2M8XA

Restrained cs-rosetta solution nmr structure of the cardb domain of pf1109 from pyrococcus furiosus. northeast structural genomics consortium target pfr193a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
MEFPDLTVEIKGPDVVGVNKLAEYEVHVKNLGGIGVPSTKVRVYINGTLYKNWTVSLGPKEEKVLTFSWTPTQEGMYRINATVDEENTVVELNENNNVATFDVSVVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07705 CARDB CARDB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m8xA00
4DCQA 2EYRA 4NN7C 5DJXB 5F7LB 2VDNH 2X1QA 1FNEA 1R3JB 4F3FA 1WBZB 2IQAB 3I3EA 4P46D 5IEKB 3TYFA 2N1KA 1T80A 4RFNC 1FL3A 1MNUH 1YJDC 2K9UA 4GLRH 1E4XI 2AP2A 4XNYL 3O3DA 5IWLA 4LLUB 2APVA 3P4NA 4NM4L 1VSCA 3D6GA 4MXVF 5I71B 2O5ZH 2VQTA 5DVNA 3TT3H 4XC3H 1S78C 4R8WL 1N4XL 3LN9A 1ZVSB 2IFFH 5C86A 3BRDA 25C8L 2EDJA 3NIFE 1I1AD 5DJDB 4UILH 5DMKA 3MJ8B 1IAIH 1KG0B 3FO9A 2XTJC 1UJ3B 3KR3L 3JXAA 4WTXA 4XBPB 4DGYL 1LHZA 4EZMA 4ZXBD 3F7YB 1P84J 1I1CA 3KVQA 2MKLC 4L9LC 3EOBA 3JTTB 3L3HB 2UWEB 4P2QD 1MSPA 3OKOA 3TVMA 3JV4B 3U1SH 4X0KB 2D7TH 4ODTH 4AEHH 3O8XC 4DN4L 1CFTB 5E6ID 4CN4A 5I30H 2OK0L 4L4VD 1T0NA 3LKOB 1PY9A 4HXBH 1QBBA 1F42A 4FFYL 4GMTH 4OM1L 1AD9B 1DQJB 4NOBA 3FO0L 3MNVA 4NHUB 4Q0XL 4LLQA 2B1HH 3L1OH 3UTTA 4LPYA 5ID0B 5C0CA 2VLJB 1F02I 3U0PA 2BVYA 4DFIA 5IW1B 4LVOC 1I8LA 4PP2B 3DROA 5CD5C 1FZKA 1KB9J 3M17A 4Y5XC 3HZMA 4KHTL 3HUJA 4KK8C 4L4TA 4GW4A 3VFSA 5D7IF 5JW5A 1RZKL 1ZV5A 1ZS8A 4K9EC 5DUBA 1MAMH 4HJ0D 4N8VB 1MNUL 1D5ZB 5E9DD 1OP5H 4JN1H 3KPRD 5D71H 5IMKB 4XP4H 1TJGH 3CC5B 3ZHKA 4YHOH 5FYJH 1JIBA 4X80L 4G6ML 4H8WC 2X9WA 4LAQL 4PJDA 4QTHB 2IFFL 5ACZB 4B41A 1KIRB 4U1MA 4IMLB 1DBJH 4PG9B 1X6NA 3QB7C 3BAEH 5KSVB 4PRPD 1IGYA 3G9VA 1IAIL 1QFUL 3AREC 3KWWB 5BS0A 1JRHL 1TCMA 3VW3H 2DQJH 2WINA 4LIQE 2H32B 1JWUB 1M6OB 2J4WL 4XAKD 4N0UE 2NYYD 3D25A 3DVIA 4ODTL 5GS0D 4WFEE 4PRDB 1ZTXH 3TN0A 3DRTA 3LKPB 4TUOB 5DGRA 5KSUA 3WFEH 1HILB 1EGJH 5EOQL 5GRUL 4D0BB 1CG9A 4HK0B 3BRGC 4U1GB 4LFHD 2IAND 1CFVL 4HXBL 2UVFA 4GMTL 3U36A 3BVNB 4XNMA 4Y19D 1H9VA 5DQDL 3KPQA 2GSGA 5KZCB 4LKXB 3H9SD 1NL0L 1CZ8L 2FJFA 4QHNA 3SPVB 3G6JB 4JM2A 3VXMD 2GEEA 3MBXH 3VA2C 1NUDA 4RMVA 3MRIA 1KLUA 1QUNA 1AH1A 4Y4FB 4UNTA 3GIVA 1GRWA 2NY4D 1DUZB 4G7YH 4YBHA 3WO4C 3B2VH 3O4OC 4IJ3B 4JO2H 4PJBB 3V6FB 3JV0A 1BBJA 2IAMC 5ACLA 1P7KB 1Z5LB 4G7VH 5DO2D 2Z31B 5KSBA 3ARGC 1RIHH 4JN1L 3LV3A 4H25B 4YFDB 4IS6A 5EZOH 1LD9B 1TJGL 1I4FB 3CZJA 1IGJB 1NGWA 2A77H 4YHOL 5FYJL 5IM7B 5F89A 1FAIH 2VB5A 4JFYA 1DBJL 1RFDL 3BAEL 4ZPTB 5DD3H 2BNRA 5DQJB 3EGSA 4OZGB 1FNFA 3VFOA 4W6WB 3HR6A 3ZHDA 3VW3L 1QFWH 3F12B 1QACA 2FJGB 3R8QA 4N5UA 4FG6C 4Q97A 3EDJA 3IJHB 3CCHB 3UZVB 5F7NC 3GMOB 4I2XB 3TNNB 3MRGA 2DM2A 3SQOH 3OBAA 1HKLL 2RGSA 4QLRA 4KRMB 4HJJL 3QEQD 1T2QL 3BXNB 4LRNH 1VDGA 5JR1L 1VGEL 2HFFA 1U8NA 4UOJA 3VWKA 2JKXA 3TBTB 2AK4D 4G5ZL 5K93A 1BGXL 4Z7OF 1ADQH 1K8DA 3AMKA 1Z9OA 3WSQL 3W11D 3I6GB 3ES6B 1I3RA 3K4DA 5JZ7D 3RUGA 3EDFA 3IF1A 3HA0A 3OAUH 1ITBB 2NY7L 3EO9L 1R3LB 4LEXL 4YBLC 2A6KA 3IGAA 4S1RL 4ODSH 3DI3B 4OZFB 1DN0A 1F8TH 1T1ZB 4C83A 1Q38A 4JO2L 5BRZE 3FZUC 4YC2C 5EZJA 4EI5D 5FDYA 4Y4HC 1OT2A 2Y7QA 2Q76A 5E2VH 5T1KD 4DKEL 4Y2DC 5J6HA 4G7VL 2ZUTA 1U8MB 2MOVA 3IRPX 1I1FB 4WHTA 5EZOL 3AY4A 2M2DA 4ZFFA 1ZAGA 5GRYA 3GMPB 3QDME 3SBWA 1SMOA 3IKKA 5D6DA 1NDGA 3AMLA 4ZNEA 2XWJA 5JXED 4GRWB 1FAIL 3AFLA 2NXZB 3BGMA 3IFNH 4Z7NE 5L6YL 2LTQC 4Z7VF 2D31A 5L2JB 1K9TA 4QXTB 5TDOB 4PJAE 4ODUB 1B90A 3MX0A 2F74B 3HE6B 4DWHA 1QLEH 2J8OA 4PJEB 2R1YB 1QFWL 1MLBA 3V5DA 1ZHKB 4Z7WB 4GS7B 4GG6B 4OGXH 4NQSB 4QRRB 1V7ML 4APQD 3HMWH 1RJZA 1KPUB 5CSZA 5DJ8B 4E41B 4G6AD 1RJLB 4PJXF 4NQDA 1ETZB 4PRNA 1A1MA 1FORH 2B7DT 5IUSA 4M5YH 3B83A 3RHWF 4QXGH 1IAKB 2HMIC 3GK8H 5I19L 3HG1B 4BK4A 1EGJA 3F6LA 3H7BA 3PDOB 2EDRA 4GMSH 1HKFA 4YQXL 2YEZB 2GITB 1JZ7A 5C6WH 5J13B 2VISB 1PYWA 3OAUL 4AEIH 4JE4B 1SJHB 1MVFA 3TH2T 5DRXB 2I26N 3EUUA 7CGTA 2LU7A 4LQFH 4Z8FH 4LVNC 1IM3A 4HEPG 1T89A 3NGBC 4OGYH 2XKSA 3UROR 3U7YH 2ZNXA 1CLOH 3CFJA 1YMHA 3P11L 1DQTA 5L8LB 5C0BA 3TO4B 3MRJB 2BERA 4W6XB 4F9PA 1AD0B 1KACB 2FX7L 4C54A 1WFNA 3RWEB 1R5IA 4BSJA 3HI1B 3IFNL 3VH8B 4MNGE 5HHVH 2VDRL 3FMGH 1BVLB 3FQNB 1BJ1H 2YR3A 3X3FH 1A3LL 2XNAA 1A6TA 3OKEA 4ERSL 5KN5B 1Z6JT 3PABB 1KN2L 2YC1A 1AE6H 4BK5A 4JO1L 4HPYH 1F4XL 1T2JA 4DUWA 5AUMB 4OGXL 4ZTOH 5T5NF 3L95B 5LCVL 3BPLC 4UU9B 4U1SA 3DMMA 3IDGB 3VFPB 5FF6B 4PD4K 2OTWB 5GGRY 4BKLB 4EVNB 2PTTB 5DHVA 3W9DB 5D5MF 4G6KL 2VLJD 1N6UA 1TNNA 1Q9LB 3O3AB 3REVA 2MNUA 3I3BA 5F7HA 5F9JA 1FORL 1YJDH 1SEBB 4M5YL 2A73B 2C3VA 3X13A 2JELL 3O3EB 3EHBD 4KQ4L 1X5ZA 5HPMB 5ADPH 3HR5A 5E95B 3RWIB 1MPAH 3UJJH 1AP2B 4GMSL 5SV3A 5BVJA 4KZEL 4RFOL 3QXDA 1MFEH 1YEKL 3UTOA 4QRQB 1CDIA 3WUWG 3T0EB 4AEIL 4N9GA 1KLGA 5J12C 2QL1A 4NUGH 1KPVA 1ADQA 1PKQA 3JSSA 1RUAH 4UUJB 1MRDH 3MJ9L 1Y6KR 4Z8FL 3KJ4B 2CIKA 1KIUA 1EZVY 2PKDA 3B8YA 4N1EA 2HAZA 3FFCB 2QBWA 1FG2B 3U7YL 2V7NB 2NZ9C 4X7CC 1EFXA 1A7QL 1OGAB 3IU4H 2EKSA 2GJZA 5DTFA 4NO2A 4O2CA 5CGTA 3CGTA 3BGFB 4UB0H 3HE7A 1N8ZA 3AC0A 3G6DH 3ARBC 2IBGA 1S9WB 1WTLA 1YMMA 3FMGL 3GNML 3MCLH 2Y6SC 3MSPA 4LMQE 2X4UA 5JHLH 2DM3A 5BXFA 1X5HA 3MRCA 3V7MA 1ONQB 2WSKA 1T0PB 4LL9A 3RWCB 5D1ZA 3LKQA 3TGXA 5DLML 2VLRA 5FAAA 4MZ3A 3ARFB 4ZFGL 1KJVB 4Z7UB 2FNBA 3GM0A 3VMNA 3BWAA 4ZTPH 5EZIH 3H7LA 1RURH 2MPAL 4X4XB 4PJCE 5EU4B 1UT9A 5JOPD 2BSRA 4PJ7A 2VL4A 2ZUUA 3QUML 5DRNA 1P7QA 4Y4FD 1YJDL 3TJHC 2YKLL 5F9OH 4R3SB 5E2WH 4I0CC 1I3VA 1EZVX 2JIXB 1H3TA 3CX5J 1ZMYA 5GRZA 1Q9OB 5DWUH 4BSWB 4M6NH 4BUHA 3GIZH 2Z31D 3SGJC 1UKTA 4UZGA 3KPSB 3BWUC 1MRCH 1YEDA 3KLAA 5EOTA 4MNHA 1WWBX 4M61B 1RUAL 2FECI 4ZPVA 3CX2A 1RIVH 1DQQB 1S9VB 2VABA 5IEHB 1RZ8B 4TVPD 3RAJH 2Z35B 4FXLA 5FYKE 1U58A 1A1OA 3DYMA 2E7LC 5ERWB 4GUPB 3IDMB 4QHUB 3OKLB 4HFWA 2XT1B 3S96B 2LAGB 1BQHB 2X70A 3DIFB 4GAJH 2Z92B 1P1ZA 2DQCH 3W0WE 3PWLB 4F7MB 3S4SB 3G6DL 3MGOB 1QBMH 2I07B 2F53A 1UFUA 1IT9L 3MCLL 1H3PH 5INDA 4JFDA 3MV8A 2FBJH 5JHLL 2Q87A 2YD2A 4XTRD 1GCFA 1HOCB 3GMMB 3MR9A 4TSBH 3HAEG 2YPLA 1ZT7A 1QSEA 2G5BB 4Q6IC 1UYWH 4PJGA 1Q0XL 4RGNE 4FQPA 4YHZH 3VU2A 4OBRA 3F7PC 2P48B 2XZAH 1P2CB 2R2HB 4K9EL 1OQOA 4IRSA 5EBWA 1S7WA 5KS9A 1AI1H 4OCWH 4GT7A 1HHHB 3MNWA 3NH7H 4PY7A 4QF1B 5F9OL 4BQ9A 3L3DB 4ZUTB 3DVNB 1FL6A 2HKFH 3LKSB 1MFDH 1AQDA 1B3JA 3HZKA 3PNWB 4M4PA 1A21A 1CF8H 3WFBL 1RZ7L 2IPUK 1FV1B 4M6NL 1CBVH 5I1AB 3OB0K 2V7HB 1IC1A 1T1WB 4JANA 1S7TA 3SOBH 3GMRA 4WFFE 3SKJL 4G3YH 4IRZH 3UC0L 4JKWA 4N0FB 1J1XH 2EXWD 1JHTA 3ME0A 4FFVC 4F15B 5HGHA 3OKDB 5GGQL 3CVIL 3ZDZE 1YEJH 3RIFF 2NXZD 3RA7L 5EU5B 4NO0A 4PJHA 5HHPA 3IFOB 2ZSVA 5E2UL 3S6CA 2FX9H 1IGML 2E9IA 3HE6D 3KS0J 1KJ2L 1HHJA 4GAJL 1JYXA 5B22A 4XNZC 4H1LB 4BQCA 1A0QL 2OR7A 3QQ3A 4PTTB 1T22B 3KNBA 1SM3H 5D1QB 3QJHA 4P3DB 4L9LA 5F96L 3OKKA 5A2IH 4WUUA 3O3BA 4E41D 1A6PA 2QADC 5K9JL 5F9DC 3O8XA 4UIMA 5FKAB 2X42A 3C5SB 2VLMD 3FO1A 1F6AB 2AKRB 4MXVE 5F3BA 1K8IB 4TSBL 3HPLA 4OF0A 5GZNC 3K80A 1J8HA 3WXWH 1BF2A 2F19L 3OR6A 3ZZ1A 5HVFB 5HI4C 5DZLA 4P2OD 2NW3A 4CMHB 3BSZL 3VXSA 3MRLA 4YHZL 3HG1D 3IDUA 4ZMAT 3Q5YA 1X7QB 3MRMA 3RVUD 5DJ6A 3L7FA 3QHFH 1RI8A 3CH8A 3LEXA 3LPWA 4JFOB 4CNIB 1PLGH 5D93B 1QR4A 1XF3A 5E5MA 4PTUB 1Y18B 3FQWB 4IOFD 4KRPB 3VWJC 4FQLH 3UCRA 5CKAA 1MFDL 1J0IA 4JFFA 3X14A 1I85A 1C08A 3Q6FB 1NGYA 4PRIE 2AERT 4FTVA 4L8BB 3K8MA 2EDQA 1CBVL 4ONHB 1J5OL 1IAOB 3HLAB 1A2YB 3VI3F 3UYPA 1B2WH 4N0UB 3FN0L 1TCRB 3MLTA 4QKXB 3SOBL 3TO4D 3PV6A 2V17H 1G7JA 4G3YL 4GFTB 1F45A 1OF2A 2P5WA 2OMBA 3U30C 1A4KA 4PJIF 2VE6B 3WLBB 1YEJL 3IFPA 5J9PB 2F54A 1LNUB 5T1DH 5AAMA 4LVHC 4KTDH 3P9WB 3O2VL 4PLJC 3VD4A 1H3UA 5JIHA 4R90H 3L3KA 5IMMA 2AV1A 1JF1B 2FD6H 2WWMC 3G04A 1BZ7A 3OR7B 5D7IE 1IQWH 32C2A 2DWDA 1JYWA 5JUEL 4RDQF 2QQNH 3QPQC 4U1IA 2NXYC 5MEND 4JO4L 3VRIA 4M6AA 3C5JA 5DK0B 5DK2A 5KSAB 1DLHB 4MX7A 2G60H 2VAAA 3UMTA 3U82B 4LQ1A 1NDMB 4XB7A 1K5NA 5IB3B 2AEQH 2MMXA 2YSSB 1ZT4B 3VDAA 2KUTA 3MV9B 5L8JB 4QHKI 3EOAB 1FDLL 2NTSP 3UTSA 3REWA 1KN4H 3MV7E 4HQQH 3C6LB 3GBMH 1N6QH 4PGJA 3TYGL 2E6PA 1TITA 1DFBL 2EYRB 2PO6A 4QHMA 4GKSB 1E28A 1ZANH 3QHFL 2WBJB 1OARH 1FL3B 5CUSL 3RWGA 4D3CH 5KG9A 1PLGL 2HP4A 3T0ED 2H2SD 3HFMH 4OLEA 3AB0B 3GSUA 1HSBB 2BRQA 3PP4L 4V1DA 1UM6L 3MLZH 4HUUA 1YUHA 3C60A 3FFCD 4OD1H 3FFDA 1A6ZB 2C3WA 3N1MC 4IOIA 2IAMA 4M3KB 1VKXA 1JUFA 4LOUC 5F7MC 1DEDA 2VXSL 1OGAD 5FYKU 3NTCH 4C56A 5C3LD 2B4CC 3ARGA 3PP3K 3FO9B 4B7IA 4K8RH 4HS3A 2P8LA 4HZLA 4XVUC 3A6BH 2OR9H 2DRUA 4CADB 3U2SA 4NP4H 2YRLA 4QTIH 4U1HA 5EB9A 5GS3A 3MRDA 3TVMB 1J11A 5D72L 2HT2C 4EQ2A 4KHXH 4X7DC 3S98A 1UB5B 4R90L 5IK3A 3IB4A 1MHPH 1T0NB 2FD6L 4OFYA 1MEXH 1HHKB 1E6OH 3BKJL 1OP3H 3GSQB 1JPSH 3TO2A 5DSCB 4F8QA 5EC2A 1ZT1B 1Q1JL 2XQBH 4LLQB 4HCRH 2EXYC 3QA3A 2G60L 2XTJE 3EOTL 2AI0L 3UBXA 5GZOD 5C0CB 3RTQC 3S9DB 5BRZB 3E6HA 5T5NG 4KK5D 1BJMA 1S8DA 3N0PB 5FEBA 4J3SA 4KTEH 5CJXC 3U6RB 2AXHA 5GS1A 2VQ1A 4JHAL 4CVUA 1KN4L 2UUDK 3M17B 3GBML 3QIWA 3VFRB 4GW4B 4R0LC 1RUQL 2Y36H 4K3JH 1EVUA 4OCYH 4IRJA 1ZANL 5C0NC 1ZHLA 1C5CH 2XA8H 1OARL 1UH2A 4D3CL 4S0TD 1K4CB 1GIGL 4JKLA 3HFML 3KPSD 5HYJE 3WJLC 2FYYA 1K2DA 4D0DB 2BDNH 3M1BA 1I9JH 4HIJA 4PJAB 1TPXB 3GBNL 4JR9L 3UXFA 4F57L 4PJDB 1U8HA 4WW2A 3U0TA 5AD0B 3LVEA 5DMGC 3RDTD 5BQ7B 1LO2L 3SKOA 3B8SA 1AHWC 1IGYB 4Z7OE 1BQUA 5BS0B 2B2XL 2AEWA 3EYVA 2FLBT 4OCSL 5TE6L 3CFBA 2YHGA 1RY7B 2DKMA 3KHOA 2B0SH 3VFUA 4NP4L 1OW0C 5D7JB 3CZFA 4KHXL 5M95B 3EYSH 2H26B 1P4IL 3TT1L 4KVNH 4CU8A 4JPWH 1MHPL 3MRBB 3KYOB 1DP0A 3CXHJ 2PYEE 3FB8A 4XNMB 4WIQA 1LP9A 1FH5H 1W72L 4PJFA 2CD0A 4KKBD 2F8VA 4ZS7L 3WFZA 2MKWA 2OXHA 4HCRL 2R2EA 2VH5H 2MHAB 1T7XA 3L3IB 2Z4QA 4M6OL 2VUOA 3G5VB 5EU6A 2YD4A 4OLYH 3SGKA 4ALAH 3EFFA 3R06A 5LWYH 2QQKH 4QT5B 2R0LL 3GIVB 1CXKA 1U41A 4Z7VE 4MDIA 4BFBD 2W60A 1R3IH 4LCYB 3GI8H 3V6ZA 1T20B 4G9DB 1FJ1A 1C5CL 1NJ9A 2HFEA 5I74B 4ELMF 1IGIL 2XY2A 4XC1L 1LEKB 3LV3B 4CMMA 4QY8A 4QRTA 4XMPH 1QKZH 2AEIT 2EH8H 2BDNL 3O81A 4GRLB 4LPTA 1RZFL 4Z5RB 1YEGH 3T77A 1BZQK 5IB1A 3LN5B 3NFSH 5FHAH 5SX4I 5JW4M 2LU3A 5E0QA 2I9TA 2IQ9L 1Z0NA 4PJXE 2WWKT 3IETA 3Q5OA 4XNUL 1UEYA 2QHLA 4F9LC 1IC7L 3IDYC 5JW4N 4LLVA 1O7VA 3C09C 4J1UA 5F1SA 3MOAL 3V6BR 5ESAA 2ZUQB 1E0OB 3QQ9C 4NKOA 1NAKH 2FIKA 4O9HH 3R1GH 2B0SL 5D1QD 4ZUWA 3MODL 2Z0BA 3L9RB 5GRVL 5HI5C 2V5SA 2KH2B 5EUOA 3B9EA 4XZUA 1VEOA 1MFBH 1NMAH 2I60H 2Q6WA 3S36L 1AGCA 4TTGA 1U8NB 3QAZC 4AIZA 3MRNB 3VWKB 1JK8A 1RHFA 3K74B 5MP6H 2VIRA 4K23H 1AJ7L 1L7TH 1LEIB 1F4WL 3KYMB 1FH5L 1K8DB 1M7IB 3UAJD 5I16A 4YDKL 1DUYA 3FCTB 3U4AA 3HMXH 2ZUVA 5HYQA 5DD6A 4O2EB 5D6CA 2WLYA 4P4KC 2VC2L 1L9NA 2QHRH 4OLYL 4ALAL 1QVOA 5JLZA 4LLMA 3S3JA 4B0MM 2QSQA 2QQKL 4I5BA 2WV3A 4ZYKB 3CU7A 1DEEA 3IGAB 4KRPD 4NQVA 3QDGA 4OKVA 4ZOAA 1DN0B 1IRAY 2CK0H 1IGFH 2V9QA 3J7HA 4LVEA 4EUPH 1WIPA 1R3IL 4HCRA 1R5WB 3QDJA 4NC2B 1AGDA 3LRHA 4PRHE 1H15B 2WK2A 2EICA 4GOSA 4JPVH 3DHJA 3AXLA 3Q1SH 3JWDH 4XMPL 3UTPD 1V3MA 2EH8L 1KCRH 4WFED 5FV2A 5C0IA 1YEGL 3QH3B 3CFEB 3CX5K 4PLKD 3ZLQC 5FHAL 2OTPA 1LILA 5I1LA 4EIGB 3QUXC 4L8SA 1DQLL 3UP1A 4DFHA 2DBLH 3MUY1 3BQUC 3VFTB 1UB6A 5FUOL 2VR5A 1FZOA 3KLHD 3TA3D 1OSPL 3C8DA 3EYUL 2HTKC 1LWRA 4GG8A 1EFQA 1CWVA 2DJSA 5I8KH 1ED3B 4PJCB 1ZLSL 4E5XB 4O9HL 5L2KE 4BFGA 4J8RB 4M7KH 4P0DA 3CAFA 3ARBA 4WV1C 5KSAD 5KVMC 5CSZB 2CXGA 1CGUA 4WNQA 4XP6H 3FOLB 1TVBA 4I9WD 5L8KB 3RKDC 3T8XA 2MCPH 1NKRA 3BD3A 1VENA 3QHZL 3ZSTA 3CFDB 3O9WB 3MV9D 4NQDB 3QXWA 3OKMA 5MP6L 1FFPB 4K23L 1A1MB 1WWCA 1I8IB 1I75A 1NAMH 5I9QC 1YEHH 3MLRH 2RFXA 3C6LD 5T5FL 3BPNC 4LSQH 3NCBB 4BFIA 4X7SH 2Y5TA 5CHNA 4PY8I 3HMXL 4U1LA 5TFSH 5JPNB 1OAXH 4LSRL 5M94B 2ED9A 4MA1C 2ZP0T 2QHRL 5E8NA 2WBJD 4MYWB 1ITCA 3PWUB 3OXRB 5H8DA 2GY7B 1PYWB 2PXYA 5GJSH 1UVQA 43CAA 3LD8C 2OBGA 5FO8A 2CK0L 2J8HA 5E5RB 4M7LH 3VFMA 2YWZA 4PB9H 1PKOA 2ENYA 1UWEL 3WIIL 1ZA6A 2DLIA 5ILTH 2DKSA 4X8JA 1G7MA 3PUCA 1GGBH 3W0WB 1I7ZA 1CQKA 4XB8A 1U3ZA 1ZGLM 3B9KA 5K9OA 1YMHB 3QCTL 1JMZA 4JG1H 5C0BB 3WEXB 3JWDL 5MEQB 2J3SA 4F7PA 3GSNB 1RUPL 5E00A 4V2CB 2HH0L 5D96C 4PLNC 1NC2A 5HGDB 1R5IB 5D7LA 4X6DF 2ICCA 4X5WA 2XZQL 4HMDA 1F6LL 5F1IB 3TVMD 2DBLL 3OAYH 3AS0A 4OCXH 5EA0L 3PWJB 1FYTE 5JQ6H 1ORSA 5IB2A 2XNAB 3C08H 3SCMC 1BJ1J 3ILPA 4RGNB 3UEZA 1BZ9A 5IQ7L 3O45A 5I8KL 4K7PY 1LE5B 3MLUH 4KJYB 4TUJA 2HJKA 4S0SD 1S7SA 1ACYH 1F4HA 4Q2ZB 4HUXB 1KELL 4XP6L 3RIFK 5DHVB 1E4XH 1MJJA 2MCPL 5C0CD 3W81A 2GT9A 4KY1H 2ID5A 5ETUA 4RDQG 4RAUA 5F6HI 2J8UF 1T4KA 5F9JB 1YEHL 4MMZC 3GSXB 3MLRL 4ODVL 2C3VB 3WNOA 4LSQL 1TVHA 4XXCC 3DUHA 4X7SL 3CXDL 4Q6IA 4ZD3L 2A83A 4U6VH 4I18C 4PYHA 1ZLVH 2HRPH 5TFSL 5GRVK 4FZEH 4X6CB 5D1XA 3PDDA 4JKMA 3QXDB 5H2BB 1C7SA 1UADC 5FCSH 3MNZA 4PIRF 5E6ZA 1F58L 2HFTA 1KLGB 4KMLB 5FOBA 5K33A 2B4CH 4J4PC 3MZGB 2CRIA 1QA9B 4M7LL 1XH3A 1B4RA 4WO4C 1MVUA 4EN3B 4PB9L 2CIKB 3HMXA 3FQRA 3WUWB 4N5EC 4POZD 4NQCA 5A43C 1YEEH 3FONA 2EH7H 5FYLE 2E27L 4JRWA 1AR1D 3WDHA 4U49A 1MCWW 4JG1L 1I8KA 4QRSA 1TVDA 5BS0D 2FEDC 4K7PX 1U92B 5C7XH 4IDJL 2HJLA 3MO1B 1DSFL 4EUPA 1T83A 4YIQB 4HKJB 5D7JD 4OCXL 3TIDB 3TN0D 3WCYA 3D9AH 4PRBA 5BXFB 2YMXH 5E03A 3DETC 3T4AB 2D0FA 2O93L 4N9OB 3MGTA 3R4DA 5D1ZB 4M03A 2ADIA 3WDIA 1FFOA 3MLUL 4R7DA 1A6WH 2YK1H 3PHSA 4GQ9H 3BWAB 2CJUH 2WUBL 3S5LA 3RGVA 5A3ID 1JTTA 4JM2D 1T04A 4EJ1C 4KY1L 1LO5A 2BSRB 4EXKA 1CGYA 1FG9C 4PRIB 5E8OB 5GGTH 3K1DA 1FGVH 3P9MB 4D9QE 4HIHB 2UZYB 3IXTA 4IBLT 3WJJC 5DJ0A 4U6VL 1KC5H 1QG3A 4F58H 3DX9A 4QOKE 3N06B 5DVKA 4FZEL 3SKNA 1FNGA 2DQDH 3RVWC 1X4YA 4JFEA 1F11A 3VD9A 1UM5H 3D0VA 4M1CC 3EFDH 4GXVL 4ORZC 1YEDB 5HYSA 1NAMA 4MNHB 2B4CL 4GRLD 3QZWA 4WFHE 4L4TE 3VWJA 1KNOA 4J6RH 1CFQB 4ZUUA 3NA4A 1DDHA 1KT2A 2K3TA 1FVCA 1LO0L 3LPFA 4K2UH 2P24A 1U3HC 2NMSA 1YEEL 2EH7L 1H3GA 5D7IB 2YUZA 3VMPA 1VESA 4X8XA 4BZ1H 2EYSB 1I9IH 2OYPA 4KAQL 5C7XL 2ORBH 3WHE0 4D8PB 5I17A 5GSVB 4U6TA 1I3GH 3BUTA 3NCJH 2OSLA 1NSNL 1UH4A 2A0LC 2CDFA 1YN7A 1IEBB 3RX5A 1HI6A 2BNQE 3OF6D 3U0WL 3RFZC 4XP5H 1XGPA 4PREA 1D6VH 3S37H 5BZDB 5EN2B 4HK3N 1MH5A 2YMXL 4OF6A 5DHXB 2WIMA 2W65A 3VWKD 3S37X 3CMOL 1ZHBB 2FHBA 3H9YA 4LLYA 3QXAA 3VCLB 3FN9A 4GBXC 1VEMA 3VI3E 2DDQH 2CJUL 2X4PB 3IJYB 3HAEB 1FGNL 4UIKH 5L0QB 2DQIH 2PUQT 1CLCA 3MLYH 5L7XL 4F7EA 3C9NA 3MNWB 4PJIE 1AGEA 3GHEH 1NBZA 4F33A 3O2WL 4JFZL 4JFXA 3TPUB 4H0GA 1Q9WA 4ODWA 2HVJB 3HZKB 5I2IA 1KC5L 1CS6A 2X10A 4FQJH 3FOMA 4ZG1A 3GJEB 1YY9C 4MVBD 4NN7B 5B39A 1MREH 4QRPA 1UM5L 3QEHB 1F2XK 3QUMB 4RFNB 4WI6A 3EFDL 3QI9A 4OCRH 2EEDA 4MCZA 4X6FA 2BVQA 3T04D 1OM3L 1JHTB 2MFNA 5IFHH 3MLPA 4RZCA 5HGHB 3HNVL 4K7FB 2DWEA 3GHBL 4WEBH 4KUZH 4A6YH 4BH7A 5LGJA 4K2UL 1AXSA 4HX1B 5I1JH 4HJGB 4NO0B 1EEYB 3O4LE 5KSBE 3P4LA 5AZ2H 4PR5B 1ZWIA 5IP4A 4RFEA 1W8OA 8FABA 4BZ1L 1NGZA 2B1AH 1HHJB 4DKFH 35C8L 2XTJB 3I2CH 4XGZB 4LSVL 5FYJD 3LSOA 3QQ3B 1FCCA 2AABH 1AO7E 1D5IL 2W92A 3QJHB 2YZ1A 4L9LB 4HH8A 1G9NC 1KCSL 1PZ5B 5CLTA 2VQUA 3GSVB 1A3RL 2BNRE 3NZ8B 3ZYZA 5GHWH 4ZFOL 3BX7C 2EDXA 4N8CH 1D6VL 2BOCB 1XT5A 4TQEH 4GW1A 4Z95L 3O8XB 4PJ8A 5C07A 5CP7B 3O9WD 5EBLA 2BK8A 4NQDD 3UYRH 5F3BB 3D85A 3HPLB 3VI4F 3PWNA 2X9XA 1J8HB 4XWOC 3L3JB 1H5BC 4JRXE 4P2RE 3QNXA 2FR4A 3VXPA 1C5DB 3L3OB 4MNQA 4CVZA 1MHHB 1DBBH 2ZSWA 3VD5A 1WITA 1D9KA 1KIQA 5FKPA 3PHQA 4QNPF 3ZDYF 5HYJB 3FTGB 1WEJH 4UIKL 4UI2A 5E99H 2DQIL 1MCQA 1Q0YH 3MLYL 4JZNA 4MA3A 4PV8A 5T3XH 4CN1A 1YPZA 3M8OH 2W07A 1XF3B 4F8TA 4NPYA 3K2UH 2P7TA 3QBTB 5I1GL 4NYLA 4YDIH 5CJXA 4LVOB 3WDJA 5FXCH 2DLFH 3X14B 3CSPA 4Y5XB 1MWAH 4U05A 3QUYC 1IAII 1JRHI 4NNXB 2X1OA 4XH2A 2BJML 3IDJA 1MREL 1JPGA 4HWNA 1KTLB 3W0WD 4CKVX 3RUGE 1D7FA 1V5JA 4CAGA 1M7DB 2HA1A 5C0BD 4KXZH 3RI5F 1G7JB 3ZMRA 5GGTA 4P48A 2LU4A 4PRAA 3ARDA 4A6YL 2ZJSH 4KUZL 2V2TB 5JDSA 1XGRA 2PYEB 4R4BB 4MD0A 4LCWA 3WLWC 3HZVA 4YHIB 2X4NA 4DKFL 3G04B 3AREB 1J12A 3I2CL 1XF2A 4N8PA 2AABL 1VPOH 3MUZ1 5IR1A 3QFJE 3NOIA 5DK2B 3W9EB 5KVGL 4MX7B 1A7RH 5GHWL 1N2RA 3HRZA 3B9AA 2VAAB 4N8CL 1K5NB 3TBVB 2AJZA 4Z7VB 5E08H 4KK6C 1B88A 1KJ2B 4ODHH 7FABL 1I1AA 4UAOC 2V2WB 3V0WH 4P23C 5IHLB 1P4LA 1IFHL 3REWB 4CL7A 3HZYB 4RWYH 2XV6B 1MY7A 3LHPH 4X9BA 5JO5A 4WFFD 5CBEB 1MFAL 3VA6A 4ELKA 4M43H 2FZ3A 4KI5C 5EORH 5HHXL 3UTZA 5I1KH 1B4JH 4Z76A 3CLEL 1Q0YL 4MGXA 5T3XL 3M8OL 3K2UL 5E6IA 4MB3A 2NY0D 4YDIL 3GSUB 1UACL 2IALA 1G7QA 1AY1L 1HCFX 1QSVA 4PJXB 3MXVH 1EV2E 4L4VA 4EN3D 2BOBB 3QYCA 1MWAL 3WO4B 1BPVA 4E0RA 3O4OB 1NFKA 4HUUB 2X4SB 1YUHB 1NFDA 1OAQH 4LASH 4LHUG 3V0VB 2IAMB 1VKXB 1S9KC 3VXRE 1GGCH 1V05A 3NFNB 2FWOA 2NY2C 1KBGL 4MWFB 5H94A 1NGPH 3ARGB 2ZUXA 4G80A 1F4YL 3FHQA 5FO9A 2P8LB 2DQGH 5GJTL 4U7SA 5C0GB 3DARA 2BSED 3ET9F 3CDGA 1JN6A 3QISA 5B38G 2YA0A 4QYOA 2X7LA 3U2SB 1YMMD 5CZVH 5DHYB 1U6AH 3RJDA 3DX8A 2BSSA 3P73A 1U95B 2APXA 5I1IH 4P9HH 2OJZH 1NUNB 4H20H 5DA0B 4XP1L 2C1PB 3D3VA 1ZGLA 5D1ZD 5E9DA 4KKLD 4XAWL 1NUFA 3KPRA 5TGBA 4A6YA 1VPOL 1YY8B 4J3XA 3FN3A 3TO2B 1NCDL 5EC2B 3CSYB 4FFZL 4ELME 3GSRB 3QA3B 4HPOH 1OD9A 2AJVH 4XHJC 4CUCA 3GJFK 5FCUH 3QIUC 3BMVA 4X4MA 4PRPA 2R1XB 1I3UA 4XRCA 2VQ1B 5CSBA 5E2TH 4RWYL 3DBXB 1K4DA 3G5XB 3SE4C 4KKNA 3JV5A 4M43L 2VSCA 1JGEB 3QNZB 4YPGB 4JGJA 4WW1A 3WKMH 5IVXF 4ZAKC 4MXQC 1H8OA 5D5MB 2D7PA 5FM5M 1I9EA 4YBLB 3M1BB 4CW1A 5FB8A 2CSPA 2X09A 1CVRA 4NM8H 4XI5C 1MHEA 4KTYA 3AUVA 4RQQA 3N50A 4Y19A 4EBQL 4YC2B 5CBAA 5DD5H 4Y4HB 1OAQL 1U8HB 4H5SA 4FQQA 2Q8BH 3H9SA 1QFWI 4Y2DB 1S7XB 5IT2H 5L2KB 1I8MB 2ICWJ 3VXMA 3C2SA 3WS6C 5FUZH 4R6UA 1MWAA 2A1WH 5B21A 3PWPA 3GBLA 1TDQA 3ALXA 2WLZA 3BO8B 3U46A 4DVRH 3BP6B 4KH2A 3NN8B 5EO1A 5FUCE 3QUXA 3MV8D 2LTQB 3EO1A 1EHXA 3RWJA 1BAFL 2K7QA 1JHKL 1XF5B 2ZKHH 2IWGA 3WE6A 3TH4T 1DBAH 5GIRB 2R15A 1CD0A 5SWQB 4OV5A 4NCDA 4JJ5B 2H6PA 3RX8A 3P2TA 4JDZA 1RHHB 1PAMA 4KI5F 2R2EB 4Y16C 3UJIL 1GC1C 4TVSa 3ZTNH 2AXFB 3EFFB 3R06B 4DAGL 2PTUA 1H8SA 3FQTA 5E2TL 4W4OC 1PG7L 2CQVA 4YGVA 2ZG3A 3SDAC 4DUVA 4PGEB 2W60B 4JAMB 1R5VA 3V6ZB 5FOJA 2D7QA 3B3IA 4AMKH 4XVSH 2CLZA 2A38A 4YR6A 1BM3L 3UO1H 4HBCH 2UYLB 2Q86A 2E7HA 5CEYB 3T1FA 3IXAB 4PUBH 4CMMB 2R29H 3HI6L 1HHGA 4MJ4A 5ALBL 3QEQA 5HHNB 1S5HB 3H0TB 3G6AB 1FYTB 5J6GB 4NM8L 2ENSA 2ILLA 3I50L 5C0DA 2AK4A 4DGIL 1GOFA 5GRWA 5C9JA 3I85A 4LVNB 4UQ3A 3MV01 4NO0D 1S78D 4JCMA 3NGBB 1YNKH 3LKRB 5IT2L 4OZIA 4FNLH 5GISH 1I1RA 2JK5A 2XWBA 1GZPA 3TWCL 2N7BA 5C08E 2XTJD 1RIUL 3SY0A 1YZZA 4MQXC 3IAQA 4MJ2A 2XKNA 2BMKA 3QWOB 5IQ9A 2H32H 5TF1L 3U4BH 3LEVL 1KGCE 4XZUB 4AT6B 3D69A 3O8XD 4EDXB 5T1KA 4HUKB 2RQ8A 5HHQA 2Q6WB 4KI1A 2ADJB 4J3UA 4Y4KC 1OOAA 1T5WB 1EEQA 1UEMA 4MAYC 1J8HD 4WFGE 3VXQA 3S7GA 1INQA 4NZRH 1N5AA 5HYEA 3BPLB 4MDJB 5DD6B 5I1HH 5JXEA 4DN3H 4RAHA 1NBQA 1KJ3H 2BNUA 5JLZB 1GSMA 1QR1A 4LLMB 4X6EA 2VUYA 4X6DE 2GIYA 1S3KH 4NQVB 1XF4A 4QCIB 5DD0L 4DVBB 4JY5L 3V6OE 1W72B 2PCPA 5CD5D 4UDUA 3NCYS 4HUMB 4KK8D 4AMKL 3ZKXC 1WAAA 1ES0B 4R7NA 4I18A 5HXMA 4APQA 4HBCL 5C2BL 3BP5B 4JHWL 4Z18A 3UJTL 3L3GB 4XCEA 4PUBL 3W39A 2R29L 3L5XL 3BD4A 2P5EE 1HNGA 2E6QA 2YRPA 3V5KB 3QPXH 2CLRA 4P5MA 4D0CA 4GAGL 1HXMA 5DJ2B 5J12B 4PJ5E 3PGCB 5BZWB 3WUZA 3GMLA 4JN2A 3WBDA 4GKZB 3GUTA 3P4OA 1W0VB 2CMRH 1MF2H 1UC6A 3H42H 4RMTA 1YC8A 2NY6C 3RVXC 2J8UE 4TVPH 3KXFE 1UB6B 1QZ1A 3WFCH 4FNLL 1H0DB 5GISL 1R3JA 3TBYB 1WBZA 1C5BL 2IQAA 5IEKA 1JFQH 2R4RH 3ARED 4GSDH 2XG4A 5E56A 5D2NE 5FGRA 4LLUA 4HLZH 2C7UB 5DI8A 3ARBB 1A7PH 4WNQB 4LSUH 3BDYH 5CJOL 1ZVSA 3T8XB 5CEZH 3JV6A 2A2QT 4RGMC 3BKMH 2UZIH 3GRWH 4EOWH 4QOKB 3HNTH 5DJDA 3UTSD 1KG0A 2DMCA 4XBPA 1ZHNB 1AKJB 5C0RH 3F7YA 1CICC 5I1HL 1MCFA 4MXWL 3JTTA 3L3HA 4KVCH 4CJ0A 4YH6A 3JV4A 4X0KA 2OLDA 4JM4L 5C09B 1OAYH 4UDTB 5JIIA 4HXAH 5BV7C 1CFTA 4PGCA 1LO3L 1OL0A 43CAB 2J12B 3PIQA 5FO8B 3LKOA 4HBQA 3VFMB 3N9GL 4W68A 1WFOA 4WHDA 4Y89A 1ZA6B 3QUKB 1AD9A 4OZFH 1DQJA 2W9LA 5IESH 2IAMD 3PL6C 4NHUA 1PD6A 3PE9A 1A6UH 2LQRA 1CN4A 1Q72H 4E42B 4LKCB 2HWZH 4Z0XB 3ARGD 3RRQA 3QPXL 2BNQB 2VLJA 2IH1B 3EDEA 2P4AB 5DT1H 2VXUH 3B2UC 4X7FC 2DYPB 2P43B 2PR4H 4FTVE 4PP2A 2Y4SA 2FGWH 3WMSA 3KHQA 1W0YT 2D4FA 4JZJC 2CMRL 1MF2L 4HKXB 1U3HA 1P9MA 1TETL 1G9NL 1CLZH 4GRWH 5F9AC 2R4RL 4N8VA 3ILPB 1WICA 1BZ9B 1D5ZA 4G42A 1MCNA 5GSRB 2EDBA 5IMKA 4FG6D 4DGVL 4PJIB 1A7PL 3CC5A 3VRJA 2GHWB 1IKNC 2AGJL 3CJJA 4PS4H 1JL8A 4ZFZA 3W5NA 5ICXA 4AY0A 5B4MC 5CEZL 2WP3T 1J0YA 2YD3A 3BKML 4IMLA 5KSVA 1NCCL 5JW4Q 3NPZB 3MLWH 1JTPA 3KWWA 1A7NH 2AQ1A 3U9UB 5C0RL 4Q6IB 1JV5B 2H32A 1JWUA 1M6OA 1S9YB 4G8GA 5AYQA 4IRJD 4IHOB 2NY5C 2EIDA 5C8JA 3I9GH 1OAYL 1OHQA 1MCPH 4PRDA 4TUOA 3LKPA 3T3PF 1RZIB 1HILA 5C70A 5I8OL 4D0BA 3O4LB 2R0WH 3EJYC 5IFJB 3MRQA 3P4MB 4XMLH 1G7IB 3BVNA 3FQRB 5EU3A 3FZUD 4OSUH 4LKXA 2VDLH 5IESL 3E0GA 2R8SH 4JG0H 4JKPH 4Y2DD 5L2KD 1Q72L 3DTXB 1I8KB 4G8FB 3SPVA 1AO7B 1FQ9C 2BCKB 1QEWB 3RJQB 4F7TB 2VXUL 3VXUE 3NBNA 4Y4FA 2W9EH 2PR4L 1BP3B 1FBIH 3OGOE 4FQCL 3X3GL 1CLYL 4PJBA 2MQ0A 4HF5L 3QWQB 1CLZL 4P49A 3O6KH 1V7NH 4P2RB 1MFCH 4PRBB 3CUPB 1TJIH 1S7UB 2Y1VA 1WSST 1P7KA 1XAUA 1Z5LA 4QHLB 2Z31A 3UZEA 3MGTB 1BVKB 3RI5K 4NNYB 4H25A 4XNZB 2NPLX 1FFOB 4NJAL 5TE7H 5A2KH 1LD9A 1IGCH 1I4FA 1R3KA 1RJYB 1CFBA 5CZXC 1L7IH 3RGVB 2ZCKL 4LU5L 3T08A 4OAWA 4BELD 5JXAH 2I9LA 1T04B 2ARJB 1XCTB 2VZ3A 2QADB 2CKBL 3TFKC 1D5BB 4ZPTA 5DQJA 4OZGA 3SE3A 5EPMB 4LEOB 4GKOA 1SY6H 1EEZB 1OD7A 1WCBB 2LVCA 4OZ4B 1N0LA 4OLVH 2VDOH 2GQHA 3F12A 1NKOA 2FJGA 3PJSB 3DX9B 2HMID 4LCIL 3IJHA 4YWGL 3CCHA 5F70A 4OLUH 4U6XB 3GMOA 1U36A 1MCPL 3MC0A 3P77A 4LLDB 3GRWA 5CJQL 3KPMB 2F5BL 3BXNA 2VO5A 3BJLA 3RY4A 3LMJL 1NLDH 3I84A 3LB6C 1E4WL 1FYTD 4O4YH 4Z6AT 1AIFB 3VWJB 2WZPD 3ROOB 3TBTA 2ZOLB 4X5LA 4TULH 2P24B 2R8SL 3M45A 2AJUL 3BYYA 3VI4E 1YNLH 4FQ1L 4XPGL 3QFJB 5CLWA 4K3DH 3SDCC 2IC2A 3ZDYE 4QNPE 2IBBA 5FGCB 3U30B 1MJ7H 1FBIL 1R3LA 5DO2C 4XVJL 2CDFB 1TQCC 1X5JA 4OZFA 1T1ZA 2DTSA 4YHPB 4F80A 5F9WC 1UGNA 4G6JL 4LVHB 1RQ5A 1V7NL 1G84A 3PWVB 4CVWA 1TJIL 4NSKB 2H45A 3GI9H 3AS3A 2W65B 5LXGH 3P9LB 1I1FA 1KENL 1CDHA 1QLFB 3GMPA 4LPXA 3KPLB 3EBAA 4B53A 4KMTH 5JXAL 2X4OA 1EH9A 4XMKH 5I0ZA 5L2JA 1F97A 1UG9A 4JQXC 4QXTA 2BC4A 3C9NB 3O2DH 1KCUH 5TDOA 2D03H 2F74A 3QXVA 3QDGD 5SX4H 4U31A 1MRFH 4PJEA 5GGVH 3VXRB 2NX5E 5IIEB 4OLVL 3WKNA 3LDBC 3ZE2F 3VRLF 2BFVH 2VXQH 2F8XC 3QDJD 1WT5C 4Z7WA 5MEOB 4XP9H 4GG6A 1S5IL 4NQSA 4QRRA 5B39B 3HC4H 1U93A 3ARWA 4NKQB 4OLUL 3D2UB 4N90D 2ATPA 4M93B 4QRPB 2EECA 5DJ8A 3E8UH 1T7VA 3MA7B 4WHYG 4NN6C 4E41A 3RPKA 4WI5A 2QQLL 4MCZB 1WZKA 1RJLA 1WV7T 1SEQH 1NLDL 4YXHL 2F15A 3CH1B 1ETZA 2DWEB 5E1HB 4BH7B 5LGJB 1CT8B 4TULL 1XZ0B 4FQXC 5E7BA 1IAKA 2XZZA 4D9RE 1P69B 2Y07H 5ID1A 3HG1A 2GTZB 3KLSA 1ZWIB 3EO0B 1R3HB 1JF6A 1MCLA 4I3RH 2NZ9D 3NZHL 2VZOA 5C0AA 8FABB 4B50A 4ELMB 5HHOE 4Q9QL 3P3YA 2YEZA 2GITA 1FNSL 1XGUA 2VISA 5CMAB 3CDCA 1SJHA 4RISH 2Q7YB 5DRXA 4ONGH 3ARBD 1WF5A 4DJMA 3CSGA 1A02N 5DQ9B 1U3JA 2XXCB 4Y2OA 4KQ3H 2DMKA 4XPTL 2Y6SD 1GC1L 5F7KC 2A6JB 3A6CH 4QOKD 3TO4A 5J0BA 3MRJA 1LQSR 4UOW0 4A2LA 1AD0A 1QLRB 4HGWA 1QBLH 4XCYA 5FKPB 2AJXL 1AKJD 6CGTA 3B6SB 4M5ZH 4P57B 3RWEA 4QXWA 4TPRH 4KMTL 4MQ7B 2DF3A 5D70L 5HTSA 5C09D 1OSZA 3OKYA 1BVLA 4PV8B 1NMCC 3RTQB 4Z77B 3O2DL 1G0DA 5D2LE 4TSCH 4G9FE 5GGVL 5KN5A 2XXMB 1WGOA 3PABA 4YAQB 2BFVL 3BT2L 3HPJA 5AUMA 4WTZG 2WIIA 4R0LB 5KJRL 3SE4A 1GGIH 3IDJB 4OQ1A 1JPGB 4UU9A 1IC5H 1TXKA 3B9KD 3VFPA 5FF6A 2OTWA 4EVNA 1SY6A 2PTTA 4HS6B 3W9DA 2BNQD 3BE1H 1Y0LB 4I48B 2ADGA 3O3AA 3G08B 3JVGC 2Y25A 1NC2D 2DYPD 4OLWH 1SEBA 3F7QA 3MRHA 4ZO6A 5E8DH 4NCC1 1GOGA 2A73A 4GRMB 3DXAA 4MD0B 1A5FL 3CU1A 4ZQKB 1R6VA 4OZHF 4YHLH 2BHUA 1JNJA 3OG6B 3RWIA 5CD3B 1FRGH 3MCKA 2GUOB 1AP2A 1AHWB 15C8L 4QRQA 2AXGA 2XIDA 1FPTH 2X4QB 3T0EA 4R9HA 3ULVC 3UDWC 2CIIA 1FC1A 4NBZB 4RISL 4ZO8A 1PQZB 5CINH 1GPOH 3SDXF 5IVXE 4UUJA 2AEPH 4H1LH 2P8MB 3DI2B 1BIHA 3HC0B 3HRZB 5SWZE 3GJFB 4XNXL 2H2PC 3FFCA 3T4YB 2AJZB 4JO3H 3VGAC 4GAYA 1FG2A 4WJ5A 5ENWB 1ZLUK 5TJWK 3A6CL 2ATKA 1INDL 4L9DA 4R97C 1OGAA 4XWGH 1UQSA 5BV7H 4OLXL 4N1CA 1TJHH 2DOCA 43C9B 4GXUM 5BVPL 4IMKC 3SJVE 4ZFOB 4TPRL 3AS2A 1S9WA 3K1KC 4Z76B 3SE8L 4HWBH 4GXUN 3TV3H 3K7UA 4I3GA 2YD7A 4TSCL 2P44B 3O4LD 1EHAA 1JE6A 2IALB 3C2AL 2MQCA 1MCHA 3PGFL 5J7CC 3RWCA 1RZGB 5HJ3B 3BN3B 4LRIC 4O51B 3ROLB 3ARFA 3DX6B 4NQEE 1KJVA 4Z7UA 5C08B 3QCVH 2DQTH 1L0QA 3O2DA 1AO7D 5EBGA 5H94B 3B9VA 4LIQH 4LHUB 4YXLH 4OLWL 4KI5E 4FFVD 3CDGB 1NGQH 3BEWB 2JIXA 4QYOB 1RJCA 4HUNB 2APTA 3I75B 4P2RD 2BHZA 1QRNE 4NRXA 3IDYB 3IDXH 5J11C 4B7LA 1NCNA 3C09B 4PYGA 5H37G 5AYUH 1X5IA 2VKXA 5IHUH 1FVEA 1GPOL 2CUMA 2J88H 3BEVB 1QRKA 4Y1AA 1DQQA 1S9VA 5IEHA 1RZ8A 3QO1B 3RGVD 3HN3A 2Z35A 1K6QH 3MCG1 2APFA 2R0KL 4JPKH 4LNVA 1IILE 1WUNT 1J0JA 2QADD 5ERWA 1C8PA 4GUPA 3IDMA 4QHUA 5ISZE 3OKLA 3CNKA 4DTGH 5H35B 3LQZB 3QAZB 2BSTB 4XWGL 4XRCB 3GGWB 5BV7L 5GZND 1V3LA 2IADB 3FT3A 4MAYA 1BQHA 5JIKA 2JCCF 1TJHL 3DIFA 3WIFB 3T1WA 2Z92A 1DVFC 1DQDH 1A22B 5HI4D 4F7MA 1WZ1H 5IMLB 2I07A 1IM9B 4XCCL 2HVKB 4P4KB 4PJ5B 4HWBL 2VXTH 1N5YH 2QSTA 2JB5L 1BECA 4JFPA 3FB6B 4X7EC 3VFNB 4P3CL 1HOCA 2J8UB 3VWJD 1NCUA 1MHEB 1IMHC 1T03H 2G5BA 2EDYA 4NWUL 1SMAA 4H5SB 1QHPA 3QCVL 4NZUH 1CK0L 3BHBA 2R39A 3WFDL 1OQXA 2DKUA 2VWEC 5CCKH 3QFJD 1P2CA 5J1AB 1FNAA 3TZVC 2VXVL 2R2HA 1M71B 2CH8A 2I25N 3ULVF 4OTXH 4YXLL 3DLQR 4FQHB 1G7HB 3VG9C 4S1QH 1MWAB 4QF1A 3PWPB 4ZUTA 5KBNC 1F3DH 1ERNA 5EO1B 3LKSA 4HC1H 1P4BH 3QUXB 3PNWA 2CR3A 4JRYE 2LFGA 3GM8A 3C6SB 4PLJD 3WD5H 3BQUB 3LEYH 4UV4L 2UWEF 1FV1A 4HZAA 1QOKA 3PQYE 5I1AA 2ED8A 2V7HA 3IDXL 1T1WA 1PG7W 4XPHL 2WWMD 3WE6B 4MA8L 5AYUL 5E6YA 1YNTB 2J88L 4OV5B 5EG6C 5GGRB 4N0FA 3QRGH 3MREA 2GAZB 1M7XA 2IF7A 3OKDA 5DF0A 1RU9H 4PGBB 4WV1B 5DVOA 1X5LA 3ZYJA 1F5WA 4JPKL 3CK0L 3TJEL 2J6EL 5EU5A 5BO1H 3IFOA 1RUKL 3RZCC 2NY5L 4K94H 4DTGL 1QFPA 2DTMH 2AK1L 3VXRD 1U8PA 4YHKH 2OL3L 5I9QB 4KGJA 4H1LA 2KQMA 3BPNB 2UY6A 3DV6A 1R5VB 4XTRC 1BOYA 2CLZB 4PTTA 1T22A 4LGPB 3THMH 1JGLL 1N7MH 5D1QA 4P3DA 3D2UD 4QRPD 4MA1B 1LE9B 4H88L 4JFHE 2VXTL 4O5LH 2Q86B 3ARTA 4LP4A 1N5YL 1QYGH 3QI9D 3OWEA 4K71C 3D18A 4ENEC 1FNLA 3RGHA 3O3UN 5FKAA 3C5SA 1GAFH 1F6AA 2AKRA 2HYMA 3FKUS 4U1KA 3P0VH 2YUWA 1K8IA 3LD8B 3CVHL 5C9JB 3RX7A 3LN4A 1C16B 4UT6L 3V8CA 2O5YH 2CDGB 4HWBA 2R56L 4LOUD 1X7QA 1B0GB 5F7EL 4M1DL 1VACB 2OR8A 4UINH 4JFOA 1HE7A 4OTXL 3MLXL 4NN5C 4I8DA 5K9QI 4PTUA 4S1QL 4P59L 2P47B 4XNYH 1Y18A 5D96B 1DL7L 3FQWA 4NM4H 5IQ9B 4HC1L 1MAJA 1T7ZA 3EZJB 4JLRA 1A14L 3BDXA 3Q6FA 2ICEB 4R8WH 1R0AL 1N4XH 3D69B 1BVZA 2NTFB 4HWEL 5IG7B 1IAOA 3HLAA 1A2YA 1C7TA 4LDOB 3D85D 1JPTL 25C8H 4N0UA 3LZFL 3SCMB 1TCRA 3S8WA 4XCNA 1JNHB 1HXYA 4NKDB 3LRSB 5AWNH 1INQB 2R23B 3HE6C 3KR3H 3TIEB 4DGYH 1JZ4A 4LCCC 2VE6A 1RU9L 3WLBA 1G0YR 2EXYD 2W0FB 2EDLA 3ZL4H 1EMTH 5BO1L 1LNUA 3ILQC 2BNUB 1EO7A 4DN4H 4JFQB 1XF4B 3G6JF 3TEUA 2OK0H 1JF1A 1PFCA 3CPLA 4R4NC 4ZO7A 4FFYH 4OM1H 4OQTL 4NQXB 4ETYA 4PG2A 4YEEA 1L6ZA 4I18B 3THML 3FO0H 5DK0A 4Q0XH 3VXUB 1DLHA 3EW3B 5FA3B 1AGBA 4XCEB 2Q8AH 1XR8A 4P2OC 1NDMA 4XBEL 3BD5A 1NBVH 1MIML 5IB3A 1CTNA 2CLRB 1GAFL 2H9GB 2YSSA 1HXMB 1ZT4A 2VLKE 5AG9A 3BKCH 4WO4B 4RIRB 4P5KB 3GUTB 2XQYG 1P6FA 3P4OB 4KHTH 3VFVB 4IOFC 5J1TC 4GKSA 4IEFB 5EO0B 1RZKH 3K8LA 4NO3B 1RZJC 4KROB 3FT4B 2UV3A 1P7HL 4UINL 2WBJA 4MB4A 4YE4H 3U4EB 2EDFA 4FMFA 5DI8B 4FFWD 1HSBA 3K4ZA 3MRPA 5DUML 5TDNB 5LJYH 1N64H 3MA9L 3T3PE 1KSRA 4X80H 4G6MH 4LAQH 1A6ZA 5SX5K 3U7WH 4IOSD 4NZDA 3JV6B 2XKUA 4OIIL 3L5HA 1T5XB 3HRPA 4U3HA 5AWNL 1QFUH 4HEME 1JRHH 1U8OA 1IQDB 4HC1A 2IEPA 4CVXA 2J4WH 3ZL4L 4CADA 1EMTL 4TTDC 4MJ6B 1G7LA 4I0PC 3EYQC 1J1OL 1NEZG 4OUOA 1F2QA 2GCYA 4PGCB 1UB5A 4LFHG 2EE2A 4NDMB 4KJPC 5EOQH 5GRUH 3FB7B 1JWMB 4F2MB 3PIQB 2XN9E 1CFVH 2DQFA 1HHKA 3WXVL 4LBEB 5LKNA 3GSQA 5DQDH 5DSCA 1BX2B 1ZT1A 2OQJA 4UT7H 5C08D 1NL0H 2FSEB 1DE4B 3NAAL 4NBXB 4U7KA 1CZ8H 2Q8AL 4J23A 1NBVL 5AEAA 5BRZA 3ZSSA 4ZS6D 4LHUD 2J5LC 3AVEA 3U6RA 1JBJA 3BKCL 4YX2L 2Y5EA 1UA6L 1HSAB 4KKAC 4QGYA 3QO0B 1CXHA 3VFRA 4FABL 2CLVB 1U3HB 4WFGD 3ZYOA 4S1SH 1FCGA 4YLQT 3D3VD 5EOCJ 3LQAC 2DIJA 2QQQA 3SDDC 5CGYC 1K4CA 4BFEA 2XQYK 4YE4L 3SDCA 4JDVB 5DXWA 4HWZB 1KXQE 4G42B 2O26U 4D0DA 4LPCA 3QQ9D 4XXDB 1BWWA 5CILL 5CJ8A 5F7DB 4PJAA 2VITB 4AH2A 3BGFC 3VRJB 1N64L 4HMEA 4L29B 1CGWA 2E8YA 4ZFZB 5KAQF 5HI5D 2NX5B 5ICXB 2LE9A 3U7WL 5AD0A 1OLZA 4RRPA 1RFDH 2YRZA 5C2UB 1HH6B 5BQ7A 3T0WA 1TQBC 5IV2B 1EAPB 1P6AB 3HI5L 5IGXL 4NQTA 4YJZL 1BQLH 4GBXB 1G7PB 3NMEA 4G8GB 1IM9D 4PGDA 5IW6B 1C1EL 5C8JB 1MCWM 2FO4B 5D7JA 4P4KD 4PJ5D 4OF7A 3FJTA 1EJOH 1HKLH 4HJJH 2H26A 5FA4B 2FHFA 1T2QH 3MRBA 3KYOA 5JR1H 3MRQB 1VGEH 1Q94B 5FYKH 2FATL 3P40A 4MJIB 3C8HA 5EU3B 3W2DL 4G5ZH 2FO1A 5HHOB 1BGXH 3KYAA 4P2QE 4UT7L 4LLAA 3WSQH 2CGRL 2YZ8A 5IVZB 5T3XD 1G6RL 2MHAA 2OI9B 3L3IA 2A9NL 3O41B 1F90L 3G5VA 3SEPA 5EIIB 4YDLC 3PWPD 4U6HB 2NY7H 3EO9H 3MRRA 4LEXH 4QT5A 1N6VA 3ULVL 4S1RH 3GSNH 4PB0L 1TLKA 2O5XL 3QUXD 4FQXA 4XX1G 4LCYA 3G5YB 5HSFA 3BYTA 1T20A 3BQUD 4S1SL 5D8JH 4G9DA 2C4FU 1J7VR 2AJYL 4DKEH 1BFOA 3ZE2E 3NCEB 3VGEA 3VRLE 5TH2A 1UWXH 2HTKD 1LEKA 4MCYA 3RDTC 4MNGA 1J05B 2GYSA 4GRLA 5INCB 4Z5RA 1R3KB 3QG6A 1WK0A 3LN5A 4G9FB 4OAWB 2I9LB 3RKDD 3S35L 3DX7B 3IRZA 5L6YH 2JLLA 5E9DE 3N1GC 3D0LB 3N1QC 4F37K 4LGSB 5DHVH 3OJDA 5B8CC 2XPGB 2GKIA 5JA8B 2RBLA 1AQKH 1BQLL 2OJEA 3EYFA 5IJKA 1V7MH 4P5TC 5EBMB 3OF6A 2K1MA 4MLSA 1EJOL 3L9RA 3P77B 5DJYB 3AROA 3VGDA 1BJ8A 4MAUL 4EDWH 3T0VA 3R8BB 3MRNA 5FYKL 2GJ6E 2CXKA 3QIBC 4XAKE 1LEIA 2V9RA 3ULUC 3BFOA 1ZEAL 3KYMA 3DUUB 1M7IA 5LGHL 3QUYB 3HHRB 5DMJB 2DIAA 3FCTA 5I19H 4TOYL 1X5FA 4O2EA 1FC2D 3BMWA 4M7JL 5IVXB 2VOTA 2EDWA 3OZ9L 2IANE 4HHAB 4YQXH 5SWZB 3ZTJG 2I5YL 4JEGB 4ZYKA 5FGBA 4RMSA 4OBSA 1U8JB 3GSNL 1Z9LA 3MRFB 3VD7A 4ZDHA 3HNSL 1R5WA 2QJDA 5ANME 1G6RA 2YXMA 5D8JL 4DZBB 3NIDF 2ICWB 3KPPA 5F6IC 1H15A 3IFLL 1A6AB 3SJVB 3P11H 3SCMD 3EKCA 4JGMA 4JREC 2O61B 4DEPC 3KYKH 3UDWA 3QH3A 2FX7H 3CFEA 4FHBD 3F6IA 1JYNA 3QEUA 2NR6C 2QSCL 2X4OB 2VDRH 2JJVA 5MEPB 3VGBA 3VFTA 2BC4B 2AQ3A 2W9DL 1A3LH 3HS0B 5E5UB 3OB8A 2IPTH 4NQEB 4UAOB 4M3JA 5F1NB 4P23B 5KTEH 1MOEA 3F62A 4ERSH 1KN2H 4KXZI 2NLJB 3RWFA 1AQKL 2J2ZA 4OZHE 4JO1H 5F7YC 1F4XH 1ED3A 4PJCA 4E5XA 3B5TA 1ACZA 5LCVH 4J8RA 1U93B 2X4RA 2ATPB 1KTKE 4UQ2B 2CKBB 4HT1H 5GQBA 4P2CG 3FOLA 4M00A 3DO7B 4J3TA 2CDEA 3SDXE 1RK1B 2Z8WC 3OB0H 4G6KH 1U91A 4LLWB 2AJSL 4R96B 4EDWL 3CFDA 3O9WA 4ZNCD 1EDQA 2OS7A 4J4PD 1OAUH 1QSFE 4BA8A 1FFPA 1QRNB 4WO4D 1I8IA 2JJTA 3Q48A 4NT6B 4XCFL 1HINL 3ORJA 4N5ED 2JELH 2B20A 4KQ4H 3QDHA 4LP5A 2L4OA 5EWIL 5ID1B 4WHCA 5JPNA 2FIRT 4PJ9A 4JKKA 5C0AB 4EXPX 3BI9X 2NY2B 4KROD 1RD6A 4KZEH 3MUGB 3PWUA 3OXRA 4RFOH 2FEDD 3IU3B 1YEKH 3MLSH 1XGUB 5J8OA 3OSKA 4AQOA 4LSDA 5FHBL 1CGXA 2RCSH 1JHLL 1CFSB 5C1MB 3MJ9H 3A67L 4Q9RL 3QRFM 2OP4L 5E4IA 1E6JL 4N0RA 1AXIB 1CDBA 3KPOB 3W0WA 3IS1X 1TIUA 5ESQA 4JY6B 3DETD 3TCLA 2VDQL 1A7QH 3WEXA 3EIFA 2RJMA 5MEQA 3KYKL 3GSNA 3ARPA 4HGWB 5EFIB 4WGWB 4XCYB 3TA3C 4LSPL 5HVWA 1CR9L 2GW5A 3WYRA 5KVEH 5HGDA 3IDIB 3Q3GB 4XX1E 4BQ8A 3V9FA 5F1IA 1OSZB 1B0WA 3GNMH 3PWJA 3UTQB 4NOFA 3SO3C 1CE6B 3QIUB 3NABL 3HAEH 4YHNB 2IPTL 1LK3H 5KTEL 1TMCB 3CLFL 3V0AC 4KDTC 3ULUF 2SEBB 4XHQA 1H3VA 5DLMH 3HPJB 1LE5A 2WIIB 5MI0C 4KJYA 3AM8C 4ZFGH 4CRPA 4Q2ZA 2VJXA 4HT1L 4HUXA 1KF9B 2MPAH 4ZAKB 3BZ4B 3UYOD 2NZIA 5SV4A 2ADGB 1SJEA 5FM5O 4XBGB 3QUMH 1OAUL 3BIBX 3LIZL 2YKLH 3MRHB 3VE0A 3PQYB 2BRRL 3GSXA 3DXAB 3OJVC 1DJSA 3DVGB 3VXNB 3LS4L 1U3HD 5IWLC 1CXIA 4X6CA 3MCKB 4I77L 2JCCE 3TBSB 3MLSL 5H2BA 2AXGB 4YDVB 2E9WA 1OP9A 2CIIB 1WLHA 4BUGA 1JNNL 2RCSL 2A0LD 1QA9A 3OAZK 3ECBB 4EN3A 2R2BB 3DO3A 4PV9B 2ZNWA 2NX5D 3WUWA 1I7UB 4GAYB 4WJ5B 2AQ2A 2NY1B 5E8PA 1DBKH 2ATKB 5ACMA 2ITDB 4XVTL 1NBYB 1UQSB 2VL5B 1U92A 2KPNA 4M8QA 2P8PB 3MO1A 1CFNB 3TC9A 2Y9RT 5KVEL 4GBXD 4WU5A 2VZSA 4G8GD 1VGKA 4YIQA 4HKJA 4Y16B 3ULVE 3DWTA 1IT9H 3TIDA 5LQBL 1DR9A 1UWXK 2R2CA 5JORB 4FQIL 3IKCB 4D9RD 5AAWA 1LK3L 1LDPL 1EK3A 3OJ2C 3T4AA 1AFVH 3RWHB 1CGVA 3ARUA 1E4KC 4MJID 3SDAB 5HHOD 5KZCD 2HT4C 2UWEE 4BM7A 1I8LC 2IGFL 1Q0XH 1YY9D 1A7BA 4PBVC 1LDSA 3BDBA 1T66C 4XPFL 5I75C 4NUJB 1EXUA 1RPQA 2EDDA 4K9EH 1RZJL 1CXEA 4PRIA 2YD9A 5E8OA 2BVPB 5K9KB 3PP3H 5E1AB 2XOTA 1MJ8L 3P9MA 4YBQC 4HIHA 5IBTH 2WANA 1OTUC 3UZQA 3WFBH 1RZ7H 5I66B 1SBSL 4NRXB 1MI5E 1VHPA 4H8WH 1X44A 5CS7A 1MIEH 3SKJH 1FVEB 3UC0H 1YQ2A 2EDEA 2QKIB 4Y1AB 2X44D 1CFQA 5GGQH 4G9FD 3CVIH 5MERB 4JJHA 3C5ZC 4HGMA 3TH3T 3RA7H 1KCLA 1L9MA 2AV7B 4KRNA 5D7IA 5E2UH 3DURB 1DBKL 4Y4KB 4YHML 3U79A 1MUJA 5IOPB 1IGMH 2DM7A 3LOWA 5KVDL 2EYSA 3FT3B 4MAYB 3STLA 1KJ2H 4P2YA 4XWOD 2ERJC 3TN0C 5KAQG 4WTWA 4DZ8B 2L7JA 4D8PA 5GSVA 1OAZL 1A0QH 3MJ9A 2UUDH 2AS5M 1IEBA 4LCUB 5CEZD 5HYIA 2AVGA 5DC9B 4Q7DA 5F96H 2VLKB 3T2QA 1X5XA 3V95A 3MV7A 5K9JH 5BZDA 4JFPB 2RB8A 5EN2A 1UH3A 4YK4C 1AFVL 1XR9B 3NACL 4JM2C 3BIAX 1ZHBA 1P84K 2F19H 3QUYD 1NH6A 4TNVF 3ZKXB 3VCLA 4UTBH 2X4PA 1JPFB 3BSZH 3BHBB 3ETBF 3IJYA 3HAEA 4OLZL 5SWZD 3LQAL 4IIQC 5BMFL 2OTUA 3D87B 2QLVB 5JHDE 3TPUA 3PGDA 5IBTL 2X89A 4HKZA 2HVJA 3Q2CA 4JQIL 2E5EA 1OAKL 4FQ2L 4OF5A 3G6JE 3GJEA 2NY6B 3WLWD 4H8WL 4OD3H 1J5OH 1U42A 5JOPE 3SJVD 1MIEL 3QEHA 1Z3GH 1JVKA 3QUMA 3ZKMC 3FN0H 1JPST 1L6XA 2BHYA 5HBBA 1KB9K 1DTUA 3MREB 3EOYG 4S2SA 2VWEE 4Z0BH 4K7FA 4NC0B 3RBSA 3VH8G 4MD5B 4HX1A 2XN9B 1TZHB 2PYFB 4HJGA 1EEYA 3O2VH 4KK6D 1BEYL 4PR5A 1PJ9A 4RGMB 5IBLC 1QNZL 4NQED 2K7PA 4P23D 5DEFB 1U8PB 3TESA 3DV6B 5ITBL 4XGZA 3IVKB 5EZLB 4QRRD 1CICB 5JUEH 1VFAA 1U8LA 4JO4H 1V8HA 3HUJF 1PZ5A 2C3HA 3GSVA 3NZ8A 3ULSB 4I0PA 2BOCA 3D18B 1FFNB 4XPAH 2VLLB 5BV7B 5CP7A 5EIQA 4CN6A 2EEBA 4U1KB 3V7AG 3D5OF 5HD8C 1QRND 5E94A 4X83A 3L3JA 1FDLH 3SDYH 1C5DA 3L3OA 4FRWA 1MHHA 3VGFA 3LN4B 4I2XE 3TYGH 4UTBL 1OWWA 5HYJA 3ABZA 1DFBH 4HFUL 5IJVA 3PL6B 3FTGA 5C0AD 1BLNB 2W0KA 4PJDF 1A47A 5CUSH 4MVBC 3RL2B 4K3GA 3GKZA 4KK9C 4QWWC 1MQ8A 3AY4C 5ESVA 4NIKB 4YNYB 2MQ3A 3PP4H 4JLRB 4Y5XA 3T0XA 3SBWC 4L5FL 4JZJB 1UM6H 5D6DC 1QP1A 4NNXA 4JVPA 1PW3A 12E8H 4OD3L 3T2NH 1CU4L 3T2PA 1KTLA 3H9HA 5DGQA 1Z3GL 1M7DA 2VXSH 4RNRB 4A2MA 3LKNA 4XCNB 5KVFL 1HXYB 3LPGA 5L88H 2PTVA 3BH9A 4Z0BL 3P30L 2V2TA 4WU7B 1AXTL 2DQHH 2GY5A 2VSDA 2PYEA 3F7RA 4R4BA 3WHE1 4XHJD 4ISVB 5D72H 2XFXA 1VA9A 4DQOH 2R69H 2EO9A 3QIUD 4FA8A 4L3CA 2WWKO 4P2QB 1J10A 1OCWL 4L3EE 2IG2L 1NPUA 1YN6A 4JM2F 2W38A 4YHIA 4GW5B 1DCLA 3AREA 3CPLB 3BKJH 3Q0HA 1SYSB 2ICWI 3ULUL 1Q1JH 1KB5L 5DMIL 3W9EA 1AGBB 4ZAKD 1XR8B 4I3SH 4XPAL 5K59F 3EOTH 2AI0H 3TBVA 3V4PH 4Z7VA 1KJ2A 2OL3B 4ONFL 5KSBF 1BFVL 2V2WA 4JHAH 4XI5D 3PQYD 3SDYL 3DXAD 1I7RA 1GOHA 3HZYA 3FRPG 2ZZUT 4OF3A 3BP7B 5CBEA 1RUQH 1HYSC 4U3XA 1J88A 3SGDI 2B39A 1QBAA 3HC3L 5T3ZL 1O5DT 4ZSOE 1GIGH 1Y6MR 4KJQD 1KJMB 2C3GA 2F58L 4YUEL 1MY5A 3CVHB 4PJXA 2FB4L 3MBEC 4LPVA 1MCKA 4F9PC 2KBGA 5D7SL 3MRPB 2BOBA 4KJWC 3GBNH 4HMCA 1H8NA 4JR9H 2X4SA 3KJ6H 4F57H 5DD1L 12E8L 1NCWH 3T2NL 3V0VA 2YBRB 2GTWA 1T7YA 4MS8C 1XGTB 2NY1D 5FM8A 1KEML 4U6YB 3NFNA 1LO2H 5F8QC 4MWFA 1CDUA 1EVTC 1DN2A 2EZ0D 3NVQA 3VXOB 5L88L 4RA3A 4Y5VC 2B2XH 3S4SG 1U8OB 4OCSH 4E9LA 5TE6H 5C0GA 4CVXB 4NCC2 2DI8A 5DVLA 2DD8H 2DQHL 4Y16D 1G7LB 5DHYA 4JDTH 2GJ6B 5EULV 4DQOL 1EBPA 2R69L 3BN9C 1U2CA 1GHFL 1NANI 1U95A 2GCYB 3DMMC 5J3HD 1P4IH 3TT1H 1D5MB 1PY4A 1BD2E 2C1PA 2EDTA 5C0FB 1RK0B 3RUGF 3I02B 2DQFB 1A9EA 3SDAD 1NEZB 4LGRB 3GKWH 1YY8A 1FO0L 4Y5YC 3ARFD 4HV8B 1W72H 3WFHB 2OQJB 3CSYA 2D3VA 1F3JB 4ZS7H 4DK3A 3GSRA 4P5TA 3C87A 2H3NB 4I3SL 4M6OH 3V4PL 2MJWA 3BW9B 5ANMB 2HG5B 3DJ9A 2R1XA 2Y72A 1UKQA 5CGMA 4PRHA 1YYML 2ZOKB 2R0LH 2JIXD 3EJJX 3QIBA 5MENE 3DBXA 3G5XA 4OUUB 1KB5A 2NY0C 3SHSA 3L6FB 3QDMB 1JGEA 3QNZA 4YPGA 1IGIH 3LY6A 4XC1H 4CU6A 2X4TB 5FUCC 5SWSE 4K07A 1UCTA 3QCUL 3SDCB 5D5MA 3V7AE 4WCYL 2H8PA 4MQXD 4WUKH 4KPHL 4UNVA 1CYGA 3V2AR 1RZFH 2GSIB 4Y1AD 1PGRB 1TQCB 2HJFA 4CJ1A 4AH2B 3HE7C 3INUL 1D5XB 5I73C 3KJ6L 5F9WB 3VDCA 4Y4HA 3RHWK 1NCWL 1JWSB 2IQ9H 3PV7A 5KANI 4OZHB 3GO1H 4Y2DA 1S7XA 4XNUH 4Y4KD 5IBUG 3A6OA 5L2KA 1IC7H 3KS0H 5F1OB 4MAYD 1I8MA 1PX3A 2WNGA 4N0CD 5CJ5A 3OL2A 4KZDH 3RZWA 5JW3H 3OG4B 1CGSL 3MOAH 4WI4A 3SDXB 2C4FT 5ALCH 2DD8L 5D1ZC 1UXWB 3WIHL 3BO8A 4LSTL 4TUKL 4PGDB 3BP6A 5I18L 3NN8A 3MODH 2VLKD 2HLFC 4JDTL 1QSFB 2CO6B 4KKCC 4EIZC 4BQBA 1IVLA 1G6VK 4HULB 3S36H 1WCQA 2F9BT 1XF5A 1MQKL 2A9ML 3GEWB 3VFWB 1P5UA 3NFPB 5GIRA 3LDBB 1AJ7H 3GKWL 2OMNA 1F4WH 5SWQA 1ZK9A 5FYLL 3S36X 3NIDE 4JJ5A 4KUCD 4YDKH 1RHHA 4AYFA 1HH9A 5GGUA 2M8XA 2VC2H 4NN6B 3RVVC 2AXFA 4HAGA 3K46A 1NLBL 4QRUB 3MRRB 4J2XA 1IKFL 3OKNB 4MQSB 5CWSB 1Q9KB 1HZHL 3RWDB 5HDQH 2FX8L 4PGEA 4FQXB 4JAMA 4RMQA 1CL7H 2NY6D 3RVXD 4NZTL 1NCBL 1BFOB 3S97C 4C57C 1KEGL 2UYLA 1KV3A 4RBPH 6FABH 2FL5B 5TH2B 4POUB 3K2MC 2NNAB 5CEYA 3IXAA 4JPIA 4MCYB 5DFTA 5HHNA 1S5HA 4MNGB 1JYVA 4WUKL 3BKYL 3H0TA 5C6TL 3G6AA 5EO9B 3QG6B 1FYTA 5J6GA 3VG0L 4M9OA 4PP1C 4WI2A 5ICZB 2XN9D 3RQ3A 5B3JE 1DQLH 1LEGB 1CE1L 2CUIA 3QR2A 3GO1L 5IB5B 3LKRA 4KDVA 3BP4B 3KPSE 3TNMB 1X5AA 1HK6A 5FUOH 3SE9L 1MELA 3OJDB 1BBDH 1OSPH 3EYUH 2CKNA 2E9JA 2YPKB 4KZDL 5DYOB 3KYNB 5F3HB 4ZOCA 5JW3L 3MQIA 1HEZA 2OJEB 2KL6A 1FSKC 3EYFB 5ALCL 1ZLSH 1A4JB 3QWOA 2E6JA 3MACL 3V6OC 5HHME 5CP3A 4AT6A 1NMCB 4EDXA 3D39E 3ARRA 2ADJA 3QHZH 1K3IA 3S3PA 4G43A 1T5WA 4AENA 4IRSC 2E3VA 1LGVA 4HS8L 2JCCB 4X4ZA 1EEUA 5T5FH 3P0YL 4MDJA 2XICA 4LSRH 3Q6GH 3ARSA 1RULL 2Q20A 3B2UD 4KGLA 4QCIA 4DVBA 1MCCA 1W72A 2EC8A 3O0RL 5HDQL 2ZUSA 4ZDHB 3SKMA 1UWEH 1G6RB 3WIIH 1ES0A 5DRWB 1CL7L 3HTLX 5FV1L 3EJZC 3KPPB 2XACC 2RAMA 6FABL 3BP5A 5D2NC 3ULUE 4CBPA 3QCTH 3L3GA 3V5KA 2WM0A 3FQUB 1RUPH 4MA7H 5DJ2A 4WDIA 2HH0H 5A2LH 1HQRB 3FT2B 3PGCA 5BZWA 4C4KT 1FZMB 4YPJA 4GKZA 3QEUB 1J1PL 2XZQH 4IM8A 3F8UB 4NO5B 3E2HC 5EA0H 1W0VA 5B4MD 1TZGL 3VGAB 2M1KA 4M6ML 3BESR 1H0DA 3TBYA 1BBDL 4R97B 1MCJA 2VZVA 4PJ7F 5IQ7H 3RWFB 3EYOB 4L3AA 1W8NA 3STZB 5T3ZE 4Q9BA 4HKBA 4U4BA 2C7UA 3MFFB 1CIDA 2X4RB 4Q9CA 3BPOC 1OPGL 1KELH 2CDEB 1U91B 3QWRA 3RBGA 3UPCA 1OTSC 1HCVA 3EJYD 3MJ7A 4QOKA 1MI5B 1E4KA 5IVOA 4U1NB 4ODVH 1T2XA 1S7QB 2PNDA 1KPRB 1ZHNA 1AKJA 3CXDH 4ZD3H 5D7KE 2Z9TA 4M62L 4PJ9B 1E27B 3Q6GL 1I85C 3V8OA 1HIML 2BVUA 5C09A 3OGCB 4UDTA 2VDNL 1F58H 1J87A 2ESVE 1DBMH 5F7UA 4JCLA 4JZOB 1J18A 1WBXB 2ITCB 4XNQB 3QUKA 4RRPG 2X05A 4TNVK 2O5ZL 1QD0A 2E27H 3TT3L 4LHQB 5ESQB 4XC3L 5HY9B 3TCLB 4E42A 4LKCA 3SGJA 4Z0XA 5J11B 2YN5A 2YPVH 2BNQA 2IH1A 4MA7L 1A1NB 4IDJH 1T0MB 3VJ6A 3ZE1F 1DSFH 4UILL 5CEXB 2DYPA 3ZDXE 5CZXD 1SYVB 4PJGF 2QR0A 2GJ6D 3C5ZA 4HKXA 3AS1A 1BF8A 2E7LA 1C12B 3TFKD 4YFLI 3KDMB 5I6XC 4JHZA 3UTPE 4U33A 3U1SL 3MRKA 2D7TL 1WZLA 4AEHL 5KS9F 5I30L 1DVFB 4PFEA 1EO5A 4UMGA 5FECB 5GSRA 1AGFB 3LRGA 1EERB 4KWUA 3DECA 3WL9B 4PJIA 1SQ2N 2B5IC 1OB1B 5DS8A 2WUBH 4U0RC 1FE8H 3FB5B 5T1LA 3RVTC 5JHDB 1X4ZA 2IBZY 2PO6C 3HB3D 5BRZD 1T1XB 3EZ8A 1JZ3A 2B1HL 4QXUH 3L1OL 1SJEB 1G1YA 2ZWLT 3NPSC 5FIEA 3C8KB 3LB6D 3VE0B 4URTB 1QFHA 2XY1A 2DLEA 1G1CA 1HQ4B 3FAXA 3U9UA 4LK4A 4V2BA 1NGXB 1JV5A 1WIOA 5TF0A 1S9YA 5A16B 4I9WE 3QDMD 4IHOA 2RHEA 4G8IA 4PJHF 3C60C 4QO1A 3TZVB 3MV9E 5DEZA 3SDCD 1R24B 5JMRA 4GXVH 1MAML 1RZIA 3VG9B 1DBML 3O4LA 4RMUA 4IIQA 5IFJA 4FXGA 3RPIB 2XZCH 3P4MA 1G7IA 5D71L 5J56B 1LO0H 4XP4L 1A7OH 4WWID 5GXBB 5E8PB 3DTXA 4G8FA 1J9CT 4AL8H 1AO7A 1KXTB 2BCKA 5DMYA 3JUZA 2YPVL 1QEWA 4KAQH 1CXFA 4M8QB 4F7TA 1Z0MA 2G75A 4WU5B 4ZUVB 1NSNH 1VGKB 4D94A 1M1SA 2DQJL 2IBZX 1BIIB 1QSFD 2I24N 2BXYA 5F7WC 3U0WH 3V5HB 5ITFA 4RBPK 3RZCB 4JRXA 4P2RA 1NCTA 1BOGB 1FAKT 3CUPA 1S7UA 1U3YA 1ZA3A 4NJ9H 3ISWA 4QHLA 1ZTXL 1BVKA 2FHCA 3WFEL 2BVTA 3CMOH 1EGJL 4NNYA 5EU7C 5F1KC 3DV4B 5GS1C 4C59B 4Z7QF 1RJYA 3WNPA 2N4IA 3QIWC 1FE8L 1FGNH 1EXUB 5TDPB 2ARJA 1XCTA 4K71B 4QXUL 1D5BA 4IRJC 5L7XH 5EPMA 4LEOA 1EEZA 4ZO9A 1J0KA 3MBXL 1WCBA 3O2WH 4JFZH 4OZ4A 4G8EB 4FQXD 5DR5H 4KFZC 3UTTE 3PJSA 4G7YL 3B2VL 5C0CE 1B6DA 4U6XA 1WWWX 3JWOC 1BQSA 4LLDA 4WW2C 2COQA 3KPMA 4NN5B 5D9SA 3V52H 1B0RA 3MYJB 1OM3H 3GSWB 3HUJE 1RIHL 4MD4B 2XZCL 4YGAB 1AIFA 3ROOA 2ZOLA 3HNVH 3GHBH 4L3EB 2XWTA 2WW8A 1A7OL 3L7EB 1ORQB 2A77L 3GJFH 1MUJB 4AL8L 3QFJA 3STLB 1QTYT 5DD3L 4OGZA 1DLFH 3IDNA 4JY4B 35C8H 5TQ0H 5F88A 3QJFA 4LSVH 4PJDE 1VFUA 4LCCB 5C0EB 1D5IH 3IAGC 4YHPA 2IPKB 1KCSH 1UCBH 1A3RH 1U8QA 4OT1H 3PWVA 3MV7B 4Z95H 1WISA 1UXSB 3T3MF 4U7MA 4NJ9L 5BS0E 4NSKA 3SQOL 2R1WB 4FS0A 5DJCA 3P9LA 3SGKC 4DW2H 5A1AA 4LRNL 4Z78B 1QLFA 5JOFB 2P46B 4HH9B 5DDHB 1N26A 4ZSOB 5ICYA 2RIKA 3KPLA 1ADQL 2R0ZH 2E7BA 2GK0B 4MZ2A 4P2OB 2YD6A 2ZG2A 1FP5A 2MCG1 2OTUB 3T0BA 4K55A 5I1GH 1IEAB 3VXRA 5IIEA 3PGDB 4BJLA 4HKZB 1ZGLP 2PW1B 1I1YB 5DR5L 1YEIH 2VKWA 3OV6A 5MEOA 4ODSL 1F8TL 3QUZC 4NRYB 2BJMH 3D2UA 1XIWC 3MA7A 5E2VL 5HVHC 5IW3A 3V52L 3ULVD 4HIEB 4HG4J 1KTDB 3CH1A 4S2SB 5JTWA 3MBEA 1EHLH 3E1F1 3GSOB 5K59E 2YN3A 4P99A 1BD2B 1CT8A 1XZ0A 2C5DC 1MLCB 2H2PD 1FLRH 4X99B 3B9DA 2CUHA 2D7MA 2GTZA 2IH3A 3EO0A 3WHXB 1R3HA 4RGOH 5MHSE 4KV5F 4ELMA 4DOHE 2WUCH 1DLFL 3S3SA 1GL4B 1BFSA 1LK2A 4Y5VA 1OP5K 5TQ0L 4K8RC 5CMAA 3ZKNC 2DQUH 1QLEL 2YXFA 1OY3B 2Q7YA 4EI6B 2AJ3A 3HKFA 5DFWH 4L8DA 1VFAB 1U8LB 1T6WA 1UCBL 2X1PA 5KVGH 5DQ9A 2F8OA 4I0PB 4OT1L 5CIPB 5MENB 2XI9A 3HMWL 2HT3C 5KOVC 3UPAA 2PW2B 2A6JA 7FABH 2A6DB 4DW2L 5E94B 1MI5D 1QLRA 1IFHH 4U1JB 3X12B 1NFIB 1OGTA 3PDGA 4Y5YA 5SWSB 3LQMA 3B6SA 4P57A 5IJVB 1MFAH 3U48A 2R0ZL 3BZEB 4PJ9D 4QXGL 5HGGS 5LGKA 5HHXH 4MQ7A 4WW2F 3GK8L 3LS5H 3CLEH 1U8IA 4GKNB 3CXHK 4O02H 5HGBB 3RTQA 4Z77A 5FYKD 2D9QB 1CDGA 2J5LB 2W0PA 1UACH 3D1MC 2G2RB 1AY1H 5ESVB 4ZOEA 4YO0B 4YAQA 1YEIL 2YUXA 3UPRB 4R0LA 5ABDE 3E3QE 3H9HB 4LQFL 2Q3ZA 3CDYA 4L8SC 4RX4D <