1NQBA

Trivalent antibody fragment
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
b'VQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKYNEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARYDYYGSSYFDYWGQGTTVTVSSDIELTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE-CHAIN ANTIBODY FRAGMENT
publication title The 2.0-A resolution crystal structure of a trimeric antibody fragment with noncognate VH-VL domain pairs shows a rearrangement of VH CDR3.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 54
structure length 232
sequence length 232
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-04-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nqbA02
1KBGH 4P4RA 4JFEB 2IH3B 4MNHB 3QWRA 4LAQH 4HMEA 3O9WD 3EO0B 1OQXA 1RULL 4P2OC 4MJ6A 5HHOB 3L3HB 4YXHH 2AJ3B 2WBJD 3HMXA 1MQKL 5C9JA 1T1YA 3ABZA 3D48R 4RAVA 1I1AD 2GT9B 4HJ0D 4EN3A 2ICWA 3F6IA 5E08L 1SY6H 4GG6F 5JLZA 5FF6B 1CFNA 1RV6X 1SBBA 2WSKA 1B90A 3MJ7A 4LSVL 2YN3A 4DOHE 4ZNCD 1DANT 4KHXH 5FUOH 4S10A 5HHVH 3AB0C 3KPRE 2YEZA 1F3DH 4NBZB 4YHLL 1TTGA 5BMFL 4RWYL 3LKOA 5IBUG 1NPUA 2PXYB 1H3WM 3MV7B 2Y07L 3FHAA 3BVNA 1IM9A 2E8ZA 1A1MB 4QRSA 3QPQC 1YY9D 1J8HD 1KIRB 1UH4A 4UT6L 5MHSE 3H42H 3MRGB 4TTGA 3T2PA 4DZBA 1IAII 4NN7B 1PFCA 2JCCB 3RA7L 4XRCA 1DQQB 1MFNA 3QQ3B 4DW2H 2PTTA 1QFHA 3OGCB 1YDPB 2GTWB 2A83A 2BRQA 1H3PH 2ATPB 4EQ3A 1HIML 5GRJH 1XF5A 3VWKC 4H20L 5L2KE 3KYMA 5D1QB 2D2OA 4XPGH 3AFLA 3BH9A 3SKNB 5HY9A 1CK0L 2B5IC 2F54D 3V7AE 4XAKD 1A21A 2NR6C 4JQXA 1WBZB 1MH5A 1ACYH 5C92A 1SEQH 5L8KB 4HKZA 2UWEF 2DQCL 4XXDB 5CWSB 3S36X 4ZPVA 4XP1H 3CFJA 3MRKB 5E5UB 5GGRY 4E41A 2CO6B 1VFBB 2A77L 4POZD 5EUOE 2NY5L 4PLNC 5KSAB 3VFOB 4O9HH 1I7TA 3N50A 2HA1A 3F5WB 3FT4B 1K6QL 1KYOK 3ALWA 3NPZB 4OZGA 1SY6A 4XC1H 4OD1L 3GMNB 3ARXA 4MCZA 4TPRL 3ARFD 3JV4A 4NP4H 1XZ0B 1N59B 3GSQB 4PGEA 1DUYA 4ODXB 4ZXBB 5L88H 1YYLH 2VLJA 3CXDL 2BOBA 2VZVA 4HPYL 1DLHB 4Y16D 4EDXB 2OJEA 4UTBL 3QIBD 3OBAA 3WIFA 1ZT7B 2CD0A 2DKMA 4KUZH 1MCKA 3LRGA 3GJFB 3GMRA 3F7PC 4LVNC 4WUKL 4HT1H 5HI4D 1HQ4B 1QR1B 2X4SA 3UTPE 5ADOL 1XH3B 4YHYC 4TVPH 2E6PA 3A6OA 4JFXB 2VITB 5J3HD 3WN5B 4JZJC 1JI2A 1J1OH 1I7ZA 4PRIA 1JPSL 1PY4A 1EDQA 1F90L 4G9DA 5A16B 3QEGL 5FDWA 1OP3H 1CL7H 4QTHA 2DYPA 3QDMB 1NBVL 4MXQD 5DJDB 5H2BA 5ANME 2P24A 1NC4B 3MNVB 2VABA 3LKPB 2QBWA 4LHQB 1IC7L 1X3DA 4DN4L 4N1HB 3OXRB 5HHQB 1WV7T 1RIHL 3D5OF 5I16A 5C1MB 2QQKL 3TJHD 3ZDZF 4UDUB 3ARZA 4I2XA 2IQ9L 4WY7H 3PQYB 1RAMA 2R39A 4LLVA 1I8IA 5DC0A 1GGCL 5DD6A 2B1AL 1QFWI 3P4OB 1R5VB 2Y5TB 2BSTA 3VWKA 2XACC 2YZ1A 3O6FC 1A9EB 1H8SA 5TDNB 4HIEA 4YHLH 3O3AB 2EXWD 4B0MM 1CFQA 3WJLC 1I8LC 2Y07H 3OKNA 1FNFA 2X40A 3DNKA 4KY1H 1A7OL 2GQHA 3W9DA 4LQFH 1IC5H 3RIFK 2VLRB 1CLYL 2QEJA 1OGAB 4UTAL 3T3PF 4UT6H 1P1ZB 1AGDA 1C7TA 4YEEA 1OAQH 3RWGA 5IKCB 5INCB 4WWID 1XFPA 3WE6A 4D9QD 4OZGE 1VFOA 2F74B 2IFGA 3FB8A 1CDIA 5CEZE 2BHZA 3UAJD 4TSCL 5JORB 2NY5C 3NBNA 4UQ2A 1HIMH 1HH6A 5FHBL 1PVHA 2D4DA 2L4OA 2NY2C 4IDLA 4H20H 3S3JA 3PDGA 5FB8B 1OVZA 4FHBD 1K9TA 2W92A 1FPTH 2X4TA 1CK0H 3MCLL 1FIGL 1H3XA 2A9NL 5I17B 4WO4D 4ODSL 3B2VL 3LZFL 4Z7VB 1U8KB 3SDXF 4MA7L 2ICWI 4CADB 3RWCA 2GKIA 5E8EB 4OKVB 3P9MA 2E6QA 5D2LE 2H26A 2A77H 5F71A 1QYGH 2LE9A 3NA9L 4GT7A 3MCKA 2Y5EA 4JZJA 1OCWH 1K6QH 1ZLUK 1QRNB 3QEQA 3K1KC 5I76A 4BA8A 5TE4H 1VEPA 1IGCL 5BVJA 5SV4A 4PJXE 2FB4H 4MJID 1CVRA 1P7QA 3D85B 1MRDL 3CXDH 3R06A 4XPAL 1S7VA 2HJKB 1JF1B 4PLKD 4Y4FD 2FZ3A 4M1DH 1PYWA 4UTBH 3ARGC 1PKQA 4D3CL 4OF7A 3OJVC 4GW1A 4IRSD 4JHZA 3S4SA 5IG7B 2C3VA 4MD4B 4AL8H 3UTSB 4EDWL 4S1DC 5F70A 5I1AB 4LKCB 1G6VK 1Q8MA 4AIZA 1FFPB 3SY0B 4TSAL 1YZZA 3MRHB 3C87A 2X4UB 4U1LB 5CJBA 3U1SH 3TZVD 2P49B 2P8LB 5E70A 1JPSH 3MV9A 5BOPA 4J1UB 1F90H 5FYJU 1LDPL 3O6FA 3QEGH 1Z6JT 1T2JA 2VXSH 3HR5B 3R0NA 3T77A 2J2ZA 3SO3C 2XPGB 1YQVL 3DV6A 4I13B 4NQDE 2EEDA 3IJYA 4Q97A 3WHE1 1I8LA 4AY0A 4D0DA 1IM3B 3MLTB 4I0PD 3DRQA 1IC7H 2NW2A 2RFXA 3L6FB 3MLRH 1OY3B 2R0ZL 4A6YB 2QQKH 3QNXB 2ENSA 1Y18A 2IQ9H 2E9IA 1I8MB 5H8DA 2FH6A 4RDQG 1I8KB 5K93A 4R26L 1GGCH 2NY6B 3QAZB 1T7ZA 1XF1A 5GGSA 5SWQA 2B1AH 2XNAB 3PWVB 1ZHBA 3WFCL 1INDL 2BCKA 3RUGF 3UBXI 1UJ3B 1OP5K 1OAZL 3MXVL 3RTQD 3W39B 2OR7A 5DDHB 5M95B 4JANA 3V6ZA 4XI5D 5DJ8A 5BZDA 4NZDA 3DXAB 4C55A 4UV4L 4Z7UB 5CEYB 4UTAH 3GEWB 5IGXH 4YNYA 3QEQE 3W11C 2LTQB 4MNQD 4M7ZB 3T1FA 1RUQL 3OJDA 5DWUL 2X5PA 4TSCH 4WFED 5HYEA 1E4WL 1ZANL 1I3GL 5F6IB 1CG9B 4WDIB 1CFTA 1D5ZB 3B9KD 5FHBH 4LSTH 3VG9B 3WFHB 3O6LL 4PGBA 1RZKL 3HZVA 5LAXB 1DN2A 3K0WA 3AUVA 3ARGA 4P2QE 3MCLH 2A9NH 1BVLB 1QLRB 1A8JH 4AZ8A 3B2VH 1UQSB 3LZFH 1IGTB 2XV6B 2EZ0D 5CBEA 3H2WA 3CFDA 2FX7L 4MA7H 5E99H 4WUUE 3OQ3B 4RZCA 5IFJA 5E5MA 4OZIB 4BH7A 4IS6B 1WAAA 5JZ7C 2VZSA 3HNSL 5GPRA 2JB6B 4WTZG 3TYFA 4CU6A 3EYQC 1RZ8A 3TA3C 3G6JA 4F7MB 1CD8A 3BN3B 2YUXA 3MXWH 4H25B 3VDCA 5ETUB 3HHRB 4CDHA 1IGCH 2IQAA 1P5UA 3C6LC 3ZZ1A 4N68A 4GAYB 3D3VD 4G6FB 3BRFA 2F8VA 3CVHB 4XPAH 4HPOL 1QOKA 1S5IL 4ZMAT 4Z5RB 4Q0XL 4XH2B 4D3CH 1ED3B 4PJ9C 1KG0A 2HWZH 5HGDB 3OKEA 3U0PB 1ZLWK 1SYSA 1P84K 3MFFB 4LHJB 5T5FL 1Q38A 3QXTA 4EDWH 1R3KB 1YNTB 3NCJH 2BSSB 2XWBB 3VGAB 4GOSA 1NJ9A 3L7FB 3QXAA 4FZ8H 1BFOA 1DL7L 1DSFL 4OD3L 2Y6SD 4PJDF 5MENE 2YD4A 4FQHB 4HKJA 4G42B 4BZ2L 4NHUB 1HE7A 4HQQL 5DVMA 5J12B 2FGWL 4RMQA 4LEOA 4NRXB 4IOFD 1P6AB 4R7NA 5FGSA 3HAEB 4IJ3C 5DMJB 3ZTJG 1M7XA 3PGFL 5CZXC 3VXQB 2DWDB 4KJQD 5IVNA 5DJXA 2P1YA 1RZGA 4V1DA 4R97C 3QULB 5BS0D 4EKXA 4KTYA 1BF8A 3RWJA 3RVWD 2EDTA 4L4VB 4R26H 3QJFA 4MAYC 3U9PL 5D7IF 3TH4T 4P0DA 3WV0A 3LY6A 2X7LA 3V0VB 1D6VH 3BZFB 2XZAL 5C7XL 4M9PA 1UKTA 2WBJC 4NZRL 1WIUA 1J87A 1OAZH 4HS3B 3MXVH 4PRHD 1OAKH 5DMIL 3ZE0E 1UKSA 3MLSL 4LHUD 1I1AC 4HJ0C 5JW5A 3RWIB 1MI5E 3IDNA 4ELMF 5DS8B 1RZKC 5DD3L 4NCC1 3M17A 1BMGA 3KXFB 4FS0A 4RGMC 3AGVA 1AJ7L 4HWZA 1B9ZA 3C5JA 5DHXB 3TA3A 1U92A 2VIRB 3BRGC 3VXUE 5DURD 5DWUH 5GRYA 3FB6A 4I0KA 1K85A 1GXEA 5D72L 1EEZA 4HH9B 1E4WH 3GKWL 3NVQA 1MRFH 4I5BB 3WDJA 1ORQB 1AXIB 5C0CA 5C09D 3O6LH 1YY9C 2J88L 3O3BB 5FM8A 2AQ3A 3MJ6A 3K46A 5JR1H 1HQRA 4DKFL 3UTOA 4PJ9A 2H9GA 5HBBA 1LP9F 4YC2C 1B2WH 1BOGA 2R4RL 3MLUL 5C0BB 4BSJA 2X4QB 1M71A 5JPMB 2VO5A 2VB5A 5F9WB 2N1KA 4DFIA 4LMQI 2V5TA 4OLUL 1XGPA 1IEBB 4I3RL 4QHKJ 5IW6A 1FN4A 4Y4HD 1EO8L 1AHWB 1ZS8B 4HWNA 4LCYB 1OB1B 2GAZA 3KYKL 4Z78A 3MUY1 4ZUTA 5C0AD 2VDKL 5IVOA 4IHOA 4Y4KD 1OT2A 3G5VA 3Q3GB 3G5ZA 5F97E 5FGRA 2J6EL 4I18B 3HFML 4HPOH 3GMLB 3MLWH 5FYJD 4Q0XH 2AEIT 2HJLA 4LSPL 4POZC 5DA4A 2UWEA 5H35B 4P5TB 1A14H 4NKDB 4V1DE 4K7PY 3MGTA 4Q58C 5EULV 1A9BA 2JJSA 4P46C 2BP3A 1XCTA 1ZGLM 3ARFC 3DPBA 3QSKB 5EU7C 2DQGH 5MEOA 3WD5H 3L3OA 4MAYA 4BQ9A 1BIIA 4UNTA 2V7HA 4K3HA 1DL7H 4WI5A 3PWPD 3WUWG 2Y4SA 5F7EL 4Y16C 2WW8A 4ZFOB 2YPLA 1CICB 3QIBC 4BZ2H 2WBJA 4XNZB 4HQQH 3QBTB 1NC2A 3SKOA 4Y5YB 5BRZB 5EO0B 1I1AA 4X7CC 1JGDB 3MBEB 4PRPE 5TE7H 4KK9D 2UY6A 5J3HC 3JWOL 3PGFH 2XZZA 1EEYA 1C08B 5IHZB 4GAGL 4OV5B 1OTUD 2YUVA 5E2WL 3AM8C 3K1DA 4MNGB 2BNRA 3TBVA 3ZT7A 5JDJA 4DEPB 2I27N 3Q6FB 2VAJA 3OKOB 2YS4A 4MXQC 3V7AG 3U2SA 1GGTA 5C0CE 1PLGH 3U9PH 5J9PB 1S78D 4OZHE 3MREA 2R69L 1KPRB 4QHMB 2HN7B 3HCVA 1WITA 1ES0B 1J8HA 4WFGE 2XQYK 2J3SA 4NO2A 5C7XH 5EOTB 4PB0H 1OSPH 3G04A 3D6GA 1HCFX 3BW9B 3KHOA 4Z7WA 3TJHC 1A02N 4ZD3H 1F6AA 4FNLL 3GMQA 5IK3B 1FC1A 1QPPA 4QT5A 2W9EL 4MD0B 4PJCA 3OTTA 5DD3H 3FO0H 1MRCH 1ADQL 4Y2DB 4RIRA 1RUPH 1AJ7H 1S7QB 1JGEB 1P53A 4U1JB 3RQ3A 4OCWL 4YHIA 5FA4B 3RFZC 2GJZB 3ZKXC 1CGWA 2M1KA 2BXYA 2ICES 1ZHKB 2APTA 1I3UA 1DZBA 4L3EB 2J88H 4K7PX 1EO7A 4GKSB 3VFTB 1I9JL 5KVFL 3S35H 1IFHL 4DTGH 5FOBA 3NCCB 2XIDA 2BXZA 4N1EA 3OKKA 3BDXA 4X6DB 4LCWA 3QCVL 3A67L 2R4RH 3MLUH 1IARB 3UAJC 4O51B 4XCNB 4P46A 4NQVB 4MB3A 3PWNA 2ILLA 2GJ6A 3ARFA 1MJUL 3BEWB 3BXNB 1KNOA 4QRTB 1N5YH 1RVFL 3ARWA 3HRPA 1YEIL 1T1WB 3D2UD 3RY5A 4I3RH 4Y16A 3V4PL 4U1MB 1EO8H 1SQ2N 3QIBA 5I66B 3EYVB 3MRPB 3KYKH 4MX7B 2BVTA 3X3FH 5J1AA 4OCLC 2VDKH 4LU5L 3QIWB 3HFMH 2GK2A 3ARDB 3FOMB 3SDXA 1UXWA 4N0UA 4LSPH 5I73B 1J5OL 4CMMB 1NLDH 1RUKL 2P5EB 4PJFF 2OSLB 2C4XA 4ZFGH 1IMHC 1H5BC 1NGPH 3E2HB 2F53B 1U8MA 1U0QA 3CDFA 3JWOC 1HI6B 4R8WL 3HPJA 1U3HC 3MTRA 3ZT5A 4MJ6B 1AFVL 1J8HE 4Y4FC 5C9JB 4NFCA 4PJIE 3SKMB 4GMTL 1RK1A 1RJZA 4RAVB 4EN3B 4IRSC 2ICWB 4Z7WE 1MFBH 3CZFA 5I1GH 2DMCA 3V0AC 1C16A 4PJCE 4LQ1A 1X5HA 4J2XA 1N4XH 5AZ2H 3I9GL 2DIJA 3DBXB 1T1XA 1IQWL 4MAYD 2YEZB 3TZVC 32C2A 3MOBL 1NUGA 2IF7A 2QSCL 4GAGH 5L8JB 4M5YH 5E2WH 1NCWH 3TT1L 2EE6A 3R8QA 2F54E 4XAKE 3IXAB 1CDBA 3NCEB 3BVNB 3KLHD 3B3IA 1GH7A 4QRSB 3QRGL 1CXKA 3H9SD 2R2BA 1MIEL 1CBVL 2IANB 2XKSA 1DJSA 3WSQL 1WIPA 4DZBB 1MFAL 2NY1C 4LSQL 2GSGA 4UNVA 4J23A 2PTTB 3WJJC 1P7KA 1PZUB 1BBJA 2A83B 4DZ8A 5E2TL 2FIKB 2W9EH 1D5MA 2FYYA 3AMLA 5EU7E 4MCYB 2AQ2A 5GRXG 1ADQH 1IGFL 3KYMB 3I6KB 4KZDL 1IC4L 4JZOB 4Y8AA 3VXMD 2X1PA 4E5XA 2C3XA 1NQBA 4O5LL 3W81A 4O2FA 1MH5B 3ARPA 4GRWF 1KUMA 3RTQC 2EDHA 3RNQA 4Y88A 1HILB 1VGEL 4AEFA 3AVEA 2Y36L 4ONOA 4R3SA 4ZPVB 3CFJB 4XNXH 4XI5C 4E41B 5JA8B 5GS0D 4LK4A 4XVUD 3QHFH 3VD9A 3MUZ1 2WK2A 1I9JH 2XOTA 3SCMD 2JJWA 4IOIA 3EYUL 3IDIA 4GMSL 5FYKU 3M8OL 4MCZB 4PRNA 1CDGA 3QCVH 3A67H 2EC9T 1H5BA 4PGEB 1A6AA 1D9KD 4Z18A 2VLJB 2OX5A 3UBXB 3VWJD 1MJUH 2BOBB 3B9KC 2OJEB 2P44B 4MJIA 5HYJD 1RVFH 1U3HA 1YEIH 3CD4A 1MUJA 2XQBL 4Y4FA 1TPXC 1FGNL 3V4PH 4DVBA 5KSVA 2UZIL 3HC3L 3GMRB 2YRLA 2J1KA 5SX5K 4PJHF 4NFDA 2EZ0C 1Q0XH 5ACZB 4LU5H 4ORGA 2X4SB 2CDGA 2BHYA 1R3IL 1MLCB 2W9LA 4F58H 4QRRA 2MFNA 3NCYS 1I7ZB 4PRIB 1J5OH 2B4CH 4G9DB 3AB0B 5FDWB 5AWNH 3GSWA 3KYAA 1JHTB 4QTHB 3KPPA 3TZVA 4JFHD 1FL6A 3ZKSD 1A0QL 3G6DL 3IGAA 5H2BB 1AR2A 2P24B 4CVZA 1AY1L 4NYLA 3I3EA 3K7UA 1ADQA 4RAHA 3ROLA 2VABB 2FEDD 1AD0A 4W6WB 3SDYL 4B7LA 5KJRH 4K71C 4KVCL 2Q7YB 2EXYD 5I16B 3SGJC 3QCUL 2WIIA 5LCVL 4I2XB 3KPSB 3SQOH 4LLVB 1JPFB 4D9QE 3M1BA 1JF5A 7CGTA 3WJJA 3UO1L 4X9IA 2V7NA 5DD6B 5L9DL 2G2RA 4IMLA 4TVSa 3I9GH 2BSTB 3D69A 3TO4C 5CILH 4CVWA 1IQWH 5DEFA 3MOBH 4HIEB 2QSCH 2Y6SC 5I74C 1BJ1J 1CFQB 3EZJB 1UG9A 3F6LA 4NQCD 5FYJL 2DQHL 3OKNB 3S4SG 4PJDA 4IOFC 2RIKA 5KSBF 2C3HA 5T1LD 4J3SA 3QRGH 3W9DB 4ZUSA 1FVEA 1JZ7A 5DZOA 1KB5L 1MIEH 4X8JA 1LEIA 2MKLC 4MA8H 5C0EA 3WSQH 3WLWD 4RRPG 2X1XR 3D39D 3HG1A 3WE6B 3S7GA 4KJQC 3FB8B 4YUEL 2EE9A 3IKKA 3BO8A 4R4FL 4JJHA 4WFFD 4M93C 2Z8VC 4MNQA 4Q6IB 3RVWC 4UQ2B 1HH6B 4MJIE 1QBMH 1KIPA 4UU9B 3B9KA 4XP5L 4KZDH 4PJGA 2X4TB 2R2HA 3MV11 1HOCB 2Z8WC 5SWSD 2WZPD 4I3SL 1IEAA 1NGXB 1KGCD 3F7VA 1HZHH 1DDHB 5J89A 3SGEH 4LVNB 1IGYA 1JWUA 4JO3L 3RWCB 3U30C 4XNYL 5F7DA 3H9HA 4Z76A 1KULA 2F8OA 3P9MB 3QA3A 2H26B 4YHYB 4PJBF 1BGXL 1AP2A 4ELMA 1N0LA 4JZJB 3IU3A 4LASH 1H15A 3EYUH 1A1OA 2ESVD 2DIAA 2HT4D 3QEQB 4GMSH 5IW1B 4ESKA 5I76B 3EJZD 2CK2A 3S97C 1MJ8H 1QFUL 5BVJB 2X70A 2NYYD 3AS3A 3R06B 1E28A 1S7VB 5EO1B 2QADB 3QO0B 5DUPL 1PYWB 2IPTL 3D3VA 1PKQB 4YXLL 2FL5A 3LQAH 4GSDL 4GW1B 2XQBH 1FGNH 2C3VB 3SGJA 3GJEB 2IGFH 3HC3H 3HE7D 3UEZA 4NOFA 1ZGLP 1NGQL 5DRZA 5I1LA 3KS0J 4AIZB 3OKLA 1R3IH 3O81A 1T04A 1GOFA 1ZWIA 2KQNA 3HN3A 2W07A 4FFWC 3OG6B 4UB0H 1OW0A 3MV9B 3C9NA 1QKZL 1KLGA 5I0ZA 3TO4A 3O6FB 5DMGD 3T77B 5I1IL 3CVIL 1MCCA 4Y4HC 3TN0B 3GIZH 1BM3H 2YWYA 1FBIL 3G6DH 4PPTA 3DV6B 3MLYH 5HHMB 4X4YA 3IJYB 3QXWA 1AY1H 3DOSA 5F21B 4YBQD 4KQ3L 1JZ2A 5D1ZB 2NY7L 1T0MA 3KPQA 5GZOD 1P69B 3H3BC 1CFSA 1Z3GL 35C8L 4Y4KC 4U6TA 4D0DB 3WKNA 4JGJA 3NGBB 4K9EL 3REWA 2NW2B 2RFXB 1RUML 3PP3K 2N56A 1JYNA 4UMGA 2Z35A 3TPKA 3RHWF 5LCVH 4EBQH 1Y18B 1UYWH 3PV6A 4CVXA 4MNQE 3ULSA 2D7NA 3BKJH 2FNBA 2GFBA 1GCFA 3UO1H 5BS0A 5GGSB 5SWQB 2X05A 4WFEE 5C0IB 5K59E 2L0DA 1BREA 2ZCLL 2DM3A 4YDKL 4QRPA 4PJGE 2BCKB 3PF2A 2AABL 1T0NA 2DQEL 3WMSA 1ZA3A 1BFVL 3OXSB 5FYJH 2DQHH 2DRUA 2IFFL 4WHYH 4JANB 4M8VA 5DJ8B 3IRZA 4HS8L 3T0VA 3TBSA 1KB5H 4Z7QE 4HZLA 1KV3A 4MLSA 3X13A 2BNQA 2WP3T 4YNYB 2EC9U 3T1FB 3K4ZA 1OTUC 3OJDB 2NZIA 5HJ3B 1KJMA 1V7ML 3TEUA 1S7TA 1LGVA 1P7HL 1CFTB 1NFDE 1S78C 5FCSH 3D3VE 4PGBB 3HZVB 4JFOA 2LU4A 4OLYL 3ARGB 3LEVH 5FYKD 1I9RL 5E24E 1FLTX 4I3SH 4U6HA 5CBEB 3CFDB 1DQDL 5J13C 5IFJB 4RZCB 3ZE1F 5E5MB 3B9EA 2LFGA 4BH7B 3OR6A 4LF3A 5T1KB 4JO3H 1EERB 4XNYH 3EFDL 2NX5B 3TYFB 2HTKD 3EOTL 4QLRA 1RZ8B 5TDPA 5IJKC 4Z8FL 3G6JB 2BDNL 4YWGL 3EYSH 4NQSA 4XHQA 4C4KT 2BX5A 1Q94B 1A3QA 4PJ8D 1HWHB 4OGXL 1TZGH 3NPSB 1XIWC 5AUMA 2AJYL 3SO3B 3OF6A 2VTFA 3FJTA 4ZO8A 2G9HA 5B22A 4XHJD 3R1GH 3RNKB 1E6OH 1IGJA 4Q9CA 5DUPH 5FUCC 4Y4KA 2JK5A 4M02A 1KG0B 3IFPA 3VFRA 4HJGA 1YECL 5IBLD 2X4PB 4GSDH 4DUVA 4G8GD 2XFXA 1SYSB 2NXZB 3BIAX 3FQUA 4BQ6A 2V6HA 2JIXA 4C83A 1U93A 4PY8J 5BS0E 4K9EC 3UX9B 1KB5A 2P48B 1NJ9B 4JY6A 4PJ5D 4RMUA 4F3FA 1YEKL 1BFOB 3TPUA 4P5KA 1KEGH 4MZ2A 3TH3T 5DD1H 5ALCH 5C0JA 4S1RL 2GYSA 3DI2B 2A0LD 3KGRA 2ZUVA 1QKZH 4HKJB 3PWPA 3NIDF 1NDGB 3CVIH 3U6RA 5GS0L 4JJ5A 3ULUF 1O0VA 2Q8AL 4LEOB 3TT3L 5F96H 4PRHE 1UB6A 4R7NB 3CUPA 4JLRA 4IIQC 4G43A 4MDIA 1W0WA 1Z3GH 35C8H 4CL7A 1DBMH 4B53A 3CLEH 4OFDA 1RUMH 5EPMA 4XVSL 1XF4A 3ALXA 5ACMA 2A6KB 5DJXB 1WWWX 4W4OC 4O02L 3DV4B 2A6JA 5CD3A 3RWJB 8CGTA 3U7YH 3QJFB 1JPTL 4PJFA 3BQUD 4PGDB 4GQ9L 3VRLF 1A7RH 2X7LB 5IVXA 4OCSL 5C09E 3RI5K 3UDWC 3WYRA 4XNMA 4PTTA 1MFDL 2AABH 1EIBA 1XF3A 2YD1A 2DQEH 3JTSA 3QCTL 5ILTH 5JW5B 1SHMA 3MRBB 5EZIL 2IFFH 4LLUA 3IDNB 3TYGL 2VSCA 4M7KL 3K2UL 4HS8H 4HK0A 3RRQA 3RDTD 4NO3B 1H3TA 2VDRL 4GG6B 3SGKC 3AROA 3C5JB 3MNWB 3TA3B 2J5LB 1WZMA 4LDEB 3NIGE 2O5YH 4RNRA 2ZCKH 3TJEH 1QSFD 3H9ZA 5HVFB 3B83A 1XIWA 4ODVH 1WFNA 4UIKL 3LN9A 3KLHC 4TUJA 1G84A 5C0AE 2Z93A 2YD2A 4JCLA 2IAMD 2NNAA 4YXKL 4BM7A 1NCDL 1HQRB 3ES6A 2KDGA 4OLYH 3PL6D 4X9FA 4ALAH 5DZNA 2VKXA 1I9RH 5FYJE 4KKAD 4X4XA 2EKSA 1UWGL 1YMMD 5GGQL 3KJ4C 4M7JL 4YDJA 4HC1L 2LQRA 5I8KH 1DQDH 1P6FA 1AO7B 1DVFA 2A9MH 3BJ91 3EFDH 1CD0A 3CXHJ 3EOTH 1XGPB 3BN9D 3T65A 2BDNH 4YWGH 1AKJA 4QKXB 5JOPE 5IW6B 3PWPE 3SDDD 1FN4B 3BDYH 3DYMA 3D2UA 3C60D 2GAZB 4Z78B 3CX5K 3E8UL 4ZUTB 2AJYH 43C9A 3T0ED 3IDXL 1ZLUH 1YEFL 4IHOB 3G5VB 3G5ZB 1U95A 4IIQA 2CIIA 3K81A 3NCBB 3VXRD 1PG7W 2HJLB 5GS0C 4U3XA 4IJ3B 3ARED 2UWEB 1YECH 5TJWK 3MRIA 2DTML 5TDOA 3GRWH 3CSYA 3MGTB 4U1IB 3SCMC 3FQXA 3STZA 1A9BB 1LD9A 1ZHLA 3JWDH 2EDJA 4W4OA 1HHKB 4FQJL 1I1FB 1NLBH 1D9KC 3L3OB 1KENL 4IDJL 2V7HB 4XNQA 5IVXE 3VWJC 4ZOBA 5HI5D 1DEEA 2QHLA 2P5WB 3MA7A 2YPLB 1NCCL 1T4KB 3UDWA 5HDQL 1K8DA 2WBJB 4MXVE 5KAQF 3U82B 1NC2B 2YMXL 3SKOB 1F45A 4EI6A 4OUUA 2V2TA 4XP4H 3B5TA 1V3MA 5T3XH 5C08B 2YN5A 3MUJA 5FHAL 4RGOH 3KPLA 2BK8A 3IKCA 4PJHA 1TJHL 4RGMB 4JM2F 1FSKC 5CJOH 5E94A 4TNVK 5FKAB 3QG6B 5B8CB 3VXPA 4YQXL 4U6YB 2B2XL 5T33L 2BNRB 5DRNA 1ZEAH 5TPWH 1AE6L 2XYCA 2I5YH 4JO2H 4JG1L 5IEHB 3U2SB 4WW2C 1JPTH 1JZ5A 1A2YA 2VDOL 1J8KA 3MREB 4FFZL 2FEDC 4GQ9H 3V4UL 4IMKC 4LRIC 4OCSH 5FUCE 1G7PA 3BYYA 3MRDA 5EH1A 4HIHA 4JDZB 3HZMA 3AAZA 2IEPA 3QCTH 2VQ1A 5DSCA 4Z7WB 3HNVL 2FJHB 3BKML 3K4DA 3GMQB 1I1YA 2OM5A 1OP5H 4KK5C 4QT5B 3TYGH 5EZOL 3FFDA 3K2UH 3G5XB 4YDVB 4RIRB 1IEHA 3SE3C 2VDRH 5C2BL 2GITB 3Q0HA 1OTTD 5LQBL 4YHIB 2JKXA 3VXMA 2IMMA 3RWFA 1CI5A 1AXTH 3FONA 4HUUA 2B7DT 4OZFA 2WQRA 4UIKH 2XZQH 2I60L 4K3EL 4HIIA 3EUUA 2FHFA 2EYTA 4OF5A 1NCDH 4FQIL 4UILL 2DQIH 1NCNA 2CMRL 2A38A 2YR3A 3L5HA 3WLWC 5MEQB 1DUZB 1CXHA 1BAFH 2FX8L 1VSCA 1X5IA 3SCMA 4HKBA 3TESA 3C09C 3P9WB 4HC1H 4LCWB 5FGCE 4P46B 1QTYT 3PWNB 2GJ6B 1W72L 5FV2A 1KNOB 1JIBA 4R6UA 5K9OA 1D9KA 3QIUA 3VWJA 4Y16B 5F7LB 1U3ZA 1DBKL 2B0SL 5F3BA 2FWOA 5D71L 3EZ8A 3I50L 4OT1H 1MQ8A 4G6AC 5F72S 1SJVA 5J1AB 1HSBA 5DK3A 3IDXH 1FYHB 1HWGB 5HGBB 2ADJA 5EIQA 5D2NC 4O58L 3SDXB 1UXWB 3MLXH 4N0UB 3GBML 1XGTA 3STLB 1PG7L 3F62A 2DTMH 1FG2A 1NANH 4KMQA 2HT4C 4YR6A 2XTJB 1U8MB 1HYSC 3SDCB 4GJTB 1FAKT 5C0GA 2G75A 2NYYC 1MCBA 3HPJB 4WW2A 1N8ZB 1XEDA 3ULVD 3H9SE 4CVUA 3A0OA 4GRMA 2MCPH 3O4LD 4IMKA 3JXAA 1NCCH 4LRIA 1RJZB 1NKRA 2VQUA 5F1OB 5HDQH 3S37X 3X3GL 5E0QA 1KEML 2Z0BA 3HE7C 1FYTA 1MREH 2HFEA 3G6AB 1C16B 3MOQA 1HSAA 4L8DB 1Z9LA 4LKXA 4P2RD 5EUKA 8FABA 3RGHA 3INUL 5FHAH 1WVZA 3RPIA 3ILPB 4X0KA 1F00I 3X12A 1TJHH 1T1XB 4J3TA 5E9DD 3SE3A 1A6PA 5T33H 2B2XH 4HC1A 3VXME 5DMGC 4MDJA 3EOBA 2IALA 4M6ML 3B3IB 1G7IA 4YPGA 4BYHA 4U6VH 3C08H 4YBQC 4LVOB 4HLJA 3OPZL 4S0TD 1U36A 3P77A 2KUTA 5GZOC 2VDOH 1CLZH 2ZSWB 4FFZH 2XZCL 5T1LA 5E00A 5DR5H 1RZIA 5DEZA 4X6FA 2Q86A 3CLFL 3OKYA 1V7NL 5DUMH 2GSGB 4NJ9L 4D9LL 1MHCA 1BBJB 3SGDI 1A22B 3D39A 4X8XA 3RPKA 4DZ8B 4MQXD 1D5MB 5A2FA 2FYYB 1DBBH 5EZOH 1T7YA 4EI5A 3L5XL 3MRQB 1F4AA 5DMKB 4WW1A 5J7CC 1N3NA 4X6CF 5C2BH 4E9LA 4E5XB 5HYJE 5LQBH 3NFNA 4NGHH 4O2FB 1TETL 2YKLL 3WIIL 4Q9QL 3BJLA 3RNQB 5SWSA 1K4CB 3RUGB 3UPAA 1A7PH 1Q9WA 3JTTB 4PLJD 4R3SB 7FABL 5JMOC 4OLEA 4QRUB 4K3EH 3BAEL 5JUEL 3DHJA 1F4XL 5D2NA 2VZOA 4OD2A 2AQ1A 3QUYC 4FQIH 1IGML 4JO1H 3LN4A 3VFUA 5CLWA 4IOIB 3WS6A 2CMRH 3BH8A 4P3CL 3GSRB 2FX8H 4TULL 2R2CA 1MFCH 4PRNB 4JFHE 4WEBL 1CIUA 2ESVA 1H5BB 1U58A 5BV7L 5K9JH 4ZTOH 1F8TL 2GCYB 4UDTA 1FL5A 1EJOL 1X5XA 4MJIB 4RBPK 1JYWA 1U3HB 5MEPA 1MUJB 1FP5A 1DBKH 2B0SH 3DIFA 4DAGH 4DVBB 1TQBC 4WI2A 4Y19B 5KSVB 2ADIA 3OGOE 4XBGA 1LHZA 2YSSA 1S7WB 4KI5D 4ORGB 3ARYA 3HE7A 3WFEH 3DO7A 4DKEL 3IDYC 3L7EA 5KOVC 4QRRB 5JHDB 1D5IL 2UYLA 3CFKA 3ARUA 4O2CA 5CINH 3GBMH 1HXMB 4HWEL 1JF6A 1T2XA 2FX9L 5FOJA 2BVOA 4GRLD 3KPPB 1FL6B 4PJEF 1UZ8A 4XPHL 1VGKA 4NQUA 4PJ8C 4PD4J 3IGAB 3BPNC 3FFCA 5EWIH 5DJCA 3RKDD 4U7MA 4OLWL 2R8SH 4NQCE 1NMAL 4PYGA 3E0GA 3ROLB 2QKIA 1LMKA 3BPLC 3JUYA 4HMCA 2R2EA 1H3VA 1LO4L 4H26A 5IBLC 1UH3A 2WIIB 3HC4H 1NEZA 1KACB 2LVCA 2NY1B 3X3GH 3IDMB 1ZT4A 3D39E 4KZEL 1KEMH 2DI8A 2ADFL 5IESL 2V2WB 4FP8H 1MHPL 4WFFE 2V7NB 2K7PA 3MGOA 1KTRL 1R6VA 2VSDA 2V2XA 3INUH 4LLYA 4IMLB 5DT1L 4K23L 3HZKA 4D9RD 3D69B 1C5DB 1KPVA 4OTXH 2RHEA 4M6NL 2A0LC 5I8EA 5A1AA 2CDFB 1FJ1A 4XPTH 3T2OA 1L9MA 5JOEA 2DMBA 3V95A 15C8H 5SWSE 2DOCA 4PJDB 4YHMH 4I1NB 4LARH 3VFGL 5FO8A 3L95B 1H0DB 4ZUSB 5HHXL 2P47B 2KBGA 3LQZA 1LEIB 5D2NE 2XZCH 1JRHL 3VE0A 5C0EB 1MCEA 2XA8H 2VLMD 3MA9H 3HG1B 3QUYA 4XCYA 3C5ZC 4M4RA 2VH5L 5EC2A 3BO8B 4NJ9H 1FZOB 1GOGA 1BD2D 3DYOA 2AK4D 4FQ1L 5DRWA 3NZ8A 2ESVE 1GPOH 1NBZB 2D4FA 4Z7NE 5I30L 1HK6A 5F8RC 1L0QA 3MUHL 2R1WA 3ZE2E 1KIPB 1TZIA 3MV8D 4G7VL 5I1EL 2R2HB 1FFRA 1I1CA 2E7MA 1PGRB 4NHCL 3CMOL 1ZV5A 1SBSL 3TIEA 1FDLL 2VL4A 5D7IB 2OTWA 1IEAB 2XKNA 3BSZL 3LSOA 4Q9QH 2DDQL 1IGYB 1JWUB 4HXAH 1JNLL 4GKNA 5HYQA 5F7DB 4Z76B 7FABH 4AK1A 3QA3B 4GAJL 2E8YA 3BAEH 5JUEH 1FFOB 3CSBA 3B9VA 2XWTA 1AP2B 4ELMB 2E9BA 1L0YA 1IGMH 2JJUA 3IU3B 2M8XA 1O5DT 1H15B 4HW6A 4XCFL 2D7TL 4KRMB 5KZCB 4HD9A 4PJ8A 4WEBH 2IJ0C 2X70B 3W5NA 4XMLL 4TUOA 3HI5H 5KTEL 1E28B 1F8TH 1GAFH 4Y1AD 1EJOH 2MTPA 2Q87A 2AXGA 2FL5B 4X6BA 1INQA 4JY4A 2IAMC 3BUYA 4K71B 3PL6C 4PJAF 2V9RA 2VZUA 4M6AA 4R9HA 3KPNA 3M45A 4KKAC 4OZIF 4G8GA 1ZTXL 5I1LB 2SEBA 3DROA 3OKLB 4DKEH 1T04B 1ZWIB 1IT9L 1LP9B 1A4KB 4E42B 2BJMH 1D5IH 4RDQF 4LPYA 1K8IB 4PJ5A 3C9NB 2XWJA 1KLGB 4HWEH 3TO4B 3BN9C 1T80A 4G5ZL 3TO2A 4XPHH 2YXFA 3SDDC 2XN9D 2ADGB 1I75A 5FKPB 1FNEA 3C60C 3T2NL 1WSST 3T0EC 2EIEA 4NN5B 1CFSB 3QNYA 5ESAB 1ZMYA 3GNMH 3UTZB 3REWB 5E8NB 1A6VH 1QSED 1LO4H 4LLMA 4IEFB 4XPFL 3ZO0A 1QZ1A 3AREC 4UQ3A 4G80A 4ZDHA 5F6HI 4JFDD 5K33A 4MVBC 3C5ZA 4ZAKD 4KZEH 5IMLA 4OAWA 3ULSB 4TRPH 2GFBB 1YNLL 3IJSA 1UC6A 4L3AA 5CIPH 5BS0B 1Q9LA 1Y6NR 4PREA 2ZP0T 2CLRA 5HVWA 1CS6A 4ZSOA 5DT1H 4RQQB 2IADA 1NEUA 4K23H 4P23D 4QRPB 1SVCP 1UM5L 1A5FL 2XXMB 4U0RC 1T0NB 1T20A 4WV1B 4QHKI 5FYKE 4RGND 5BVPL 2LU3A 3Q6GL 3F12A 4LVHC 1CLOH 3BP7A 3TBSB 4HZAA 4JKWA 4APQD 4HZLB 5E6YA 4JRXD 1JRHH 5CGYC 5I1KH 5CLTA 1LNUB 3X13B 3BIKA 1MAMH 2BNQB 3T0AA 4KGLA 4MYWB 1QSZA 4UT7L 2VH5H 4HCRL 4UUJA 2KZWA 4IRJD 1KJMB 3MRJA 5GS3A 5INDA 3PNWA 2VQTA 1MCSA 1S7TB 1MAJA 3RKPA 5I30H 1QSFA 2PYED 5DUBA 4JFOB 3ZHKA 2VC2L 3MODL 4G7VH 2A2QT 3CMOH 2IAMA 4U6HB 2CRZA 3BSZH 3GJFK 2OI9C 2G60L 1QG3A 3ZDYE 1S9KC 5DHVA 4LF3B 1JNLH 4MMZC 4X9BA 4ZODA 3IJHA 3S36L 1ZLVK 2X10A 5FXCH 5TDPB 4PJ5E 3UTTA 5DC9B 1DQTA 3QG7H 3EHBD 2BY0A 5DJAA 4XCFH 2CPCA 1OTTC 2A6IA 2EDOA 4BELD 3SDDA 4YGVA 1EVUA 3C60A 1FO0L 3RVTD 5DK0A 3T0EA 1RZFH 1C7SA 4Y4KB 1HH9B 2JK5B 5ITFA 3IFPB 3VFRB 4HJGB 2W65A 2AEWA 5CJ8A 3V5KA 1I3RA 3FQUB 3VXRA 3AREA 1J05A 1J0ZA 2JIXB 1Z0NA 2PO6D 4C83B 1U93B 5IQ9A 1X5YA 1KB5B 4JY6B 5D7JD 4XVJH 4H8WL 5SX5H 4P5KB 3BUTA 5C0JB 1T7XA 3P9LA 4EJ1C 5ADPL 1JTOA 5GJTH 4H1LG 1C1EL 1I3VA 2VUYA 4JJ5B 3QUZA 5GGRB 2AJZB 1N0XH 1UB6B 5I75C 3SDAD 3CUPB 4JLRB 2DKSA 4G43B 3EYOA 3U46A 4MDIB 1W0WB 1SJEB 3QQ9D 4S1SH 4U3CA 4NZJA 4HIXL 3OKMA 3V0WL 3MGAA 5EPMB 1XF4B 4XPFH 5DD5H 5IROC 3TIDA 3UMTA 4NC2B 4PTUA 3IF1A 2NLJA 2LU7A 1MCJA 2A6JB 5CD3B 1YNLH 4I3GA 1QSFE 4PJFB 5IFHH 5JMRA 3VFMB 3B9AA 1SJHA 3NIFF 2ITCB 1UWXK 4PTTB 4QHUA 1FNAA 2ZUSA 1XF3B 5IP4A 3JTSB 3GGWA 4FG6C 4BSVA 3V5HA 2JJTC 2NXYD 3Q6GH 4LLUB 4JHWL 1YMME 3KS0H 1GZQA 4HK0B 1IKFH 4B5EA 1SMAA 3QXUA 1GOHA 4HUXA 2JLLA 2OLDA 2NY3B 4R2GD 4UT7H 5IMOB 1Q9OA 4R4BA 4U1KB 3GFUA 1XIWB 4GQPH 2EIZA 5TFSL 3T0EE 4D0BB 4TNVF 2C7UA 2Z93B 2YOCA 4LLDA 1JI1A 1XAUA 2H8PB 2NNAB 3BGFB 1RMFL 1KT2A 5A43C 3VXRE 3O4OB 5DK2A 4X4XB 2EKSB 3KLSA 4YDJB 4QXTB 1T5WB 1A7QL 1DVFB 4YX2L 4MQXC 5C07D 4OZ4A 4NQEA 3BT2L 4U1SB 1GGUA 1AKJB 2GY5A 1HINH 4ODWA 5BOZG 1IAOB 4H8WC 43C9B 1DQML 3STBA 3WHE0 2DM4A 5AYQA 1U95B 4EXPX 1HKLL 4ISVB 4PLJC 4NNPL 3UJIL 3MRIB 2VR5A 4F80A 3BGAA 5TDOB 3FN3A 3CSYB 3IS1X 5IROA 2RGSA 4BFGA 3STZB 1LD9B 1ZHLB 1NL0L 3IS0X 4GBXD 4ACPA 3OB0K 4U0QB 4ODUB 1FHGA 4L8SA 1I9IH 2FGZA 1EXUA 3RL2A 2F5AL 4GXUN 1U41A 4H8WH 2CJUL 4XNQB 4JR9L 4OZFG 2D7OA 3C8HA 1BF2A 1DEEB 4NM4L 1XCQA 3MA7B 4LSSL 3OX8A 1VESA 5IB4A 5I71C 1B3JA 1K8DB 4ZO6A 4X7TB 3VGEA 3O4LA 2XT1B 2DD8H 4EI6B 4OUUB 4KJWD 5D1XA 4ZTPH 2FJGB 2JJTA 3D9AH 2VLKD 5EUOF 2ZKHH 4DKAA 3BGMB 3EDKA 2AJUH 4MWFA 4ODHH 3KPLB 4HIXH 4PJHB 3WXVH 3V0WH 4P2RA 3H0TA 4UINH 2PF6A 3VGDA 5B39A 1W8OA 3V7MA 3VXPB 5FV1L 5DRNB 5E9DA 1F5WA 4KKBD 5J11B 3PP3H 2AEPH 5FK9A 4DGIL 1AD9B 4WVRA 3VH8A 1T5XA 1S7XA 4JGUA 3QEUA 3VD5A 3IU4L 1G7PB 5C6PB 1Z9OA 4AH2A 2VDML 1E6JH 3MRDB 1X4YA 2WUCH 4C56D 2HVJA 3HZMB 4OBSA 1FNHA 1NCAL 4YDLB 3GBNL 1Q72L 4N5UA 3V52L 3RWDA 4M48H 1JV5A 2VQ1B 4RMSA 5F9OL 3PP4L 3H8NA 4JHWH 3O3EB 1I1YB 3OKDA 3FFDB 5JIPA 3LEXA 4L4TA 2LAAA 4MAUL 4HK3J 5AG9A 4JFFB 4FZEL 1T7WA 3IVKA 4ONHA 1DCLA 5CKGA 5L7XL 5HVHC 3U4EA 3RWFB 4HUUB 1MVFA 5SWZD 2NW3A 1G7LA 1A4JB 2H3NB 4MLIA 3RBGA 3O2VL 4L8CA 5GGUA 3LKNA 5TH2B 2EYTB 1RMFH 4G6JL 5KSBB 5JHLH 3W0WA 2CRMA 1IZKA 4MA3A 2NTFA 3SCMB 3D1MC 3DVNA 1JPGB 4HGMA 2APVA 1U42A 1V05A 3GMPA 1A7QH 4YX2H 1EBPA 1G9NL 4L9LC 4KMTL 4HWBL 4I77L 5K9OB 1D9KB 3BT2H 2ZNWA 3QIUB 3VWJB 1SYVA 4GFTB 5F3BB 1WFTA 1J0IA 1FZJA 2FWOB 3ULVE 5AG8A 1CXIA 1CE1H 4J3VA 4E0RA 3O4LE 4Z7OE 4HUWA 1U8IA 4PP2B 3DX9A 1HSBB 1DQMH 4UT9H 1KF9B 5F1NA 2VN4A 1A1NA 1HKLH 2ADJB 4NRYA 3FB5A 5I19H 3Q48A 4OCNC 1T6VN 4P2RE 4HUMB 1BHGA 1XGTB 4OZGF 5ERWA 1NBQA 3KPMA 3UJTH 1R3JA 1RPQA 3MLVH 5E9DE 5I2IA 3KDMA 1VPOL 5J0BA 4JPIB 3UTQA 3DETC 1ZKAA 3SKJH 2VNCA 2OK0L 3DYPA 5C0GB 2G75B 1HHIA 2R0KL 3IFLH 2ARJB 5DF0A 4NM4H 3QPXH 1BVKA 4GRMB 3P4NA 2F19L 4LSSH 2AP2A 3ARBC 1MHHB 2W60A 1BIHA 2EECA 3TWCL 4U4BA 1FYTB 2HFEB 2OXGA 5ISZB 1I4FA 1YYMH 2DB8A 5FO7A 5JTWA 1HSAB 3NTCL 5D2LF 2VR9A 4PJAA 8FABB 1URLA 1IL1A 1X5FA 1J11A 4P4KD 4X0KB 4HXBL 4PJ7E 5IVZA 4OM0H 4YPJA 3X12B 4RX4D 4FMKA 2KH2B 1S8DB 4DGYL 3H3KA 3S8WA 5B4MD 4PJXF 4MDJB 5I9QC 3EOBB 2WIMA 4XNUL 3VXSA 4OFIA 3ZTNL 4DGIH 2EIDA 1VFAA 4M62L 1KSRA 5I18L 3GIVB 1S7RA 2H1PL 3P77B 5ECJE 4TSBH 4LCUB 5T1LB 2O93L 1QEWB 4LEXH 1T1ZA 3TF7C 2I07A 2Q86B 2OQJB 1NCAH 1IAIM 3GBNH 5AZEL 3V52H 1YQ2A 4L8BA 1MHCB 3I3BA 5F9OH 3D39B 4JFED 4ZAKC 1GGBL 5DJ0A 3V6OC 3C09B 4XZUB 2W0KA 2WBKA 3F7QA 2AK4A 4J8RA 4EI5B 2ED8A 2R0LH 4XP9H 4L9LA 4MAUH 5J6GA 1M1SA 4WW1B 4F15B 4FQXC 5T3ZD 1N3NB 4P23C 4U1GC 4PBWD 4MB5A 1QFPA 3TBWB 5F7KC 3NFNB 5L7XH 3MV8A 4GH7B 1G9NC 1G6RB 1XR8A 4KV5E 1A7NL 3FN9A 1JMXA 2VXTH 4J12A 4RGNC 2PKDA 1Q9WB 3UPRA 5EBLA 3KYNB 3K80A 4KI5E 1NEZG 4OCRH 5D70L 3CC5A 1ROWA 3O3DB 5D2NB 4G9FD 4APQC 4OD2B 3ZTJH 4G6JH 3VFUB 3LN4B 3TBYB 5KS9A 5E95B 3BH8B 5EIVA 5C9KA 1YY8B 2PXYD 5F89A 3V8OA 1S3KL 2YK1H 5DRXA 4P49A 3QXDB 5J6HA 1PBYA 2DLIA 3QHTC 4IRJC 3WNPA 1U58B 4P2CG 5D5MA 5DJ2A 1G9NH 1GSMA 3P0YH 4KC3B 2NPLX 2CK0L 4KMTH 1FL5B 4URTB 4OUOA 4HWBH 4I77H 3BD4A 4YFEA 2O61B 2J8OA 3DIFB 3NAAL 3S96A 1V3JA 3ARBA 4XBGB 3LHPH 1JGVL 1INEL 4NC1C 3HE7B 5LXGH 3EOAA 2R29L 5CKAA 5D1QD 2NY4B 3L7EB 3WXWL 2GTZA 2UYLB 1J1XH 2X44D 3CFKB 3P73B 4O2CB 1OTSC 4W6XB 3VU2A 4LAJH 3OHXA 1HKFA 2CRIA 3LDBB 3BZ4A 4G6MH 4D9RE 2Y9RT 2D03H 1UZ8B 3RAJL 1VGKB 3S35X 3WNNA 4MQTB 1KELH 3FFCB 1KOAA 3HE6B 5DJCB 3BZEA 4XBPB 2OK0H 5D6DC 4KJYB 1RQ5A 1N64L 2QKIB 5KSAD 3U9UA 5GRVK 3RVTC 2R0KH 4PY7A 2VRAA 2R2EB 2E27L 2C26A 1JE6A 1FV1B 3VW3L 2F19H 4H26B 4TOYL 1X9QA 2CIKA 3QUKA 4NM8H 2ORBH 1FH5L 2VLME 2VOTA 3FCTA 2AXHA 2OR9L 1HNGA 2PO6C 3T2QA 3GK8H 3SO5A 3P40A 1BD2E 4JFDA 2AK4E 1S7UA 4LLAA 3V6OA 3MGOB 1QRKA 2WINA 4LLYB 2V2XB 2BNUA 3O11A 1QBLL 1QFWM 1VFUA 3HZKB 5D7JC 5EFIA 5HXMA 2AV1A 3GB7A 3QDJE 4FQXA 2X89D 3VXUD 4DGYH 4LLQA 3MV8E 5CUSH 5IFAL 4XNUH 3CU7A 5FO8B 2WWKT 4M62H 1FAIL 4HWBA 5I18H 5F1IA 3SDAC 2H1PH 1EX0A 3LV3A 1IQDB 1MOEA 3LQZB 4OIIL 2ICCA 1T66C 3QHZH 3WIHH 5KS9E 4R96A 1FNSH 4TNWF 4APQA 3QFDB 3QUYB 3QDMD 4JRXA 2RBLA 4OFVA 4XCYB 3OG4B 5EC2B 4YFLF 5DRWB 5L0QB 3NZ8B 1VDGA 4BKLA 2FECL 3KPOA 2AXJA 2C4FU 5D5ME 2PR4L 2XQYG 1OAUH 4IRJA 4J3OC 2FR4A 4YHOL 4PY8I 2R1WB 5D7LA 4RMRA 1TZIB 1HHGA 4P9ML 4LBEB 4Y1AE 3TIEB 3T1WA 2ZPKL 5DJZA 4QNPE 4X4ZA 3PQYD 4AEIL 2XKNB 4RMVA 1JWMB 4Q7DA 1TQBB 4HGWA 5F88A 1A7NH 1UCBL 1NH6A 4PUBL 2NXYC 4HF5L 4GKNB 5HYQB 3B9DA 2F8XC 5JXAL 3WNMA 3MOAH 4X7SL 2DLTA 3IDYB 3RY6C 2XWTB 5TGBB 4HHAA 4UI2A 2IWGA 1OSZA 3PHSA 3TNMB 1J0HA 4RAUA 5DJYA 1S3KH 1UKQA 4R2GC 4PJ8B 5FA3B 2BERA 3U36A 2XN9E 3BPNB 5D96C 2FBJL 1KTDA 4AEHL 4LFHD 4TUOB 4Q9RL 2VLRD 4ZS7H 1OGAD 5D6DA 3QZWA 5E2UL 4AG4L 3C2SA 3WLBA 3A6BL 4X6BB 3BD5A 1INQB 3C5SA 3ZE0F 4JY4B 3BUYB 3NAAH 1QSEE 3KPNB 4X80L 4G8GB 1INEH 1DLFL 2HJFA 1NAML 3FMGL 5TQ0L 2SEBB 4JFDE 5B38A 3V6OE 2PO6A 3HI1A 5KW9L 3WXWH 3MUGA 4PS4L 4PJ5B 5HDOA 5D7JA 4G8FB 5C0RH 3TO2B 3RAJH 3KPRA 5T5NG 1WCBA 3EFFA 4P57B 1U8LA 5DEGA 3VMPA 4RGNE 3QUMH 3QNYB 1PX3A 3I2CH 3O8XB 3SDAA 2E27H 2YPKA 1N7ML 1QRND 5DHYA 2BY1A 3CH1B 2ARWA 4FXLA 1P4IL 4JRXE 4QO1A 4TOYH 2EEAA 4G80B 3ALPA 3BX7C 3LD8C 4OI9A 3C5ZB 3MJGX 4HWUA 5IMLB 4OAWB 3GSNB 2HT2D 3IJSB 2VXVL 3PDOA 5KVMC 3D85D 1Q9LB 1OF2A 3CCHA 1FVCA 4YHNB 2CLRB 2F58L 3TVMD 4ZSOB 4LP4A 2IADB 1QBLH 5CCKL 1CGVA 2Q20A 3HNTL 4LPTA 5DJ6A 3T09A 3FHQA 2PYEE 1BZ9A 3LKSA 1T20B 3UTSD 5A40E 4FQ2H 3GI8L 4S1QL 1CYGA 3F12B 1K5NA 5GSRA 1B0GA 4G8EA 1ETZA 4HSQA 4NC1E 2I25N 1XF2A 2HT3D 12E8L 1FAIH 3U83A 4F7CB 4CW1A 4OGYL 4OIIH 5IHLB 3BIKB 1WZKA 3RY6A 4N9GB 1X5LA 4K3GA 1ZE3C 3IT8D 4ONGL 5A3ID 1F42A 4WTWA 3MRJB 2X1QA 4KKBC 3T8XB 1IAKA 1UM6H 4JO4L 1BQLL 1B4RA 2PR4H 3PHQB 3PWLA 2BVQA 1IGIL 4YHOH 1ODAA 2MMXA 2JB5L 3MV01 3WKML 4M9OA 2ZUWA 3SJVB 5TQ2H 2ZPKH 4YK4C 1YJDL 3HA0A 3EDEA 2X1WL 4LCCB 3ZHDA 1TJIH 4OQTL 1MCOL 3L5IA 1UCBH 4LPWA 3QUMA 4PUBH 2EDYA 2NY6D 4ELKB 1X6LA 4HF5H 2EDRA 2R0WH 3BPCA 3DUSA 3ILQD 4P5MA 3IJHB 5JXAH 4EUPH 5CEZH 4NPYA 2HRPL 3GI9L 3UTTB 3T3ME 2BMKA 2YA0A 2AGJL 1DQJA 1F58L 5CJQL 2FO4A 1MWAL 5DJAB 5CIPB 1JGUL 4H0GA 3MACH 4YGVB 3HPLA 5A2IH 4OZHF 2AJXL 2FBJH 1PDKA 4Q9RH 5ANMA 4GS7C 1CWVA 3LAFA 2H2SD 3DI3B 4GW5A 4LNRA 5E2UH 4AG4H 1G7QB 4MSWA 1A64A 3A6BH 3O6KH 1E4XH 2W65B 3N9GL 1I9EA 3V5KB 2HVKA 1I3RB 4NSKB 3NABL 4ODTL 1J05B 2Z31A 4JB9L 5E5RB 1MIML 5EA0L 3N1QC 5ESVB 4LRNL 4N8VG 3FMGH 5TQ0H 1MCLA 2MQCA 5IQ9B 2VDNL 4C54A 4F37K 4OLXL 5KW9H 3DARA 1I1RA 4PS4H 4U1NA 3FRUA 3P9LB 5EC1A 4U0RB 3QUZB 1OD9A 3D0LA 3PGDA 5DVLA 2N7BA 1IKNA 5IMMB 4KRPD 3WDHA 3RGVA 3U46B 3EYOB 4LVHB 5IB2A 2PTUA 4KTEL 1T21A 2VLKA 3RVXD 3U7WL 4HV8A 4WTXA 4J3XA 1N7MH 2DLEA 1P4IH 3IF1B 2NLJB 4RFEA 3WBDA 2BOCA 1FZKB 2V17L 3BDBA 4I0CC 4HUVA 1FVDB 3RIAK 5GRUL 2VXVH 2MPAL 3D87B 4PV8B 4EUPA 4U7SA 1RU9H 1G9ML 1SJHB 1ACZA 1HEZA 5IBUB 4QHUB 3SOBL 4JKPL 1TCRA 4P2OA 4DGVH 4YAQA 1M7DA 3GGWB 1WBYA 4BSVB 3V5HB 1U9KA 4C56A 3GI8H 4S1QH 3LRSA 4U05A 4U2ZA 2WBWB 4CDGC 3BP6A 1T22A 3IFNH 2QV2A 3VGHA 4D2NA 5BJTA 1YJDC 4WWKD 2FJFA 5C07E 3WEXA 4P4KC 2ITDA 2HYMA 4HUXB 4MHHI 5D2LA 4DCQA 4Y0GA 3JVGC 1X5GA 1UACL 3QR2A 1Q9OB 4PRDA 4LPUA 4R4BB 2P7TA 5B4MC 1NFIA 4JO4H 5EORL 2EIZB 1B6UA 1IGIH 2C7UB 4PJXA 3LIZL 5SWZA 1AR1D 4LLDB 4PJIF 3VFNB 2JB5H 4N0YL 2WMPA 2XA3A 4XPBL 1RULH 3CDYA 4Z7WF 1KN2L 3B43A 3BD3A 1YJDH 5DK2B 1MQKH 3CPLB 3EGSB 4ZS6D 4OQTH 1UT9A 1MCOH 4PJCF 2M2DA 3MNZA 2WUBL 5B39G 4L4VD 5HYSA 5E08H 4PV9A 5ENWB 2VXQL 1G7JA 4OZ4B 3MRLB 2DICA 4NQEB 3TLRA 3D25A 2HRPH 2DQJL 3GI9H 4LSVH 1S9WA 4J6RL 3VH8G 4ZFZA 2AGJH 1WQVT 5IHBA 1UGNA 1Y0LA 2HLFD 5BMFH 3L1OL 4RWYH 5CHNA 4X6CB 2AJXH 3OAYK 3KXFD 1KYOJ 4HS6A 3QB7C 4NQDA 2ED9A 3ZKMD 2IPUK 2AEQL 2VLKE 4JM4L 5ESQA 4ZO7A 4NC0B 3O2WL 4LL9A 4QYOA 3WNOA 2DAVA 3NABH 2AERT 4JDTL 4PGJA 5HHPA 3DUUB 3WCYA 2PXYC 1MIMH 2GK0A 3MBXL 5EA0H 3S5LA 1C5CL 4LRNH 1NCUA 4XBEL 3RA7H 3MR9A 3KYOA 3MRMA 4I48B 1U8HA 2IC2A 1BQUA 2VDNH 4L8SB 3NN8A 3RL2B 4OLXH 1XCQB 3L5WA 5IB1A 1A3LL 5L8LB 1MVUA 1MJJA 5J8OA 5I8OL 5IB4B 4NN7C 4FMFA 4CNIA 4C56E 5GGTL 5C0BD 3I02A 4JHAL 4KHTL 4QCIA 4UV7L 4KK8D 5D1XB 3GBLA 2XG5A 1G9MC 4EIZC 1U8JA 2DQCH 4MWFB 2XG4A 4NDMA 4YIQA 3QI9C 5D1QC 4O00A 3MX0A 1OM3L 4P2RB 3U7WH 3VI4E 3H0TB 3U0TA 5B39B 2NY5H 2YA2A 4OQTA 4P4KA 2OL3L 4RX4A 3IDJA 3N85L 3P11L 5TF1L 3JVGA 5FK9B 1QQDA 1LEGA 3JUZA 5GRUH 3ZDXE 2MPAH 3QFJB 4OD1H 1T83C 3VH8B 4TPRH 1T5XB 4NUJA 4PJEB 1S7XB 5FCUL 2QSVA 5SWZE 5LVEA 4OIBA 5D4QA 5KSAC 3QEUB 4P5TD 1G9MH 4AH2B 1MWAA 4HPYH 2HVJB 2R56L 3SOBH 1BQSA 1F3JA 1JZ3A 3RWDB 3L3IA 2GSIB 5DLML 1JV5B 5L6YL 4P2QA 2VUOA 4JZNB 4FTVD 5DZLA 3T4YA 3OKDB 4WUKH 3O0RL 4PB9L 4X99A 4CGTA 3C2AL 1DEDA 4WUUA 2IH3A 2KKQA 4HEPG 4L4TB 5ADOH 4FABL 4KDVA 1CIDA 4RRPA 1VA9A 3DMMB 1CD1A 1YNKL 2HKFL 1LK2A 3IVKB 5EU3A 4ONHB 3U4EB 4O4YL 5BRZD 1JCKA 2BVEA 3MBED 1O7SA 3QNZA 2XKUA 1CVSC 1NBVH 5BO1L 2NW3B 1G7LB 3WJLA 3KWWA 3LIZH 1FZMB 1CU4L 3WN5C 1CGXA 1D3CA 1MLBA 4XPBH 3W0WB 4DN4H 5T1DL 3F65A 4G9FA 1RIHH 2DBLL 4MA3B 2NTFB 3NFSL 1AIFA 1I7RA 1FLRL 3DVNB 2PXYA 5CSBA 2EICA 4HG4K 2WM0A 4JY5L 2DBJA 2O5XL 3GUTA 1MHEB 3GJFH 1A1MA 1LK3L 1QHPA 1KCLA 5GZND 1A3RL 2I9LA 3WFBL 4X6EB 2OP4L 4Z0BL 1FZJB 2J8UE 3PWJA 1ZLVH 2J7LA 3P4MA 1UWEL 4G6KL 5F9AC 5I71B 5MENA 1U8IB 1V3KA 1CCZA 3P0GB 3QQ3A 1U8PB 1YDPA 2VERN 1A1NB 2DQDL 2ATPA 4NRYB 1A7OH 3FB5B 4JM4H 3K3QA 3QI9A 4XMPL 3NACL 3O2WH 5ERWB 1CLYH 1H8OA 4FQLL 5I15L 3DGGB 4QOKB 1E4XI 4KQ4L 4JDTH 1R3JB 1R3LA 6FABL 2DIBA 4L29A 3MBXH 1C5CH 4XBEH 4A6YL 4XCEB 5A2KH 3KNBA 4L3ED 5HYFA 3RVUD 1T83A 1UVQB 4A2MA 1HHIB 1H3GA 4XXDA 1BVKB 1VFBA 4HLZG 3P4NB 5M94B 5I8OH 1IBGL 2W9DL 5E8OA 1TVHA 4KUCD 1FIGH 3HC0A 2LV4A 3FT3B 4JHAH 4KHTH 4OF3A 1HHHB 4ODSH 1I4FB 3W9EB 5FO7B 4GUPA 1P9MC 1YC7A 4PJAB 1MI5A 4JFEE 5CGMA 1BX2A 4ODXA 5HPMB 1GVIA 1KTLB 1X5ZA 5IVZB 3E3QC 1DLHA 4EDXA 3V6FA 3NA9H 2OL3H 5T3ZE 3N85H 3P11H 3WNKA 5GGVL 2X89A 3VXUA 3GJFA 5B3NA 3VXSB 5KANG 4Z0XA 5D7SL 1FC2D 2ZSVA 3ARDD 5KVGL 5C2UB 1MRDH 4MGXA 5IT2L 1T1ZB 2P5ED 3WN5A 4YJZL 4JPWL 4G9FE 1X5AA 2EIBA 3OZ9L 4L8BB 1HHJA 1P5VA 5DLMH 3X17A 3QDMA 3DX6A 3MV7E 1ZLSL 5DJ0B 2Q76A 2HT2C 3O0RH 4PB9H 4J8RB 3JV6B 5B21A 4LSRL 4FABH 4TSAH 2Z9TA 3TVMC 3AMKA 2EKJA 1YUHA 5J6GB 1QUNA 2D3VA 3N1GC 4EZMA 4JREC 3VG0L 1M4KA 3ISWA 2ICEA 2F9BT 1LDPH 2JCCE 3WHXB 2E7LC 5HHNA 3PQYA 3CAFA 4MA1C 5LWYL 1CL7I 3UPRB 5EBLB 2I9TA 1YQVH 1G0XA 4EEEA 2HT3C 1CU4H 3CC5B 1R5VA 1A9EA 3HS0A 3BFOA 5TDNA 2VR4A 2VE6A 3NFSH 1M6OB 2R0ZH 3MSPA 4N0FA 5DRXB 5A3IC 2HFFB 5J6HB 4L1DA 4UAOC 5K59F 5E6IB 3BMWA 2KZ1B 3DX8B 4L5FL 5DJ2B 5IF0B 2B8OT 1FORL 5E2VL 2IAND 4PJGF 1LK3H 2OL3A 2OP4H 2FHCA 3WFCH 3S96B 3IFOB 3O9WC 1PW3A 4OCXL 3ARBB 1INDH 4IM8A 5IKCA 5INCA 1UWEH 1SM3L 5E8PA 2APXA 3EOAB 4Z7QF 2NY6C 5JORA 1EJ6A 4JFZL 3ILQC 1TZHA 4GW4A 2GTZB 4UBDD 4PRPA 4UV4H 3VMOA 4Y5VC 4XMPH 3OHXB 4FQLH 3BZ4B 4F2MA 4KQ4H 3P0VL 5I17A 5IIEB 1ZVSA 3VDBA 2VWEC 1U8KA 1NFDF 1RUQH 3BZEB 2MCG1 1P84J 4E41D 4OCMC 1ZANH 4Y89A 3U9UB 1I3GH 3T0BA 4BQCA 4PY7B 3RY4A 3C6LA 4K55A 4WI8A 4ZUWB 4YHZL 1CE6B 2H2SC 3OB0H 2VN7A 4OZHA 2D7PA 1RZKH 3QUKB 2V5RA 2W9DH 5F6HJ 4XMKL 3QDME 3FCTB 2I26N 1TDQA 4Y5XC 3PIQB 2VLJD 2PW2B 1S7UB 2X09A 4GLRH 2FX7H 3VG9C 2WINB 1Q9KB 2BNUB 3O11B 4AT6B 3D85A 5EFIB 3HNSH 2HJKA 3TVMA 4TN9A 3GB7B 4YFLI 3QUXB 4FQXB 4OM1L 3QZWG 4LLQB 3CSPA 2BRRL 5IG7A 4MD4A 4OSUL 2J4WL 2QSTA 3PQYE 5GGVH 2VJXA 3UTSA 3K74B 2E7LA 1DFBL 4XB7A 2W91A 3ROOA 4KRPC 5D7SH 5F1IB 4LKCA 3VA2C 1LE9A 2RB8A 3LV3B 3MRHA 4PRID 2FD6L 5JDSA 2D31B 5B38G 5IT2H 4U1LA 1AGCA 1UB5B 3H3PL 1A6UL 4R96B 4JGMA 1S5IH 4MHHG 3RVXC 3NOIA 1KCRL 2EDWA 4J1UA 3OZ9H 4WHTA 4DVRL 5MP6L 3HR5A 4K3DL 5IJVA 4BKLB 1ZLSH 1L9NA 2DQTL 2AS5M 5T5FH 2ZG3A 1Y6MR 4IRJB 2FR4B 1W0VA 2PW1A 5D7LB 5DFWH 2VLRE 1HHGB 1IM3A 1OGAE 2C5DC 2ED7A 4F7EA 5JOPD 3GM0A 5DJZB 4JG0L 1NFKA 4ZUVB 1DSFH 3KPSD 4OD3H 5J56B 2R4SL 3O9WA 3O6ML 4A6YA 4G3YL 1L7IL 3UP1A 5F88B 4UIMB 4M3JA 5LWYH 2FGWH 3VGAC 2LAGB 5L2JB 3AY4C 5FO9A 1SMOA 2P43B 1DE4A 1VERA 5HI4C 3VXNA 4HHAB 4WWKC 2Y23A 3PWVA 2CKBL 3E3QE 1OSZB 4Y5VA 2N7AA 1RIVL 4QXGL 4RAUB 5DJYB 5J12C 4RCAA 4Z7VE 3U36B 5MI0C 1RI8A 5FYLD 4L5FH 1KTDB 3TNNA 4NBXB 1FORH 5DQJA 4CU8A 4QEGA 3BIBX 5E2VH 1N26A 2A6DA 1IZJA 2W0FB 4Z7UA 3WLBB 1AR1C 3C5SB 2WAHA 4LSUL 6CGTA 1QRNE 1YEHL 3ET9F 1CQKA 2XZAH 4KROB 4PJIA 4WCYL 4TVPD 4NZRH 4O2EB 5ICXA 4ZS6C 4ZFOL 1FL3A 2HJFB 5DMIH 3DVGB 1SM3H 3MLSH 5GHWL 5F7FA 3G08A 4Y5XA 3HI1B 1CG9A 4JFZH 2DL9A 3MUGB 2OBGA 1G9EA 3NIGF 4DOHB 5D7JB 2O26U 3BISA 3HAEH 3P0VH 3KPRB 1WCBB 4Q6YA 3UTSE 2HLFC 3EFFB 4J3WA 1U8LB 5DEGB 2EXWC 2DLFL 3IDGA 3DURA 2ATKA 2F54A 5D72H 1PZ5A 3WUWB 1QNZL 5DQDL 3GKWH 4IS6A 3SDAB 3ZKMC 2X9YA 2JB6A 4YHZH 2YPKB 5DHYB 5GRVL 2X2YA 4F7MA 4DKFH 4XMKH 3V6BR 3D0VA 4H25A 4CAGA 5KVDL 5ETUA 5F1SA 3CCHB 5CP3H 4FA8A 2DI9A 5MERA 1FVCB 4QGTA 2QADD 4GAYA 1S9XA 5CMAA 1VKXA 5DJ6B 3N1MC 4JHBA 4OLUH 3OJMB 4Z5RA 1BZ9B 2B39A 4XH2A 5L2KB 1ED3A 4OM1H 3LKSB 5JNYA 1M05A 2BRRH 3MFFA 3QEHA 1K5NB 5GSRB 1XR9A 1ETZB 2YD5A 4WO4C 1XF2B 1DFBH 1R3KA 4KK8C 3HTLX 5F9WC 2VISA 3AY4A 2DLGA 4CW1B 2F5BL 5AYUL 3L7FA 5EU4A 2J6EH 2FD6H 3MV9D 2OJZL 3H3PH 5EUOB 4WWKA 3TN0D 2Q7NA 4DVRH 5HHMD 1CDHA 2VAAA 5MP6H 1JN6A 4K3DH 5D1ZD 3NH7L 4JKLA 2VWEE 5DI8A 1U8NA 4JRYD 1CTNA 2DQTH 3AM8A 4NRXA 4M43L 5IVXF 3PWLB 1JP5A 2JF1A 4FQCL 4P4RB 1QFWL 4Z7UE 4OF8A 3HAEA 4MXVF 4P5TC 4JG0H 4PLKC 5F7EH 1EGJL 1KCVL 1T1YB 2DWDA 2R4SH 2DJ4A 1L7IH 3UCRA 4RISL 1UZ6E 2EDXA 5EU5A 3QUMB 4XC3L 3DUSB 3BPCB 4P5MB 5JLZB 1CFNB 4YHPA 1LEKA 3MJ7B 3DRTA 5F7WC 2ZCHL 3DX7A 4EUPG 2CKBH 2QHRL 1DQJB 4FFYL 2FO4B 4QXGH 3JWOH 1JNJA 2DQFA 2CDEA 2D0HA 3UPCA 4HS3A 5TF0A 5CP3A 1VENA 3L3KA 1PD6A 5I1DA 3LKOB 4Y5YC 4EQ2A 1QLEL 3RWIA 3MBEC 1F4YL 1OOAA 1IM9B 3DUHA 5ANMB 4OJFL 1JZ6A 4LNRB 3KXFA 5C0FA 1X5KA 3S88L 2R69H 4LSUH 2HVKB 1OT1A 5HPOA 1BLNA 4I0PC 2Z31B 4WCYH 4DEPC 5H94A 3WFDL 4UZGA 4BQBA 4PIRF 4XRCB 1D7FA 1EUUA 5GHWH 1DBAL 4K3JL 2J6EA 1UJTA 4FNLH 3OAUL 1SVZA 1ORQA 5E4EB 1ORSA 4BH8A 1XF5B 4ZOEA 5GZNC 4PLOB 5JIKA 3BH9B 5HY9B 1PKOA 3AXLA 3D0LB 4OLZL 2VMFA 4KKLD 4OCWH 4EOWL 3RGVB 5T1KD 2DLFH 2NX5D 3BZDA 5C0BA 4WO4A 5I1HL 5IB2B 1QNZH 4HKZB 1T21B 4A2LA 2QQNL 1UA6L 3GSOA 4HV8B 5HYSG 2ZJSL 1R5WA 1IEBA 1QD0A 1I7TB 4RFEB 2BOCB 2DJUA 4HUVB 4R7DA 3WDIA 5KVFH 1IFHH 1ZS8A 4OZGB 4DWHA 5KVDH 1E4JA 1X5JA 4EUPB 2QQQA 3JV4B 3RIFF 4PG2C 1DUYB 3O45A 2CKBA 3RVUC 5HDBE 3HMWL 3FRPA 1J7VR 2MJWA 3EO9L 3BMVA 1C5BL 3V79C 4L1HA 4POYA 2NXZD 1HEZB 3SE8L 4QTIL 4P2OB 1TCRB 4YAQB 2L7UA 4NKDA 5KN5A 3WIFB 3BYTA 3U0WL 1T22B 4IRSA 4IRZL 1N2RA 1KBGL 4L4VE 4FTVA 3ZMRA 3S5LG 5A2JH 2P45B 2F5BH 4S2SA 5EOQL 2FJFB 1RZ7L 4PRBA 5J06A 2ITDB 5D2LB 4PYHA 3FOLA 1OARL 2CKNA 1KCSL 2YD9A 3NCMA 3E1F1 4DCQB 2JJVA 2ZUQC 4B50A 4HULB 5C71A 1NUDA 3MROA 1RUKH 4PRDB 4POUB 2P7TB 4W4NA 2DYPB 1NFIB 4Y5YA 5BRZA 5EO0A 4LDLB 1JGDA 4PJXB 2ZZUT 3KXFE 1QFWH 3ARDC 4UOW1 4R8WH 5I73C 4KHXL 5FUOL 1AFVH 1EGJH 1KCVH 4GG8A 4OV5A 3HUJA 4H0HB 3VFSA 4GMTH 4I0PA 5DO2D 3PJSA 2DM2A 4RISH 3O2DL 4KFZC 5EDXA 1K2DA 1H9VA 2EE2A 5I0DA 4XC3H 3BHBA 4PV9B 1I8IB 3VD4A 1YMHA 2MKWA 1K4DA 5J9PA 2OTUA 3LKRA 2YWZA 1S9WB 2ZCHH 1KPRA 4ZFZB 4M1GL 2MNUA 4MS8D 3VWKB 1ES0A 1Y0LB 4NN6C 1JWSA 2B5IB 3TT1H 4DW2L 1VFMA 1QLEH 2CLVA 3KAAA 5JPNA 5C0BE 4HS6B 5IK3A 4NQDB 1H3PL 3RTQA 4MD0A 4J4PD 5C70A 1JHKL 5ESQB 3TA3D 1CBVH 1BBDL 1QFOA 4QYOB 4XPGL 5E1AA 3S88H 1AGDB 2C3WA 5HHPB 4J3UA 3RWGB 2GK0B 1MFAH 4R0LC 4LSQH 3HB3D 4MQ7A 3MR9B 1DBAH 1SEQL 3THML 5EOCL 4JKMA 5E2TH 3RP1A 5C3TA 5ID1A 4PG2A 4XP1L 1JK8A 4L3EA 1ZOXA 3L5WB 5IB1B 1EPFA 1IGFH 1MVUB 1MJJB 1S9VA 4ZFFA 3VFTA 4MJ5A 2HFTA 4CNIB 1IC4H 4OLZH 3I02B 2YRPA 4O5LH 4XC1L 1AO7D 2ZWLT 4H5SA 4NP4L 4FTVE 1VGEH 4NQVA 1U8JB 4NDMB 2Y36H 4YIQB 2APWA 2QQNH 2G5RA 3U0TB 3BEWA 1EGJA 4UBDC 3BXNA 5FYLL 3HR6A 3B5HA 1T1WA 3MCKB 3IDJB 4JQXC 4U1MA 4KUZL 4YLQT 3EYVA 1QQDB 4CN4A 5IQ7L 1LEGB 2EDKA 3M8OH 4WW2F 5BRZE 3OV6A 3Q2CA 1AGBA 1IILE 3W5MA 1P7QB 4KWUA 1C5BH 1NFDA 1FFQA 2FZ3B 5B3JE 1SEBA 1F3JB 3HUJE 3L3IB 1JVKA 3FB7A 3KHQA 4P2QB 3S4SB 4MNGE 3QDGD 2OSLA 3U0WH 1QR4A 2UZIH 3T4YB 4BK5A 4X99B 5F7UA 3LEYL 4WUUB 3CIQA 1NGZA 1WGOA 2P5WD 1HI6A 5EOQH 1RZ7H 3SHSA 2YPLD 1CD1B 1DBJL 1OARH 1LK2B 1KCSH 5EU3B 5CFHA 3HI6L 1NC2D 3SKMA 4NRZA 1S9YA 3K4AA 3QNZB 4WY7L 1A0QH 5EZJA 3MRNA 5C08D 3FZUD 1YPZA 3KWWB 4LGRB 5EU6D 1MLBB 1LDSA 3DRQB 3SDYH 2BNRD 2QJDA 3DBXA 1CXEA 4G9FB 4KVCH 3QCUH 2AW2A 1AIFB 1I7RB 3JV5A 4FOMA 1RY7B 4XVTL 1MF2L 3O2DH 4AIOA 3IXAA 4R0LA 2NY0D 2AK1L 3GUTB 4KY1L 4U2YA 4JKKA 4LQFL 1WZ1L 4OGZA 4L3EE 1TJGL 1IC5L 2I9LB 5L9DH 2IANA 4ZPTA 1ZHBB 4M1GH 3S3SA 2CGRL 2NY2B 3BPOC 3PWJB 1LE5A 5I1CL 1OAQL 3P4MB 4YO0A 3LN5A 5MENB 2APBA 4X6DE 3DSFL 4F7TA 3LKQA 4PRHA 2FIKA 4JDVA 3V6ZB 5BZDB 4KKCD 4GAFB 4LHUA 4MCYA 1JHKH 3QDAA 2WWMD 4X5XA 3PXJA 3QI9B 1WFUA 3UYOD 4HK3N 1BBDH 1FPTL 3CU1A 3I6KA 4KK9C 4JZOA 1R3LB 2PETA 4NKOA 3EDFA 4L29B 3TFKD 3TV3L 4RWHA 4Z7NF 4YUEH 1DN0A 1HCVA 4R4FH 3KNBB 1HILA 2VDLL 3THMH 5EOCH 3U7AA 3ZE2F 1MFEL 1KB9J 5C6TL 1KJ3L 4XXCC 1BJ8A 2AJVL 1QYGL 4ZO9A 4LIQL 3MLZL 5C09A 4XP5H 5E8OB 1OCWL 2P5EE 1TVHB 4KI1A 4CJ1A 4LCWD 3HC0B 4PG9A 4P46D 4GUPB 5TE4L 4Q6IC 2MOVA 2GJ6D 3TM6A 2F53E 5GJSL 3WS3A 1MI5B 1BX2B 2FB4L 3UBXA 4ZOAA 3V6FB 4M1DL 5FYLH 2E5EA 2HAZA 1BGXH 4FXKA 3O2DA 4B41A 4LFHG 5IM7A 4AL8L 1TFHA 3VXUB 4YBHA 1ND0A 5IQ7H 4Z0XB 2H41A 2V5YA 2FBOJ 1YPZE 1QFUH 2IQAB 4NO0D 2ZSVB 4Y4HA 5ACZA 1MLCA 1D5XA 1OLZA 1WZLA 3OAZK 5C0AA 3OMZA 1G0YR 3U1SL 1F4WL 2IPTH 1CGUA 4YXLH 3OKEB 1HHJB 2XTJD 2VXSL 1JHTA 3DX6B 3SDCD 1NSNL 4U31A 5ICZA 1NGQH 2Q76B 1J0JA 4JFYA 5GS2D 3LEYH 2QADC 1EA9C 2D0GA 3QXAB 1YUHB 4WU5A 2IANE 2N4IA 1DBJH 5K9QG 1AGFA 1KJVA 3EAKA 2Q7YA 2DWEA 3MLRL 3HI6H 2ICEB 3K8KA 4H1LH 1BECA 3VXOA 1C8PA 5HHNB 5I1IH 3KPSA 1JPFA 2I9TB 1FBIH 4KQ3H 2NY7H 3TH2T 4KDWA 2VLLA 4K9EH 4W6YB 3HS0B 1A6WL 5DTFA 4Z95L 2VE6B 3TN0C 4NKIL 4N0FB 1J86A 1RZGB 4V1DB 4LGSB 4XVTH 1MF2H 5D1ZC 2AK1H 1KLUA 3Q1SL 2DTSA 4TUKL 3NGBC 1WZ1H 4E41E 1TJGH 2OL3B 2ZCLH 4YDKH 2CGRH 4XXCA 5I1CH 4NZTL 5IGXL 4WENB 3I85A 2DM7A 4XB8A 5E8PB 1BFVH 3OR7A 2AI0L 3DSFH 1T2QL 3EO1A 4Q6IA 1ERNA 2VLJE 1TZHB 4GW4B 3M17B 4LSTL 4PRPB 3OAYH 4OV6F 3FTGA 1TVBA 4TTDD 3BEVA 4HWZB 4F2MB 4UU9A 2C9AA 2H6PA 1QBBA 1ZVSB 5IJKA 1HOCA 1U92B 1EUTA 4NBYB 5FECA 3TV3H 3WL9A 1NGXA 1ZVYA 3B8SA 4X98A 1DDHA 1KPUA 3FB6B 1EEZB 5E99L 3ME0A 1V7MH 2VDLH 5AEAA 2Z8RA 3H6JA 5H37G 1MFEH 2LVEA 5C6TH 1KJ3H 3C6LB 4NOBA 5C0CB 1IRAY 4LDOB 3UYPA 4OZHB 2V5MA 2AJVH 4H1LA 4F8TA 4PRIE 4LIQH 3MLZH 2NMSA 4OFKA 4M5ZL 1JUFA 1L4IA 4PJ9B 3ZDYF 5HGAA 5IW1A 3MXWL 1XGYL 2H9GB 5ELIA 3G5YA 1BOGB 1L0XA 5GJSH 1B4JL 1PY9A 3L3GA 1M71B 3SGEI 1FE8L 1U3HD 5JQHC 1BWWA 1WWCA 4X7FC 5EO1A 3QO0A 3TVMB 1J1PL 4Y19D 1MJ7L 2HWZL 4QHLA 2FEEL 3EYFA 3PWUA 4Z8FH 4JREB 4GXVL 3ZYIA 4I2XE 2BHUA 3GJEA 4WU7A 3KPSE 4OGXH 4KKLC 3T0WA 1H8NA 1Z9SA 3NCJL 5DXWA 3ROOB 1DANU 4MA1B 4QRRD 5JHDD 1LE9B 1G7MA 3B2UD 4FZ8L 5JDSB 1EAPA 3IYLW 1AGCB 4NWTL 4XWOD 3MLPA 1F4WH 3MJ9L 2CO7B 4D94A 4XVUC 3VI3E 4P9HL 4MB4A 1U2HA 4WHTB 5IB3A 3NPSC 5IJVB 3TN0A 3QH3A 1NSNH 4R97B 4UAOB 5D1ZA 1R24A 1XCTB 1W0VB 5CEXA 4JRYA 5FYLE 5LGJA 2PW1B 4OZFH 5MEOB 1YEKH 4MAYB 4F7EB 1BIIB 2ARJQ 3TCXA 3N1FC 2NXZC 4S1RH 4WNQA 2NY1D 3O9WB 3Q5OA 3AS1A 1X6NA 5GS0H 1CF8L 1OGTA 4TVPE 3QP3A 4U7KA 2Q8AH 5BZWA 3TT3H 3W2DL 3VDAA 3QRFM 5FO9B 1DE4B 1I1AB 3VXNB 1XGUA 2IBZY 5BW7C 1G0DA 5C0IA 5EG6C 3QJHA 3IAQA 4Y5VB 1D6VL 4XVSH 1A6WH 4YZFE 1EEYB 4Z95H 2Q3AA 3LS4L 3SGKA 4NKIH 2FATL 1OAKL 4LVEA 3TBVB 1GIGL 3OXSA 1EEQA 2ID5A 1N6VA 3BRDA 4O02H 3TNNB 1QACA 5DQJB 5T5NF 2A6DB 3Q1SH 4TUKH 4HIJA 3BI9X 1QLFA 4XT1C 3HG1D 3L3JA 3HCVB 1MELA 2VZ1A 4JEGB 1J8HB 3H9SA 4NZTH 4PJIB 4NO2B 1U8QA 1MFDH 5ICXB 2EXYC 1FL3B 3G04B 5HJ3A 5DO2C 3G08B 2MHAA 2AI0H 4Y5XB 4YC2B 5EZIH 1F6AB 1MRFL 1T2QH 4NCDA 5CZKA 1I7UA 4PJCB 3CX5J 1EHNA 4M7KH 1KCUL 4P3WA 5HGGS 1G1YA 4WI9A 1PKQE 2EYSA 3VGBA 5JR1L 1A7BA 4QY8A 4MS8C 3HAEG 3JBG7 4KJPD 1B2WL 1YEDA 3IDGB 3DURB 2ATKB 2F54B 4PGZA 1PZ5B 4CBPA 4JRWA 4KRPB 3ZSSA 5T1KA 4NWUL 2NX5A 3BE1L 4J4PC 4GXUM 1J10A 4I9WD 2J5LC 3MV9E 4YXKH 5KZCD 2GI7A 4M5ZH 1Q94A 2PUQT 3SQBA 2EYRA 5FOBB 3D0VB 3EDJA 5DVKA 1XGYH 1F6FB 5HHME 1TITA 1UWGH 1X44A 3OKKB 5GGQH 4M7JH 3HB3C 3RHWK 5MERB 1B4JH 1A47A 4JRYE 3P4LA 5DFVD 1WK0A 2QTEA 1FE8H 4P9HC