1NQBA

Trivalent antibody fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
VQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSSDIELTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0-A resolution crystal structure of a trimeric antibody fragment with noncognate VH-VL domain pairs shows a rearrangement of VH CDR3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords SINGLE-CHAIN ANTIBODY FRAGMENT
total genus 54
structure length 232
sequence length 232
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA02
4X7TA 4IEFB 3RKDD 3MNZB 3O6MH 2A1WH 4MNGB 3TESA 5I1IH 2PXYD 4M93B 5JO5A 1JIBA 4MAUH 4P2OD 3NCMA 4JRXD 3SKUD 5GJTH 5AD0A 2JJWA 1AGDA 1M05A 2YPLE 4TSAH 1FZMA 2B1HL 1G7IB 3LKQB 5DK0B 2P5EB 5KSUA 2FHBA 4G42A 2AABH 2R1XA 1WTLA 3DGGA 1CLOL 4GRLA 1EHXA 4PBWD 4WHYG 4EBQH 2HLAA 2F58H 4NRYA 1SY6H 2AW2A 2J8UF 2H32B 4HUUB 3SDCB 4GH7B 2X2YA 2BMKA 2H8PA 4KUZH 5F21B 2DM3A 1CWVA 1DQJA 4PJGE 1KXQE 3IDIA 3T4YA 3VFUB 4MCYA 4XP6L 4G7YL 5D70L 4YXLH 4GKNB 3HCVA 1A1OB 2BVYA 5T1KB 2VDMH 2AK1L 1UJ3A 2X40A 5I75C 4HHAB 4DZ8B 5BV7C 3S96B 2FATH 5KW9L 5IT2H 3B9KB 5LJYH 2PYEB 4YR6A 1SJVA 4NYLB 3X3GL 3HE6D 4PJGB 5SV4A 4O2FA 2WWKT 2OP4H 4PY7B 3U0PB 4JZOB 4U1MA 4NWTL 2QKIB 1A4JA 1G7QB 3U6RA 1RPQA 2X4SA 2Y06H 3RL1A 5J8OA 2WIIB 4X6CB 2ICWB 3VXNA 3BEVA 2HT4D 4OIIH 1S78D 1OCWL 1MWAA 1DTUA 3DRTB 43CAB 5IW3A 4E9LA 5IB3B 3IB4A 3MNWB 3ARFC 1FCGA 2AEQL 1J0YA 3T3MF 1LO4L 4HJ0C 2IQ9L 3MCLL 5IP4A 4YO0A 3QQNA 4MD4B 5E4IA 3HI5H 4Q6IA 3FO9A 3UJTH 1YEEH 4RISH 1XZ0A 3G08B 3ULVD 1ZVSB 4R96A 5I8OL 3CLEL 1U8KA 3L3IB 4LGSB 4OZIB 4PJEB 1S7RA 5FM8A 4KI5C 2DDQH 1G7LA 4F2MB 4TPRL 4TOYH 4AEFA 3BKML 4EI5D 2VLRA 3GSQB 2IPUG 3P4NB 3SDDD 2DLFH 1A22B 3BO8A 3WHXA 3MBXL 4X9GA 3BN9D 2AJ3A 5SWZE 4ZXBB 2F9BT 5E9DA 1HHJA 4Z9KB 1KJMA 2BHYA 2NY1D 4AIXA 4O51A 1RU9L 5FUZH 4GXUN 3VXME 5BRZA 3TJEL 3O4OC 5D1ZA 4Z0XA 2J88L 4M00A 4Y19E 3WUWG 5IW6A 1LQSR 3QZWB 3LN5A 1XF2B 1ZANH 1BFVH 1RULL 4NO2A 5EZLA 1MCEA 4OM0H 4M7KH 2VNCA 1RUKH 4JFDE 3QEGH 2FJHA 4G3YH 2DYPA 5T3ZE 1K3IA 2Q86A 4P2OC 4QRUB 3I02B 4I18C 1YZZA 1IGYB 5KANG 1JZ5A 3ESVF 2IANB 1F2QA 3MJ8A 4B5EA 5C0EA 2QQQA 1K4DB 2EEBA 3I50H 4J7RA 4E41A 5KANI 1CQYA 1QLEL 3V5HB 2IANA 4X9BA 1J18A 1F3DJ 5ISZA 2VR5A 3EYOA 5TGBA 3PE9A 1WICA 5D7IB 2ARJQ 5EU6B 5DSCB 3QIUB 5JW3L 2WP3T 5H8DA 1DQML 1NSNH 1AHWA 3FFCA 1MLCB 3CU7A 3NZHL 5DSCA 3MYJB 1S7TB 3BWAA 3NH7H 4UUJA 4CL7A 1PDKA 4FNLL 3NBNA 4YHYB 1VACB 1NMCC 3H9ZA 4LHUA 5ERWB 3SKJH 5HI4C 5B39A 3M17A 4QGYA 4LSUH 2AJSL 5K9JL 1FVDB 2X1OA 5MEOB 1WGOA 4YEEA 4H8WC 1FL6B 4ZS6D 3FQXB 4HGWB 5GZOD 1ULVA 2ADFH 5EOTA 4X0KB 4B41A 5MENB 5CEXB 3QXWA 3LEVL 1BD2A 2VH5L 3HI6L 4QYOA 2OMBA 3MRMB 1VFUA 1MAKA 3QUKB 4IIQC 1Y0LB 1RUPL 1M05B 4PJ7A 2EDBA 5JHDE 3FQTA 1LD9A 4P5MB 4X5XB 4PJ9D 3BQUD 2NY0C 5D8JH 5JPMB 4G8FB 4LLAA 5GGQH 5KN5B 2N1KA 5MEND 1VEPA 1DVFC 2M1KA 5E1HB 1JI2A 1V3KA 4HMCA 1KLUA 1JHLL 3D39B 3HE7D 1JYXA 4QHKI 3OAUH 3TFKC 4GRMA 3WNOA 5F7DB 3PHQA 4YX2L 2A83B 4KHTL 4IRSA 2UY7A 3HFMH 5HHPB 4ELMB 4Y4HC 1G7JA 2J3SA 4UQ3A 5J9PA 2FLRT 3GBML 3HPLA 2AJUL 3RZCC 4P3CL 5JOEA 3KJ6H 2Q76A 2ZNWA 4N0FB 4HUMB 1NL0L 5I0DA 3CXDL 1FAIH 4OZGF 4PY8I 3B4NA 3HC4H 2PF6A 1D5BA 3L5JA 2VAAA 1KG0A 4KUCD 2Y6SD 2B0SL 2KQMA 1RZKH 1YMHB 2HRPL 4OCRH 1NLDH 5KJRL 4LSPL 4KI1A 3UTSA 2EDHA 3IJSB 3VXOA 5GRWA 1W72B 4X9FA 5DJ6B 5F97E 4HIEA 4G3YL 4DFIA 3DSFH 4OCNC 4F15C 1EEYA 1X7QA 1QG3A 1CLYL 4TUJA 2ZUQB 2EDYA 1Q72L 3RU8L 4P9HC 2CKNA 5BRZD 2CK2A 1DQDL 2FD6L 2CMRL 4GXVH 3FONB 1NGWB 2GK0B 2GHWB 4UV4H 1PZ5A 5JMRA 4WW2A 5JXEA 4HXAH 4Y2DD 3WUWA 5D2LE 5I66A 5FYKH 5DJCB 1B6DA 4UBDD 4WJ5B 3TN0C 1KEMH 3ULUH 4I13B 2O5YL 4LLMA 1GGBH 5DEFA 5SWZD 2ICCA 3J7HA 4Y8AA 1OARH 2NY5H 1NH6A 4G6KH 3LZFH 2AAVA 2NY6C 4WUUE 4JANA 4G6JL 1GPOL 1I8LC 1II4E 4Z76B 4JZNB 3VFSA 3TVMB 3LS5H 1CXIA 2BCKB 1PYWA 1ZT4A 1MNUH 4I0KA 5C9JA 2JCCB 1DQQB 4NBXB 2VLRD 1VCAA 3L5HA 4M7LT 3VE0B 1MPAL 4XPTL 3MTRA 1I1AD 1JFQH 3RX8A 4QXTB 1G7LB 3CFJA 3VFNA 4F2MA 2EDQA 4OBSA 1WCQA 1ZHBA 4HUNB 3C2AL 3RA7H 1I7TA 1IAOA 5DD6B 4TVPL 4UDUA 4NO0D 3MOBL 3P9LA 2B4CL 1K2DB 4P48A 4NKQB 35C8H 4FQHA 4P46A 3QHZL 3BQUB 3GJFA 1FYHB 1TNNA 5FM5M 4QHNB 4XAKD 2CDGB 4Y1AE 5INCB 4IM8A 1AIFB 1A7QH 1X5IA 4D0BA 1UB5A 3STZB 5BZWB 1QBBA 2EYTB 4HWEH 4G6FB 3NPZB 4NJ9L 1A1NA 4FXGA 2FHFA 3U7AA 4BK4A 4BFGA 3NPSB 2E9BA 1BX2A 1OGAA 4JHWL 4PJ9B 2XN9D 5CBEB 1ZWIB 1NCBL 5E9DE 3C87A 4L9LB 5AAMA 1YQVH 1F6FB 1S7TA 1PEZA 2HFGL 1B90A 5IHLB 2NXYB 3VWKD 5CJOH 1N4XL 3QJHA 2JCCE 1PG7L 1TJGH 4N8VB 4NJAL 2QEJA 3MLUL 5C0FA 2IWGA 2YWZA 3GFUA 4JN1H 5IB5B 2QKIA 4K9EC 3RTQC 5IK3A 3CIQA 3WSQH 3TT3L 3O8XC 1L6ZA 5DWUH 2HKHH 1R3IL 4DJMA 2BOBA 1R3JB 1DBAL 4MJIE 3CFBB 5IB3A 4R9HA 4F7EA 2A9ML 5I74B 4XMKL 3BGMB 2YC1B 1A7OH 1VGEL 3AY4C 5DA0B 3VA2C 2YD6A 3FZUD 2BSSB 4U1LB 4XC1L 3I85A 3X14B 1RUQH 1YECH 1JNHA 3T0VA 2GSIB 3DX8B 4FFWC 4I3SH 1ZEAL 2IPUK 4EOWL 3WJJC 3V0VB 4FXKA 2BC4A 5IB1A 4ETQB 4QHKJ 5C0IB 1GGBL 3IDUA 1GZPB 1ZGLP 4HG4K 4YHZL 1KCLA 2OJEA 4NZJA 3GI9H 5JLZB 3QEUB 2VLLA 4ZTPL 5KOMC 4MS8C 4I48A 4LHQB 5B4MC 1I9JH 1HHHA 3QCTH 1I7RA 3FKUS 3DTXB 1MFCL 2W0PA 4H0IA 5H94B 5J3HD 3RKDC 5KSUB 1FLRH 1MI5B 4Z6AT 3FT2A 3TT3H 3WXWL 3ALWA 5I1LB 4PGZA 4UAOB 4PJAB 3OPZH 2AJYH 3MUJA 3RIFK 1S5HA 4D9RE 5GZOC 5K9JH 5TDOA 5FECB 1BBDL 4XHQA 4LPYA 5BQ7B 2JB5H 3MA7B 1N5YL 1NC4A 2OR9L 4PJBA 2H2SD 2JCCF 4KKCC 1Q94B 1NJ9B 3ILPB 4FTVA 4NCC2 4NHUB 3IU3B 4UOW0 4PJ5A 2FSEB 1ZKAA 4L3CA 1VDGA 5E8DL 3VFTA 1RIHL 1M7IB 1WZ1H 2F58L 5MI0C 1A1OA 5E8NB 4U6HB 3X13B 5ISZB 3IFNH 2IPKB 1JZ8A 5JOPD 1FNLA 2ARJA 2BK8A 5C6PB 4MNGE 3WJJA 1M6OA 4PJ8C 1A6TA 1F58H 2P46B 3HE6C 4X99B 3SO5A 1UA6L 3VGDA 5J57B 1OF2A 1IC7H 3I6KB 4EUPB 1YEKL 3B9KD 4FG6D 4U1IB 1IEBA 1A7RL 2VXQL 1AR1D 3L5XH 3MLSH 1BVLA 4HC1H 2P5EE 3F8UB 2LQRA 3PWNB 5C3TA 1HYSD 1S78C 3EYSL 4NC1C 4NZDA 4CMMB 2GTWB 1DVFB 3FQXA 4HGWA 4BSVB 3SDAA 5C0RH 3SGKC 3U2SA 3STLB 3HE6B 1IC5L 4PJAE 3HR5A 1INQA 4NNXA 2ATPB 1IEAB 3LKNA 4H26B 5IFJB 4JFFB 3SKOB 4QT5B 1KACB 2NTFA 3B2VL 1QSFA 3BDYH 5F93C 3GI8H 3TO4B 3WIIH 1A4KB 5L2KE 5TQ2L 5L88L 3QWRD 2UZIL 4RZCA 1CU4H 4N9GA 2DBLL 4OZGB 3G5ZA 3MFFA 2FIRT 2NXZC 3C9NA 3BMVA 2XTJE 1RUAH 4KJPD 4Z77A 1JCKA 2OXHA 4FQXC 1AXTH 1MHEB 3M1BA 5EZOH 4OV6F 3QRFM 5FDYA 1S7QB 5E8PA 1PEWA 4XT1C 4YAQA 4KK5D 1CFNB 5IGXH 4YDVA 4ZTPH 1NGQL 2FD6H 2CUMA 4DKEL 2BNRD 1BAFL 3QG6A 3OWEA 1NGPH 3HZMA 1YEGL 2W9EH 1LEGA 2EECA 3U7YH 4BQCA 5I1CL 1HHIB 2CD0A 1CIDA 2VAAB 4Q7DA 4M62L 2DQFA 2VLMD 2BSRB 4ODVL 4CAGA 3TJEH 4MJID 5LGHL 5I8EA 1FO0L 4JRYE 4YHLL 3LV3A 5HI3C 4U6VL 5JORB 3SGDH 5AAWA 3F12A 1LO5A 5CIPH 5ADOL 1M7DA 5IK3B 4KRLB 1NMBL 2OTWA 1C5CL 1OB1B 3EFDL 4YJZL 3O41A 3V0WL 4FFVD 4J3SA 3MCKB 3OKEA 4GRWF 4LU5H 1Y18B 1N6QH 3QJFB 5JIPA 4XP4L 1A9EB 2RGSA 2ZSWB 1OPGH 3MCKA 2NMSA 1J05B 3RWFB 1G7IA 3UCRA 2IQ9H 1SMAA 4GQ9H 2H32H 1ITBB 4GMTH 2H2PD 3HI5L 1KV3A 2JJTC 4XP1H 4G80A 1FVDA 5I2IA 4G9FE 3KPSB 4AMKH 4DGVL 5B8CC 4O2EB 3O8XD 4PP2B 3C8KB 3FO0L 1KB9J 3CMOL 4YE4H 1KOAA 2CJUH 4B7IA 4LPVA 4PP1D 1TNMA 5C70A 5DI8A 5EBLA 3QT2A 5SV3A 1V7ML 4Z7VF 2YD4A 4QHUB 4YPGB 2E8ZA 5EA0H 2P49B 5DMGD 3PDDA 2AERT 1TVDA 3FB8A 4MCYB 5D71L 3EYVA 4RQQA 1UM4H 1MRDL 3BWUC 5IVXF 2PYED 2NZIA 4AH2A 1ZHKA 3IKCB 3U9PH 5EOQH 3V95A 1K6QH 2G75B 4M1DL 1NC2D 4MXWL 4J3WA 1G84A 1I8KB 4LRIC 4MA3A 4U1NB 4UNUA 3LKPA 5T1DL 1A9BB 3OHXA 3QZWG 4X8JB 2Z8WC 2UZXB 3LEXA 1T7VA 1A3RH 4QHLB 3EJZD 5GRXG 2O61A 4M8QA 3LKPB 2X9XA 2DF3A 5FO8B 2HFTA 2ICWI 1T0NB 4XP1L 3IDYC 1HIML 5H35A 2LU4A 4YHPB 5HVHC 1I1RA 2FATL 1QR4A 2J5LC 2J8HA 1RMFH 2QSCH 2FWOB 2X4QB 4J8RA 5IQ9B 3OJDB 4L8SC 2IAND 2XNAB 2YSSA 4N8PA 2IMMA 4KQ3L 3VGAC 2D31B 2YMXL 3NA9H 5DD1H 4PJBB 4TSAL 3G6AB 1DR9A 1IM9B 3P11H 1T1WB 1T3FA 4Y88A 4KFZC 1R6VA 1WC7B 4F33A 3VFMA 2CDEB 1IGTA 4J1UA 3GI9L 4ZSOB 4FP8H 4ODHH 1P7QD 4MYWB 2VAJA 3SO3C 2CUIA 4P9ML 2PETA 5ISZE 4X6CF 1WWWX 4HS8H 3T08A 4RX4D 1GGCL 3VXRB 1MFDH 4NM4L 4BUGA 1QP1A 3DSFL 3RGVD 4PV9B 1RVFH 3KXFA 1G6RB 4MNQB 1CK0H 1RZ8A 4LRIA 3OAYK 5HD8D 1Z9SA 1RUPH 1IGFH 2BVOB 3KLAB 2HMIC 3T4YB 2MNUA 2VN7A 1FYTB 5IIEA 32C2A 4Z0BL 1EFXB 3BUTA 1RZFL 4AM0B 1AFVL 5ACZA 1QSFD 1B2WH 3UTPE 5FYKL 4KC3B 3GIVB 3BH9A 3IFLL 2R8SH 5D1XD 3JV6A 1JWSA 2MCG1 2NX5B 2R4SH 3LKSA 3QEGL 1LK2A 1EK3A 5D6CB 1MHHB 2J8UB 1AKJB 5DHYA 4LSDA 3CCHB 5E5MA 1Z2KA 4ZAKC 1L9NA 4J6RL 2ZOLA 5IV2A 1YEHH 4RRPG 4KKBC 2K1MA 5MEPA 4ZD3L 3WMSA 2DQHL 1U3ZA 3FHAA 3N50A 1KT2A 1IAOB 1SJHA 2XG5A 1A7RH 3REVA 4S1QL 1EGJH 3SOBH 5CLWA 3U7WL 3HS0B 3O4LE 1EMTH 1CT8B 4MXQC 3SPVA 3LV3B 1S7QA 5E8PB 5I19H 1VEMA 5E1AA 2A74A 1Z3GH 3F7VA 1XGQA 4AEHH 4QCIA 2XV6B 3I6LE 5MEQA 1CFQB 1MFAL 3BPLB 1UXWA 2XA3A 3NOIA 5C07D 2Q8AH 1ZT1A 4Z7UF 4QWWC 5KZCB 2DMBA 2VDNL 4MJ2A 2YD2A 1UXWB 2PO6C 2MJWA 4QO1A 4P4KA 4LSRL 3EOTH 3GIZL 2HFFB 5J56B 4ZFFA 1CGYA 3MYZA 3MZGB 1OGTA 5M94B 1F4YH 1FYTD 4JFEE 3N0PB 4XC3L 3VXUA 3BE1H 4JQXA 3RIAK 3RQ3A 1YEIH 1MCRA 2J8UE 1DUYA 1DBKH 1OB1A 4OLYH 1AH1A 4R3SA 3QZWA 1MQKL 3MGOA 4PRDA 1T0PB 2R39A 3O6FD 3IFNL 1DBJH 4G6KL 4PG9B 3S8WA 2OM5A 4GJTB 4UU9A 4O2CB 4U4BA 1R24A 3FHQA 3MMEB 3OAZH 4PGBA 5HHOA 3O4LD 4NNPH 4OLWH 2BVPB 3ARGA 1JUFB 1I1YA 3RL2A 3ULVH 5F9AC 3N1PC 5I8OH 4N5ED 1QFPA 3AREB 3GHEL 3HFML 1H15A 1QFWL 5E2UL 3SQOH 5I15L 1U8PA 1WZLA 2LAGB 2HFEA 1W0VB 3NN8A 1F11B 5F9WB 5ID1A 5J4MA 4IRJD 3QIBA 5CP3A 3S37H 1XMWA 1UB6B 3P30L 2BP3A 3L9RB 4LCYA 2F15A 1NMAL 1IRAY 2OXGA 4P5TB 4ZFOA 1HNGA 4K7PY 2VABA 4NBYB 1UEMA 2D03H 3QCUH 3OXRA 4JCLA 2NY1C 4XPFH 2A6KB 5JIKA 3GSNB 2WZPD 1KSRA 1UT9A 3O6FB 4MZ2A 3MUY1 5GGTA 4KV5E 1QO3B 2VDLL 1YNKH 1DQTA 1EPFA 3QEHA 3C6LA 5J13B 1EZVY 3L3GA 1HSAB 3V6BR 4V1DE 2VL4A 4JDZB 3SGEH 4KI5D 1BQSA 1RJLA 2P8LA 1L7IH 1S7XB 1MFCH 4MD5A 4FRWA 1AXSB 3QDHA 4BM7A 3V6ZA 2IADA 5HHMD 3MRGA 1NAKL 3TA3B 1MCCA 1RZGB 3D0LA 3KPLB 3LSOB 4JFFD 5C6TL 1CE6B 4GRLD 4W6XB 4JHZA 1CZ8H 4EVNA 1CGWA 3ARGC 4WW1A 4U31A 2DKUA 4L3CB 5IMKB 4P3WA 1MJ8H 3SDDC 2DM7A 4OIIL 3K7UA 4NPYA 1LDSA 1QOKA 1U58A 3LB6D 3SDYH 4ZO6A 3S88H 5I1DA 5SWZA 2Y5EA 3FJTA 5DURB 4KDTC 4GO6B 1P53A 4XCNA 1FAKT 4XNXH 5D7JD 5C0DB 2R15A 5FYLH 2WK2A 2DWEA 1DP0A 5DTFB 1ZHNA 2D0HA 3QCVH 3TN0A 5L0QC 4EUPA 4HCRL 4HGMA 2CDEA 4FQLH 3H7LA 3QQ3B 5BVJB 4EN3D 3ZDZE 5BV7L 4N1EA 4J3VA 5E6ZA 1I7TB 4JO2H 2B5IC 3CX2A 5JR1H 4LSSL 3H9SD 4EOWH 4PB0H 5HYSA 4ZPVB 1DEDA 2D9QB 4LASH 1UXSA 2KKQA 1G7MA 2XFXA 4WGWB 4PFEA 1M71B 1A7NL 4DKFH 4GMTL 2E9JA 3GBNH 3IGAB 4Q97A 3EO0A 1WFNA 4PJ5E 1F00I 1ZT7A 5C0RL 2B20A 4XHJD 4NRXB 1IBGH 1CLZH 2NCMA 4HWNA 3DYPA 5TDNA 4XP5H 3UDWC 3KHOA 4HPOL 1CDUA 4ZUSB 5I1HL 2AQ2A 3MR9A 2EKSA 4X98B 1CT8A 2Q7NA 4LFHG 4M5ZH 5EBMB 5ETUB 5A2JH 2X4RB 2DOCA 2DIJA 1ZGLA 4Z78B 3F7VB 2ENSA 4QRPA 1ZA6A 4YZFF 5MP6H 5I66B 1Q0YH 4IHOA 4WV1C 1KLGB 3T2OA 1Y6KR 4U49A 3JV4B 2B0SH 4I3RL 4LVNB 5DHVH 5E8DH 3ECBA 3T65B 1WZ1L 4YBLB 4DZBA 1CBVL 1FZKA 3CLEH 4JREB 5CGTA 3Q1SL 3MA9L 1FVCA 4P99A 1PYWB 1YNLL 3PWUB 2G2RA 3L5WB 4Y5YA 4DKFL 3FOLA 4IOIA 4KPHL 2UUDH 3L6FB 4FNLH 2BHUA 1OAQH 1E28A 3MBEB 2EH7L 1WZKA 5CZVH 3GJEA 1AQDB 1BF8A 2EIBA 4Z7VB 2Z91A 3IXTB 1BQLL 1KIRA 3F7YA 5TDPB 5B8CB 2MCPL 1GZPA 1CDCA 4ZO8A 4EDXA 1MH5B 3PHQB 4J3UA 4LCCC 4D0DB 4JY6B 4YHKH 1VFAA 1XCQA 4OZGE 1MH5A 3NPSC 1ZK9A 4I3GA 1IGCH 1M4KA 2VZ3A 3UDWA 3F58L 1ZVYA 1RZ7H 1QUNA 4YHZH 5ITFA 3SCMD 4XXDB 4GRWB 4OLUL 2DJUA 1OTUC 1SQ2N 3EYUH 3WO4B 3R8QA 4ZNCD 1VGKB 1FNHA 2VDQL 2X4OB 2YPVH 1FYTA 1YN7A 5I1JH 1IAIM 2LABA 3FRUA 3FT3B 3IDGB 1VENA 4FQ1L 5KVDL 3C60D 1KTLB 5IB4B 3NCYS 1IC4L 4HKXB 3SCMB 3GMPA 3MV7D 3V7MA 5IEKA 4OJFL 2R2BB 5KVFH 1N6VA 4R4NC 5D7JB 4OCYL 5C07B 3H42H 4RQQB 5CKAA 3QNXA 1U8IB 2XZCH 1TPXC 1XGYL 1MCPL 1MHHA 1K85A 3C5SA 5IBLC 5FHBL 5A1AA 4MSWA 4U7SA 3W0WA 1T1YA 2P47B 4F7TB 1YEGH 1TVBB 3TVMC 1HE7A 4TNWK 2YPKA 5EPMB 4I0PD 3V52H 5CJXA 3BE1L 1QSVA 1KGCE 4ETQA 5GSVA 1AO7B 3ARBA 5T3XE 1YEFH 4EUPG 1OF2B 3I6KA 4RGMC 2FR4B 4OD1H 1QLFA 4WI7A 4O5LH 4NYLA 3DNKA 4UQ2A 1A3LL 1NDGB 3MYJA 4UUJB 5L6YL 1J0HA 4GAGL 4QRSB 2WNGA 4K7PX 3UTTB 2WAHA 4MA7H 4E42A 4MMZC 4BSVA 4V2CB 2R0KH 5HGAA 1LNUB 1FQ9C 5EUOB 3WFHB 3OJDA 1RQ5A 2R0LH 5TE6H 2MTPA 2EC9T 5HDBE 2YBRA 3RZWA 5IFJA 5E00B 2ITCB 4XNMB 1Y6MR 4ZPTB 2HMID 1JHLH 2KUTA 3G5VB 4U1HB 3X3FL 1A6WL 5GGVL 3MRGB 5CCKH 5E00A 1B0RA 1X5GA 1EEZA 2E7BA 5BS0B 6CGTA 3KPRA 5C0BB 2WBJC 3VWKC 5FYLD 3RBSA 3O9WC 4WVRA 1MWAL 3LHPH 1WFTA 3NACL 4OCLC 1PX3A 4KPHH 1YJDC 4JLRB 3SE3A 3O2DH 2OS7A 4KQ3H 1QNZL 4M6MH 3TNNB 1H5BC 5ESAA 3GZKA 2CKBH 4UILL 1YUHA 2V2XA 4FQHB 4M3JA 4P46B 1CGUA 2UVEA 4YGAB 3QUMH 1X5XA 3QUMB 2IAMD 4YDVB 4OGZA 4HBCH 5KSAD 4L9DA 4LLQA 4I9WD 1MHCA 5CJXC 1RUAL 3QO0B 5KJRH 3MLVL 4Y16B 3SDDB 4PJ5B 2WIMA 1AD9B 1XR9B 4KROC 5CWSA 1KEGH 4NT6A 3B5TA 1DSFL 5F3BB 1WWCA 2F54A 3C2AH 4XWOD 5IVOA 1ZXQA 5FCUL 5I8EB 4FQXA 3RVUD 1P7KB 3K4DA 2XWJA 3K80A 3CLFH 1KIPA 3DBXA 3QHZH 4PY7A 3O6LH 2Q86B 2OJZH 2J4WH 1LEIB 1N0XH 4JY4A 2FX9H 3Q3GB 4ONFL 4G9DA 3WV0A 2V9TA 4ORGB 1LP9F 5IW1B 3TO4A 4HT1L 2BFVH 2RB8A 3CCHA 3QUZA 3FN3A 4PJAF 3MNWA 3IT8D 2FL5B 1ZAGA 1IC5H 5BV7B 4ZTOL 1DVFA 4NJ9H 4NUGL 4X6CA 5J11B 4HIJA 4X7SH 3NA4A 2CR6A 3QDJD 3G04A 1FC2D 4Z77B 3BAEH 4IRSC 2WLZA 4OD2B 4MQ7B 4GAYA 3M1BB 3WIHA 4TUKL 1YQ2A 4E41D 1EO5A 3C8KA 4JJHA 4HMEA 5I1EL 1B4JL 1IGIH 3WIHL 1S7SA 1KIRB 3F7YB 5TDPA 3QFJE 1IM3B 1A4KA 4PLKD 3W9EB 1BIHA 4GG6A 4U1KA 3MBED 1TITA 1P2CB 2ZUSA 3PP3H 3WSQL 4MJ5A 2VL5A 2WINB 3ZZ1A 1JHKH 3WLWD 5I16A 4LKCA 4P9MH 4WFHE 5K9KB 5JHLH 4NQCA 4JFDB 4K3JL 3O3AB 1JNJA 5SX5K 1RVFL 4P2YA 4O58H 1OGTB 1GSMA 2EZ0D 3DVGB 3BJLA 5HHVL 2YWYA 3DURA 2VE6A 4OGXL 3FOMB 3F12B 5DD3H 3CFKB 4U6YB 3LEYL 4N5UA 1ND0B 4L1HA 4JCMA 5T3XH 4JN2B 1CCZA 3MRNB 5DDHA 1D5IL 4JFOB 3QXTA 3VI3F 4LBEB 2JF1A 4ZFOL 1JPSL 4UU9B 1CG9A 3GRWH 3HNVH 4FQCL 5JDSA 5L2KD 5J6HA 5J9PB 5FF6A 1I1FB 1J8HB 5DD5L 3MO1B 4LPUA 1QFUH 2H2SC 4KKCD 5A3IC 1CD1B 2DYPB 1I8IA 5DEGB 5ABDE 3U1SH 3LAFA 4N0FA 1SVCP 2YUXA 3LEVH 3UPAA 3HI6H 4LSTH 1CR9H 2IG2L 3DV6B 5DS8A 3F7RA 2ZUUA 5T3XD 3QIUA 5D7LE 4LSSH 5EFIA 5LAXB 3VCLB 1YEHL 3ARQA 5T3ZH 2ADJB 3RU8H 4PUBH 2JIXD 3HG1E 2ZJSL 4NZUL 2R29L 4R90L 5IEKB 1NUFA 5DHXB 3P0YH 5J0BA 1EBPA 3OAZK 1JZ6A 5F7MC 5IFHL 4YFEA 5EOTB 3PWNA 1K5NB 4CMHB 3D5OF 1OSZA 5C0CD 1P5UA 1UEYA 5INDA 5J12C 5JDJA 3DWTA 3MRJB 3RY6C 3CFEB 4MDJB 1MFNA 3L1OL 4JFDD 5DRZB 4XHJC 3RY5A 4WWKB 2BDNH 2NLJB 2BOBB 4PJXA 1PY4A 1N6UA 3WDJA 2HP4A 2DQCL 1PZ5B 2L4OA 3F7PC 2FJFA 2A6IA 4J4PC 1UA6H 3BD4A 2X9YA 3MACH 3EYVB 2E7LA 3HMWH 5GS0D 5SX5H 4IJ3C 1FNEA 3PGFH 4PR5A 1T1XA 3VH8B 4GW1B 4GRLB 3VWJB 3GJEB 4S1RL 4LGPB 4FFVC 5T3ZL 4OLYL 4F9PA 3GIVA 1BLNB 2ESVD 3D18A 3KLHC 1T03H 4Y5VB 2VISA 2OZ4L 3P4MB 4Z76A 3OR6A 4OQTL 3RWJA 5I1DB 2H32A 4EIGB 5I1AA 3RWDA 3BP6B 5DYOB 1I1CA 3D18B 2GSGA 2J6EA 4NUJA 5TF0A 5ALBH 1INDH 3DX6B 3CVIH 4BFBD 5FO8A 1GAFH 3D87B 4PRNB 2Q87A 3VRLE 3IAPA 5TFSL 1QACA 1MRCH 4R0LA 3BXNB 1CFTA 4QHMA 2DQJH 3VXMB 1JPGA 3GM8A 1UWGL 1R5VB 4FS0A 4KZEL 5IVZB 1D6EB 5IQ9A 4WNQA 5FYJL 5AG8A 3HRZA 4H88H 1LK3L 4XBGA 2IPTH 2Q1EA 4NP4H 3Q3GA 3BP7A 5T1KD 3GMPB 3HB3D 2EH8H 3I3BA 4J3OC 3MCLH 5IW1A 1H9VA 3C5JA 4AG4L 5CJOL 3UPRB 5JW4N 1ZLVH 5ADPL 1U8HA 4E41E 3QBTB 4YFLF 4XCEB 2IQAB 3UPRA 1NBYA 2CK0L 3C5SB 3I3EA 2B39A 5JXAH 3CFCL 4OB5L 3S5LG 4HLZG 4OFPA 3EYFB 4A6YB 3BKMH 3CH1A 1FPTH 3LQZB 1PGRB 2P8PA 4MD4A 4MB5A 5ETUA 3ISWA 3ZT5A 3RHWF 1LP9E 3Q5TA 4JKWA 1L9MA 2PYFB 2VXSH 5KTEH 3SE9H 3GIZH 4KI5E 1BM3H 2NQCA 3MRRA 2CGRL 5E6ID 4OFIA 3SBWA 2P5WA 2VIRB 4UINL 5D7KD 1GZQB 1RZFH 5IM7B 4NHCH 4MJ5B 1TPXB 1FG2A 2E7HA 2I9TA 3L95B 5HY9A 1FZJA 4KROD 2AJ3B 5FUCC 5GS0H 1BQUA 1C5DA 1JV5A 2VUOA 5CSZB 5I73B 4LFHD 3RVWC 3EGSA 1IAKB 3J8F7 3VE0A 4U1JA 4OD2A 1LMKA 1C5DB 1JV5B 3PGCB 4YDJA 4LCUB 4AIZB 4RAVA 4LSVL 4FQIL 1F11A 1B0RB 3VDBA 4EI6A 3UX9B 1FGNH 4NGHH 4K07A 3FOMA 2JTDA 4LCWA 1FIGL 1U9KA 3U0WL 4TRPH 2APFA 2BXYA 1HKFA 1KB5A 3QI9C 4OB5H 3CPLA 4KKBD 5F8RC 1LE9A 1KB5B 4ZUTB 2NY4C 4NQCB 2PO6B 2VWEC 1MFEL 1IEHA 3D85B 5GS0C 4OV5A 4UNTA 2EH7H 1KJVA 1ADQA 4O51B 1XF4A 3IJYB 4L4TD 5H35B 3O2DA 4V1DD 1K8DB 4W68A 1UVQB 3QXUA 1PW3A 1UB5B 5I8KL 3STZA 1N7ML 1J0ZA 5T5NF 1GOGA 2GT9A 3C5ZA 4RWHA 2FH6A 2X09A 3OX8A 1EVTC 5CBEA 1U6AH 3QG6B 3P9MA 1TCMA 4I18B 5EC2A 1NFDA 3U4EA 3GGWA 4DCQA 1B4JH 2HJFA 2Q8BH 2ZUYA 3WXVL 2D4FA 3PWLB 1PKQE 3H0TB 1FNGA 1KTRL 5BVPH 5C0EB 2CLZB 4S0SD 5IMOA 4HSQA 3DV6A 1QSEE 1C7TA 4ZD3H 1XGRA 4TNVK 3WE6B 2EDWA 3O3EB 2AV7B 3PP4L 4F57H 2V17L 4HGKC 2VSCA 4K7PH 5GS1A 5HBBA 1WBZA 5ICXA 4XP6H 5D70H 2QQNH 3O3EA 3ZDZF 5DD3L 3GKWL 3DVNA 1RHHB 2CLVA 3OKLA 1B0GB 3P11L 1BF2A 4N5EC 2Y1VA 3UBXI 4BFIA 4OI9A 4RMUA 2R0ZH 2AJUH 2L7JA 1J1XL 4XVSH 2ESVE 4Y4KD 3W5NA 3FB7A 1HQ4A 4HV8A 1CI5A 4WWKD 3V6FA 5D7SH 4GUPA 3EOAA 4TVPE 4GRMB 1KXTB 2FYYB 3WFHA 4ZTOH 2Y07L 3QIBB 3OKNA 2DI9A 2V7HA 1T20A 1P2CA 4JKPH 2JB6B 4NO5A 3DETD 4UINH 3MRBB 3DRQA 4KDTA 1I3RB 4EKXA 5DI8B 1U8MB 2WUCH 4FFYL 5EBLB 4FXKB 2FH8A 4XNYL 3O11A 4YXKL 1LD9B 4P5MA 1LK2B 5D1QD 1JF5A 1ZOXA 4RRPA 1L6XA 3RGVC 4M43H 3IDJB 1DBJL 2AJVL 4GLRI 3NAAH 3C6LB 1HZHL 3HNSH 4KMTH 1HINH 1BAFH 3IKCA 4Y5VA 5C2BL 3O9WB 5CMAB 3B9EA 2AXGA 1LWRA 4OAWA 4YWGL 4YHOH 4JFQB 1H3VA 1MWAH 4CRPA 4S2SA 4XRCB 3LEXB 5E2VL 5I15H 3SDCA 4GSDH 1ZLSH 1DFBH 3LSOA 3VXSD 3RAJL 1URLA 1S7VB 2DS4A 1FE8L 2DQIH 4QRQB 4DVBB 1RZIA 4CN6A 3H9SB 5HVFB 5HHME 3VDAA 3GK8L 5ADOH 3KYMA 4Y4HB 4G8EB 4UI2A 4C58B 2X1QA 5JOFA 2EICA 1H8SA 4X7FC 1VPOH 2BSED 4UTAH 3GUTA 3GI8L 1UYWL 1Q8MA 2AEPH 2A0LC 1ZLUH 5D5MA 2ATKB 4F7PB 3CGTA 4K8RC 4ONOA 2C7UB 2RQ8A 3ARXA 5KAQG 3RZCD 1NDMA 3W5MA 1M71A 2KDGA 1IE5A 1XGPA 4L4TA 1UKTA 2YUVA 4XNZC 3ARFA 4NM8H 1EJOH 2FL5A 1JGEB 4M7JL 3PABB 1HXMA 4D9RD 4Y89A 1MY7A 2BY0A 5FKAA 3VXRE 3BHBB 4IDJL 4MJIA 1FFOB 4XCCH 4AIZA 1FG9C 4H25B 3KPNB 4WCYL 4WHTA 5F8QC 3L3HB 1A6UL 4M9PA 1JI1A 2Z93B 1GC1H 5HI3D 35C8L 5LXGL 4GW4A 2DAVA 4YHYC 5DEFB 3IS1X 4U05A 4H0GA 5EORH 3G5ZB 3MFFB 5HY9B 4GW4B 4DKAA 2UYLB 4PG2C 3S88L 2VLRB 2XYCA 3GSQA 2B7DT 3MV01 1DL7H 4K55A 3BDBA 4HH9B 4PLOB 4QHUA 4YPGA 3WO3B 4AQOA 1F02I 1T80A 1T0MB 2WSKA 2OR8A 2XPGA 3MXVL 1IAIL 2DTMH 4HH9A 4HWBL 1X5HA 3OBAA 1TLKA 2FEEI 5DJZA 3ZMRA 1JRHH 3WFZA 1A3RL 1BQHG 3JV5A 3KPRE 3O8XB 5F7HA 4Y7MA 1QFWM 1DBML 3QNZA 3V7AE 1WVZA 4CVZA 3FMGL 2MQ0A 4Z7NE 2YPKB 4LIQL 4U1GB 3PL6C 1WV7T 4LHJB 5KSBA 1OGAB 3V4UH 5DDHB 5DJXA 2XZCL 4V1DA 4MD5B 3D6GA 3V0AC 1UWXH 1ODAA 4OCXL 1WT5C 1YEJH 5IVXE 4QRRD 3FCTB 5ICYB 1IQDA 1GC1L 5C8JB 3SY0B 4QRUA 4XPFL 4WW1B 1ZLUK 4R4FL 4AY0A 3EJZC 4WUKH 1E4WL 5TF1L 4LCWE 3HC3H 2PTUA 5GZNC 4OUUB 2YBRB 3BP5B 4ELKB 4MQTB 3TO4D 5HYIA 3OKEB 5EC2B 5EU4B 3SKNB 3MOAH 1VGKA 2X4OA 4MA7L 5J6GB 3ARBC 5DRWB 5DK2B 1BWMA 2PTVA 3CC5B 2PTTA 5DTFA 2HWZH 2BSSA 3UAJD 2EH8L 1HOCA 4IDLA 3DPBA 1IFHL 1ACYL 3PGDA 5JHDB 2R1XB 2VDKH 2GCYB 3BH8A 2I5YL 4GMSL 5BRZE 3QDAA 4XNQA 1YNTB 4QNPE 1J1PL 3DSNA 3LN9A 5F96L 1C08A 4MCZB 2V5SA 7FABH 3L95A 4F7EB 1EEUA 3RRQA 3WXWH 3U36A 1WEJL 1NLBL 2IAMA 2Z31D 4HDIA 3ULUD 2A77L 5KVFL 4AENA 1AHWB 3B2VH 1K8IA 1B0GA 3SO3B 1KELL 5CZVL 3L3OA 4EI5B 4POYA 1WBYA 4LQFH 3HE7B 2QQLH 1YPZF 4PGCB 1KN4L 3SHSA 2GEEA 4JG1H 2JJSA 4G8GB 4ONHA 4WFED 2B1AH 1H5BA 4RIRB 5FV1L 3CSGA 4FQXB 3V0VA 2VDRH 4JO2L 1LO3H 4D9LL 2CIKB 2AXGB 4CU7A 4AM0A 5D1QA 1AGFA 5DVMA 3GO1H 3RWDB 1WSST 4P23B 3OKKA 4PGDB 1QBLH 1JVKA 2QV2A 1XGTA 2PO6A 3TC9A 1I7RB 1E0OB 3X12A 1W8NA 3HPLB 4P5TC 2BSTA 3MUHL 2Y5TA 4MAUL 3LS5L 3WBDA 3MLWH 1MJJB 4M03A 2R2HB 2X89D 3O6FA 1JF1A 4QOKB 5KVDH 1BREA 3MZTA 1QFWI 5GGSY 5AZ2H 3REWA 1SJEA 2APTA 4DN4H 1AR1C 3Q5OA 2WBWB 1J1XH 4LIQH 1IGFL 3R0MA 4M7ZC 1MCNA 3ZDYF 2JIXA 2P8LB 2HLAB 2ZG1A 3DUHA 5JHDD 4PJIA 1MFBH 4AEIL 5IVXA 3JUZA 4KKLD 1V3LA 2GFBA 3ABZA 4PJIB 2H8PB 4L8SB 2FBOJ 4NKDB 3QUZC 3ZE1F 3TT1L 1FSKC 1LK3H 3K2MC 1V7NL 4HKJA 4OCWL 5FGCB 1U8QB 4D9QE 4YGVA 2ZUWA 3BPOB 3GSOA 3JSSA 4MJIB 3RJQB 4FQLL 5M7QA 2AI0L 3EYQC 1KJMB 2ARWA 1YC8A 2JJSC 4WW2C 3QIBC 3LKNB 4H26A 4I1NB 4Q58C 1BQHA 4YGVB 5E8EB 5GGQL 1DUZA 4OIBA 1MCOH 1LO2L 4NN6B 4P2QE 2FRGP 3HZYB 4L9LC 5EC1B 2V2TB 2EIEA 3WUWB 1DUZB 3QNYA 1RHHA 2CLVB 1YDPA 5I8CB 3QEQD 4QKXB 1MY5A 4S1QH 3D0VB 4RA3A 4WO4D 5E6IA 3G9VA 2YD5A 1KF9B 5FA4B 1CIUA 2XA8L 4RGNE 3RNKA 1A6ZB 1J8HA 3VH8G 1D5ZA 3I75A 1CL7H 2N4IA 4OGXH 1MCLA 4RCAA 3MMEA 3QUXA 4PD4J 5D4QA 3OL2A 1IBGL 2VDPH 1U41A 3EDJA 4PRIA 4OFYD 5DJZB 3L3HA 4X6FB 4HIHB 3KS0H 2NTFB 1N5YH 1IAMA 3V5KB 4OD3L 1NLBH 1NCDL 4HD9A 4UT7L 4XBEL 3FB5A 1ADQL 1TVHB 1J5OH 1KPRB 3RJDA 4MXWH 5B3JF 3RDTD 4PBXA 4DKDC 1XIWC 4I4WB 4X4XA 1ZHBB 2AK4A 1UM5L 1F6LL 3VG9C 4DGIL 4X6CE 2IGFL 4H88L 4RNRA 3PF2A 5FYKU 4JHBA 5EU7E 1A02N 2WW8A 1MVUB 2CDFA 1EFQA 3QDGD 1WQVT 4MA8H 4U7KA 1OSZB 4NP4L 4NZUH 3GMRB 3QNZB 4KDVA 1MVUA 4KTYA 1YNLH 3AB0B 4FZ8L 3B5HA 2MSPA 3W11C 3CFDA 3CFJB 2CMRH 1LE5A 5JW5A 4Z5RB 2VZOA 3BI9X 2V6HA 2Z92A 5DQJA 3CDFA 4ZPTA 2J6EH 1FV1B 4NO2B 3T65A 4OF6A 4XZUA 3ULVE 1TQBC 3QDGB 4Y4KC 4APQB 5E2UH 3RWGB 2DKMA 4KVCH 3BZFA 1MRFL 4O5LL 3C2SA 1OQXA 1FL3A 5EA0L 4K8RL 3IRZA 3WFBH 3G6DH 2DWDA 5E2WL 2C7UA 4ZFFB 2W60B 4HK3J 1IGYA 3VI3E 1BLNA 3H3BC 4FZEH 1UM5H 2ESVB 1CFBA 1OAXH 5KS9B 2C1PB 3S37X 3MRNA 1A1NB 4FXGB 4LAQL 2ICES 4ODSH 3LPWA 3DX6A 4TNWF 3WFEL 3P77A 1BZ7B 4PGEB 4YIQA 1YN6A 4YXHH 3OGCB 4O2CA 1IGJA 1DEEB 1DQMH 1NSNL 1C12A 1IQWH 1CXHA 2YKLH 1CS6A 1WWBX 2HKFL 3H8NA 5ESQB 1UB6A 2B2XL 3MODL 2J12B 3UTSD 1UZ6F 2OZ4A 3MV8B 1GVIA 3E6HB 3TWCL 1UZ6E 5C0CB 4HUVA 1P7KA 2OQJA 4P23A 3IJSA 4FQJL 4JKLA 4DEPC 3T2NH 3I6GB 2V5TA 3O3DA 4JFXA 5T1MB 1FO0A 1FNAA 5IWLA 2J2ZA 1W0WB 4ZFOB 1PQZA 4EZMA 4PGCA 2NPLX 2VDOL 2X4QA 5DJ0A 4FQ2L 1WCBA 1A1MB 5MHSE 4PY8J 4X6BA 5EIIB 3C08H 9CGTA 4QOKE 3L1OH 4XCYA 2I25N 3QI9D 5L2KB 2BNQE 3QAZC 4K94H 1LO0H 1F3JA 5H37G 4WWKC 4XCYB 1IJ9A 1CE1L 2NY0B 1ORQA 4Q0XL 3V6OA 2NLJA 3OKOA 5DHVA 3TA3A 1AI1L 3G6JA 5CD3B 3MACL 5I0ZA 4W70A 2VLME 1KB9K 4XP9L 4ONFH 4D9QD 4DN3L 4GG6B 1T22B 4PB0L 2A9NL 5EUKA 3O0RH 4PRID 3QFJA 1UJTA 1AXTL 2VDNH 3EHBC 4ZSOE 2A9MH 4HUXA 3GMOA 1BHGA 3EO9H 1IM9D 1R3LA 3V4UL 3PHSA 3PUCA 1NBZA 4LLWA 1DQQA 5IBTH 4TVPD 1ITCA 5KSVB 3GMMB 4XVUC 5TFSH 4XBGB 3ARDA 4CJ1A 2EEDA 5L7XL 1GIGL 1PKQA 1Q94A 5D72H 5DC9B 4YDKH 5BS0A 5IROC 4KVCL 3CDGB 2WBJB 3ES6A 4KJPC 4NQEB 1YMMB 3OMZA 2NZ9C 4U6YA 4YUEL 3DIFA 3MRHB 1T5WB 4HPYH 5F88A 4GKSB 5I6XB 5ICZB 3UJIH 1K6QL 3VGAB 2GTWA 2X7LA 4I0PA 5I74C 4NQDD 3HCVB 2GIYA 3TIDB 2X4UB 3L3DB 3KXFB 1K8DA 2VC2H 3SCMC 3V5KA 4R26H 2KZ1B 2MQ3A 1BVKA 5EU7C 1MUJB 4O58L 1T6WA 2BMKB 2YD7A 3H6JA 4G8GD 2ITDA 5AUMB 5LGJB 2PYEA 3C5JB 2DICA 4C83B 4L29B 3D25B 4JAMB 4KY1H 1QSZA 3CLFL 4PJGA 5DRXB 5HHMB 2HKFH 5HDLA 1KJ2B 4JHAL 3TP4A 1KC5L 1XF1A 3WLBA 1KTLA 1JPTL 3FFCB 3NTCL 4R4BA 3QR2A 1JN6B 1IZJA 5GRUH 2ZWLT 4HEME 3LIZL 4KRPB 4OT1L 3WLBB 3ZL4H 1IAKA 3DBXB 3QUYB 4ODXA 5TQ0L 3LN4A 3DV4A 1H0DA 3FTGA 4OTXH 2PXYA 4K9EH 3VGHA 4Y19A 5INDB 4O00A 2CQVA 4OZFH 2DM2A 4M5YH 1OSPH 4Z8FL 5T33H 2BVQB 4KDWA 5K59F 1FG2B 4I3SL 1BD2B 4NQTA 1RJCA 3MLXH 3SE3C 3L5WA 5J7CC 4R8WL 3FOLB 4I2XE 3HPJA 2HG5B 4PRHD 5JZ7D 4JY5H 4NZTH 4PRIE 4PJXE 5E1AB 2Y36H 3L5XL 3K8MA 4J4PD 1VHPA 3P2TA 1VACA 4LHUB 5B39B 5BO1L 3A6BL 4QCIB 4HV8B 4NNPL 4OLWL 2ZPKL 5C2UB 1T83C 4MQ7A 2EO9A 2XACC 1F90H 4JE4B 4OSUL 4OUUA 1T20B 4HIXH 2VRAA 5CLTA 3VXPB 5BRZB 2F53D 1KULA 4OI7A 3IDMB 4K3EH 2OJEB 1GOFA 5JLZA 2VXTL 4XVSL 4U3XA 2IH3B 4APQA 4LK4A 1SBSL 4MQXC 5CP3H 3QXDB 1T04B 4UOW1 1KTDB 5DZNA 3FFCE 4B7LA 4MWFA 1A3QA 3MOQA 2WANA 1EEZB 2BVUA 2RJMA 2XY2A 3EZJB 2XRAH 2R9HC 2VN4A 2E9IA 4XNYH 3WIFA 3D39A 3AXLB 1M1SA 4M1GL 1ZGLM 1MI5E 5DJYB 2NY3C 2E5EA 1QRND 1FSKB 2DQGL 1SBBA 5BJTA 5KSBE 3OKYA 5GQBA 3TO4C 4ZFZA 5DJYA 5FUCE 4EDWH 4Z7QE 4PGBB 5GZND 3Q48A 4PB9L 5C09E 5HSFA 4GAJH 4LSVH 3U0TB 1MCFA 3T3PE 1TZIB 4JFPB 2DMKA 2VSDA 1MHCB 1MCDA 5GJTL 4K3DL 4UV7L 1W2KT 2CXGA 3PXHA 5DEGA 3MNVB 2Z31C 3ULUC 5LCVL 1K4DA 3UPCA 4E41B 2PN5A 2IFFH 3MLZL 4LIQE 1IKNC 5C0NC 3PDOB 3U9UA 5IF0A 1DDHB 1PY9A 3D48R 4S10A 5EUOF 3OKOB 1M6OB 5DHVB 3KWWA 4JM2C 4KI5F 1QRKA 3BKCL 1I3RA 1TJHH 5B38G 4O9HH 1WIPA 1TDQA 1MCJA 4I48B 4APQC 3W39B 3SKJL 2FECL 3WJLC 1B2WL 1S8DB 2H1PL 5HGAB 3QPXH 1W8OA 4JZOA 4M8VA 2E6QA 1IT9H 2XZQH 4NIKB 5K33A 3CJJA 2V7NA 3DRTA 43CAA 4FFZH 5SWZB 4WHTB 2ID5A 3D2UD 3RIFF 1N2RB 1F5WA 1MOEA 3EDDA 1RIUL 4HUKB 2VZUA 4XMLH 5FDWB 7CGTA 1FBIL 3DJ9A 4MNHB 2FEDC 1BBDH 4QXTA 3D3VA 4NKDA 5E08H 1T5WA 2X1PA 1MF2L 1FL5B 4HUXB 3FO2B 4PJDA 1R0AH 3O6ML 4U7MA 1KTKE 3VXSB 3TH2T 3DXAE 3KYNB 3FN9A 2X7LB 3VFVB 4U0RB 3ULUF 4PTTA 4LQ1A 4TSBL 2WWKO 1U2HA 3ARGD 2VDOH 5FGRA 1KJVB 1I1AC 4XBPB 4WU5A 1UM4L 2O5YH 1B9ZA 4CUCA 5I17A 1TJIL 2GTZA 1RJYA 3OB0H 4JPIA 1QFUL 3MJ9A 4G6JH 1JYWA 3C5ZB 1U8NB 1F58L 4L8CB 4YNYA 2VLKB 2CLRA 4ZSOA 4ACPA 3MV8E 3KYOB 3GDBA 4G7VL 4ZUUB 2EIZB 2VLKA 1T21A 5DJAB 4M1GH 3WUZA 2C3GA 2YPLD 2V9RA 4UAOC 1GGTA 1U3HD 3RVVD 4V2BA 1IAII 2JELL 2W9DL 3BYTA 3O3DB 5DC4B 3ZT6A 4M43L 1YEDB 1DANU 5KVMC 3BKJH 4GQ9L 1J9CT 5D7JC 4DOHB 4IS6A 3TZVD 1MCWM 4H8WH 2AXHA 2MKLC 5CP7B 3ROOA 2UVFA 3IFPA 1KIQA 2R0WH 3L3JA 4F7CA 2GJ6D 1Y18A 2ZOLB 5IMLB 1H8OA 3QUZB 3R06B 5L88H 3T77A 3IDNB 2FX7L 4X83A 3EDKA 4L3EE 4RMVA 1D5MB 5IG7B 4GAYB 3WEXB 3K4AA 3KPNA 3LS4H 4Q2ZB 1UQSA 5CD3A 4K23H 15C8H 4K71C 1W72H 3WL9A 5GRZA 1OHQA 3T1FB 2NY6B 4GRWE 2GW5A 2Y7QA 1T22A 4HS6A 4P9HL 2V5RA 1KXVC 1KBGL 3S36X 5DLMH 4WEBH 5L9DL 2NY6D 3DHMA 4R97C 3MV7B 4QTHA 4HS6B 5E6YA 2Y23A 4I2XB 1H3XA 5IOPA 1A5FL 2ORBH 5L0QB 1GHFH 2JKXA 3ZKXC 1RFDH 3A6OA 3BKJL 3CSBA 3DVGA 3WS6A 3D85D 3WCYA 1LO2H 5CIPB 4PJ7F 1FFQA 4I9WE 4AK1A 3NTCH 4Z7VE 4H1LH 4PRAB 4POZC 3QYCA 1PG7W 2IANE 3VGFA 3TZVA 2F5AH 2I60L 3DXAB 3DMMA 5KSBB 1MCPH 3UTZA 3TZVB 3QXDA 1UKQA 5CS7A 5IVNA 4DGYL 2UZYB 4M9OA 1IZKA 1MHPL 2W91A 1OSPL 4Z8FH 2R1WA 1V5JA 4BSWB 3O45B 4L5FH 4YK4C 3FZUC 5ILTL 5A3ID 2X9WA 3QNXB 3TCLB 1LEKA 3VXMA 4RA0C 1I8IB 3WKNA 5F6IB 1AP2B 1KBGH 3WFEH 5EU6A 3D25A 4JAMA 3OXSA 1D5BB 4PTUB 4Z7UE 3KGRA 3OX8B 4KJYB 2Q6WB 5BV7H 2P42B 1KJ2A 3RWIB 3TBYA 1T1WA 2DD8H 4OSUH 3U36B 3FQNA 5DQDL 3RWCB 4JQVC 4D0CA 5F6IC 5GS2H 1OAQL 1PVHA 4K2UL 5D2NE 4P0DA 3ARED 1EEYB 3C6LC 3D39E 3DV4B 4JZJB 2FGWL 1TQCC 2OZ4H 3NABH 1S9VB 2W9LA 5E8NA 4FQJH 3ALXA 1CDJA 4PYGA 2MCPH 2IPKA 2BJMH 1Z0MA 4XAWH 2AV1A 4NO0A 5EIVA 1NFIA 3QHFH 3UYRH 3IYLW 5JIHA 5D7KE 3TZVC 3ZE0E 4HDIB 3MV9B 1NGXB 3T1WA 1QTYT 3VFOA 4RX4A 4CMHC 3SDXE 1T1XB 4ZO9A 4LEOB 1AE6H 1UACL 4RBPH 4U1GC 3V4VL 4KJWC 3N9GH 3P4MA 4H20L 4AJ0A 4DAGH 3ETBF 2ICEA 2XZAH 3RWHA 1TZGL 3IDYB 1G7JB 4UQ3B 3VFGH 1MCIA 1HQRB 6FABL 4ZS6C 4R7NA 2UWEF 1NBVH 3CVHA 3KAAA 1MIEL 2OTUA 1JGDB 5I1GH 1HQRA 1ES0B 1EVUA 5BO1H 2I9LA 4GQPH 4LPTA 2H2PC 1FH5L 3IXAA 4UV4L 1FZMB 3VJ6B 1RIVL 1RZGA 2FX8H 3D0LB 3KPLA 5CJQH 3AS1A 1GHFL 4YHOL 3DTXA 5HHOD 4X4XB 1A6PA 2YR3A 1SEQH 3VXSA 1PSKH 3C60B 5F9JB 4OGAC 1TJHL 3QG7L 4JQVA 1IL1B 4WFFE 4PJDF 3IVKA 4QHMB 1HH9B 3PJSB 3C6SA 2BFVL 3MODH 4NWUH 1KLFA 1ZVHA 3WHXB 5GRVL 3L3KB 5D2LF 4GKZB 1INEL 3S4SB 2CR3A 4AIOA 1BM3L 3IJYA 4MA1C 3R8BB 4YUEH 3KLDA 2OR9H 4NFCA 5SX4I 1JRHL 4Y16A 3D3VE 4O4YL 2DQUL 3ROOB 3RZCB 4U0RC 2JJTA 2YD9A 2FSEA 4LMQE 1E4XI 1UJ3B 4N8CL 1DANT 4C4KO 5J6GA 1MQKH 1KNOA 4Z7UB 2HFFA 2ADIB 1C1EL 5HYSB 5GJSH 2VOTA 1A9EA 3O2WL 1MCHA 3G04B 5CJ5A 1P4IH 3E3QC 3QDMB 4JFHE 1CLYH 2AXJA 5F1KC 1G1CA 1F97A 5CGYC 3PGDB 4PRIB 1I7UA 3ZKND 5E5UB 4U1MB 3OF6A 2PXYB 3INUH 3BGFB 2W07A 4ODVH 3BZEB 3MGTB 4OZIE 3IF1B 4FN0A 4NRZA 1QNZH 3D69B 4GW5A 1RURH 3KJ4C 3VI4E 2P5WB 1JYVA 3SQBA 4O02H 3K2UH 3N1QC 4P2OB 3D69A 1DJSA 4GW5B 3MFGB 1N3NB 5JQ6H 1YPZE 5I8KH 1KT2B 1SJHB 5CEZL 5CHNB 5BXFB 5EU6D 3REVB 3GSVA 4Q6IB 3FO1A 5DT1H 3HMWL 4MGXA 3A0OA 2O93L 3BPCA 2GY5A 1JZ3A 1U91A 3N1MC 3OZ9L 1CN4A 4LHUD 3MLXL 5CINL 5FYKE 3VRIB 3DX8A 4OM0L 25C8L 3VDCA 2YUZA 2UWEA 1YNKL 1AD0B 3LRSA 2XQYK 1QYGH 3MJ7B 2DBLH 3VFRB 4G6ML 4D0DA 5EUOE 5ANMB 2NNAA 4H8WL 1BD2D 1F4HA 2B2XH 2J1KA 1CTOA 3BPLC 1CICC 1MCWW 4HFUL 5BCAA 4AQ1B 1NAKH 1TIUA 2GT9B 2R56L 4BZ1H 1REIA 1FIEA 4TQEL 5DMGC 3UTPD 4YQXH 5I9QB 5D2NC 4YDIL 1X5KA 1QVOA 1U8JA 3ARFD 4GLRH 2DI8A 1NGYA 5HYQB 5JNYA 1YYLH 4CVZB 3VCLA 3SN6N 2M8XA 1Q0XH 2X5PA 3GSUA 4YC2C 5H37H 5IJVA 3ROLB 2NYYD 2IALB 2C1OA 3P0VH 3I9GL 3TPUB 4FQ2H 1A7PL 4ELME 4I18A 4OLZH 3Q6GL 4ZAKB 4JJ5B 2EDDA 5C07E 3BAEL 3OKDA 3G6DL 4GRLC 2R2BA 3I02A 4N68A 4A6YH 3O4OB 3FCTA 5ICYA 1OY3B 3ZTNH 4BKLB 4PJBF 3VFWB 4J1UB 2DQDH 4X7EC 1F8TL 3KYKH 5CZXC 4QRRE 3V5HA 1U58B 3PV6A 4HXBH 2AV7A 4QRPD 1HKLL 1WF5A 3ZSTA 3BPNC 4ZS7L 5C0ND 3VI4F 2HVJA 2AK1H 2FB4L 5EB9A 3SGJC 1D9KC 4P4RB 5IMMA 3KPMA 4M7JH 4OLXL 3MRPB 2OQJB 1RMFL 3RNQA 4UV7H 4YHMH 1MAJA 3CDGA 1MFBL 3N85H 4F33B 3B3IB 3W39A 5C9KA 4KZDH 5C7XH 4E42B 4JFEA 5DJ2A 3K8KA 4LHUG 3L7EA 4YWGH 1EJ6A 3T3PF 3FQWA 5I76A 4JDVA 4ZPVA 3DI2B 1OCWH 3RWHB 1YNTA 1QO3A 4NO3B 4HF5L 5DRZA 4C4KT 4U1SA 2HVKA 4Y16D 5HHQA 4KZEH 1KEML 2H9GB 1CGSH 2F74A 4C54A 3IRPX 1MI5D 3DI3B 3PL6A 3MXWL 1F4XL 5DMYA 2V7HB 5E0QA 1NCCH 5KVEL 3IGAA 5E2WH 4LMQI 5FOJA 2HLFC 1FGNL 3G5YA 1CGVA 4RISL 1WT5A 3GO1L 4LEOA 2P45B 1I3VA 4L4VB 1H3WM 5DMIH 5IIEB 5DF0A 2R1YA 2H6PB 3BVNB 1RK1B 1DQLL 1CE1H 5DVKA 5EBMA 3CU1A 2H6PA 3ARVA 4R7NB 1JPFA 3UTQA 1ORQB 2P5WD 2EDTA 1UZ8A 1N8ZB 5C0BD 4MNGA 4P4KC 4PRPD 4P3DA 2C3HA 2QQKL 2PW2A 3IXAB 3VJ6A 4NHUA 4PJHE 2J5LB 3QWOB 4UDTB 1Q9LB 1OW0C 1AKJA 1YY9C 5DXWA 5ELIA 4ALAL 3LKQA 3MV8D 1X5AA 5DK0A 2ADGA 2YD8A 1OT1A 4OBRA 3WN5A 3X11A 2ZCLL 1NAMA 1DBBL 4G8EA 4WI4A 1OM3H 5DO2D 1S7VA 2N7AA 3T2NL 3BRDA 2NY5C 5CD5C 5T1KA 3GSWA 5EOCH 5DJXB 3JVGA 4NCDA 4PTUA 3JTSB 1MJ7H 4IOIB 2XKNA 2X4NB 3HZKA 3S4SA 4DQOH 3UTSB 4OF3A 4GT7A 4X5WB 3UEZA 4IOFD 4KUCF 2X4UA 4ODTL 2DQCH 5HVWA 4LLYA 5E99L 2HTLC 4WGVB 2IAMC 3GB7B 4CNIB 1CICD 3UZQA 1FNFA 1BVZA 1H8NA 3DXAD 3BX7C 3DIFB 4I8DA 1U8OB 1X4ZA 3CSYA 4S1RH 2EYTA 3VXNB 4P2OA 3S3JA 1Q9KA 5L2JA 3U0WH 1PLGH 4HH8A 3WKML 4ZOAA 1P6FA 4CN4A 3UJJL 3KJ4B 2EYRB 5CJBA 3B6SA 4LNVA 4XXDA 4RGOH 3F62A 4N0CC 5LGHH 4K2UH 4LP4A 3WFBL 3D39D 4UOJA 4LCWB 4HWZA 4N8VA 1XR8B 1ZSDB 3VMPA 3PG2A 2X70B 4XXCA 5D6DC 5F70A 3RA7L 3MV8A 2ICWA 3SJVE 3U0TA 2WINA 2KQNA 4KTEL 1EXUA 1CLOH 2J88H 1MHEA 2UYLA 3HTLX 4IRJA 3GSRB 4YFDB 5A16B 4NQSB 2GAZB 3H2WA 4N1HB 4Y4FB 2VXVL 5EO1B 4XCFL 1BEYL 1W0WA 5AWNH 1FFNA 2HG5A 1IQWL 5B21A 3VG0H 4D2NA 2NX5A 2XTJD 4X6BB 5EIIA 1P84J 5IF0B 3U9UB 3ARBD 2H3NA 1T2QH 4G43A 3DXAA 1EUTA 4Z18A 3MUZ1 4P46C 2AK4B 3BIBX 3EHBD 2YD3A 1ZT1B 4F80A 4L3EA 2MHAB 3KNBB 2D2OA 3Q0HA 2OI9C 2I5YH 3QA3B 4PRHB 4MNQD 4CVXA 3QRGL 2A74B 4U33A 1OP5K 1P5VA 1VADA 3BKCH 5I1KL 2W0FA 5KVGH 1PZUB 3E2HC 3NZHH 4ZOEA 5I1IL 3TV3H 4JGMA 1JPTH 4W6WB 4KTEH 3BEWA 2XIDA 2R23B 3Q6FB 4M1DH 4QXUL 4PJCA 1RIHH 4NQDE 1AXSA 2VQUA 1YJDL 3Q5YA 5SWQA 1LDPH 1TZIA 3KPSA 2Z8SA 2PTTB 4X4ME 5IKCB 4DQOL 3ARGB 2NW2A 1CVSC 2HH0L 1OVZA 4YXHL 5GIRA 4P59H 1DZBA 5BW7C 4P2RD 1O5DT 3IETA 5E9DD 4S1SL 1MJUL 2DDQL 3MLTB 4XNQB 3QISA 1L4IA 3NN8B 3FRPA 3MV9E 4AENB 4CADB 1NAMH 5KSAA 2P4AB 5F1OB 3VXRA 1XIWA 4EQ2A 4KJWD 3QAZB 4YQXL 4YDIH 5ACLA 4WEUD 2VLJD 4MCZA 3P77B 2ZOKA 1GGIH 3F6LA 3KPPB 3MREA 5HPMB 2VDPL 3EOYG 1XH3B 2P43B 4YDKL 3LD8B 5DRNB 4ZNEA 1S7WA 4N0UB 4KQ4L 5A40E 1K5NA 1RUML 4OQTA 4XAWL 2FIKA 2A6KA 3OPZL 3SKMA 4ZUVA 4L8DA 2RFXA 3QO1B 1X6NA 2DLGA 5DVLA 4RWYL 5F71A 1P1ZA 3QH3A 5LGKA 5SWSB 1KPUA 2OP4L 1Q9WB 3LCYA 4Z78A 2AKRA 3FN0L 1LDPL 1EO7A 4X7DC 2ATPA 2V5MA 3QCUL 1TETL 5DGQA 4JPKL 3QPXL 3JTTB 3QULB 4P4KD 5TE4L 2X1WL 2OL3H 4TUKH 4F7MA 4LSPH 1U0QA 4ZYKB 1NCAL 2IADB 1KPRA 1A0QL 1HHGA 2C4FU 5EZIL 2R2CA 1JPST 5DJ0B 3RI5K 3QDJA 1A14H 1FNSH 1TCRB 3DX9A 4Z7NF 2MMXA 1DLHA 1HHGB 3F7QA 1A2YA 3GM0A 3QUZD 4CBPA 2XXMB 2VLJE 5ESVB 1IVLA 2GFBB 3L6FA 1FN4B 5ISZD 1Q9LA 2Q3ZA 1SEQL 4HFUH 1JK8A 2W65A 1LVEA 1BP3B 5DJ6A 1S7RB 1AGBA 3U83A 2BRQA 4XVTL 3TNMB 2Z35B 4GG8B 5EZJA 5I30L 2D7NA 3QO0A 2RIKA 1I7ZA 4ODBD 3RVWD 3VFPB 1NCCL 5KVEH 2HT3C 3F5WB 3ECBB 3IDIB 3HZMB 1VSCA 1KG0B 4XMPH 1U3HB 4Z7UA 5FM4A 1XF5A 4MQSB 2HJLB 3S35H 5IBUG 4X5WA 1G7PB 3BFOA 1EFXD 4A2MA 1C7SA 2XQBH 2H1PH 5E2TL 3TJHC 1N4XH 1IT9L 2CRIA 4N0RA 1KIPB 1F3DH 4IBLT 3VXUB 3VXSE 1U8NA 3AS0A 2AGJL 3HZVA 4WHYH 4AT6B 4FABL 1VFAB 1XCQB 3FQWB 5I76B 4WO4C 4Z95L 2VXTH 5IMLA 4WY7L 3RUGA 3O45A 3P3YA 5E6IB 5HTSA 4LP5A 2PNDA 5GGUA 3PIQA 4WFFD 1XGUA 1WLHA 2C4XA 3ZTJH 3DMMD 5IGXL 1FZOA 3EFFB 3WS3A 4JFPA 2X44D 3CXHJ 2ZCKH 2A6DB 3O8XA 1G7MB 3O4LB 4YO0B 1R3HA 5I1GL 3JBG7 1VFBB 4ZNEE 2C3VA 2ITDB 4ZQKA 5JW3H 4HJ0D 1X4YA 4HKBB 4H1LB 4OKVB 1JMZA 1F13A 1EAPB 1DBKL 4HPOH 1P9MA 3RPIA 5MENE 1E4KC 5TE7H 3ESUF 2RAMA 1TENA 4MZ3A 3ARYA 4AG4H 5D7SL 3EDEA 3DO7A 3RY4A 1I9JL 4PRHA 4CW1A 3K4ZA 1YEEL 2BNQD 1BOGA 3TIEB 1HI6A 1JGVH 5C0JB 4YHIA 4LL9A 2ED7A 2DN7A 3CD4A 2DI7A 5FXCH 4ELKA 4WFGE 4L3ED 1QKZL 3H7BA 4MDJA 4WEBL 5L9DH 4WTWA 1G1YA 1EDQA 3QDMD 1N6QL 1FYTE 4P23D 1SM3L 3KPOA 3DX7B 5FHAL 3MNZA 2R4RH 3NGBC 3OKMB 2FO4B 1BIIA 2VR9A 1Y0LA 3CK0L 3LEYH 5CEZE 4XGZB 4PRPE 5DQJB 3MRLB 1X9QA 4UQ2B 1HOCB 3ZLQC 5HYSG 1CF8H 2DQTH 2O61B 2R1WB 2NW2B 5EH1A 3MO1A 3NIFF 3SGEI 4JDTL 1LO5B 4JLRA 2VITA 4R3SB 3FQUB 2VXVH 2G60L 1KYOJ 4OF8A 2JK5B 2UWEE 3EYQD 3AVEA 5FYJD 3OR6B 5E8OA 3RWJB 3W0WE 3VXPA 4WFEE 3LN5B 2CRMA 1XF2A 3QJFA 2A73A 3MJGX 4JKMA 3ZTNL 1NL0H 2DIBA 1JGVL 3PWVA 1MNUL 3RIAF 2IEPA 3N1FC 4CJ0A 1VPOL 3VFUA 1KIUA 3BP4B 5E2TH 3VFMB 5KAQF 3GMQB 3RUGF 4ELMF 3Q2CA 5A2FA 3DGGB 2G5RA 3WE6A 5AG9A 1YUHB 1FL6A 4NO3A 4GKZA 5HGHB 1X5JA 4WHDA 2AKRB 4PJCE 2AEWA 5C09A 3BP7B 4NBZB 2K9UA 5HHOE 3E6HA 4GXUM 4HUVB 2ZZUT 1FFPB 1DN2A 1PQZB 1MUJA 4LEXH 3GSNA 4O2FB 4XBEH 3QIWA 3BIAX 1JBJA 3CVHH 2A6IB 4IDJH 2E7CA 4P5TD 1F6AB 1KYOK 2BX5A 1DQDH 3QI9B 4G8FA 5KN5A 5IHUH 2EYSA 3S5LB 1HSBA 4BK5A 3OB0K 3WNPA 4UB0L 2P1YA 3HNTL 3OG6B 3EJJX 5LKNA 2GJZB 4DK3A 1HSBB 1I8MA 1HWGB 1Q9WA 3L7FB 3BESR 3BSZL 4KXZH 1E4XH 5EUOA 4WI2A 4J6RH 2YHGA 2ZSVB 3EKCA 5CZXD 1UQSB 4KK8C 3RWEA 3BP6A 4BELD 2G9HB 3FQRA 5DMKA 5HGBA 1OTTD 4JO3L 3WL9B 4S11A 3BH9B 4C56A 3QFJB 2FGZA 2X4SB 4HKZA 4RMTA 5F44A 5FCUH 2DLTA 1Q38A 1INDL 4PV8A 4U1KB 3B8YA 4OFYA 1MVFA 1RZIB 1NAMB 4NQUA 3E1F1 1OP5H 5TE6L 4M3KB 1HCVA 12E8H 4MX7B 4G42B 1E6OL 5LBSL 3FMGH 4CKVX 4HT1H 3PWUA 3RDTA 4P3CH 3P4OA 4K8RH 2V2TA 3PWJA 2ATKA 1WZMA 3SPVB 4OZ4B 3T0EC 2IJ0C 1EHNA 5CSBA 1J12A 1EO8H 4U1IA 4ZXBD 3JV0A 3ZYIA 1NC2B 4Z7VA 4D8PA 4IIQB 3WLWC 1MJ7L 1X7QB 3P0GB 3DUSB 1VB9A 5TH2B 4LBEA 5K9KA 1ZEAH 2G5BB 3MBEC 5EU3B 2Z31A 3NFNB 1JRHI 1I75A 4KV5F 4PLKC 3DUSA 3M07A 1IGIL 3WIHH 2ADIA 4WI3A 2A2QT 4C57C 3HUJA 3HZYA 1PG7X 2EEAA 4HK0A 4XNZB 4QT5A 4JM2A 1PKOA 4PBVC 2ZOKB 5DJ8B 2BERA 1I7UB 4ZQKB 1RJYB 4XPBL 1M7XA 5IW6B 2EDFA 2B5IB 5IT2L 4K94C 1PLGL 4GG6E 1RZJH 4DCQB 4PREA 5J89A 2FIKB 1S7UA 4F9LC 3U4BH 5EDXA 2BZDA 4AEEA 2DLHA 1X5ZA 3RY6A 5DEZA 4QRTB 4PJEF 4OZIF 2QSQA 1KPUB 4WWID 2I07B 2R69L 5CJQL 4PJ8B 5D93C 2FX9L 5IESH 1F3RB 3EJYD 1T7YA 3AS3A 4OGYH 3Q6GH 4OM1H 2A77H 1QQDB 3NMEA 3RPIB 3EW3B 4MSWB 2BNQA 3CZFA 5F89B 3BGMA 4NKIL 4HFWB 3QDGA 4ODUA 4F9PC 2VDLH 4FHBD 4PJ5D 2OYPA 3U79A 3QUKA 3B3IA 1VEOA 1U93A 3ARZA 2OI9B 1N0LA 3QA3A 2DQUH 4PJGF 3OZ9H 1I1AA 4QRPE 4NN5C 4PJHA 3U4AA 4WTZG 1KN2L 2W65B 2Y9RT 3FAXA 1IARB 2YD1A 4WY7H 3V9FA 1G0YR 1PBYA 2JK5A 4FQQB 4MXQD 2R29H 4DTGH 3P0YL 4OLVL 3UROR 3O2WH 1AD0A 3LRSB 4F37K 4XPHH 2NXZB 4QYOB 3V8OA 1S9YB 2F5BL 2JE8A 4JFED 3RTQD 2GSGB 4NUJB 2ZUVA 2C3WA 3FO0H 5K9QI 3K1DA 3LPGA 4NQCE 4F9LA 3ET9F 4DUWA 1JJUA 4XWGL 3KDMB 4LDLB 4ERSH 3UO1H 5ESQA 1KCRL 1TTUA 4I5BA 1MHPH 4GS7C 3VWJC 3N9GL 2EO1A 4NKIH 1YMHA 4AT6A 2Z4QB 1QA9A 2R0LL 3B8SA 1TZGH 3VRJB 3HC4L 2HVJB 5I1AB 4JFXB 1BZ7A 2E7MA 5SWSE 4PRPA 2Q7YA 4U6TA 5JO5B 3VXTB 5GGUB 5F1SA 4NJAH 2XZZA 2DM4A 2Q76B 2FX8L 1AI1H 3OJVC 3D9AH 5B3NA 1VFBA 1AD9A 1XR9A 5CWSB 4ZODA 4DUVA 1JGLH 3BUYB 1R3IH 2OL3A 1KC5H 5HI5C 3O2DL 5C0CA 1T5XB 1AFVH 3PQYB 4LCIH 1Q72H 4HJJL 4NWUL 3M8OH 2ZCHL 3QIWD 5JW4M 2BOCB 1RZJL 3EO9L 1BBJA 4P5TA 2DJ4A 2F74B 3W11D 3U46A 1UCBH 3PQYA 5C0IA 3CFEA 5C6TH 1ZMYA 4F58H 4HAFA 4PS4L 1YEDA 3ZHLA 1FORL 1JE6A 4GXVL 4HZLA 1WIUA 3RWCA 1BOGB 3NA9L 3WN5C 5T1LA 5L7XH 4XCEA 4M6NH 1KJ3H 3X14A 1V8HA 1GH7A 3HN3A 3MLRL 1CYGA 4M7KL 1I3GL 2CIKA 1BZ9B 2DQHH 4HIIA 1QR1A 3V4PL 4WEMB 3VFSB 3VWJA 4I3RH 5J1AB 3UJIL 5JA8B 2OBGA 4GAGH 4U1JB 1JHTA 1D5MA 3B2UC 3LH2H 1MAMH 3A67H 5J1AA 3BW9B 2VUYA 4G6AC 1IM9A 2FCBA 1AGEA 2FJFB 2OJZL 1MFDL 1NEZB 4KRNA 1B4RA 3T1FA 1FDLH 1NBVL 1FPTL 1I7ZB 3QIUD 4K3EL 1NEZA 5DWUL 2YZ1A 4HJJH 3REWB 2F54E 2L0DA 4RAHA 3TVMD 1UM6L 2RHEA 1J86A 4KVNL 1BQLH 5I17B 1QEWB 4XCNB 1BQHB 2D7TL 5LQBL 3CVIL 4KZDL 5DT1L 1VKXB 5C7XL 4Y5YB 1JF6A 4C56E 5IJKA 3C8DA 1EZVX 1G9NL 1MRCL 2XKUA 2C4FT 1VKXA 3RVVC 3QIBD 2F54B 2AEQH 3OQ3B 2P24B 1I3GH 3ULSB 1M7IA 1LO0L 3MOAL 3HC0B 1HXMB 3P9LB 1YY8A 1P4LA 1KPVA 2CSPA 5ID0B 3T04D 5FFLA 1W72L 4FZEL 4OZHF 4JY4B 5GS1C 1T4KA 2WUBH 4W4OC 4F3FB 2HRLA 3AMKA 1E27B 5DJ8A 3UTOA 4KKLC 4OF7A 3A6CH 1P69B 1OAUH 1MCKA 5INCA 3SOBL 1P4IL 5I6XC 1XGRB 4OJFH 4LU5L 4OQ1A 4HKBA 5GRYA 1JWMA 3CFCH 4JN1L 5E7FA 3ZHDA 5FV2A 3RNKB 3ULUE 1KIQB 2YOCA 1EO8L 4RZCB 4F7CB 5SWQB 1QPXA 3FRUB 3PWLA 2E27H 2J8OA 1J0JA 2GAZA 5JXEC 3MSPA 4LLUA 3IDNA 2W59A 4UNVA 5BMFH 2X10A 2VXUL 4Y4FD 2LU7A 3VXMD 4O2EA 1RV6X 1A7BA 3HMXH 4Y19B 5JQ6L 2KBGA 3DUUA 2J8UA 1BGXH 1RUKL 3CFDB 4DGYH 5T5FH 1Y6NR 1CR9L 5J11C 2H3NB 1IGMH 2FB4H 3UXFA 1CDBA 4LPWA 1I8LA 1EX0A 3G5XB 4XPBH 4XVJH 3VA6A 2UV3A 3ZYOA 2EKJA 4Y5VC 4V1DB 4EQ3A 4BH7B 2ZG2A 4PJXB 3VD9A 3I50L 4R26L 3VG0L 4G6AD 5E56A 2W92A 2YN5A 1H5BB 3DLQR 4TVPH 3X3FH 5CCKL 3BPNB 3A67L 4W4OA 1FNEB 3LB6C 5I1LA 3IDMA 1U8LA 3MRBA 3MLYH 4KK6C 3NVQA 4QLRA 1LEGB 4JFQA 3KPRD 3BEWB 4MXVE 4M1CC 5E24E 1NC4B 2FHCA 2R9HD 1LEKB 5GISH 3KDMA 3NIDF 1C12B 2FWOA 4O9HL 4HJGB 5FUZL 3QUML 2WMPA 1A7PH 2Y25A 1BFTA 4LDOB 3HHRB 1CU4L 3QHFL 4P57A 5KBNC 1BFSA 4UZGA 3GSWB 3LZFL 4NDMA 4H5SA 4P23C 3MGOB 4PP2A 3WNKA 2R23A 2VB5A 4LNRA 1XEDA 4H1LG 1S3KH 4JPVL 1NCNA 5C09B 5IVXB 4ELMA 3QFDA 3FL7A 4GOSA 4R97B 3TPUA 3UZVB 2WBKA 1AE6L 1NFKA 1T7ZA 1MCOL 1SYVA 1WJ3A 2CRZA 5GHWH 5C08B 3ILPA 2HTKC 3A6BH 3PWPB 4HIEB 5DUBA 4DVBA 2RBLA 2COQA 3H0TA 1Z3GL 1F6AA 1HILA 2VQTA 3VFGL 1GGCH 2VC2L 3BUYA 5C0AA 5JZ7C 4YX2H 1C8PA 1U3HA 3GSOB 2YN3A 3W0WD 1AHWC 2HN7A 4WWKA 5TPWH 1DDHA 3JWDC 2NR6C 5D7LA 1BMGA 3MV9A 4FFWD 3NFSH 4QF1B 2MFNA 5HYJD 2W9EL 2FYYA 1YECL 3S3PA 3M45A 2XTLA 4RFOH 4EJ1C 3VD5A 2O5XH 1P4BH 5K9OB 3FONA 2CPCA 4XPGH 3TH4T 5GISL 3DO3A 15C8L 1EERB 2D0GA 3LHPL 3NACH 5T5NG 5EULV 4Y5XA 2VZVA 4C56D 1QBAA 4KU1A 2BDNL 3EUUA 1B88A 3OB8A 1CFVH 1E4XL 5DJ2B 3PABA 4FQQA 1NUDA 4ZG1A 1EXUB 1S3KL 4JKPL 1BGXL 3KR3L 3QHTC 1NMBH 2UZIH 1N3NA 5IFAL 5DFVC 4BQ8A 5T5FL 4M48L 5FK9A 4NCC1 3O6KH 1RSFA 4YDJB 5F3HB 3ARDB 5CUSH 1PG7H 2EXWD 1JYNA 3FFCD 4HULB 5AZEL 3QUXD 3C8HA 1MLBA 5F7UA 2MPAL 3I3DA 3H9HB 4Q6IC 8FABB 4D3CH 3KYOA 1SEBA 2ZKHH 2UY6A 3QDJB 4LF3A 2Y06L 5F9JA 5EU3A 3MRQB 4R2GD 1MELA 4NRYB 4ZUTA 1AJ7L 3TIDA 2ZCLH 2ZNXA 1XF5B 3P9WB 2X4PB 3L3DA 3UTQB 2NZ9D 1S9XA 5D71H 4P2QD 1UWGH 2D31A 1D9KA 2KH2B 3TH3T 2I24N 1CFQA 1Z9LA 1YMMD 1G6RA 4LDEB 4YBHA 2W0FB 1QSED 1D9KB 2B4CC 5HJ3B 3HUJF 5D1ZB 3GKZA 4QRQA 4WI5A 1FV1A 1P9MC 4DUXA 4P2RE 1IMHC 4MAYB 2F8XC 4UB0H 1L7TH 1Q1JH 1XF3A 3PL6D 4TPRH 4TOYL 4X98A 5FEBA 4BZYA 2Q20A 4XC3H 1FLTX 2I07A 3HE6A 3S98A 5CBAA 3MRIB 4JM4L 4G9DB 1OPGL 2VIRA 1JWSB 4G9FD 1KLGA 1XT5A 4YC2B 2N7BA 3K3QA 4WTXA 3SDAC 4PJCF 4DZBB 1ADQH 1JGEA 4XH2B 5DVNA 3RUGB 3WIIL 3FO1B 5CEYA 2F5AL 2EKSB 2ADJA 2I60H 3SQOL 3RNQB 5E94A 4LLVA 3EJYC 3ZE1E 3AROA 5JTWA 1FORH 3I2CL 5CEYB 1TJIH 4CDHA 4RMWA 1A3LH 4P2QA 2O5XL 5FYLL 4KTDL 3RGVB 3L3IA 5HYFA 2MOVA 5JA9A 4XCFH 5JPNB 4Y0GA 4E5XB 4XMPL 1VESA 1NMAH 1OW0A 2WUBL 3MLRH 2XZAL 5EOCJ 3E6FA 2QTEA 4G5ZH 3W2DL 3BO8B 4IRZL 1BFOB 3O6FC 2EE9A 1ZV5A 3D85A 4KKAD 4FP8L 4TTGA 1NGQH 5C0AD 1U8MA 4JFZL 1TJGL 1OAZL 4JFDA 1BIIB 3DO7B 1NGPL 1FH5H 1F8TH 3L3OB 1HHHB 4HJGA 4NZRL 4K7FA 3JWOC 5HYJA 5FOBB 4JPWH 1B3JA 1C5BL 1P84K 1ZHKB 2E27L 1HSAA 1L7IL 4CU6A 1D6VH 1DBBH 3S35X 3O9WA 5CMAA 4JFYB 2QADB 1M7DB 2ZKHL 3FQRB 1FRGL 3UYPA 1CZ8L 1RAMA 4JKKA 2WLYA 3CNKA 1U42A 5GGRY 4ERSL 1KENH 1U36A 1KJ2L 2P7TB 1PX4A 3C09B 1WC7A 1J1OH 1I1YB 4YHPA 2HLFD 4TUOB 3RL2B 3SDXB 3V8CA 3PHOB 5IEHB 3QPQC 3OKDB 3IU3A 4YLQT 1U8IA 4HBQA 2GQHA 5LG1A 1SYSA 3RKPA 3PHOA 4G9FB 4QEGA 5IEHA 2QHLA 1F4XH 5FIEA 1JNLL 5D7LB 2CIIB 4GRWH 3BP5A 3TFKD 4M93C 4NQED 5KG9B 3AM8A 4ZFZB 5E6IC 3SKNA 2EXYD 2BOCA 5TDOB 1OAKH 1UADC 4C59B 1V05A 5D93B 2NXYC 3HAEH 4H0HB 4JM2F 3GHEH 5D9SA 3LVEA 2VQ1A 4RGNC 1NDGA 3CZJA 5FGBA 5D7LD 1YC7A 4JZJA 4A2LA 5FYLE 1PAMA 1P7HL 2G5BA 5F6HI 1U8PB 1D9KD 1D6VL 1OT2A 4X0KA 5FA4A 4L4VE 3TEUA 3CSYB 1CDHA 1A21A 4KMLB 3RI5F 5I1CH 4OLVH 1CL7I 3X13A 4URTB 3CXDH 3S3SA 4KQ4H 5J1TC 3RDTC 4KAQL 4Q9RH 1IEAA 1F4YL 4LSUL 3ARSA 2VXUH 3CVHL 4PJFE 4HHAA 3MV9D 3TBTA 3GMNA 4U3HA 3KPPA 5AWNL 4UIMB 3GMLB 2R8SL 1K4CB 1S8DA 4ODWB 4WV1A 3HE7A 4MJ6A 4R7DB 2W0LA 3TF7C 4ZUSA 2VDRL 1AY1L 3VFVA 5C0CE 4CMMA 3MRQA 3UMTA 2BVEA 2V2XB 1QEWA 5D1QB 4I0CC 2O5ZL 2OTUB 5D8JL 5D5ME 2Y72A 2YSSB 4PD4K 5F9WC 2E3VA 2AJVH 2G9HA 4KRMB 1MSPA 3GMRA 4TQEH 4WCYH 2JIXB 1Z9OA 5I19L 4OZ4A 2X05A 3O2VL 3S34H 3ILQC 3QWOA 4UDTA 4RFOL 4EI6B 4ZYKA 4WU7B 4L8SA 5T3XL 3MRHA 4QOKA 5DO2C 3BKYL 4JZJC 3ULSA 3GRWA 3VXRD 1HHIA 3V5DB 4OM1L 2BNRB 4OCSH 3QWQB 3CUPB 1OTUD 4WU5B 1T4KB 3EDFA 3OJMB 1CD9B 4XPAH 5EWIH 4F58L 4JM2B 5HJ3A 1KENL 2B8OT 3VRLF 5IFAH 4UTAL 3GSNH 1LE5B 3H3PH 1UYWH 3EO0B 1NLDL 4PJDE 4CGTA 4DWHA 1BJ8A 3BHBA 3LQMA 4PG9A 3RPKA 4L4VD 4M61A 4DAGL