5CZVH

Crystal structure of notch3 nrr in complex with 20350 fab
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
216
structure length
206
Chain Sequence
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYTISWVRQAPGQGLEWMGWIKPRWGAAHYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGSFWFGYWGQGTLVTVSSASTKGPSVFPLAPALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neurogenic locus notch homolog protein 3
publication title Characterization of activating mutations of NOTCH3 in T-cell acute lymphoblastic leukemia and anti-leukemic activity of NOTCH3 inhibitory antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 206
sequence length 216
ec nomenclature
pdb deposition date 2015-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5czvH01
2G60H 1N8ZB 3QEGL 3D3VD 1QRND 3RWJA 4AENA 4LRNL 1A7PL 3HZVA 4NBZB 4PJGA 4PJEE 4C56D 4FXLA 1GGBL 4PJ8B 3VJ6A 1HWGB 3AS1A 3RL1A 4NZJA 3QG7H 4JR9H 1YNTB 4RGNB 4G9FB 3TH4T 3VXRE 3EOAA 3RDTB 2AXGB 2XKUA 3K8KA 5BOZG 3RAJL 4KMTH 2NY6B 4BFEA 2FJGA 4JRYE 5HI4C 3VFVB 3UTSD 3MV7B 4HFWB 4YHZL 1ZGLM 1G7MB 4JY4B 3QDGB 5DF0A 3BKCL 1MFDL 4LASH 4XVSL 4I2XB 3W0WA 3HI6L 5FOJA 4QYOB 1YC8A 3CFKB 3F7VB 4JQXC 2HJFB 3O3DB 5CBAA 3U2SB 1AO7E 2G75B 1F90H 4LVHB 4A6YA 4HPYL 1JK8A 5IB4B 1CL7I 5JXAL 3V0WH 5ESQA 2Y23A 3VFMB 1CR9L 4P4KC 4C83A 4QLRA 4GRMB 1MHEA 4KI1A 3KYMB 4NN5C 1CFNA 3TA3A 1JPSH 1J0KA 4PJAF 4KKBD 4MAUL 3M45A 2IFGA 5FK9A 5E6ZA 1FNGA 5AD0B 2X6MA 2X70A 3QA3A 2AXJA 1XGTA 4MHHI 3WHE0 4JFDE 1J1PH 4YPGB 2VLLB 3TP4A 4KRPB 1HHIA 4WHCA 1KBGL 4Y4FA 4KRMB 3OAZK 4PJIB 1T04B 3B9EA 1KYOK 3S96A 1EJ6A 5C6PB 3D18B 3V4VH 2F58H 2IWGA 2GJ6D 1D5BA 4RFEA 1FFPB 1DL7L 4ODXA 4PJDB 2GT9A 4NQCE 3KPOA 3Q0HA 2AP2A 4NO5A 1NBVH 4FMKA 5EN2B 3REWA 4KAQL 3PXHA 3BT2L 2AAVA 5I1CL 1JP5A 3BE1H 3IJYA 3O45A 2D03L 3C8KB 5HYJB 4S2SA 3T3MF 3F62A 3SJVD 4EDXB 2DJUA 2A6IA 5DO2C 1YUHA 2XA3A 2QQLH 4JG1H 4RRPG 3CMGA 3P11H 5DA0B 3MRNB 5D1QB 1FG9C 1DSFH 4M62L 1HHKA 4AH2B 5FM5M 1JMXA 2XZCL 5FO8A 4HUVB 1AFVH 2X7LA 3O6KL 3MLSL 1JNJA 1KUMA 1MEXL 2UVEA 4WO4A 4XBEL 3KYKL 5E8EA 4UIKH 2GKIA 3GHEL 5LCVH 2MJWA 3S88H 4YH6A 1UH4A 1NC2A 3PHQB 2NW3A 1T7WA 1NUFA 5B39A 2EEAA 2YA0A 1TPXC 1XGUB 1YY8A 1BFOB 5CZXD 1G9EA 3L95A 4MJIE 1A47A 4LMQE 1INEH 1B6UA 3UO1L 1RUPL 2NYYD 4F15B 4PY8J 1C5BH 1OTSD 1GGUA 1QOKA 3OKNA 5IB1A 4Y4HC 1XAUA 5HGDB 3NIFF 2HTLD 1LE9B 2PO6D 43C9B 4QF1B 3IU3A 4R7NA 5IJKC 5I8CA 4OD3L 2I07B 4EVNA 5F9WC 5GQBA 1MCFA 4AM0A 1IEAB 3QXTA 4JHWL 2DWEB 1K2DB 1QSFA 4P2QB 1WIPA 5DTFB 3X13B 4CVZB 3T0VA 1JPTL 4P49A 4HZAA 2NY1D 3KXFE 3EZ8A 4HT1L 4XBGB 5CJQL 1OLLA 2F53A 3ZT6A 1ZA6B 2ADIA 4JFOA 3UP1A 1SEBB 3K3QA 5F3HB 5CD5D 1N2RB 3H0TB 5ILTL 4BZ2H 3HKFA 3DETC 4RISL 1Z9LA 1QBML 4P23A 4LCWD 2EYTA 3M07A 3L3OB 4KFZC 2QQKL 4IS6A 3LPGA 1KLFA 1NANI 2Y06L 5I1GH 1OF2A 4E5XA 4HKXA 4EI6B 3CFDA 5F96H 2CXGA 3EDJA 4C4KO 1JNLL 5LAXB 5CKGA 5IEHA 3FZUC 3W0WD 4D9QD 1RK1A 3NZHH 4LFHG 3MC0A 4NRZA 4PJBE 4BA8A 4HIJB 4NOBA 1WK0A 1E4XI 4ODSL 4WEBH 3W81A 4G8GE 5I15H 2RAMA 3P73A 3V5HA 4ZUSA 1GJIA 4LIQL 3MA7B 1TETL 2B5IC 2D31A 3LDBC 4NCC2 3S7GA 4ZUUA 1P7QD 3LCYA 4MQTB 1A7RL 3S97C 5F21B 1OAUL 4S11A 1MCOH 4BZ1L 3BWAA 3BKYH 3TNNB 5GGVL 2NZ9D 5C0BA 5E2VL 4LSVL 2VOTA 4WW1B 4Y1AA 3TA3D 4D0BA 4PRHD 3OZ9H 1C16B 2NLJB 1S8DB 3DYPA 4FQXD 3C8DA 4YDJB 5I66B 1MI5B 3OKKB 5D96C 3S3JA 2X4RB 3NOIA 5HVGB 3G5YA 1S9VB 4V2CB 2IQ9L 1PYWB 1CLOH 2OL3B 3O2DA 2J8HA 3BD4A 1F58L 2DOCA 2VWEC 4WFED 3BISA 1R3IH 4J6RH 2VLJE 3TF7C 4V1DD 3L6FA 5EIIA 3UBXA 1MLCA 1AHWA 4RSVA 1G9NL 1C5DA 1EERB 4QXUL 1ZWIB 4LARH 3VE0A 4Q9QH 2J1KA 2E6JA 3UTQA 3DO7B 3BPCB 3CZFA 1A7NH 3OB0H 5HJ3A 4YPJA 2IC2A 1SJEA 3O4OB 3BPOB 5E8OB 4MMXC 2E8ZA 5HVFB 3V2AR 3BHBA 5BRZB 3QEQB 3FB6A 3S35L 3ROOA 2NMSA 5C0JB 4WW2B 1TVHA 4JR9L 4A6YL 1VDGA 2MKWA 4ZDHA 5FGRA 3VWKA 3ZHLA 1NCDL 3GHBL 2DJ4A 1S7UB 5MENB 3EYUH 4TPRH 3PWVA 3SDXE 3LKQA 2DWDA 1LK3H 2Z92A 4NN5B 1HH9B 5E5RB 4PRDB 2MWCA 5EZOH 4JFQB 5IVOA 4GBXA 4GW1A 4L3AA 1UZ8A 5DS8A 3GSNB 5JHLH 5IVXE 1ODAA 3MRMB 4QGYA 3S4SG 1NC2D 3N1FC 2EDQA 1T2QH 2EIEA 3PP4L 4YZFF 2W60B 4LF3B 4NHUB 4XCYB 3VH8A 1T3FA 4N1HB 2CLRA 4FOMA 4PS4L 5I1IH 1MAKA 4MVBD 5BS0E 1AQKL 1Q1JH 4K3DL 4C54A 1WITA 1ZHLA 3EYQC 4P5KA 3GRWA 5DD6A 3SBWA 4LLUA 2VXUL 4OM0L 2GAZA 1JWUA 3BO8B 3NZ8A 3UDWC 3VXSB 1A1MA 4MWFB 5E6IA 1KPVA 1C12A 5E8NB 4H0IA 4PRBA 2M26A 4PRIE 3WIIH 4XCNA 2XIDA 5MEOA 1J1PL 1U93B 2I25N 2PCPB 3NCYP 1QSFD 2IFFH 4ZSOB 2Z8VC 4TTDC 3IB4A 1FVEA 1Z2KA 2J5LC 3B83A 4R3SA 1FSKC 2IG2H 1E4WH 4PUBH 2YZ8A 4OZFG 5ITBH 3ULVH 2FBOJ 3VI4F 2GJZA 1QACA 5C0RH 1KN4L 2OMBA 3SDAB 3ROLA 4KPHL 5EO0A 1PQZB 1TDQA 2HJLA 3A67H 5IF0A 1VKXB 1EJOL 3QQ9D 5GSVA 2KUTA 1BEYH 5C0GA 4FABL 3G6AA 5IUSA 2ADGA 3QQNA 5H35B 3MNZA 1FL6A 3KYOB 3HUJB 1MHPL 5IB3A 2IF7A 3HMXH 3ILPA 4QRPD 1RIHH 3TESA 3IDXL 4LGSB 4UDTB 5GIRB 5L9DL 3KDMA 4XVTL 5K59E 2CD0A 2DM4A 5DZOA 4R4BA 3P11L 1DSFL 4Y16B 2O5ZH 2XZZA 3CFCH 1CTNA 5J13B 3ULVF 1I8IB 2WUCH 3GMRA 1WVZA 4Z7VB 1AFVL 4Y4HB 5EDXA 1LEIA 2PTTB 4Z9KB 4EOWH 1QEWB 2WWKT 1N5YL 4KHTH 4R9HA 4HWEL 1FYTA 5I1JH 4I0KA 1NH6A 2VIRA 4KKBC 1ED3B 3MJ7B 3RVWD 5F7HA 4JPKL 3N06B 1NGQH 4IRSB 1DN0A 5C0BD 3U0WH 4WFFD 3D85A 2PETA 5LBSL 3HZYB 5HHOD 5F7UA 1INEL 4PBWD 1CDJA 4W6WB 5KW9H 3MLXH 3DXAA 4NN7B 3VD4A 1SJVA 3C6SA 3X17A 3CFJA 4RGND 2FO4B 5D72L 5FO9B 4WI2A 3LD8C 2DQFB 5K33A 3NAAH 2HVJB 1YYLH 1HQ4B 4UDUB 2A73B 3MOBH 3OKDB 3FQNB 3NCCB 3LS5H 4P99A 3T0EA 2GJJA 1IGML 5FKPA 3U7YL 4CBPA 4OIIH 3W11D 3ZSSA 2XWTB 5IQ7H 5K9OB 2J8UE 1XGQB 5DLMH 3E6HA 3OX8B 1A6ZA 4PJ9A 5DFVD 1EDQA 3D5OF 2X4NB 4OFVA 3HG1E 4BZ2L 1KGCE 2VL4A 3KNBB 5DJCB 5C0CE 4ZFFB 2B5IB 5F1NB 5FYLH 2B4CL 4O2EA 1FO0H 3V6ZB 1RJCA 1RI8A 2J6EA 5IHUH 4RA0C 2EH8H 4FG6C 1B2WL 4L29B 5FDWB 4UILL 4FFWD 3JTTA 1XF2A 1QSEA 4IEFB 3VXOB 4NO0A 5ISZB 4XZUB 4GBXD 5CZXC 4JRXD 2P8PA 3NZHL 3ET9F 2X1PA 5D96B 1BVZA 2R2EA 3QR2A 5DUBA 5KJRH 2VXSH 1CU4H 1EX0A 3IDJB 5D71H 3CMOH 3EFFB 3SCMC 3OAZH 4QTHB 4YHOL 3WCYA 2BMKA 1OTSC 3QRFM 3ARSA 4HC1L 3VG0H 2FLBT 5KSVA 1S3KL 4F9LA 2XN9E 5IVZB 3QDAA 2FX9L 4HS3A 2VDQH 2ZWLT 2G9HA 4UTAL 5C0AD 4CMMA 4E41A 3WL9A 4X6DB 2E6PA 3BKYL 1I9JH 1IKFH 4AZ8A 4KC3B 1A9BA 2CIKB 3VRJA 1NSNH 4YHLH 3I9GL 2LAAA 4LQFH 3V9FA 2RR3A 3V6FB 2NY1C 5I16B 1P4BL 5D7LA 2DLIA 4M1GH 3G5VA 4XBPB 2XRAH 4PJFB 2HG5B 3JWOC 3MV9A 1JJUA 1FZMA 2OMNA 2XPGA 2YD2A 5CD5C 4HHAB 4OCWH 5EBLB 5BZWA 3MJ8A 3QHZL 1MCIA 5GZNC 1R3IL 1T0MB 3LKSB 4OGAD 3P9MB 1F4YH 2EDEA 4J6RL 4XCEB 1I4FB 3U1SL 2WP3O 3IFLL 3MV8D 3HA0A 5CSBA 1AXTL 1FFOA 3VXTA 3HN3A 3D0LA 2NNAB 3B8SA 4L3EE 4DJMA 4Q9QL 3I6LD 3PWNA 4PJHB 5FV1L 1WLHA 3WNLA 3LS4L 4L4TA 1IMHC 4CL7A 1Q9KB 3U9PH 2HRPH 3LSOA 3NA9L 2OK0H 1BQLL 3QIUD 3TBWB 4JJ5A 2BVQB 4DVBA 1KXTB 3ARZA 3FT2B 1FL5B 1Q0YL 1X4YA 1DANT 4QRTA 1RK0A 3ULUC 5KVFH 3T65A 1GH7A 4MZ2A 3EO0A 4PJXB 2AXHA 1XGRB 5I75B 2VERN 1J8HB 4NQUA 5BV7L 1LILA 5I76B 1BZ7A 1PLGH 4G42B 3F58H 2DF3A 2QADD 3WIHA 1WBXB 3KPSA 3UTTD 2RQ8A 1D5XB 4PRPD 5F9JB 3QIBD 1EVUA 2DTMH 2GFBB 3TA3C 2XY1A 4G7YH 1T2QL 2ZCKL 3FMGL 1FAIL 3EDEA 3P9LB 1OAZH 4NRXB 3MBEB 5IIEB 3ELAT 5DJ8A 5ICZB 2IPUK 4L4VA 2BHUA 5DHVH 2B1AL 3W9EB 4U0QB 3TBVB 1JPST 3VI3E 3C09C 1CE1H 2DKSA 3DXAD 3TPUA 3VDAA 4JZJA 4FQHB 3D6GA 4OKDA 5FYJH 1XF5B 1MCCA 4LLMA 4CADB 3KR3H 3FONB 4LCIH 3IS0X 3QZWB 4PJCE 3UTZA 4JVPA 5CEZD 3CVHH 4P46B 2YEZB 4D9LH 1HNFA 4WTXA 3BW9B 1TJGL 1YMMA 5D2NC 3W2DH 1A14L 3CH8A 3DV4B 3OAUL 4GOSA 3D87B 1HXYA 2IANE 1JWSB 2IFFL 5E70A 4Y5XB 2E9WA 1OLZA 3MYJB 4PUBL 1OW0A 4KI5E 4ZUVA 4CN4A 1BM3H 2ZG2A 4PJ9D 4LKCB 5C0RL 5C0DA 5I2IA 2Z4QB 3DUUA 1N0XH 1MQ8A 1U8LA 4DK6A 2DMKA 1BEYL 2O5YL 5FYKD 5E9DD 3UC0L 1T21B 5C07A 4FP8H 1CCZA 1NGWA 3BQUB 1MWAA 3QUMA 1TXKA 4NFDA 4NQEA 1KJVB 5DEGB 5I1LA 4U1NA 4LQ1A 4F37K 2R1XB 5DJ6B 4OD1H 3LKNB 2GTWA 2AJ3A 3IXTB 3RIAK 4OLVH 2EDWA 3S98A 4URTB 3V0VA 4K8RD 2O5ZL 3OKOB 3C5SB 1ZVYA 1RIVH 2EYSB 2NY0D 2WUCL 5SX4I 1DTUA 1JHKH 3SKMB 3LD8B 3NPSC 1X9QA 3R8QA 4L4JA 2UWEA 4UB0H 3O4LB 2FIRT 2MHAB 1NMCC 1YJDC 1U8JA 1QFOA 1R3JA 2F54E 2BNQE 2WINB 4X0KA 4TVPE 2NY5L 2A9MH 5EOTB 1VFUA 5J57B 4N0FA 3TBYB 1HZHL 4U1LA 3S3PA 4YAQB 4U1JA 1K6QL 3GJFK 5KW9L 5FV2A 1IGTB 2FBJL 4JFEA 5BVJA 1EA9C 5HVHC 1BAFH 1H3WM 1FPTL 3K8LA 5D7LD 3P30H 5AZEH 3SDCA 4DKEH 2IH1A 1RZKL 5F8QC 1W0VB 3GSOA 3IFPA 3NAAL 3L3HA 4IBLT 4OV5B 3DVNB 5B38B 4QXTB 4RFOH 1UJ3A 1QYGH 1JHTB 3QQ9C 2LE9A 3RBSA 1BOGB 2YPKA 1NJ9B 1B6DA 3G08A 3TCLB 1S7SA 4EJ1C 1OAXL 5A16B 4LCCB 4XPBL 5GGRA 3S35X 2G2RB 3MRCB 4OIIL 4WUUB 3FKUS 4ZAKD 2QL1A 5EBWB 2PYEB 3Q1SH 1VSCA 4UNUA 3QCVL 2DLFL 1DQJB 5EIQA 2W1NA 2VXTH 3RWCA 3DX8A 3FQUA 1N3NB 3RUGF 4CJ0A 2CUMA 4JHBA 1UZ6E 1VENA 4IIQA 3SCMB 5L0QC 2PXYD 3PDOA 2F5BL 1KCVH 3MGOA 4JQVA 4N8CL 1IAKA 3Q3GA 4K07A 3FFCD 4U05A 2BRQA 1PG7H 2X4PB 2XI9A 1CF8L 1G6RL 1XH3B 1FNHA 3C08H 2EH8L 1IFHL 5HDQH 1KF9B 2YMXL 3KPSD 4QRQB 3J8F7 3RVWC 5D9SA 5I71C 4TRPH 4K55A 3DRQB 3GKWH 2JJSA 4QRRD 1FGNH 4YHMH 3NPZB 5KJRL 4JFZL 4RWHA 3RWJB 4DFIA 4U1HA 3RY6A 3HZVB 2VH5L 4M7ZC 3AROA 2R0WH 4BELD 3VJ6B 1EMTH 4NZTH 3CFBA 1E4JA 2VDQL 3EOAB 3BPNC 1I3GH 5E99L 4GAJL 1KULA 4JKLA 1IKFL 3U6RA 2FRGP 4DWHA 5T3XE 4R0LA 4HIEB 1AHWC 4R96A 4XXCC 4LQFL 4KUZH 1L7IH 1G0YR 2JELH 2VZ3A 4M1GL 1W2KT 5DFVC 4OLZH 2R2BB 2DD8L 1S9WA 1I7TA 1LO3H 1NFDE 2AK4E 4MAYD 5D2LE 2O5XH 4A6YB 4S1DD 4MDJA 1JK8B 3DVGA 4YBLC 1C08A 3MUJA 1NAKH 3KPPA 1CN4A 4ZFOA 4ORGA 4RRPA 4ZO6A 5ESQB 5JOFA 5EU6A 1ZSDA 1B4RA 1JZ6A 4LDEB 4IOFD 3FFDA 4C83B 3CPLA 3D2UB 3U9PL 4GXVH 1GPOL 1MHEB 4NWTL 4FFWC 4PJ5D 5J7CC 2OK0L 1CFNB 4LSQL 3AAZA 3R06A 3RWDA 3LN9A 4GBXC 5FK9B 1I7ZA 4AEFA 1FNGB 5I1EH 4PJEF 2X70B 4NDMA 2Z93A 3QA3B 1XGTB 1IC7H 2Y72A 4QXGL 1SY6H 1PKOA 3C09B 3DWTA 3WXVH 5EUOF 5EOCJ 4Y4FB 5SWZA 1HHGA 3ES6A 5TGBA 1B88A 3S96B 4PGDA 5ACZA 2XKSA 1UWEL 1NUDA 1BIHA 1DZBA 4RFEB 4ODXB 2GT9B 5IMMA 4YUEL 2JKXA 4UT7H 5CEYA 3SKUD 2EDTA 1HOCA 4NO5B 4FNLH 5E6IC 4XNZC 3REWB 5CJXA 3D39A 2JCCE 3JBG7 3IJYB 3O45B 4FQ2H 3U4AA 1LD9A 1JHLH 4MD5A 1FL3A 3OG6B 4RCAA 1I9IL 3I02A 4RMRA 1RURH 4S2SB 4I5BA 4HJGB 2A6IB 3FTGB 1WAAE 1YUHB 3UJJH 3I75A 3VU2A 5FYJL 4OGAC 5FM8A 3OKMA 3I6GA 1HHKB 3KR3L 4K94C 4XPTH 5TQ2L 2LU7A 2WBJA 5C3TA 5FO8B 1U9KA 1U8OA 2X7LB 4DUXA 3ZYOA 3CVHL 3VFOA 1M05A 4ZUTA 4AJ0A 2H3NA 4WO4B 5GHWH 3V4PL 5E8EB 4I13B 2FGZA 3QIUC 5FHBH 2NW3B 3IAGC 4DOHB 2XG5A 4JM2F 5B39B 1OGAA 3BGAA 1YEIH 2A6JA 4PJ7E 3L95B 1TENA 3QWOA 5IW1A 3QCTH 3KPNA 4F7MB 1E28A 1FBIL 4U1KB 1A5FL 1ZMYA 2V7HB 1WBYA 4H5SA 1N0XL 1Y18A 5IB1B 4OF0A 2SEBB 3MLVL 4F57L 4JO2H 3QEUA 2EE9A 3NGBB 2R1WA 4YLQT 3IU3B 3MOQA 4R7NB 3GEWB 4EVNB 3UYOD 4F8QA 1JYXA 1F11A 1V3LA 4P59H 4AM0B 3EYFA 2BJMH 4U6TA 4JHZA 5KOMC 2BNRD 3U48A 3PIQA 4KZEH 5JW5A 2UZIL 1JHKL 1RJLB 4JM4H 5KG9A 2F53B 5CFHA 1NAMA 1VFBB 2ZSVA 2ADIB 2MPAH 4JFOB 3BP4A 3PWPE 2H8PB 3G6JB 4WHYG 3T4AA 2V5MA 3QI9A 4MX7B 3CXHK 5C0NC 3AGVA 2P5WB 4GW5A 1X4XA 2ARJQ 4P23B 2EYTB 4EDWH 1ERNA 4IS6B 1OF2B 4E5XB 2YPLE 4HKXB 5B8CC 3TZVD 3DSFH 4G9FE 2VDNH 4NQXA 3CFDB 3T0EC 1J0YA 2X1QA 5CJOL 1OWWA 4I0PD 3MFFA 1WWBX 3KAAA 1UWGH 1FFRA 1GGIL 5IEHB 4LSRL 1E6OH 1RK1B 3MV7E 4NRZB 3QDGE 4PJ9C 5L0QB 4N1EA 1KEGL 1WZLA 3P73B 4I2XE 4ZUSB 3H42H 4HW6A 4RFOL 2DQJH 4K71B 4JDTH 1REIA 1AGCA 2D31B 2X1OA 1CDUA 1OD9A 3G5XA 1M71A 4ZUUB 4RIRB 4J8RA 1XMWA 1GGCH 4ZS6D 1MJ8L 3SDDA 5GGTH 3BWAB 1EV2E 1QQDA 3QPQD 1T0NA 3FQRA 4Y1AB 2O61A 4D0BB 5DD1L 1FZKA 5DQJA 4K8RC 3TYGH 3TH2T 5E2JA 1SBBA 2VITB 3FOMA 2RBLA 3G5YB 4Z5RA 3REVA 4OKVA 1PG7L 4DN3H 2OJZL 4HJ0D 3JVGA 5LKNA 4U6VH 1SEQH 1CE6A 4F9LC 1IILE 3BZEB 2VLKD 3HNVH 3L6FB 5EIIB 3UBXB 1MLCB 4PJIE 2YXMA 1C5DB 4HJJL 3OSKA 1MAML 3P4LA 1JYVA 2H1PH 5GS0H 3VE0B 12E8L 4LCUA 3GKWL 5EU4A 3UTQB 2WUBH 4IRJA 4PJDE 4YHML 3CZFB 1NBYA 1CFSA 4KDVA 5HJ3B 2KZWA 4OLYH 5E6YA 4CGTA 2PUQT 1AGEA 4MLIA 3BHBB 5T1LD 1JYWA 2R0WL 4PTUA 4FA8A 5EFIA 1EMTL 3ROOB 1TVHB 4ZDHB 8FABA 3VWKB 3HRZA 1GIGH 4PJAA 1I3GL 5HYJE 2AGJH 35C8L 4HQQL 4OZFA 4N0CD 5GRVK 4BQ8A 1U3HD 3LKQB 4TNVK 3OF6D 5SWSA 2PW1A 2Z92B 1RZGB 3CSGA 5IM7A 4YHYC 4ZAKC 4AG4L 4GW1B 5DD3H 4AQ1B 1UZ8B 5ADOL 5DS8B 3EGSA 4H0GA 3WO3B 4OLZL 1X5IA 2ZJSL 1LO3L 1SBSH 4WFGE 3BP6A 5D1ZA 3VH8B 2GUOA 1T3FB 2V2WA 4HEME 4LCYA 2XZQL 2CLRB 4NNYB 1V7NL 5BV7B 1VHPA 2NPLX 3KVQA 3N1PC 4G6AD 5C6TH 4CW1A 2EEDA 1WFOA 5IP4A 1ZHLB 4YNYA 4P5KB 5DD6B 4V2BA 4LLUB 2APVA 1JWUB 3NZ8B 4M6AA 2DN7A 5E6IB 4XNZB 1KPVB 1C12B 1OARL 3WLWD 4KDWA 1G7QA 4FQLL 1A6TB 2HT2C 4FQPA 3KYNA 4POZD 3TV3H 4F37F 4PRBB 4QWWC 1IC7L 1ZOXA 1MCLA 3OPZL 4UT6H 4Z78A 3RIAF 4XCNB 3CC5B 5MEOB 5FF6A 3GJFH 4C4KT 5IT2H 1FVEB 1NCTA 1HIMH 4DQOH 4EQ3A 4P2QE 3B5HA 3S6CA 1KLUA 4R26H 4ELMF 2GJZB 1BQHA 3C9NA 5HYSA 4JZJC 4MSWA 3ROLB 1F4AA 1OM3H 3NABL 5EO0B 2HJLB 5IF0B 1JGEA 3GNML 2NQCA 5GSVB 3QO1B 5C0GB 2ADGB 3HC0A 4Q74A 3SHSA 3CNKA 1G9MH 4X6FB 1H5BA 5IB3B 1F4WH 3JV6A 3ILPB 2NY7L 5E2TL 1A6VH 3KDMB 1EHNA 32C2A 4R4BB 4MAYC 3H3PH 4JB9H 5D70H 4S1DC 1OW0C 3L5XL 5B3JE 1QFHA 3ZLQC 3GMRB 3VXPA 1LEIB 2CK0H 2CKBH 4DCQA 3UPCA 5TPWH 2F74A 2EO9A 4IOFC 1FYTB 2DI7A 4LDLB 4CVXB 4JQIH 3Q6GH 4MA3A 3LZFH 1X4ZA 3CFIC 3IAPA 5AYQA 3TT3L 4S1QH 4GRWB 2NY4B 4O00A 3LEVH 2XNAA 1DN0B 2X10A 4CVWA 3MR9A 3W39A 3D85B 3BMVA 5C08B 1S78D 2ZUYA 1WZ1H 1A2YA 4HKZA 3C60D 1N6UA 3C6SB 3CFJB 5CWSA 2J4WH 2CXKA 1EO8L 4I9WD 4K3HA 1OAYL 1DCLA 4UAOB 5ENWA 5E2UH 3I3EA 2ATPA 5HHPA 1EHLL 1G7HB 1NCWL 3L3KB 5F3BA 4JO1L 1MH5A 3T0EB 5FKPB 1I8KA 4WI9A 1YQVH 3QDJB 4GLRI 4HKJA 5L6YH 2E7LA 1EO7A 1AKJD 4JFHD 3WSQH 1T22B 3E6HB 1A6ZB 3BUYA 3BKJH 2XFXB 2MPAL 4KJYA 1WEJL 1HK6A 1VPOH 4WJ5A 2DQDL 5CCKH 1MELA 3PF2A 5L7XL 3BEVA 4WHDA 1FG2A 1CIDA 1UJ3C 2YWYA 5BRZE 3UJTH 3QEQE 4F7TB 1PZ5A 3S5LG 1P9MC 3T2PA 1RUAL 1A0QH 2VDNL 5T1MA 5I74B 5ID1A 4U4BA 2CRYA 3VD7A 4N9OB 4XPGH 5SWSD 1XF2B 3JTTB 2ESVD 4I3RH 4IRZH 1QSEB 1KJMA 2CRZA 1RVFH 1UWGL 5BXFA 4NO0B 5MENE 2E9IA 2O26U 2P8PB 2BFVL 2R39A 2AJXH 1QBAA 2R2EB 4GSDH 1AQDB 5M7QA 2DBLH 1I3VA 4K3EH 3HAEH 4IIQC 3N0PB 4X9IA 2BMKB 1QPPA 1JZ2A 4ODHH 4JQVC 5BMFH 4LPXA 3C6LB 5KSVB 1CGWA 1LEGA 1ZVHA 2VDRH 3JWDH 1NCAH 4HS3B 3VD5A 1CL7H 2G9HB 4NFBA 1JN6A 4CMMB 4E41B 3WL9B 4Y88A 4JHAL 4OIBA 2VLRA 4ISVA 1FIGH 5E1AB 3RY4A 1A9BB 5GJTH 1FZOA 3VRJB 3WEXB 3L5HA 3RTQA 2VZVA 4W68A 4LL9A 4YQXH 2JJSC 3VXSE 2HT3D 3MXVH 1KENH 1VGKA 3WD5H 3HMWL 3G5VB 3K4DA 2CDFA 5IFAH 1KELL 5AEAA 3MV9B 3RY6C 2EC9T 1FZMB 3DX7A 4QHNA 5J1TC 5BZWB 3MJ8B 1LGVA 3ZDYE 5SX5K 4OBRA 2DTSA 4AIOA 1QLRB 4ZSOE 2ICWI 2JIXD 2OR9H 1QSZA 1JPGA 1I75A 1FFOB 2YD6A 4X5WA 3VWJA 3D0LB 2H1PL 1HH6A 5GS0L 5F89B 3PWNB 3TZVC 4L4TB 4R0LC 3CSBA 4I0PC 1F3RB 2JK5A 5CP7B 3TIEA 1R5IA 4JJ5B 1URLA 3VXUE 4DVBB 4F3FA 1IGIH 4OUUA 4QRTB 1RSFA 1RK0B 3T65B 3MNWB 5IHBA 3BH9B 3HUJE 3O3EB 4BK4A 3AM8C 2X09A 1J1OH 2OBGA 1GIGL 4ONGH 4ZOCA 3OJVC 4QRUA 5E0QA 4LBEB 3P4MA 1P7KA 2ED7A 1BZ7B 4O58H 1S5HB 4OJFH 4Y2OA 2C3GA 5J3HD 4ZS6C 5DD3L 4LHQB 4Z7VE 4NNXA 1Q72L 1DUYA 4M4PA 2AK1L 5HY9A 1BD2D 3SDYL 1NMBH 4ZFZA 1T03H 4X7EC 3QPQC 3GMQA 1CYGA 1U92A 1SBSL 1O0VA 3H9SD 4OZIB 3ZE1F 5DJ8B 2NY2D 4L4VB 4AT6A 4N1CA 3PGDB 4MS8D 1IT9H 4NQSB 5DDHB 3OJDA 4P5TA 2MKLC 5GRJL 1BBDL 3BIAX 5E00A 2D0GA 4JREB 1OP3K 5HD8D 5T1KA 2P4AB 4ETYA 4JFYA 4JZJB 1KOAA 4HWBL 4LLMB 2OSLA 3CAFA 1KB5L 3CK0H 3RJQB 3UTZB 2DIAA 1MSPA 4N68A 5D7JA 1YEEH 4M6NL 4Y5VA 4P2OD 5JO5A 3R0MA 3TV3L 2QLVB 3DBXB 1YMMB 1D5ZA 2FGWH 2VQUA 1KFAH 1J0ZA 1NCUA 1CDHA 2HH0H 2R15A 2P24A 3UYRH 4ZUVB 2M1KA 2XKNB 5DZNA 4R26L 3EFDH 3RVXD 3H9ZA 5C0DB 4ONHB 3DUUB 4HK0B 3HE6A 5FGBA 3HMXA 1U8LB 2A1WL 1U3HC 5C09A 3GKZA 3E6FA 3BGFB 5C07B 4MA8H 1NGWB 3EAKA 1MWAB 3QUMB 4NQEB 3FQXA 5SWQA 2CDGA 4U7KA 4WDIA 3EO1B 3I3BA 4U1NB 3VFPA 5I1LB 4OGZA 5M94B 1I1RA 1NANH 5E8DL 2AJ3B 3WUZA 3U0TB 4Z7OF 3C87A 3BJ91 3V0VB 4JB9L 3W5NA 1DLFL 5ISZE 3EZJB 1R3KA 1UKSA 1KCSH 2ZZUT 4G6AC 2UWEB 4PLJD 4JRWA 3H8NA 2EIZA 1E4XH 4K9EL 5DMKA 4LU5H 3LRHA 3AU1A 4HMEA 4YEFA 1U8JB 1R3JB 1X7QA 2K1MA 4P2RA 1YA5A 4X0KB 4YGVA 2R9HD 2CQVA 4POZC 3MLWH 4UUJA 3STLA 3X11B 1PG7X 4N0FB 5D93C 4QT5A 4U1LB 5C0FA 4X4ZA 4U1JB 2HKFL 4UQ3A 1FLTX 1DEDA 4X6DE 3INUL 4JFEB 5BVJB 3BKMH 3VFRA 3VD3A 2X4TB 3SDCB 5FFLA 4JN2A 4OCRH 3QISA 4FZEH 5I6XC 2IH1B 1A9EB 2AEIT 3DHMA 3GSOB 3IFPB 3L3HB 1I9RL 3KJ4C 4Y2DA 3DX6A 4WY7L 1MNUL 1UJ3B 3PWUA 3VXQA 4H8WL 4B41A 4PJFE 4C59B 1WJ3A 3E8UH 2YPKB 2YA2A 4Z7QE 3G08B 1S7SB 4D3CH 1YQVL 5L6YL 5GGRB 3I2CH 1A21A 5JOPD 2D4FA 3WSQL 4ZTOL 5MP6H 1TQCC 1CDCA 4LPVA 4PJHE 4FTVA 1FO0A 3DX8B 3FQUB 3RWCB 1ZV5A 5JXED 3K80A 2HAZA 2YPVL 4IIQB 3FRPA 1MCPL 3PDOB 2I9TA 1C1EH 3MGOB 4ODVH 1IAKB 3Q3GB 1KB9K 2VDLH 3PDDA 4FFVD 3UJTL 1PEWA 4EKXA 4MMZC 2DS4A 1KPRA 2X5PA 4PJXE 1A0QL 4I4WB 4KTDH 5IB2A 5JHDE 3MSPA 1EEYA 4I3RL 4XC3H 1LE5A 1J8HE 2EDRA 3VGHA 1INDH 1RIUH 2EH7H 5H94A 5D9SB 5C2BH 3EYSH 5DHYA 1YNKL 2AJXL 5GS3A 1EUUA 3WKMH 2JJTC 1S78C 4GSDL 1WF5A 5BW7A 3C60C 4HLZG 4Y19A 1CLYL 5D8JH 1WT5C 4U1HB 3VFGH 1MCHA 1QRNE 1F00I 3CSYA 3IDNA 3PDGA 5JUEH 2WQ8A 3F5WA 1U8NB 4U1SA 5CMAA 1R5WA 1WTLA 1FIGL 3WNMA 4Z7WF 5L2KD 2GTZA 3U6RB 4R0LB 4R96B 2NXZD 1IBGL 1WZKA 3QHFL 5IB5A 4LK4A 1R5VA 2BY1A 3DLQR 3MXVL 5JA8B 3DPBA 4HUMB 2P5ED 4G3YL 1ZTXH 3WD5L 1TTFA 1KCLA 3ARXA 5TQ0H 3ULVD 4UOJA 1ZHBA 4HFUL 5DMIH 4OLUH 1S9WB 3V95A 4M43L 4MCYA 2VRAA 4MDJB 2VN7A 3DVGB 1YN7A 3V6OA 1C08B 3KPPB 5TE6H 1UACL 4ZFOB 2HKHH 4ORGB 5JOFB 4PB0H 5EU6B 1H15B 5J56B 4NM8L 1ZSDB 4BSVB 4LOUD 3O6LH 3FFDB 3CPLB 3VRLE 1ZLSL 2D7QA 5E2WH 1CFQA 5HVWA 3AAZB 3RWDB 1HYRC 3H7BA 1YDPA 1I7ZB 4Q58C 2QHRH 2OZ4A 4NDMB 2Z93B 2CR3A 2AXFB 4OIAA 1RZ7H 1J1OL 1HILB 4FFZL 5DJXA 1I9EA 5D1ZC 2YKLH 4WNQA 3WIFA 4LGRB 5SWZB 1ADQL 1HHGB 1QLEH 1SQ2N 3ES6B 3P3YA 5TGBB 4PGDB 5EPMA 3LRGA 4XP4H 4TUJA 5ACZB 2UZYB 1MIEL 1D6VH 1J11A 1FNLA 1XR8A 2YK1L 5IMMB 1TQBC 3MRIA 5CEYB 3QDJD 5DHVA 1HOCB 4I1NB 5D7IF 3O4LE 4N90E 3QIWA 3D39B 4RMUA 4WI4A 1LD9B 2HT3C 1V7ML 1EGJH 4O5LL 2DQGL 4YDKH 1LO0L 1FL3B 3I02B 3JTSB 2A38A 3K2MC 2DQUL 3OWEA 5DJAA 3CX5K 3WNNA 1S9KC 3I75B 3RBGA 1F45A 4AL8H 1XIWD 1RUKL 2C3XA 1FCCA 5IFHH 2WBJB 3MLUH 4YGAB 4X6EA 4BFIA 4OZGF 3U83A 3VFOB 1YECH 2R56H 1M05B 4S1RL 1YEEL 4ZUTB 5KZCB 1SM3H 2J3SA 3J7HA 4IDJH 1KFAL 3MRJB 3QUXA 5DMYA 1OGAB 2KPNA 4DN4L 2F8VA 2A6JB 2HH0L 3UYRL 3F6LA 5E5UB 4GAYA 1I1FA 3BX7C 3QWOB 2WNGA 5IW1B 3BDXA 3KPNB 3EUUA 1EAPA 4XNXH 5FYLD 4WUUE 3DVFA 1E28B 4HWUA 3QZWG 4FTVD 1NEZA 2PYEE 1MIML 1WBYB 4G6FD 4PLNC 4KHXL 1F13A 1Y18B 4G6ML 3IFNH 1UA6L 1FFNA 4LVNB 4M7KH 3SE3C 5GRWA 3QEUB 1XFPA 5J3HC 1DEEA 4LIQE 2J88L 2R1WB 3DIFA 5EZJA 1I1AA 2MTPA 2EDHA 5D93B 4DKDC 1DP0A 2EDXA 3EYFB 3RHWK 1JZ7A 2NXYB 3PIQB 4MS8C 5JW5B 4G7VL 4X8JA 3QG6A 2E3VA 1KCSL 2GY7B 3QXAA 5KG9B 4Y19D 2YUVA 1SHMA 5HD8C 2ZSVB 3BP4B 3VFSA 3T4AB 4LU5L 5SX5H 3VFTA 3QI9B 1RZFH 1GAFL 1JBJA 4L8SA 5FA3A 4OZHF 2BOCA 1H3XA 4P2OC 3MJ9L 5GGSA 3S34L 2X89D 3RUGA 4NQXB 4GFTB 3MXWH 3MFFB 4HK3J 4MB5A 1TQCB 4YXHL 1VCAA 2F5AH 4OI9A 2E7LC 4JGUA 4NO2A 3VGBA 1FE8H 2R2CA 4OCRL 5L8JB 4EI5A 4HD9A 3AY4A 3RVXC 5KANG 2FX8L 2PR4L 3W0WE 4EN3A 4D9QE 5F1IA 1JUFA 4PGBA 1U3ZA 4TVPL 3ULUE 3T09A 4HG4K 1AGCB 4GRLD 4TSAH 4GMTL 3G5XB 4ZUWA 3V5DA 4GG8B 1Z3GH 4HCRL 3ZDZE 4J8RB 4A2MA 3I2CL 1IZKA 1Q9WA 4KV5E 3SDDB 1QKZH 5A2IH 3WFBH 1QQDB 3S37L 5C0IA 4JY5L 1T0NB 3FQRB 1AY1L 1FZKB 4LPYA 5IFJA 2X2YA 2V17L 1JPFA 3RWGA 5E4IA 1NL0L 3WHXB 2D7TL 3FOMB 3SKJL 2XT1B 2E7MA 3S4SB 1JZ8A 2NCMA 1MJ7L 3REVB 4OKVB 3PP3K 4PLJC 3TO4A 2FX7H 1OP3H 4KRNA 3MZTA 5F1KC 2RIKA 1IC4L 4R97B 1CE6B 4KTDL 1LP9F 5AUMA 4JKMA 5K9QI 1CG9A 1J8KA 5FCSH 4X7SL 1ZGLP 2HN7B 1BFVH 4HSQA 4LCUB 5EU4B 2B1HH 4IRJB 4NKQB 4MJ5A 1NBYB 4I3SH 1CFSB 1J05A 3DV6A 5ITFA 5GISH 3T2NL 3LPWA 4L1HA 1BECA 5FYJD 1AGEB 4WUKL 2OXGA 3QB7C 4L8DA 8FABB 2HWZH 2GY5A 3HRZB 5I8OH 2FHFA 2P8LB 2DI8A 4OZFB 4PJEA 2Y36H 3KPRA 4G9DA 3C5ZD 2R0ZH 1LEKA 2PW1B 2XTJD 3VWJC 5IM7B 3QXDA 3O2VL 3QPXH 4ZMAT 1XCQB 1JWMB 5A43C 5EUOA 2AJUH 3O3AB 4J1UA 3EGSB 1J0JA 1TZHA 3QUXD 3SE8H 1T1YA 3WLBA 3MRHB 3PL6D 2VXQH 1DQLL 1MPAL 5DJDA 3BP6B 4TVSa 5D1ZB 2GUOB 5H2BA 3ZT7A 2V2WB 4P9HL 5AYUH 4DOHE 4LCYB 5KSBB 3T1FB 4XWGH 4YR6A 1KC5L 4DKFH 4FFVC 5T3XL 3BP7A 4QY8A 5L2JA 4GQPH 1V3KA 4CW1B 1KJ3H 1U8MB 3WUWA 2VISA 4RX4D 4ODUB 1TQBB 4JLRA 4YNYB 5DD5H 1KJ2L 5LGHH 5J6GA 4OQ1A 4NQDD 5JDSA 4ZPTA 2V6HA 2RJMA 1AR1C 1SY6A 3OKEA 3P77A 3LKOA 1DVFA 4QHKI 4MCZA 1G7QB 1IQWL 1IARB 3DUSA 2QHRL 1UADC 3KYNB 3L9RB 5JORA 5EZIH 4HKBA 1EPFA 4QOKA 2W0PA 2YSSA 1AD0A 3FRUB 4Z78B 4Z76A 4WV1A 5FF6B 4XNUH 2DM7A 2IAMA 4N0YH 3MNVA 4S1SL 3D48R 1QFPA 3PHOA 2W07A 3BOVA 5F8RC 2Q7YA 1QSFE 1KLUB 4YX2H 1BQHB 3C9NB 1MLBB 4JFDA 5HYSB 5SX4H 4MSWB 4WI5A 2L7UA 4JM2A 5E5MA 1JGEB 2F53E 3B3IB 2NXZC 5FUZH 1G84A 4M5ZL 3G6JE 5D7JC 1F8TH 5ELIA 1WWWX 3HC0B 5FUCC 1L0XA 1CTOA 3QUZD 5JW4M 4U7SA 1EGJL 4DEPC 1H5BB 3QFJA 4HS6A 4ZQKA 3JV6B 4K7PH 3ULVC 1DFBH 5HHQA 5HHNA 1WBZA 1NMAH 1IGYA 4F2MA 32C2B 1P4IH 2N7BA 3B9DA 3R8BB 4XNYH 4AL8L 2VN4A 3LV3A 2ZCHH 5JMOC 3VXPB 1JGLH 3MLUL 2OP4L 3THML 4R2GB 2HFEA 4YBQC 1ORSA 4DCQB 5E8PA 1BBJA 5F6IC 5F70A 2F74B 2B39A 3WO4B 1QBLL 5EORH 5D5MF 4MA3B 1BOYA 1NGZA 4WFHD 4M3KB 3RZCD 4Q9RL 1GOHA 4YXLL 2BVOA 2BSRA 4YIQA 1CXKA 1ACYL 1MFAH 3MRDA 3S5LA 5CEZH 4NKMA 1FC1A 3QWQB 4NBYB 1S7XA 3L3DA 4XAKE 1P69B 4GAGH 5DXWA 1AC6A 3QDMD 2ID5A 3ZE2E 4HKZB 5F9OL 1A02N 4GMSL 3RZWA 1DQML 2FHBA 4Y1AE 4LPTA 5CWSB 3D0VA 1YEHL 3RGVD 5BVPL 5DRNA 4M7KL 2R4RL 1TJHH 4XB8A 4NNPL 2BVUA 5ENWB 5B39G 4IOSD 4EBQL 2GK2A 2VDPL 5F3BB 1MH5B 2A83A 4AEHL 1A4JA 5CUSH 4HKJB 4GJTB 3ARFA 3DNKA 3PGCA 2JB6B 5FYKH 3GSXB 4WCYH 1DANU 1Q38A 3EOBB 2XQBH 5B3JF 2AERT 4O2CA 2VO5A 4M6ML 5HGAA 5ALCL 1EK3A 1HWHB 3DHJA 2LTQB 3BZFA 3BUYB 3VXMD 4P9MH 4KJYB 1GYAA 4OQTH 5DJ0A 2RFXA 3WFHA 1XIWC 4K2UH 4I77L 4WJ5B 1NC4A 1RZFL 1MQKH 3ARGD 4Q2ZB 2VL5A 3BEVB 4GS7B 5DR5H 4Y2DC 4MDIA 1FG2B 4YE4L 1JNHA 1Q0XL 1NLBH 1H0DA 1OTTD 5T1MB 5ID1B 1JFQL 3VW3H 3MXWL 5J0BA 2I24N 1KJMB 5BXFB 2X1XR 2R8SH 2B2XH 5H37G 1OAQH 4OFYD 3VXRD 1OTUD 1JZ3A 2EIDA 4RDQG 1RHFA 2W65A 5LGJB 5DK3A 4JRYD 1P4LA 4UTBH 1H9VA 2GSGB 2XQYK 1KCRL 1XF4A 2WWKO 3HE7A 2B0SH 5GGTA 1FC2D 3BN9D 3T8XB 3WFCL 3FO0L 5I1AA 3AXLA 1AO7D 1JN6B 2J8UB 1KT2A 1CD8A 4HS8L 5CHNA 3M8OL 5D1XA 1QKZL 2VLRB 4ISVB 5F1SA 5I1KH 3NMEA 3WFBL 2EE2A 1WCBA 1U8IA 3NFNA 2EDFA 1FZOB 1YEDA 3ETBF 3HG1B 2V5RA 4JQXA 4P3CL 3RTQB 5H8DA 1A3LH 4KDTA 4Z0XB 4HBCH 4QOKD 1CLCA 4DAGL 3GSNH 5C70A 4BQCA 1VGKB 5BW7C 3TT1H 2BP3A 2CDFB 3ZKNC 4DGVL 5LXGL 5I19H 1AGFB 2FX7L 4QHNB 1EFXD 1M7DA 5KS9F 4XC1L 1UXWA 1BFTA 2H9GA 4YFEA 4U33A 1N6QH 4P4KA 4JFDD 5JLZA 4Y7MA 3TJEH 3VWJB 3CCHB 2UV3A 4JM2D 1HH6B 1OT1A 1PX4A 5CGTA 1D5IL 3FB7A 5JPMA 2JK5B 3GSVA 3LVEA 3TIEB 5GISL 2OI9C 3IGAA 2MQ3A 5F72S 4F3FB 4NQCD 1RJZB 1I85A 3E1F1 3B2UD 4CN6A 1MF2L 1ONQA 4LFHD 3P0GB 1TLKA 4ZXBD 4X6BB 5CILL 3QUYA 4X9BA 3UBXG 1JF5A 1CDYA 1KEML 3BZDA 4QRUB 4GRLC 3P4MB 1P7KB 4DVRH 3QJHA 4Q6YA 3QCUH 3LMJL 3ZT5A 5JIHA 5IBLD 2C26A 5T5FH 5I8KL 5CSGA 4XP9L 1U2HA 4NNXB 2APWA 1DUYB 5HY9B 2YD7A 3O6FA 4LLAA 4ZFZB 3L3IA 3SE8L 2MSPA 2VXQL 3GMQB 1FYTE 1U92B 2FSEA 5DK0A 2NTSP 1MCBA 4Z0BL 2FHCA 2QKIB 4XVUD 4ELMA 2BRRH 4PLOB 1J1XL 3N1GC 1UM4H 4AT6B 4GRWE 3RU8L 1A7OL 4APQD 3OJDB 4P5TB 1B0GB 2FH6A 1RZJH 4ZS7L 1OSZA 4JFYB 4HBQA 3MUGA 3TJHC 5DD5L 5C08E 1WC7A 1YYMH 1W72A 2J7LA 3O8XB 4ALAH 3WFEL 3GJFA 2C3VA 4MJID 5D7JB 3OR6B 4M6OH 2LVCA 4Y5VB 5JO5B 3F6IA 1DUZA 1IEBA 5AAWA 4PV8A 5CEXA 1D9KD 1D5ZB 4N5UA 3VH8G 1KG0A 1PVHA 2H45A 3CLEL 4N0YL 3SKOA 3BSZL 1VGEL 4N8VA 2EDKA 5JQ6L 2VB5A 3K1KC 3T0EE 2P24B 1TZGH 3X3GL 1FORL 2DBJA 3FCTB 5L8LB 4YX2L 2DDQH 1JZ5A 3O41A 2VUYA 4PYHA 4XMLH 3WXWH 1SJHA 1P84K 1AIFA 1KCKA 6CGTA 4LLDA 2XV6B 3HE6B 4RGMB 4OCXH 5FUZL 4OTXL 5C09B 2XTJC 1LMKA 3E6FB 5T1DH 4EXPX 3X14A 3KXFD 6FABH 4WU5A 2CDGB 4O9HL 1WFNA 4E42A 3GO1H 4FQJH 4WDIB 4GG6F 3VFPB 5C92A 4YHIB 3QUXC 1Y0LA 4JO4H 5IBTL 4X4MA 3PL6C 1CFVL 2CKBA 3QEHA 3PQYA 3HCVB 2CGRH 5TJWK 2BNUA 5J11C 1CGSL 1QSEE 1GC1L 4ERSH 3GIZH 3MFGB 5E94A 2DIJA 4NQTA 2EIZB 5JR1H 3MBXH 5DMKB 5GRUL 3K2UL 1XEDA 3AU1B 4XMKH 1BX2A 1X7QB 4OM1H 4P2RB 4RGOH 5T5NG 4G5ZH 5E56A 4R90H 4G8GD 1I1AC 4NZUH 4KROD 2CKNA 5D1XD 5F9DC 1NFIB 2ZNXA 5LQBL 4QT5B 1I3UA 5J1AB 4G8EA 4E41E 3ARQA 4UQ3B 4PREB 5KVDL 3CUPA 3VFRB 5A2KH 2DQHH 5EBGA 2R69L 4KKNA 4JN2B 3NA4A 2VE6A 4NZRL 1FDLH 1OPGH 1PAMA 4XHJD 4Y2DB 3O9WA 3DX6B 4KQ3H 5GS0D 1QVOA 3VXQB 1MY7A 2H41A 1B0WA 1L7TH 1AJ7H 1DBMH 2DI9A 4L8SC 3MV9E 1P1ZB 2Y6SC 3ESVF 4MB3A 2Z31A 3S36L 3PE9A 5CUSL 3QUZC 4OZ4B 3SOBH 4WCYL 2YS4A 1CXHA 3LH2H 4WWKD 2JTDA 3N9GL 3ZKXB 1UEYA 2VLJD 3TVMA 3RKDD 1INQA 1Q94A 5CGMA 4L4TE 3L3JA 3F7PC 1LK2A 1FO0B 4UU9A 3QEGH 1IGJB 3TFKD 1GL4B 4X4XA 3T1WA 4LRNH 1E6JL 1A7PH 1RULL 1IM9A 3IXAB 2F54B 2HLAA 2BNQB 3U9UA 2I9TB 2OL3L 4EN3C 4PGEA 1GGBH 4L9LA 2ZOLA 2Q87A 1FH5L 5C86A 1D6EA 2Y25A 2F15A 1GZPB 2Q76A 1AP2A 5IB2B 3RAJH 3U0PA 5DURB 4LP4A 3ZYJA 1LE5B 3CVIL 2B2XL 2ADJA 2VLME 3HAEA 1CFTA 4YHZH 3JV4A 5DHYB 3QAZB 3OHXA 1QFWL 4RAUA 2VABA 4XVSH 3L7EA 3HI6H 1KIQA 1MFEL 3L7FA 3LKRA 3HR6A 2JB5L 4UTBL 4X5XA 2OXHA 1QZ1A 3VRIA 2B0SL 4ONFL 1AD9A 3RGVC 4N9GA 1KYOJ 3A6BL 3EOYG 3RNKA 4HPYH 3CSYB 1A6WL 3IDNB 5HGGS 4L4VE 5JXAH 4U1SB 5CMAB 4QCIA 1R5WB 3MGTA 1CR9H 4WI8A 1Z5LA 4OCNC 1IL1B 3HLAA 5IB5B 4PJHF 3NH7H 4Z7NF 1JGDB 1R5VB 1A3LL 1YNLL 4G6KL 5BS0D 2OI9B 4MAUH 3DX9A 3GSNL 2VXVL 5DWUH 4UV7L 1ZHBB 3BZ4A 3HNSL 5I19L 1YMME 5IWLA 4MCYB 5JZ7D 5DK2A 4MNQA 3ARGC 4HGMA 1KBGH 2BVTA 3EJYD 3LEXA 4PTTA 5A2FA 1UCTA 4PRID 2Z8RA 5TF1L 4U6HA 4L5FL 4ACPA 4HIHA 3B9KA 1G7LA 2ICEA 1OTTC 4FXGA 4XH2A 5HHMB 3UDWA 2IQAB 2HRLA 4AIZA 5IMLA 4OF5A 1OQXA 2ZOKA 1CFQB 3Q5OA 1X5JA 3R1GH 2W9DL 1YDPB 3QNYB 5I1CH 3D3VA 1OTUC 5C07E 2D03H 4Z18A 4F7EA 4UBDD 4C56A 4YXKL 4NQEE 1U0QA 4JFFA 1ZE3C 5DJXB 3P4NA 4WNQB 4M00A 1DBKL 3BN9C 1MCJA 5EPMB 2GCYB 1ZVSA 4A2LA 3QCUL 2DQTL 3AS3A 4Y5YA 2APXA 1VEOA 5T5FL 4X9HA 3U30C 3UTSA 3MRIB 3O6KH 1MEXH 4K3GA 4DUVA 5J89A 1UVQA 2UWEE 3E3QE 4XBEH 3QIWB 3GHEH 5D2LB 5JA9A 2AABL 1ZEAH 3GGWA 2VZSA 3IETA 2IH3B 2ED8A 1F4XL 4MQSB 2GITB 4QNPE 5MHSE 3TWCL 2IAMC 2D4DA 4BK5A 5T3ZE 5DJAB 4NQVA 4D0DA 4WI3A 5EWIL 1YPZB 2C5DC 3RVTD 4HX1B 3FQWB 1UFUA 1RUPH 4FN0A 3UO1H 4AMKH 3VRLF 4JFEE 4X6EB 4BFIB 3FN0L 1L9MA 2DLGA 5HPOA 5EO9A 4JM2C 1JGUL 3O9WD 1LDSA 4M6OL 2X1WL 1GZQA 5LVEA 4LSUL 3BGMB 5DFTA 4X6CF 4XXDA 1LNUA 3ALWA 2Z31D 2COQA 2CLZA 5KSAD 4KMQA 4OD3H 3VG9C 4NWUL 4X5LA 3VFUA 4RA3A 1KTLA 3PJSA 4JHWH 2A0LD 2I27N 4GAYB 3B2UC 4M93B 1EAPB 3TVMD 1OY3B 1JPTH 3MRRA 3UPAA 2JJWA 5KTEL 4ZXBC 3SE9H 3TC9A 4LLWA 4HT1H 5CJQH 3LKPA 2BVPB 1BZ9A 2GJ6A 3LOWA 4P3DA 4XRCA 1IM9D 2BX5A 2BY0A 1FFNB 3B5TA 3JUYA 5T1DL 5ILTH 4C58B 1DEEB 4RISH 1KTKE 1QBMH 3DIFB 4WRLA 5M95B 5EZJB 1I1AB 2QQKH 3GO1L 2UY6A 4JO4L 1QP1A 2Y06H 2YN5A 2ORBL 4GKSB 5HSFA 1KGCD 4G80B 5C0CD 1RMFL 3N1QC 1NUNB 2CGRL 5CGYD 5ADPL 3LQAL 4G8FA 1JNLH 5ANMA 4ERSL 4NP4H 4R4FL 4APQC 4X8JB 4E0RA 3QG6B 3IJSB 3QXAB 4PD4K 2YRLA 4ODSH 3BIKB 3VFSB 3MBXL 4LIQH 3VFTB 4KXZH 2CJUL 4KJPC 3V52L 5F6HJ 2IBGA 1DJSA 4XVJL 5FA3B 3GSRA 4QEGA 2FL5B 3EHBD 2Y4SA 2BOCB 5HTSA 5HGBB 3GSQA 2FH8A 2BDNL 5GGSB 1D9KC 1A7RH 3TN0D 3RUGB 3DMMB 1OAUH 5CS7A 5GGVH 1TJIL 2NY3D 2XN9D 3NCJL 4LSVH 5E2VH 4Q0XL 4F8TA 5DC0A 2BY2A 3V8OA 1T0PB 3MCKA 4EI5B 4OFDA 1HDMA 4JPIA 4EN3B 1HEZA 5F1IB 2IQ9H 1JUFB 4PGBB 2PO6A 1L7TL 1AJ7L 1F58H 5DQDH 5FOBA 2VZOA 4U6XA 4GXUN 1QLFA 4TSCL 4ZUWB 3V5DB 1BJMA 3B9KD 3ABZA 1BVKA 4FQQA 3B5GA 1G9NH 1Q9WB 1D7FA 5DT1L 4QXUH 5CP3A 4JZOB 3MRGA 5C0IB 5EU6E 4GT7A 1O7SA 4PR5A 3PWPB 5IFJB 1CD0A 4YC2B 3KYAA 5K9KA 1JPFB 3RWGB 4L3ED 4KK8D 4WHTB 4PG9A 1UH2A 4JFFD 4Z7WA 3VMNA 3BPLC 3GMPA 5DRWA 3S35H 3TO4B 2YPLB 3HE7C 3Q5TA 3QUKA 4ZODA 4A6YH 4LCWA 3O2WL 5J6HA 2HMID 1NCDH 2X4QA 3GHBH 3GMOA 3M1BB 5AUMB 1CG9B 5SWZE 2A74A 1FP5A 4NO3A 4ZNEA 4KROC 5D1XC 4PFEA 3UYPA 3FB8A 5IKCA 1HHHA 3VFNA 1J5OH 3T0BA 4MJ5B 1J05B 4KDTC 5JDJA 2EE6A 1AGBA 2WWMD 1GGTA 3PP4H 1BZQK 3D39E 4HPOL 1BQUA 3ZE0F 1ORQA 5AWNH 4GUPA 4LHJB 4XHJC 4PS4H 5GS0C 1PKQB 4E9LA 1RPQA 1AQKH 4K3DH 5EC2A 1P7QA 2YD4A 2DYPD 4WIQA 4G9DB 3LRSB 2YR3A 3OXSB 1LEKB 3NH7L 3QXDB 2VXUH 4OM0H 4PRHA 4WWKC 5EUOB 4FQXA 3ZDXE 3O6ML 2C1PA 4JAMB 4IMLA 4J1UB 5DWUL 1TZHB 5IR1B 3BVNA 1T1YB 5GRXG 3RKDC 3WLBB 3TFKC 5DJDB 1KIRA 1WV7T 5H2BB 2DL2A 1I85C 2VAAA 1OGAE 4YR6B 3ARBB 2PKDA 3QUYC 3BP7B 4QY8B 4K7PX 5L2JB 5D7IA 4V1DA 4CVUA 2IAND 1MFBL 3WUWB 4HWNA 2VISB 3ZTJG 4NM4L 3U30B 5J6GB 1KN4H 4Y4KD 5JDSB 4ZPTB 4KPHH 1KLGA 4KI5D 1EJOH 1JNNL 3P77B 3OKEB 4B5EA 3R1GL 4LLYA 3LKOB 3MRFA 4HIIA 1DVFB 5D2NA 4FABH 2EDLA 1V3MA 1X5AA 3O6FC 2I9LB 4QHLA 4F58H 4HKBB 2YSSB 1NFKA 3AREA 1AD0B 1MHPH 4Z76B 4WV1B 3IDXH 4TULH 3L5WA 2IAMB 4UQ2A 3MNVB 4YDLC 4OZGA 5L9DH 4XVTH 4K3JL 3PHOB 3MREA 3RX8A 3HB3D 4S0SD 2Q7YB 4TUKL 4TNWF 3TH3T 2JLLA 5F7EL 1XGPA 3MJGX 5E5MB 1N5YH 1S9YA 4Z7UF 4HWEH 1I8LC 3R4DA 1KTRL 1ZEAL 3QFJB 4M8QA 4ZQKB 2AEQL 2GW5A 5HHQB 5HHNB 4JPKH 5DC9B 1WBZB 4F2MB 3GB7A 4KKAD 2D3VA 5IBUB 1ZS8A 4NGHL 5LBSH 5KSUB 2F54D 2BNQD 4OCYH 4OAWB 4TVPD 3EJYC 4AMKL 3LV3B 4P4RA 3ARDD 5KAQF 7CGTA 5F88B 1VESA 3GSWA 5D72H 1ORSB 2ADFL 1G9MC 4ETQA 3G04A 2I5YH 4UNTA 3KGRA 4DW2L 3IDMA 2BVOB 2BSRB 1ROWA 5J06A 4YIQB 3S5LB 3MRDB 1IGMH 2DMCA 4NKMB 1RAMA 2LQRA 5HDBF 1UQSA 3U7YH 3L3DB 2PYFB 2X9XA 1K8DA 2Q6WB 4KJWD 4UBDC 4L3CA 1N64L 4KQ4L 2EC9U 1G7JA 3SE9L 5JIPA 1PFCA 4U49A 1HSBA 4OZHA 3D0VB 3IDYC 4HUXA 1AH1A 5DRNB 3G6JF 2GYSA 1DE4A 3O11A 2B4CH 3B4NA 4ODTL 4LHUA 4I9WE 3DURA 4JKKA 1B2WH 4QRPA 4UILH 3ARFB 3PGCB 2CO6B 3GDBA 3P0VH 4YDVB 3QULA 4NP4L 5MI0C 4TTGA 4O2CB 2AEPL 5HGAB 5C3LD 3BZFB 4LNVA 3K81A 2FCBA 1B3JA 1K85A 3RVTC 5DJ0B 4ELKB 1FZJA 2EDJA 2RFXB 3MRBB 3WFHB 1AC0A 1FV1A 2NX5B 3GI9H 1NC4B 2RCSL 4YHOH 3MOAL 4F7CB 1ZHKA 1N5AA 2F8OA 3O2DH 4HC1H 4MDIB 3O9WC 1S3KH 3H9HA 2MOVA 4M48L 2FX9H 1H0DB 4UTAH 2AQ2A 2Z31C 1MRFL 1ETZA 1N8ZA 3MUHL 1R24B 1Z9SA 2VYRE 5HHOA 3WNPA 2A0LC 5DVLA 3I9GH 1I8MA 5DJZA 2L4OA 1U42A 2Z9TA 2EXWD 3T77A 3TVMC 5C6WH 2W65B 1P4BH 5T3XD 1P4LB 3DO3A 3RDTA 1LP9A 5CIPH 3KPQB 4UOW0 1XF4B 3LQMA 1BIIA 3HE7B 4M9PA 5DQDL 1PSKL 1S7TA 3VMPA 3QHZH 4L9LC 2Y7QA 1T5XA 5I1AB 2ZPKL 1PJ9A 2W59A 3AXLB 5KSBE 3U1SH 4F9PC 3IFLH 1KT2B 5CHNB 1AXTH 2AK4D 3MUZ1 4XXCA 2RGSA 3U2SA 1CT8A 1WCBB 1U8IB 3LS4H 3NFNB 4XI5D 1YEDB 1BFSA 3NA9H 1UXSB 5CGYC 1BQLH 1FGVH 5DUPL 4ZG1A 2EDNA 3UPRA 5E4EC 3ARED 3ULUL 3S9DB 2LV4A 1Q0YH 3JWDC 4MNHA 4HV8A 3KLSA 1M7DB 1CD1A 1UXWB 3UZVB 2H9GB 4M1DL 4M02A 3MGAA 5BV7H 3EHBC 4P4KB 5JLZB 1U8QA 3VGGA 3TN0C 5I0ZA 1J5OL 1S7WA 3FB7B 4JRXA 3SGKA 5JPMB 2IPTL 1X3DA 5EOCL 2P8MA 3QRGH 3SO3C 2ZCKH 3FMGH 1FAIH 1WIOA 5DVKA 3D18A 4OGYH 4OCSL 5AWNL 4HF5L 1MJJA 1ONQB 1W0WA 2B1AH 1MCEA 5IWLC 4UT9L 3C5JB 3QUYB 1HNGA 2YC1B 4FZ8H 3NIFE 5C0AA 5IEKA 4OBSA 2FECL 4KJQC 3QJHB 1CICD 1UJTA 3B9KC 3IRPX 1CBVH 4RFNC 2ZUQC 2QSTA 5AAMA 3WMSA 3BDYL 2DM2A 3C8KA 3A6CL 4NZDA 3O6FB 5HYJA 2ATKA 4H88L 5TE7H 1X44A 3L3IB 4EDXA 3BWUC 3I3DA 1TJGH 2APBA 1A14H 2FSEB 5DK0B 4R8WL 3MRNA 3OAUH 4ELMB 1QO3A 4YDLB 4NRYA 1Y6KR 1UH3A 3HPJA 2R4SL 2C7UB 2CRMA 3H2WA 2ZUWA 2W0LA 1G1YA 1OSZB 5DD0L 4HDIA 3MV8A 1T2JA 2YD1A 1WC7B 3MMEB 1W72B 4XCFL 3SGJA 3PHQA 4Y5YC 4ODWA 3EO9H 3VXUB 4Y8AA 2C3VB 4WI6A 2O5YH 3CDFA 3UC0H 1MFCL 3H3KA 3QIUA 3KPMA 1DUZB 4QRSA 1DLHA 4F58L 4LHUD 5MEQA 1IEBB 4PV8B 5CEXB 1TPXB 1KG0B 3FN9A 4Z95L 5IHLB 4TULL 3SKOB 4KUCD 5GGSY 4N8VB 2WWMC 1RD6A 5J12C 2HFGL 3ARRA 1JIBA 5D5MA 4QF1A 2FWOA 3O41B 3U46A 1DQTA 1AIFB 4LLDB 4MXQD 2VUOA 4LNRB 3UTTA 1YJDL 4PRPA 3QIBA 3BDBA 1IM3A 1TTGA 1IEAA 1GSMA 4KVCL 4P2QA 3X14B 4NKOA 3RX7A 2QEJA 5F9WB 3KLHD 4WU5B 3LIZL 2NY5H 4E42B 3FO9A 3WFDL 1WWCA 1Y0LB 3OJMB 2CKBB 1HZHH 1RUQL 3V79C 1YEFL 3QEHB 3WE6A 1SEBA 3PQYB 1K6QH 4OCYL 2R29L 1N2RA 4M7LL 3NCBB 5JIKA 1BQHG 2BNUB 4PJ8D 5HYSG 2FBJH 4AIXA 3QYCA 1FPTH 1JF1A 4G9FD 3RDTD 1KTDA 1RZKH 1U6AH 2NY6D 3T3PF 15C8L 2I5YL 1AXIB 1FVCA 2A2QT 3MV7D 5FAAA 4XP6H 3QDGD 5B8CA 5KAQG 5LAXA 1BWWA 1MHCA 1OAXH 4CU8A 3BYYA 1KIUA 4XPBH 2HJKA 4G8IB 1G7IA 4G8EB 1KPUB 3SEPA 4EUPA 3H6JA 2VLRE 3CUPB 3QCVH 2DLFH 2DM3A 3HB3C 2VE6B 2J2ZA 2F5BH 2EYRA 4N8CH 3LDBB 5E9DA 4MJ6A 1QVOB 1CF8H 1G6RH 1UB5A 5BZDA 1CVSC 1PZUB 1ZANH 2B7DT 4OF3A 1IFHH 1C16A 2NLJA 2W9EL 1K3IA 1MI5A 3P0VL 2YMXH 3OKKA 4RMSA 4OQTA 2VDKL 3H3BC 3MCLL 3U82B 4J4PD 4KKAC 2Q8AH 4KRPD 4YZFE 1INQB 1Q94B 1HHJA 4KTYA 5JPNA 1HN1A 1LK2B 4HXBH 4UU9B 4YFLI 2NYYC 4JFZH 3GI9L 4X4XB 5ETUA 2H26A 5HDLA 2HFFA 3U9UB 2X4UA 1R3LA 2HLAB 2VH5H 4MYWB 4YO0A 3O2DL 4PGEB 4L9LB 2HTLC 4EQ2A 2P47B 2PO6C 1NGPH 5GSRA 5C9KA 4JVUA 3DO7A 4CMHC 1D5MA 3U0PB 5E99H 4GAJH 4HH8A 1OGTA 4WTWA 1CFTB 5BRZA 2NW2B 4KJWC 1B9ZA 4NIKB 5AG8A 5KS9A 3SE4C 5HYJD 1NUGA 4RAUB 2VABB 1U95A 1KIQB 3L7FB 3LKRB 1EVTC 5FHAL 4X5XB 2OTUA 5D1QD 1MCWW 1S7UA 1FNEA 2DD8H 3VRIB 1AD9B 1N59A 1U58B 4N9GB 3RNKB 4KZDL 4C55A 2FZ3A 3P0YL 4DTGH 4L1DA 2VTFA 3V5KA 4U31A 3FT3B 5E1HB 2ZKHH 1MRCH 5HYQA 4QCIB 5F7NC 3MGTB 3QBTB 4WFGD 4CJ1A 4ZAKA 1Z5LB 3HLAB 1GPOH 4NWTH 2W60A 3RL2A 4LSQH 1SJXA 1FGVL 3SO3B 3DX9B 3SY0B 5KVGH 5I1HL 1A4KA 3K4ZA 2V5TA 4FQCL 2PW2A 3PV7A 3BZ4B 2PXYA 4NJ9L 1CXEA 3V7MA 3L5IA 4QXGH 1FHGA 2WW8A 3FFCA 3SQOL 4MNQB 5JHDB 1T89A 4O2FA 3BJLA 1LO5A 4PTTB 3LEXB 2W38A 3LN5A 4U6HB 2G5BA 2BCKB 4HIHB 5TFSH 5TH2A 4MD4A 1G7LB 1WGOA 2DQCH 1UWEH 3RX5A 2ICEB 4FXGB 3GRWL 4IMKA 4XH2B 1IEHA 1Z6JT 1YEJL 3TEUA 5IOPA 4YUEH 3MLYH 4AIZB 2YD9A 3UCRA 2NZ9C 2ZOKB 4QRRA 2FJFB 5IESH 2P7TA 4P2QD 3D25A 3QRGL 2AVGA 5DRXA 4U3HA 4FQXC 4GKZA 1J86A 4P9HC 5C09E 3D3VB 1QRNB 4JDZA 1Q8MA 5CJ8A 4F7EB 4OGYL 1NCCL 3QJFA 4JY6A 4OCMC 4C56B 1H8NA 3Q48A 1I9IH 2J5LB 2VR9A 4OZIF 1YEKH 1YQ2A 3GK8L 4ZPVA 1FSKB 4R4ND 3FHAA 1MCQA 1PQZA 3P4NB 1N4XL 2M2DA 1NBQA 4FZ8L 4UZGA 4DGIL 4TQEL 4XPAL 1ZVSB 5H35A 5TQ2H 1CBVL 4IOIA 3UTSB 2VDMH 5JQHC 2ED9A 3QNXB 1U8KA 4M7JL 5JIIA 1UVQB 4UDTA 5TE7L 3V4PH 4XI5C 4H1LH 4DKAA 1DQQA 1MWAH 4TOYL 1T6VN 3QUMH 3GGWB 2AJVL 4XX1E 4KH2A 4P2RE 3AREC 3IETB 1I8IA 3GMLA 1DN2A 4MAYA 3PABB 3NTCL 4NBXB 4OB5L 4R7DA 2PTTA 4ONOA 4BKLA 1QEWA 3IU4L 4LAQL 2F19L 5IHZB 4NQVB 4D0DB 1FBIH 4MB4A 4S0TD 3MRLB 1A5FH 5C8JA 1OL0A 4MQ7B 3CXHJ 3EO9L 1ED3A 1DBJL 3MJ7A 4GG6A 4YWGL 3MLVH 4PJ5A 4F57H 1X5YA 4DZ8A 3N50A 1GCFA 2OQJA 1YN6A 3V4UL 4XXDB 1LNUB 4W6XB 4YDIH 4POYA 1V8HA 4YBHA 1MRDH 2CLZB 2W0FA 4PY8I 1CZ8H 2ZSWA 1MI5D 4LEXL 3MLZL 5ICXA 1KTLB 3PJSB 5D6CA 3T0WA 1UM6L 3G6DL 4P57A 3MRRB 1HI6A 2UZIH 4MVBC 4UDUA 3FAXA 3P9WB 3LKPB 2EDDA 2GJ6B 4P3DB 5FYLE 3D9AH 1CICC 5HI4D 4ZNCD 1SMOA 4PGJA 2UYLB 3MTRA 5F44A 4M7LT 3S3SA 3AS0A 5K9OA 4OI7A 5E08L 4BM7A 3WHE1 5CJOH 3GIVA 1F6LL 5L88L 4J3WA 3SJVB 5BRZD 3B8YA 4G8FB 4Y0GA 3QEQD 5ANMB 4BH7B 1GGIH 2Q3AA 4LSRH 4HH9A 4UI2A 4E0RB 2VR5A 5C71A 5F1NA 5EZLA 4NUJB 1ITBB 3MACL 1KEGH 1RJYA 2APFA 1U6AL 5MEND 2CH8A 3MJ6A 4L29A 5FDWA 2LU3A 5EA0H 2P45B 4NC2B 3GSRB 4XP6L 3VXOA 1P9MA 1DDHA 2J6EL 1EBPA 1IAII 3JSSA 3KJ6L 8CGTA 1NGYA 1OP5K 1MJ8H 2YD3A 4XCCL 1A3RL 1KCUL 5DD1H 2QQQA 4RMWA 4N0UA 3MCKB 2ENYA 1DR9A 1OSPH 1HDMB 4JPIB 1HEZB 1T2XA 4XX1G 3F12B 4OFPA 2PO6B 2OJZH 1ZANL 2ZUTA 3ECBA 3VXSD 4U6XB 1QLFB 1NCBL 1IQDA 1LQSR 1FNAA 1Q9OA 3KLHC 3V6FA 4MXVF 4FQQB 3V6OE 2XOTA 3QQ4A 4HJJH 1VACA 4BYHA 1MAMH 5DHXB 3MRGB 12E8H 2EDYA 5HYFA 1NEUA 1OQOA 2BNRA 4PR5B 4Q97A 2Q8AL 2H32A 5HHME 2NY1B 4HXBL 5EBLA 3OJ2C 5K9KB 4NKIL 3V0AC 4PJ8C 2GHWB 3LKSA 1T0MA 4AENB 2F8XC 1I4FA 4PJGB 1G6VK 4JPVH 4RGNC 4PG9B 1IGCL 3RDTC 4Z7WB 5CD3A 2P48B 1AGDA 3SDAD 5DRWB 3RL1B 2Q1EA 1NGPL 4UMGA 3QUKB 4PJHA 2NY6C 4LCWB 3WFZA 4J3XA 3VXUD 1H3TA 4RAVA 3K46A 3GMOB 3K0WA 35C8H 4HQQH 2A74B 3TZVA 2FJGB 4NO3B 5MERA 4I0PA 4JZNA 1P53A 3X3FL 3FT2A 1QFWI 1JRHL 3W11C 3O0RL 3FB8B 4AG4H 1EEUA 1HHHB 4FHBD 3VFNB 3W0WB 3UZQA 3FRPG 5ADOH 4LVHC 4F80A 3FN3A 5I18H 3QNZA 1CGVA 4Y16D 3HFMH 5CBAB 3WYRA 1AGBB 4MNGA 3AM8A 2DJSA 2Y5TA 4XPHL 3U7AA 1S9XA 2ZJSH 3UX9B 5I76A 4Y4HD 4G42A 1ORQB 2QTEA 4DTGL 4GUPB 4XB7A 2XZQH 1X5KA 2X9YA 1CXFA 2ZKHL 1MRCL 1V7NH 1P7QB 4LRIA 1OCWH 5ALBH 3WIHL 1XCTA 4FQIL 1YPZE 3LHPL 3MA9L 3PWJA 1A6UL 3UTPE 2Y1VA 4LKXA 3TA3B 3MBEA 4IRSD 1GOGA 3H7LA 4PRHB 1OARH 3DI2B 4FQXB 2C1PB 4J4PC 3H9YA 4IMLB 3SGKC 3FQTA 5KVGL 4FQLH 3LEYL 1M4KA 2GQHA 4KRPC 3BVNB 3BP5A 3OPZH 1WSST 2EECA 2PNDA 1KIRB 4CADA 1HHIB 2VAAB 1FJ1A 3L1OL 5D7IB 5TFSL 2DQCL 2VLKA 4V1DB 1D5BB 4ZYKA 3MLYL 1P7HL 1KLGB 3NABH 1LDPH 3KPOB 3OB0K 1IAMA 3GFUA 3GNMH 5IESL 4LLYB 3MRFB 2E27L 5D2NB 1IGFL 1JCKA 3HZKA 4QHLB 1L9NA 5F7DA 3FOLA 5T1LA 3HTLX 1YEKL 5D1QC 4LKCA 2NY7H 3L5WB 4N0RA 4UQ2B 5E2TH 2Z4QA 1F3DH 1MJUL 4OZGB 5IK3A 3CXDL 2AI0L 2Q20A 4POUB 3MREB 4ESKA 5IG7A 4X6CA 3L5XH 3EYVA 4H20L 4KTEL 1U3HA 3OF6A 2VDML 1AI1L 1XGPB 1EHAA 3SGJC 3GBML 2R1XA 5DJ6A 1MCRA 1KXQE 1S9YB 5GRZA 1MWAL 5ISZD 2GEEA 5BO1H 3QUML 3NFSH 1NC2B 3OKOA 4X9FA 4PY7A 3TT3H 3I50H 4M8QB 1YY8B 3DOSA 2E6QA 3SKMA 1K4DA 3GB7B 4F15C 1M7IA 1ZS8B 1RUML 3RUGE 1FFQA 4ZTPL 3NPSB 3FT4A 4GQ9H 2EO1A 3B9AA 4OLXL 4U7MA 3T2QA 3OKNB 1CFBA 1NMCB 4HIXL 2QADC 3I84A 5EOTA 3OGCA 1EO8H 4ETQB 1OAYH 5KVEH 4YDIL 5FUOL 3QIBC 4YAQA 1HKLH 1MRDL 3F7QA 1VADA 3IDMB 5I8CB 5J9PA 1CZ8L 4GKNA 1EHLH 1IGTA 1ZA3A 1NCWH 2IADA 4JO1H 5T3ZL 1QSFB 1UQSB 1M6OA 5GGQH 4D8PA 4L3CB 3U36A 5HVHB 1BGXH 1G7JB 4R4NC 1I3RA 5B38A 1HSBB 1T7VA 1JHTA 1U8PA 3NACL 5L8KB 1WEJH 4C57C 3D9AL 1HINL 4OLEA 4HUXB 3TCLA 4JO3L 5A16A 5LWYL 4LCCA 2DQDH 5B22A 5L7XH 1DE4B 3MRCA 4WUUA 1FNFA 3O11B 3HNTL 1LO2L 4WVRA 4OLWH 1LHZA 3DURB 1H3GA 1RUAH 4QRPB 2XZAH 1CXLA 3T0XA 3TYFA 1J0IA 4XNQA 3QULB 4JFPA 4G43A 5B21A 3MX0A 5IGXH 4L8BA 1NEZG 2BFVH 5JHDD 1K8IA 2EDOA 2YRZA 1J8HD 3IVKA 3V5HB 1FZJB 1T1ZA 1FV1B 5AZ2H 5EA0L 1ZHKB 1N5AB 4EEEA 4PYGA 4X7FC 3H9HB 3DRQA 2XTLA 2WANA 4JKWA 3VGDA 1PKQE 5I71B 4JHAH 2WZPD 5C0BB 4BQ9A 2FEEI 1JTPA 3MBED 5HHOB 2JJTA 5K9JL 4TTDD 2VJXA 3KPRE 2RB8A 3C60A 4LSPL 4MLSA 1I8MB 2V5SA 2AJSL 5DJZB 1WT5A 3T77B 2NY0C 1OSPL 4M7ZB 3WN5A 4ZFGL 5EUOE 3HMWH 1LP9B 3BAEL 1KELH 4JFXA 2ICWA 43CAA 1BIIB 2W92A 4LSSH 1RHHA 1S7TB 4HIEA 1CXIA 5I8EA 2FYYA 2Y7QB 3IDUA 1T5XB 3BPNB 4P46D 2NTFA 3FO1A 1AHWB 4YHKL 2CUIA 1R0AL 4OZFH 4EIZC 1CT8B 5DQ9A 1AKJA 2R2BA 2WBWB 3ORJA 3QWRD 3O4OC 4PJBF 3BPOC 4AEIL 2A77L 4PV9A 4P3WA 4W70A 5DRZA 4NHCL 1SJEB 5IW6A 4WW2C 3UPRB 4JPVL 1QNZH 4YFDB 4MNHB 4HV8B 3FB6B 4QOKE 3U4EA 4D9RE 4YBLB 5CLWA 1H3PH 1CD1B 3D2UA 3BXNA 1ZLWK 3ARUA 4ZFOL 3BQUD 4M1CD 3PWVB 4G6JL 1C5CL 1PEZA 1U8QB 1IC1A 2DWDB 1J7VR 2ESVA 3CH1A 4GBXB 1S7WB 4JRXB 1Q72H 4M03A 2AK1H 3SDYH 5I18L 2P8MB 3HFML 4J2XA 5DGQA 2OX5A 3X12A 4HXAL 1RZ8A 2UZXB 2PXYC 2L7JA 1OD7A 1QG3A 1MJJB 1W0WB 3NIGE 3QFJE 3O4LD 4N90D 5TDNA 5KSBF 1T89C 5GRJH 1BBDH 1VERA 1OCWL 5ALBL 4KGLA 5C0AB 5IEKB 4HWBH 1ZT4A 5FO7A 1KB5H 1OAKL 5A3ID 1ZGLA 2GAZB 4IMKC 1IC5L 1A1MB 4JG0L 4MQXD 4M6NH 4MJ4A 5GS2H 1EHXA 2ATKB 4HJGA 4DGYL 2VQ1A 2X40A 3FTGA 4ZD3L 4IHOA 4CN1A 1QO3B 1P6FA 3QH3A 3RNQA 4NRYB 5FGCB 3HPJB 3ALXA 4R3SB 4FFYH 1F5WA 1RY7B 3SDAC 2V9RA 3SDXF 4Z7UA 3ZYZA 1PY4A 2JIXA 4OF8A 4HDIB 3MV8B 4W4NA 4FG6D 1LDPL 4BQBA 4ODWB 2A1WH 5T33L 2HYMA 5IVXF 2BHYA 4WUUD 3G6AB 4NC1E 3QIUB 3KPMB 3MNZB 4QRSB 1DLHB 5MEQB 1FL6B 2PYED 4JPWL 5IV2A 5JOEA 2FIKA 1OP5H 5DUML 4F7MA 4U1KA 1RZJC 3NIDE 4OGXL 4Y16C 2V7HA 5J13C 5E8DH 2H2PD 3SCMD 2YXFA 3A0OA 2SEBA 4HK3N 3WUWG 5D5MB 1DLFH 4WU7A 2FWOB 2JJVA 4OSUH 3WDHA 3U46B 3W82A 4PGZA 2VC2L 4MXWL 2QADB 3SE3A 1W8NA 2J12B 2MCPL 2DQEL 1JE6A 5DI8A 3UTTB 3K8MA 2X05A 2LFGA 4PRPB 3QIBB 4K9EH 5D7KE 1IM3B 2VAJA 1BD2A 1G1CA 3DGCR 5BO1L 2NX5E 3NFSL 2AJYL 1BJ8A 1NQBA 4NKOB 4IRSC 2VIRB 3I50L 3ZMRA 4TSBL 1KN2L 4HGKC 3FO9B 4CAGA 1RJLA 3H9SA 4BQ6A 5IJVA 1VFBA 4NN7C 3WE6B 2Y07L 2IBZX 2H8PA 3G6JA 2HKFH 4O02L 3INUH 4GQ9L 4MX7A 5GZND 3DXAB 3GBNH 4HZLA 2P5WA 4I48A 1JF1B 1NAML 1KB9J 5KANI 1KTDB 3B2VL 5KVEL 1I9RH 3DGGA 2WMPA 2FATL 4LVEA 1HKLL 4WY7H 1MNUH 4P2OA 1FVCB 4H8WH 5FCUL 1QFUL 3DJ9A 4XMPL 7FABH 3MCG1 5B8CB 3DVIA 3BI9X 5EH1A 1MHCB 5LGKA 3LQAC 5K59F 5DEZA 2BXYA 3ZO0A 5IBUG 1PD6A 5GGQL 2HJKB 2V2TA 4KK6D 1T1XA 1IRAY 3ULUD 1A7QL 1G7IB 1BGXL 4GW4A 4EUPB 4ZTOH 2V2XA 1DBAL 1X5GA 4PJ9B 5DVOA 3N85L 4X80H 3T0DA 4NUGL 3BRFA 4KGJA 1WZMA 3CJJA 1JI1A 2YPVH 1A7BA 1MCPH 4RIRA 2VQTA 2EYRB 3O3UN 5E9DB 1MVUA 3WJJA 2KH2B 4MJ6B 3D2UD 4O2EB 2BC4A 1UB5B 2OR8A 5BZDB 5HI3D 5IQ9A 2IPKA 4OLWL 2PTUA 4ZO7A 2XZAL 5D7SH 4JDVA 2DRUA 2VITA 2P49B 5KN5A 5IGXL 1X5FA 1YNKH 3BD5A 1UENA 2NY0B 4HC1A 4Y4FD 5A2LH 1FRGL 1HHJB 1L0YA 5JPNB 1S7RA 1KACB 5DUBB 3MO1A 4UV4L 4OFIA 4J3UA 1CLYH 5ETUB 5AZ2L 5D6DC 2H26B 3BZEA 2HFFB 2X4UB 1R3LB 4RWYL 3U4BL 4X83A 4YO0B 3IAQA 1T66D 3MV11 5HHVL 5GSRB 2P42B 4WI7A 4PB9L 4EIGB 2ZCLL 1D5MB 1JTTA 2G60L 2J8UF 4JVWA 5CIPA 1OGTB 1BF2A 1IBGH 5FA4A 2CIIA 3QHFH 5FKAA 5KS9B 3KPTA 2VNCA 1V5JA 3MLTA 1U95B 3QG7L 5HGHA 3HR5A 4G3YH 5D7LB 2OTUB 4KMTL 3IKCA 1FNEB 4HFUH 1U41A 4LSSL 2XPGB 4M43H 1N59B 1MVFA 2C4FU 2FZ3B 4KK5D 3SKNA 1RZGA 4ELME 3V5KB 2P44B 1F02I 4WO4D 5HYQB 4LASL 1UACH 3MRPA 3VXTB 2Q86A 1IAOA 4YHYB 4NM8H 4ZAKB 3RPKA 3DECA 3EDDA 3JUZA 1ZLSH 3LSOB 1F90L 3RL2B 3JWNC 2A6DA 4NNYA 2DMBA 1FN4A 1QNZL 1A4KB 2PTVA 3V0WL 5JXEA 4ZO8A 2PW2B 5FIEA 1RQ5A 2PXYB 5I75C 2YD8A 3FFCB 3EO0B 3FHQA 1H3PL 3CX5J 1QBBA 4FFZH 1EH9A 4O2FB 1LO5B 3MUY1 1JPSL 1ADQH 2YBRA 3MRQA 3LN5B 1BJ1H 2IPUG 2G5BB 1A6TA 5TH2B 1CGXA 4MD4B 1MIEH 4LRIC 3KPSB 2YK1H 5IOPB 3TBSA 3CC5A 2WV3A 1IZJA 4QRRB 2P7TB 3D25B 5DRXB 3MBEC 1P5UA 4GKZB 2D7OA 3K4AA 4BH8A 4JDZB 2R0LH 2C1OA 3V4VL 2F58L 3GSUA 3QJFB 1V7MH 4JY6B 4O5LH 4O51A 1ZLVK 2DQGH 2F53D 3UAJD 1LO0H 3MYZA 4JKPH 4ZPVB 3KLDA 3NN8A 2DQUH 4X4ME 3HPLA 4HJ0C 1N6VA 3TPUB 2FECI 1NBVL 4AY0A 2P5WD 3QO1A 3PQYE 3MODH 4P23D 4P46C 1T7YA 5BQ7A 1RUKH 1HSAA 3BE1L 5L2KA 4BSWA 1F4HA 4IOIB 4X6FA 1UB6A 1MCSA 1EEQA 1CVRA 4S1RH 1U8KB 2MMXA 2CSPA 5GPRA 4Y5XC 2P5EA 1DQQB </