2M8XA

Restrained cs-rosetta solution nmr structure of the cardb domain of pf1109 from pyrococcus furiosus. northeast structural genomics consortium target pfr193a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
108
structure length
108
Chain Sequence
MEFPDLTVEIKGPDVVGVNKLAEYEVHVKNLGGIGVPSTKVRVYINGTLYKNWTVSLGPKEEKVLTFSWTPTQEGMYRINATVDEENTVVELNENNNVATFDVSVVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title PDBStat: a universal restraint converter and restraint analysis software package for protein NMR.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Unknown function
total genus 18
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2013-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07705 CARDB CARDB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2m8xA00
5B8CC 5I71C 1A7RH 2D4DA 5F1OB 3MYZA 1E4JA 2BSTB 1U2HA 5C0IA 3MNWA 1NBVL 2IANB 4Z7QF 3W11C 3HNSH 3IDUA 2VZSA 5C0EB 1I1AD 1YEIL 2VDRH 4PJ9A 5J9PA 3O3AB 1LQSR 1T21A 1OT2A 1MY5A 1WK0A 3KGRA 2AQ3A 1KCUL 2O93L 4NM8H 5KS9A 2GSGB 1FYTB 1KTRL 4ZFFA 4ZO7A 5CGMA 1OAZH 5CFHA 1KB5A 4ZTOL 2PO6A 2BVQA 4MJ4A 4WI3A 4BQ6A 2OI9C 4OGAC 2GHWB 5C1MB 3EOTH 3LPGA 5C08D 4CGTA 2ERJB 1YZZA 4LSRL 3EHBD 1KLGB 1OAKL 1BQLH 1H5BA 3AU1A 5IHLB 1AQKL 4CADA 1S5HB 4JDZA 4RFEA 3GSWA 3MBED 4P9HC 1E4XL 3PQYB 4EI6B 5C0BE 3ZSSA 4IDLA 3RIAK 3SDAA 4PJFA 4TQEL 3QIWD 2W0KA 3ZKMD 2VSDA 1O7SA 1EHNA 1JTPA 2D7PA 4M5YL 3UTQB 1C5BL 1MI5B 3QDGD 1UXWA 1NMAH 2EO9A 2Z93B 1GH7A 1BFTA 4I3RL 1ZGLM 2D7OA 3C6LB 4LPXA 4HFUH 4LKCB 2ENYA 4HS3B 4ELMB 5LGHL 1KPRA 4R7DB 3AB0B 4RRPG 4HWUA 2ATKB 2R1WA 5J4MA 5C71A 3ARBD 5L88H 5E00A 3OJ2C 4KAQH 3S34H 5HHVH 4P3WA 1YNLL 2H2PC 2VQ1B 4KPHH 4XH2A 3HLAA 1NDGA 1X7QB 3NTCH 4HK3N 1FVEA 5IVXA 1CLOL 3BGFB 4DVRL 4PRHE 3BIBX 1RHHB 3R0MA 2Z35A 3PHQA 4NKMA 1NEZA 25C8H 4MD0A 4LLVB 4X6EA 4ZYKB 2XKNB 4OZGE 4OZHB 5DQJB 5E2TL 3VXTA 5I2IA 1T6VN 4ZOCA 3P40A 1BVLB 3RJQB 1BF2A 5DEGB 4C56D 5FYKL 5HDBE 3B9KD 1I7TA 2KH2B 1JUFB 4OQ1A 4ALAH 4XCNA 4NKOA 1OSPL 3ROOB 5I75C 1R3IL 4LOUC 4O02H 1PYWB 2ZG3A 4QRQB 1NSNL 4CRPA 1AIFA 5MEOA 4Y1AB 4M5ZL 5IW1A 4TNVK 5DT1L 4JZJC 4JHAL 5T5NF 1PX3A 4UT6H 3SE3C 4U1NA 1MCWW 4WEBL 1JNNL 1S7XB 3ARFD 4MWFB 1QHOA 4J8RB 3GKWL 2IBZX 3BUTA 3G6DL 4OI8A 4TSCL 1F45A 1NGWB 5ACLA 3ARDD 3PWPD 4LQFL 1IL1B 1MNUL 1DQQA 1ORSB 1U8IA 2BFVL 5CEZE 4OV5B 3MLXH 4Z5RA 3E0GA 4FQXB 2OQJB 1KGCE 1M6OB 2DQDL 3JWDL 3IKCA 2HVJA 3GGWB 3DMMD 2HTKD 5ICXA 4GKNB 2FJHA 2XOTA 1PSKL 1FORH 3RGVA 1VFAA 1I8KA 5BZDA 1SJXA 2OP4L 2PXYB 2YEZB 2BMKA 1ZMYA 1V7NL 2R56H 2J6EL 5CEZH 5C0CA 3QQ9C 2CQVA 1HYSC 1QUNA 4APQD 2ENSA 1T2JA 4AT6A 3T2NH 4CU8A 4PGCA 3TYFB 3SQBA 5FO9A 5H94B 1VSCA 4EI5B 1I7RB 1A4JB 3L5XH 4C54A 1WITA 4KQ4H 4M3JA 3CUPB 2OK0L 4OKVB 5D72H 4GBXC 4OQTH 3O9WC 3DETC 1M05A 2E5EA 4HHAA 1J0YA 4XWOC 3HZKA 3U7AA 4UINH 1QNZL 2W07A 1YYLH 4WW2F 3VXSE 5HHOD 1JNHA 1Q1JL 3E2HC 4JFHD 5CD5D 5K59F 5J3HD 2FX8H 2VZ1A 4NKIL 3LD8B 4B50A 3RPIB 3D0LA 2AV1A 4DCQA 2PNDA 1MH5B 4NP4L 1LP9E 1ACZA 5F88A 2BSSB 4RMTA 4XNYL 5ETUB 1Y6NR 2R4SL 2R2CA 2W65B 4HH9A 3QFDA 2PW1A 3NPZB 4UQ2B 5FGCE 2GAZB 2GY7B 1FSKC 2DJUA 2RCSL 3O8XD 3CIQA 2EE3A 4UIKL 3WEXB 3GNMH 4TTDD 1KENL 43C9A 4QT5B 3QDME 4JGJA 1V5JA 2R69H 5E6YA 2WLZA 2X1QA 1QRNE 3X14B 2A9NL 1MI5A 3BX7C 3HHRB 3VFSA 1Q0XH 4F9PC 3FQWB 3WIHA 2X89A 4DUVA 4Y4FD 2VDLL 2VQUA 4R7DA 3UYOD 5KTEH 4NCC1 5CBAA 4J2XA 4FZ8H 2F19L 3EJZD 4XNMB 1H8OA 3LVEA 2AEPH 2EDHA 3Q6FB 4L9LC 3HAEH 4K23L 4QXUL 4CVZB 3EO1B 2R29H 4Z7QE 2NY5H 1E4KC 4WRLA 1G84A 5DSCB 4N90D 5FGRA 4AG4L 3VFWB 1JF5A 1LK2B 4AEIL 5LQBL 2EXYC 3CSBA 1UC6A 3LKOA 4RA0C 1BGXH 2FLRT 5EUOF 3AXLB 5H35A 1CFSA 1UM5L 1R3KB 5F7HA 5TH2B 4YHOL 4DZ8B 4NZRL 5HYEA 5IMKA 1HHKA 1HINL 4KRPD 3KJ4C 3MRCB 3EOAB 1MQ8A 3L3KA 1JPFA 1KFAH 3BSZH 3K74B 5L0QB 3GJFA 5EZOH 5DO2D 1CICA 4WTWA 3MLUH 4KTEH 3TVMB 4Y1AA 2A6IB 1TFHA 5FAAA 5D1QD 4UB0L 1NANH 2B1AL 5A40E 1GHFH 1KBGH 2J4WH 5BQ7A 2OR9H 4I4WB 2EH7L 2HKHH 1HHGA 4IS6B 3KPRE 3LPFA 3RWHA 3ULVL 3RNQB 5HHPA 1U36A 1N0LA 2Y07L 1ZKAA 2Y36L 1WZMA 3O81A 2IG2H 4OGZA 2BVOB 3QPQD 5E1AA 2VLMD 1M7IA 1UACH 3U0PA 3JV4A 4JY4A 2NY4C 4X7TB 3ZKXB 4S1DD 1WT5A 1CBVL 2E27L 3VFVA 2Y6SD 2W9EL 1DBML 4GKNA 4RQQA 2EZ0C 1NCAL 3T4AB 1LD9A 4LHUG 4PV8B 1ZHNB 1G0YR 5D7KD 1FAKT 2R0LL 2YEZA 3VGAC 1TJHH 4G9FD 1FVCB 1RVFL 5I19H 3TCLA 4KI5D 7FABH 5EBLA 4UT9H 3IDNB 4DKFL 5C0AA 2HFFA 3P4OA 4KMTH 1R24B 2IC2A 3UTTD 4Y2DC 1A4JA 2W0LA 1KG0B 3LB6D 3B9KC 4PJHA 1WBXB 3I2CL 2Z9TA 5ISZA 3MZGB 4GW1A 3QFJD 4P3DB 1U8HB 1IEBB 3U7YL 1BLNB 4Y2OA 5H2BB 1GGIL 4Z95H 3BKYH 1LO4H 2XXCB 3NFNB 4P46B 5JPMB 1WZ1L 1NGXB 2KDGA 4HKZA 3BPLC 1CFVL 4WWKD 1T83C 3GRWL 3VFPB 1IAOB 3GK8H 5CSBA 3ARDC 1RFDL 3N50A 3WFCH 2BOBA 3EKCA 3MV01 1T04B 5ESAB 3HPLA 2W65A 3ILQD 3BPNB 5DWUH 1CDJA 3FKUS 1V3MA 4EUPA 1NANI 1EZVX 3D39D 2NY3B 2IALA 4HPYH 4YBLC 5C70A 2XNAA 1SVZA 4P5TA 2HTKC 4R7NA 4ZG1A 3SQOH 3W0WA 5KSAB 2GI7A 1WBZA 4I0KA 4Y19B 1CQYA 2RB8A 1B6DA 5MENB 3DO7A 1ZTXH 5I15L 1JGEA 4OLUL 4K8RH 4D0DA 4XAKD 1GC1C 5ITBL 1YEKL 4APQC 4PJ7B 3GI9L 4TUKL 3FQWA 1INDL 1VA9A 2YD5A 3T0EC 1I9RH 1DQML 4OCSH 1DBJH 1RU9H 2EDDA 5D5MB 1UKSA 2CSPA 2HH0H 2X4PB 3FFDB 3UZQA 2E7MA 4WFEE 1KJVA 3Q6FA 3OXRA 4PJBF 2J8OA 3AM8A 4GXVH 4G80A 3QEHB 3MYJA 3OR6A 1PKQB 1U3HD 1FG9C 3F7VB 5J3HC 1IC7L 5HD8C 5JZ7D 4JPKH 4PP1D 1ZA6A 1X44A 5F9WB 5T3ZE 4Z7UA 2MNUA 5EIVA 3MRFB 4YIQA 5DTFB 5TH2A 4DZ8A 2ORBL 3SO3C 1N7MH 4PTUA 3EDFA 4FQJH 43CAB 1EFXD 1KJ3L 1SHMA 4X7SL 5C6PB 1FFQA 2UWEE 2HFGH 4PJDF 3OKMB 3KXFD 1RUQL 1YA5A 1CTNA 5FCSH 1F4YL 5T3ZH 3K4ZA 3VRIB 2DLEA 3OKNA 3VWJB 2DLFH 5JW5B 4OCXH 5EWIH 3O8XC 2FJFB 1JNJA 4QF1A 5F7WC 3LH2H 4P57A 5DK0B 4I4WA 1EMTL 2CUHA 2P5WB 4S0TD 5EOCH 2QJDA 3PNWB 3P4MA 1RMFL 4HS8H 4KRLB 2NY1D 1YY9C 3K4DA 3IDIA 2APTA 4DK6A 1QLEH 3F65A 3N85H 4UV4H 5FF6A 5CLTA 3QDJA 3EOYG 4Y4FC 4X7TA 3HE6D 4MA3A 5EBWB 4ONFL 3OKYA 1EFQA 3X3GH 4X7DC 1MFBH 4X9GA 2N1KA 5TQ2H 2WM0A 4GKSB 2Y06H 1ORQA 3LSOA 4C4KO 1L7TL 1ZHNA 1ND0B 3LKRB 3TZVB 1K8DB 2VLRE 3BDXA 2I25N 2IGFH 3EYSL 2EYRB 4J12A 3V6OE 4O51A 1A14H 1MCQA 3MXWL 3T65A 1EJOL 1MVFA 2CDEA 1PY4A 1TNNA 3QIBD 5DLML 4AZ8A 4OF6A 4UIMB 2Q8AH 1EVTC 5CGYC 4H8WH 2VITA 3SDCB 2FEDD 1A7NH 5JUEH 1MVUB 3LRSB 1JWSA 4HH8A 4M00A 4FTVE 5HHME 4PJXF 2Z31D 4RAUB 2J88H 1IEBA 1SEBA 5D7IE 4BSWB 2J5LB 2H6PB 1GIGL 3DHMA 4KK6D 5AZEL 3K2UH 1P4IL 5DC4B 3Q6GH 32C2B 1BAFL 5JOPD 1HILB 2CH8A 5BRZA 4JDTH 4NNYA 3BHBB 2P42B 1A4KB 1IAOA 2VC2L 5JLZB 3OJVC 4ZTPH 4X4XB 4YX2L 4XTRD 4YDKL 4NWTL 4NM4H 4G8FA 1KEGH 3QPQC 4HWEL 4QHMB 4S1QH 5ESAA 4MLSA 4NO0D 4OLVH 2M8XA 4QEGA 2VE6A 1S5IL 4M62L 4OGXL 3VWKD 5LBSL 2C1OA 3WFBH 3TO4D 2ZSVA 5JDSB 5FCUH 3GZKA 5IM7B 5FGBA 5I0ZA 3MXVH 4O9HL 1Q0YL 2Y6SC 5L2KA 5IEHB 1MAJA 4HMDA 1LO2H 3SE8H 1NFDE 2QQLL 3SGKC 3UJJH 4EDXB 5MENA 2V5RA 3G5ZB 5C09E 3S5LB 1FL6A 4L8SC 5K9QG 3HB3D 1C8PA 4PJGF 4MDJB 2EC9T 1X3DA 4MAYD 4BFGA 2DMBA 3PWVA 4K7PL 3TN0B 3RDTB 3PV7A 1XGPA 3O6KL 2I9TB 5FB8B 4JRYD 2AI0L 3A0OA 1IMHC 4KKBD 1MCPL 3QUMB 1QQDB 4JFDA 3BT2L 3MROA 4I48A 3BPCA 1QSFA 3N1FC 4ZQKB 2VO5A 5A2IH 4P23A 1L9MA 4I0PC 1ADQL 1NCUA 2VN4A 4ONGH 3H9YA 2FH6A 3V5DA 4HIHB 3ZDXF 4F80A 5KVFL 3GMNB 1WIUA 5AUMA 4WWKC 5B4MC 1DDHB 2A73B 3KLAB 3SDDA 3FQRB 4JG1L 4YDLB 4EBQL 3BGAA 1NBQA 2P44B 1PFCA 2J1KA 3RVTD 5KANI 3ILQC 2VDML 3U30B 4B41A 1LE5A 4G6FB 3L1OL 1EEYB 1F6AB 5GGSA 3VFMA 1D5IL 3PL6B 5D1XA 4HAFA 3RWDA 1IZKA 2P7TA 2OZ4L 2KPNA 3VXOB 5JR1L 5IW6B 2L0DA 2F8XC 4ODVL 5I1EH 2E9BA 2PN5A 3LEVL 4CDHA 4P3CH 4OIAA 3X12A 1I3RB 2VABB 1A7PH 3MGTB 4HIIB 4ONHA 5E8EB 2AJZB 3NBNA 1KT2A 1UG9A 2XN9B 5E2WL 5EUKA 5AD0A 5C0DB 2NY7H 4PJBE 1K85A 5DJ2B 1ND0A 1V7MH 4XCCH 1K8DA 4HULB 1CLZL 1D5ZA 5DMGC 1N3NB 3CMGA 3S37L 4WI8A 3BEVB 1KN2L 4JAMA 4KI1A 5IESL 1JYWA 2VXVL 1NMCB 3OAUL 2CIKA 2DYPA 1DQJB 1M4KA 2FO4A 5JIIA 3WUZA 1LGVA 4MXWH 3HI5H 3OKLB 4N0FB 5E8PB 2G60L 1A7QL 3DNKA 4W6WB 1LK3H 4KHTH 4RAUA 5IMMB 5C6WH 3VW3L 4JVWA 4H88L 4PJDE 4OZIA 3P0YL 5J12B 5SWSA 1HSAA 1PEWA 3VXQB 3MPCA 1ITCA 1RI8A 2P46B 3HNTH 4GAGH 2P5ED 3OR7B 2UYLB 1J88A 2AK4D 3BHBA 1MCNA 2CDGB 1H0DA 1DN0B 4GUPA 2ATPA 3DRTA 1RJLA 4RNRA 5CILH 4PRPA 2BNRD 3IDMB 4XP5H 2VLKD 2X1PA 2AV7A 3DROB 4XAWL 5IVNA 1F8TL 4PB0H 4PTTA 3B9DA 1DL7L 3WFEH 4XPAH 1BHGA 2WMPA 3OKEB 2B0SL 4JO1L 4LLAA 4NQSB 1IC5H 1NMBL 4EQ2A 3V4PH 1Y6MR 3UYPA 4BFIA 5EU6A 1BOGA 3IJYA 2ZNWA 3WNLA 4FP8L 1NFIA 1BF8A 3SN6N 4RFOH 4MDJA 3BKCH 1EBPA 3V5HA 3F6LA 1PLGL 3QIBC 5DC9B 4MA8L 1MSPA 2I9TA 4HBCL 5FB8A 5FDYA 4EN3C 1NGZA 4ZFOB 3DWTA 1DANU 1QQDA 2JTDA 3SKNB 3IJHB 4EEEA 3UTSD 1MCEA 3S4SB 4JY6A 3SCMD 2AXGB 3MRJB 2HN7A 1DUZB 3QXDB 2EDNA 1G7IA 1MUJA 3KPSA 4HC1L 5F1SA 4ZSOE 4HSQA 2BRRH 3I84A 4IM8A 2QADB 2GFBA 2DI7A 4Q6YA 1ZVSB 4KK6C 1NC2D 5F7MC 4GRLB 3JUZA 1I7UA 4M48H 4A6YB 2RR3A 1DDHA 1XF5B 1OGAA 4P0DA 1KIQA 4TPRH 4WI2A 5I18L 3QSKB 2UVEA 3GM0A 3WHE1 3JXAA 1CN4A 5IFJA 3HZVB 4P2RB 4X98A 1H3PL 1I1YB 2ICEB 2DQGH 1YPZE 1HOCA 3VWKC 3CC5B 1EEYA 3EW3B 1F6AA 3TO4C 2GJZB 4HD9A 1TCRB 5K9JH 3C09B 1JIBA 4FQLH 1OVZA 1QO3B 4JZOB 4OAWA 4FQQB 3FQNA 3H0TA 1R3LA 3ESUF 2XV6B 1T89A 3MCKB 1FNSL 1TDQA 4WI6A 2V5SA 1DTUA 1HKLH 3ARTA 4KC3B 1S7WB 1CVSC 4GAYA 3VFRB 2VZTA 3HB3C 2FBOJ 5KVEL 4OBRA 4LKXB 4AQOA 1PAMA 2DQEH 4FNLL 2H3NB 2VABA 4HT1H 1QPXA 1A7RL 1HI6B 1K3IA 5C08E 3VG0H 5IK3B 3CD4A 4KKBC 5M94B 1NFKA 2PW2B 4ODUB 5F3HA 4KKCD 1P84K 1PEZA 4LNVA 2VDRL 2YOCA 5E8NB 4PLOB 2A6DB 1DBKH 3L9RB 3RL2A 1IGTA 1RJYA 1NC4B 4M6MH 3FO1B 3MCLL 4NM8L 3C5SB 1HSBB 3VXUB 3IDGA 4HLJA 2DBLH 2J2ZA 5DMKB 1OAZL 2F5BH 2VERN 3ROLB 3ZDXE 4J7RA 3QDGE 1IT9H 5C0GB 3QAZC 3EOTL 3D25A 4NZJA 3W5NA 5GGSY 4R4NC 3FN0L 3BWAA 4LRIC 4N0FA 4M9PA 1SYSA 4QCIB 4XC3L 4LLDA 3FZUC 3MJ6A 1P1ZB 1A1NA 4K94H 4WV1B 1W0YT 1PKOA 2IQAB 1AKJD 2VH5H 1FO0H 3CGTA 4KI5F 5I1CH 2DIAA 2GY5A 4RWYH 3OR7A 3D3VA 4Z76B 1NMAL 2MJWA 3CDYA 5KOVC 3STLA 3HI1B 3MV9B 3W2DH 5JHDB 4HFUL 3FB8A 3MRHA 4WU7A 5I1KH 3KPMB 4PR5A 3QCVH 4X4ZA 3RPKA 4U0RB 4PJIF 5L88L 4KAQL 3S34L 3RZCD 4K7FB 5HHVL 2YXFA 1JWMB 4O5LH 5HYQB 3ARGA 4KPHL 1A3RH 2BY3A 4PP2A 4UAOB 3NTCL 3AS3A 2NX5B 5E08H 1W2KT 4JLRA 4TSBH 1WWAX 3GSUA 2VISB 4TSAL 3C60B 25C8L 5BMFH 3L3DA 2C9AA 3O4LA 4RZCA 3QDHA 4LSVH 3VI4E 3QUXC 3PABA 2YN5A 5TE6H 3LV3B 5JXAH 1G7LB 2H32B 5C0FB 4E0RA 4Y4HD 1G6RB 4ALAL 2YSSA 5I8KH 4PJ8B 3RL1A 1I85A 4O02L 5D70H 1LO3H 1MCRA 1A1MB 1VDGA 2EDWA 1IGYB 1WQVT 2W60A 3GBML 5TDOA 4MJIB 1FN4A 3MLWH 1QRKA 1U93A 1UYWL 5FOBA 4H8WC 3CLEH 5FM5M 4G8GB 1HQRA 2G2RA 4K3HA 4UZGA 1AP2A 4OJFH 1H3GA 4FFZL 5TDPA 5IBLD 2OYPA 4MCZB 3MLXL 4O58H 4F7PB 3FONB 3UPCA 4GG6A 3HZVA 2DLHA 1QOKA 3MRPB 2X4UB 1OLLA 4U1IA 5IB5A 5ANMA 3FT4B 1RZFH 2FJGA 1QSZA 5I1AA 5KSBB 1QO3A 2PYEA 4WU5A 5HHOE 1KLUB 3VGDA 4JFHE 2R56L 4PY8I 5CEZL 2H8PA 4PJAF 2PO6D 4F15B 4AIOA 5IWLC 3O4OC 3UBXI 4EQ3A 4ZOEA 3O6FD 5MHSE 3T2NL 4RMWA 5EZJB 1V3JA 2ILLA 5CEYA 3L5XL 3LQZB 1K5NA 1LO5B 4M61B 1WVZA 3S5LG 4BH7B 5CD3B 4LRNH 5D72L 1QA9B 4LGSB 2WBWB 4OQTL 3WIHH 2GTWB 1KIPB 2CRYA 2YPLD 4ODUA 4KVNH 1O0VA 4I3SH 1ZA3A 2OX5A 3SKUD 3AMKA 3RWCB 3TF7C 4UINL 1YYLL 2Z4QA 5E8NA 2OMBA 3DYPA 1BWMA 3QIUD 4LCUB 3WLBA 3MRRB 2A6DA 3L9RA 4TVPD 3L5HA 1N4XH 5DRWB 1DN2A 1Q72L 2EH8H 2FX8L 3FO1A 3P0VH 1JI1A 3D69A 4M8VA 4QRRB 4XBGA 5AZ2H 4Z77A 4GMTH 4HUVB 4AH2A 4V1DB 5I16A 2JIXA 4JFEB 4LHUD 3AAZA 4Y16C 1WZKA 5F7UA 1BQUA 1QBAA 1A6UH 3TLRA 2B2XH 3CVHH 3VMOA 1B0WA 3BH9B 3LS5H 5D7JA 1CQKA 2H26B 4I2XA 1EO8L 5GJTH 3ZDYF 1A9BA 3HZMB 5F72S 3BMVA 3GNML 4IOIB 3GJFH 4LDLB 1D5MA 3BN9D 4ZXBD 3VE0B 4WEUD 1KIRB 4M6OH 3RVVD 5C8JA 2R69L 1N26A 2VZUA 1T66D 5E8OA 3VFUB 1TVBB 5DDHB 4QXTB 5T5FH 1FFNA 3SJVB 4W81A 2EDOA 5GSRB 1Q0XL 5KN5B 2R1XA 1YEDB 4D0BA 2R8SH 1VPOH 4IHOB 5E5MA 4ZAKB 1XR9A 5KTEL 1F3JA 1U91B 4DKDC 1PZUB 4FZ8L 4XZUA 1XCTA 3LN9A 4HV8B 1MHEB 3C87A 4K7FA 2JK5B 1KXVC 1MCWM 1MF2H 2AEPL 1J7VR 1UM4H 4NIKB 3WO3B 5JXEA 4AEFA 1XIWA 1CFQB 2R29L 4G6JH 2NY5L 2ADGB 1T22B 5EIQA 5CHNA 4LP5A 4I18A 2XFXB 4JFYA 1BGXL 2X2YA 5GGVL 1B4RA 3WJJC 5IBUB 1A8JH 1TQCB 4WHYH 4XB7A 3TIEB 4YQXH 1Z0NA 2Z8RA 3LV3A 4NC1C 1HCVA 5FUZH 4FRWA 1T03H 5F89A 2FYYB 1KFAL 2VLME 3MMEB 3BSZL 2BNUA 5EZOL 4PYHA 3MLUL 4N1CA 5BXFB 4KTEL 2RGSA 3TBYB 2OL3H 1MCBA 3PWLB 2YZ8A 4JFFA 4PRIA 5KSUB 1GHFL 5A3IC 1KBGL 1LDSA 5IB1A 5MI0C 2O61A 4NBZB 1ZGLP 3OKDB 1A1OB 2OR9L 2IPUK 3BP6A 5D7KE 2HKHL 2FO1A 4DVBB 3MOQA 2QHRH 3QXAB 2BRQA 2F58H 4G9FE 1WIPA 2LQRA 2J6EA 4KI5E 2IG2L 2FWOB 5A16A 3CFEB 5B38B 1UACL 1DJSA 2IAND 4F7PA 4PS4H 4YE4H 5F1KC 1GAFH 3T1FB 2NY6D 1J8HE 4PJIE 3DPBA 2DWEA 5FKAB 2XA8H 3QFJE 5EUOB 1INQB 4XP4H 4EUPH 4ZUTB 4ETYA 4WUKH 3QHFH 1FFRA 1TJHL 2XKSA 5I1DB 5I19L 1HH9A 3JWOC 7FABL 4UT9L 1MCSA 2AABH 4OI9A 4XHQA 4OZ4B 1CE6B 1Q9LA 2ITDA 5I9QB 1YN6A 3EGSA 1CFTB 3LKNB 1UJ3C 3PGDB 3OF6A 4U1HB 4X5WB 1I75A 1BFVL 4U6HB 5E9DE 7CGTA 1KJMA 4AQ1B 1ZLSH 5CD3A 3BPOB 3PQYD 2DLGA 3WJLA 3D39E 5KVGL 1EEZB 2EDRA 4CJ1A 1E0OB 3V9FA 5J57B 4Z7VA 4XNQB 4P4KA 1H9VA 1FLRH 4Z95L 3BKYL 2FATL 4OB5H 5B8CB 5I71B 1LO4L 3IJSA 1C5DB 3QWOB 1MI5D 1EV2E 3KYOB 4HUVA 2APFA 2B39A 3C6LD 1A0QH 5FYLE 3S4SG 1S8DA 3HUJE 2F74A 1HYRC 3BYTA 5F7NC 4JKKA 3VFOB 4XBPB 1B6UA 4PG9B 3WFCL 1WISA 2JB6A 4HJGA 5FO7A 2ICWA 5ICYB 5IBLC 3REWA 5DC0A 5DWUL 1OWWA 2QQNH 3ZKSD 1IC4H 4KDWA 4PD4K 4P2QE 4UQ3A 3HCVA 2OI9B 4PJ9C 3SQOL 5FYLH 1NH6A 4L3EA 4OFKA 3HZMA 4HX1A 5MEQB 4H25A 4RWHA 3EFFA 1ZTXL 2NTFB 3C9NB 3PGCA 1C08B 1BBJB 4K8RL 4Z0XB 4MSWB 5GRXG 3BGMB 1TVBA 2PO6C 2A74A 3MV8E 4QXTA 3UDWA 1C12B 5DZNA 4E42B 1UZ8B 1I9RL 2ZCKH 3QXUA 1VCAA 4OCSL 4ZAKA 1RU9L 1H5BC 1QFWM 3OHXA 4DWHA 1CICD 4HFWB 2HH0L 3THMH 3SKMB 4Y1AD 4X6CA 1B0GB 1S7SA 3ES6A 3T3MF 3SGDI 4FQCH 1XCQB 1FL5B 4GXVL 1I8LA 1F4WL 1JZ2A 3SDAC 3KXFE 1Z5LB 3GSXB 1I3VA 3LRHA 4P9MH 1DQDH 4YHPB 4ODTH 2M26A 4JPKL 4JHWH 4ZO9A 1MCOH 3IDJA 4G8IA 2H9GA 2ADJA 5EU7E 4X6DE 4ZUVB 1N5YL 4FQXD 2JKXA 3O0RH 4DKAA 1N7ML 4HIXH 3FO9A 3ZTJH 4FQJL 5FKPB 4HWNA 3MMEA 1IEHA 1A3LH 1D6EA 3H3PH 2CRMA 3DIFA 5EC1B 2HFGL 2JCCA 4DK3A 2WQ8A 2PXYD 4WTZG 5T3ZL 2Y72A 1C7SA 1A6ZA 2DLFL 2HLFD 3BD4A 3O11A 5EWIL 2HYMA 3H7BA 3W81A 3QUZA 3BN9C 4ZXBC 4LEOA 5EOCL 5GIRA 4BUGA 3RVVC 3QXAA 4YFLI 1G7JA 3NABH 2EE9A 2VXTH 4R4BB 3MV7B 2FWOA 1QLEL 3CFEA 4UV4L 3BIKB 1OY3B 5ISZD 4ACPA 1FG2B 3VXRA 3D2UA 4HIEA 4RSVA 5HYJA 5DF0A 4KWUA 1U8KB 3T1FA 5D6CB 3RI5K 3MREA 3X3GL 5AWNH 1MFBL 1UFUA 1AO7A 4MNHB 2Y06L 3RP1A 4U6XA 3RUGA 1RJZA 4PRNB 5KOMC 2CIIA 3QQ3B 4TNWF 2IGFL 4GQ9H 1QVOA 4GFTB 1KN4H 3GSNL 1A14L 2X40A 2F9BT 4RCAA 3HFMH 4DW2H 3GRWA 1KCRL 5BVPH 3GJFK 3PGDA 5DQ9A 4CW1A 2Q8AL 3SKJH 4LCWB 4GRWE 4QOKB 1A7NL 2FX7H 1DQLH 2OTWA 2VL5B 1H15A 4HMEA 1I8IB 1U95A 4PRBA 5MERA 1EEZA 2J88L 4OLWH 3RGVC 4POZD 4Q58C 3CFIC 3DX8B 5JMRA 5E03A 3DVIA 1VGKA 3VD3A 4DZBA 2VLLB 5CIPH 2MPAH 4YHIA 3NPSC 3PWJB 1U8OA 5HBBA 1NGYA 3OBAA 4GBXB 3AY4A 3Q6GL 3ZE0F 4P5MA 2R4RH 4JDTL 1E27B 1U8LA 4DN4H 1IVLA 2ZUWA 2VRAA 4ZTPL 3C08H 4LARH 5D7LE 3M1BB 3MGAA 1EHLH 3W39A 3E2HB 1B4JH 4JN1H 4S1QL 4YHYC 4OLVL 4D3CH 3L3GA 3G5YA 3RHWK 3S97C 2OXGA 5CJ8A 1NLBH 3B43A 1X9QA 3WFBL 3O41A 5FCUL 5BZWB 2MCPH 2I5YH 3MXVL 3B3IB 5ECJE 5LGJA 2NY6C 1LO2L 3SE8L 4WJ5A 3F12A 1ULVA 1G9EA 1CDGA 3UJJL 5KG9B 3TNNA 1N6VA 1WAAA 1M7XA 1HDMB 3MLSH 3LN4A 4XVJH 5IR1B 5IEKA 3ET9F 3P3YA 1HEZA 1FSKB 4LSSH 3G6JE 4HMCA 3GSRB 1IKFH 1OGTB 1SBBA 2Y7QA 4PJXB 3S36X 4E42A 5C3LD 1VACB 3VXMA 2XG5A 3KLHD 5IVZA 2PF6A 2HJKA 2WBJB 3NIFE 3TVMD 1FJ1B 4YAQB 3IAPA 2V7HB 5DJ8A 2XICA 2J3SA 1OP3H 1YEEH 1U8JA 2W0PA 4O2EB 5T5NG 2ESVB 4ONGL 3DX9B 4N8VB 4U1KA 1ES0B 1R5VA 2VIRB 5CP3A 4QRPE 1FH5H 4PPTA 2MTPA 3VGGA 3IFPA 4L9LB 3LZFH 1W0WB 4UDUA 5H37G 3QDJD 4Z7WE 1T2QH 3FB5B 4C83A 4HUUA 4U6YA 3ZT6A 5GS0H 4MNGB 5DJXA 5BS0B 3K0WA 1KCKA 2XZCL 2MSPA 1CU4H 2FR4B 3OQ3B 3BGFC 4Y5YB 3EJYD 3L3IB 2FIKA 3DXAA 4PJGB 5SX5H 4JFXB 2XZZA 3KJ4B 3MRIB 1HWHB 3FT3A 4IDJH 3BQUA 4X9IA 1QBML 4XVUD 5I1EL 4BYHA 2CXKA 4OV6F 2DB8A 4HUXB 4HKBB 5INCA 3MFFB 4P3CL 4Z8FH 3IVKB 4N0RA 1E28B 4N8CH 4JZNB 2DQFB 4YDVA 1TZGH 5FECA 3BIKA 4L4VA 2EIZA 4NNXA 1A7PL 5EPMA 1CICC 3DGGA 2QSVA 1OSZB 4NC0B 5CUSL 2QBWA 5KVMC 4S0SD 4X6BB 1CE1H 3C8KB 3T3ME 3PHSA 2NY7L 3DARA 1V7ML 4XCCL 4NCDA 4YFDB 3E3QC 2NY4B 3VU2A 3V52H 2NYYD 5GRVK 1BBDH 3WDJA 4WI7A 2HVKA 2AK4E 2BNQA 5CWSA 5EO9B 2HFEA 1FZKA 1MRDH 5DA4A 2BNRE 4LCWA 1YN7B 5J13C 2VLKE 4MXWL 2NY3D 3DUUA 5DVOA 3HI5L 3VGAB 2CMRH 8FABA 1P7QB 2PTUA 3SBWA 3WUWA 1WT5C 4PY7A 5HI3D 1EAPB 3NZHL 5KSAD 5IBUG 5HYFA 2X4SB 1IM9B 1LK3L 4KHTL 5I8EB 4N0UB 5KS9F 5MEND 2OJEB 4Y2DB 4RAHA 5F8RC 2R9HD 4M7ZC 4C56B 2HLFC 3B9KB 3HNTL 4GAGL 2EICA 2VN7A 1HHIB 4AIZA 1FZJB 3BZEB 2WWKT 4N5ED 1QR1A 4XP5L 1EO7A 4HZLA 5E2UH 1HHHB 2HRLA 3GMMB 1Y18B 2X7LA 1HHJA 3CDGA 4P2OA 4JFDD 1B9ZA 3DJ9A 4PB0L 3I6LD 3NFPB 4URTB 1QSFD 3BPLB 1XGUB 5DRNA 3SDXA 1VFBB 4PJFF 3JVGA 3V8OA 2LTQB 3PWPB 4OKDA 4NWUH 3B3IA 1MLCA 1A7BA 4XPAL 3UTSE 1GPOH 4R4FL 5B38G 2NZ9C 4HIJA 2DDQH 4BH8A 1IC5L 3VDCA 1ADQA 3V4PL 4Z7OF 5LKNA 1CT8B 3EO0A 4NQCB 4JRXB 1C1EH 2NLJA 3PIQB 3SE4A 3I50H 3EBAA 2WNGA 4PJEF 3BKCL 4FFYH 3B6SA 4NO5B 2NY0B 1I1FB 4J3OC 1F00I 1YEFL 2Y5EA 3QQ4A 3WKMH 2WBJA 1ZT1A 1JHKH 2L4OA 1U92B 3B83A 5IVXF 4NJ9H 5F6HJ 1LEKB 5BV7H 3NCCB 4FQHA 4P5TC 5D1XD 3LKSB 4YAQA 2E8YA 3VWJD 2L7UA 1FFPA 3WS6A 3WNNA 5IIEA 5IG7A 2BDNH 2V7HA 3T0EB 1NCTA 2V5TA 3OAYH 2IFGA 2EXWD 4WNQB 4POZC 2P5WD 1IGIH 1U8NB 3OTTA 1C5CH 3DVNB 3KS0H 3HMXH 4TRPL 2NW3B 3FQTB 2VIRA 1QFWH 1URLA 1QD0A 4RX4A 2OZ4A 1KJ2B 1D9KA 4HQQH 3LIZH 1MOEA 4Q74A 4PJCA 4Y5VA 3JBG7 1WIOA 3MLTB 4TPRL 1RQ5A 3A67H 1FGNH 3I85A 1CDCA 1G7MB 2F53B 4DTGH 3AM8C 3RX7A 1F11B 3TZVD 3CSYB 3FFCA 5K9JL 4FQLL 2YPKA 5DHYB 4OF7A 3SO3B 2YKLH 4BFBD 2WAHA 1K8IB 3SY0A 1MPAH 2C1PA 1FNLA 5DJ6B 1MFCH 4YHKH 4MHHI 3ARZA 4U1LA 3WSQH 5DHXB 1BQHA 2DYPD 4XMKL 2HJLA 1RD6A 3AS2A 4CNIB 4HKBA 3TM6A 4N68A 4F37F 1ZS8A 1NDMA 3O8XB 5K33A 4HT1L 5F1IB 1AC6A 3KLHC 3VG0L 2ZSWB 5JHLL 5ESQB 1J1XH 1IKNA 2EO1A 3IDYC 3VD4A 4DUXA 4FZEH 4KVCH 1OM3H 2GEEA 5HGDB 3AROA 3OV6A 2CDFA 1DBKL 2F15A 5EBMA 4MQTB 4GOSA 1MLBA 3P4NA 4M6ML 1NGPH 4HG4K 3TJHD 5HGBB 4TUJA 1W8OA 1AD9B 2DBLL 2CLZB 3QEQA 2F5BL 1QSEA 4Y4KA 5DVNA 4YR6A 1IT9L 4QGYA 4XXCA 4F7MB 4FXKA 4LIQE 3QH3B 1MCDA 3RX5A 3TBWA 1GZPB 2ZPKH 1OQOA 5JA8B 3ZKXC 2WP3T 3O3BA 3O3DB 4PREB 5DVLA 1RK0B 4YXKH 4PG2A 3M8OL 1IQDB 4X5XA 2VSCA 4K94L 5HJ3B 4XNZC 2A9MH 5I8EA 1F2QA 1IGJA 4OSUH 4OZFB 4Z0BH 3QI9A 5T1LA 1R3HA 2VH5L 1FO0L 5I1CL 4RWYL 4OUUB 4UUJB 1AY1H 2AJVH 3DRQB 2SEBB 1UVQB 3TA3A 4YUEH 1Y0LA 4XVUC 3LRGA 3TN0D 3HC4H 1VEPA 1OP3K 3W2DL 1RZJH 1CGVA 1ZT7B 4CVWA 5I1KL 1Y18A 3QCVL 1AE6H 4MX7A 4J4PA 1XGUA 5GRWA 4J1UB 4OT1L 5E0QA 4O5LL 5IKCA 1A3RL 4NRXA 3P4LA 1JBJA 2Y23A 3QXWA 3U46B 2J8UA 4TSBL 3GI8H 1BZ9A 5J11C 1BREA 2AJUL 2HKFH 2E7CA 4RMQA 4PV9B 1LE9A 5C0JB 5BMFL 4HC1A 2D3VA 4WUUA 2ZNXA 3G9AB 2CKBH 4PJ5B 2NYYC 3HA0A 1OGAD 2AJXH 4LSVL 5SX5K 5CBEA 1G9NC 2CLRB 3MUGA 4G9DB 1HE7A 5I8KL 2ID5A 4GW4B 5JQ6H 4PIRF 4L8SB 1ZVYA 3I3DA 3U9PH 5D70L 3WLWD 4M4PA 1LO3L 3EYFA 5HVHC 5FGBC 2P48B 5D2NE 3VRJB 3BKMH 5HI3C 4LSRH 1JZ8A 3KYNB 4OZHF 4MYWB 5IFHH 1P2CB 3MLWL 3CH1B 2R9HC 3N1QC 1GRWA 2R23A 5ITFA 3GMLA 2VWEE 5ID0A 3CLEL 1E4XH 4GJTB 3PJSA 4ORZC 4OJFL 4I0PB 5AG8A 5HHQA 4O58L 1KCVH 3MRKB 2WINB 3PP4H 2XPGA 1YJDC 2XN9D 3BD5A 4HUWB 4WWKB 5E6ZA 4P23C 5DJCB 4BELD 2YPLE 1RZFL 3RNKA 5SWQB 2FLBT 2IADB 2PETA 5ACZB 3E6FB 1EGJL 5FIEA 5ERWB 3IXTB 4NT6B 1E4WH 3MRGB 3WO4B 2AAVA 5F9WC 1YNLH 3RWFA 5ALBL 3QEGH 3KDMA 3QCTH 1KELL 4Z7OE 1EXUB 2VXSH 2EEBA 4W6XB 1BD2B 4HLZH 3SDDC 4DVRH 3D48R 5HGHB 1FFOB 1IAII 1LEIA 4KV5E 2CRIA 3DV4A 4PJEE 1KACB 5F71A 3WIHL 3JWNC 2A83A 4ZPVA 3MRQB 4GG8A 3QEUB 3OGOE 4L4TB 4I3SL 3RZWA 1OTUD 1L6XA 5D1XC 1TJIH 3QWRD 4P48A 1MY7A 3C5JA 3FB7B 5EZLB 3VDBA 1FDLH 3P0VL 1R3IH 4JVPA 5AZ2L 4GMTL 4MXQD 5FK9A 2J7LA 2CLZA 2F54B 4LK4A 4NDMB 4OD2B 5BJTB 2D7NA 4I8DA 2IAMA 4M5ZH 5ACMA 1BMGA 3GM8A 5DJYB 5BW7A 2NXYD 4KHXH 3KYAA 1HXYB 1A6UL 4N8VG 3SDYH 1HH6A 2B2XL 3CVHL 3RRQA 3ARGD 4JFPA 1M7DA 1CR9H 1J0IA 5C0BA 3MNVB 1LILA 2XT1B 4ERSL 5IBTL 1BM3L 4PJAB 5JNYA 1OAXL 4LMQI 5JORB 1FZOB 2BFVH 1XFPA 5GJTL 1FCGA 2I07A 4JGUA 5HY9B 2FBJL 3HE7A 1E4XI 4MCYA 3JWDH 4M6OL 3MGOA 2EYTA 2Q87A 4AENB 4ETQA 4Q9QH 3REVA 1N5AB 1TQBC 1EFXB 1XF2A 5T5FL 4PGJA 1X5GA 1WCBB 5FYKU 3OAYK 1RUPL 4P4RB 4XXDA 1VPOL 2HA1A 1T2XA 1CGUA 4JPWH 2N7BA 4KMQA 3TIDA 1H3VA 1ZHKB 3FCTA 1I1RA 4R3SB 3FB6B 1AD0A 5FYJU 4J1UA 4OD3L 5IHZB 1AR1D 1MF2L 4PRHA 5F7DB 4YXLH 3U9UB 3L7FA 1UM4L 4XGZB 3T4YA 3VGHA 3S96A 2EDJA 2J5LC 1WCQA 3L6FB 5INDB 2CPCA 3ZYZA 2QADD 1YY8A 1BFOB 3IFOB 3GMQA 4OZGA 1FHGA 2YD7A 3EYVA 2FZ3A 3TJHC 5D2LB 4NQDB 1TVHB 1ZE3C 4MXVF 1JE6A 1UWEH 4YQXL 5DMIH 5HGAB 4WI5A 5D9SA 2BVPB 4JEGB 4P2RD 5FUZL 2Q76B 4FQ2H 1FVDB 2IANE 5A2JH 1AXSB 1YMHA 3TBTB 1SEQH 4L8CB 2PYED 4Z78B 1AH1A 3B4NA 2OL3L 3I6GB 5MEPA 1A6WH 2DQCH 3QIBB 1J0JA 5I66B 4JO3L 4EN3B 1FYTE 4NN6C 3WIFA 1BZ7B 2QHRL 2F58L 5T3XH 3HC0B 3MRBB 4H0GA 4NHCH 3R06B 4UIKH 3TN0C 1U8QB 5DURB 5TDNA 4LSPH 4PS4L 4YE4L 5F9AC 2WV3A 3MRKA 5DI8B 1GAFL 1NCBH 3PQYE 4HUWA 3JV6B 1EBAA 4YJZL 2FD6H 4LCIH 3OB0H 1Q9WB 3LS4H 2XA8L 1NC4D 2PR4H 1J8KA 1R5WB 1GZQA 4WUKL 4NQEB 4F7TA 1ZVHA 1N59B 2F19H 4NUJB 1WBYB 4NO0B 4IRSA 5GGRA 3RY4A 1MI5E 1G0XA 2XYCA 2Y5TB 3G5XA 4AEHH 3VWKB 2AABL 4OCLC 3CXDH 3HG1B 5HGHA 1FFOA 4ELME 4D2NA 4X0KA 1MREH 1MQKL 2C3VA 3EYOB 1ZLSL 3AREA 4QYOA 3VXSA 5E70A 3MRQA 3QEUA 3OX8B 3WLWC 3QA3B 4LCYA 5ENWB 1T7VA 4LLWA 1QP1A 4XBEH 5T1DH 1FLRL 4MQSB 5DJ0B 1KPVB 3LKPB 2R2BB 1T89C 1G7QB 3SKOB 4JDVB 1VADB 1TCMA 4IMKA 4OZHE 3MV9D 5JHDD 4TUOB 1A0QL 2BOCA 2M1KA 3GMPB 3PWNA 2Y25A 1M71B 1JYNA 4ZS6D 4KJYB 2LU4A 4PRAB 4UU9A 5JOFA 5EDXA 5FYKD 2VKWA 3IAQA 2VLJB 5JXED 2NX5D 2HT3C 1X5YA 4K3DH 1XIWD 1IC4L 5GRVL 4Y1AE 3QAZB 3NIDE 5FYLL 3H9ZA 3HAEA 4JR9L 4IOSD 1QRNA 1NUGA 1TZHA 1IE5A 1ZGLB 4YHNA 4U1SB 2CXGA 4M7KH 2BHZA 4KROC 4NKDB 4KJPD 2VR9A 1I1CA 3I3EA 1F6LL 3BZDA 4MB3A 2HFTA 1MAML 5F7LB 3L3JB 3S36H 3SOBL 4Q2ZA 2DOCA 3THML 4EJ1C 4YHLH 3MR9B 4MJ6A 1RUKH 3MJ7B 5DFWH 1A22B 1GL4B 3X17A 4JFFD 5IHZA 4UBDD 4WDIB 4FQCL 3U9UA 4LVOC 3DX7B 2DI8A 1A6AB 3GDBA 2X70B 5JO5A 1BIIA 4MJID 3L6FA 1CI5A 2H2SC 4UOW0 1OTUC 3IFOA 4P9ML 1DQDL 3WXVH 2EDLA 4G8GD 4ODTL 2RFXA 2DM2A 3FMGH 1JYVA 3ESVF 3CX5K 4JHWL 4KK9C 4YGVA 3KPOA 4NQDA 1MCOL 1VKXA 2YD1A 5TF1H 4Q97A 3FTGB 1GGIH 1L7IH 5DEFA 3O0RL 4ZUSB 4DAGL 4HIXL 2NXYC 3IETB 1XF4B 3F8UB 4G8EB 2XTJC 1A3LL 4G6MH 3FQUB 3H3PL 3ARGC 1AJ7H 2EDEA 2R2HB 1JHLH 1X4YA 3QUXB 1A9EB 1U8MB 3JZ7A 3I6GA 4JFQA 5T33H 3RX8A 1INEH 3KPRA 2R2EB 4Y88A 3CXHJ 5C07B 1S7VB 5DRXA 1C16A 3HS0B 2KL6A 3MA7B 3HC0A 3MRBA 4UMGA 3NABL 3GO1H 3TO2A 5HGGS 1TPXC 4MQXD 4OZFG 4NPYA 5LVEA 5I15H 3D85A 1T7ZA 1X4XA 2FEEL 1I85C 5DMYA 1EAJA 2VKXA 5BVJA 1DSFH 5DYOB 3MNZA 5ITBH 2GK0B 1FGVH 4P4KD 2C3HA 4PLKC 2MHAB 5AWNL 1AR1C 1Q9WA 4J3SA 1RZIA 4Q9RL 2XY1A 3L95A 1WWWX 5EO1A 1JPGB 1XGRA 4QRRD 3JTTB 5JPNB 5IT2H 5ELIA 1RZJC 4LBEB 4E41B 4O2CA 4WFGD 4GQ9L 4QRTA 4FG6D 4V1DD 1KN4L 4ZUUA 3QNXB 5GS2D 5D71H 5C9JB 3HFML 4DW2L 3BMWA 4MJ5A 3PUCA 3KHOA 3GIVA 2UY7A 3UYRH 2WW8A 3SKJL 2BC4A 2FX7L 3DGCR 2QLVB 1DQLL 3O4OB 4L29B 4LU5H 5SX4H 2ADIB 3P9MB 5DXWA 5GRZA 2GQHA 5ENWA 4K3EH 4OLWL 2PYFB 4JM2B 3C09C 3M17B 3RWGA 3DVGB 1QEWA 2MPAL 1KPVA 1RZGB 3LKPA 1FIGH 2R4RL 3GHEH 4DN4L 1RUQH 2YA2A 4JQVA 4LSDA 3C08L 4LARL 1M71A 4KJYA 4ZAKD 4MS8D 1B4JL 1LEGA 1OPGH 1Q8MA 4JN1L 2NCMA 4D3CL 3OXSB 3Q3GB 5GS3A 1HCFX 5ICZA 1J5OH 1CIDA 1RMFH 3KR3H 4KZEH 4OZIF 3OKKB 4UI2A 1XF3B 4CN6A 5I76A 2I5YL 1KXTB 4J3VA 1OD9A 2BSED 3QPXH 4Y16B 2YR3A 1CS6A 1WICA 1P9MA 4CDGC 1ZGLA 1RUMH 3MLSL 3QNZB 3ULVD 1EDQA 5J1AB 2FHFA 4D9RD 4W4OA 3OZ9H 3MRDA 3Q2CA 3IU4L 4LHQB 1NCWH 1YC8A 2E9JA 2KQNA 5IP4A 2X10A 1T5XA 3EYSH 4NSKB 1P69B 5D7JC 3MR9A 4RMSA 3QG6B 3F58L 4RMUA 3C5ZA 1ZANH 5DLMH 4DGIL 3F7YB 2X70A 5HVGB 2AEWA 5TE7H 3QUZD 3Q5YA 4U1MB 5GJSH 2GSIB 2D0GA 1J05A 3T8XA 2E7HA 1NAMA 2AKRA 3CU1A 1FH5L 3GHBH 1JK8B 4PB9H 3OB0K 3ZHDA 4X99A 3LZFL 1PG7W 3D9AH 3SHSA 4F33B 1FQ9C 4I5BA 1GIGH 3D2UD 1T2QL 5SX4I 1RIVH 2X42A 2UWEA 5JDJA 1YQVH 5GS0L 4EVNA 5EZIH 4D0CA 1TZIB 2CRZA 3RIFK 3TT3H 5JXEC 2NW2A 1XIWC 2R0WL 1S7RB 1H3XA 3VD9A 1G7PA 4NQXA 3U2SA 5GGVY 5EFIA 4I18C 2C26A 4IDJL 5DJAA 3MLYH 2XWJA 5DUBA 3HS0A 2D9CA 2X4QA 5IQ9A 3ZE1F 3MA7A 4AK1A 1ZWIB 4KJPC 3GSNA 4Z8FL 5EIIB 2QQLH 4N8CL 3BO8A 1TZGL 2A77L 5MI0B 2AXFB 1FV1A 2G5RA 5E24E 3MLRL 1RZ7L 3JWDC 4KUCD 2AJSH 3EDEA 5KSVA 5EC2A 4PBVC 3RWIB 2VLRA 1ZSDB 2VL4A 3T08A 1CE1L 2QSTA 3O6KH 5DS8B 4Y19E 4YK4C 1UEMA 2PKDA 3V6OA 5MENE 4UILL 4PGBB 1A6TA 1HKFA 4OFYA 3ARXA 3IGAA 3RTQA 4F7EA 1YUHB 1T1XB 1BBDL 1O7VA 3IF1B 4ESKA 4PJ7E 6FABH 2GCYB 5HI4C 3S6CA 3P77B 1ADQH 1MRDL 1OTTD 3U79A 5D5ME 4FTVA 1AGDA 1I8MA 3T0WA 4HDIB 2CMRL 3D18B 4F9LA 4L29A 5D7IA 3I6LE 2DM7A 4F7CB 1F97A 3RKPA 5TJWK 4XP1H 1UJ3B 4JM2A 3VCLA 1PKQE 4H5SA 5GHWH 2XWBA 3PDOB 1UCBH 1TTUA 2X9XA 4ELKA 3D0VA 4QNPF 2IH1B 1FYHB 5SWZE 5ADPH 2A6KB 3L1OH 4YZFE 4IRJB 3RVUC 5TGBA 2HLAB 2DBJA 3E8UH 3TBVB 2PCPB 3KPQB 2VDQH 3MRMA 2X4RB 3HR5B 2OZ4H 5E2UL 5D8JH 3G08B 1DBAH 2WSKA 4Y7MA 1HXMA 5HVWA 3WJLC 3TP4A 3ARWA 3VRLE 2XXMB 3NCMA 1NFDA 1Y6KR 3NFSH 1XF3A 3PGFH 4NWUL 1CG9B 4P4KC 1GPOL 1SQ2N 5C09A 3LKQB 5IB2B 2NNAA 2DDQL 3NH7L 3LCYA 1M1SA 3LEXA 4LDEB 2ZP0T 2H2PD 4ZOBA 5C0IB 1KYOK 3MNWB 2P5WE 3QNZA 1C1EL 5B3JF 3I50L 5J1AA 1DVFA 1FZMA 2WQRA 3DV6A 5LWYH 2GJJA 4PJ9B 5J9PB 4FFYL 4JFZH 1T21B 3BH8A 3TBSA 2HTLC 3QO1A 5KS9B 5D1ZA 2ZUQC 3WKML 4ZFFB 1JHKL 1I4FA 4NJ9L 4KY1H 1KB5B 5BV7L 2BVQB 2APVA 3Q0HA 5DZLA 1WF5A 3VI3F 4BUHA 4LOUD 3MC0A 2GSIA 1IGIL 1H5BB 3AU1B 1C5CL 1KSRA 3HMXL 1CGWA 3LEYH 4JDZB 5FUCE 4M4RA 4I3GA 4RFEB 1QFWL 3GSWB 4Y0GA 3UDWC 2NPLX 5T1MA 2UVFA 3MV7D 3LIZL 1NUDA 4ENEC 4QTHA 4F33A 3SDAB 3V0AC 4PJFB 4XB8A 5IROA 4ZAKC 3A67L 1RZ8A 1FGNL 3H9HA 4H1LA 5A43C 5GRUH 1UXWB 3S3PA 4OIIH 1D5XA 4DTGL 1I8LC 2IWGA 1VERA 1KPRB 2ZG1A 4JO4H 2YKLL 1JF1A 5L7XL 5JIKA 1MPAL 1CFNA 5E00B 2Q7NA 1MFCL 3QULA 2BNQD 4JRWA 1CZ8H 4XH2B 3R4DA 3HLAB 3N1PC 1NDGB 3WSQL 1XGTA 2Z8VC 3ULVC 1FVEB 5IVXB 4ZNCD 3HI6H 4LCWD 2ARJA 2YUZA 4LPTA 4ORGA 2IPKA 1NJ9A 4GG6F 1WJ3A 1VFMA 2Z35B 3PHQB 3RBSA 1HYSD 1NEZB 4BM7A 3F5WA 1WFTA 4X6EB 3BXNA 1R5IA 1LMKA 4JZJA 4JKWA 3KPPA 1J1XL 1G1YA 1PQZA 4PJBA 3VXTB 5I2IB 4O2FA 1WZLA 4FZEL 5IB2A 1OM3L 1PLGH 4RIRA 4HK0A 1I7TB 4CMMA 4XCNB 4GBXD 4NKOB 5E1HB 3DETD 1NGPL 3QUZC 4XWOD 3P30H 1WEJH 3C2AH 1AIFB 3TWCH 5K9OB 5MEOB 4ISVA 5IW1B 3IF1A 4U1NB 4YFEA 4ODBD 1T0PB 2AGJH 1PVHA 2ZPKL 3UBXB 3D18A 2C5DC 4YXKL 4PJDA 4B53A 4GW5A 3CPLA 1DQQB 1U8IB 2BVUA 4U2ZA 3GB7A 2A9ML 2V5YA 3L5WA 3QO0A 4OSUL 4K3JH 4Z5RB 3OMZA 4IIQB 4Z0BL 3IKCB 4ZDHA 4OCNC 2HVJB 4DKEH 4X7CC 2AJVL 5ICXB 3FAXA 2FJHB 4IRJA 3HC4L 4LL9A 3RGVB 1VFAB 1I8KB 1RZJL 4QXGH 4AEEA 4NJAH 2WBJD 2OTPA 2BMKB 3O9WA 3NPSB 4U1JA 5HHNA 5C0CB 3H2WA 1AE6L 3ULUE 2DI9A 5I1LA 2D7TH 4KGJA 4AT6B 3FOLA 4PGCB 5FO9B 2ESVD 1N8ZA 3GI8L 4YHYB 4RX4D 4LLYA 1X5HA 2FGWH 2HKFL 3AY4C 1NGQH 1M05B 2CLVA 3BI9X 4HHAB 2CKBL 5IJVA 3HZKB 3ULUH 2AJXL 1JNHB 2KZ1B 4LLMA 2NY6B 1FIEA 2EXYD 1QBBA 1BJ1H 3DYMA 3MCLH 5KANG 1OTTC 3CFJA 2P49B 5BS0D 5JQ6L 1Q38A 1ED3A 4TOYH 2OJZH 3D0LB 3U9PL 2O26U 3FFCD 4CU6A 2AV1B 4GT7A 4DCQB 4ZSOA 4M02A 3BKML 1RURH 2XN9E 2QR0A 5F88B 2ZUVA 2HWZH 1X4ZA 3FN0H 5B22A 4NZDA 5IFHL 4HH9B 3CMOH 3TNMB 3QFDB 2PW1B 4XC3H 3DO3A 2QQKL 3LQAH 3BD3A 3LPWA 4I9WE 4QNPE 5I1IH 3PP3H 43C9B 3U4BH 1TTGA 3INUH 1YPZA 1OB1B 1KCVL 3V0VA 1KTLA 3PP4L 3UJTH 1ZOXA 4HXBL 2C3GA 1I1AA 3FO2A 3VFSB 4DUWA 3ZKQD 4POYA 4ZPTB 2NY4D 5ID1A 2XWTA 3MRNA 5CBAB 4D9LH 4U33A 3RWJA 1MRFH 2QKIA 3V7AG 4Y4KD 1E4WL 2EZ0D 3QEGL 3QCTL 2VXSL 5C08A 4MA7H 1RK1B 1OLZA 3DTXA 4QRSA 1P7QD 4TSAH 3GMRA 4R6UA 4WVRA 5FGSA 3LKOB 1K4DB 2FCBA 5JIPA 3MBEA 3LDBC 3CVHB 1IM9D 5H35B 1CFSB 5KSBF 2APXA 2I60H 4Y2DD 2WUCH 1UT9A 1HHKB 3QI9D 1TJIL 1MCKA 1TLKA 1PD6A 5IMKB 2EDYA 1UGNA 2ZKHL 3QIWA 4EDWH 3L3KB 1FDLL 1JPFB 2DKMA 3BQUC 3FN9A 3GJFB 4Z7NF 4WHDA 3VI3E 3QDGA 1CICB 3EDDA 5K9OA 2JJTA 1FO0A 5F9OH 4HUKB 3CDCA 4MLIA 3KPNA 2IEPA 3B5HA 4KHXL 3GBMH 3UTZA 4CU7A 3WFDH 5BQ7B 4J4PD 3SDYL 3ARBA 3RWHB 1HHGB 4GAJH 1UYWH 3UBXA 1P7HL 4OFVA 1CR9L 5HHPB 4Z7VF 1YECH 4NYLA 4Z6AT 2HT4C 4MD5B 4HGWA 5E1AB 1R6VA 1I9IH 4FFZH 5DK3A 3KJ6H 3OAZH 2MQ0A 4KXZH 2HT2D 1M7IB 3QUKA 3NCYP 3U0PB 4IIQA 5J13B 3JV4B 4JY4B 4NQCD 4JRXD 3MO1A 5HDOA 4Q9QL 3VFVB 5E6IB 1SY6A 1S7TA 4RQQB 4NO3A 2NY0D 1LD9B 4C55A 3PXJA 4JPWL 4M7ZB 2Q86A 1NLDH 1ZHBA 3SBWC 4KQ3H 4U4BA 4D9QD 4P2RE 3TCLB 5EBLB 4M7LT 1VEMA 5D96C 3MLVH 5C0AB 3TEUA 5EU3A 3CFKA 2HFFB 1AGEA 4YXLL 3P4OB 3T0ED 3OL2A 4LLQB 3LHPH 2IH3A 3ARFA 3UROR 3NA9H 1F58H 5ALCH 2OL3B 4PJHB 3HKFA 2AXHA 3HTLX 5ISZB 1JV5A 4GW1B 4M43H 3G6AA 1MJ8H 4L8BB 1UWEL 4F2MA 5DMIL 1Z9LA 1S9YB 5HD8D 4P2OC 4G6AC 2F53D 3V0WL 1Q72H 1P4LA 4OGYH 3X11A 4HKZB 5E99H 4FQ2L 1JGLH 3DMMA 2VAAA 1SEQL 3JVGC 3BUYA 2FL5A 4UNTA 5DHVA 4UTAL 2BOBB 1AFVH 4G42A 1A6WL 4RISH 2DQCL 3HPLB 5DZOA 5E8DH 4RFNC 3CVIL 4NNPH 1Q9OA 3TNMA 3WNPA 4EUPB 3ULVF 3VXUE 4APQA 2IALB 3SE4C 1EGJA 4HGMA 2XNAB 5T3XL 4G43A 4R7NB 4NHCL 4P5TB 4N1HB 1EO8H 3W0WB 5I0DA 5HXMA 2BZDA 3TPKA 1WBZB 3UZVB 5DJDA 3WCYA 5I8CA 1FNEA 3DO7B 2WBJC 5IF0A 1JGEB 4LSPL 2JCCF 4PRDA 1OB1A 4D0DB 4F8TA 5IMOA 3GFUA 4KXZI 1YY9D 1NCBL 3WS6C 5HHOA 2FD6L 4WW1B 4LCIL 4XCEA 3LS4L 5CCKH 4ZPTA 2PR4L 1MJJA 2Y1VA 1JZ5A 2IBZY 3V6ZA 3O45A 1FNGA 5M95B 1KJVB 3SPVA 4AEHL 1D9KC 3OXRB 3S98A 4QHUA 5HTSA 4G80B 4Y5VC 1XZ0A 1F2XK 3MV9E 3A6OA 5JHDE 3MYJB 3OR6B 3CXDL 1RK1A 5K93A 1JPSL 5F3BA 1U3ZA 4Y8AA 1MREL 4KDTA 1K4DA 1ZA6B 5GGVH 4LVHC 3CVHA 4Z7UB 4YIQB 3RUGF 2NX5E 1SM3H 4Y5YC 4MZ3A 5FYJE 5CGYD 1XF1A 4R96A 4XBEL 5T1DL 2X4OA 1A47A 4PTUB 3HUJB 1AI1H 1EA9C 4AJ0A 1W0VA 3K7UA 3IDYB 4LLUA 2ED8A 3O6LH 3OKNB 4Y4FA 1QPPA 1WTLA 5AAWA 4QF1B 5FYJH 4P57B 3JUYA 1U8PA 3KLDA 2LVEA 4KUCF 2CUMA 3P4MB 1CGYA 1IKNC 2B1HH 4K3DL 1IM3A 4K9EL 5EN2A 4MD5A 5DUPL 2D4FA 4G3YL 2K1MA 3IDIB 2F8OA 4U31A 3BAEH 1B90A 5FF6B 3QDJB 4MJIE 2W9LA 3BP5A 3DHJA 4MA3B 4HGKC 1G6RH 4PJ5D 3VDAA 5HYSA 4M7KL 4Y4KC 3MSPA 3I75A 4G8GE 5E6IA 2IPUG 2OTUA 1BX2A 2ZOKA 5E4IA 4XNZB 4XXCC 3LSOB 1ORQB 2F8VA 1KPUA 2OR7A 3S36L 3BIAX 4GKZA 4AY0A 3MJ8B 4O51B 3EOBA 4YHLL 4PG2C 1RUKL 1F90L 3T65B 4WHTA 2CDEB 3F7QA 5D1QA 3PP3K 4NHUA 1J12A 2K7PA 4PLJC 3EZ8A 3RGHA 3BP4A 4LLQA 5KSBE 3CLFH 4JPVH 1BFVH 3R1GH 1D6VH 1NEZG 3QI9C 2VITB 2OL3A 3WXVL 5CEZD 1JWSB 3FMGL 5D6DA 2VR4A 3TA3C 5KVGH 4X8JA 4R97C 1KGCD 3H42H 3V2AR 4I0PD 5TF1L 1A2YB 1SEBB 4L8BA 1DUYB 1R3JA 1L7IL 5CP7A 2FATH 2VDPH 1S9YA 1R0AH 5J11B 4X9BA 2Q7YA 2C7UB 4J4PC 3QZWA 1PG7X 4BK4A 4NRZA 5BRZB 4G6ML 4NNYB 1QBLH 2HG5A 5B4MD 1S7QB 1FCCA 1AJ7L 1ONQA 1JHLL 2LTQC 3QDAA 4QXWA 4G8FB 3RAJL 1BJMA 3CK0H 4QRUA 5T33L 3JSSA 2J8HA 1INEL 1NCDH 3BEWB 4G9FA 4F3FA 3UBXG 5C6TH 2HT2C 2VE6B 4O00A 4QRRE 5FUOH 4WFFD 2C1OB 2ZSVB 3U4AA 4WFGE 1BD2D 2V2TA 5HVHB 3FRPA 4V1DE 3GO1L 5L2KB 4JANA 4JFEE 1QLFA 1O5DT 3VFTA 3K81A 3CFDA 2NY0C 4U2YA 5F1NA 1T0MA 1YEGL 5EORH 1FNHA 1J0HA 3ZT7A 4L4TD 1FL6B 3ME0A 1J8HA 4PJIA 4DQOH 3QFJA 1DSFL 2DQHL 2GIYA 1FGVL 4RGNB 4ZNEA 4WW1A 3OKOA 3PWVB 3FRUA 1UXSA 2F5AL 1IEAA 1XGPB 1XH3A 1OW0A 2WIIA 5CJOH 5E2VH 5IUSA 5IT2L 2F54D 4ODXA 4JFDB 3MROB 5CIPB 4I48B 3ZL4H 3BPCB 1QSFB 3GMOA 3SJVE 5D71L 2FNBA 4P23B 3IKKA 1F4WH 1L4IA 5E9DA 4BZ2H 4ZFZA 3OAZK 3U6RA 3RQ3A 4EIZC 5DMGD 3UYRL 4HXAH 2HJFB 1W72A 3V5DB 4LAQH 1A7OH 3D39A 4CKVX 4FQ1H 3UJIH 5K59E 4OLXL 4Y5XA 5AUMB 4LU5L 1AQDA 1QRND 3DLQR 1N5YH 1JGDA 4K3EL 3GSOA 3SDDB 2QHLA 4U1GC 3JTSA 3GIZH 3AUVA 4DEPC 3HUJA 1FIGL 1LE5B 2DD8H 3GHEL 4L8DA 1QLRA 3ULVE 5GGSB 3VFMB 1B3JA 4HKJA 5D1XB 4D9RE 3RWDB 3NAAL 2P7TB 1OPGL 1NAMH 4M6AA 1QTYT 5CZVH 4P2QA 2BVTA 4NQVA 4CVXB 5IHBA 3MJGX 1J5OL 2K3TA 3KR3L 4NOFA 4KZEL 3MRLB 4YWGH 3X12B 1CLYH 1U3HA 4N0CC 5I6XC 3QPXL 3ARSA 1OL0A 5B39A 3MV8A 1ZHLA 4NQDD 3P9LA 1RUML 2LV4A 3WFHA 4PY8J 4ONHB 1OOAA 2IAMC 1KT2B 2YD2A 2EDFA 3IT8D 1BFSA 3ARRA 3OZ9L 5CZXD 2KKQA 2C4FT 5EUKB 2V2WA 5AD0B 5BW7C 4UT7H 3RIAF 5J6HA 4CAGA 1CCZA 1NCWL 3SDXF 1D5ZB 3U36A 1EZVY 3MJ8A 3K8KA 5BCAA 1TQBB 3GSNH 4JAMB 5TQ0H 4CN1A 5GZND 5GSVA 1OTSC 1ZANL 1KCRH 2CIKB 2DYPB 5EUOE 5TE4H 2FO4B 4BSJA 3HE7C 1BWWA 4EN3D 5TE7L 2E6PA 1UKTA 3L3HA 4KJWD 2P45B 4QRPB 5GJSL 5L8JB 2P43B 2CO7B 3OGCA 4X6DA 3GHBL 4B5EA 3E6HA 4PB9L 4Z7WB 3D9AL 1A2YA 4H20H 1DUYA 1J87A 5DURD 5EOTA 4LAJH 5T1KA 4OZIB 4YPGA 3NN8A 5SWSB 3WFZA 1HSAB 2AQ1A 4ODWA 1RIVL 3HE6A 2C7UA 1YQVL 3OJDA 5EZIL 1S7QA 1H0DB 4GUPB 2ATPB 3DRTB 1RJLB 3TT3L 4RNRB 4PRPB 4NQED 4ZS7H 1X5XA 2AV7B 3O3EA 1KTDA 1RIUL 1FL3A 1P4BH 3BEWA 3QJFA 4KRMB 5KW9H 3MLYL 3PV6A 2P8MA 4Q6IA 4PTTB 3HG1D 5ADOL 3VGFA 1YQ2A 4TNVF 1SYVA 1UB5A 1CD1B 2V9QA 4IMLA 2E7LA 5D4QA 1HQ4A 2I27N 2BXYA 4NN6B 1NAKH 5EU6B 4BFIB 1BOGB 3IJYB 2VXQL 1EH9A 1NFIB 2Z31A 3ZLQC 2AJSL 1A64A 5K9KA 3V5HB 3NZ8A 4B7IA 5DVMA 3BOVA 4WHYG 1S78D 2XKUA 4QHNB 1NGZB 3VJ6A 2HRPL 2B7DT 3C8HA 5CIPA 2WLYA 4JY6B 1PGRB 1F42A 6FABL 2HN7B 1W8NA 5C3TA 1G7IB 1MUJB 3KPSB 3QHZH 2VLJD 1DBBH 2HJFA 2ZUXA 1S3KL 2GFBB 3B2UD 4OUOA 4TYUA 4XP9H 1CXKA 1UH4A 2A38A 4JN2A 4YC2B 1CGTA 1SJHA 1E6OH 2UZIH 4XVTH 1NUFA 1I7UB 4XPFL 2DTMH 4XP1L 1OGAB 4P9HH 4R4ND 1KIQB 5DD0L 5GHWL 3MFGB 2EKSA 1UCBL 5IFJB 3FZUD 4IRSC 3BWUC 1YMMB 4X98B 4MA1C 4BKLA 3WO4C 5D7LA 2W0FA 2XZCH 1HOCB 4L3CA 5ADPL 4U7KA 4MAYA 5KVDH 4LVEA 4GSDH 5AG9A 3E8UL 2VDQL 4OAWB 3EJJX 3FQNB 3H0TB 1R3LB 5D8JL 4EUPG 4RGOH 1DBAL 3F62A 1QBMH 2EC8A 3VG9B 5JW4R 3AREC 4CVXA 3C5ZD 3S35X 4GAYB 1RIHH 1Z0MA 2VUOA 1I3UA 4FXGA 3HNVH 3SE9H 3ULSA 4NRYB 1G0DA 2CGRL 3NFSL 2JLLA 3MRLA 2GUOA 3IS1X 3PGFL 1ZT4A 2HP4A 3KPLB 4H1LH 1YYMH 3HPJA 3BZ4A 4OM1H 1UJTA 5KZCD 1CXIA 4IMKC 3G6JA 3NMEA 5F3HB 5CUSH 2ZOLA 4LEXH 4P2YA 5LWYL 1KB9J 5DR5H 3GUTA 4I13B 3H9SE 3MV7E 4JFZL 2R1YA 3RL2B 3VFGH 1IGTB 1ERNA 1RJYB 4S10A 5ESVA 3IDGB 3EFDL 2YUVA 3QUXD 4KY1L 3NCJH 4KROB 3QUYB 4S2SA 2J8UF 2BSRA 4YDIL 3N0PB 3RKDD 3HRZA 3D25B 3D1MC 4X4ME 3I9GH 3WNKA 4HF5H 5C07D 4QRPA 3BWAB 2NY5C 2RAMA 1SYSB 5L2JB 3LEYL 4LLDB 1X5JA 3NZHH 1A1NB 4Z7WA 2ZUSA 4LVOB 3TJEH 2YS4A 4JREC 3U0TA 3RWEA 3WNOA 1DEEA 3VMNA 4QOKE 3L3OA 3D3VB 5GRUL 5LGKA 4KTDL 2EIBA 4XWGH 1L6ZA 2DM4A 4OIIL 2BCKA 3STLB 2QSQA 4N9GA 2BVYA 3FB8B 3MRHB 4OFYD 2YPVH 4WU7B 4XCYA 4E41D 4JO4L 2O5XH 2OCFD 3BZFA 4PR5B 3GKZA 2IBBA 3IU3A 3T3PF 2NXYB 5L8LB 2XTJB 4N5UA 4WO4A 2P24A 1CZ8L 3ARGB 4PP2B 3UEZA 1FPTH 1XGQA 5E5RB 3HI6L 2XZQL 4JLRB 1LO0H 4TTGA 4R4FH 4FTVD 1FRGL 3G9VA 2VDKH 5CZXC 1CD1A 3GSUB 4XMLH 1UQSA 1MFNA 1GSMA 4L3AA 1T5WA 3L3DB 4HBQA 3O4LB 4RZCB 4DJMA 4LGPB 5A1AA 5C7XH 2PTTA 4JM2D 1BP3B 2CKNA 3PABB 1TPXB 1GOHA 5GZNC 1MEXH 4E0RB 3PG2A 2A6JA 1OF2A 2Y9RT 2YSSB 1YEFH 4W68A 5EO0B 4QHNA 4LCCA 3RL1B 4KJWC 1EIBA 2AK4A 2X44D 5AYUL 3ZTJG 3P30L 1WEJL 3C2SA 3C2AL 2VYRE 3TWCL 1JHTA 2BNRA 2VLKA 1SVCP 2A0LC 4PJXE 1P5VA 5GRJH 2W60B 5TDOB 2AGJL 2I9LA 1CDBA 1FN4B 4TRPH 1FNAA 4JFOA 1U93B 1UB6A 3T2QA 2WWKO 4GMSH 5IJKA 5FOBB 3QT2A 5EULV 1MHCA 1HQRB 2G2RB 1U58A 3GJEA 3MZTA 1AP2B 4ODHH 5C09D 2Z91A 4Y16D 4D8PA 5E4EC 3UC0H 5TDPB 2V2XA 3L7EA 4K3JL 2X4TA 2ESVE 2IJ0C 3UTOA 3HZYA 4YNYA 1DVFD 4GG6B 4DKEL 1YMMA 5CJBA 4U1IB 5CSGA 3QUML 5IB5B 2GJ6B 5ANMB 2FJGB 5I1AB 5D1ZD 2PYEB 4QXGL 4NJAL 4WU5B 5DEZA 2Y4SA 1AGBA 3W9EA 2H8PB 2Q6WA 1T1WA 1MWAH 2OSLA 2DICA 4MNGE 1EHAA 3V95A 3UTSA 5BS0E 2D7TL 4XMKH 2YUWA 3SCMA 1S9XA 3UPRA 4NRYA 4RRPA 5LAXA 4WY7H 4PJGE 5CEYB 3KPLA 5F93C 4KK8D 1K5NB 3ZHKA 5F97E 1REIA 3BJLA 1NC2A 2FGWL 1S78C 1NGQL 2YMXH 5JHLH 5DGRA 3HMXA 1ZA3B 3ULUL 4JQVC 4K8RC 4MMZC 4YO0A 4JB9H 1A21A 2Z4QB 5FA3A 1KEMH 4NN5C 3WLBB 1VEOA 4RGMC 1CXLA 3MV11 4XBGB 3D69B 5GGTH 4Z77B 1G7HA 4OCYL 1T1YA 5FDWA 3B2UC 3CFBA 4TOYL 2OJZL 4AH2B 1LVEA 3QUYA 2V6HA 5I16B 2JIXB 4OZGF 4UDTA 4YPJA 1RURL 3AAZB 1GYAA 3WN5A 2HWZL 3LOWA 3RU8H 5IMLA 1WC7A 3CMOL 5HDBF 4PUBH 5L2JA 5D7JB 2D9QB 1L0QA 3B5TA 3LQAL 3M8OH 5DK2A 4HKXA 4W4OC 2FRGP 3FQXA 5BO1L 1MHHA 5I1IL 4I2XB 3ZKND 1A9BB 5A3ID 4AL8H 1SJEA 5F6IC 2BHYA 1D5MB 3U4BL 1JWUA 4ZMAT 5C8JB 3INUL 5A2KH 2AJ3B 5E8OB 3A6BH 3VA2C 1FFNB 5JW3H 3UJTL 1AR2A 1VENA 3C5ZC 2R1XB 1ZK9A 3CSGA 3V5KA 2XQYG 4D0BB 4N0UE 2MQ3A 4OF8A 1CTOA 5E5MB 2IQ9H 1XR9B 1ZEAH 1F3JB 5GQBA 4C56E 2LU3A 5HPOA 3U83A 4D9LL 1MRFL 4XZUB 1XCTB 4OT1H 3BFOA 4HJ0D 4MDIA 3VXNA 1XIWB 2YBRA 5GISH 4MA7L 1T6WA 5CHNB 1FAIH 2AJUH 1JN6A 4I18B 3WNMA 4JFYB 2I24N 1F6FB 1SY6H 3DX6A 1I9JH 3KYMB 4POUB 3T04D 5J6GA 2I60L 4R90H 4X9HA 4DFHA 2KZWA 2WUCL 3PWPE 3W82A 2WP3O 3MBXL 1AKJA 3VD5A 5J89A 1NBZA 3RKDC 1T3FA 4EDWL 2ZJSL 5CMAA 5FA4A 5F89B 5EO0A 5JW4N 4AM0A 3ZSTA 4NQCE 2BNUB 4IRJD 4JRXE 1RY7B 4A2MA 5DJZA 5F9OL 4JFFB 4PRIB 1DLFL 1JPTL 4M1DH 4M6NH 1CXFA 4YK4B 3WFDL 5ABDE 5IB1B 2O61B 2ZZUT 3BP6B 1HNFA 4GAJL 3T0DA 3G04A 4TN9A 3RZCA 2P8PB 4LNRB 2V5MA 1K2DA 1YECL 4EIGB 4ZUWA 4D9QE 3P73A 1I9IL 5A16B 3T0EE 1K3ZA 3KJ6L 3V6OC 3T77A 3FOMA 2HMID 1QG3A 3DUSA 4DGVL 2X4NA 3BVNA 5DHVH 3RTQC 1YNKH 1AGFA 4PJ9D 3AC0A 4ZFOL 4KKAD 1JL8A 2X41A 2GJ6A 2V7NA 5EU4A 2DWEB 1GC1H 3GSQA 2CKBA 4KTYA 4LFHG 1LDPH 4Y4HA 1EGJH 1P7KA 1NLDL 5FHAH 2F53E 1HH9B 2ITCA 4KQ3L 4EOWH 4F9LC 2DRUA 3KWWA 5ALBH 1KELH 3MLVL 1Q9LB 2ITDB 3LMJH 1YN6B 3EGSB 1KJ2H 4JM2C 4J3UA 1EX0A 1U0QA 3C8DA 3LHPL 4YEEA 1GGBH 1F58L 3NA9L 4QHKI 4XI5C 3DBXA 1RV6X 5ALCL 1KJMB 1GXEA 4JM4H 4R0LA 3MUJA 4O4YH 3SDAD 3PXHA 4M43L 3R8BB 2LAGB 1MJ8L 4KJQD 4Z7VB 3EO9H 4P4KB 1AHWA 3CDFA 1H8NA 1PX4A 2A2QT 3A6CH 3ARPA 3IJSB 3MACH 1XR8A 4OGYL 4X4YB 2GK2A 5E99L 5D2NA 1JGLL 3UTPD 4JPIA 3P11H 3MODH 1HZHH 1S8DB 2F74B 1PG7H 1AFVL 2JB6B 4U7MA 4RISL 4HJGB 5FO7B 2ICWB 3JV0A 2X6MA 3REWB 5E8DL 4MHHG 5D2LF 2ZUQB 3RY5A 1JI2A 3R0NA 4NNPL 4U05A 2P47B 3L5JA 3U48A 1DVFC 4ERSH 4GRMA 3O6FA 1BM3H 2BY0A 4UQ3B 1OAXH 5IBTH 5GS1A 3HCVB 4MD4A 4G7YH 2DL9A 1VGEH 4L3EB 4HX1B 4XPBH 2FBJH 4H25B 4X5LA 1ETZA 3EFFB 1U41A 1PZ5A 2QL1A 5D1ZC 3DURA 4N90E 4NO2A 3PGCB 5KAQG 2AJ3A 2YPLA 2A74B 1CL7L 1RUPH 2NZIA 3IRZA 3QIUA 5CCKL 5I74B 3ZZ1A 2KQMA 3WHXA 1F3DJ 3OHXB 1YNTA 4KK8C 4CJ0A 5F96H 4X6CB 4XX1G 3TESA 4OD3H 1S7SB 3ES6B 3CZFA 5GXBB 4K71C 1DE4A 4LHUA 3UCRA 4PJEA 1PJ9A 5IROC 3V8CA 1Z9SA 1QR4A 4OZFH 5FO8B 3IDJB 3ORJA 4G8IB 2H9GB 3KYMA 2ADJB 4LVNC 5EOQL 1SM3L 5TPWH 4YH6A 4WTXA 3LN5B 4ZXBA 5F9JA 3UZEA 3FO9B 3WD5H 1AI1L 4L4JA 1D6EB 4MAUH 4J3WA 3DIFB 5IOPA 4PGEA 4NUGH 1Q9KA 3X13A 4LSUH 2JCCB 3G5VA 2DIBA 1WWCA 1ZV5A 4PJ5E 3RGVD 2OXHA 3GBNH 5F70A 4P5KA 3O6LL 3WE6A 1A6ZB 3O11B 3ZKNC 5C0CD 4FA8A 1OCWH 5FYJL 3H7BB 2CR3A 4JO3H 2DM3A 3QUZB 1UZ6F 4LEOB 3FL7A 5GIRB 2P8PA 4LNRA 5DD6A 1G7JB 1Z2KA 2B1HL 3BW9A 3PWUB 2VMFA 3BISA 3BAEL 3STZA 2ARWA 3W5MA 3UTTE 1WSST 5HHXL 3VXRB 3D2UB 3I02A 1G6RL 4HIEB 5E94B 5HYJB 2GITA 1QKZH 1JZ4A 4UNVA 3MREB 1GOGA 3BDYH 4HJ0C 1AO7B 3OSKA 1QSVA 4U6XB 2Q8BH 3RUGB 1RJZB 5HDQH 4CN4A 2CIIB 1S7UA 3O2VL 4V2CB 1QVOB 3ECBA 3WS3A 3BDBA 4NZUL 5DQ9B 4CW1B 3CLFL 4JPVL 4KH2A 2EYSA 2MCG1 3R1GL 1D6VL 3PHOA 1MQKH 2AW2A 1NKOA 2ED9A 2OTWB 1H15B 2G9HA 2OMNA 1U95B 4IRJC 4PRBB 4WFFE 5MERB 3H42L 1BD2E 2BSTA 1VGKB 5FOJA 4DZBB 2VDPL 2IANA 1R0AL 4YHIB 1U8OB 3ZMRA 1NGYB 1K9TA 3KPTA 1CXEA 1VHPA 4X4YA 5C0EA 5C0RH 1JP5A 2ED7A 4P5MB 5IW3A 1QBLL 1U8LB 5J7CC 3O3AA 2X89D 4L4TE 4XAKE 3R8QA 1W72H 2X09A 3W39B 3KS0J 4FQIH 2GSGA 1FYTA 3CK0L 3D5OF 5MHSD 4XC1H 3L3GB 1NCDL 1V3LA 3G5YB 4CMHC 5C6TL 2MKWA 5I8OH 5FUOL 2HMIC 2F54E 1EUTA 3O41B 1NPUA 1KLGA 5LGJB 2UWEF 4KKAC 2NY2D 4JR9H 4BQCA 3FAWA 4WJ5B 3F12B 1S5HA 3O6MH 3OPZH 5EORL 3TNNB 4G5ZH 3PQYA 4JKMA 4EI6A 1QACA 3LN4B 4P59H 4DQOL 5IEKB 1WLHA 3S8WA 1HEZB 4PJAE 4HWZB 1TIUA 2Y7QB 2DL2A 2LVCA 4MNQB 1MAMH 5CJOL 3UTQA 5E2VL 3VXMB 3SOBH 5IVZB 1VFUA 2HJKB 1V05A 2Z93A 1QZ1A 3C6LA 1IGFH 5C2UB 4LKCA 3ZL4L 3DOSA 4HS3A 4ELMA 4OFIA 4AIXA 1DFBL 3VMPA 5DJ8B 2ATKA 3BKJH 4BZ2L 1U8JB 1MCJA 3S3SA 4KJQC 4LSQL 4HXAL 3CXHK 4U1KB 1X6NA 2VQ1A 1R5VB 4LAQL 1A7OL 1X7QA 4FQ1L 3UJIL 2E6QA 4M93C 5FO8A 3IFPB 4FABL 1G1CA 1I1AC 1RHHA 4UDUB 2EDQA 2BK8A 35C8H 4BQBA 1V3KA 2ZCLL 4LLVA 2VDOL 4ZFGH 3LN5A 2XKNA 4DAGH 4ZYKA 3GIZL 5DQJA 1N0XH 4HUUB 4OZHA 4U6YB 4C83B 4ODSH 5E6ID 5DJXB 3LDBB 1BVLA 1P5UA 2DD8L 5D2LE 5DEGA 4NQDE 1RAMA 1JUFA 2FIKB 3DXAB 4ZO8A 3EHBC 3ROOA 2R0KH 1NAML 1PYWA 5D7IF 3FT3B 3V4VH 5CZVL 3ZDYE 4QRQA 5C0AD 3BQUB 3MBEC 4JM2F 1S7XA 4MWFA 4BFEA 4J8RA 5INCB 3S35H 3PWUA 4YWGL 3QCUH 3QIWC 1CLYL 4YDVB 4K94C 3ZKMC 5JA9A 1NGWA 3ARUA 4HLZG 5FECB 4L4VB 2EIZB 4NNXB 4OF3A 1IL1A 3DI2B 1WFOA 2CK0H 2YRLA 5EPMB 1ORSA 5E94A 3DGGB 4QGTA 2JJTC 2E7BA 3PDDA 4OV5A 2NZ9D 4R26H 4L1HA 4FQXA 4Q9RH 2OQJA 1M6OA 2A1WH 4UT7L 3GGWA 4JG0H 3ARBC 2BJMH 1NFDF 4D94A 2Z8WC 1A5FH 5JOPE 5TQ0L 2HVKB 2PXYA 2BNQB 5CWSB 3TCXA 2HFEB 1FZKB 4PLNC 5TE4L 4IIQC 4NQEE 3AGVA 1RZKL 3DUUB 3T2OA 4JE4B 1D7FA 8FABB 5E95B 3WUWB 1CD8A 3QXVA 4P5TD 3TYFA 3IFLH 4PY7B 5H94A 5D96B 3W0WD 3O2DH 4EI5A 1I7RA 1CK0H 1TXKA 2VAJA 3DSFH 3B8YA 4H20L 3CUPA 3HG1E 3KAAA 4OKVA 1J8HD 4GRWH 4NFCA 1UADC 4AIZB 4U7SA 2XIDA 1UZ6E 1QR1B 3ARFC 4ZS7L 4HZLB 4U6VH 4M1GH 2XQBH 2X7LB 1HHJB 3CDGB 1P4BL 4P2OB 3RPIA 4JJ5B 5KW9L 5DRNB 4JRYE 5L9DH 3EZJB 3OG4B 3SDXB 2AK1H 1MH5A 5E9DD 2BSSA 2FSEB 1ZXQA 1MLCB 5ETUA 1OAQH 3ARQA 5TFSH 4HIJB 4KFZC 4BH8B 4OLYH 4UQ2A 2VLJE 3CX5J 4RFNB 4XPTH 3DMMC 1MIMH 1NAKL 1IGCH 2GAZA 3EO0B 2NLJB 3F6IA 1OAUH 3WEXA 4HWZA 3KG5A 2FEEI 4QT5A 2AS5M 1JGUH 3B6SB 3IU4H 5FYLD 4MNQA 3U7WL 2AJYH 3X14A 3QQ4B 1ZT1B 4G7VL 2RJMA 4GAFB 1IILE 3AS0A 4FQHB 4HPOL 3F58H 5IIEB 5IG7B 1FFPB 3X3FL 4F57H 4DGIH 3QHZL 4P2QD 4XNMA 1DBBL 3M07A 4XP9L 3TYGL 4CVZA 3EO1A 1E6OL 2UZIL 4N9OB 4XVTL 1D9KB 5DSCA 3VFWA 1LK2A 4JVUA 4PJCB 2DTML 3EYQD 4Y5VB 5CD5C 4P9HL 3MV8D 4C58B 2CJUH 5SWZB 3AXLA 1WV7T 1II4E 1RJCA 5F21B 1R3KA 5F7YC 4YHMH 3OB8A 5E7BA 4LVHB 2FX9H 4JHZA 1KNOB 2ZCHH 2UY6A 3MRCA 1JFQL 3EOAA 1OQXA 5KVDL 1J10A 3FFCB 4FOMA 4GSDL 1V8HA 2R0WH 4OLEA 3K1KC