 1I8MB 4RMQA 1OGTA 4HKZA 1YMMD 4LF3B 5FECB 4LVEA 3F6LA 3TF7C 2HTKD 3MBEB 5I18H 2ITCA 1TMCB 2OJZH 3QDMB 1CZ8H 3VFVA 3MV7A 3AREB 4OZHF 2AXJA 3RTQD 3DYPA 5BJTA 4X6EA 1L4IA 2GAZA 4I4WA 5TF1L 1VADA 15C8H 2J1KA 1DANT 3NA4A 4NQSA 3V6ZB 1R5WA 3RVWD 3VXNB 5DJZA 2YD1A 4LLYB 3GI9L 4F57L 3OKYA 4OSUH 1LD9A 5HSFA 4K7PY 4UTBH 4AG4L 1AC0A 3PGDA 2VAAB 2HJKA 4QTIH 3GB7B 2VLMD 2VOTA 2F19H 1YYLH 2FLBT 1QYGL 2XQYK 2FX8L 4JPWL 4YDJB 3S88H 1XGUB 3E3QC 1KIRB 3BN9C 4LHUA 3MRRA 3HPJA 5EPMA 4HJGB 3VFNA 4Z7VF 1LE5A 3S37L 5F1NA 3BZ4A 4FQXA 5L2KD 3MA9H 1JIBA 2DQCL 1AD9A 1VESA 3UJIH 1RAMA 5HVHC 3MXWL 3WHXB 2I9LA 2FH8A 4LCYA 4ONOA 2AJ3B 4Y4KA 1UH4A 3OR7B 5AYUH 1U36A 4JHBA 4ZO8A 2L7UA 1NCNA 4NYLB 4P9HH 1I7TA 4YNYB 3MLWL 1R3JB 3O6FD 3KJ6H 3KJ4C 4PUBH 4MNQD 4I2XA 4MZ3A 3FQNA 2X4PA 3DGCR 4PGZA 3U2SA 3OAZK 4JFOA 3RQ3A 3VI4F 1NCDH 2BSTB 1N0XL 5K9QG 4J3OC 3MCLL 1YECH 3MROB 5JNYB 3EBAA 2EDJA 4FQIL 1TZIA 1D9KA 4M5ZH 4YPJA 3OF6A 4P5MA 3MV9A 2MSPA 5GRJH 2AP2A 5F9AC 4BKLA 3I6KB 3PDOA 3JWNC 5C0AA 4YPGB 1KLUA 4HGMA 2B5IC 1QSFD 4XMPH 5J12C 3PQYB 4UBDC 5D2LE 1OM3H 4E9LA 4HH9A 2O5ZH 3WO4B 5EU5A 4ZNEA 4K7PX 1KJVB 1FRGH 1P4LB 2VDPL 1WT5A 4PGJA 3HG1D 1EHLH 2Z9TA 1RK0B 1NFIA 1CBVL 3TO2B 3FN9A 3V7AE 3V4UL 3PHOB 1DQML 3QDME 7FABH 3PWJB 1NAMA 5JORB 1D6VH 2VLJB 1LP9B 4TUKL 2BFVH 2FIKA 5CWSA 3SDDC 1S7XB 1K3IA 1GAFL 1KN4L 1OF2A 4HKJB 4PV9A 4YAQA 4LRIA 4HZLA 4LSRH 5DZLA 1EEQA 4PJ7B 1TVDA 5CUSL 3PP4H 3NZ8A 3WNNA 3RNKB 2X7LB 4P2RA 2AS5M 3SE8H 3P3YA 4Y4HC 4JFPB 3FAXA 5JMOC 5C2BH 3NOIA 3B2VL 2OTUB 4HHAA 2HMIC 1KOAA 2X4UB 1KC5L 2OZ4H 1D5XB 4LHJB 1JRHL 5E2VL 2V7HA 4KTYA 4YHPA 3MMEA 3T0WA 3GMNA 4G6KH 1LVEA 1TZGL 4L4TA 5EUOB 3DVIA 1RJLA 3GSNL 3WJJC 4BK5A 1FYHB 1UM6H 3ULSB 5B4MC 4OCXH 5HHME 5MENE 5D1ZA 6FABH 3UDWA 2QQNL 2QR0B 3DNKA 2HG5A 3RWJA 2JK5A 3F7VA 8FABB 1I1RA 3SY0A 3QJHA 1SJEB 1NCTA 3VRLF 2DI9A 3R1GL 1ZV5A 3RVUC 5JW3H 5DHVH 4X7DC 2D31A 3CFEB 1ZLWH 3RZCC 4S0TD 1T0PB 4YO0B 1P6AB 3TP4A 2XWJA 4OFYA 1JI2A 3BVNB 5IHLB 5DS8A 4M8QA 1N0LA 2VZ1A 4XPGL 1EX0A 3KS0H 3QDJA 3P73B 4TN9A 3W39A 4KPHH 3GSOB 4TVPE 5K59F 4G6ML 4LDLB 3V6OA 1EGJA 2C1OA 3WHE0 1OHQA 4G3YH 3KPOB 1NDGA 1NCUA 4DFIA 3SOBL 1SEBB 4MXWH 1PDKA 3KPQA 3I3EA 5FA3A 3T8XB 4LHUG 4DQOL 3BUYA 3RWFA 2Z91B 1XGQA 5HGGS 3Q2CA 1RJYB 4AIZA 2ZG1A 4Z7QE 5AD0A 2R56H 3ESUF 5DHYA 1BBDH 4TTDD 2DQHL 2AI0L 5DJ2A 3SGKA 3DGGB 1OQOA 3C6SB 4KKAC 5C07B 5T3XE 4GW5B 3UTPD 3VFOA 1DQQB 2GK0B 1YC8A 3EDDA 2XT1B 4WWID 4OTXL 3IU4L 1RURL 4OQTA 4PRHE 4LLWB 2XOTA 1R3LB 4PJIE 3TEUA 3PXHA 1YEKL 3MPCA 4J12A 3L6FA 3HR6A 4DFHA 4CVZA 1X5XA 4PJ9D 1FLTX 1MCQA 5JXAH 1DN0A 2QSVA 4DKFL 4H88H 5FYLH 3HAEA 4X4MA 1KB5B 1FLRL 2H6PB 1T0NA 1ZK9A 1H3TA 2WSKA 4MX7B 1LP9F 4XMLL 3ARDC 1RZ8A 3WDIA 1QSZA 4QRTB 4RDQF 2EH7H 3D39D 4R96B 2B39A 1IMHC 5M94B 3TIEA 1PY4A 4PLNC 1P2CA 2BNRB 2HRPH 3O2DL 4LOUC 1TJGL 4MB4A 4XBEH 1ND0B 4OLZL 4HG4K 3V8OA 2YPVL 3MNZA 4LCIH 3ULUC 3RY4A 2HVJA 2DRUA 2DL9A 4LSQL 4CVXA 1KIUA 3WO3B 3CU7A 2BNQE 3ABZA 4ENEC 4OGAC 3RPIA 3AFLA 4WHYG 5IGXL 3LEVL 1FNHA 2BCKA 5CZXD 3ULVE 1GGCL 2PCPA 2DAVA 1DEEB 3OGCB 3BRDA 3IAGC 1KPUB 4NCC1 3X13A 3MRLA 3WS6A 2W0FA 3QPXH 3P4MA 4IRZL 1QFWI 4WV1A 5LCVH 4JZJB 4R3SB 4S1QH 2XPGB 1A6AA 1KB9K 4F7PA 3DUUB 2IANA 4CVUA 3ZKXB 4GRWH 3IKKA 5KVEL 2VZ3A 3MRGB 1E4XL 3R0NA 2P5EE 5D7LE 1IZKA 3FOLA 4LARL 5FYJH 4JFFB 5DEGA 5GGVL 5FYLE 4JHAL 3TNNB 5KAQF 5SWQA 2CXKA 5D7IA 1G6VK 5J1AB 3KVQA 4HEPG 3G6JF 5E6ID 3BPOC 5GPRA 3ILPB 3BD3A 4X8JB 1PKOA 1KLFA 1WFTA 1KEGL 4WGWB 5H35A 2OXHA 4UOJA 4XPAL 4UU9B 4X4YB 2X2YA 3VFUA 2PXYA 2V7NB 3GKZA 5KSAD 3MLUH 4GQ9H 4EIGB 1A4KA 2J8UE 3L9RB 2E9BA 4GMTL 2BRRH 3MV8A 4EDXB 2W91A 1INDL 3DOSA 4JM2B 4U1KB 4WDIB 3RIAK 5BQ7B 1MRCH 3BPNB 2M8XA 4PRHB 4CU8A 1BQLL 3I84A 3RJDA 2C4XA 1W0VA 2A38A 1MNUH 5KS9E 1LO3L 3U7YH 5BRZE 2H26B 3UBXG 3PXJA 3IXTB 1TQCB 3T77A 4FXGA 1JGLH 1Y0LB 1CLOL 1Q0YH 3HE6B 1MQ8A 3B3IA 3UPAA 2R0ZH 4P3DA 3CSYA 4ZUVB 5C0CB 4X6CE 1QR1A 5AZ2H 1HXYA 3OB0H 3OXSB 2QADD 2BVOA 5GGTH 1MJJB 5MHSE 1EO7A 4PJDA 3T0AA 2HJFB 5JHDD 5D2LF 1MEXH 3HLAB 3V5HA 4L8SB 5ITBL 1A02N 4FG6D 4YBHA 4XZUA 4UIKL 2NXZD 4JJHA 4G9FE 4NUGL 4XCNB 1GXEA 5ESVB 4PJHA 2ERJC 3FT3A 1MHCA 4JQXC 5HI5D 3KPRB 1JK8B 3T1FB 5D9SA 3DURA 5ACLA 1EFXB 4FTVB 4HUXB 4UUJA 3O6LL 1UENA 1UT9A 1JF5A 2N7BA 2ENYA 1MCOL 4KDTC 1I75A 4PREA 4Y88A 1BBDL 1Q9KB 4R2GD 1CQYA 2EDFA 3ZE0F 1EJOL 3MBED 5EU6A 3DV6A 3ZDYF 1HQ4B 4NN6B 1K9TA 4D0CB 1LP9E 3TO4D 5KS9A 2DQGL 4WGVB 1NANH 4PRID 4GAGH 4XNUL 2V2WA 5I66B 3L5WA 4U1HA 4YHZL 4HMCA 4QNPF 4G9DB 1INEH 4PJAE 1G84A 4OJFH 1UB6B 5JIPA 3U9UB 5D72L 3SDCA 3ZT6A 1IE5A 5I1GL 3CUPA 1CICC 2IQAB 3KPSD 3GKWH 3BRGC 3A6CL 2VL5A 3T2OA 3EYSL 5D1XB 3VXUE 4IS6A 3SKOA 4GS7C 5F9JB 4OFYD 4GLRI 5D7JB 2MOVA 1MUJB 4EVNB 3QUZB 2EDLA 3DX6A 1PSKH 1U95A 4NJ9L 3V2AR 4YUEH 3O2DA 4YHZH 5DRZB 1EPFA 3H7LA 3WHXA 3HC3H 3S35X 3QDGA 1VFBA 3FHQA 2VITB 1OGAB 4HFWB 5FEBA 4L9LC 3B8SA 2SEBB 4X5WA 5TF1H 3N85H 4IRJB 3SGJC 4GMSL 3GMLB 5I1EL 3UYPA 2WINA 4Z0XB 3QDJE 4LSUL 5EBGA 3D0VB 2DBJA 5FFLA 1S7WA 4L8CA 4NQVA 2OZ4L 1G0DA 3HN3A 4N5ED 2F5BH 4WHTB 3U4EB 3TVMC 1NH6A 3AS2A 1WLHA 2OCFD 4Y1AA 4NNYB 3IJHB 5INDB 1JPTL 5C6TH 1XGYH 1IAOB 1KEMH 3T0DA 1PZ5B 5D7KD 2A83B 5GGSA 2O61B 1IJ9A 3QO1B 4LKXA 4LLVB 5IIEA 4Q9CA 1EFQA 2OQJB 2KZWA 3G6JB 4G80A 4F58L 1P1ZB 5JDSB 1JWSA 1S5IH 4LPCA 4GG6A 4Q9QH 4NM4L 3VXMA 3QG7L 4J23A 4L3CA 1LDPL 1I8IA 4NC1E 1E4JA 3BPOB 1IC7H 1MQKH 1W0WA 2F74B 4S1SL 4N8VG 1MOEA 1TVHA 4QHLA 4EN3A 1JWMA 3SKJH 1I7UA 1S5HB 5EU4A 5FB8B 2ED9A 3JWDH 3P9LA 3QEQA 3I6GA 1NGQL 2OS7A 3A67H 3AM8A 4FQ2H 3BO8B 2NY3B 5MEOA 5EO9A 3T65B 1BWWA 1SJHA 3U7YL 2DTMH 5HHQB 1BJMA 2ATPA 2AV1A 2FL5B 1FNLA 3UJJH 2YUXA 1SBSH 1ORSA 4QRRE 4N8CL 3W0WA 2YPKA 4JFHE 4F7TA 4PGEA 5HD8D 5IG7A 3TO4B 4JDZA 1ZT1A 4XB7A 3CMOH 3F12B 4IMLA 5FHBH 4PRIB 2A6KB 3P9WB 3SKMA 4X7TA 1FAKT 5F9DC 1QRKA 2HRPL 3O2DH 5I8EB 1HWHB 1H8NA 3V52L 5HYJD 1JI1A 3BP5A 1BECA 3RWEB 3X11B 2DTML 1NEUA 5CGYC 2HH0L 1BFTA 4U1SB 4JFEB 4KJWD 5A16B 3SO5A 3RWHA 2VXTH 3LKQA 1GPOL 1OTUD 1WZ1H 3KLHD 4M8QB 3CFDA 4P23D 4D9LH 4I0PD 3ZKND 1A6TB 4FQJH 2VTFA 2JTDA 3IFLH 2Z31A 4I2XE 4RIRB 4L3EE 3LEVH 2EE6A 4OSUL 2XWBB 4JRYA 5D93B 5L7XL 1QNZL 1QBLH 1SEBA 3GNML 3MA7B 3KPQB 3WLBB 2D0HA 5HPMB 3P4OA 1GJIA 5BV7B 1GPOH 4OZ4B 4XWGL 5E03A 1LO2L 3NAAH 4OCLC 3EOTH 4PJFE 3PWPA 2NW2B 2VISB 5TDOA 1UA6H 3QCVL 4KJPD 2NTFB 1LO5A 1W8NA 2IAMC 3QUYC 1Y18B 1GCFA 2PKDA 2IMMA 4JO1H 1CI5A 4GW5A 3VFOB 3RHWK 2FX9L 1S7SB 1CICA 4KQ4H 1BIHA 4XMKH 3C9NA 3AB0C 3ULUL 4KAQL 5I8CA 1U8OA 1J05A 4IRZH 1VKXA 2OJEA 4FN0A 4XNMB 1T1YB 2XQBH 3PIQA 2QV2A 1ORQA 3RGHA 1DN0B 4JZJC 4IIQC 4NQDE 3AY4C 2PO6A 3ZYIA 4JPKL 3UPCA 4V1DB 1ZHBA 1JFQH 4NZTH 4R4BA 4HCRH 5J4MA 4PY8I 2PXYC 4W4OC 5L88L 4Q6IC 2EE2A 3KPLA 5GZND 3U0WH 4I18C 4P57B 4QRRA 2GTWB 2D7PA 4HUNB 2WQ8A 3HI6H 3QUZC 4DCQA 2WM0A 1J7VR 1MCKA 5ICZB 3EYQD 2YA2A 1S9WA 1U91B 4H0GA 3ET9F 3TZVD 4DGYL 2EE3A 4P5TC 1FL3A 1AE6H 1ZLVH 3CSPA 3O45A 3KLSA 3JSSA 1NAKL 5EC2A 1D5IL 3EJYC 4GUPA 1KIQA 4K8RD 4PJCF 4TYUA 1BLNB 4AEHH 1ZA3A 2P8MB 2WBWB 3OGOE 2YD8A 2XZAH 2PYED 1YUHB 5EU7E 1RJZB 3GSQA 5E2VH 2LAGB 5FOBB 3HMXL 2EDKA 2IH3B 2BCKB 4WTZG 3VXNA 2Q3ZA 3BKCH 5H94A 4OCSL 5DRXB 5I76B 3HI5H 4HWEL 4HIIA 4OGYH 2W0FB 4NNXB 3ZDYE 4P4KA 4YBQC 1DBJL 2VXVL 2VAAA 4AIOA 4PJ9A 1TJHH 1DP0A 1UCBH 3HUJE 3QZWB 4P5TA 4HUWA 5IF0A 3PNWB 2APXA 4JR9H 4TRPH 3ARBC 4LSSH 3MRGA 2ZUQB 4HX1A 4KHTH 1GZQA 1QSFA 4WNQB 3HPJB 5FGRA 4ZXBB 5IHUH 3NGBB 4ZPTA 3PWPD 4U6TA 1N64L 3RY6C 1EEUA 5DEGB 3GI8L 1B0GA 2P24B 4YFEA 4ZUWA 3FN3A 5CJ5A 1PEWA 1A9BA 2GCYA 4Z7VA 4LASH 4Z7WA 2A6IB 4P9HC 2R8SH 4PJEA 4JFYB 4ETQA 4LCWD 1NGWB 4UU9A 1KB9J 3OR7A 4XC3H 5I71B 4LU5H 2B2XL 5HHVL 4BJLA 4LSVH 4OCXL 3SGKC 1FH5H 3H7BA 1TQBC 3UJTL 3RI5K 1N4XL 1XGPA 3UZQA 5HYJA 1NJ9B 4JFFE 3CPLB 4HKBA 3OTTA 4HIHB 5KSVB 4Y4KC 1JNNH 3O6ML 1JYVA 5TQ0L 1EERB 3VFMB 1QFOA 4LP4A 4GQPH 3LKSA 4L4VA 1HHGB 2FZ3B 2VQTA 3RA7L 1CG9B 1V3MA 3H42L 3SDCC 4O5LL 2ZJSH 5F7FA 5HGAA 3HE6A 4D8PB 3T0VA 3L3OA 2NY6C 3CSYB 4MAYC 1X44A 2VLKA 4YHMH 3VWJA 2ICEB 3UJTH 1I4FB 5BS0B 3BD4A 2YMXH 1A3LH 1HDMB 3QDGE 4YWGH 5EU5B 3L7EB 1GL4B 3BDXA 4WJ5A 2AABL 1U93B 5F7EH 3RDTB 1R3IL 4NWTH 2CJUH 2Y9RT 1NKOA 1HHKB 2E8ZA 3P30H 1FIEA 1MCIA 1YNTA 2YA0A 3BGFB 3GBML 2YR3A 1NFIB 4NZRH 3HZKA 3G6AB 5ESAB 4OZIF 5B8CB 4RGMB 2VLJE 1QQDB 1U6AH 4MGXA 5IQ9B 1JNLL 3MV9D 4GBXB 4AMKL 2IADA 1HIML 1ZEAH 4NPYB 3TIDA 1NEZA 4HKJA 3BZFA 3I6LE 1DEDA 5ICYB 2VDQH 4LVOC 3QQ3B 1EA9C 5LCVL 1FJ1A 1G7MA 4MQXC 2RB8A 5D72H 1BD2A 5JO5B 2F5AH 2BC4B 1PKQA 3G5YA 4HULB 3ARDA 5CAYB 1Q9KA 2G5RA 5C3LD 4FQCH 2NY4C 1HQ4A 2XQYG 3RGVD 1TTUA 4F8TA 1FPTH 1GC1C 4YHPB 1PG7W 5DT1L 1MFBH 5CCKL 3P77B 5I74B 3QI9A 5BW7A 2IBGA 1SY6H 4XH2B 2F8OA 5T3XH 1WBYB 5DUPL 3P11L 3GO1H 4QGTA 2X4TA 4OF0A 4B53A 4JPIB 3STZB 2M2DA 2VSCA 4ZODA 5TDPB 1L6ZA 3SQBA 3QJHB 3U9UA 3VE0B 2R29L 3ZE1E 1M05B 3DVGA 5T1LB 2ZNWA 4BQ6A 1WAAE 3I6LD 1ZVYA 5F9JA 4CU6A 4YDIH 3T0BA 3MLZH 3VFTB 4OZFH 5BMFL 1FGVL 3HC4L 4X5LA 3VXRA 2APVA 4ZFFB 3NFPA 5DO2D 2XKNB 3QFDB 1ES0B 2DBLL 4XAKD 4HGWB 2NR6D 3WFDL 1VFBB 1ZVHA 1C08A 3MLUL 1CXEA 4GQ9L 3TYFB 2CLZB 2WAHA 3MRIA 5I0DA 4CRPA 3IVKA 3OG4B 4UIMA 1JZ8A 1DSFL 5D7SL 5EU6D 2FB4H 2YRLA 4O4YH 3BEWB 3IDJB 4HIXH 4AY0A 4PLJD 3MLZL 4S1DC 3SCMA 2NXYD 3MRCA 1HINL 1ZT7B 2ZCKH 1I85A 2VLRA 1CXHA 5CSZB 4POZD 3DVNA 3LDBC 3L5HA 3SO3B 4Y1AB 5F7UA 2DWDB 2N4IA 3PP3K 4OCYL 5B22A 4WUUB 3CX2A 1NGXB 1FO0A 2A83A 1S7TB 4ISVB 3KPSA 2QQLL 2JJUA 4KHTL 1ZA6A 2Y5TB 4LLWA 1DANU 3EDJA 2Y1VA 4AZ8A 1H3GA 3FQXA 1MEXL 3CXHJ 3RUGE 1P69B 1S7QA 4L8BA 3BWAA 2IGFL 1BM3L 5D8JL 3ARBB 1EMTH 3NPSB 5JR1H 1JWSB 4ZXBC 4JREB 1LE9B 4OQTL 4Y4HD 2QHRH 5EOCH 5EZOH 3FOMB 1XF3A 5CINH 5JW3L 4NQCA 3VXOA 4GRWB 5J8OA 1H3PH 2R4SH 1JUFA 3IFPA 4ESKA 2VQ1B 4QRTA 3LRSB 1XCTA 3MGOB 5BXFB 5L6YH 5CEYA 3MREA 1H0DA 2BDNL 5F7DB 1KUMA 1UA6L 3QCVH 4YR6B 3RP1A 1NGPH 3TBYA 1HKLL 4LHUD 5C08B 4RWYL 5B4MD 2C4FU 1FDLH 5GS0C 1DQDH 4BFBD 4G7VH 4GRMB 5MEOB 3V0AC 4CJ0A 1MF2H 4Y8DC 3OKMA 4GKZA 5HHQA 3WFZA 4MXWL 1MFCH 2OR9L 4N90E 3FZUC 4NQDB 3RPIB 2AJXL 2WIMA 1T22B 3VXTB 1KCSL 3PL6B 5HVWA 3JV6A 3EW3B 1JPGB 5B39G 4B0MM 4FQJL 12E8H 4OIIH 1S9XB 1NEZG 1FVCB 4KDTA 2HLFD 1IAIH 3THML 1CFQA 5I8EA 1JPFB 4ZUSA 4UOW1 3D6GA 4CN1A 3BP5B 1UWGH 3CC5B 3L3HB 1KN4H 2GT9B 4OF5A 3D2UA 1IGMH 1X5GA 4M61A 4ZSOB 4MJ2A 1XZ0B 3U6RA 1IC7L 1AKJB 4Z5RB 5T1LD 1A4JB 5GRWA 5GGQL 4XVTH 2IPTH 2PF6A 3JBG7 2HWZH 3V5KA 4TSCL 3KJ4B 1CCZA 5KTEL 4OLEA 4JY4B 1IAKA 2ADGA 1MCFA 4DZ8A 1CGYA 2NY6B 3FRUA 1KCUL 5HGBA 5ILTL 4KJYA 2HT3C 5EORH 1RZIB 4KKAD 5IB1A 3O11B 5E95B 4A2MA 3IAPA 2R2HA 2WANA 5ISZB 5F3HB 4TPRL 1WFNA 3P2TA 1MI5A 4LHQB 3V4PL 3MCKA 4X6DA 4I1NB 4CN4A 3G5ZB 4H26B 5E6IA 2R0LL 3KLDA 4BUGA 4ZDHA 1LO5B 1IEBB 3K74B 4O2FA 3A6BH 1JGUL 2WMPA 1MY7A 1FNSH 4QLRA 1N2RB 4Q7DA 1WUNT 2FSEB 5I17B 1NBVL 3D0LA 1X5HA 3V6OE 4MSWA 3CFBB 4I77L 1J05B 3DLQR 5KVGH 4Z8FH 1RFDH 1WITA 3TJEH 4ZFOL 1YY9D 4YZFF 3VGAB 3GSWB 2JIXB 4ZAKD 3VD7A 4UI2A 1YNKH 2VXSL 4LNRA 1MHEB 5DEZA 4XCFL 2E7BA 4KUZH 3ULUE 1MLCB 1JL8A 4ORGA 4EQ2A 3GHBH 2DM3A 2XN9D 4WU5B 3MRKB 4P2QE 4H5SB 4IDLA 3X14B 1PKQE 5BRZD 4N0RA 4LCWA 4UUJB 5DJDB 2AK4D 4M6NL 3MJ9A 1E4KC 3BXNB 4FP8L 2R4RL 3ARFA 1X5FA 3O4LA 2J6EA 4PREB 3QCUH 1C16A 1GGIL 3BH9B 3IB4A 4YLQT 4HC1H 3N1GC 4R26H 3D25A 5FUOH 3I2CL 4TOYL 1OSZB 3KPPA 2IG2H 3CVHL 3SGDH 2QKIB 1YMME 1KN2L 2V2TA 1C5BL 1S9VB 3H8NA 3BUTA 1A7RL 3O8XB 4PJ5D 1WEJL 3TT1L 3WFDH 4Z7UA 1F4AA 5F8QC 2X4NB 1F8TL 2VUOA 1A6VH 3MOBL 4XCEB 4JFZL 2EH8L 1OLLA 2NX5D 1JYWA 3BHBB 3CUPB 2GITB 5DHVA 3DUSB 4NQUA 5I1KL 5GXBB 3PQYD 5ACZA 5HYEA 2Y6SC 2VL5B 4GG8A 2AEIT 1XIWC 4XI5C 4BZ1H 4OLWL 2GW5A 3QDMA 3EOAA 1WBXB 5D1QD 3MO1B 3DHMA 4JN2A 1I7RA 3QIBC 4IIQB 4JLRB 1JNHB 1NBZA 3D69B 5FM8A 1BMGA 2HTLD 1SM3H 3BPNC 4JPKH 4MA8L 1NSNH 1CGSH 1DUZA 3LPWA 4E41B 3OAYH 2H8PB 3K2MC 3CIQA 5HHOB 1JF1A 4EDWH 4X4XA 4LLYA 5AZEH 2E9JA 1NCBH 4ZAKA 4PG9A 3PGDB 2ICWJ 5M7QA 1E4XI 1KJ2A 5IBLD 4KY1H 1A1NA 2F5AL 1B4JL 4HKBB 3HI1A 3DMMA 3PWPE 1WWWX 5IEKA 2X70A 3FQRA 3BPLB 5SX4I 1X5ZA 3VRIA 2QADC 3MUGB 2NLJB 4LEOA 1FORH 2YWYA 3U4EA 3QIBA 2R29H 4E0RB 1MCWW 1X5KA 1LE5B 1QBAA 1H15A 2C3VB 3D39E 2FB4L 3IJHA 4HS6B 4HPYH 4KGLA 3E6FB 2ORBH 3NTCL 5EZJA 4D0DA 3T2NL 5T3XL 4RGNE 2XKSA 1HZHL 4NO0A 2X1PA 5CEXA 2Z0BA 5IIEB 3STBA 5L2KB 5CEZH 3SHSA 1MJ8L 2PO6D 3OJ2C 2AXFA 1J86A 2XKUA 1J8HA 1YPZA 4YHIA 4PRNA 3HZKB 4EBQH 4NYLA 1MCEA 1YEIL 3VRLE 4ALAL 2VNCA 1KLGB 1QQDA 1FIGH 3Q6FB 5AAMA 3VXMB 4MJ5A 3L95A 1FFPA 1GSMA 2WLYA 3BKJL 4NWUH 2ATKB 2G5BB 2IPUK 3ULVF 1AJ7L 3EOYG 2OL3B 2BVUA 3GMQB 5K9JH 3TNMB 3VD5A 1UWEH 1A22B 1D9KB 4YHKH 4X7EC 2BVPA 4OD1L 5CZVL 2NY7L 4TUOA 5TQ0H 3WKNA 3I6KA 3SE8L 3IDYC 1JV5A 4OLVH 3P9LB 4DGIL 5CLWA 2HFFB 2L4OA 1FZMB 5EFIA 3IFNH 4LMQE 5I1CL 2AK4B 2YEZB 3C5ZC 3QJFA 4JAMB 3RKDD 1VEOA 4LFHD 2UVEA 3WIHA 2JCCA 5ANMA 5IMKB 3DTXB 5FF6B 2IH1B 3C60D 1N4XH 3K4AA 1LO0L 2NZ9C 3G6JE 2A6JB 2J6EH 1K8DB 4ZS6C 3VG9B 3ZE1F 5KTEH 4O51B 4TNVK 4KK9D 4ZFOA 1JMZA 1MCBA 4Z78A 5FYJD 1CFTA 3MGTA 4U3HA 2ICWI 5FM4A 3ARQA 4ZOBA 5MERA 4PV9B 3H42H 3MLRH 3JWDC 2WBJB 2ARWA 1GGUA 3DROA 1MRCL 4Y5YC 1JTTA 3R06A 5EOCJ 2FX7L 5DLML 3RNKA 1CXKA 4B5EA 1WC7A 3LKQB 3VFTA 1S9KC 1L7TH 3S36L 2RBLA 4MDJA 5IESL 4X9HA 3VDAA 1GOGA 4H88L 4J3TA 5FYLL 4HGWA 4WHDA 3DECA 2R4SL 1GVIA 4M3JA 2I9TA 4N5EC 3TGXA 3FHAA 3EGSA 5HYQA 5K93A 2ZOLB 4DUVA 4F7MB 4UT9L 2R2CA 4PB9H 1IEAB 3MXVH 5L9DL 4G8EA 1QO3B 1J8HD 4OFIA 3TVMB 2FH6A 5HHOD 1XR9B 3KAAA 4MAUL 1C1EH 2EDRA 2HG5B 4N0UE 2OK0L 1FGNL 1FDLL 5GGQH 4WHCA 1X5YA 4NJAH 4YHLH 2F15A 5TDOB 2BVQB 1TNNA 3MRNB 4RBPH 4P46B 1GGTA 3RRQA 5IW1A 4OI8A 3LKPA 4LSSL 4JM4H 5ICXB 1BF2A 5KVFL 4G7YH 2XA3A 1QR4A 3TT3L 1YEJL 1CXIA 4YHOH 2W60A 5ERWB 5ILTH 1F11A 3C9NB 3FMGL 5DTFB 2ZCLH 4LVHB 4LLQA 3LQZB 4X6BB 4FQXC 2KDGA 3OG6B 4WCYL 2F19L 2IWGA 3ELAT 4NZJA 2R8SL 3DIFB 3H3PL 3ARBA 2C1OB 2R4RH 4PGCA 2PO6B 1U8HB 4A2LA 4HLJA 2OYPA 4XHJC 5KN5A 5E2WH 1U8KB 3MJ8A 4PIRF 1ED3B 4KKCD 4XCCH 4YDVA 4K3JL 4UT6H 5HHXL 1N6VA 3DX7B 4M5YH 1XGQB 2QQKL 3LRSA 1U3HD 4LSUH 5DMKB 4Y4HB 3BISA 4XX1G 5L2KE 5DMIH 4OD3H 1A6WH 1N6UA 2D7TL 5MEQA 1FL3B 2HT4D 5BMFH 3AC0A 1E27A 4HWNA 1A7NH 1VENA 4JZOB 1Q9OA 2YPVH 5C07A 1JNJA 1BLNA 4Z7OE 4JB9H 5HVGB 5KSAB 4MHHG 4BSWB 1Z3GH 2YBRA 1AHWA 1IGYB 2ADIA 1F97A 2F8XC 5MP6L 5ENWA 5HHXH 2Q7YB 1AGEA 5ETUA 2HA1A 4JY6B 1V3KA 4WFHE 4RNRB 5T5NF 1WAAA 5H94B 3MSPA 2X6MA 2H6PA 3KXFE 2CRZA 3BPCB 3PL6D 1I1AC 3KLHC 4PJ9B 1PEZA 1BVZA 1MVUB 4KROB 4ODVL 4K94H 4LCUA 4KI5C 3OZ9H 3HE6D 5ESQB 4NZUL 4WW1B 1T1ZA 2EDBA 1WZKA 2BVTA 5DD3L 1OGTB 4R90L 2WIIB 3DO3A 3G5VB 2VXQL 5F93C 1LEGB 1NL0L 4Z0BH 4ZSOA 1D5MB 5E4IA 4F80A 2W9LA 1ND0A 5EIVA 3GDBA 3MNZB 2WK2A 3V4VL 3QEHB 2GCYB 3NVQA 3HRPA 3WBDA 4AIXA 4Q2ZB 1IC5L 1GHFL 5HYSB 2HKHH 4X6EB 1M7IB 1E4XH 4Q6IA 3MV01 4R4FH 2DYPB 4UT7L 4NRXA 4KKBD 3S35L 3SCMC 5CCKH 1S7UA 2FJGB 2PCPB 2NXZB 4N8CH 2VDML 5HGBB 5CD5C 3X13B 4Z8FL 2PYEA 5IB3A 5D5MF 3DBXA 5TE7L 5BVJB 1TNMA 2X40A 5CP7A 2HJKB 1G7LB 2ORBL 4UNVA 1NJ9A 1N7ML 2P4AB 4I9WD 3MCKB 4RMWA 3T0EB 2K9UA 3MV8D 4K07A 2E7HA 1UZ6E 4YH6A 5HJ3A 4XTRC 3CVIL 4H26A 2DD8H 3LKSB 1UM4H 1MREL 3QFJE 4R2GB 4R4ND 2MKWA 5IB2A 3MCLH 3PV7A 3PV6B 3VG0L 3MZTA 5J1AA 1UM6L 4X0KB 5L0QB 1AD9B 4QEGA 1H3WM 1QKZL 2EEBA 3FFCB 5J13C 3H9ZA 3OL2A 3EYQC 3GMRA 4DZBB 1ZS8B 1QFPA 1KSRA 2APWA 3BQUA 4IJ3C 3T2PA 5KW9H 4XMPL 1QFWH 1T3FA 3THMH 2V5TA 3CK0H 3FB5A 4NBZB 4PV8B 4K8RC 2AGJH 3UJIL 4NO3B 4LDOB 4JM2A 4I2XB 4WDIA 1QLRA 5F70A 2IADB 2X89A 4GXUM 5DJXB 1E4KA 5E00B 3BP7B 1MNUL 1IBGL 3MUZ1 4BZYA 4U05A 1KJ2H 4TNVF 1W0VB 1B4JH 1QLFA 3OKEA 1KCRH 4OLUH 4EI5A 1TZIB 4ELMF 5I74C 3B2UC 3QIWC 4U6YA 1G1CA 3B2VH 4D9RD 3LOWA 1IGCH 1G7MB 2BSRA 4PRHD 3TBWA 4RWYH 5HHMB 43C9A 4Y89A 5ID1A 2R23A 4P3DB 2EYTA 4HW6A 3HUJF 4DGVH 1YNLL 2VXUL 3BH9A 1X7QB 1RQ5A 2BMKB 3BP4B 4UDTA 5DMYA 5TPWH 3BKJH 4NWUL 1PZUB 3NIFF 1RK0A 5JXED 1GZPB 3DMMD 2XTJD 5GHWH 1AGDA 1A3RH 1ADQL 3MRBA 4QRPB 3TLRA 3V5HB 3P0VL 4MJIA 4G6MH 4PJIB 4M6MH 4QTHB 3MFGB 4PJGB 3RVXD 1CLZH 1QD0A 4I3GA 5F71A 5ESVA 5TE6H 5JHDB 1IGML 3NZ8B 2HVKB 3KYKL 1UWEL 2P8LB 4HJGA 1PVHA 5AUMB 5T1LA 4YX2H 4LSPL 4ELKB 4IDJH 5E2UH 3ZHLA 1NC4B 3Q5YA 1NAKH 4WW2A 5FUCC 3MV11 4PPTA 5D96B 1QFUH 2I60H 2OTUA 1BQHB 4O02H 1NMCC 3SDXA 1DL7H 3VGAC 2H32H 1BGXL 3HE7B 4GAYA 4U7SA 4Y2DA 1BD2D 2BOBB 1NQBA 4F37F 3GMNB 2D7OA 4JJ5A 4J1UA 5I2IA 1A14H 3F58H 1U2HA 1YEKH 4JFXB 4HS3B 1XGTA 1HILA 4MHHI 5CIPA 3B9VA 4WFFE 1SEQH 3ZDZF 1FCGA 2A74B 1I3UA 2LAAA 3FQRB 1I1CA 2H1PH 3T0ED 5C8JA 3MUGA 4LEOB 2W38A 1CDUA 4I8DA 4NDMA 3WEXA 3CFEA 1CQKA 5IVXE 1FYTE 4YO0A 1BIIB 4NQED 1NGXA 3QH3A 1T83C 3UAJD 4E41E 5I1LB 2XIDA 5DRZA 3M17B 1ZSDA 1NAML 3FQXB 3MLVH 5CEXB 2APBA 2ZUWA 1RUAL 4UIKH 1P4LA 5FYKE 3RU8L 1RURH 1OGAA 1FO0L 4MQXD 1DFBH 1ZWIB 4Y5XB 5LWYH 3TO2A 1AI1L 1BFOA 5JXEA 3PHQB 4C4KO 3OPZL 4B41A 1XF3B 2ZPKH 35C8H 4UNTA 5GSVB 1NAMB 4NQCB 4L29B 1IGIL 4DUWA 4CMMA 1AXTH 4BH7B 4K2UL 4KK8C 3GHBL 2NY4D 3VG9C 4BZ1L 4Q9RH 1WFUA 1XCTB 1JN6B 1B6UA 4FQPA 5DJ2B 1Q9LB 4ODTH 5F9WB 3O0RH 3DYOA 4CL7A 2RFXB 4CBPA 2PUQT 4QXWA 1MRFH 4NNYA 1JV5B 5JPMA 3P0GB 4ZMAT 5F7LB 4M6OH 4N9GB 1CFBA 3VFGH 1Q1JL 4Y5YB 3WFBH 1HK6A 4I77H 3BESR 3I2CH 3HKFA 2UV3A 4G80B 3QDGD 3JV6B 1DBML 3D9AH 1F6LL 1YNKL 3OAUH 1WIUA 4C56A 1NLDL 1R0AH 1DQLH 4POUB 1KB5A 4O2CB 2R2BA 4AH2B 3QB7C 4WFGD 3MC0A 4MX7A 3ZHKA 4PBXA 2WBKA 4XPTL 4UQ3B 5DO2C 5MP6H 5SX5K 1FFNA 4ODXA 1SJEA 3CC5A 3L3HA 1W0WB 2WBJA 2E8YA 2NR6C 1CDGA 1T21A 4QHLB 4NRZB 3U46B 3D2UB 3U30C 2UZIL 4P2YA 5DYOB 5IVZB 3QT2A 3HZYA 2ID5A 1T04B 4GRWF 3D3VD 2BK8A 5ALBH 4J2XA 1DBBH 4K9EH 4Q58C 2ZKHH 5F72S 4XVJL 4PJ8C 2H2SD 5B39A 1YEIH 4GMTH 3GSOA 4UT6L 3UBXI 1KYOK 2NY3D 32C2A 2A9NL 2CK0H 2YPKB 3RUGB 4MS8D 3FO1B 3KPOA 2ZOLA 1KPUA 5GS1C 4HS8H 3VW3L 4NGHL 1D6EA 1KEGH 3HNTL 4POYA 3KYNA 3WXWH 5DJCB 4WI2A 3VMPA 4R3SA 1GHFH 4IBLT 4QF1A 4YHKL 3ARXA 3EZJB 4NHCL 3NN8B 5C0IA 3EOTL 1RJYA 4AIZB 2KKQA 2PETA 5AD0B 1MRFL 1R5IB 1ADQA 1MF2L 2KUTA 4FTVD 4P46A 4HIEB 2JJWA 5IW1B 2EC9T 2C3XA 1QVOA 1CD1A 1SMOA 5HYJE 5IHBA 3HPLA 1HYSC 1IGTA 2RHEA 2XWTA 5C0JA 2VDMH 3EJZC 1W72A 3EOBA 3K3QA 5JQ6L 4MSWB 1B0RB 3RVTC 1PYWB 1R3LA 5AG9A 4X6BA 1A1OB 2EKSA 3JXAA 4NHUA 4F7EB 5D2NB 4KZDH 4PTTA 3ZDZE 1CGVA 2V9QA 4KTDL 2VXVH 4OV6F 1WK0A 4DOHE 3BMWA 3B9EA 2FRGP 4ALAH 3U30B 3E8UH 3VA6A 5GS0D 4U1KA 1T0NB 4NKMB 3VFSA 2QSTA 5IHZB 1IQDA 4DGYH 3K46A 1F6AB 4LBEA 5KG9A 4L4TE 3GBNL 2YPLD 2WWKT 2M1KA 2C4FT 3OXRA 3GI8H 1CU4L 4X6CF 1Z9SA 1RUQL 4W6XB 2NW2A 2VISA 2BY0A 4YUEL 3VXUD 4AEFA 3S9DB 1P2CB 1BBJA 5L88H 3OJMB 1M1SA 2GKIA 4NJAL 3EO0A 4GRLD 4OB5L 4J6RL 4KZEL 2HLFC 4KH2A 4P2RE 4LSDA 5T1DL 3LEYH 2XZQL 3KXFD 4U1IB 4AM0A 3HI5L 4HWEH 3IDMB 3B9AA 3S96A 5I73C 3MOAH 1XIWB 5J57B 1WFOA 1OSZA 2ED8A 1NC2A 1RHHA 3RY5A 1ONQA 5LGJB 2J6EL 4KMLB 2ZCHL 3ME0A 1QSEE 1S9VA 3QP3A 4TUJA 5B21A 3ZE0E 1RZGB 1J9CT 3BPCA 3NFSL 4RAUB 3U82B 4O02L 4G6JH 3VH8B 1NCWL 2GTWA 4V1DE 5IWLC 2UUDH 1ACYL 4NN6C 5JUEH 2Y36L 2AW2A 2BSED 4PJHB 5D1ZC 3RHWF 1GH7A 4G7YL 3KPRA 3PUCA 1UYWH 1DVFD 2CSPA 1W2KT 4XCCL 5TE4L 1NMAH 3HFML 3KWWB 4FMKA 5L6YL 1YYMH 4DK6A 3PWVB 3TA3D 1MAKA 1RV6X 1X6NA 5LAXB 4P2QA 4HUXA 3VXPB 5JHLL 2ESVA 3JVGA 3RKPA 4OD1H 4F58H 4UV4L 3QNZB 3U0WL 1KTDA 1A21A 2NW3B 2XV6B 3T3MF 1ADQH 3S34L 1FG9C 3B5GA 5T5FL 3D18A 4G43B 4M48H 5FYKU 2ICES 3OKKA 2AJ3A 5E9DB 5IROC 5T5NG 1ZMYA 4W70A 3SDAC 3O9WA 3C8DA 4O58L 3WFEH 2MCG1 4K3DH 2H8PA 4XP9H 2OI9B 4RQQB 2F8VA 1Z5LA 1R3JA 4QOKA 3LDBB 5M95B 4H0IA 2YSSA 3BE1L 5CP7B 4M8VA 2APTA 2CDGA 5TJWK 5C9JA 4Y16D 1JGUH 1P7HL 4LRNH 5C09B 1F4YH 1UH2A 4ZPTB 3TCLA 3HAEG 1EBPA 4J3UA 4BKLB 3SKOB 4ZAKC 5HVHB 1KJ2L 4RZCA 5IW6B 5KVMC 3IDXH 4XPFL 3PV6A 5DQDH 1MUJA 2WQRA 1XCQA 4ODUB 3E6FA 3MJGX 5FYKH 3MACH 3P30L 4GH7B 3UTTE 3UDWC 4PRDA 4JM2C 3WIFA 5F89B 5E8PB 3TV3H 4ETQB 4XVUD 1BGXH 5EULV 4QRSA 2ICWB 1A6UH 4U4BA 2VITA 4J8RA 3P11H 4RMRA 4XCFH 3K4DA 1YPZB 4KV5F 3FB5B 3LRHA 4IRSD 4PV8A 1U8NA 1I9JL 3PHOA 4F15B 1YPZF 2ENSA 3CZFA 4YX2L 1XGPB 5HYJB 4I9WE 4MJ5B 5JORA 1A7QH 4L5FL 4XZUB 2VXTL 3UTTB 2NY2C 5LVEA 2A6DA 2R2EA 5CJOL 4HZLB 3V4PH 4IOSD 2EDXA 5GIRB 4NQVB 4HIJA 3T1FA 5EG6C 4KI1A 2FZ3A 2O5XL 3TESA 4U6YB 4JHWH 5DD0L 1UJ3A 1I9IH 1F3DH 1F5WA 4JDTL 4QT5A 3BAEL 1G9MC 2R1XB 3GSNH 4K71C 2A0LC 1KACB 2DDQH 5TGBA 4I3SL 1U8IB 5E8DH 3TN0A 3X17A 5EU6B 1X7QA 4CMHC 3A6OA 3UXFA 4WUUE 3RI5F 4KQ3H 1AR2A 1NMCB 4P4RB 4YE4H 5KOVC 5DT1H 4BQ8A 4Q0XL 4L4TB 3BE1H 4P99A 2D7MA 1RJLB 1IM3B 1IM9B 1NGZB 1XIWD 4XI5D 3LKOA 5CJ8A 5IFJA 2ZJSL 1BOGB 1FO0H 3LV3B 4U1HB 3WCYA 4FFWC 4NKOB 1RY7B 4G9DA 2V6HA 3DRQA 3BAEH 1RIHL 1XR8A 4P2RD 3C09C 4NKDB 4MXVF 4PTUB 3EYVA 1OTSC 2F74A 4YHNB 3LPFA 1ZVSB 5K9QI 1P4BH 1QBMH 4JY5H 2E3VA 2HVKA 5DI8A 3SPVA 4UNUA 4HH8A 5D7JA 5SX4H 1WC7B 3WLWC 4GG6E 4KRLB 1MCCA 4F33A 1JNLH 1T7XA 4CKVX 4PJ5E 3B83A 5TQ2H 2ZSVA 4OKVB 1A7OH 1DQLL 4OZIB 3Q0HA 4WFHD 3QI9C 1CD0A 3RIFF 3VGBA 4LCCB 5IFHL 3QUYA 5D4QA 4J1UB 4WENB 1J12A 1OAUL 5IBUG 4ACPA 4P2OC 4X7TB 1U8QA 1AE6L 4GW1A 2CR3A 1DLFH 4Q97A 5BS0E 3BUYB 5C08D 4M6OL 3CVHB 4QXTB 3RAJL 2HFTA 3Q1SH 3SO3C 4BA8A 3KYOA 2D0FA 2YWZA 2F54D 1A5FH 2PO6C 1G9MH 2VO5A 3BW9A 4G7VL 3VGDA 4F7CB 5DD3H 4S2SB 1RUMH 5GJTH 2OJZL 5DUML 5F1IA 5BRZA 2Y36H 4PD4J 1DQQA 2GK0A 1X4YA 1U8JB 4JFDA 3NBNA 5D8JH 5DTFA 4MQ7B 1DE4A 1G6RA 1N8ZB 2B4CH 2JB6B 3QFDA 4HJJH 2IBBA 3IDIA 1MCNA 3UTQA 1YY8A 1DR9A 3W9DA 1U58B 4KAQH 1EHAA 1LDSA 1ZWIA 2B1AL 3IDGB 2BNUB 5E5MA 3LN4B 4FZEH 1J1PL 3HRZA 1IC4L 5GSVA 1S9YA 3BEWA 1G1YA 4YDVB 1T5WA 3SKNA 3EAKA 2AEQH 4PJ7F 1AKJD 3TPUB 4R96A 1MRDH 1JN6A 5DMKA 5IMLB 3PWPB 3U9PH 4RMUA 3C60C 4APQA 3D3VA 4MQSB 3NACH 1RJCA 1FV1A 4NZTL 1MFEH 3INUL 2NY4B 1S7SA 2X5PA 2P5WA 3NZHH 1KCLA 4JQIH 3VU2A 1UWXK 3WNMA 5CEZD 3T4YB 4P59L 5EUOE 1J1PH 5I8CB 1ZA6B 1EZVX 2Y5TA 2DWEB 2DJUA 3E8UL 3QIUA 1IGFL 2ARJQ 3RL1B 4J7RA 4D3CL 1T1YA 5MENB 3BJ91 4WUUD 2VH5L 3L7FA 4NUJA 3W0WB 3GSRA 2I25N 1DEEA 3OGCA 3CFIC 4PGEB 1IC1A 5IG7B 3H9YA 2FX9H 3C8KA 5JQHC 2AGJL 3QHFH 1LK3H 1S78C 4MLIA 2ZUVA 1LE9A 1IM9D 1DQJA 1KIPB 4L9DA 2XRAH 3P4MB 4M62H 5DDHA 3LEYL 2A9NH 2CK0L 1KCSH 3BEVA 4OB5H 3PDGA 1JP5A 3FT2B 1FFNB 3IJSB 5E2UL 1J1OL 2ZUXA 4O2EA 1BAFL 1U91A 4ERSL 3W11D 1I9RL 5D6CA 4HUVA 1D5MA 5IQ7L 4RX4A 4JPVL 3N1MC 2NMSA 2NY7H 3TNNA 5HXMA 5SWZA 1YJDH 3HZYB 1M6OA 3SDDB 4GRMA 3P4LA 4Q2ZA 2GUOA 2YC1A 3NCYS 4Z7NE 5L8LB 4IEFB 1TVBB 1VEPA 4P9ML 5D6DC 1RJZA 3GSQB 1K5NA 4J3VA 5FOBA 4Y5XC 2B1AH 4LSVL 1MFDH 1CL7H 2NY2B 4JCMA 4X4YA 4D9QD 1IGJB 4OTXH 2IQ9L 4RIRA 1CXLA 3FO1A 4MXVE 5H2BB 2HTKC 3SGDI 5HBBA 1HYRC 2D9CA 2ED7A 3KYNB 5DJCA 4OCRL 3DHJA 4E5XB 5J13B 4P3WA 5F9WC 2J8UA 3MRFB 1DTUA 3P4OB 5HHNA 3GSNB 5ABDE 4FQXD 2J2ZA 3FB8A 4M6ML 2JJVA 2H26A 5HGDB 2EIZB 1MH5A 5C92A 4PLOB 1RULL 1UKTA 3IJYB 4XHJD 5K9JL 1LMKA 1M4KA 1UEYA 5DA4A 4OZGA 1CD1B 4DVBA 3JV4B 4WEMB 2A6IA 3KPNA 5E7BA 3RGVB 4YDKL 2FGWL 4NNPL 1HXYB 2OJEB 4JFYA 3OAUL 4N8VA 1Q38A 4MNGA 1UXWB 3DUHA 1KPVB 5C0AE 3W82A 4G8GA 3S97C 2O5YH 2FIRT 2HT4C 4WVRA 3IDXL 5DQDL 1R3KA 4MJIE 5BV7H 3GZKA 1FHGA 2UY6A 3RWCB 5ISZA 1OAKL 4PLKD 4XVSL 4LBEB 5DJXA 4XCNA 1HHJA 3WNLA 1FP5A 2AXHA 4PJXF 2NY5C 1SEQL 5JHDE 1C7SA 4JB9L 5I1AA 3E6HA 2FEEL 1I3GL 1QRNB 1UM5L 1X5AA 3GMOA 5FK9B 2YPLE 1E6OH 2JJSA 2R23B 2B1HL 3WL9B 3DRTA 5C0DB 4K3DL 2HLAA 3BKYH 1A7QL 3ARRA 1ITBB 4P2OB 5GQBA 3D0LB 2MMXA 3FJTA 1I4FA 2X4OA 4U1IA 1EEZB 3QG6A 3IT8D 1FZKB 4QGYA 1T6VN 2EZ0D 4F9PC 2YUZA 3V0WL 2GSGB 3EDKA 2X89D 3V0VA 3MV7D 3LZFL 5FUZH 1J8KA 2B8OT 4HFUH 3OMZA 3KXFB 2YD4A 3C08L 2B4CL 1HH9B 4L4JA 3SDAB 5BZDA 3SE9L 1MFBL 2UWEE 1PFCA 1WZMA 1AIFA 4KKBC 4WFEE 4XBEL 4K23H 1BVKA 4X7SH 4HX1B 4GAFB 4NJ9H 2V5YA 1OWWA 4FQQA 3DWTA 4HWBH 2EXWC 4NFCA 3IRPX 1IARB 3D5OF 3RAJH 4WW2B 1A6VL 3T3PE 5C0RH 6CGTA 5I75B 3OWEA 1CDHA 3MYJA 3QQ9D 5FXCH 4HDIB 1F42A 4PRPB 2MHAB 5DMGD 3SDDD 1B3JA 1UJ3C 1SM3L 2EYRA 5AZEL 1NGWA 3BGMB 1FZOB 5I1EH 1ZE3C 1L0XA 1KF9B 1BWMA 5I2IB 3T0XA 4R4NC 5DD1L 1KCVH 5J6GA 4YGAB 3GMMB 3MR9B 1WBYA 2J7LA 5C86A 3MRPB 3Q3GA 4W6YB 4MB3A 2HMID 3MLYH 1ZANH 1BQHG 3DVFA 4Z7UB 2DQEH 1JZ4A 4JDTH 3P40A 1JPTH 2GQHA 3LVEA 1RIUH 1PD6A 5TFSL 1XGUA 4L1HA 3BHBA 4KMQA 1F8TH 2DLEA 4LHUB 4YQXL 4PJ5B 1HHGA 2K3TA 4UTAH 2ZZUT 5T1KA 3LCYA 2R56L 5F96L 1KN2H 3NAAL 3SN6N 3U1SL 2WP3O 1I7RB 1WEJH 2AKRB 2PR4H 3QUMB 3S37X 2Y07L 3KDMA 4P2QD 1A7OL 3GSUB 2H3NA 3QUMH 5H37G 4Y4KB 1MCOH 3SQOH 3G6AA 4K3EL 5IKCB 5C71A 1VHPA 4JDVB 4XP6L 4OUOA 4IRSB 2DB8A 3T08A 4WTZA 2XI9A 5ITFA 2FDBP 2LFGA 4NT6A 1D6VL 1ZLSL 2DQIH 4E0RA 5KANI 2Q86B 2XTJC 2EIEA 5L7XH 5JPMB 5C0AB 3I6GB 3C5JA 4KWUA 4GXVH 4PJAF 1M71B 4AENA 1T1XB 3UZVB 3OQ3B 4RGOL 3LMJH 5CUSH 1GC1H 3T65A 3RVXC 4GBXC 4B50A 4NO0B 3U0PA 4HF5L 2Y23A 5FDYA 3VWKA 3CJJA 5HPOA 5L2KA 1E6JH 4HWZB 1KJVA 3QAZB 3G04B 4TTDC 4Z18A 4JO4L 4NQEA 3VI4E 1P9MC 4L3AA 4R6UA 4O9HH 1FIGL 3LKOB 1A1MA 4L3ED 3QI9B 2LV4A 4XBPB 1WWBX 4XNZB 4DN4L 3VXSD 2ESVE 2RCSL 3LV3A 4ODHH 5IVXF 4ZD3H 2VZUA 2Q76A 3VXOB 4KK5C 3STZA 4M5ZL 1FNSL 3K7UA 4MA3A 1C8PA 3VFPA 2CGRL 2VQ1A 2LE9A 3PABB 2A77L 4HBCH 1GRWA 4PJ9C 1GIGL 3ARGB 2VE6A 1KB5L 1F13A 5DVMA 5EZLA 2FO4B 1RUQH 4L8SC 1YMMA 2GK2A 2NY1D 3D1MC 1UWGL 4P2RB 1ZLWK 2PW2A 4M9OA 3T2QA 3QCTL 4F33B 2ERJB 3KR3H 3CFDB 4C54A 4JAMA 3ARDD 6FABL 4OZIA 5GGRB 2IEPA 2D2OA 1J10A 4KY1L 5GGTL 2BY1A 1C08B 2ZUUA 4O58H 1KPRB 4N0CD 1B9ZA 1KCKA 2AJZA 1JBJA 3MRIB 1IFHL 1QHOA 4XVTL 5D2LA 1X4XA 4H1LG 2VDKH 4TVSa 3QNXA 1FVCA 2CIIA 4HD9A 3KG5A 3WLBA 3GIVB 3MGTB 5DMIL 4M1DL 3UAJC 4MNQB 3F7VB 8FABA 4OZ4A 1S7RA 3ES6B 3MV9E 3HCVB 3H6JA 1Q94B 3ULUH 4PJFA 5CZXC 1N3NB 3BYYA 3DROB 2ZUYA 3R06B 1N5YH 4CDHA 1O7VA 1AXSB 4Z5RA 4XB8A 1KELH 2ZWLT 4Y4FD 3EDFA 5F6HJ 2VQUA 3S3JA 4X9IA 1P7QA 4L9LB 2Y25A 4KK8D 4WCYH 5GISL 1LEKB 4R7NB 5DD5H 1DDHB 5FO7B 5SWSD 2ZPKL 35C8L 4KJYB 4MMZC 3E3QE 5IMOA 1ZHBB 3R4DA 3C8HA 4DKAA 5IJVA 5IQ7H 3QULA 3OSKA 3EYOB 3MNVB 4DCQB 2VLJD 5D93C 5F21B 4KTEL 2Q3AA 2RR3A 4OBRA 4WO4B 4X7CC 5IMLA 5DHYB 5BXFA 5JOPD 4TQEH 3MRNA 1ZLUK 2AJUL 1KEML 4ZDHB 2C3HA 4PJXB 3LKPB 4GMSH 3C6SA 3TT3H 5ICXA 1TPXB 1TLKA 1KIQB 4MA7H 3WUWB 2FHCA 3WJLC 4U31A 3MLXH 4KVNL 3GMPA 2P5WB 3BKCL 4ERSH 1TJIL 3JZ7A 4U7MA 3IDNA 5IJKC 2NYYD 4WWKB 3N9GL 1U8PA 5CHNA 1OAUH 2IG2L 3CVHH 4CVZB 3VXTA 4NO0D 5HGHA 1AR1D 3ZTJG 4WI5A 4OI9A 5FYKD 3ZYZA 1A6ZA 2G75B 3S4SG 4LIQL 1CL7I 3KHQA 2XYCA 4AL8H 5IM7B 4P4KB 5TQ2L 3AXLB 3HB3D 4P5TB 1JGDB 4NQEE 2IF7A 1JZ7A 3H3BC 1HI6A 4PJ8D 1CS6A 1Q72L 3QR2A 5GJTL 1R5VA 3W9EA 4YDKH 1P4BL 4JY5L 4YC2B 3MRKA 1CFNB 1AHWC 3KHOA 5D7JD 5E56A 3RX5A 4D0BB 2ITCB 5C6WH 3O3BB 2FWOA 4GW4A 4RGND 2HVJB 3VXME 5J6HA 3EYSH