2M8XA

Restrained cs-rosetta solution nmr structure of the cardb domain of pf1109 from pyrococcus furiosus. northeast structural genomics consortium target pfr193a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
MEFPDLTVEIKGPDVVGVNKLAEYEVHVKNLGGIGVPSTKVRVYINGTLYKNWTVSLGPKEEKVLTFSWTPTQEGMYRINATVDEENTVVELNENNNVATFDVSVVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07705 CARDB CARDB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m8xA00
3BO8A 1UC6A 1FNGB 1OAUL 4WVRA 3GNMH 3BZDA 2Z35B 3ELAT 3HN3A 4WI4A 4BZ1L 4QXGL 3KYMA 2FJGB 5CEZH 1TVHB 2E6PA 3KYAA 1WWAX 5IVXA 4Y4FA 4ENEC 3DRQB 2E7CA 2V2WA 2ZKHH 3T0AA 1XGRA 1TJGL 3ME0A 5T3ZH 4QHKI 1IGYA 1CGSH 4PJBF 2HT2C 1I9JL 1NMBH 2XG5A 1U3HC 2GSIB 3QEQB 1HIML 1TTFA 5FYKH 1UXWB 1V7NL 4PJDB 1MCSA 2AJXH 4PG2C 5FCUH 5TF1H 3SJVE 3FQWB 5I71B 1VFAA 2OTWA 1TNNA 1EO5A 2YK1H 1A6VL 3GMMB 4CUCA 2ATKB 5FO9A 3F62A 2P43B 5HI4C 4HC1H 3L3GB 5I9QC 1U3JA 3MV7E 1UZ6F 3MOAH 1U93A 4Y1AE 2Q86A 5I8KL 1OTUC 1U95B 3C8KA 2VWEE 3U4BL 2I27N 5EPMB 2R1WA 4ZNEE 1MUJB 1QFUL 3RI5K 1UVQB 1RIVH 3SHSA 2E8YA 1IAKB 4U0RC 1BP3B 1I8IA 3KLAA 4YX2H 4NJAH 4NQUA 4MWFB 1S7WB 2GJJA 3IS1X 3IAPA 2F15A 2XKSA 1RUQH 2R9HC 1IT9H 3UPCA 2QQQA 1EMTH 2AV1A 3C5SB 1J18A 3P9MB 2W65B 2Y23A 5EU5A 4TSAH 2VABB 3PWVB 1JGVL 4FQXC 4D9RE 1FG2B 3I3DA 5D72H 3D69A 3D85A 5ADPH 1DQDL 3UEZA 3O6ML 1OB1A 1HZHL 5KN5A 3D48R 3MOQA 5T3XD 4QRRA 5JNYB 4PJGB 3T4YB 1OTTD 2ZNXA 4E41D 4RNRB 5IQ7H 1MJ7L 3V4PL 2VXSH 4K94L 2O61A 3TH2T 2AJSH 3ABZA 4NIKB 4XNXH 3C2AH 4FFYH 4PLKD 4OLEA 4Y1AA 4N8CL 3HAEA 1SEQL 1F11A 3W0WE 1CF8L 2Q8AH 2COQA 3I02A 1NANI 5BS0A 3BH8A 3MACH 5E2TL 1WFTA 2HG5A 4HH9B 4XMLH 2NTFA 2GJ6A 1CU4L 3BYYA 4LLQB 4XHQA 3BPCB 5JW4Q 2F54B 4H8WC 3O3UN 3U0PB 4ODSL 1ACZA 1Y6NR 1YEIL 1IQWL 4PJHB 1RJYA 1FYTE 4ZOEA 2GAZB 1QBBA 5GGTA 3TIEA 2HVKA 1KF9B 1TFHA 3LIZL 1PQZA 3W9DA 2V7NA 5BXFA 5K59F 3BW9B 2ZZUT 1YMME 4U6YA 3CMOH 2DIAA 5IVZB 1A3RH 1AP2B 2QQKH 4NQDD 2ZP0T 4HLZG 4KKCC 3C6LA 5ICXB 4GUPA 2IADA 5F7LB 1MHCA 4DVRL 3S35X 1G1CA 1G6RL 5GGVY 3SDYL 2FR4A 2N56A 5DJ2A 1GC1H 1EGJL 5BQ7B 2J88L 5DDHA 2EDLA 1YYMH 5DJYB 2CLZA 1FV1B 5FYKE 4F9LA 1KB5B 2L0DA 1SBSL 4YBLC 4KJPC 4NKOB 4MD5B 3BVNB 1X9QA 1B0RA 2F53E 1KACB 2FZ3B 3GKWL 4FQXB 3D0VA 4Q6YA 4U7MA 1JWUB 3OJMB 5ACLA 4XNUH 4QRQB 5D1XB 4PJ8D 2FYYA 3MGAA 5KVDL 4P9MH 3N9GH 2X4OB 4OIBA 4X6DE 1ZEAL 1DLHB 1OCWL 1MCWM 1ZGLA 4PGCA 2PN5A 2ZUYA 1ND0B 2OM5A 3VDAA 5KVGH 5DHVH 3HZVB 4QOKA 5EBLA 4M6OL 1RVFH 4YQXH 4XMPH 3KNBA 3MOBH 2OLDA 5IMLB 4KTDL 1Q9LA 3QUYB 3TNNA 1PKQA 1CI5A 1LD9A 4OF6A 3DNKA 4JDTL 4P5TB 2W91A 3GMNB 3K74B 3O8XB 4PJDE 3TZVA 1WK0A 2DLIA 2GTWB 3TH3T 2DJSA 4PJ8B 1IGIL 3ARFB 4JY4B 5E4EC 1A2YB 5CCKL 4PTTB 5EUOA 1RJLA 3DMMA 3BPNB 2CJUH 4U3XA 5J1SC 1A1NB 4YHPA 3ZE1E 1EDQA 1WBYB 2EICA 2VZ1A 3H7BB 2A2QT 1SBBA 1Y6KR 3BPNC 5DSCA 4MXWL 1OWRM 2YN5A 5HGDA 1OAQL 4XMKH 5ENWA 5JA9A 5KZCB 5ADOL 2AEPL 3IDMA 3S8WA 3QUYD 2VTFA 1LDSA 2VUOA 4NKDB 1MI5A 1U8NB 5EIIA 4OUUA 2VDLL 2OSLA 1H3GA 3VFNA 4JY5H 1LO0L 3RZCC 4PV9A 4OGZA 4OGYL 1I1CA 4NCC2 1B0GB 3MV11 3UJIH 1CDCA 2WAHA 5I1AB 3KPQA 3TBWB 3CFEA 3AB0B 4O58H 1KPRB 4IRJB 3LEYL 3RTQC 4F3FB 3QEHA 1OHQA 1DL7L 1U8QA 2PXYB 4XP6H 1M7IB 1L0YA 4M48H 4JPVH 4M4PA 1T7VA 2FWOB 3GK8H 4OLWH 2HRPH 1OT2A 4JZJC 3PWUA 3VE0A 1ORQA 4HUNB 1W72B 3KPRB 4Z7VB 4B7IA 5D93B 1YEHH 1MCJA 3MRLA 4OI7A 4XNMA 4PRPB 4XPAL 4HW6A 5KSBA 1I1FA 2EDFA 2DQTL 1KPUA 4CNIB 4LCWD 1YEKH 3D1MC 3WYRA 1AQDB 5FF6B 5I19L 5T33H 3VFWB 2GJZB 3H0TA 1PY9A 4RRPA 1ZHBB 4L3ED 1AQDA 2PYED 2DMBA 4DZ8A 4EUPG 4TUOA 1IM3B 1OD7A 1QKZH 4HUVB 2BVUA 1AGBB 3ULUC 1VGEH 3WIHH 2EDOA 4YHLL 5EWIH 5D1ZD 5CD5C 4HJJH 2NX5B 5IFAL 4K3JH 3LSOB 3E8UH 3DXAB 3HS0A 3L5XH 1UCBL 4LSRH 1WGOA 3C87A 3KPRD 1EV2E 3QJFB 3QIBC 2FEEL 1NAML 4HJ0C 3ULVD 4Z18A 4R7DA 3O3AA 3UX9B 2W0KA 3B83A 1M7IA 1XF4A 4X4XB 4K7PH 1SJEA 4YR6A 2AK4E 3OSKA 1EMTL 3D3VA 4R4BB 1YMMA 2IH1B 4S11A 1TZHA 3CFDB 1W0WA 3QO0A 4MNGB 4HUUB 4C54A 3CFEB 3GRWA 2JLLA 3LQAC 5I1AA 5EO9B 3TA3D 4NCC1 1Z6JT 1A4KA 1B4JL 4CGTA 4CJ0A 5IHLB 1VPOL 4IM8A 4F33A 5ISZB 3PWJB 5IBTL 4WI9A 3RNKA 4FQIH 1QNZL 2PETA 1MOEA 3JV6B 3K1DA 5IR1A 2GY5A 3MO1B 1FLTX 2AK1L 4XCFH 3BT2H 4LCIL 3ARBB 1UM6L 3MYJA 4NQCB 4HIXH 2XY2A 4YGVB 5K9KA 4X5WB 1T7YA 1QLFA 3CXHJ 2P8PA 5AYUH 5CEYB 4XXCC 3PQYB 4TYUA 5FHBH 3UP1A 2IGFH 3FCTB 2DTMH 1XF2A 3JVGC 5JTWA 1FQ9C 3TZVB 2IG2L 4APQD 5GZOD 3QFJD 3BWAA 3TNMB 1ZLWH 5KJRL 1SY6L 5MP6H 4P5TA 1JRHL 3TO4B 4Z78A 3B2UD 1AFVL 5ALCL 4M6NH 1BM3H 1EA9C 1E27A 3I6GA 2HRLA 4WW2B 5DT1L 1AGDB 4X6DB 4HMEA 4IBLT 3ARBD 1LO5A 4OF7A 3GMRB 1JNHA 4KH2A 1HHHB 4X4MA 5TGBB 1X5JA 4WO4C 4OFYA 3WN5A 2P48B 4HKBB 4NUGH 3BDXA 2GFBA 1Q9KB 4HS6B 3HE7B 3EDEA 3PQYD 5C07D 5C0GB 1N0XL 2QSCH 5J3HD 5CSZA 3FT3A 5EBGA 4GKZB 3NFPA 2R0KL 3VMOA 5EU7C 1MLBB 2D9QB 4KC3B 5FYJU 5T1MB 4PLJD 3WXVL 5CJQL 4CN4A 1TZGH 4M61A 2BSED 5TDOB 3OJ2C 3GHBL 4PJGF 5DQDL 3V7AE 3O2VH 3IYLW 3HTLX 4XVUD 4HCRH 5H35A 5I18L 1DBAL 4NUJB 5EUKB 5JQ6H 1XCQB 4DEPB 5I1KL 2VWEC 3RTQB 4KZEH 4NN6C 5I71C 2DM4A 3FT4B 3KPTA 3V5HB 4Z0BH 2MPAH 1XEDA 2FGWL 2KBGA 3VWKC 1NCCH 2CKBA 4YQXL 4Y4HA 1HI6B 4Y19E 1GZQB 4ZUUB 1P6FA 3U6RB 5B21A 3WNLA 4WENB 3HE7D 2CRZA 1GGIH 3RRQA 2VOTA 3O4LB 4KRPB 2BP3A 2XIDA 3N1FC 4EI5B 2ADIB 5DZNA 1WAAF 1JGEB 3NAAL 4YHIA 1QO3B 4M6MH 2ZUWA 3PF2A 4HBQA 2AJVH 2HJKA 1J0YA 2XQBH 4LLYA 2DQJH 3OGCA 3T0ED 4PJEB 1T1YB 2CJUL 5FYKL 2DWEB 5EBWA 2VIRA 1FNSL 1P2CA 1UWEL 3DUUB 4ZPTA 2ZSVA 4U3CA 5EO0A 4MZ2A 4N0FB 2DYPD 3OR6A 2XKNB 1T20B 2FECL 1HKLH 3EDJA 5E8EA 2P7TA 3QG7L 5IKCB 3VJ6B 5CJXC 3AAZA 2A9ML 1U8MA 5TQ0H 1NKRA 4XNYH 2BHUA 4GAYB 3GIVA 3E1F1 3BP7A 3EYUL 4EI5A 4UILH 3WHXB 4TNVK 4X80L 1H3VA 5IW1A 4NC1C 5CP3A 5E9DE 1UZ8B 3T0EB 3U7WL 2R4RL 3O11A 4XC1H 5MENE 5LGJA 2ITDA 1CTNA 5EUOE 1S7QA 5D7LB 4HJGA 4HFWB 5C2UB 1U6AH 4N90E 4JPVL 3L3KA 2LV4A 5D1ZC 3RY6A 1PBYA 1MQ8A 4NQCE 1KXQE 5DC9B 1F6LL 3HMWL 3D5OF 4OI9A 3LEXB 3DX9B 1VESA 5MEND 2B5IC 1MQKL 1QSED 4GSDH 1RZKC 1RIVL 2AV1B 2EO9A 2QADD 5I0ZA 3S37L 4HZAA 5IESH 3NFSL 4HXAH 4W6YB 5F97E 2HT4C 3NFPB 4Z95L 3T0VA 3MLPA 2YD5A 3MRFB 2GFBB 5JIIA 1R5WA 4JDZB 2Z93A 5SWQA 4NO3B 3LKNB 1KELH 3IFLH 4CDGC 1XGPB 1UA6H 2P24A 1RFDL 4AT6B 4FQ1H 3WLBA 1T2JA 3JUYA 5SWSA 2CUHA 1U95A 2DBLL 3DWTA 2RQ8A 5LXGL 5DS8A 1A9EB 5EORL 4AL8H 5MHSD 4P2QE 1X7QA 4JHWH 1E27B 1XR9A 5EC1B 3MC0A 1DSFH 1RY7B 3AGVA 2QHRH 1OSZA 5GGSY 5DJCB 3TBTA 3KPSA 2OZ4A 1NEZB 3L3DB 2ICEA 4OFDA 5DD3L 3VDBA 4GAGL 5C6PB 3MCLL 5CEYA 5I76A 3V52H 3D25A 1UACH 3VXQA 4P3CH 4Z7NE 3RWGB 4XBEL 4I4WB 1VFAB 2DIBA 3FQWA 3PV7A 3JVGA 1UXWA 1L7IH 5E99H 3TBSB 5E6IC 3GRWL 4EOWH 1RZJC 4O5LL 3ILQC 4U0QB 3CDCA 5I8EB 3SKNB 1Y18B 1F3RB 5F3HB 3LIZH 1E28B 1NLBL 1PAMA 2FX8L 3DRQA 1F02I 3ZTJG 1MCEA 2KKQA 4QXUL 3PWJA 4QRUB 1BD2D 4LFHG 1QQDB 4HUKB 4BZ2L 2PW1A 4AMKH 5CFHA 2OR8A 4DFHA 1F4XL 3DVFA 4P46A 3GMQA 3PHQB 3N1PC 5MERA 4Y88A 3OKKB 5L8LB 1MIML 1NC2B 3HG1B 3K2UL 4HUUA 3IJHA 4GBXB 3I75A 3X17A 3NA9H 4MQ7A 2VB5A 3U0TA 4TOYH 1JBJA 4B53A 4OQTA 4JM2B 5JQHC 2YHGA 2OTPA 2PUQT 4R7DB 3NFNA 5D6CB 4M93B 1C1EH 5DJ8A 1GVIA 4W6XB 1N59A 4GKSA 4WI2A 1XCTB 1T1ZA 5BV7L 3G5YB 4P5MA 3NH7L 4QY8B 4Y0GA 5CKGA 2IGFL 1N5YL 3EYQC 1JN6A 2PNDA 3BE1H 3QP3A 3FJTA 1LP9F 2Z8VC 4WJ5A 1K8IB 5ACMA 5HI5D 4CADB 4P59H 2GCYA 5ALCH 2ZOLB 5ID1A 1A7NH 4ZUVB 3SGEH 3NA4A 3KVQA 2O5ZL 3ZHKA 3HE6B 2G5RA 3SDCC 2X4TB 3BKCL 1A7RL 4YXLH 1I1FB 2A1WL 3WEXA 4XNMB 3F7QA 4DJMA 4ZPVB 2ZG1A 4POYA 3MLRL 4X6BB 5JMOC 4LCYB 4YPGA 3B9DA 2BOBB 5I17A 4JGMA 2ZUXA 4C56B 12E8L 1ZWIB 4GG8B 1ADQA 2NW2A 5B3NA 4R8WH 3NZHH 5FOJA 3P30H 1RU9L 1CICD 4ZS6D 5CBEA 4Y4FD 4ZXBB 4HWBH 2VDML 4H1LG 3PV6B 4RISH 5FECB 1V7ML 2X4QA 4XB8A 4AEFA 3F6IA 3ARWA 2F58L 3GSUB 3MROB 1LO4L 4JHBA 4GO6B 1INDL 5IB3B 3MRRA 4K71C 2HKFH 3U4AA 1CXLA 1BBDH 2UYLB 3SKMA 3IDIA 4M43H 3MRPA 3GIZL 2MWCA 3CX2A 2ZCKH 2CDEB 4JKMA 4RFEA 5SX5H 2NCMA 2AJXL 5FCUL 4ELMB 5F1OB 2V2XA 4P5KB 3WDJA 3JWDH 4C56D 4FABH 3W0WD 4LIQL 3CIQA 2J1KA 3BOVA 3O0RH 3R4DA 3U46B 4OFVA 2A77L 4BUGA 5HHXL 1ERNA 1T6VN 4PLKC 1RZFL 1OAKL 1NJ9B 4XXDA 3RQ3A 3WKNA 1XAUA 3TP4A 1JYVA 1CFTA 1A2YA 5DGRA 3WHE0 3EO0B 1GH7A 1I9IH 3EDKA 1S3KL 2XWJA 4W4OC 2HMIC 5HXMA 4YAQB 5DYOA 2VR4A 3O8XA 5E2WH 4DEPC 2V5YA 5C0EA 4XPGH 1QBMH 2YKLH 3EYUH 4JQVA 2DS4A 4G9FD 3L6FB 2HT4D 5CILL 3QUYA 1QSFD 5IFJB 3QDJE 3TT1L 5C09A 3MLTB 5DJZA 3F12B 1XGYL 3EYOA 1HINH 1TQCB 1NSNL 4CN1A 2BRRL 2VDNL 2VXQH 5E5MA 2WUBH 3ULUE 1N5AA 1YPZF 1P7KB 3MLWH 5IB1B 3QXWA 1DUZB 3LEVH 1Z3GL 2VZOA 1AGEA 1JPTL 2IBZX 4MD4B 4Y4FC 5GRYA 4F7PA 3G6JB 5EZOH 4OF0A 4LSSL 3SCMA 2I9TB 3SDDB 4X99B 1BWWA 1YNKL 2Y1VA 1I1AC 5E1HB 1VEOA 3RBGA 1IAOA 3QHFH 2WBKA 2JCCE 5I6XC 5ID0B 3LZFL 1I3UA 3RUGB 2NNAA 5MEOB 1LNUA 5HDLA 4J3XA 5HGHA 4M5YL 2Y36L 2DQDH 3U9UA 2CPCA 2E9JA 1UH3A 4OLXH 3P0VL 2CUIA 5FO8A 3ARGB 3MNVB 1BFTA 4K7PL 4GRLC 4X8JB 5D7IB 1C16B 1MCLA 1XF5A 3RVWD 1RAMA 3L6FA 4MDIB 3BAEL 1F8TH 5C0EB 2WINA 3V6OC 4L4TA 1JNNH 2XWJB 2IPUG 5F88A 4DGVL 1BAFH 5DRWB 1ROWA 4LCIH 3B3IB 5DI8B 4IEFB 5C2BL 5FA4B 3MXWH 3W2DL 1V3KA 1CDYA 4LLMB 2VAAA 5E94B 2JB6B 4HPYH 5IBUB 3MJ6A 2IBGA 4XNQB 3MA9L 1BLNA 3VFPB 4RGMC 4JRYB 3STBA 4NJAL 3VFSB 4HH9A 4PIRF 5C0BB 2IMNA 5IHZB 3FQXA 2OI9B 5ESQB 4ONHB 3WL9A 3BGMB 4UAOC 3WIFA 3L3OB 1KC5L 1KIRA 4L1HA 1HQ4A 4OZHE 4XNQA 1GXEA 1I1AB 2K3TA 4M6NL 3SDDC 4OF8A 3D3VD 3BDYH 4OCSL 3QI9D 1A02N 3ESVF 5JXEC 2FH6A 3OKOA 2GI7A 1F58L 3AVEA 4G43B 4QRRB 5FECA 2D31A 2IF7A 4L4JA 3RWDA 2APBA 4LRIA 2GYSA 5C0DA 3UTOA 1ZT1B 1IGML 1ZWIA 3FQTA 4BH8A 3D9AL 5C0BD 4XCNA 2CR6A 4NOBA 2L7JA 2W65A 4ZAKB 3O6LL 5IB2B 5E7BA 2UUDH 4M7JH 1E4WH 3CVIH 1RJCA 2ERJB 4OQTL 4XWOD 4MMZC 2V9TA 3PWLB 4LF3A 3WUWB 1MFNA 3GGWA 4HKZB 4PJBB 3LY6A 3R0NA 1CLCA 1IEAB 1M05A 2WIIB 1G9EA 2VKXA 4D9LL 1BBJA 4FOMA 5FIEA 2NY3D 1N5YH 4QRRD 5KVGL 1NLDL 1MY7A 2VZUA 4HLJA 4OZHA 3DGGA 3P4NB 3WO3B 3ESUF 2NYYD 4K3EL 2DQHH 3FMGH 1MI5E 5GSVB 1KCKA 3C09C 3KS0J 5CHNA 5IB1A 1S9WA 4DUXA 4QY8A 4JN1L 3VXRB 4HIHA 4ZAKD 5F6HI 4OCLC 4PB0L 2XTJC 2H6PA 4R7NB 3NFNB 3LPGA 1T7WA 2HFFA 4LVNB 5ICYB 1NFDB 1FO0L 5ERWA 4WFED 3QNXB 3O6FA 4JFFB 2FCBA 4M7LL 3RNQA 3RVTC 4PRDB 3WIIL 1WEJL 2J8UB 3U1SH 4P46B 5DMIL 3T04D 1JYXA 3G5ZB 2NXZC 4FFWC 3WFDL 3V2AR 3A6OA 4ZFFA 1KCRH 1J8HD 4JB9L 4K3DH 4URTB 5KSBE 4OLYH 2IQAB 4LKCB 1GZPB 4KI5F 1DDHB 5FUOL 3BO8B 5KTEH 4P5KA 5F1KC 3FOMA 4P5TC 2DD8L 3I3EA 4G8GD 4Z7QF 3MRHA 4S1DC 3DRTA 3FB7B 5HD8C 4I4WA 2VITA 2RFXB 4JY6A 3AB0C 3O0RL 1GGYA 4F8QA 4KRNA 1YN6B 2AJZB 1FH5L 2J8UF 2X4RB 3MRDB 5FYKU 5LQBL 1KTDA 2DB8A 4QOKD 4KK8D 1XGQB 1S9WB 3MJ7A 2QV2A 3UJJH 3H9SE 4ZTPH 1GGIL 4QKXB 4OZHB 4XCEA 2JCCB 1IL1B 2YUVA 1NC4D 4JM2C 4MX7B 2A6IA 1BIIB 3OPZL 4G8GB 5I30L 2WBJC 3HE7C 3GUTA 3LKNA 1DQQA 2YSSB 3KXFD 5J12B 3FB8A 3GJEB 1R5WB 2C3HA 4JM4H 5TJWK 3K3QA 4Q9CA 5ESAB 4LF3B 3WUWA 2YBRA 3G5XA 4WW2F 3QAZC 3RWFA 4QWWC 1ES0A 1EEQA 1N8ZA 5BVPL 5IV2B 4KK5C 4WI8A 2VJXA 2Z31B 3VXSD 3SQBA 4L4VD 1DSFL 5JXAL 3MRIB 2HFEB 1YNKH 1RI8A 4P2QA 1QPXA 5J3HC 3IU3B 1CGUA 5C0RL 2X4PA 5IVOA 1CT8A 4XP6L 4GOSA 3NN8A 2BY3A 3KPNA 4PG2A 4OZGF 5DJ8B 3QI9C 3TPUB 4EIZC 4G6KH 2UWEB 2AEIT 2G9HA 3QJHA 2NY5C 4S1SH 5T1LD 2AXGA 4U1JB 1I3RB 1U8PA 1WFOA 3BP7B 1PSKH 1EEYB 4BSWB 1B2WH 5IJKA 2BY1A 4GAYA 2AGJH 1JTOA 2EH7H 2EO1A 3LKOB 5INCA 3HG1A 3FQXB 3VD4A 5SWZA 1UB5B 3REWA 3BDBA 1BREA 4APQC 2YXFA 1VDGA 3NCJH 3OR6B 3F65A 1BLNB 3RPIB 3NIDF 5E94A 5D5MB 3QDGA 3AREA 4YHMH 5GRJL 2DWEA 1Q9OB 1SYVB 5EBWB 3V4UL 4DGVH 3ZDZF 1AI1L 1G9ML 5CBAA 3F7YB 2XRAH 1BM3L 4X0KB 3L3JA 2V5SA 4H8WH 4NZTH 5ITBH 3PP4H 3TBSA 3VGDA 4G9DA 1FIGH 3MLVL 1MCFA 4XPHL 3DVNB 4MNQB 1IC5H 4YE4H 3QULB 1AY1L 4LPTA 4YXKH 5CJOH 2X4UA 5M7QA 3MV8E 4FS0A 3HFMH 3FB5B 5E7FA 5FO8B 1FNEA 2FLBT 2R8SL 5GS1C 3OWEA 1HI6A 4XPTH 3ARRA 1D6VH 2DLEA 1TLKA 1ZHLB 3U9UB 4P2RB 5C0IB 5DA4A 4TUJA 3DROB 3BKJH 4KMLB 3BZ4B 1QFHA 4MVBC 4RMUA 1XCQA 2JK5A 5EC1A 1X7QB 2EDHA 1YNTA 2NMSA 1UACL 1A9EA 3QDMA 1DBKL 2CR3A 1BF8A 4M61B 5IBTH 2JE8A 2Z9TA 1K8DB 2E9WA 2YA2A 1JNLL 3KYNB 4HJ0D 1HWGB 3KGRA 3MCKA 4NO3A 4QRPA 4RAVA 5JOFA 1VFBB 43C9A 1WZKA 4JCLA 5IOPA 3THML 4HS6A 1FZMB 1TPXC 4OCWL 3V6FA 1CFNB 2EIBA 5HYQA 3V5DA 5GJSH 2RR3A 2FHCA 4GMTL 2VMFA 5LAXB 2PYFB 2MPAL 2FIRT 1RUKL 3GMRA 4QEGA 3OAYH 4TSBL 1JK8B 4D9LH 1H5BB 3ROOA 3P4OB 4HWBL 1QHPA 1X4YA 1XZ0A 1R3JA 3X11B 4LBEA 1MVUA 4HFWA 3BEVA 5AD0A 3N85L 5D7LA 4TPRH 2B39A 2HWZH 1N64L 2ITDB 1FVCB 1RIHL 3G6DH 4ALAL 3QXTA 4EI5C 3BMVA 1TETH 4YK4B 4HMCA 5KSAB 5DMKA 4B0MM 5F7UA 3R06A 4JM2F 3MREB 4UDUA 3RHWF 3GIVB 1SJHA 4D3CH 3DO7A 2MTPA 4G8IB 3U30C 3SDXB 2D4FA 1J11A 4NNPH 2VLRD 4PJBE 3MLYH 3RNKB 4WWID 4R96A 3TCLA 2JJSC 1WSST 4KVNL 1N0LA 1A7OH 4TVPL 3PNWB 4HGMA 5E1AA 1T4KB 3P40A 3E0GA 2I5YH 1LE9B 5DJAB 3RDTD 3ZTNL 3QCVH 2K7PA 4OZFH 5JXED 1NCDH 5JW3H 5CZVH 4U1LA 4H0GA 4LSQL 8FABA 2R0ZH 4XRCB 2HJKB 3QHZH 5E2VH 3QUYC 5F7NC 2VDOL 4ELMF 2DTSA 1Y6MR 2EDBA 5C0AD 4JG1H 2DLHA 2IPTH 3LEVL 12E8H 5ANMB 1NAMH 2CLRA 4HBCH 3HMWH 4U1MB 1IGTB 1S5IH 4C83B 4X6BA 2YC1B 1KSRA 4HLZH 1CDIA 4OT1L 5SWSD 2ED8A 5TPWL 1RD6A 3IS0X 15C8L 1JUFB 3F58H 3CJJA 5DUPL 1K4CA 1NCBL 2ADFL 2EDYA 3RDTB 3VXMA 4AH2A 1NBZB 3RL2B 4YBLB 2PW2A 1WAAA 3FN0H 4DZ8B 3H8NA 5FA3A 4O2CA 2J4WL 1UM4H 4HUMB 2ICWI 1CXFA 1RIUH 5EFIA 3UDWA 2LABA 3HPJB 4X9HA 4R3SA 1KPUB 3GB7B 4I0PA 4PJCA 3FQUB 1NBZA 2H9GA 1I4FA 2B4CH 1Q9KA 4EUPB 2P44B 1MFAH 1NDGA 3PHOB 3QUZC 2FO4A 4FXGB 4OD3L 5JW5B 2X41A 5L6YL 5KS9B 1XCTA 1ZTXL 4ENED 3VMPA 1L7TH 1KJMA 3OG6B 3TFKC 3LQMA 2R1XA 4NNXA 2BZDA 1X3DA 5GS0C 1C08A 1NGWA 3S5LG 3ARXA 4GFTB 4XPGL 1JNNL 2X2YA 5CAYB 1YZZA 3TNMA 1B3JA 3IJHB 1B0WA 5C8JA 4ZYKB 4BFGA 2H1PH 1NC2A 1JRHH 1VKXB 3MXWL 3NZ8B 2W9DH 2OR9H 4TRPH 3G5VA 3VXTB 1FRGL 1A6WH 1I75A 3QEGL 2YS4A 4NWUL 3QIBB 2UUDK 2OJEB 3IETA 1ACYH 2EIZA 5FK9A 2VL4A 2XV6B 3JSSA 3X3FH 3TCLB 5K9JL 3BD3A 3WE6B 1FFPA 1YY9D 4N8VA 5MP6L 4X5XA 5DQJB 3SY0A 3O4OB 5ENWB 1DCLA 1JWSA 3BX7C 5HYJA 1A9BB 5DQJA 3SY0B 4NRZA 2BSRB 3FO2A 4JAMB 3UTZA 3JV6A 4IOIA 3RIAF 1TJHL 1NFIB 3RWHB 4U1GB 3RWGA 4F33B 3QUXD 5F7YC 3WXVH 5I76B 5HHPB 2FD6H 4K7PX 4PTTA 4NQDE 1BVKB 1NL0L 5C0JA 5BRZB 1F6AB 3PXHA 3TC9A 1TZHB 4MNGA 2YPLD 4LSPL 5F96L 4G80A 1GL4B 1LD9B 4F57L 2AXHA 5J9PA 3AY4A 4L8CB 4K55A 4YR6B 1MFBL 1NGWB 1Z0NA 3CU7A 4DAGL 5B8CC 5IMLA 5DMGD 2Q87A 2R69H 4H1LH 4X83A 1E4KA 3MLVH 4L29B 5FUZL 5D2LB 5IW3A 1XGPA 4MA3B 1F90L 5C08D 3QIWC 2FO4B 1CFNA 1EO8H 1I9RH 3RIAK 1FSKB 3TYFB 2A6KB 4EN3D 2DDQL 2A1WH 1FZOA 5J56B 3V0AC 43C9B 2X4OA 2IPKA 5IOPB 3HPJA 5F8RC 5EFIB 2YMXL 3IU4L 4QRQA 3T2NH 4P23B 3MRQA 4PV8A 4M62H 1KJ3L 3GZKA 4PJIB 1YNTB 3WCYA 2EE3A 5KSBB 4PREB 1EGJH 2O26U 5D96B 1IGCL 2R4SH 3R1GL 3FRUA 2E3VA 3GIZH 4YHKH 4PJDF 4Y4KA 1P9MA 3C9NA 2RB8A 3GNML 2IWGA 4EN3B 4XI5C 5AAWA 3U7AA 5FYJH 4F2MB 1OGTB 2E6QA 1IQDB 1AKJD 1OTUD 4PJIE 3VMNA 2YZ1A 3U7WH 1T89C 1HDMA 4G9DB 1A7QH 4XNYL 3UPAA 3TBYA 4P23D 4FXKB 4KRPC 3W9DB 3DPBA 5HI5C 1AGFB 2FECI 2W0LA 4Z7OE 5I1GH 2Q76A 2DBJA 5ILTH 1D6EA 3VFMB 1HCVA 4ZPTB 2IAMC 1EEUA 1UH4A 4LLQA 5BV7B 4YNYA 3MJ9A 3REWB 2W0FB 2YWZA 3SDXA 4JO2H 4OM1H 1XIWA 5TF1L 2O5YL 1M7DA 4D94A 3TA3A 1MLCB 1AIFA 2P5EE 1EEYA 2VSCA 4BSWA 4NQEA 4UDUB 1E6OL 1QRNB 1L0XA 2AERT 1GGTA 2UWEA 1IFHL 4H20H 2H3NB 4XGZA 2FATH 5F1NB 3UROR 5E5RB 1OAQH 4XMKL 2A9NH 4KJYB 1MRDL 4WI6A 5DFWH 3FFCA 3Q5TA 4HUWB 3X13A 2Q3ZA 3MBXL 4LBEB 4ONFL 3TNNB 1OGAA 4XVUC 4NZUL 2ADJA 1JHTB 5FGCB 2B0SH 3PWVA 3SKJH 2V17H 1F4HA 2FX7H 2BVPB 2MJWA 5GS0L 5M94B 5JA8B 4PBVC 1IM9D 5LAXA 3HZVA 3L5HA 5CWSA 4LMQI 2IFGA 2AEQH 4RA3A 4L9DA 2HT3D 1OAUH 1N4XH 3CH1B 4Y5XC 2P42B 5C0GA 3MRBB 4UILL 4WUUB 3RA7L 1MH5B 1NCUA 1I8IB 1NFKA 2PTTB 3TBVB 3LMJH 4BJLA 4HKBA 4JB9H 2ZCLH 5F7DA 3FO0L 3SE8H 4NO2A 4JKPL 3N50A 2CD0A 3KYNA 5T3ZE 4YLQT 1LO5B 1YEDA 5C0BE 1MRFL 3R8BB 2VISB 3VW3H 4E41E 1MFAL 3MJ7B 5K9QI 4H26B 3SN6N 4GKNB 4Z7VE 3Q3GB 1MFDL 1J8HE 1KTDB 3SGKA 1MHCB 1QR1B 4TSCH 1L9NA 1O7VA 5TFSL 4PD4J 5DHYB 3L3GA 3FHQA 4GUPB 1YPZA 3TESA 1JHKL 3S37H 5IESL 4PGBB 3ZDXE 2X9WA 1N2RA 1KGCD 4FQ2H 1XGTB 1CGVA 2PYEE 1JVKA 3QULA 2ENYA 1J9CT 3TV3L 4OTXL 4E41B 1A5FH 1WIPA 4OFYD 2X05A 1A1OB 2NXYC 3VD3A 3OF6A 2NQCA 4GG6B 3TVMB 1X5YA 1JTPA 5HD8D 1KBGL 1GZPA 1J87A 1M71B 2HVKB 3MO1A 4QGYA 3M07A 4OGXL 1QRKA 4NHUB 2DLFH 4G6AC 3S6CA 3WD5H 1QFUH 1RJYB 3RKDC 5IMOB 3CK0H 4PJHA 5BV7H 5GGUA 4G7VL 4P2QD 3U0PA 5KSVA 2YWYA 3TN0D 2IAND 3NH7H 3MUJA 5J1TC 4ZODA 3ILPA 1G9NL 3RP1A 2AJ3A 1C8PA 3O45B 5BS0B 5JW4N 5DD3H 5HHQA 1ZHNA 4QYOB 3CFIC 3CFDA 1BD2A 5KW9L 1KTLB 4MAUL 3G6JE 4UNUA 3BKJL 4MJ5B 1VEMA 1T5WB 5DJ0A 4GXVL 1TVBA 2OX5A 1NFDA 1LK3L 3QJHB 1NDMA 2WBJB 3PL6B 4IDLA 3ES6A 1EJ6A 3TPUA 4KFZC 3CLEL 1IKFL 3MRGA 3STZA 5EZIH 4PJAF 2LVEA 4X4ME 4HDIB 4RAHA 3MRNB 3O2DA 1WBZB 3VXRA 4YWGH 2CLVB 3ZYIA 5JW4R 3FO9B 3T1FA 5E08L 4P2QB 4RISL 3TN0B 2HFEA 1H3UA 3T65B 3DARA 1CD1A 4L8DB 4TUOB 3GJFA 4HUVA 3TH4T 3FT2B 1TCRA 1U8JB 5EU5B 1C5CL 1T04A 3O9WC 4XP1L 2GJZA 3DIFB 1CGWA 4LVOB 5DVMA 3INUH 1PYWB 2AKRA 3MBED 5F9JA 2YBRB 1VHPA 1UQSA 3EFDH 3LKPA 5FUCC 2NLJB 5ESAA 1KTKE 4PJBA 1VSCA 2AVGA 3PL6D 4DVBB 5JR1H 3Q1SL 3CX5J 4YUEH 4UB0L 5FHAL 4Y5VA 4ZUTA 4UBDC 1MPAH 1PYWA 3QXVA 3NBNA 2GQHA 3QRGL 4XHJD 3K4ZA 1J12A 1GYAA 4HMDA 4MX7A 4QRSA 4NKQB 5HYSA 1OF2A 1U8IA 5SX4I 1QFWI 3BQUC 1U93B 3TN0A 4MB5A 1XGQA 3H9SB 8CGTA 2HVJA 2FJFA 4XP4L 1NGPH 2ICCA 5CUSH 2B2XH 5FDWB 3O3EB 5MEQA 1MCPH 3JV4A 3OX8A 1A3LH 4NNYA 5CJBA 1MELA 4S1DD 3JWDC 1HYSC 4Q9QL 5D7JA 4KPHH 4P5TD 3V6ZB 2VITB 4I13B 1AC0A 2VLJD 3QFDA 3R0MA 4OLZH 3DRTB 3FB7A 4J2XA 4PJDA 4IDJH 1KIRB 1H3PH 2GSIA 2GK0A 3QEQA 4HK0A 1LP9B 5ADOH 3DURB 5KVEL 1D5IL 1G7LA 3RAJH 1FFOB 3IRZA 4L9LC 3DX6B 3TCXA 3CLFH 3VFPA 5I75C 1OP3K 2QR0B 4WHTB 5GGUB 2KPNA 3SJVA 3NAAH 3KYMB 2MSPA 4ORZC 3I6KB 3B5HA 1RJLB 4I9WE 3HPLA 1HN1A 2P49B 2VERN 3SGEI 4CN6A 4LLUA 2FJHB 1MHPL 2UZXB 3A6BL 3KAAA 4OT1H 3GMNA 3UYRH 4ERSL 4PJ7F 4KZDL 1KB9J 2WM0A 5DEZA 3RNQB 4IS6A 2ZSWB 4GRMB 1NCBH 4GAFB 2CIKB 3O4LE 3L3HA 4B7LA 3ZMRA 5FAAA 4ZAKC 4IIQB 3MNVA 4JVPA 4MLIA 5F44A 2BNRD 1HWHB 2H6PB 4R7NA 5GSRB 1GOFA 2VLKA 5I1CH 5EBLB 3MBEA 1OSPL 1GSMA 1NGQL 2EKJA 2K7QA 4HIHB 4DCQB 3C5ZB 3MRJB 3G6DL 5IB4B 1ZE3C 2A74A 3WIHL 1DLHA 1C7SA 2Q3AA 1CYGA 2NY3C 3VWJA 1I9JH 1NMBL 2F54E 2JJUA 2HFGH 4PJCF 1JWUA 2QKIB 2FZ3A 2HH0H 3PXJA 1G7QA 4OD1L 4A6YL 2ZKHL 4XB7A 4P4RA 5D1ZA 5F7DB 1ZT4A 4PRPD 2WIIA 3DMMC 2YD9A 3D2UA 4KKLD 2AJYL 3PWLA 3CGTA 3ULVC 2UWEE 4UAOB 4G6KL 5DURD 5L6YH 2IAMA 4JFXB 2D2OA 4YDVB 1MEXL 1J8HA 4FQLH 1DVFB 5C0AA 1S7XB 1C5DA 4L3EB 4J6RL 1XF3B 4NM8L 5IB2A 4RMQA 4K94C 5GSRA 3JXAA 4ZO6A 4PJAB 3NFSH 4ZSOE 3VXUA 2R0LH 3U79A 3I9GL 2X42A 4LCUA 4IIQA 1JGLL 2CDFA 1H8SA 5C0DB 1RK1A 1RUPH 4BKLB 2ZSWA 1MREH 1S78C 5JUEL 2V7NB 4UMGA 3BP6A 2FDBP 5D2NA 5K9OA 5DR5H 4JANA 1WLHA 2H3NA 3HPLB 1VADB 2HMID 5DO2C 1NJ9A 4XXDB 4LGRB 5E2UL 5GHWL 3OR7A 2WWKO 4M5YH 4J23A 3WSQH 4QHMA 3TA3B 3CSYB 2GJ6B 1YEFL 1AI1H 1G9MH 2AI0H 3BH8B 5FXCH 5IHZA 5C7XH 1MF2H 3FRPG 4J7RA 3SOBL 1KIPB 4AIZA 3QIUB 1MWAH 1KTRL 4TVPE 1K5NB 3MRMB 4J12A 1QFOA 3QFDB 4WUUE 4TNWK 1A8JH 1DLFL 3I84A 5DVOA 3ZDYF 2ESVB 1S7RA 2VAAB 3SKMB 4PTUA 3B6SA 3OMZA 1G9NH 4W70A 2YD6A 3UC0L 2O61B 4CU8A 2G5BB 1UWGL 1Z2KA 4FNLL 1PVHA 5D7JC 3CXDH 3D18A 3MSPA 1TTGA 4OD3H 4ZFOA 5CGTA 4P3DA 1UCBH 3TBYB 3NPSC 5C07E 1HDMB 5HVFB 5ITFA 4AENA 1PG7L 3KYOA 2CIIA 4JFDA 1X5HA 1XF5B 2JKXA 1YQVH 5E8OB 2GJ6D 2NW2B 4OZHF 1MWAA 5HGGS 5KW9H 4PJXB 4XI5D 5D7LE 3P9MA 3H7LA 4DK6A 2ZOKB 4PRHB 3MA7A 4HAFA 3TO4D 4WU7A 4FQCL 3IF1A 3WO4B 3DTXB 2X4NB 1MAJA 3ULSB 4N0UE 1XF1A 4JPIB 4DKEL 4DVBA 1AQKH 2P5EB 1WC7A 4JRWA 5BJTB 3D2UB 1LNUB 4HQQL 4N0UA 4Y89A 2W9LA 4P4KC 5FV2A 1MUJA 4X6CF 3VA6A 4ZDHA 3S88L 3W39B 3BI9X 5DUBA 1AC6A 1L4IA 3FFCD 4M00A 1S9YB 5I1LB 4EI6B 2XN9E 3P73A 1LQSR 2Q86B 4HXBH 1MAML 3JV5A 1E0OB 4KXZI 1BEYH 2APVA 1JZ4A 3VWJC 3QT2A 1FJ1A 4DN4L 5IGXL 1CK0H 1CGSL 2EDKA 3V4VH 4QTHA 1AD0B 2ATKA 2XQBL 3V8OA 5FO9B 3BRDA 3W9EA 1RK0B 3IDGA 2OTUA 5HHME 2WBJA 3ORJA 4K9EH 5J06A 4JM2A 5J9PB 3ARFC 2VDLH 3TJEH 3BP5A 4LSPH 4HKXB 4CVZA 4Y5YC 1CBVL 4RCAA 1NQBA 1U92A 2V5RA 1WISA 2AJ3B 1GPOL 4EI5D 4QRTB 4RWYL 2VXUL 4XPBL 3I6KA 3K8LA 2WANA 2Q6WB 4OLVL 1G7MA 5C9KA 1JF5A 3B9AA 5EU3B 4LVOC 1P4IL 3MLZL 3OAZK 1F3DH 4OCYH 4WHTA 1HKLL 2FSEA 4MJIB 2BSRA 1H9VA 1XFPA 2OXHA 4OLWL 2AK4D 5EIVA 5CLWA 3ZE1F 5HYJB 4FP8L 1S9KC 2YMXH 3IU4H 5AAMA 3T2NL 4NQVA 5JDJA 4Y4KD 4OIIH 3DSFL 3BXNB 3C6SB 4PS4H 3HUJE 1NBVL 1NMCB 4L4TD 2EIEA 1KENL 2ZCKL 3IETB 3QIBA 4GS7C 3OJDB 2APWA 2UY7A 4O02L 4OV5A 2BVQA 32C2A 5CP7A 3MODL 4QXWA 4NNYB 2WNGA 1OW0A 2DOCA 4WTWA 1VKXA 1JHLL 5HPMA 4ZSOB 4GQ9H 2HWZL 5HGBB 1N7ML 1T5XB 3QNYB 2CXGA 1T83A 4U33A 5CBEB 4GKNA 1NMAL 1GJIA 3IDXH 5F3BA 3EHBD 4BFEA 4OBRA 4F7TA 1BOGB 2SEBB 4MHHG 2V9QA 4M1GL 4MVBD 5I74C 1DFBH 4BQ9A 1E6JH 1RZIB 3OKYA 5T1KB 2Q20A 1FL6B 1HZHH 1FN4B 1HIMH 1DANU 2Z92A 5DRZA 1ED3A 5CGYD 2D7TH 1ZTXH 5D1QB 3MRFA 4YHZH 3MRBA 4UV7H 5L2KD 1NAKH 3SE8L 4J4PA 3T3PE 3ROLB 3VG0H 2QADB 5L9DH 4HC1A 1C5BL 4U49A 1JWMA 1WFNA 4M3KB 4RGNB 5D2LF 3Q6FA 3BWUC 4RMVA 3EYQD 1H3TA 5DWUH 5B4MD 5I8KH 5GISH 1HOCB 3T65A 2EXWD 5KSUB 3VXMB 3L3KB 3T1FB 4X98B 4XBPB 5T1KD 1A5FL 3BN9C 3L5WA 5HSFA 3I9GH 3OKDB 4P2CG 4Q9BA 1F6FB 1P5UA 3H3PH 2YD3A 3PHSA 2CUMA 4X9GA 5JHDA 2XFXB 4Z7WF 1FRGH 3VXME 1BFVL 1TVBB 2EH8H 3U0TB 1IGFL 1L7IL 5DLMH 4MA7H 1EEZB 2PYEA 5I1DA 4ONGH 3ZT7A 4YDLB 2EC9U 3T2OA 3HZYB 1T21A 1XR8B 2XZAL 4FTVA 3AAZB 5FHBL 2ORBL 5D7IF 4U1IB 2E5EA 1FO0B 1GC1L 1GHFH 5EO0B 4K3JL 2PW1B 1T4KA 1Z9OA 1S9VB 2D3VA 5DD1H 4QF1B 1P1ZB 3VD5A 2BSTA 4NHUA 3V0VA 1CLZH 1MIMH 3RA7H 1M71A 3LN9A 1ZLVH 4Z76B 3P4LA 4FXKA 4GG6A 1A6UL 4KMTL 4JKPH 3BQUD 1S7UA 4CMHC 1QO3A 2DKMA 1JNLH 3WJLA 4JLRA 3GI8H 3MRKA 4F2MA 3G6JF 3X12A 1V3LA 4JFDE 4RDQF 1IGJA 5DMKB 3CAFA 3QEUA 4DN3L 1JV5A 4YO0B 3ARTA 3LN4B 2ZG2A 1MFEH 1YPZB 1AHWA 5BZWA 4PRHE 5E6YA 1I7ZB 3LRSB 5JDSA 4F58H 1I8MA 1OSZB 4WHDA 1D5BA 5TDNB 2V7HB 2BDNL 4S2SB 3OL2A 4M6OH 1JFQH 3IFNL 2OL3B 4TPRL 2OJZH 4RRPG 5GGTH 4HF5H 2DQFB 1S9XB 5TDOA 4PV8B 3X3FL 4FXLA 3BJ91 1QLRB 1NUNB 1WVZA 4ZOBA 2Q7NA 1I85C 1A6ZB 1SQ2N 1EBAA 2PTTA 4XCFL 3TBVA 3FT3B 3QXAA 3PGDA 1MHEB 1KOAA 3HI6H 4S1QL 1FZMA 2IH3A 3CH1A 3KHOA 5T3ZL 5HJ3A 4ZOCA 1KIUA 5EZLA 1TZIB 2VXVH 5KJRH 4XVSL 4ZMAT 2OP4L 4ODTH 4G7VH 2NW3A 3SDYH 1OM3L 5SV4A 4HQQH 3EW3B 4UOJA 4DVRH 1AGDA 3E2HC 4Z7UF 2PTUA 4MLSA 5J6GA 2XTJB 1OGAB 1WJ3A 5IG7A 5IHUL 4L8CA 5F96H 5F7WC 3DROA 2ZUQB 3CFBA 1I7ZA 3LRSA 1F6AA 1YQ2A 1Z5LA 5JDSB 1OAYH 1P7QB 3WO4C 3TN0C 1N3NA 1XF2B 1N0XH 3QZWG 3HR6A 2X4UB 3PQYA 2B1HL 1T22A 4PYHA 2P8PB 4KV5E 1QRNA 4KQ4L 3DVNA 4MNQA 4LGPB 4OFPA 3P0YL 1WAAE 1R3IH 4WHCA 1HSAA 4N0CC 1MFCH 1OT1A 3WV0A 4KK9C 2X9YA 1UJTA 5IKCA 5DHXB 1XIWC 1KPVA 1T2QL 5CJQH 3K80A 2MCPH 4JRYE 5ALBH 1P2CB 1YEKL 3DUUA 1OAXH 4HPOL 2G60L 2EYRB 2NY4D 2X1QA 5E9DA 1UB5A 5EU6E 4HEPG 5INCB 2X7LB 5C8JB 4J3TA 4WWKA 1RHFA 2W92A 4CVWA 3ZE2F 3ZDYE 4DK3A 4JFDD 2GKIA 1T0MA 4M1DH 4BFBD 4X4XA 2ARWA 3QBTB 4OCRH 4WO4B 4U6VH 3C9NB 3BIBX 3QJFA 3K7UA 1IEHA 4IRSB 3KPNB 5L8KB 4OJFL 5GS2D 2AEPH 5KS9A 1YUHB 3F7VB 2HT3C 5AZEH 1UENA 1BQLH 5BMFL 5TQ2H 3GB7A 1AGBA 3QUKA 1HOCA 2CMRH 5I1HL 5C0CE 2B4CC 4YHYC 4EBQH 4OB5L 4HFUH 3MRQB 4P9HC 4L3CA 2ARJB 3GSNB 2FEEI 4CU7A 1V8HA 4NBZB 2JCCF 3MV9E 1ACYL 2XXCB 1A0QL 3GK8L 2PO6B 4JRXB 4AH2B 3VDCA 3CLFL 2UZYB 2A6KA 3TYFA 4V2CB 3ARBC 4P3WA 3FB8B 4X4YB 1W0VA 4FQPA 3MMEB 2KH2B 3OKEB 1U6AL 5LGKA 3KLHD 3M1BB 5T1KA 3S5LA 3AU1B 5JIPA 1R3HB 1G7IA 4RMWA 1IKNA 3BKYH 5MI0C 3QEHB 3D39A 1BGXH 4PRBB 1AXSB 3KPQB 3TBWA 4PGZA 2LFGA 3S36L 2IAMD 3M17B 1B0GA 5C7XL 2BVOB 5DEFA 2PO6D 4W6WB 5GIRB 2OSLB 2R1YB 3C60D 3S3JA 2AJSL 2ATPA 1DQDH 4R96B 2IQ9H 2CQVA 3RZCD 3IVKB 3X3GL 1UJ3C 3VXPB 3ARBA 3KLSA 4NKIL 4P9ML 5IB5A 2R2EA 1H0DA 4WEUD 4U1HA 3MFGB 3QQNA 4I3SH 2FSEB 4MJIA 2HH0L 1FZKA 4MCYA 4ZQKB 1BD2E 4MJIE 1A1NA 1RZKH 5DC0A 3WLWC 5IQ9B 4ZFFB 2BY2A 4LHUD 4GAGH 4N5UA 3UBXB 4FNLH 5EUOB 4CKVX 3CVHA 4HS8L 1LEIA 1HE7A 3MOBL 3WDHA 5CS7A 1LE5B 3VXSA 4NQDA 5EO9A 1ZS8A 4OZ4A 1I1AD 2NY5H 2V2TB 5J57B 3IDYC 4J6RH 4PRBA 3LKSA 3P2TA 4HKXA 4NWUH 4I77H 2IH1A 3D3VB 4R4BA 1R3JB 4MQXD 1XZ0B 1SJEB 3LB6C 1ZLSL 1C08B 1BJ1J 1H5BA 1DBBH 4CJ1A 2GHWB 4FTVE 3MV7B 3VH8G 1NCTA 4O2EB 5HHMB 1RUML 4HH8A 1UWXK 4KVCH 3ZO0A 2N1KA 1CE6A 2Y7QB 2GITB 3U2SB 4O2FB 4M6ML 3UBXG 4M7ZB 4PJFF 3OQ3B 3T2PA 3BESR 1OD9A 5B4MC 4JRXE 1DJSA 1S9YA 1NCWH 4ZNCD 3BEWB 5DMGC 1LP9E 4M3JA 1JRHI 3KWWA 4V1DB 1T80A 1UG9A 1KCLA 2HJFB 3OXSB 2AI0L 3EIFA 2AJVL 2PKDA 4PLOB 4PJ7A 4I0CC 2DQIL 1R5IB 5LJYH 4OGYH 4P57B 4KJPD 4UTAL 3O3DB 2AP2A 3GGWB 1K4CB 3F7VA 3ULSA 1MNUL 3ARED 5HHMD 2Y9RT 1KXVC 4P2RA 4LCCC 4HIJB 4KPHL 5D2LE 4LEXH 1CBVH 1R3LA 1ORQB 1T1XB 3HI6L 2ICWJ 3KPRE 2ZOKA 2F8VA 4PRHA 4C59B 4PJXA 4PJEF 3BGFC 4XCNB 3NGBB 3MLXL 4B41A 5HI3D 4U6YB 5L2JA 2PXYA 3MNZA 4X6FA 2A77H 1LILA 4R97C 3UAJD 1A7NL 2E7HA 1CD0A 4JR9H 1E6OH 4BQ6A 2G5BA 5J11C 1S8DB 3HAEH 1LE9A 5DMJB 4XC1L 3B6SB 3OBAA 3AREB 2JB5H 3L1OL 5C0ND 1DANT 5AEAA 1AJ7L 5DD0H 1CICC 4ZS6C 3HZKB 2Y07L 3S96A 4OM0L 3CZJA 5T33L 1K5NA 3O3BB 4M02A 3L3OA 3JTSB 2Z91A 4OCNC 3WL9B 2HG5B 3BKMH 5ESQA 1NSNH 2GW5A 4TULH 4Z7QE 2KDGA 4LAQH 3VFSA 3MV9A 1P4BH 4RMRA 4YHPB 1FFRA 3KJ6H 1IAIH 1L9MA 4KZDH 3L9RA 3PABA 3QNZA 3UJJL 1S5HA 1T22B 1EIBA 5J8OA 3QDJD 4L5FL 1VGKB 3P30L 3RL1A 2XACC 3SQOH 3VGAB 5GGSB 3HC0A 4JFED 3T4YA 3HNSH 1EZVY 5JNYA 4RZCA 5I1CL 5KS9E 2WINB 2NPLX 3WFCL 1I1RA 2MMXA 4R2GC 5JOEA 3UTSA 1QLEL 4JM4L 3P4OA 4G8FB 2ZG3A 3PWPD 3GEWB 4CW1A 4JHAH 5IFHL 1JHKH 1S7TB 1OW0C 2VABA 3MV8D 1RMFL 4PJAA 1D5MA 5D2NE 4QOKB 5ACZA 2A9MH 2YPVH 4L3EA 3BISA 2YRPA 5C08E 4X80H 4OSUL 4JFXA 5GGRA 2AJUH 4LIQH 2R9HD 5B38A 1OQXA 4XC3H 2VXUH 3KLAB 2AJYH 1J0KA 3GJEA 4Y2DD 4Y4HD 4LASL 4O9HL 4AY0A 1RZFH 3K4AA 3KXFB 4X99A 1EFQA 5CSGA 1KB5A 2I9TA 1TQBC 1S9XA 3H42L 4M5ZH 5MHSE 4MA7L 4OLUH 4YHLH 3ARGC 3C5ZA 4HAGA 5IMMB 5DRXB 4J3WA 1LVEA 5D70H 5A16A 3MLWL 2Z31D 1J7VR 3VFGL 3VXSE 3WSQL 4K8RL 4PRNB 2WK2A 3EYOB 4LPWA 1A1MB 1EO7A 1AP2A 3C08H 5DLML 5GGRY 2AQ1A 2DI8A 1J0HA 1NCAH 3ARDD 4IRZL 1CXHA 3RGVA 4PJ9D 3OKMB 3IDXL 3FOMB 5D7JD 1A7PL 2AABL 1EVUA 3DX7B 4HUXB 5T1LB 5TE4H 2HLFD 2FBJH 5GRJH 5GJTL 1JL8A 4D0BB 2D7NA 3QDGB 3JWOH 3RX8A 5J11B 1IC5L 1Q72H 3CX5K 3EOBA 3VXOB 1LMKA 5IM7A 4YC2B 1UJ3A 1TZGL 3MZTA 1FFOA 2Y36H 5SWZB 2EYSB 1MCCA 3T3ME 1G6RB 2J8UA 4LP5A 1A6WL 4ODHL 4OZGA 3O6KL 3MGOB 2EDEA 3S37X 2PCPB 4FHBD 4DGYH 5IBLC 1I3RA 1U8PB 1KULA 3IXAB 4K8RD 2UYLA 3HRZB 4UIMB 5D7JB 4Q0XH 3WNPA 5BOZG 5JHDB 1X4XA 3CDGA 4NWTL 4PJ9C 4RMTA 2YA1A 1DBKH 3GSUA 3ZL4L 2W38A 2Y6SD 1GAFL 1XT5A 3OKDA 2DI9A 3KR3H 2X4QB 2BVTA 3VG9B 1AO7B 3VU2A 4AMKL 4FFVD 1OVZA 2HVJB 1CXEA 2BNQE 2DLFL 2VDMH 2Q8BH 3SE9H 2EYTB 1DTUA 5D1XD 5EOTB 5GSVA 5M95B 1G7HB 4S1QH 1AFVH 3U4EA 4G5ZH 1YY9C 3P4NA 4OCMC 2Z31A 1CTOA 1MCPL 4NOFA 2ICWB 4QRSB 5C70A 2Y5TA 1FAIL 1ZVYA 4P2RD 1ZLSH 4BYHA 3I50H 3GSVB 1JPGB 2VLMD 2BC4B 4ZPVA 4F57H 2RCSL 4KGJA 4P46C 3P11H 4R90H 4HKZA 5D1QA 5HDQH 4XVTL 1LK3H 4Y2OA 3ZYJA 3BGAA 4X9FA 1O0VA 2YD8A 3HE6A 1TPXB 2BNUB 4Y2DC 5ESVB 2ZUUA 2WUCL 1OAYL 5EOQH 4JO1H 3O8XD 1DEDA 1U8JA 2ICWA 2IJ0C 4CBPA 1T7XA 2VC2H 4FABL 5JIKA 4D0DA 4RWYH 4WDIA 3RWEA 3DI3B 5I1KH 2DQIH 3LD8C 2B1HH 1OAZL 4RFOH 3GHBH 3GMMA 3QCUH 3NABL 4J3SA 4WFFE 3K0WA 5KZCD 4JY6B 2E9IA 3HRZA 4UIMA 2YPLA 4AEEA 1QBLH 5JXEA 5GS1B 1T5WA 1T1WB 4NC1E 4C55A 3WJJC 4WI7A 2I5YL 2R39A 4NZDA 1Z9LA 2AXFB 1Q0XL 2CH8A 2E6JA 3BGMA 5GRWA 5T5NG 3IAGC 4ONHA 5MERB 3O45A 3RHWK 4KK6C 3PJSB 4O02H 2MCPL 1X5AA 3ZKQD 1K9TA 2BVEA 4PG9B 1N6VA 1M6OB 2WLZA 3EOBB 4EQ2A 1OAXL 1QG3A 2FBOJ 5EU3A 4PS4L 1NUGA 4D0BA 4HXBL 3VXNB 2DQHL 3PWPE 1IC7L 3GBML 2VQUA 5EH1A 4NM4H 1A14L 4AG4L 5DC4B 4HD9A 4ZFOL 5I1IH 4Y16A 4TQEH 2O5XL 5IK3A 2YRLA 1CIDA 1A1OA 1DQMH 4JFFA 4MDIA 3O6FB 5GS1A 4KK5D 3VGGA 2BNQB 5C86A 1Q9WB 3FZUC 3HI5L 4X8JA 3P0VH 1WICA 3HLAA 2HFFB 1EUTA 5ICYA 1B4RA 5D4QA 3PWNB 4HWUA 4F15B 2C4XA 4M7LH 4LCWB 3V52L 3G04A 3TBTB 1HKFA 5L88L 1A0QH 3DXAE 3L95A 1FJ1B 3SGJA 4H26A 4JHAL 3V5KA 1FVEA 3NCMA 4WW1A 2VISA 4DUVA 1BHGA 5I1LA 2VDPH 1SM3L 1P4IH 3MLZH 4I0KA 4K23L 5SWSB 3AREC 5EN2B 2BFVH 2NX5D 4QRPD 5BW7A 1PGRB 5IQ7L 3DXAD 2BX5A 4Z7UA 4YHNB 2OL3L 4HXAL 2P8LA 1UFUA 2DD8H 2P46B 3C2SA 4GG6F 1BAFL 3ZYZA 4WTZA 3T8XA 3ALXA 1QTYT 4BSVB 4J3VA 4IRJD 4NN7B 2YOCA 2QADC 2Y5TB 4PBWD 4Z95H 1WTGT 2BOCA 3GJFK 4AZ8A 1LO2H 1X5ZA 2D4DA 3QWOB 5T1DH 1B9ZA 5C09B 3QSKB 5IFJA 3V6BR 3VGAC 1KLGB 4Q9RH 3RWDB 5H37G 4D9QD 1BZ7A 1E4KC 1RV6X 4HWBA 4P3DB 4YXHH 1FE8L 4HT1H 4GLRI 4HIEB 3O11B 5F1NA 4P49A 2BJML 1PX4A 4WY7L 4BELD 2QQLH 1CFTB 5IW1B 3TPKA 4DQOL 4IIQC 5LG1A 2AK4A 2XI9A 5E8PA 4I5BB 3ZKNC 3DUSB 4ZUSA 3QB7C 4F7MA 3MRMA 5CZKA 1WCQA 5EOCJ 4G6FD 2XWTA 3UCRA 2EYSA 3U82B 1VA9A 2AK1H 3QIBD 5C09D 25C8L 3NCFB 1CN4A 3P9LB 3MRPB 2QHLA 3ARZA 2JB6A 1DBML 4JFZL 5IMKB 1YMMD 5AYQA 2DIJA 1CR9L 1UGNA 5FA4A 3STLB 3B9KC 2Q76B 2VDQH 2CK0H 4MCZA 3H9YA 4U4BA 5T1LA 3HC4L 3DX7A 4K3EH 4JFHD 3L7EA 3QPXH 3C60C 5F7KC 1TITA 2VL5A 4D8PB 2C1OB 2NYYC 4GKOA 4XX1G 4HPYL 3BIKA 5D7IA 2OR7A 3W82A 3NA9L 5B38G 4NP4L 4EN3A 3O6KH 3LN5A 1BEYL 1GZQA 5A16B 5TE6L 1MWAL 2VLJA 4NO5A 4YDVA 3MLSL 4DWHA 3H9HB 1QSEA 2FRGP 1CIUA 1PKOA 2XT1B 2Z4QA 3B4NA 1YJDH 5EU4A 2NNAB 4QT5B 5MEOA 3KPPA 4NZTL 4FZEL 4L8BA 3U1SL 3GMOB 4X4ZA 1I3GL 3FAXA 5EOCL 4N1CA 3T3PF 3RPKA 4WV1A 4DUWA 5IHUH 1H3XA 4NQCD 2ZOLA 5ID1B 4X6DF 4P59L 4H0HB 3I2CH 3VWJB 4F7PB 2AV7A 3SCMC 1AGEB 1KJ2L 3BE1L 2H45A 1JN6B 3TWCH 4BH7B 4K9EC 4HK3J 1KB5L 4I3RH 2GITA 4LLVB 3EO9L 4MA3A 4NZRL 3G5YA 2CXKA 1EHLH 1HHGA 4GMSL 5TGBA 3H3KA 5D2LA 1IKNC 4MD0A 1EAJA 5E8DH 2ZPKH 5SV3A 3P77A 5F9WC 5DMYA 1S7TA 4J1UA 1MCNA 3ARDA 4JE4B 5K9QG 4TVPH 2LVCA 4F37K 2RGSA 1F4WL 1PFCA 2FH8A 3KPLB 4H5SA 4PLNC 4RZCB 4GQ9L 3IKCB 1KCVL 1DQJA 4POZD 4Y19B 1ITCA 1ZS8B 4HF5L 4LSQH 5BRZA 1KENH 3HC0B 1F45A 5I2IB 4HPOH 3PHQA 2R69L 3NIDE 3V7MA 3U36A 1W8OA 3EUUA 1T2QH 1QQDA 1ZHKB 3L9RB 5IW6A 4U1KA 1K85A 5ALBL 4R6UA 3LS5H 5IGXH 3D87B 4NQCA 5AG9A 1EXUB 4NRZB 4AEIH 1Y18A 1FCGA 2HRPL 5ETUB 2BSSA 1IJ9A 2C9AA 2GK0B 1K3ZA 5IR1B 4MJ6A 1FO0H 1NAKL 4UOW1 1HK6A 4JFOA 2HN7A 5D7LD 3IDIB 1KJ3H 1QLEH 2R1YA 4KI5E 4JZOA 5BVPH 4QO1A 3V6OE 3EAKA 3G5VB 3VXTA 2A9NL 2NY2B 4OCRL 1SVZA 1D5IH 1JZ3A 2O5XH 3O4LD 4KRPD 3KPSB 2V5MA 4ZYKA 2H2PD 5DJCA 3NCEB 5D7SH 2QBWA 4JQXC 2D0GA 4EBQL 3WS3B 1PEWA 4XH2A 2ENSA 3D0LA 4NN7C 1FZJB 3W11C 4PJ5D 3RWCB 5FYLH 1MY5A 5DK0B 1AGCB 3TF7C 4FG6D 2R1XB 3HUJF 3SKOA 5IFAH 2P8MB 3AU1A 1KJMB 4LASH 4G9FE 5C08A 3TJHD 2UVEA 1BFVH 1EJOH 5LBSH 4JVUA 2AJUL 1BVLB 4ZUTB 1QBML 2GT9A 2HFTA 3VI3E 4N0YL 2H9GB 4ZS7L 1ZSDA 4NNPL 3VH8A 5IIEA 2NLJA 3WEXB 4PJ7B 4KUZH 2CKBH 4EDXA 2HA1A 1R6VA 2HJLB 5F9JB 1IM9B 1X44A 3UBXI 3KWWB 3SO5A 1MCOH 3DIFA 1K8IA 4CADA 3LEXA 2CDGB 1T03L 1N7MH 2E9BA 3GJFB 3LAFA 3EOAA 2PW2B 1F42A 4KTYA 3QAZB 4RWHA 3IJSB 2R0WL 4IRSC 3CXHK 3FO9A 2MOVA 1V5JA 3GHEL 5C1MB 3IDJB 1QZ1A 4HEME 1WBZA 3NGBC 3O6FC 4M7KH 15C8H 3EFFB 5ABDE 3PWUB 4FQ2L 1T89A 1IGTA 1IFHH 2J6EH 1JF1B 1IBGH 2NY2C 3S7GA 3MV7A 3BRFA 5JORA 5HDBF 4KXZH 3WHXA 1HHJA 4DN3H 2XKUA 3PP4L 3CCHA 4CL7A 2CK2A 4F3FA 3QH3A 4FQLL 1BD2B 3DX8A 4GBXA 4PGDA 1QFPA 4I2XA 2IQ9L 4OLXL 3SGKC 2X7LA 1LE5A 2DF3A 4UDTA 3ILPB 4LLDA 1JGLH 5I1JH 2OK0H 1NC2D 3LRHA 5E1AB 1V3JA 2YPKA 3U7YH 1RIUL 2VIRB 1MI5B 1U8NA 5EIIB 5B22A 3UZEA 4DAGH 1YY8A 2H2PC 5I16B 2EKSB 1NLDH 4HX1A 3MA9H 4FRWA 5BS0E 2A73B 2FX9H 5E8NA 5GGTL 4XCYA 5IB5B 2ZCLL 4MDJA 5I66A 2QLVB 5C2BH 2PXYC 1SEQH 4NQED 5FYLE 3LQAL 4TUKL 2ATPB 5E4IA 3GSXB 1XGTA 1Z0MA 5BS0D 5F9WB 2CGRL 3CPLA 3NTCL 2BVOA 4YZFE 4PGBA 5FYKD 5A2FA 4JY4A 1Q1JH 4WU5B 5B8CA 2GTWA 1LO3H 1Z5LB 3DHJA 4YHML 2EC9T 4G8EA 4R9HA 4DW2H 4WRLA 3CFBB 4KWUA 3O2VL 1D9KB 4Y4HC 3SBWA 4JG0L 4QHLA 4LVHC 1XR9B 3VGHA 5J6GB 5CGMA 1HH9A 1WWBX 2JJTC 1H8NA 3DGCR 4YUEL 3T77A 3BN9D 5LGHL 3WLBB 4KUCF 4Y5VC 2NW3B 1F58H 4KDTC 1BOYA 1MLBA 5HYQB 5HI4D 4WNQA 5SWQB 4X4YA 5TE7L 3SDXF 5CSZB 4UQ2B 3V6FB 3VFUB 5CEZE 3GI8L 3KYKL 4ODUB 2PO6A 3CSBA 4YXKL 4UTAH 1JPSL 2X5PA 1KLUB 1HSBA 4Z7VF 5D1XA 3BRGC 4GRWB 1NEUA 1VFMA 4LLWB 1HHHA 5A3ID 4L3CB 1F2XK 2BVPA 3T77B 3WNNA 1ETZB 2VC2L 4DKDC 4PRPE 2ADJB 6FABL 1I7RA 1SBSH 1FLRL 2WBWB 1D9KA 1IMHC 4R8WL 3VWKB 3X14B 4Z78B 3RY6C 1YUHA 4PFEA 3EJZD 2IADB 5BZWB 4M7LT 5FFLA 3T4AB 4Z8FL 1U2CA 3LN4A 2VLJE 1KNOA 3NVQA 4NWTH 4M8QA 5BVJA 4QHUA 1CGXA 4I3RL 3B9KB 2X44D 3UTQB 4NCDA 2KQMA 4X5WA 4JN1H 1MLCA 2F19H 4NO0A 2X1PA 3HE6D 1PQZB 2X10A 3RX5A 4X0KA 5CJXA 2XKNA 1KN2L 2WWMC 5L2KA 3WFZA 3WXWH 2EYRA 1ZOXA 4HBCL 1P1ZA 1KJVB 3BHBB 2XZZA 5FDYA 2DM3A 3DUHA 1D6EB 5HHXH 5BZDA 2EDDA 3P11L 1T1YA 1QR4A 4ODXA 3B9EA 2F53B 4JPKH 1A64A 3B9KD 4O4YL 1AD9B 2CMRL 2NY0C 4NC0B 4JFFE 2WP3T 3HZYA 1F11B 5DRNB 1HHJB 1P84J 3CUPB 1MJ8H 2MQ0A 1U9KA 3GBLA 4QHUB 3V4PH 2YUXA 1QVOA 4FQ1L 1CT8B 4PJGA 1OTTC 4X9BA 4XP4H 3V5HA 5C6WH 1I8LA 1AR2A 4W4OA 1B2WL 1JPST 4JHZA 4L3EE 5DZOA 3IU3A 1PW3A 3VWKA 3X14A 5HYSG 4JJ5A 1NCDL 5JW3L 2XTJE 2Y5EA 3KPMA 4PP2A 4PREA 4NUJA 4HHAB 2F53D 4IMKC 4U2YA 3U30B 2C3XA 3Q0HA 5D7SL 2CDGA 4OUOA 1WQVT 3DHMA 5IJVA 4O9HH 4AEHL 1RJZA 4NFCA 1HSBB 1YEHL 4CNIA 2HJLA 2AEWA 1FZOB 1ZSDB 3BPOB 3RVUD 3MRLB 3RU8H 4U3HA 1B6UA 5GGQH 3VFUA 1FPTH 4ZOAA 5GS2H 3P4MB 1ED3B 4OD2B 1MREL 4H8WL 4IOFD 1DQQB 2YSSA 1W72A 1MCOL 1FN4A 3P3YA 4I3SL 3GRWH 3EYSH 5K33A 1FL6A 1WBXA 2R1WB 3TGXA 1FORL 3HCVB 2FATL 4HIIB 2JCCA 2CKBL 4G9FB 2SEBA 1HH6A 5D71L 5H2BA 2D7TL 4LSUL 1CVSC 3MJ8A 2YEZB 3I6GB 3RY4A 2XY1A 3C8HA 1NEZG 4G80B 5IEHA 3MBXH 5EO1A 4G3YL 4XH2B 3E8UL 3QUZA 2VDKH 3MXVH 2FB4H 4G8EB 1I8MB 2P1YA 4BZYA 1JCKA 4ZSOA 3MUY1 3OJVC 4NQTA 1SEBB 1U8OB 2C3VA 4JRYD 4PJGE 5HPMB 4Z6AT 5EWIL 1YECH 1JV5B 4LPVA 2E7LA 2WMPA 4LDLB 4M9OA 4PRAB 1EHXA 4JFOB 1HYRC 1UKTA 5FUZH 4YGVA 5BO1L 3BXNA 4N5ED 4AJ0A 4HULB 1U42A 3VFOB 1U3HD 2D03L 3TEUA 4YJZL 5EZIL 2A6JA 1D5XA 2V2WB 3H7BA 3QPXL 4K2UL 4MJ2A 3OGOE 4FFZH 2EKSA 2KZ1B 1LDPL 4YEFA 2FIKA 5F1IA 1L0QA 4PJ7E 5ISZA 1R5VA 4NSKB 2FJGA 4QCIB 1IILE 3G5ZA 4XMPL 3T3MF 1CLOL 3QIUD 3BYTA 4YC2C 4BFIB 2XOTA 1PG7H 1VACB 3QO0B 1T21B 2ESVD 4XPFH 3QQ3A 3CMOL 1FIGL 3WS6A 3V4UH 2YD7A 3FL7A 4LVEA 4J1UB 1JZ2A 3O3AB 3IFOA 2OXGA 3KNBB 1FVDA 4OGXH 3Q5OA 1X6NA 3EFFA 3AXLB 5ITBL 4XP5H 4LVHB 4FXGA 3E6FB 4V2BA 43CAB 5IEKB 3NMEA 4NHCL 4EUPA 5CHNB 3DETC 1QSEE 3FQUA 2EEDA 1G6RH 5DJDA 3IJSA 1KEML 3W0WA 4HGKC 2AV7B 5EU7E 1JGUL 3U0WH 3DOSA 3RGHA 1QEWB 3S34L 3VXRD 1EHLL 2YD2A 5GGVH 3ZKSD 1BECA 1WIOA 5FA3B 1LO4H 1A7QL 4I1NB 1I1YB 3QQ9D 3D2UD 3CSGA 2MQCA 1M05B 5DJYA 1LO0H 3ZTJH 1NH6A 4PRPA 4JPIA 4ODHH 4RFNB 5DFTA 3LKQA 5T3ZD 2X4NA 3WUWG 1BVLA 2Z92B 2MHAA 4OKVB 3LKRA 1A6AA 4LRIC 3SDCB 5A2LH 3CZFA 3TLRA 3ZLQC 2YC1A 3MUGB 1FCCA 1UM5H 4KTDH 4R4FL 1VERA 5C9JB 4GH7B 1U8QB 1FZJA 2J5LB 3O2DL 2D31B 3HUJB 1MRDH 4G43A 3L7EB 3BKCH 3QEQE 5CCKH 2XG4A 4NP4H 1Y0LA 4NQSB 1UKQA 1D7FA 3HA0A 4KDWA 3OJDA 5GZND 4N0CD 4NZUH 4U6HB 5J12C 1CDJA 1NCNA 2C7UA 1WZMA 4Z8FH 3BZEA 3BPCA 3QIUA 2L4OA 1ORSA 2VQ1A 3BSZL 3EYVA 4G8IA 2NXYB 5ETUA 5TH2A 5CINL 2XWTB 3IKKA 5EC2B 3O41A 4AQ1B 3HAEB 3WN5C 4Y1AB 1FNFA 1JMZA 5A1AA 2AK4B 4EJ1C 2Q7YA 3GMPA 1L7TL 5KSAA 5CD3B 1ZANL 1S7VB 3GDBA 4PJ5E 3K81A 4PJ8A 4RGOH 1ZLWK 5F88B 1NC4B 4L4TB 5I1GL 1NGPL 5FM5O 5A43C 2VDRL 1OWWA 1YEJL 4NRYB 2Y4SA 3BP5B 1MVUB 5E0QA 1FL3B 4LIQE 2VLRE 1W0YT 2F5AH 3GM8A 3W9EB 3OB0K 4MXQC 4WCYL 4MD0B 2EDRA 3VXUB 2DQGH 2AS5M 1C5DB 4LSTH 4M4RA 1J8HB 3T0EC 4QHNB 3L5JA 2ZUQC 4D0CA 3UDWC 4YX2L 3GHEH 4UBDD 3SQOL 4U1SB 1B88A 5DUBB 4Q9RL 3KDMB 5D1QD 3SCMB 2D7QA 3UTTA 5GRUH 3QDMB 2CLZB 4MD4A 5DD5L 3ZKXB 1A7PH 2AABH 5AZEL 3TJHC 3W2DH 4N0UB 4QTIH 4GQPH 5F6IC 3HMXH 3AS0A 4YDKH 3ULUL 3T0WA 2Z4QB 3N1GC 3O9WD 4YPJA 1ZHLA 4FG6C 4RGND 4PJ5A 1VFOA 3DVIA 4L8SC 4XZUA 5IJKC 3SDAD 5DTFA 1CFVL 4PP1C 5DFVC 5F9OL 4OZIA 1FNEB 2PTVA 3LN5B 1EUUA 1D5ZA 4PLJC 2BNQA 3ZSTA 3A67L 1FL3A 5D7IE 4X7CC 3AUVA 4JEGB 5FYLL 4LLUB 1T6WA 5EORH 2GK2A 5A40E 3RI5F 1XGRB 4JFPB 3TIEB 1P53A 2JJSA 4OZFG 2W9EH 3O9WB 1UYWH 5DA0B 5D5MA 1GGBL 2ESVA 5CEXA 4ODWA 2RBLA 2QQNL 3V0WL 2F54A 4FZ8L 3MLUL 1WZLA 5EA0H 3RWJA 1KIPA 5FYLD 3LH2L 1CXIA 3OV6A 3VG0L 2V2XB 1ORSB 5KAQF 2EDXA 2XQYG 4XVTH 1FAIH 7CGTA 5FHAH 4G6MH 2AXGB 2CGRH 1TJHH 5H94A 5T1DL 1GGCH 3MRRB 5C6TL 3BGFB 1QUNA 4NKIH 3MROA 3BQUB 3O3EA 3VFRB 3WKML 1LWRA 3NN8B 3MGTA 4JO4L 4BZ2H 3CDFA 3LHPH 3C6LD 4YDLC 3RVWC 4PJ8C 2FHBA 3D69B 1RK1B 3D85B 4BKLA 3FB6A 3QG6B 3J8F7 4K3HA 4GG8A 5C9JA 5KSAC 5FKPA 5EDXA 4LVNC 1YYML 4C56E 5CGYC 3RWIB 5IV2A 3TWCL 2DYPA 3LKRB 1QBLL 2BNUA 5ESVA 3SDCA 4Y7MA 5D8JH 4I0PC 4KKNA 2BCKA 1GIGL 4NJ9H 3N0PB 2NY1D 5F7FA 3GSQA 1OP9A 2Z8SA 4XCCL 2YUZA 2P8LB 4Q0XL 3LKPB 2X4TA 3IAQA 1IAKA 1ZT4B 4ZO7A 2W07A 3GSVA 4KKCD 4JFZH 3GUTB 1FC2D 2O93L 3ULUF 1KFAH 1ZGLM 4JDTH 2A6IB 1YQVL 5IUSA 5JHLL 4UV4H 5DVKA 3FT2A 1ZK9A 1JPFA 3D85D 3EDDA 2NR6D 2ARJQ 1FVEB 3QPQC 4YIQB 5IEKA 4LSDA 5CD5D 4QXGH 4F9PC 4HDIA 3AMLA 1CDBA 3OHXA 3UYRL 3ULUD 2VLKB 5I8CA 1DQML 2OYPA 4GKSB 2VRAA 3MRGB 1V05A 1Z9SA 2CRYA 2F9BT 5DUMH 2C26A 4M62L 3NTCH 5D6CA 1FVDB 3VCLA 3IFOB 3S98A 2WWKT 1NGYA 4GRLA 2CIKA 1RZ7H 4KAQH 3A6CH 1MNUH 3UJTL 2QTEA 4OZGB 4PUBL 4V1DE 5IP4A 1UWXH 1YNLH 2F58H 3LS4H 1CWVA 1ZHNB 4QYOA 1UB6B 5C3TA 3GMQB 4ZNEA 1I7UA 4X6EB 5TDPB 2APTA 1REIA 1UJ3B 5LQBH 3PDGA 3VXOA 1U8KA 4NSKA 3HI1A 3MLYL 1MJJB 2CRMA 5KOMC 5L88H 1QA9A 3GSNL 4OIAA 3KYKH 4X6EA 3FN3A 4HUXA 1KB5H 1U2HA 3ZKXC 1G7LB 3ZKND 1CK0L 1DE4A 2R0ZL 4JFEE 2AXFA 5AUMA 2J5LC 1UXSA 3BPLC 5HHVH 4TVSa 5TQ0L 4FN0A 1FDLL 3QNXA 4PRAA 1KIQB 4GW5A 5DMIH 5JQ6L 1INEH 3OX8B 4HFUL 5E2WL 5DHYA 2WIMA 3B2VH 4X7EC 1RUQL 4JQVC 4YIQA 3LCYA 1CE1L 5HYSB 4LQ1A 4OLVH 3H3BC 1YEJH 3HZMB 2BJMH 4G42B 4PBXA 2IFFH 1WBXB 1OL0A 1A7BA 2P24B 7FABH 5DQ9B 2F5AL 4A6YB 2GTZB 4Y5VB 4YXHL 1KV3A 4JDZA 3N1MC 3L5IA 1MJ7H 3FTGA 3WFHA 4EVNA 3ARVA 5GGRB 2YK1L 1ZVSB 5I6XB 1FH5H 1FNSH 3H2WA 4KDVA 4ETQB 1RJZB 1BQUA 5CWSB 5C92A 2XN9D 2ZUTA 3LMJL 4ZAKA 1D5MB 3MV9D 1LEKB 3RWIA 4KRLB 4XT1C 5C3LD 4E42A 1YEFH 1KB9K 3QG7H 2VZSA 2HFGL 1IBGL 2V9RA 3U4EB 3FB6B 2BMKA 5GRXG 2C3GA 2DKSA 2X4SA 3MRNA 3FZUD 1IEBB 1NMCC 1DBMH 2QHRL 2JIXD 1FGNL 3UMTA 4UV7L 1VGKA 4XGZB 4OQ1A 3MV01 1NDMB 4JZJB 4XBEH 2IC2A 3QUMA 5I8OH 3FQRB 5BV7C 1UM6H 2XN9B 3KG5A 2D03H 3VRJB 3MV9B 4P2OA 5TFSH 3TV3H 2VZ3A 3GSOA 1KT2B 1XIWB 1AD9A 4KUZL 2R0LL 1U3ZA 3CFKB 2W0FA 2F53A 4JGJA 2G75B 5ISZE 4UT6L 2ZSVB 1KJ2A 2R56L 1FYTA 3RZCB 4FTVD 5CEXB 2H32H 4WFHE 2DLTA 3VI4E 4B5EA 1XGUA 1S8DA 3K46A 3ZSSA 3QUMH 3GSRB 1F00I 1H3WM 3I6LD 3MJGX 4LHUG 3FFDB 3OKMA 3AY4C 2APFA 4G6ML 5A2JH 4ELKB 4E41A 4PRIB 4LHUB 2JELH 4XBGB 2DJUA 1JGEA 1SY6H 4GBXC 1U8LB 1S7SB 2GY7B 3QFJA 1OGTA 1XIWD 3UTQA 3I2CL 4Z9KB 3PUCA 4TOYL 4L4TE 2Q1EA 1N2RB 2R2HA 3IGAB 1KNOB 1SVCP 4HG4J 1KCSH 3SOBH 1NUDA 5F7HA 4ZFGL 4NQXA 3ZE0F 3BUYB 1YEEL 3TFKD 3O8XC 5HGHB 2DMCA 1AE6H 1KCUH 2VE6A 4U1NB 4LOUC 1CVRA 1FNAA 2JIXA 2DM2A 1ETZA 3QQ9C 4V1DA 1YEDB 4H1LB 5GRVK 3IDNA 3CVIL 5ECJE 3TJEL 4TTDD 3KJ4C 3RVXD 1A7RH 4YXLL 3C09B 2F74A 5LWYH 3HE7A 4HCRL 4PGEB 2Y7QA 2ITCB 4LP4A 2CKNA 1X4ZA 4PY8I 5ACZB 1EFXA 1JNHB 3INUL 4KRMB 1A22B 5C0CD 2R23A 4KKAC 3MLTA 1MFEL 3OAUL 3F7PC 1HH9B 4WW2A 4G8FA 4RBPK 5CP3H 1K4DB 3H9ZA 4RAUB 3EO1A 4F7CA 3QCTH 4LEOB 1BQHA 1T3FB 5F93C 3QISA 1WT5A 5E00A 4OZ4B 5GGSA 1BX2B 1BZQK 4ZUWB 4EXKA 2P5WE 3A0OA 5MEPA 4R2GB 2B2XL 5CD3A 3CVHB 3BZFB 4Y8AA 5HBBA 3RFZC 3UBXA 4KAQL 4P48A 3GSXA 5EBMA 2VXVL 1A47A 5K9KB 3QWRA 1CDUA 1WZ1L 3FO2B 3MYJB 4JAMA 3UTZB 1QRND 6CGTA 3RDTC 5GRVL 5CUSL 4MDJB 1ZA3B 3EGSA 4U1HB 5IT2L 2EXYC 5D9SA 1J0JA 4M48L 5E8NB 4YNYB 3JTSA 4X5XB 4N1HB 5CIPA 3PIQB 3PP3K 3S4SA 3BZEB 1FFPB 3DBXA 4GAJH 2DN7A 2YPKB 1JTTA 5GIRA 3WFBH 4ORGA 4KHXH 3MX0A 2J12B 3DYMA 3IJYA 4ZFZA 4H20L 1KCRL 1NANH 3VI4F 3QO1A 4RGMB 1FBIL 2NZ9D 4OCYL 2ZUSA 3HUJA 4Q6IB 3V9FA 3DX8B 1YEGH 3QH3B 4GRWH 4ZXBA 3S4SG 4YH6A 3QDJB 1IQDA 4R4FH 3L7FB 4JFEB 4MXWH 2XZCH 1PEZA 4YPGB 1KLFA 1JYNA 4J8RA 1R3LB 1T1XA 3FRUB 3QA3A 4KVNH 1GOHA 3CFJB 4R97B 2VR5A 2MHAB 4HIJA 4OKVA 5GHWH 5FCSH 2RAMA 1OQOA 5J6HA 3G9VA 1NDGB 1NBVH 3PWPB 2I07A 1R24B 1NGZB 1OPGL 4WEBL 35C8L 1FORH 4I0PB 4IOSD 3ULUH 4R3SB 2HJFA 1KUMA 5IF0A 4KROB 1OSPH 2ARJA 3GSNA 3P9WB 3VGBA 1RZJH 1ZLUK 4JPKL 2I9LB 3MNWB 1G84A 1G7JA 4Y2DB 3LQZB 3U2SA 3WFEH 4D9QE 1CE6B 2VSDA 5TPWH 4PJFB 5EU6A 4G7YH 1AO7E 1MRCL 3K8KA 4L29A 3FKUS 3LQAH 3V7AG 1H15A 1G0XA 3HNSL 4LPUA 4Z0XA 3VD7A 2QSQA 4O51A 1FC1A 4N8VG 4KMTH 3I75B 2YKLL 4MSWB 2WP3O 3RKDD 3WS3A 4KROD 4OAWA 2V2TA 4NM8H 1TXKA 4RMSA 5TQ2L 4NQDB 1ZT7A 4XRCA 4WGWB 5JHDE 5DF0A 1LEIB 2GSGA 4KY1L 4NYLA 3SDAA 1MCDA 3REVB 2R0WH 1PSKL 1QFWM 4LCCA 4NKDA 2MCG1 2ED9A 3E2HB 1JZ8A 4KTEL 5SWZE 1CS6A 1D5XB 3WJLC 4R4ND 3LVEA 1JPTH 4AM0A 1H0DB 1JWSB 2MKLC 4WHYH 3QDGD 4KDTA 1BGXL 2UVFA 4KKBD 1YN7B 4N8VB 1HNGA 4XPFL 4U1KB 1RZGB 4M03A 3TZVC 1DN2A 4E5XA 1T7ZA 1JGDB 4Y4KC 3QUML 3REVA 5SWZD 2XZAH 4MAYA 5GS3A 5HHOA 3GM0A 4XWGL 4ZUWA 4K9EL 4FQJL 1ZT7B 2F54D 1P7QA 1DQJB 1JPSH 2A0LC 4Y19A 5J7CC 4LHQB 4I48A 3BEVB 2E7LC 4MSWA 5IEHB 3UYOD 2UZIH 5AWNL 5IG7B 3M8OL 2YRZA 1BMGA 3TT3L 2D7OA 4FQIL 1SYSB 5FGBC 1SHMA 3HCVA 3ZKMD 4XPHH 3IFPB 5BO1H 2WUCH 5EOQL 5EIQA 3X3GH 4YHKL 4A2MA 1TZIA 1W0VB 2RCSH 3ARFD 2Z93B 1PX3A 4XCCH 5HDQL 5HY9B 4ISVB 2A6DA 2IANB 4K2UH 1MFCL 4Y2DA 1WFUA 2I25N 2BY0A 1G0YR 2D0HA 1R0AH 2DL2A 4TN9A 3WXWL 4MD5A 5IJVB 4WWKD 4QOKE 5IF0B 1MFBH 4FQCH 2VO5A 4BQBA 1RULL 2DQFA 3V79C 3DV6A 5AZ2L 5T3XE 3RL2A 3E3QC 3QI9A 2JB5L