5CZVH

Crystal structure of notch3 nrr in complex with 20350 fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
206
Chain Sequence
b'QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGWIKPRWGAAHYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGSFWFGYWGQGTLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurogenic locus notch homolog protein 3
molecule tags Immune system
source organism Homo sapiens
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
total genus 41
structure length 206
sequence length 216
ec nomenclature
pdb deposition date 2015-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czvH01
2X40A 4HWUA 4NKIL 4FABL 4P48A 4J3TA 5D96B 4NRXA 2DKUA 4Q97A 1GOHA 2YUVA 2VN7A 4P5MA 4NP4H 4TVPH 2KQNA 1UM6H 3V0AC 4HLZH 1AY1L 3O8XA 4XPHH 3PQYE 4GBXA 3PL6B 4J8RB 5KOMC 2CKBH 4K7PY 4G43B 1NGYA 2H8PB 2OR7A 4P59H 1JHKL 1I4FA 1JWSB 2WWMC 5FUOH 1BQHB 5F9WC 1D6VL 3MJ7B 2QADC 2PYFA 3LRGA 1U6AH 4G7VL 3ZTJG 1H3PH 4UIKL 3LB6D 4LFHD 4K7PH 3HNTH 2VZVA 4L3EB 5F7MC 4YBLC 4XAWH 4FQHA 3UJJL 2OR9H 1NGWA 2O5YL 3D1MC 5DMKA 2BZDA 3ARUA 2KKQA 5EO9A 3SDCD 2PR4L 1CF8H 5DFTA 1NKOA 5FM4A 4LLYB 4XGZA 4JO3H 3T0EE 1IQDB 2ZZUT 2FJGA 4XRCB 1OAUH 3U7WL 2Q86A 1N7MH 3DUSB 3I50H 3WIHL 4OD2A 5CKGA 1J11A 1Y6MR 2VQ1A 4QOKD 1X4XA 4NM4L 2VJXA 1UVQB 2BSSA 4DTGL 4YXLL 1GXEA 2ADIA 2JKXA 5DD3L 1GC1H 3SQBA 1CTOA 2NZIA 2AJZB 5B8CB 1PFCA 4HBCH 5C07D 1OTUD 5DMIH 4X6FA 1MHEA 5FM8A 3UDWC 2IPKA 1KFAH 2ZNXA 5BQ7A 1RZKH 2UVEA 2XRAH 2A6JB 1WIPA 3DX7A 2VLKA 2NXYC 2VXVL 2RFXA 4G6FD 4YNYB 3L3JB 1MCSA 1VFBA 5AZEH 3RUGE 4L3CB 4C58B 2Q6WA 3UZEA 1ODAA 3MLZH 2WQRA 3QIBA 1BD2E 2R8SH 4ZFOL 3GMOB 2DM2A 2BNUA 2CO6B 5A2KH 2ICWB 5IB5B 3HPJB 2PYEB 1QBML 2J6EA 2JTDA 3HNVH 2XWJB 2OI9C 4LIQH 3VXRD 5C3LD 1LHZA 2Z31A 3WHE0 4RFNC 5D1QA 3VXRB 3VGAC 2YEZB 4POUB 4AH2B 1YN7B 2HN7A 4O5LH 3L3IB 3V6OE 5L2JA 5DRNB 2W9LA 1JYNA 1J0KA 5LAXA 3GSUB 3PQYB 3TZVA 1QEWB 3IJHB 1Q8MA 1RURL 3U7YL 1CGSL 3D0VA 2AK1H 4Z95H 4WNQA 3IRZA 4ERSH 3KYNB 2PF6A 5ACLA 4Y5VA 5GJTL 2Z8RA 3NABH 3NTCH 2PTTA 5KVGH 1AHWC 1MCRA 1MUJB 2R2BB 4NBXB 1IC5L 4RMUA 2FJFA 4JZJC 3THML 2HG5A 4GMSH 3O6KH 4O4YL 2PUQT 5HI5D 1KN4L 4FZ8L 3UTSD 4Q74A 4MA3B 3FO9A 4ODUA 4KWUA 3CFKA 4NCDA 3PWJB 3GMNA 1CD1A 1KIQA 1YNKL 5BZDA 1G9EA 4J4PC 5IT2H 1RIUL 3UTTB 2DMBA 2FX9H 5GJSH 1EUTA 5JIIA 5FK9A 4QHKI 1XGUB 2GUOB 4N5UA 1IKNC 5KSBE 4HEME 4Y16C 1CFTB 5EZIL 1KXVC 1PG7H 2AJXH 2A9NH 1UXSA 2X1XR 4PGBA 1KPRA 3ES6B 3LQAL 1X9QA 3MBEB 4JEGB 1UWXH 4J3OC 4YAQB 3O6FA 2QSCL 1DQJB 2QADD 1FL5A 1PKQA 5C8JA 5FYJU 4JREC 3WXWH 4N90E 4Z7VE 4PJDF 1P1ZB 1WIUA 4K3HA 4PGJA 1DBAL 2PYED 1KG0B 4OGXH 3NZ8A 5F6IC 3SDAB 3MLVL 3VFPB 2MQCA 1KIPA 3ZT5A 4TUKH 2DN7A 2GJ6D 43C9B 4NQEA 2YC1B 5E6IA 2UYLA 4Y19E 2A9MH 3QNYB 4I3SL 3K81A 4DGIH 5ILTH 1BBDH 3FT4A 4TSAH 1NLDL 5BV7H 5D5ME 1MCEA 1QBBA 1WISA 3FO1B 4N0UE 1ZHNA 4OI7A 1KJ3H 4PJ9A 2C4XA 5B39B 5FA3A 1K2DB 3C5ZA 4TQEL 3QXDB 4WFFD 2GFBB 5KSUB 4NN5B 5EULV 3RTQD 2HKFL 3KXFB 1R3JB 2AEQL 4O2FA 5FO9B 3D69A 2B2XH 4Z0BH 2FECI 3ZYOA 4PGDA 3BP5A 3U0PA 3MRFB 1IAIH 4YFLF 4WTWA 5DC4B 5ITBL 2A6IB 3GSWB 2HFFA 3EYQC 4F37F 3IDXH 2YD8A 1U58A 3T3PF 5C0DA 1EEYA 5CLTA 3CC5B 3MBXH 1AQKL 4XNYL 1AKJD 3P4NB 3RAJL 3OPZL 1JK8A 3VE0A 1TMCB 4MA1C 2ZUTA 1J5OH 2RAMA 3LEVL 2LVCA 5C09D 3QHFH 3F6IA 4PJXE 4FFZH 4G8EA 4JG0L 4LLYA 3BW9B 5EOCL 4ZO8A 1KCLA 1XF5A 2HJKA 2M8XA 1VA9A 4RFEA 1X4YA 4FQLL 3UTPD 1XF1A 4PRAB 4EJ1C 4LCWE 3H3BC 4MHHI 1BF2A 3ZYIA 1R3KA 4H20H 2R56L 5INDA 3OR7B 3NIGE 3SKOB 1KGCE 1KV3A 1FZOB 1I7UB 2G60H 1TTFA 1YMHA 2XZZA 3WFCL 4YEEA 1UZ8A 1JV5B 3IVKA 1U2CA 3RPKA 1GAFH 4LVOC 1I8KB 2GTWB 4UUJA 4YPJA 5TDOA 4Z77A 1MHEB 1RIVH 5KSVA 1HEZB 4ELKA 4D9RD 3W11C 4P23C 3U1SH 5I6XC 4E0RA 4AZ8A 4OZGE 3WEXA 4TTGA 3PXHA 5JOEA 1Z3GH 1S9VA 2Q3AA 4PJ5A 1NDGB 5B3JE 5F70A 5H37H 3L3JA 3R1GH 2XTJB 1JPTL 1MCIA 2P44B 3ILQC 3MV7E 2XTJE 2AK4B 4R9HA 5HHXH 1DUZB 4PJHE 3JWOC 3CXDH 5K9OA 1FYTE 3O41B 3ULVH 4F33A 2BVUA 2DQUL 2YSSA 4ZNCD 3N1QC 4YHLL 3QUYD 3KPOB 3FFCE 4LKXA 3MLZL 4OI8A 2P5WB 2FBOJ 4MAUH 1M6OA 4RWYL 5D1XB 3OF6D 4BFIA 2ZOKB 3S88H 4NKMB 2IAMC 3QRGL 3C60A 4JQXA 1IZJA 4G80A 1QLRA 3GMRA 4WFHD 5GGQH 3WE6A 5GS1B 1MCJA 4M1DH 5EUOF 5IUSA 1IGCL 3T0EC 2ZCKL 2Q8AH 1MNUH 4X4YA 1DZBA 2XZQL 2ZUQB 3MV7D 4P2RE 2J5LC 3CU1A 4J4PD 4PJ9D 2IAMB 1YYLL 2F5AL 3RI5K 1AP2B 1T20A 5DC0A 3JWDC 2CO7B 2CIKA 3R1GL 3SOBL 4F3FB 3CIQA 4DQOH 5GQBA 1R5WA 1X5JA 5EU4B 2WWMD 2YD4A 2V5SA 4W6YB 3RWGB 1FIEA 1NGPL 1LE9A 2AERT 4HS8L 2GK0B 3D6GA 3MRCB 4LIQE 4F7CB 4ZOEA 1W72A 4XHJC 1MLBB 5GHWL 5BVJB 3TJHC 4KMQA 3LPGA 5I1KH 1BVLA 3R8QA 4JO4H 4K3EH 2GUOA 3SDDA 4N9GB 1I9IH 1EXUB 3C2AL 1CFVL 1HH9A 1CDHA 3FONB 5DUBA 1MJ8H 4K7PL 4JFFB 2DQFA 2QV2A 4D0DB 4NFCA 4KROC 5AWNL 3GFUA 4EUPH 5CSZA 4IS6B 4YXKL 1T4KA 1BEYL 3MLRL 3DXAB 4V2CB 3JTSB 1F6AA 5J0BA 5IVXA 2CLRA 2EDXA 4FOMA 4MB3A 1A5FH 3D2UD 3CPLB 5ITFA 5F3HB 2B39A 2X9XA 2YA0A 1Q72H 2CGRH 2IG2H 1JGLL 4GO6B 2GCYA 3K2UH 4LFHG 1GZPB 4WW2C 3BSZL 1H3VA 4JO4L 3U9UB 5JDJA 2GAZB 4KKLD 2LAGB 1ZKAA 5T1DL 3GNMH 3QUKA 3QIWB 4NO2A 3MBEA 2XN9D 2X1OA 1UENA 1B0WA 3WBDA 2A77L 4WU5A 5I30L 2KZ1B 1B90A 4F7TB 4MA1B 1S7XA 5D2NE 1U36A 4M02A 1IAMA 4TNVK 1LP9B 1EAPB 4RFOL 3F65A 4HQQH 2X42A 3KPPA 1BD2D 4H5SB 4MCZA 2F8XC 3QNYA 5K9KB 1BX2B 2P5EE 5IFAL 1QSEE 1A7PL 3QXAA 4WWID 4L8CB 2P5EB 4QEGA 4HH9B 3BN9D 2N7AA 3QPQC 4JQVA 3SGKA 3JWOH 2DDQH 4OSUH 4ZDHB 5D7LE 3N1GC 1S7TB 4NGHL 3NH7L 1JBJA 4PJDE 3HNVL 5EO0B 3STLA 4JN1L 5C7XL 2VXUH 1G7IB 3DI3B 3IDXL 5I1LA 4HH8A 1JZ2A 3A6CL 4FN0A 4PRAA 4YFDB 4KI1A 4JVWA 3OMZA 4JN2B 3HTLX 4L29B 1KB5A 5INDB 4M43L 3MJGX 3KPQB 1NUFA 1JHTB 3GI8H 4L9LB 2O61B 1BF8A 1T22A 3VD7A 5IHUH 2AEIT 3VA2C 4S1RH 3BUTA 2A1WH 4WW2F 4KKCD 5FGCB 3MLPA 4WUUB 1R24B 1I1FA 4IRJB 4HX1B 5CHNB 1X5FA 2ZCLH 4GUPA 2EDNA 1ITBB 1JZ8A 5KS9E 1KCVH 1HZHH 1S3KL 4P4KC 2IANB 1TJHL 5CSBA 2PO6C 4O4YH 2ILLA 2HLAA 5GSVB 1HSBB 2W07A 4KV5F 5CJ8A 5CCKL 3X12A 2X4SA 3NGBC 4UBDC 1FAIH 1I7UA 1XGRB 2XZCL 3B83A 1RPQA 3HNTL 4P5KB 3MLUL 3T0EB 3RWEA 1PG7L 2WANA 4CMHC 3ULSA 3LQMA 1BQSA 4N90D 1YEEH 1BECA 4PJIA 3WNOA 4MX7B 3TV3H 4TSBL 4JO1H 1HZHL 1S3KH 2ED9A 1KCRH 1FYTA 3P0YH 3R0NA 1OD7A 2APTA 4GSDL 5D2NC 4YHPB 1WFUA 2Y4SA 3FB7B 4LRIA 3P4OB 1AR1D 5D1QD 3NCYS 1IQDA 4L4VA 2C1PB 4BSVA 5D4QA 3W2DH 4K8RD 3PWVA 1TVHA 1TZGL 1ZVSB 2MKWA 4J7RA 4LQFL 2VDRH 3RJDA 1NCWL 2DB8A 3UJTH 4B50A 2DIJA 2P24A 3MBED 4K3DL 4C56D 3JWDH 4L4TE 2CIKB 1CE6A 3BEVB 4JLRA 2X9YA 1C7SA 2Y06L 2DD8H 2NZ9C 4JGUA 4MS8D 1P84K 1LE5A 5HDBE 1INDL 2XRAL 1QSVA 4Y1AD 4Y16A 2VXSL 5HHVH 4YDKH 5FGSA 2LFGA 5EIIA 1KTLB 3K4DA 5CEYA 4PJDB 2Y5EA 3ZE1E 4CU7A 1AKJA 3LKRB 1E6OL 1QSFB 3HG1E 3BKJL 1D5XB 2BCKB 2XICA 4BFGA 4NPYB 4R4BA 1ZT1B 4L3CA 2GQHA 5FYLD 4I3SH 4DGIL 2NY3B 4JY6B 3C6LD 1FPTL 4IM8A 2LU7A 4LVNC 2PN5A 5D7JC 3MBEC 3QZWA 1CG9A 3NIGF 2DD8L 5DJCA 2M1KA 2VDMH 3GI9L 4XAKE 5C71A 1OSPL 2AQ1A 1KGCD 1AC6A 4YHZL 4MJIE 2XZCH 1EMTL 2DI8A 1MIEH 1J0ZA 2J5LB 3QWQB 5FDYA 5SV4A 4OIAA 1HXYB 4PJFA 3DURA 1H5BA 5DRWB 2YEZA 2IQ9H 3MRMA 1A3LL 1DLFH 4ODBD 2CGRL 5M94B 3E6FB 4HK0B 3MJ9A 5I8CB 3KLAB 2PXYB 1IILE 5DRXB 3EBAA 4B41A 1QVOA 2X7LB 4XZUA 4UT7L 1FCCA 5E8PA 2HKHH 1MCWM 4Z7QF 1K5NA 4MB4A 2HJFA 4XVJL 3VXME 2C3HA 4YBLB 5JXAH 4J3VA 4MQXD 1F4XL 1ZE3C 3EOAA 3KPPB 3GI9H 3SDCC 1A7NH 2J8UA 3TBYA 2BNQE 4OLVH 4OZFG 3VD9A 2K7QA 1IEAA 2BNRB 4TUJA 4EIZC 2NY7L 3TZVC 1KPUA 1FC1A 1TETL 3RBGA 3NOIA 4RRPA 3RVVD 4ZFGL 3MRBB 3CFJB 4Y5VC 4MJID 4R2GB 3DECA 1YEHH 4JDZB 4YFLI 4NQCD 5TFSL 2Q87A 1Q9LB 4C57C 1CXFA 1QA9B 3STLB 5IKCA 3BP7A 2ZUWA 5C9KA 2OI9B 3QDGB 3B8YA 1A6AA 4HJGA 2BVTA 2AXJA 1S7XB 1N0LA 1T6VN 3EDEA 3PNWA 1FJ1A 3P4LA 3O6FB 4AMKL 1A6VH 1DBKL 3KPQA 3UROR 3TBVB 4PJEB 5HI4C 4H8WH 3B2VH 2Z91B 2GYSA 1WQVT 4NIKB 3S37H 1MVUB 4IIQB 3L9RB 1R3LB 2MHAB 4OFYA 2YRPA 4Z7VF 4P2RD 1KJMA 1FC2D 3V4UH 4HC1L 1E4XI 2Z4QB 3HG1B 4YR6B 5T1KA 1HILA 3V5KA 4LLWA 5CLWA 4WDIA 4S1DD 3T0VA 3O6FC 1QSFE 4X99B 4J1UB 4JVUA 3MV8E 4G8FA 3BE1H 1NMBL 1MF2L 4MNQB 3QPQD 2VXVH 3DETC 3QXDA 1Z9MA 2A9NL 2JCCB 3PWNB 1L0XA 3VI3E 4NO5B 5K33A 4GKSA 3KWWA 1ORQB 4LCIL 2G75A 4O9HL 3CGTA 4GAYA 1JRHL 4GMTH 3EO0B 5HD8D 4X6DF 2JIXA 3HE7B 5GSRA 4PJAB 4Y19D 1G7LA 2W0FA 3CDGA 1G1YA 5DMJB 1K6QH 4EUPB 4OLEA 3QQ9C 5H35B 3QP3A 2IANA 3Q5YA 1UACL 2P48B 1CDYA 1ROWA 2W65B 4MAYA 4PYGA 1JTPA 4JFHD 5CZXC 5KTEH 4MD0B 4RQQB 5I8EB 4IRJD 1AGDB 4AIZA 2DQIH 6CGTA 1P6FA 5K59E 4O9HH 2PW1B 1JHLL 3C9NA 2ICWI 2HFEA 3IDMA 4GKNB 4KTEL 3RWHA 4XWOC 1IL1A 1IGFL 4PJFF 3MA7A 4EI5D 3RNKB 3LSOA 4JFEB 3PGFL 4APQA 1Q0YL 2VISB 2A6KA 3MLRH 1ZHBA 3VFOB 1C08A 1KJ2A 4PREA 1MJUL 1RFDL 1QPPA 4YHPA 4E0RB 4XNYH 3SQOH 3FFCB 1SEQL 4HWZB 4PJ5B 4PJHA 4QRRB 3DV4A 3LCYA 1XZ0A 3VGEA 4KQ4L 3QQ3A 5FYLL 4EN3A 5E7BA 1UWEH 1G0DA 4KH2A 3MGAA 4HG4J 1DFBL 3DHMA 5E70A 5C6WH 1F6FB 5D70L 4RDQF 3QZWG 5ISZE 4IMKC 4PJ9C 2WBWB 4U49A 1MFAL 5DJXA 1LEKB 4NDMB 5D2LA 1PVHA 4WHTB 3STBA 5T5NG 3K46A 3BPCA 2FX7H 3DURB 4LVEA 3H9YA 4NN5C 5E00A 1NLDH 3L5WA 3TIEA 1F8TL 4R4BB 1XF3A 3I6GA 4OCNC 2EEBA 1QVOB 2X7LA 4JZNB 4GS7B 1EHXA 3PE9A 1FNSL 1K5NB 5I71B 3PXJA 4CVXA 1RULL 3U9PH 5DJ2A 1P4LB 1NFIA 5KANG 4U1JA 1G7MB 4NKOB 3V6OC 1HHHA 3FFDB 5F1OB 3C60C 5GRYA 2DQCL 3Q6FB 3OB8A 1TFHA 2ZG1A 4ZPVA 5EPMA 5LWYH 2X4RB 2X4OA 4LU5H 5TQ2L 1SVCP 1CFSB 2IQAB 3IDJB 3U0TA 1N8ZB 4XMKL 1BZ7A 2MQ3A 4OTXH 2QEJA 4U4BA 1N6QH 1UM4H 5C0BB 4BZ2L 4WEBH 4X8JB 1IGFH 5E03A 5D1XD 3RWDB 2R4SL 3LKNA 4YFEA 3JTTA 1OT2A 4X7SL 4HMEA 4ZUTB 1KJVB 5IQ7L 4YXKH 1MWAB 2H2PD 3S5LA 4HULB 1VGKA 3DSFL 5IB4B 5MEND 32C2B 3PNWB 1G6RA 5C0CA 1ZV5A 3MV9B 4S1DC 2R0KH 4I77H 4NWUH 3MLUH 3VRJA 1MCDA 3TBYB 4QHUA 3W5MA 3TO2A 2HMIC 5E4EB 4PP1C 3U6RA 5T3ZH 1RMFH 2BJML 4XBPB 1BFTA 3MUGA 1MJ7H 1JGVH 1U95A 1J05A 2ED7A 4Z7NF 3H7BB 4OM0L 1OAQL 2AJ3B 3TWCH 2HT4D 1PAMA 3TBWA 2DYPA 4YUEH 3ET9F 4X99A 5FUCC 4E41B 4U1IA 4I9WE 3JUYA 5E8NB 4L5FH 3T3ME 2Z35A 1CGXA 5EOQH 3O11B 1OGAE 2GSIA 1MHPH 4KVNL 4M7JL 1WTGT 1U8IA 4CJ0A 4LPUA 1XCQB 1NQBA 1HHKA 5AAWA 1YPZF 4NZTL 3TNNB 3MO1A 2HFGL 4P3DB 4I4WB 3O2VL 5DURD 3ULUE 3QFDA 3O9WA 5INCB 1T03L 3ZE0F 1AI1L 4LPCA 4EUPG 1FNHA 4EBQL 4PV8B 2VTFA 2RBLA 2APBA 4KROB 1A64A 5C08E 4W4NA 1V3JA 5HJ3A 3MJ8B 2I5YL 4CUCA 5DJ8A 3JV4A 1EGJH 4JAMA 4GQ9H 3RA7L 4X0KB 1S7TA 4PRHB 2D0HA 1U91A 5ALCH 1TCRB 2JE8A 3BP4B 4LF3B 4PLKD 3OQ3B 5GGUA 3I9GL 2VWEC 3FQXB 4GOSA 1B0GB 5I9QB 3I84A 4ZPTB 2XQBH 4GBXB 3GK8L 4QOKA 5AG9A 3SKMB 4NNPH 1OAZH 1BMGA 3EHBD 2ADGA 2DQHH 1XR8A 2WBKA 5CD5D 4J6RH 1CXEA 5IG7A 3LN4A 4WUKL 1ZHBB 3QHZL 4OBRA 1FZMA 5T1LB 3IF1B 1CR9L 4MAYB 1XR9B 3CVHB 5CEXB 1LO3L 5KVEH 1ZANH 5IIEB 1TDQA 4X5WB 4B5EA 5HYSG 4YPGB 1GIGH 5I8EA 3ARPA 5GS0D 3QUML 4FRWA 4D3CL 35C8H 4F9LC 1RZJL 5EO9B 3AXLB 1YMME 2FX9L 1F4YH 1DQDH 4PRID 5MEPB 2K7PA 1KCKA 4Y4FA 4PG2C 4XGZB 1MFCL 2VLRD 5TE4H 2YBRB 1OF2B 1I9JH 1IL1B 3CSYB 1RUQL 5E7FA 5ACZB 5ERWB 3QO0B 3QJHA 1KIUA 2B20A 4JO2H 3X3GH 1FVEB 3IFLL 1RZJC 1F3JA 1UVQA 1KF9B 3AU1B 3L7EB 1AXIB 1E6JL 5MP6H 3HRZB 1M7DB 4N5EC 3OL2A 4S1RL 2XTJD 3HE6C 2BVOA 4KKBC 3SGDH 2Z31D 4RMWA 4MQ7B 1JIBA 2Y36H 4ODTH 4MXWL 2QSVA 4JFPB 4PRHD 4R26H 5ISZA 5JOPE 5BZWA 4G8GA 3T2NL 2YHGA 2YS4A 1O0VA 1UQSB 3N06B 2N4IA 3SGKC 1NKRA 3IXTB 4LEOA 3VJ6B 5IB5A 1KJ3L 3RWCA 2IJ0C 5EFIA 3V4PL 4A2MA 2YUWA 3O4OB 3X3FH 5I1IL 2WUBH 4WHTA 1CE6B 3EO9L 3L7FA 2GK2A 3BPCB 1CFSA 3OKEB 5HD8C 2UY6A 1CT8A 2VC2L 1BHGA 2VL5A 3BZEB 4ODSH 3QNXA 2PXYD 5L2JB 4X6BB 4FG6C 1GGYA 3CLEL 4AEFA 4NFBA 3WN5C 3VXRA 3DUUA 1LDPL 4LVHC 1ERNA 1OP3K 4I48B 3TT1L 4KVCL 2R2BA 5FV1L 1VFBB 5IFJA 1Q9OA 1OAYH 5D71H 3KYOA 5E94B 5FYKD 1A0QH 2JK5A 4I3GA 1YNKH 3P9LB 2BHYA 1MRFH 3O6FD 4PRPD 5JPNB 3S4SG 3FO9B 1MUJA 4N9OB 2AJVL 4U0RB 1F5WA 2ESVA 3BJ91 1L0QA 1W8NA 3HZVB 4OGYL 2XXMB 3DRTA 1MFCH 1CDUA 1LO4L 1MFBH 4NJAH 2OZ4A 4LSSH 4OF8A 5CBEA 2VXTL 2OZ4H 4WGVB 3T0WA 4A6YL 5D9SA 2A0LD 4NQCB 4N0RA 1LWRA 3MRRB 2Z31B 3TBWB 3HB3D 2X1QA 2DMKA 3GM8A 4BFEA 4IHOB 3SJVE 4F7EB 1MWAA 3W5NA 1MWAH 1UXSB 4K94L 3V6ZB 2Q8BL 4P5TC 1NCUA 3BUYA 4N8VB 4MA7H 1YEIH 3PQYA 1C16B 5MI0C 3R06B 4ZYKA 5D71L 1FL5B 5FYLE 5C8JB 3L5JA 3QXTA 3OKKB 4JB9L 1VFUA 3WNNA 3BZ4B 1I8MA 5E8PB 4O02H 5T1KD 1U8JB 1EAJA 3OKOA 1E27B 2V9TA 5LKNA 2NTFB 4JFDE 5DQ9B 4YWGH 4P4KD 3FB8A 1SMAA 3OGCB 3MCLL 4UTBH 2GJZB 4HGWB 5FCSH 5MI0B 2Q76B 5SWSA 2AGJL 1MCPH 4H25A 4FQCH 4JZOB 2P42B 5I1AA 1JNJA 3G04B 3GMPB 2VQTA 2MCPL 4MVBD 5F7WC 1WV7T 3DTXB 3QDGA 4KKLC 2X4UB 4S1SL 5C6TL 4RZCA 3FQXA 1WBZB 5E1AB 5D6DA 4M1DL 1IGML 1U8NA 4HT1L 2OR8A 4HBCL 3VGDA 1FFOA 4JRYD 1EERB 1JNNL 1CGWA 4LARH 3IJSB 5DS8B 2D7PA 3P4NA 5DMYA 2YPVH 5EORH 2J8OA 43C9A 2JCCE 5KN5B 2OK0H 2ZJSH 1C5BL 1EO5A 3SDAC 4HUMB 5F6IB 1UEYA 3ZL4L 4GT7A 4R6UA 2KPNA 2FX8L 2E8ZA 2Q7YB 1J1XH 5E5MA 3EJZC 5SX4H 3QDMA 5B39A 1BZ9B 3SJVA 2GFBA 5M95B 3FN0L 3OR7A 4IDLA 2YR3A 4HJ0D 4O2FB 1PDKA 3QUMH 5FO9A 1WVZA 3O6KL 3CUPB 4PB0L 1F00I 2GIYA 4NZUH 1Z9OA 4X4ME 4L4VD 4N8PA 1NGQL 3WNPA 4FFWC 4N0CC 3B9VA 3MRJB 3ZYJA 2R0LH 4Y4KB 1N59B 2FWOB 4XNXH 3ARGA 3CDGB 3C6LB 2D0FA 2DMCA 5T1LD 4DZ8B 3QI9D 5DK0B 3LQZB 4L4TA 4Y5XB 4NQVB 5E8EB 2EYTA 4WO4B 1UWXK 5ADOH 4OCXH 3FB6A 1G9ML 3OAYK 3M17B 5CJXC 1X5LA 3QEHB 1FNFA 4ZO6A 4RMTA 4X9HA 4YX2H 5MERB 2BY0A 3OR6A 4XNMA 5DO2D 2HRPH 1WZ1L 2SEBA 4U6TA 3DV6B 2VDNL 4YIQB 3B9KC 5J1SC 4U1HB 5ID0A 1ZHLA 5I8OL 1I7TA 2E7LC 4J4PA 2HT3C 5MEQB 4E5XA 4WGWB 4GRLA 2Y07L 4G8GE 1NC4D 3ZHKA 1V7NL 3LSOB 1IKNA 4GXVH 4QKXB 4WENB 4JRWA 1FPTH 1OWRM 3DBXB 5EC2B 2C3WA 3FQWA 3EJYD 1TNNA 3FOMB 2FNBA 2I24N 4U1LA 1A7PH 4R3SA 4I2XE 4NQDB 3EDDA 3TA3C 1MELA 2WBJC 3S7GA 1ZLSL 1J0HA 5JNYA 3C5JA 3DNKA 4YHNB 2OS7A 5LXGH 1T1YB 2F54E 4WI7A 1PEWA 4RBPH 4HHAB 2FGWH 4WTZA 3GBMH 3IB4A 4ELMA 4QHMA 1UXWB 4L5FL 5IM7A 2Y23A 4LBEB 2PYEE 4ZAKA 1NBZB 4TPRH 1AGBB 5TDPA 3Q2CA 5GRXG 1LEKA 2UV3A 1JFQL 4R7DB 1A1MB 5DJZA 4ONHA 3S3SA 4PTTB 2DRUA 5EH1A 5GGSY 4CAGA 5KSAB 3MV8B 4IHOA 1S9XA 3KLHC 1QRND 3BZFB 4XPTL 4HUWA 5I1JL 3MA9H 2VLJA 1BP3B 3ZKNC 5I15H 2D3VA 4MDJA 5DJAA 1SEQH 3NCYP 3BKMH 2L7UA 3SDDB 3UEZA 3VXPA 3WUWB 4LSSL 3G5XA 4NNYB 3STZA 5IBTL 3WIHH 5DMGC 1NFIB 3EDKA 3HC3H 5DDHA 3FO2B 3OX8A 2VDOH 1HHHB 3FFDA 5E6ZA 2E7CA 4YBQC 4Q7DA 1DLHB 1VEMA 2BP3A 4WEBL 5ETUB 5J8OA 3E2HC 1X5YA 3QHZH 5EU3B 4R0LB 4LSPH 2F9BT 4NO3B 1A7RH 1N3NA 2IALB 4YHML 2XZAL 3ARDD 1NFKA 1I1AB 4MD5B 4JGJA 5I0ZA 4EVNB 1K3IA 3DWTA 3KPLA 4H88H 4QRUB 2DLEA 2P46B 1I8MB 2D0GA 4UILL 2VZUA 4D0DA 1QYGL 1F90L 1M05A 4PRIA 4FFVD 5CSZB 1MAKA 1ORSA 1DR9A 3VXQB 4CKVX 4DEPC 5J11B 1N6QL 3HI5H 3CH8A 1OGTA 3DXAA 3N9GL 3AB0C 1IAOB 4PD4K 4JY5H 2BY1A 1X5XA 3ZSSA 4GS7C 1UCTA 1LK3H 5B4MD 2VOTA 1VACB 3FJTA 2EKSB 3ESVF 4XVUD 4JVPA 1KB9K 1AXSB 3F12A 4CADA 2RCSH 3W9DA 4NRXB 4U1IB 3WO4B 3CH1A 2F53A 4RMQA 4H1LA 3ARGC 3BRDA 1MY7A 4CW1A 3MNVA 3I6LD 4P5MB 3W39B 4P99A 4G3YL 4HUVA 4BQ9A 2VITB 3TVMC 1NAMB 3RU8L 5BV7C 2EEDA 1UKQA 3P77A 2AEWA 1FL6B 4HIJA 4AENB 2AXGA 4LASL 4U05A 4MNGB 1AC0A 3BD3A 1T5XB 2A38A 3UTZB 3OB0K 1S8DB 3H9HB 1C5CH 4KK5C 1E4XH 5C0JB 4GRWE 5C0FB 4HBQA 2XY2A 3DOSA 2H45A 4XBEL 3NFSH 1J0JA 1ZAGA 4Q9QL 2NY4D 4LVNB 4YHIB 3O81A 3TYGL 2E9JA 1T21B 4ZMAT 5EU7C 2VR5A 2YOCA 4PJGA 1SJXA 4XP6H 3TGXA 1UKTA 2ID5A 4OZIE 3ORJA 1MCHA 1R3IL 2D9QB 4KJYA 4U1HA 5ID0B 1ZHLB 2C7UB 1RY7B 2OR9L 4PGCA 1ZLUK 3GSVB 3O3BB 4LSUH 1FSKC 3C6LA 3SKMA 1OP9A 4NKDB 4QT5B 4QHLB 5DJDB 3ARWA 4L3EA 4P5KA 4XTRD 4PRPB 5GS1C 3UC0H 1K4CA 1U3JA 3LQZA 1U8LB 3T2PA 5CEZD 4JANA 1ZA6A 2VR4A 3M45A 1CZ8L 3UTTE 5TF1L 5IMLA 1FYTB 3FQUA 1EEQA 1XGTB 4PBXA 3TEUA 3QUZB 4U1GB 2DF3A 1XR9A 1U3HD 2ERJC 2HLFC 5AWNH 4NQDA 1YY8A 1V7ML 3VXSE 1J0IA 2I5YH 1SVZA 5E6IC 4R97C 4OUOA 5CGTA 2YKLH 5JNYB 1FFQA 1WJ3A 2Q86B 3HLAA 2PCPA 8CGTA 2JJUA 5DSCB 3MRKB 4NYLA 5B8CC 3OG4B 3GMOA 3BRFA 1XIWC 4BH8B 1T7YA 2VLME 2YPKB 5CGYD 2APXA 4MNQD 2W9EH 5HGHA 4TQEH 1N5AA 2KUTA 2AVGA 1FDLH 3P73B 5F7HA 4XP9L 2AEQH 4JRXB 5EIIB 1IARB 3EW3B 3TBTB 5JIPA 5I8KH 4OSUL 4WI8A 2QKIA 4ELMF 5KSAA 1FGNH 4LHUA 1UKSA 5JR1H 3O9WC 1NEZA 3BEWB 3INUL 4M7LL 3TYFB 3T77B 1T83A 5C08B 1BJ1H 1JNHA 2NNAB 2XXCB 1RZGB 1OOAA 1U3HA 4HS6A 1T1YA 3G5VB 5GS0C 3QH3B 4JY6A 3BKCH 3VCLA 4M9OA 2C1OA 4HFUL 4WCYH 3V6FA 1X6LA 4MNHB 4ZOCA 4CVWA 5A1AA 5D7LB 4U1SB 3QZWB 1JTTA 2DQTH 2I26N 4JFOB 5HI3D 5FGBA 5I30H 1J18A 2CLVA 1ZSDB 5TPWH 3LD8B 1W72L 5F7DA 2A2QT 2CDFB 1JZ3A 2VDLH 1FGVL 3KPRE 4AEIL 1SYSB 3BEVA 3MPCA 4JLRB 5ADPH 2OSLA 4D9QE 4NO3A 4LLDA 4L8BA 1NCDH 2V7NA 5EWIL 5CILH 5HSFA 5J4MA 3EYQD 4J3WA 1CT8B 5DFVD 5IHZB 3MLSH 3UTPE 3O2DA 4LSUL 3O45A 1BOYA 4PJDA 3H0TA 4JFHE 3QIWD 4K2UL 3VWKC 2VQUA 2P49B 4S2SB 2E9IA 4XPBL 4PLJC 4UT9H 1U8HB 1BJ8A 4OM0H 4WHYG 3PWPA 5C0EA 3QBTB 2OXGA 2IPTL 4BSWB 4YAQA 1A4KB 1NBQA 4LLVA 2ESVE 3ZSTA 4Y1AE 5FHBH 5IMMA 2QADB 3ALWA 1P9MC 1DQML 3X17A 5GGTH 4POYA 2I9LB 4KI5F 2AEPH 3UZVB 1I1YB 5IBLD 2FR4B 4KJWC 1C1EL 4JM2C 1TLKA 3SE3A 3C5SB 3HUJA 1U8PA 2F8VA 2E9BA 3DVGA 4JFDB 4X6DA 5DUPH 5FK9B 4HK3N 2F5AH 4Z8FH 1FNGA 4YDVB 1MHHA 3HN3A 4HKZB 3CFJA 1GGCL 3MNVB 2DBLH 4RBPK 2Q20A 4LHUD 1YEFL 3OJ2C 3MV8D 3PV7A 2XZQH 3IDUA 1T80A 4PUBL 1R3LA 2MHAA 4KU1A 4Y7MA 4I13B 3OKOB 1JGDA 4RCAA 3KAAA 1T5XA 4I9WD 4XCCL 2KDGA 1K9TA 3PJSB 1X5GA 4ODWB 5IOPA 4YHYC 4WW1B 1IAIL 4LRIC 1NGXB 4OLYH 5J13C 1JVKA 5SWSB 1CICA 1YN6A 4M61B 3CFCH 3V7AG 1FO0A 3HG1A 3MACL 4LCYB 2XFXA 2L4OA 1LD9A 1QSED 3FQNB 4PJBA 4Q58C 5KSUA 2YUXA 4XXCA 1NCWH 4L4VE 3SPVA 2NQCA 4HLJA 1FBIH 2AQ2A 3IYLW 3GHBH 3QCVH 1A6AB 4HJGB 2X4UA 2R69L 1WCQA 3QB7C 4FNLH 5D1XC 5MEOB 4PGDB 1VKXB 2A83A 1UGNA 1OP5H 4RSVA 2V2WA 3EYVA 2YA1A 4FMFA 4NT6A 4PJ8D 4LL9A 3IAQA 4JQVC 2JCCA 3RVXC 5HXMA 1FZOA 1RZJH 5GS2D 1IFHL 2DQJL 5HHOB 3SDYL 1A9BB 1QR1A 4RFNB 1TZIA 4PRPA 5JUEL 2OTWA 1OT1A 2EO1A 2UZIL 2VLKD 1BQHA 1HI6B 4PGZA 4UUJB 3QHTC 3EFDL 4OZ4B 3FQUB 3QXUA 4IMLB 5J56B 3QWRA 2BSRB 4WDIB 4F8QA 2P47B 2VDOL 3BW9A 3QDJB 3L5XH 2CDGB 4PJ7E 3G6JF 2R56H 3T4YA 3ZTNH 1I7ZB 2HVJA 4U0RC 1U2HA 1D7FA 5KG9A 3G9AB 4Y5YB 2JB6A 2ZUUA 3HC3L 1F3DH 4KHTH 5BOPA 4YHOL 4K23L 1NDMA 3E0GA 4M6NL 5CMAA 4U1NA 1RZ8A 1QG3A 4LNRA 4AIZB 4KXZH 3B6SA 5I19H 5DQJB 4CVUA 1UH2A 2DTMH 4XAKD 1B0RA 4NZRL 4JRXA 3F7VA 4H8WC 1D5IL 2ARJB 3RL2B 4EZMA 3MA7B 4JKKA 1AIFB 1LEGB 4JDVA 1GH7A 4QRRA 1AH1A 2E27H 1MHCA 3KPSE 3TPKA 2A6DA 5GZOD 1FLRH 4V1DA 4OBSA 3QH3A 3GMMA 1JF6A 4R7NA 1T03H 1JGUL 5F7YC 2J7LA 2QHRH 4F58L 3VXMD 2FX7L 4H26B 5F7UA 2SEBB 5EBLB 3UTQB 1NSNL 4G8IA 2HFEB 3TBTA 3U0WL 4R90L 1R5WB 3JZ7A 4GW5A 5CD5C 2YZ1A 5F9JA 3KS0J 4LAQL 4FA8A 2YMXH 3IU4L 3SKNA 1DFBH 3MRNB 4OCRH 4NM8L 3GIVB 1L7IH 3PDOB 1VFAB 3E6HA 1Q38A 3CLFL 2F54A 5EB9A 1HHGA 4YQXH 5FB8B 4DN3L 1ES0A 1UYWL 2VDNH 4TVPD 3J8F7 5CD3B 1EK3A 4EEEA 2F5BH 3PGDA 1AI1H 1ND0A 2RFXB 4YNYA 5IBUG 1K8DA 5FDWB 5KANI 3GSUA 5DJYB 1NBVH 5EU7E 3TO4B 2Y07H 4HHAA 5L88H 3RWFA 5IMMB 1OB1A 1AP2A 1T20B 4QHMB 4K94H 3CU7A 4Y5VB 4TSCL 2IQAA 3IDJA 5DJ2B 4QGTA 5E9DD 2LABA 2FR4A 4UAOC 1CN4A 3QUMB 3MRCA 1UCBH 1CLCA 4JCMA 1A6TA 1RJZA 2HTKD 4LPXA 2GI7A 3U0TB 4JFDA 4X6DB 3SE8H 3SKUD 5E2VH 5E2TH 2CLZA 3PWJA 3TVMA 3RPIB 1C1EH 4Q6YA 1LP9F 2AJSH 4NHCH 3VXNB 1NEUA 2YA2A 1TTUA 5I66B 5SWZD 2EDYA 3QDJD 1DEEB 4CNIB 4U6YA 4ZUTA 4M7ZB 3THMH 3ARTA 3OB0H 3L1OL 3IS1X 1CLOH 4B7IA 5IR1A 1FE8L 5C0AD 4Z95L 4FFYH 4A6YB 3DSFH 5B38G 3BDYL 5F8QC 4OZGA 3ZLQC 3MFFA 4HWBH 3Q1SH 4TRPL 3DO7B 4WV1B 4P2OC 5EG6C 4WWKA 4S1QL 2CH8A 3HS0A 3BGMA 1B4JH 3ZT7A 4U6XB 3PDGA 5FYKU 4N8VG 2YPVL 4KI5D 5IW3A 3BH8A 4U6VH 5I1LB 3HKFA 1QRKA 4YDKL 2XWBB 2AV7A 5EZOH 2EDOA 4F2MA 4PGBB 1X5IA 2IGFH 3CLFH 4YJZL 3M1BA 3T2NH 1KEGH 3PWLB 4KZDH 5FM5M 2HLFD 4I8DA 2NY5L 4GW4B 3MRLB 4D9RE 4BFBD 5DA0B 5ID1A 4PTUA 3O0RH 1KG0A 3VFPA 3NZ8B 1EO7A 3Q5TA 3FT3A 1INQB 2XY1A 4NGHH 1MCLA 3MUZ1 1LNUA 2Y6SD 1NAMH 3F7RA 4CDHA 4HX1A 3DHJA 2AJ3A 1LD9B 2E7MA 1NL0H 1U41A 4EN3C 4V2BA 2CDGA 1Q94B 4ZXBA 3IDNA 1I9RH 3RVXD 1TPXB 2F53B 2ARJQ 3VG9C 2ICWJ 3Q3GA 1ZLVH 5E8OA 3BX7C 1ADQH 3FRUA 3HR6A 4K7PX 5JXEC 2O5ZH 2CK2A 4TSAL 4M00A 1RJCA 2N56A 1CD8A 1HHKB 2HJKB 2J1KA 3MO1B 2FB4L 1SJEB 5LVEA 1D5BB 3C8DA 4Z7NE 4HIJB 4AENA 2HJLB 3FMGH 1QR4A 2DIAA 1R3KB 1S5IL 1C5DB 4ZPTA 4MJIB 2FATL 3BFOA 3H9ZA 3MODL 4PJIB 4TNVF 3L3HA 4OAWB 4OGXL 2R4SH 3IFOB 4XVJH 2HT2C 3SJVD 4IOSD 3QFJA 2VSDA 3GMLB 3SDCA 4WU7B 1B4RA 3LEXB 1FV1B 4DVRH 3IXAA 1WAAA 5GSVA 2IFFL 1U42A 1KENL 3BP4A 2Z8VC 5DEFB 2H6PB 3T2OA 1RZ8B 2C5DC 2J6EH 4FQ2L 4P46D 3DMMA 5GS0L 3QJHB 2VDQH 3TM6A 3V5HA 3FRPG 3HUJE 4L3EE 2AK4A 1S7QB 4LLQB 4RAUB 4G8IB 3VXOA 2YXFA 1J8HB 1KXTB 3RL2A 1RULH 5D7JD 3U9PL 2PTUA 1YMHB 5F9JB 1GOFA 3Q6GH 1JV5A 1U8LA 4JDVB 4LKXB 5FGRA 5C0GB 4KJWD 4ELME 3D0LA 1M71A 4TVSa 3L3OB 2FYYA 4WY7H 5D7SH 5LBSH 1CDCA 1V3KA 3ZKQD 3HI1B 5CZVH 3CVHA 4V1DB 5CEXA 1EO8H 1HHGB 4ACPA 2ZPKH 3U79A 5JOFA 5GGVL 3NIFE 2P8PA 4OCWH 3WS6C 3VWJC 4OCRL 1ACZA 4UINL 3WFEH 3WNLA 1RUKH 3C6LC 3RWCB 4NPYA 1RHHA 1OP5K 5GS1A 4NQTA 2EYRA 5CFHA 4M5YH 3RWFB 2DKSA 4LVOB 4PLJD 1HYRC 3O8XD 1MFEL 1A6ZA 4DCQB 1C5BH 1IAKB 3CSYA 5I8KL 1KIRB 1FHGA 4Y4HD 5D6CB 3V95A 1IGMH 2DTSA 4OD1H 3JV5A 2KZWA 3IFPA 2J2ZA 4X6BA 3JV0A 4G6JH 4HIXH 1DUYB 4QRPA 5IQ9A 3MACH 3WLBA 3S9DB 5DGQA 2MOVA 4BFIB 3LKQB 3RWGA 4M62L 3BEWA 1ACYH 5BJTA 1REIA 1ZHKB 1A14L 3PL6C 3RX7A 1LDSA 2VL5B 4RWYH 3CZFA 4LPTA 1HNFA 3K80A 4ZAKD 4H0HB 4PJHF 4NQXB 2D7OA 2C1OB 1KC5H 3WFHB 3KPRA 4B7LA 4TOYL 5ADOL 4RA0C 3FO0L 5GJSL 4F80A 1J0YA 1F13A 4NOFA 5F7EL 5KTEL 4UIMB 3EDJA 4R97B 1JP5A 1CFQB 1OTSD 1FE8H 4N8CH 1QYGH 4Y89A 1XCTB 1IQWL 3CDYA 3IRPX 1Z6JT 4G9FB 1YJDL 4OQTH 5F1SA 5TDNB 4I0CC 3SDDD 4F7CA 3SGJA 3U36A 5IP4A 3TYGH 1IKFH 4XMLL 5CEZL 3MXVH 5KJRL 3H42L 4N9GA 2A74B 1IEHA 1EJOH 4S2SA 2EZ0C 5TQ0H 4NCC2 2AKRB 5F9OL 3BYTA 2V2TA 3FN9A 1BFSA 1MI5D 5LGHH 4F57L 4LDOB 3C87A 3OKKA 3G5ZB 4LVHB 2Z91A 2R2EA 5IVXE 1J5OL 4IIQA 4GJTB 3BMVA 3SDXA 1HWHB 4NO0D 4Z7OF 3HZVA 1KBGL 3GBNL 4WUUD 4JRYE 1LK2B 4MCYA 4OCYL 5ICZA 1N4XH 4U6XA 4P5TB 3WS3A 2GCYB 4WFFE 3GMPA 4X9GA 1HOCA 1XIWD 4HH9A 2EH8L 1UB6B 1FNGB 2XWBA 4YDVA 1P9MA 1XT5A 3QYCA 1XH3A 3QUKB 3ZHLA 2EIBA 2RHEA 1TXKA 5HPOA 2XNAA 1NLBL 1FVDB 3O3DA 5JORB 1S9KC 4RGND 4QRSA 2R29H 3OAYH 4TYUA 1G7IA 1JCKA 4R96B 4KHXL 4DWHA 1I1AC 3BQUD 2W60A 2FRGP 5D5MF 1NC4B 1U3HC 4OFVA 4YO0B 4Z5RA 1VFOA 1YUHB 5IFAH 3RI5F 5DFVC 4S11A 3KYKL 1VPOL 1X44A 1FDLL 1HILB 3IETB 1HKLL 4GAGL 3QDME 1LVEA 5C09E 4ONGH 1MLCA 2IPUK 1CICB 1YN6B 4LP5A 5IJVA 4ZFFA 3LEXA 1EVUA 4CU6A 3TBSA 2W65A 2CD0A 2XFXB 3KG5A 5ECJE 1I8IB 3FAWA 3EOBA 4X4MA 2V5TA 4MD0A 5C0BD 1MCNA 2VLLB 5EU6D 5JPMB 4ODHH 3HMWL 3ARDB 5IVNA 4I77L 3TP4A 5CGMA 3QFJE 1AE6H 1F4XH 3TESA 1OW0C 4HMCA 3MRJA 3ULVL 1F45A 1QZ1A 1T22B 1LMKA 4W70A 4Q2ZB 3NPSB 1I4FB 3K3QA 1M71B 1BWWA 2GSGA 4G6FB 3DROB 3RY4A 2IC2A 4DZ8A 4M1GH 3VD5A 5HDQL 3R4DA 4OFPA 4UQ3B 3D85B 2NX5D 3TVMD 4AY0A 5LGJB 3VW3H 3G08B 4KUCD 1HDMA 3QI9A 3QQ4B 1JPFB 4JM2A 2HLAB 4NUJA 3HMWH 3VRIB 3HE6A 2VQ1B 5KG9B 3RY6C 2R9HC 2LU3A 1I7TB 1J8HA 1OTTC 4XVSL 4U1NB 4YK4C 5T5NF 1JWUA 1VEOA 4KDVA 1U92B 5DJXB 2CRMA 5DQJA 5C3TA 4JKLA 3SBWA 1FAKT 2H32H 3RVWD 3SOBH 1N2RA 2XQYK 4R2GC 4OZFH 5FUZL 2FSEA 4ZTPH 3B9EA 3TNMB 1PQZA 3D39A 3U2SA 2VLKB 5HYJA 4Y16B 4M7ZC 1MQ8A 3IGAB 3REWA 3H7LA 3U46A 5BQ7B 3LKPB 1FG2B 2R0ZH 3BVNB 3P4OA 3ZE2F 4AG4L 4OCLC 5SX4I 1A6ZB 3KVQA 1DSFL 1D5XA 5FEBA 1PG7W 1CGVA 5GGRY 3IT8D 2CK0L 5F6HI 3C5JB 4YHNA 5DQDL 3N0PB 3WN5A 1A6UH 5EBLA 4XBGB 4PYHA 1MRDH 1PSKH 3UPCA 4JQXC 3QUYC 3I02A 4HW6A 3MLXH 4FFWD 4N0CD 1UM5L 4E5XB 2X4OB 4JJ5B 1RZFH 2DQDL 3I3BA 3SGEH 2NPLX 4OZHF 2BMKB 3MV8A 4JM4H 5EU6B 1UJ3C 3L3IA 4W68A 4PTTA 3PHQA 1RK1A 3H8NA 1CDBA 4OCMC 1XAUA 1MH5B 5DEGA 4YHKL 2CJUL 4P0DA 4JZNA 3HHRB 1I1RA 2BSTB 5F9DC 1FIGL 5DRXA 1ZANL 5I74B 2FL5A 1P7KB 2V17L 1RIVL 3KYNA 4Z76B 1BIHA 3H2WA 5IM7B 3BGFC 1Z5LB 4B53A 4F9LA 3MXWL 1N8ZA 4ODUB 1U8OB 2EIDA 2DQEH 3D5OF 3SHSA 2HG5B 1U8QB 4XX1E 1I1AA 2O5YH 2FB4H 1IEAB 1FZJA 1PLGL 4OV5A 4KRLB 3MV9E 2R4RH 2CJUH 1CL7H 4TUOA 4JR9H 4X6EA 3WDHA 5SWQA 4HK0A 5EDXA 4KV5E 1LGVA 4LDEB 4HCRL 1Q9LA 1FFRA 4ZS6C 1PZ5A 1FVDA 2OQJB 4NO0B 4XP1L 3OZ9L 4QRSB 3QCTL 3SN6N 1JYXA 2GJJA 5D2LE 1SM3H 1E4JA 4NNYA 5FUCE 3RA7H 3F5WB 1IAOA 4GMSL 3S4SB 1BREA 1F4WL 3FO2A 4YDJB 5F88A 1P53A 2VXUL 3PF2A 3ROOA 2UUDH 1N6VA 4MCYB 5FF6B 5IK3B 4MAYD 4P5TA 1MVUA 3N50A 2VH5H 4OCSH 4TTDD 1E28A 2NY1D 5A43C 1AO7D 1UB6A 1WCBB 3KXFD 4ZFFB 4AL8H 4XXDB 1WIOA 4HFUH 2AJYH 4TULL 4U7SA 4HZAA 2VRAA 5C2BL 4MXVF 1BPVA 3D9AH 3OKNA 3MYJB 1U93B 2QQLL 4XCEA 3GBML 1R3JA 3KPLB 3BJLA 4PJCE 1DJSA 2NW3B 1I7RB 1CBVL 1WC7B 1TCMA 1BIIA 2CUIA 4PJ9B 4Z5RB 1ZT7A 5JW5A 3WFDH 1M05B 2A6IA 3VXQA 3AS1A 1D9KA 2XTLA 1QBMH 2VITA 1VADB 4QOKB 1CCZA 1KCRL 2P8LA 4FQJH 5GISL 1NEZG 1G7PB 3QI9C 5T3ZE 1UZ8B 4Q2ZA 5DTFB 5C0RL 3NCMA 2ICEA 5I8OH 4AIOA 1YEEL 2H32A 3OBAA 4FXKB 5T1KB 4OLVL 4PJXA 2EKSA 3DI2B 4PJ7B 4WFED 4J3UA 4PRHA 4UQ3A 2R1XA 5AG8A 3IDNB 1VCAA 3DARA 4N0FB 5IBLC 4X7CC 3GUTB 4PJEF 1DQQB 1QFPA 1OLLA 3ZDYE 5FV2A 1IQWH 3CVHL 1WAAF 4FFVC 5EBWB 5JA9A 4N1EA 1A1OB 3TT3L 4RFEB 4RQQA 4EIGB 3DLQR 1CXIA 4JPIA 2WV3A 5IW6B 4NO5A 2YSSB 3UTSB 1A02N 4WW2B 3UMTA 4MD4A 3KJ4C 4FTVD 3AREA 5HYFA 1K8IA 1EJOL 5IG7B 15C8H 5EC1B 5IMLB 4HIHA 3UCRA 3NCJH 3NFNA 3QUZD 5TH2A 4NP4L 1IC5H 5DJDA 1G1CA 3RAJH 4ODVL 3D85A 1FVCA 1NDGA 1T89A 2HYMA 4NUJB 1CK0H 4CMMB 1TVDA 2VAAA 5J1AB 3S35L 4Y4FB 1T04A 5C08D 3FMGL 2V7HB 1G0XA 1WFOA 4QTIH 4WWKC 4RAHA 4UV7L 3CLEH 4BSJA 1W2KT 3X14A 2YPKA 4EDXB 4HK3J 2P7TA 4P57B 4EN3B 1J1XL 1P4BH 5DA4A 3DYPA 3MV11 4OF5A 4NJ9L 1FQ9C 3QUZC 2KL6A 3BESR 5GGQL 5DZNA 1UT9A 1CQKA 3IKKA 4LRNH 4MSWA 1SY6A 1WEJH 2GK0A 3HG1D 1SY6H 1W72B 4MWFA 3TIDA 2BDNH 1GZQB 2L0DA 4G42B 1TTGA 1A1NA 1A6UL 1KELL 1NCCH 1I8LA 4Z7UA 4L8SA 3L3DA 4RISH 2J4WL 3DV4B 3MLXL 2DJUA 3MNWB 4HEPG 4WCYL 4DGYL 2AABH 5EFIB 3E8UH 1MCWW 3CFEB 3HLAB 3P2TA 4Z0XB 1S5HB 2MNUA 1WBYA 4K07A 4XC1L 4RAVB 1AO7E 1PYWB 3WNMA 4WTZG 3RGVC 2WLYA 2IH3A 1KNOB 4BH8A 1KOAA 3ARRA 2CDEA 2DQUH 5EUOE 1T7XA 3RIFK 1YEDA 4OM1H 5CJQL 4LLDB 2A0LC 3PP3K 4U1JB 4QO1A 1S7VB 5I1HH 3WS6A 2VLRA 4XPFL 2CDFA 3F7YA 1ZTXH 5BVJA 2X4RA 4OV5B 4JY5L 3NAAH 2BNRD 3BO8B 2NY3C 4Y1AA 1JE6A 1T3FA 5A16B 4XNXL 2EECA 3IU3A 5CZVL 3ECBB 1MLBA 4DJMA 1RZGA 3RWDA 4KK9D 5C9JB 4J3SA 3G5VA 3JTTB 5B3JF 5J12C 2MCG1 5BO1H 2NX5E 4JFZH 1EXUA 1UB5B 3V0WL 4CDGC 5DK2B 5IEHB 3BD4A 2WP3O 1RZIB 3PV6B 4JFOA 3MV9A 2NTFA 4X6DE 1DDHA 4LPYA 3BGAA 3MGTA 3OGOE 3Q6FA 3HNSH 4EOWL 4MAYC 1ZTXL 3VFTB 1R5VA 2YZ8A 3MLTA 5HDQH 4XBPA 5EU5B 4JFED 4U0QB 1KC5L 3WFBH 5CJQH 2IADA 5HGDA 3GHEL 1QHOA 1F11B 4TVPL 2B4CC 3MYJA 1NFDA 3CK0H 1NAKL 2A74A 1MF2H 5L0QB 2XIDA 3V0VB 4OZIA 1NCTA 6FABH 4HJ0C 1WC7A 3SDXE 4F7PB 2VZSA 1S9YB 1EAPA 1NCCL 3RY5A 4APQC 3BE1L 3OGCA 3WDIA 4MCZB 5I1JH 4WO4C 4FQXA 2DDQL 4DGYH 2XTJC 3IAGC 3VMOA 5BXFB 1SHMA 2FH8A 4GAJL 2QLVB 2I25N 4DN3H 3ZKXB 5L6YL 1RSFA 5HI5C 4M61A 3LDBC 3DMMD 1NMCC 3T08A 1IM9A 5I1EH 3HC0A 4Y19B 5DT1H 4DUVA 1JF1B 2YMXL 2ZPKL 2VLRE 4JFQA 5B4MC 2ZCKH 2FLBT 3GUTA 3GHBL 2VE6B 3QCVL 3VFMB 4IIQC 3MRQA 3MROB 3QO1A 4ZDHA 1U8NB 3MJ9L 3GMQA 4KK6C 1IRAY 5EOTA 3PL6A 4J8RA 4LHUG 4FQ1H 3BPLB 2GY5A 1DQLL 3ULUD 1G9NL 1YNLH 2X4PA 2GW5A 1EVTC 4HIHB 5EZIH 5J6GA 4ZFGH 3O2WL 4NQSA 3UJIH 1EBAA 4UTAL 2J6EL 4FQ2H 4YK4B 7FABL 1FORH 2O61A 4GQPH 3FAXA 1A7QH 3WUWG 1KACB 15C8L 1Y18B 4OQ1A 2YK1L 3ISWA 2R1YB 4XCNA 4OCYH 3EYFB 1I7ZA 2HVJB 4RDQG 4UT7H 3LN5B 4XB7A 4S0SD 3VGFA 1L4IA 5DJ8B 5FA4A 5MENB 2GHWB 4HWBL 2FIRT 2DICA 3HC4H 5DJ6B 4KMTL 1T04B 1L0YA 2R0WH 1YEKH 2VXTH 4JPIB 5F7NC 5GGUB 2UZYB 5F96L 3WL9B 5ALBH 3OSKA 5HGBB 4NBYB 3UBXI 5MEPA 3D18A 2GT9A 5F7LB 4B0MM 5ANMA 4Y5XC 2R2CA 1RZKC 2WLZA 3MLYH 3P11L 4BKLA 2IBZX 4K3JH 5C92A 3S36H 5BMFL 1YEJL 5IESL 5T1LA 2PXYC 4IMLA 3T0DA 2VDKL 4P4RB 4TPRL 1BM3H 3LS5H 2VAAB 1V5JA 1YNLL 2IPTH 1A1NB 1PX3A 4QHKJ 4EXKA 5C70A 3M17A 5CEZE 1AIFA 1LEGA 1T0PB 1CGSH 2YD2A 4HS3B 3VI4E 3I3DA 2G9HB 2C1PA 1EFQA 5J1TC 3NIDE 3VFNA 1JUFB 4NQDD 5I17A 3VXUD 1OP3H 2Z92B 3EKCA 4K2UH 5AYUH 1KCUH 3D25A 4CJ1A 1LO5B 5HDBF 5CMAB 1J86A 1CFNB 4U3XA 4Z7UF 3ULVF 1KULA 4O00A 2YPLB 1CG9B 3O6MH 3WIHA 2QQLH 4OLYL 4LGRB 4DKEH 2MPAH 2IH1A 1FN4B 2ARJA 4OM1L 4ODTL 4PP1D 1L7IL 3C5ZC 4LCCC 3RTQB 2HMID 3RWIA 4OZHB 3NH7H 1AO7A 3G9VA 4WI5A 1UYWH 3NBNA 1OHQA 5MP6L 1A4JB 5DRNA 3ECBA 3U4AA 4IMKA 1MPAH 5E6YA 5DQDH 3EYOB 4X5XB 3D0VB 3UO1H 5FB8A 4D8PB 2J88L 3HMXH 4PLNC 2WQ8A 2D31B 3IXTA 5HY9A 1JF5A 1S7SA 3O6ML 4IEFB 1CICC 3MGTB 3TF7C 4P2OB 1I9JL 5E0QA 4JKMA 1EUUA 5DZOA 2J8UF 2PR4H 3QEGL 2ZUSA 3MNZA 1WUNT 3I2CL 2ESVB 2BVYA 4JO3L 3RJQB 4OZGF 1OW0A 4UI2A 4Y88A 1XF2A 5GZND 3BZEA 3MRBA 3ZTNL 2QQQA 1OAUL 3PDOA 2DOCA 1DEEA 2RR3A 2X5PA 4UDUA 2XZAH 1UB5A 2XT1B 3VFUA 3QUYA 1NJ9B 4Q6IA 3GB7A 5DK2A 5IEHA 3VFSB 3GHEH 4XPAH 2ZWLT 3QA3A 3A6BL 3NZHH 3R06A 3SE8L 2X10A 4CNIA 3GJEB 3C8KB 1TJHH 2G5RA 1CLZH 1I3UA 2XWTA 3MJ6A 3BZ4A 2Z8SA 3NMEA 4Y4KC 4CN6A 2OZ4L 1ZLUH 4PRPE 1QNZH 5IR1B 2OBGA 4QXTB 2XN9E 4KJQC 1U8KA 3MOBL 5FHAH 1TVBB 4PJXF 4G5ZL 3VWKA 1SJVA 4YR6A 1D9KD 4XI5D 5E1HB 1OGAD 1AXSA 3ALXA 4G9FD 5AD0A 1V3MA 2ZUVA 3DPBA 4AIXA 4DEPB 4K9EC 3SBWC 2MFNA 3CH1B 4UAOB 2V9QA 2R8SL 2DBJA 1ZHNB 4JDZA 2DQHL 3AS3A 2XQYG 3W39A 5T3XD 1AR1C 2B1HH 2DLFH 2NY6B 4FQIH 5D1QC 2WK2A 1UC6A 3GMQB 5FKPB 1B2WH 3DYOA 4HC1H 3O2DL 4M7LH 4CMHB 2IEPA 4R90H 3T8XA 3PWUA 1U8JA 5JXED 3AAZA 1E4XL 1FFPA 3TZVD 3ULUC 1WICA 3S98A 2H2SC 4P2RB 5J9PB 5HYQA 4GH7B 3DGCR 1D6EA 5FF6A 2P4AB 2W9DL 2DWDA 4OB5H 2EDRA 3LMJL 1DVFA 4FXLA 1JPST 5C2BH 1P7HL 5SWZE 3V6OA 1Q94A 3C60D 4IJ3B 4HCRA 4WV1A 5E95B 1CTNA 5BS0D 5KN5A 1YEGL 1E6OH 1P2CB 1QO3A 3ARFA 5JO5B 5E8OB 1J10A 1MCQA 2Z93A 5JQ6H 2BJMH 3WIFB 1VSCA 1BGXH 1T66D 4ZXBB 4QWWC 5J11C 3LDBB 1NCAL 2WIMA 5IBUB 8FABA 3M8OH 3ZT6A 4MA7L 5FO7B 1ZT7B 4DW2L 1I9EA 5JW5B 3WJJA 1AQDB 3ULVC 3O8XB 1SM3L 1IM3B 5DZLA 4GG6F 1EA9C 5EO1A 1MCOL 1LILA 3S5LG 4O2EB 5HYSB 2CRZA 1KCSH 1E4WH 3IJSA 4NN7C 3IVKB 5DTFA 2HTLC 5HHXL 5H35A 4HXBH 1Z9LA 2ICEB 5KSVB 4MJIA 4WU7A 1YEKL 3SCMD 1HNGA 2PYFB 1C08B 1KJ2B 4KRPC 3ARGB 4NRZA 3HB3C 4PRIE 5EZJB 2EIZB 1CXKA 3U30B 4GKZA 4NQED 4TVPE 3MOAL 1R3IH 2DLTA 2EXYC 4I3RL 2NY4B 3QQ3B 3N85L 1MIEL 3ZDZE 5JZ7D 5GGRA 3ZHDA 5KJRH 3D39D 5HYJD 4UV4L 2IQ9L 5GGTA 1E4KA 3O3EB 4ODXA 3VXOB 5JW4R 1NGQH 2HFTA 4P2CG 4LDLB 4F33B 4XRCA 1JI1A 3DUSA 1RJYA 4HWBA 4WW2A 1S9WA 3BXNA 2DLGA 2J8UE 5E9DE 5D2LB 2BNQA 1KTDB 2AJSL 3L3HB 1K6QL 4KC3B 3QPXL 4P4RA 3ARBA 4GG6A 2BRRH 2BC4B 1JPGA 4OZHA 3OHXB 1YY8B 4KK9C 4CVZA 3QXWA 1D6VH 4JFEA 2A73A 1Y6NR 3QEUB 2OK0L 4G80B 2W9DH 3F6LA 4OB5L 4JHWL 1R0AH 3S8WA 4NYLB 3K1DA 1KUMA 5JOFB 2FD6H 2V7HA 5IW1B 3W0WB 3OR6B 1IGYA 2CUMA 1RU9L 5A3ID 3CAFA 4CBPA 2ATPA 5C0IB 4LSRL 3MNZB 4JHAL 4IRSD 1AO7B 2XPGB 4H8WL 2EDFA 4KAQH 1CFBA 4Z7UE 4IRZH 4RISL 2OMNA 3HRPA 5KSAD 2B2XL 4Z0BL 2FYYB 2XA8H 3HI1A 4G42A 1YPZB 4J3XA 5D1QB 5LXGL 3QG7L 4KUCF 1KJVA 3GBLA 1QUNA 1SQ2N 2BHUA 3MCLH 4ORZC 4C56A 3CFBB 3VI4F 3QA3B 1EEZB 3VWKD 4W81A 5KBNC 1S5HA 1AGFA 1T4KB 3VRJB 2XWTB 1CGUA 3WLWC 2IH3B 4R26L 3GSOB 3AMLA 4PPTA 2PTTB 4UNTA 4L8BB 1I1YA 2VL4A 5T3ZL 3EIFA 4KTDL 4L9DA 1A1MA 4GBXD 3H7BA 1DQMH 3BQUA 3F7YB 4HGMA 4QRPB 4D9LH 5IQ9B 5EU3A 3UTSE 2IPUG 5KVDL 2DYPB 3BIAX 5ALBL 4LPWA 2IANE 3IFLH 3BO8A 4M1CD 3QUYB 2Z35B 1T0MA 4JM2F 4OFKA 2BNQD 2GSIB 1T2QH 3EGSB 4GG6E 5IBTH 1ZA3A 3S34H 5FUOL 2AI0L 5DI8B 3AY4A 1VERA 2LV4A 3PUCA 5D7IE 5AZ2L 3S5LB 1M1SA 4QHUB 4PG9A 1G9NC 2I9LA 2AKRA 1CYGA 3H9SB 3GSNB 1AY1H 1JGDB 5DHXB 4OLXL 4FABH 2BOBA 2BY3A 2EDEA 1DLHA 3EAKA 4KTDH 3U4EB 1T5WB 3PJSA 2NYYD 2X4NA 3FQRA 4D0CA 5IOPB 4HV8B 3ZMRA 3HUJB 5DD6B 3WJJC 2BNRE 4QF1B 4M43H 2OLDA 1P2CA 1QO3B 3OJVC 1T2JA 1EMTH 2ZSWB 3HFMH 3M07A 4RX4D 3P4MA 3P9MA 3BRGC 2QHLA 2FIKB 2AW2A 5B3NA 3O3DB 2OL3H 4HJJL 5JORA 2QQKH 3BWAA 5D5MA 2VC2H 5E8NA 2CUHA 1TIUA 4DFHA 4DKFH 2PETA 2R0ZL 3GSQA 4I2XB 4NT6B 4M6MH 5FYKE 1IM3A 5DJ0B 1P4BL 4HDIB 4NZJA 2R69H 3WYRA 5HHQA 1BD2B 5DT1L 4DVBA 1MRDL 4NQEB 3TA3A 3KR3L 1U58B 2QSQA 3QXVA 5JMOC 2HT4C 2CK0H 4MA8L 4HWEH 1EGJA 3QQNA 5BRZD 3FQTA 3SE4C 1QRNB 1D5IH 4OT1H 4PIRF 2FH6A 4DKEL 1JK8B 1WWBX 5JPMA 1TZHA 4WFGD 3P30H 1VKXA 3AVEA 2VNCA 4JAMB 4MNQE 4OI9A 5FA3B 1H3XA 2NY7H 1ONQA 3EOBB 5HHPB 2OJEA 5J06A 4JO1L 1DQTA 3PHOB 4NZRH 4ZFZB 1HCFX 1MIML 5EO1B 5HYEA 4L1DA 3VXUA 1KPVB 1MJJA 4Z6AT 1EIBA 2R4RL 3MRGA 4YZFE 5F1NB 4ZXBC 5ABDE 5CJXA 3ULSB 3BDYH 3WSQH 1W0VB 4QRPE 3SKOA 2GSGB 4PGCB 3DMMC 2ZSVB 2BC4A 5IWLA 2YD6A 1KLGA 1NC2B 3CFIC 5J12B 2GJ6B 2OMBA 3HAEH 2H1PL 4JFFD 5LGJA 4IBLT 3MSPA 4JFPA 4Z7WF 2HA1A 4I0PB 2EE3A 5DJ6A 5EIVA 4MJ4A 3HZMA 2WZPD 2GEEA 2J12B 1OF2A 1WT5A 4LCUA 3ARGD 5FYJH 3EYSH 1HDMB 3B6SB 5AAMA 3VRLE 4PR5B 1I9RL 1UJ3B 1YA5A 1N2RB 1KTDA 2Z0BA 3VH8A 3VGBA 4NRYB 3QIWC 4HG4K 3ARDC 4NKDA 1N64L 5DHVA 1LE5B 1U92A 3K2MC 3HC4L 4HUNB 1QBLH 3O6LH 4U3CA 3LRSB 5L0QC 2CKBA 3HZYA 4Z7VB 3RUGF 3REWB 2XG4A 3KDMB 3GSRA 4LARL 3O0RL 3HRZA 1PY4A 1NLBH 2K9UA 1RU9H 4GXUN 4QRRD 1UQSA 1S7UA 2BVQA 4HKJB 4XCCH 4KHXH 4ZS6D 5EN2B 1QLRB 3NPZB 5BZWB 5DJYA 4N0UB 4G8GB 4NKIH 2EH7L 3QRGH 2JK5B 2P8MA 2O93L 1NMCB 5TE7H 3G6DH 4ZOBA 2ATPB 5C0IA 3NIDF 1ULVA 1E0OB 2B7DT 5GS3A 3W9EB 3GGWB 1CXHA 3RVTD 3I75B 2CLVB 1G7QB 4NZTH 2WBJA 3PHQB 5KZCD 1DSFH 3DVNA 4PJBE 1A6TB 1EZVY 3TH4T 2GITB 5CJOH 3ZDZF 2EC8A 3MRHA 1OL0A 1W8OA 5ICXA 3T77A 1BM3L 1XFPA 3U46B 5DGRA 4E9LA 2ADFH 3WE6B 2VERN 4XZUB 2ZKHH 3AM8A 3F7PC 3O3AB 5K59F 3B43A 2VDQL 4O02L 4GRWH 1DVFD 3L3KA 5IFHH 1J7VR 3RL1A 3NFPA 1A4KA 1S7SB 2EDJA 2CXKA 1KEMH 2EDTA 3HE7D 3QUMA 4HKXB 1QOKA 4OLZL 5DO2C 5E2WH 2IG2L 2OSLB 5DD6A 4JFYA 2JB5H 3PQYD 3QR2A 2JLLA 1QKZL 2X44D 4GKOA 4M6NH 5I73B 3T1WA 4L8DB 3RDTD 4JZOA 5D9SB 3EGSA 1X7QB 3MRRA 4XVTH 3C5SA 5CGYC 1PZ5B 4NO0A 4JJHA 1HQ4B 3OKLB 1RJLB 3RWJB 4QCIB 1LDPH 3MLSL 4HKBB 1A6WH 1ZT4A 2X4QA 3GKWL 1J8HE 4YZFF 4D0BA 5HTSA 3MBXL 5EBMA 1IC7L 5DWUL 2ZCHL 3CVIL 1J1OL 5IFHL 1O7SA 1OPGL 3NCEB 4WU5B 4JFEE 2QQNH 1HH6A 1CDIA 3MRIB 4A6YA 4ODHL 2YN5A 3FQRB 2CR3A 2AABL 1MJ8L 3KGRA 4Z76A 3OXSA 4Y2DB 4U1KB 5JW3L 3K4ZA 4QY8A 1KJMB 1PJ9A 5ITFB 5DQ9A 1H8NA 4F8TA 4YDIH 3V4VL 3GK8H 1K3ZA 4AJ0A 2FDBP 4WWKB 4HUKB 2EE9A 5ESQB 3QDGD 4NM8H 4ODWA 4RA3A 3WFDL 3OAZK 1U93A 4LRNL 1NGXA 3GO1L 5L7XH 1E4KC 1XIWA 3G6AB 5I1AB 3ILQD 4WIQA 3KLDA 5AYUL 2ZOLB 4JFDD 3F58L 5CUSH 4AL8L 5AUMB 1WK0A 2H8PA 5HHQB 1UM5H 3UBXG 1EHNA 3KLHD 2NY0D 3KYMA 1WBZA 1JWSA 4YC2B 2OYPA 2V2WB 3T2QA 5KSBF 2BSED 1FNEA 2ORBL 2D4FA 3SE9L 3SDAD 3P0VH 1IC7H 1GPOL 1UWGL 3D39E 4WW1A 5HYJE 4XVUC 5JHDE 3FOLA 2DKMA 2P5EA 4FQHB 4NWUL 1HI6A 2XA3A 5J7CC 2EYTB 4KROD 5D7JB 2Z93B 3ULUH 1BZ9A 5T33H 4OCXL 3HZMB 3C6SA 1F3DJ 4X7EC 3T4YB 1CZ8H 5DXWA 1I7RA 5MERA 2EYSB 4M3JA 5IT2L 1I85C 4P9HL 2COQA 3UTSA 1KPVA 4JN2A 5FYKH 4KI5E 1S7QA 1QPXA 4RAUA 4KZEH 3B3IA 4FFYL 4GFTB 4Q6IC 4Z7OE 3ARFC 1BFOA 1SBBA 2P8LB 4MQSB 1NUGA 2XOTA 4DK6A 1CF8L 4K3EL 5B8CA 3I2CH 1T2XA 2CKBB 2VISA 3QIBC 4NZDA 3JSSA 3K4AA 4I0PA 2Q8BH 3RHWF 1J87A 5F21B 4UV4H 5BRZB 2AQ3A 5JXAL 3DX7B 4V1DD 3T0ED 4GKZB 4LCUB 2VLMD 1KN2L 1RHHB 4KJPD 3VA6A 4PR5A 4ZUVB 1RI8A 4ESKA 5C0ND 4KZEL 5MEQA 4DCQA 2X05A 3I9GH 4FNLL 3ULUL 4WJ5B 4OGAC 4JRXD 4EDXA 2ERJB 4H1LG 2QR0A 4G3YH 5ALCL 2VDLL 4PRDA 2NW2A 4MWFB 3EDFA 4XHJD 4LK4A 2V9RA 5FFLA 1HN1A 5TH2B 3ARBB 5BW7A 5F1IA 4HPYL 2CSPA 3VDCA 2A73B 3QEUA 2B8OT 4GXUM 2NY5H 3TIEB 3OTTA 3MNWA 4S1SH 2YD7A 3UYPA 3OAUL 1DVFC 1MRCH 1QSEB 5IV2A 1MFDL 1DE4A 3GMMB 2DL9A 3ZKXC 4KMLB 2JELH 4KY1L 1YEDB 2BDNL 2B1AH 3ARBC 3ARQA 2NY2B 5I1EL 3OJDA 5TDPB 3KJ6H 2E9WA 3QCTH 4FZEH 2EDQA 4RAVA 3T1FB 5HPMB 2JIXD 1RIHL 4CRPA 5D7KD 2F19H 4KRMB 2I60L 3D9AL 5LQBH 2V2XA 2EIEA 3GMNB 2XPGA 3TN0D 5D8JL 3HE7C 5DLMH 2BRQA 5EU6E 4RWHA 3VG9B 5F7FA 5F71A 1Z9SA 3GSXA 3U36B 1RUMH 1GZQA 5DD0L 3ZKMC 3CSPA 3IJHA 3RWJA 2FHFA 2VAJA 1ES0B 3FL7A 3IDYC 3TVMB 4GAFB 3RGVB 1FL3A 5IESH 3ILPA 3KPRB 5I8CA 5I1GH 1DBAH 1XGPA 4XVTL 4XNZB 1FRGL 3IFNH 4Z0XA 3NCCB 1ZT1A 5DDHB 1DQJA 1MI5E 5I2IA 2NXYD 4FQPA 1JWMA 2ITCA 4UIMA 1OB1B 2OXHA 3TA3D 4DKDC 5F3BA 3WUWA 2IBBA 2XN9B 3G5XB 1EX0A 4DVRL 3ZKSD 4U1KA 1RIUH 2ZCLL 3RRQA 2F58H 4KKBD 3RY6A 2PO6D 1QBAA 1OTUC 4OIIH 1VACA 3CX2A 3HAEB 2BVPA 2NY4C 1KN4H 4MGXA 3CX5K 1I1AD 1R5VB 3WKML 1XGUA 3TN0A 2FEDD 5J3HC 2JF1A 1FAIL 3ES6A 1RZFL 2DQDH 3ULUF 3DXAD 1N5YH 5C9JA 1U8IB 1NGPH 4HMDA 1Q1JL 5DI8A 1T83C 3WDJA 2C3XA 1OAZL 4X7DC 3KYMB 5DR5L 2EE2A 1RZIA 3PWLA 1QHPA 3V4UL 3TBVA 1FBIL 4FHBD 3UTZA 5ESQA 2X4NB 3SDYH 1ZGLP 4DUXA 3LEVH 2JCCF 1EGJL 5C0JA 3MLTB 3UO1L 1NMAL 4G6ML 4QF1A 1DANU 1GVIA 3QSKB 5CZKA 3EUUA 4DKFL 2X70A 4BZ1L 2RIKA 3E8UL 5HGDB 1I8IA 3CMOH 1EBPA 2VDPH 5A2FA 5T5FL 5EOTB 1JF1A 3C6SB 2ORBH 1NAMA 4H1LB 5C86A 4HIEB 4JCLA 3RIFF 1YEHL 5FYLH 3BP5B 3U0PB 3BKYL 5FECA 3RVUC 4XP4H 4XMPL 3RKPA 3LPWA 5JHDA 2HFFB 3RUGA 3VWJB 4NQSB 2E27L 1HINH 4PY8J 1FZKA 4FQCL 2CR6A 2HRPL 1AGCB 4KKAD 2MKLC 5E08L 2AXGB 4HPOL 1II4E 5TDOB 5I0DA 3LN4B 1G7JB 4Z8FL 5IJKA 5GSRB 1JNLL 4HFWA 5I71C 4L3AA 4LLWB 1INEL 4KUZH 5DYOB 1QFUL 4NN6B 3A6BH 1F4YL 1QRNA 4IRSB 3BQUC 4UTBL 3LN5A 2VO5A 2ATKB 3SE3C 1MI5B 4XCFL 1P5UA 1GAFL 2YBRA 2AK4D 1EFXD 3DO3A 3L5IA 3OWEA 5T1DH 3DX6A 2Z31C 1GGTA 1D5BA 5HGHB 3V5HB 5DVKA 2G75B 1MSPA 4JANB 4LLQA 3VXMB 2AJXL 3MJ7A 5IQ7H 2PW1A 1F02I 4YHMH 5D72H 1HYSC 4MYWB 2ZKHL 1GOGA 1AXTL 1C5CL 3O3BA 4W6WB 3OKDB 3WEXB 2XKNB 4FQQA 1KYOJ 3O8XC 5C0GA 2PTVA 2A6KB 3S36X 2W38A 4PREB 1JPFA 3MRDB 3PGCA 5E5RB 3QUZA 4FZ8H 3PP3H 2JJTC 4MDIA 4ZUVA 1LP9E 4ZUSA 1JZ7A 5F8RC 2P8PB 4IOIB 4JFXB 5HBBA 1UCBL 4NC1E 4MNHA 4EBQH 2IWGA 2PCPB 3ARBD 5IHUL 1TQCB 1N5AB 4YQXL 1LO5A 2H3NB 3ELAT 3ZO0A 4L8SC 1PKQE 5I73C 1IAKA 4XPGH 4Y4HB 4DGVH 5JW4N 3RTQA 2F54D 3A6OA 5I1CL 5LCVL 1NBVL 2F8OA 1VENA 1LE9B 3QWRD 4KVNH 2X89D 4M7JH 4WEMB 2RCSL 1PGRB 3TYFA 5K93A 3D0LB 3V9FA 1MCBA 3CJJA 4YDLC 4LOUD 2ZUYA 1DUYA 4LNVA 5TGBA 1H3TA 3MCKA 1SYVA 1NFDE 1BVLB 5FKAA 5TJWK 5ITBH 3K8LA 3OAZH 2R2HA 2JJVA 1DBBH 1ZS8B 5BJTB 1A9EB 4QXUH 1YEGH 2G9HA 4POZD 5DD3H 3VRLF 4I48A 3NIFF 1KB5H 1IE5A 4N0UA 3EFFB 3GJFA 1IGCH 5ILTL 5I2IB 5EZLB 4GAJH 4M6ML 1QRNE 5FCUH 1KSRA 5J89A 2GY7B 3VMPA 3UDWA 4FQXD 4M93B 1OD9A 3VFWB 5DRZA 4XP5L 4H0IA 4ETQB 1Q9KA 5I9QC 4ONFL 2EKJA 1ZSDA 2XV6B 5D7IA 3RHWK 3ZE1F 3LN9A 4QTIL 2ENSA 5KAQG 3GSXB 4P23D 3N1MC 4BM7A 3EYUH 4G9FA 4X7SH 1HQRA 4RGNE 2GAZA 2C9AA 3RGVA 5TDNA 1JMXA 2WM0A 1MHHB 3CZFB 4JFFA 4LCCB 3SO3C 2J8HA 5ESVB 5IWLC 3X3GL 2X09A 3L6FA 1CLZL 4Q9RL 5MENE 1MIMH 4OLZH 1Z5LA 4WHYH 4HCRH 3BPNC 1A7OH 1LP9A 4G8GD 5DHYA 2JB5L 1G7MA 4NKOA 4ZTOH 1P4IL 3C8KA 4HUUB 4K7FA 4NUGH 3VFGH 4HKXA 3NABL 3NTCL 2Z8WC 3SDXB 2E5EA 2VLJD 5CILL 4NN6C 1UM6L 1IKFL 4XMLH 5CEZH 4GRMB 4P3WA 1BZ7B 5A3IC 5LWYL 1WZLA 3QIWA 4NO2B 4XP5H 3DETD 4JPVL 4KK8C 3L95A 3WHE1 2OQJA 5FKPA 3UAJC 3B9KA 2VDML 1FP5A 4Z7WE 4WEUD 4HKBA 2E7LA 1VGKB 4UU9B 5I1IH 3GB7B 1ZT4B 1IM9D 2RGSA 4PJ5E 2O5ZL 3AAZB 3NAAL 2XNAB 1NMAH 4G6MH 1YDPB 3RUGB 3TFKC 4KAQL 3ROOB 2ZUXA 2LE9A 1G7PA 3WO3B 1A9BA 1MFDH 1KIPB 4QNPE 2FO1A 1FGNL 5L88L 3O4OC 2EO9A 1B2WL 4KK6D 1G7JA 2CRYA 2YC1A 1HINL 3C8HA 4CGTA 3ARFB 4XWOD 4KQ4H 1GHFL 1ZLWH 2OJZH 4PJBB 5KS9A 3BN3B 3OAUH 4LMQI 3TCLB 2NY6D 3B5GA 4KI5C 4HIEA 3MJ8A 5D70H 8FABB 4IRJC 2OP4H 3AS0A 5CP7B 1ED3A 3X12B 3FQNA 4IOFD 2X1WL 1AD9B 2JB6B 4FXGA 1L9NA 3OV6A 3LKOB 1U3YA 2HTKC 3PL6D 3DX6B 3LHPL 5HYSA 2NY6C 3Q1SL 2I9TB 4KJQD 2UZXB 4H88L 2O5XH 5GRJH 3L3GB 5C0DB 4Q9RH 4FXKA 1CD0A 5FYJL 4PV8A 2NMSA 5DYOA 4Z18A 1OAKH 2ADGB 2K3TA 4O2EA 5F89B 2VXQL 5ICYB 1LO3H 1T7ZA 2EIZA 1QFWI 5C07A 3ESUF 4IRSA 3CNKA 3PABB 2HRLA 3OXRB 4HAFA 2M26A 2EEAA 2NX5B 3LZFH 1PW3A 5EZJA 5A2LH 4ZUSB 1TETH 5C0BE 4WUKH 4BH7B 4LF3A 4RGOL 1AJ7H 2ICCA 1AFVL 1XGRA 5IB1A 5GHWH 4I18B 4D94A 2X89A 1B0GA 1AQDA 2ESVD 4Z7WA 4FQLH 5JHLH 4Q9QH 2OTPA 5EA0H 3FHAA 1ADQL 3PP4L 3N85H 3OKDA 4K3GA 4X8XA 1X5HA 3RIAK 2UWEB 2DWEA 3IKCB 2XI9A 5EC2A 2UWEE 3BKJH 5TQ2H 5D7IF 1R6VA 1HHIA 3QEQA 4AM0A 4PJAF 2BX5A 1A14H 3KHOA 3MREA 2UUDK 3MODH 3O2WH 3UJIL 4E41E 2CKBL 3UPRB 1I1CA 4OLWL 2IFGA 4P57A 4JM2B 1A7QL 1CQYA 3I3EA 4H26A 1ZLWK 5I1CH 3UTQA 2HWZL 1DUZA 2H2PC 4ELMB 2DI9A 2AXFB 1WEJL 4ORGB 1EFXB 4Y4HA 1NBZA 4FQJL 4LEOB 5GISH 4I0PC 3VJ6A 3H9SD 5IEKB 1VDGA 3LMJH 1JWUB 3PG2A 4ETQA 4QYOA 1CWVA 1FVEA 4JN1H 3RGVD 4XBGA 2N7BA 3V52L 5IB3A 4ZUWA 4JJ5A 4AQOA 4UNVA 1KB5L 3KPNB 1M7DA 2XA8L 3LIZH 1G6RH 1S9XB 3PIQB 3WHXB 1DANT 1KXQE 3HPLA 3TNMA 3MRMB 1A9EA 4RMSA 4MQ7A 4JPWH 2BCKA 3T0XA 3GIVA 3QEQD 5JZ7C 4YUEL 3O9WD 3WJLC 3I50L 5CZXD 3GJFB 5CS7A 1F90H 1WBYB 4DKAA 5GPRA 1JMZA 1CLYL 3ROLB 3DUHA 1OWWA 4MS8C 1EHAA 4U3HA 2IBGA 2BOCA 1CLOL 2FLRT 1RD6A 1FG9C 4M03A 4XTRC 2B5IC 2FL5B 1BVKA 2EH8H 2IAMA 4X6CE 2H1PH 3HUJF 3WV0A 1JZ6A 1I85A 1RK0A 5JPNA 4Y8DC 4XCFH 1HXYA 5EU4A 1N3NB 4ZTOL 2AI0H 2ARWA 1U8OA 1BVZA 3FCTA 5A16A 3X13B 1WLHA 4MD5A 3PP4H 4QLRA 5HI3C 4E42B 4JPKL 2BXYA 4FS0A 4EVNA 2AXHA 5T1MB 1YNTA 3BP7B 3ARZA 4YHOH 4P2QB 4R4ND 1T0MB 4F2MB 1NBYA 2CQVA 5TE6H 3TV3L 3QEQE 3I6LE 5BVPH 5DC9B 3AMKA 3E1F1 1S9YA 1KCSL 3MRPA 1A2YA 3KJ4B 1QD0A 2FJHB 3IAPA 4PJ7F 3IS0X 4NKQB 5D7LD 1KLUB 5IVXB 5T3XH 3S4SA 3DRTB 2Z4QA 4WO4D 1T5WA 4MJ6B 3V5KB 4OZGB 4FQ1L 1UJTA 2P5WE 5J57B 1YYML 3FT2B 5JDSB 4L4JA 3HC0B 4NC2B 4NQUA 4PV9A 4OKDA 1JYVA 3F12B 4CADB 3JVGA 2APWA 4QRRE 3C08L 2XQBL 5GGVY 2C3VB 4TOYH 4CL7A 3OKNB 4FXGB 3ETBF 4C4KT 3QUXD 3KPMB 1NSNH 3BIKA 1ZGLM 4XPFH 3Q0HA 4HT1H 2NW3A 3OPZH 3KS0H 3I6KA 3RNQA 2AV7B 1SJEA 2I27N 3TLRA 5LCVH 5EORL 3TA3B 4M62H 4Y2OA 2HP4A 2ZG3A 3LVEA 5ID1B 4I18C 4OKVB 1BOGB 3QXAB 3V6BR 4ZFOB 1JPSH 4O2CB 5CBAB 3KXFE 1TZHB 3GJFK 5CP7A 2X70B 4HUXA 1Q0XL 3BSZH 1B6UA 4GG8B 1OAXL 3LD8C 3K8MA 3A67L 2F74B 4EI5A 1WZKA 4EOWH 1L6XA 4WFHE 3U1SL 3MYZA