2A6IA

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide klasipthtspl
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iA01
2PYEE 4GAJH 1JK8B 2IPKB 5IBUB 5GHWL 5EUOA 1DCLA 2E3VA 2AV1B 2J4WH 2FX9L 4YHLH 5F9AC 3KPLB 2R56H 4J3UA 4DKEL 3RVXC 3CMOH 3GBML 2AEQL 1WICA 2GJ6D 5ICZA 4F15B 3C8DA 3MLWH 4M6NL 4MXVF 2PTVA 1H3PL 1Y0LA 3MUJA 1U41A 1BJ1J 4HUUB 4JFEA 4TUKL 1T1ZB 1TXKA 4I13B 3VWJC 5T1DH 3VG0L 3W81A 3PGFH 1C08B 1T0NB 2R23A 1R3HB 4RAUA 4HMDA 1ZGLA 4LSUL 4PRNB 1SY6L 1OCWH 1UYWL 1F4XL 4N8VG 2NX5E 4IIQC 1BLNA 4X5WA 5KANG 3Q1SH 1KIRA 3OKMA 3HPLB 1YDPB 1LO3L 3AB0B 3ESVF 2I07B 3WIHL 1EHNA 1Q9LB 2VKXA 1A7PL 4PJBB 4P9MH 1YN7B 2VN7A 2Z93B 4L8SC 4ODXB 3TYFA 3L1OL 1P4BH 1E6JL 3O3BA 4DN4H 3NCJL 2OL3L 3HE6C 2G2RB 3ULVE 2X4SA 1TTFA 4BKLB 3M8OH 4PRHE 3EZJB 3RTQC 2NLJB 2D3VA 3MNWA 4J7RA 4NM8L 1B4JL 5HI4D 1AO7D 3KG5A 2VLLB 1UZ8A 5D1QD 5MENE 1UJ3B 1YMME 4G3YL 4EDXA 3UBXI 5D2LE 2Q1EA 4RGNB 1RUQH 5EUKB 1TJHL 3ARFC 1YECH 1T2XA 3A6CH 3ECBA 4XMKL 1OGAB 5BJTB 4HCRL 4XAWL 2R0LL 3V6BR 5I1LA 4L3EB 3V52H 4M8QB 3HR5A 3HAEH 4LPWA 1MWAA 1RK1B 2AVGA 3V0WH 3DYMA 4YQXL 1DBML 4BA8A 1L7IL 3CLEL 4QTIL 2GK2A 3B5GA 2G5BA 1IAIH 5C0IB 4H20L 2HFGL 5IB3B 2F5AH 4I0PA 3S36X 3O6LL 1D5ZA 2EECA 3X3FL 2EYRA 3I50H 2A77L 3RVWD 4HF5L 4NOBA 1G7MB 3WLBA 1A9EB 1SYVB 4ZDHA 4MJ5B 1A8JH 3KNBB 4XWGH 5KW9H 4P5TA 3LHPH 4NKDB 1KN2H 4Z77B 2GAZA 1BZQK 2Z92A 3QUYC 1I8IB 3DTXB 3N9GH 3P4MB 3B8SA 4UI2A 1XR9B 3CH1B 4KVCH 1VGKA 5EU5B 4AY0A 1BIHA 1MJ7L 2NY2C 3K7UA 1ZMYA 1NJ9A 3IFNH 3MUHL 3QULA 4JM2B 5MP6L 1ACYL 1RURH 5DJDA 1KJ2H 2K7QA 3BVNB 2EXYC 3VXPA 3EGSB 4PJGE 5CILL 3ZO0A 4DTGL 5MEQB 2F74A 3D3VD 4GH7B 4HIJB 3MRKA 5IOPB 4WV1A 3MRRB 1RZKH 3QIWB 4JM4L 3OXSB 5DWUH 3UPRB 3F7RA 1OAYH 4EUPA 2YD8A 4F37K 5INDB 1D3CA 3VXRA 3ARBC 4Q6IB 1RUAL 1AXTH 4YAQA 3KJ6H 2WLYA 5GGVY 3EYFB 2GY7B 3F62A 3HUJA 3OV6A 4MJID 1A5FH 1I9JH 1TJGL 5C0AB 1LD9B 4R4ND 3GSRB 3BP4A 3SOBL 5J1AA 3QXVA 4WFHE 3WJJA 1LNUB 2W65B 3EO0A 1TZHB 1XIWC 3DETD 1NEZB 1T22B 1IGJB 3CLFL 4CMHB 2BVOA 4ZO8A 5T1MB 4QF1B 3QPQD 1AFVH 3GFUA 2VAJA 1HSBB 5IMKB 1S7SB 5CZXD 1IAOA 4JR9H 2OZ4L 3NPSC 4AG4L 1QNZH 4OQTH 4UDTA 5EU7E 3QYCA 2UYLA 1UGNA 1MIMH 1MCFA 3S34L 2BXYA 1G84A 1DVFB 1I1AA 3D18A 5DSCA 2DI9A 3ZHLA 4GXUM 5A2IH 4UNVA 1YYLH 4IMLB 5SX4H 3N85H 4B7LA 3X17A 5AG9A 1K3IA 3ARSA 1GZQB 4BZ2H 2VKWA 1QUNA 5BRZD 2VN4A 2CPCA 4U2ZA 3MLPA 3IU3A 1JGDB 2J6EH 4HK3J 4MA1B 1EH9A 3UROR 1T1XB 3C5ZA 2IPTH 1JTPA 4AIOA 1IGTB 4HKXB 1CICB 1BD2A 3BPOC 3HN3A 4OCRH 3ROLA 4NQVA 3IKCA 2WWKO 2ATPB 2CIIA 1JPTL 1QBLL 1FDLL 2YPKA 5DUML 4W4OC 4UMGA 5D6CB 5TE4H 2HT4D 4PJ9C 2FLRT 2XTJB 1IM9B 4PJ5B 4NQCD 4GAYA 5CJQH 4HPYL 2HFFB 2W9LA 3REVA 2UY7A 4L4JA 4XNUH 3L3HB 2IG2H 1R5VB 3IGAB 4YIQB 1GXEA 5I30H 3FB7A 2H1PL 5IMOA 3W39B 1O7SA 4P9HH 2AJVH 1KJ3L 1LHZA 1ZLVH 1AKJB 3QUXC 3HCVA 4GUPB 1UM4L 1I3UA 4OLWH 2Y6SD 4TSAH 4D2NA 3VFNA 3SDDB 2R9HD 5TJWK 4JKMA 2D7QA 1BQLL 1FVCA 3ZYIA 1K2DA 1MIML 3CUPB 4Y5VC 4G6ML 1JHKL 3WE6B 3IJHA 3KLDA 3TO2B 4HJGA 3MOBH 4QYOA 4CU8A 2EDHA 4P2OD 4XI5D 3O4OC 5C0CB 4KK6C 1RULH 3AREA 4NQXB 2D03L 2DQGH 3VFSB 5MI0C 4PJDF 2ZNXA 1HCFX 5C0RH 3DRQA 4JDZA 3DO7A 3VXMB 1A14H 2X1QA 1IT9L 2BXZA 4NT6A 1GAFL 4Z7OE 1QRNA 5JHDB 1FNAA 3PDOA 4OF8A 1RUKL 2OLDA 2ENSA 1NBVL 1FFNB 1MCPL 3RVVD 3SGJC 2XY1A 3WHE1 2NNAA 3MJ7B 2EEAA 3QUMB 5KS9B 2QSTA 4I5BA 3OKOA 3WIFB 2L4OA 3X13B 4JHBA 1MFDH 3FOMA 3JUZA 2P24A 5IQ9A 4WFFD 4KDWA 2VXSL 3V8CA 4CVXA 1KGCE 43CAB 5DK0B 3C2AL 4YHIB 5GZNC 3L95A 3QHZL 2VDMH 3AU1B 3RQ3A 3RY6A 5TDNB 2DJSA 4I9WD 3W9EB 3W11C 4TNWF 1WCBB 4O2FB 4CAGA 3F7QA 3V4UH 4R90L 2VLJE 4YHPA 3TIEB 5I19L 5AYQA 5C07E 1MELA 3WKMH 1U3HA 3HZMB 5EU7C 3SDCC 1OF2B 3BDXA 4KHTL 3TO4B 3JV5A 3AXLA 3HAEA 4YDKL 3IKKA 3RVTC 1CDJA 3FT4A 5BS0D 2FZ3A 3TN0D 1RUPL 4ODTH 5J6GB 4PLNC 1X6NA 1CGWA 3CFKA 4IRSB 4GXUN 4ZFZA 5DURB 1A14L 1FL3B 3A6BL 1NUNB 3OXRA 3C9NB 1N5YL 1UB6B 5D7LD 3QA3B 2BSTB 5I8CA 3GUTB 5D8JL 1TENA 2Z31A 4GAFB 4Y4KC 3GMMA 2HFEB 3B9KA 3QUKA 4YXLH 3EOAB 2B4CL 1U58B 4QRPD 5IB1B 5DDHA 3RDTC 5J13C 1EZVY 4ZOEA 5E00B 2BNQD 3RWDA 4IOIA 3UDWC 1FVEB 2XN9B 3QEUB 5C0BB 1BVKB 5CBAA 4EN3D 4PJAF 2JELH 3BP6A 2BVTA 5D2LF 3SEPA 3H6JA 2R1WB 4G43A 4KK9C 3UCRA 2HJKB 1XGYH 3UBXB 5KSAD 2OJEA 2DOCA 1KJ2A 1JFQL 4OAWB 3CCHB 1MQKH 3SO5A 1UH4A 2B1AH 5DI8B 4JO1L 5CZKA 2ADJB 4JG1L 4Y5XC 1Z3GL 4U33A 1Z9MA 3PWUA 4PLJD 2J8HA 3G5VB 1LVEA 4ISVA 4ERSL 5CSGA 3I75A 2X4UB 4QHUB 4K3DH 1LP9F 5GS3A 1NDMB 1DQDH 4F57L 2O5ZL 1KBGH 1KEMH 5J06A 2IJ0C 3AB0C 4BQ9A 1I75A 3QUZA 1JZ8A 5ESAB 2W60B 1J0KA 2J8UE 3VFUB 4UT7L 1RPQA 3O9WC 4RRPA 2XWJB 4APQD 3MCLL 2JCCB 4ELMB 3PL6B 1ES0A 5E9DA 2BHUA 5F7EL 4XCYB 1F97A 1ADQH 5IIEB 4P5MB 4LSVL 3U30B 3RU8H 3ULUL 1T1YB 2W59A 2XA8H 5TFSH 3PWPA 4OQTA 1CT8A 5JIPA 3A0OA 4N90E 1ETZA 1NCBH 2HKHH 5HGHA 1G1YA 4QHKJ 3BGFB 3KYAA 4G6AC 4B53A 4N0UB 4RGNC 1T03H 3VXRD 3BSZH 1A0QL 4YUEL 3QIBA 4AM0B 3VRLE 4NC1C 1MVFA 3RWCA 3O2DL 3K2UL 4K07A 4OLZL 1CGTA 1DJSA 2J6EA 4U6HB 1MFEH 2SEBA 1TETH 3KYKL 4LARH 1IEAA 4FZEL 4X6BB 3STZB 3GNML 4I3RH 2IEPA 1ZA6B 5HPOA 3OAYK 2WP3O 4O2EB 1A21A 1EUUA 2VAAA 1MCCA 2X41A 1YJDL 5F6HI 4K2UL 4JRXD 5DUBA 2JJSA 1SJVA 4ZUUA 4GKNA 2L7JA 1J9CT 1IJ9A 4Y16D 5MHSD 1I1AD 5HYJE 3ZHKA 5EC1B 1NEUA 1HHKA 1I85A 1M7IA 3GSVB 2IC2A 4OGAC 3OBAA 4EI5A 1II4E 1HQ4B 1U92B 3OAZK 4P57B 5E2UH 3VGGA 4EVNB 5DD6A 4Y8DC 3TGXA 1JMZA 1Q1JH 2F19H 2Y06H 4ALAL 1YEGH 4FABH 1RIHL 1WWAX 3BWUC 2EH7L 1IC7L 4RSVA 4E9LA 1EXUA 4EXKA 1BD2D 2VIRA 4JY5L 4LLDA 5HGBA 4BFEA 2D7TL 2EDJA 4QT5A 4KTEH 1U95A 3OQ3B 1HI6A 2PN5A 5D96B 5GS1C 4X8JB 3SY0A 4XCEA 1RZFL 5DQ9A 4YXHH 5M94B 5EBMB 1JWUB 3SDAA 1UM6L 1ZV5A 2B5IC 1KELL 2R1YA 5IQ7H 3G04A 5E0QA 3DNKA 4OZGF 5HDQH 4HUVB 2XQBH 1NBYA 2HRPL 4NKQB 1CDIA 3FO2B 4NQDB 3BKJH 2X9WA 2MCPL 3GGWB 1HXMA 3IETB 4HPOL 1KEGH 3MOQA 3QSKB 4NC0B 5D7JA 2BNRE 5CAYB 3MACH 3MRLA 1QG3A 5T3XL 1P5VA 3OR7A 1XMWA 2C3HA 3BGAA 2DYPB 4LVNB 4M62H 1KCKA 1KPRA 2C3XA 1UXWA 4UILH 1Z2KA 4MCZA 5DMJB 4V1DE 4YR6B 2ZPKL 4J3VA 4V2CB 1G7QB 1DBKH 2XZZA 3V5KA 3VMNA 4JDVB 1NDGA 2DQTL 4WUUB 2DTML 1IC5H 4FNLL 1DBJL 2VDQL 5C09E 5IHZB 1Q9WB 4BSVA 1P7HL 4GW5B 4HH8A 1W72B 3KXFE 2CXGA 4KRPB 4CADA 3NZHH 2GSGA 4NQED 4X7EC 2OMBA 1ZT1B 4NUJA 3FFDB 5JDSB 4M02A 1C5DA 2VABA 4L5FH 4NFDA 2IH3B 2YA2A 2P7TB 4PJBF 2DI8A 1YNTA 1CICC 5L9DH 2DQIL 3RWIB 2J2ZA 3FRUB 5HDQL 4LVOB 5D1XB 2P44B 4OFYA 2GEEA 1MHHA 5BVJB 5CJ5A 1S7VA 3N1PC 1GGCL 1IGYA 2BJMH 4YDJB 3I6KB 1NANI 3H9ZA 1IAMA 1OAXH 1ONQB 1KB9J 4E0RB 5JQHC 1F6LL 3JTTB 1EHXA 5E6ID 1WEJH 1Q9KB 2DJ4A 3HFMH 2FJFB 5HHOE 1T4KA 3WDIA 3BOVA 3U7AA 1RAMA 1VB9A 1EEYA 2BSSB 1NFKA 4RMWA 4UAOB 4MAUH 1JHLL 5HGGS 4PJXE 3CJJA 5LCVL 2DBLH 5GGRY 5DD1L 1P2CB 1V7ML 2F53B 1I9RH 3STBA 2VYRE 1BJMA 4ONHB 3ZKSD 2ZG1A 5A2FA 4BSJA 4WTZA 2I60L 2APXA 4JANA 4HQQL 4W68A 1FZMB 3KLHC 2P5EE 4GRWE 2CIKA 1JHTA 3GMPB 4OV5B 4I48A 3MBEC 1C5CH 4K7FB 3IS0X 3O8XB 1HYSD 4YFDB 1QSFB 4C56E 5ECJE 4HH9A 2YRLA 5I15H 2YKLH 1KTKE 4D0DA 3BUYA 3BKML 1S5HB 4DFHA 5DA0B 5F7NC 4JREB 4H8WC 5B8CC 3AROA 2XACC 1SJHB 3IFLL 3HPJB 4NKOA 2X4RB 4Y1AA 3VRIA 2GTWA 3U82B 3VI3E 1CDBA 4EZMA 3EJZD 3VXUA 3U1SL 2BOBB 4URTB 2R0KL 4PJEA 5HI3D 3GI8H 4UTBL 4RNRB 1GPOH 1DQTA 3BEVB 4KMTH 3VXQB 4S1DC 1YNLH 4OZHA 2NY3C 2Y23A 2HP4A 4PTTA 4YJZL 1OSZB 1I1CA 2V9QA 1XGTA 3S6CA 5J89A 3ILQC 5FCUL 5DJ0A 5H94B 3SGDH 3V8OA 3BD4A 4NNXA 4P46A 1ADQA 3VI4F 4JM2F 2A73B 4YBLB 1T5WB 2YPLA 1R3JA 4F80A 1TCRB 4Z95H 4OZIA 3F8UB 1NL0H 5JNYA 4F2MB 25C8L 2B7DT 5JIIA 2B0SH 3QXAB 1DBBH 3LDBB 4LEOB 4UTAL 5D93B 2FJHB 3LQZB 5K33A 2WK2A 3DHMA 4OFVA 1MHCB 1RMFH 3HNVH 5GGRA 1MCNA 1QO3A 5D9SB 1J12A 4B5EA 4JRYB 2R0ZH 5LQBH 4G8GA 5GSRB 1FLTX 3I3BA 3WXVL 1JN6A 5GGQL 2CK0L 2X4TA 4IEFB 4YBHA 4F8TA 2HWZH 3V4PL 1T1WB 4KROD 5SWZB 4LEXL 1JZ7A 1RZJC 3R06B 4U1MB 1WF5A 4XP4H 2V2WA 2XV6B 1DL7L 2W0FA 5SWQA 4PV9A 2HKFL 5IKCA 2F54D 4EQ2A 2X9YA 4LQFL 3PWNB 4WWKB 3E6HB 4DN3H 4PJ8A 2DN7A 4LVHB 4N0CD 4QRRD 5T3ZH 3SN6N 2OXGA 3K4ZA 2R2HB 3S4SB 4MCYA 3SJVB 5EPMA 5DVLA 1Q72H 3WV0A 5GRVK 1TVBB 4U1SA 4TULL 2DM3A 3A67L 3QIBD 2XFXB 3S35X 3GIVA 3FT2A 2EH8L 1KOAA 3T4YA 3EDKA 1FGNL 4O9HH 3ZYJA 3OKLB 2KKQA 4KUCD 3ARDA 3O45A 4ODVH 3F58H 3VRJB 4YNYB 4DJMA 4CKVX 1E4JA 3RGHA 2I9TA 1MRDL 4K8RC 3T0WA 1OP9A 3VG9C 2ED8A 4M7JL 4Y4FA 3DVGB 3M1BB 5E8EB 4ONGH 1U8OB 5IVXB 5T1KA 3OSKA 4O2CB 4XPGL 3HZKA 3LKPB 3P0VL 1JI1A 1F3JA 3QNZA 1A6WH 3QDJE 4CBPA 3BUTA 2PXYA 4K7PL 3WS3A 1MHEB 4K3JH 2C4FT 5K9JL 5C7XL 1YMHA 1CWVA 2A2QT 3PP3K 2CKBH 5D70H 1D9KA 2H9GA 5F3HA 5KOMC 4QHNB 2HH0H 3SO3C 4HIIB 3RGVC 2DD8H 5MEOB 4G9FB 5EZJA 4PGZA 4HBCH 1G7JB 3PL6C 5F7UA 4AL8L 1LK3H 3DUHA 3BXNB 2V5TA 1KT2B 1W0WA 2IADA 4Y8AA 4ZOAA 5F1NA 3QR2A 3QWRA 3MRGB 1KB9K 3O11B 1SEQL 4GBXB 2G9HA 4NJAH 3IJYB 2VXQH 1F2XK 4D9QE 2NY5C 5DJXB 3RL2B 5AWNH 1J11A 3T8XA 4D3CL 4U6YB 1I7RA 4NFCA 4OSUL 1J05A 1IEHA 4ZTPH 1FN4B 1Y6MR 1FPTL 4QRQA 5H2BA 1T2QH 4XNXH 5DUPL 1PDKA 3WLWC 32C2B 4W70A 1ZOXA 4NZTH 1ORSB 4Y5YA 5JW4Q 2P5WB 2FATL 4R4BB 4M1DH 1K4CA 4ONFH 1PX3A 1MJ8L 2QQNL 5IMMA 1YPZE 3W2DL 5KS9F 3VD7A 5IEKB 4HD9A 3M17B 4RFOH 2Z8SA 1ODAA 3P9MA 4C59B 5DD0H 1YEFL 2XA3A 1F3DH 2VXTH 4N5EC 5I75B 4DOHE 2FRGP 2QKIB 3DGGB 5FCSH 4JFQA 5DVKA 3O6KL 4D0CB 5JORB 5ILTH 1S9WB 1SMOA 1GVIA 1MWAL 3TIDB 4Q0XL 1CFNA 3PWLB 5F6IC 1XF1A 1NGQH 2FCBA 4LDOB 4BFGA 3DBXB 1VFMA 3EHBC 4G8IA 4K94L 4MNGB 3EO9H 3SPVB 2GT9A 1HYRC 4G6KL 5D7SL 4KI5E 1T89C 1XZ0B 1OAKL 3P9LA 3RX5A 3DJ9A 4KGLA 1UM5H 1OY3B 4WCYH 4DGVH 4NRYB 2H6PB 4WW2B 5HHVH 2ARJB 2VLRD 3GSOB 1BOGA 3QG6A 4MQSB 5FHBL 4F7MB 4AEIL 5CGMA 5HDOA 3MRMA 3PIQB 5F7LB 5C2BL 1H15A 3DXAE 4HC1L 5HD8D 4RGOH 1FL5B 1T21A 4TPRH 1N6UA 4LIQE 1ZANL 4GAGL 3QO1A 3ZE1E 2C3VA 4D8PA 4R26H 2EDXA 2R29L 3H3KA 1X5HA 1KF9B 3IFOA 5L2KA 2FEEL 2AGJL 3DRTA 1CFBA 1QSEE 4YK4B 4TN9A 4HWBL 1ZTXH 5E8DH 4K71C 3I6LD 1A6UH 3V5DB 5H35A 1WBZA 3EYSH 2OTWA 1OT1A 4Z5RB 2NY6D 3WO3B 3HB3D 5C08B 3BQUA 2YS4A 5KTEH 4LKXB 5DD3H 3HI5H 3N1FC 1G9MC 3MUGA 4Z7WE 3BWAA 2EC9T 4FZ8H 3VXTA 4GMTL 3WFDL 3OKKA 4MMXC 3RWEA 3KYMA 3IU4H 1FFPA 4PRDB 1CBVL 2IBGA 4UQ2A 1FNFA 4KRPC 2V2TB 1ITBB 5FF6B 4HJJL 1C16B 1AIFA 5FKAB 3PWJB 4QXTB 2JIXD 4J1UA 1FL6A 5C6TH 5EOQL 1P6AB 5HHVL 4LHUG 4PBWD 5IW6B 3QIUA 2F8OA 1TCMA 3L3DB 3MV8D 3NABH 5JXEA 2PCPA 2DWEA 2R69L 4KXZH 4NP4L 1U3JA 4PGBB 5EZLB 1ZHBA 4PREA 1IL1B 5E6YA 3VFTB 5F44A 5IWLA 3OL2A 3K2MC 4ENEC 5DMIH 4K3EL 4NO2B 1HQRA 3L9RB 1KN4H 3QEQD 3LIZL 1DLFL 3RA7H 3ULVL 5DMKB 5CIPH 2NZIA 2VL4A 5E8NB 1YY9D 5ANMA 5FB8B 4XPHH 3H0TA 1J8HA 2CRIA 1HHJA 4D9RD 2ID5A 2IWGA 3ZZ1A 4IBLT 3VWJA 2IQ9H 2Q6WA 4YDVB 2NR6D 1S9YA 3MXWH 3MGTA 2YMXH 4TUOB 2CO7B 4G8GD 5IJKC 5CSZA 2AXJA 3GEWB 5C71A 3H7LA 4IIQA 4ZD3H 3BHBB 1QBAA 4HS8H 4F9LC 4HDIA 4PJ7A 5BO1L 2A9NH 4YZFE 4YWGH 1KPVA 4XHJC 1F4WL 4L8SA 4YBQC 1AGDA 4N9GA 3LEYL 1FZKB 3HE6A 4HUWA 4HMEA 1XCTA 2DQHL 4WIQA 3NABL 1AGEB 3B9AA 1RZIB 3RTQA 1LO0L 1JGUL 3QQ3A 1WBYA 4GQ9H 4HEME 5E2WL 1MCQA 5I73B 4TOYL 5KVEL 4BFIA 4OUUA 4XP5H 1A1MA 3FKUS 2DB8A 5GSVB 2F8VA 2CKBA 5DHYB 4FRWA 4QOKD 4XNMA 2F8XC 3ARFA 3P73A 5EN2A 3FFCA 3OJDB 3GMNA 4DZBB 1I1FB 4HKZA 1OTTC 4M1CC 4DCQA 3IS1X 1AD0A 1FNGB 2AABL 3MYJA 5FECB 5IR1B 4X9IA 4RWHA 1R0AH 4Z0XB 1H9VA 5T1LA 5DQJA 3D0LB 3L5IA 5IM7B 4M7LL 2YMXL 3VWKC 2X4QA 5I1KH 4LLYA 3ESUF 3IT8D 3GO1H 2WWMD 4IDJH 2V7HA 2FX7H 3IJSB 1R3IH 4TTDC 3G08A 5E2VL 1MRCH 1MOEA 3P9WB 3BAEL 2BOCB 1UWEH 1MIEL 3KJ4B 1RZGB 1UVQA 4M00A 4PJDA 5AZEL 5E1AB 4D9LL 3L3JA 3V6ZB 3IXTA 3BN9C 2Y1VA 1WCQA 2A0LC 5ACZA 1P7KB 2XNAB 3CX5J 1K9TA 5B38A 5CEXA 2GSIA 2RIKA 3AS2A 5FYJE 3LKNA 3C5JA 4LRIC 1MAML 3PJSA 3ZTNL 5J7CC 1AE6L 1WZ1H 2DQFA 5DQDH 1AQDA 2VZVA 4XVJL 3AS1A 3KHOA 4HXAL 4JFFD 5ICZB 2G75A 3MCG1 4KRLB 1KLUA 5IFAH 4P2QB 1Y0LB 4LSPL 4KH2A 4JFEB 3QUYA 3X3GH 3MLZL 2ZJSH 3K8LA 3QWRD 1XFPA 4HFUL 2R23B 4LVHC 5IMLA 1KPUA 4RAUB 4PLOB 3KPMA 1IAII 5E95B 4GG6E 12E8L 2UZYB 1ZGLB 3CFCH 3BZFA 3MRCB 4NM4H 1BLNB 2IMNA 2ICWI 4NO0A 1QZ1A 1KIRB 2NXYD 1JCKA 3OKMB 4ESKA 4FFZL 1SEBB 2CLZA 3ARBA 1GOHA 1NC2A 2GUOA 1N6QH 1SHMA 2BDNH 4DVBA 3TYFB 3O3BB 1GGIH 4ZTOH 1N59A 4IJ3C 5JUEL 3OKYA 1K3ZA 5IJVB 2X4SB 5DJZA 4HUNB 4HK0A 1X5GA 4JFDD 4P4KC 4KZDH 3MNWB 2NX5A 1AD9A 1XF3A 1XIWA 3OKNA 2XPGA 1AQKH 1G9NC 5IVOA 1UZ8B 1W0VA 4NFBA 4NKIL 2R8SH 4EDXB 1YPZF 1TVHA 2JJVA 1X44A 2QQLH 1F4YH 1J0HA 4QEGA 3SQOL 3UTTA 4EBQH 3ECBB 2FEDD 4UIKL 3VXSE 1T83C 3VH8G 1M71A 2RGSA 1Q0XL 1FNEA 4LHQB 2C7UA 5F3BA 3P4NB 4P2RE 5I1LB 3HR5B 5D5ME 1FAIH 3OMZA 1N2RA 4OD3L 3EFDH 2GJZA 2IAMA 1OWRM 1CN4A 4KJQC 4M9OA 4XBPA 5MENA 1YMMA 4DEPB 2G5BB 4PJAA 4YPGB 4BFBD 2GK0A 4P59L 3I9GL 5D2LA 3P30H 4I0PB 1D5ZB 1IBGH 1DANU 1WFTA 1IGIL 2ZOLA 2AS5M 2EYRB 4FQLL 1FVDB 4S2SA 4QWWD 1CFTA 1G9EA 3ZKND 4H0GA 1GGTA 3DX6B 1CGYA 1KXVC 4W4OA 4NZDA 4L4VE 4JGUA 4HKBA 3VE0A 4PJ9A 1MJJB 2HVKA 3WLBB 3WFEH 1QLRA 4NWUH 2W9DL 4ZDHB 4R2GC 5AUMA 3T0AA 2X4OB 3W9DA 4Y4HD 3MC0A 4LF3A 1GGYA 2FSEA 4HGKC 4M48L 4P5TB 3SE3C 5JDJA 2H32H 1NC4A 2HTKD 2Z92B 1LP9A 3OF6D 5EOCL 4UV7H 5SX4I 1GGUA 2Q87A 1VGKB 3QUXA 4K23H 1CR9H 1GC1L 1CCZA 3RHWK 5HVFB 4DGIL 2EKJA 3VMOA 3QFJA 1NJ9B 3QULB 5ALBL 2APFA 5DJDB 1HXYA 3VXPB 3T2NH 1VADA 2CR6A 4O58H 2ZUSA 1YEJL 3MRKB 4WV1B 4FFYL 4Y5VA 5CIPA 5FHAL 1INDH 4EUPB 3SE4C 3EZ8A 4F3FA 5GS0C 3S98A 1A9BA 4UU9A 1T2JA 3RIFF 2YA0A 4YGVA 2DKSA 4I3SL 5H37G 4YAQB 4QXGL 3DVFA 3HUJB 3FMGL 2WINB 2AJUL 5F7FA 1TZIA 3OR6A 4MXQC 2WSKA 4JFYA 3GSNH 1J1OL 4NN5C 3W5MA 1N7MH 2DMKA 3BP4B 1EO8H 4J3XA 3D5OF 2HTLC 3D25A 3MGOB 3TT1L 3EO0B 5D7KE 1I3VA 2WUCH 2XQYG 4F58H 1IGMH 1W8NA 1WJ3A 1VPOH 1EUTA 4X5XA 3P0YH 4WW2C 5ISZA 3TFKD 2Y07H 5IB5A 3SGJA 2VDLH 1IAOB 3OAUL 5D7IE 1OGAE 3QRFM 3TBVA 4U2YA 3ZE0F 3SKMA 4UDTB 2UYLB 3QJHA 3E2HC 3BIBX 3RVXD 2NYYC 2QSCL 3D18B 2YD6A 4JFXA 3BX7C 2AEWA 4JDTL 1J8HD 3WNMA 4XB8A 1I3GH 1PAMA 4WI4A 3RIAK 1SM3L 3CX5K 1JPSL 2XTLA 3H3PL 1F8TH 1Y18A 2CDGB 3IU3B 1XGQA 4R8WL 1IQWH 2AK4E 3C5ZB 1L7TL 2XICA 1IZKA 3MV9B 3RWJA 1MF2L 1IEBA 3ROLB 4JHWL 4UT9L 2GY5A 3SDCA 1KFAH 4NQVB 3IKCB 2CIIB 2WV3A 2BNUA 1OP5H 3DVNA 4KKLC 43C9A 3AY4A 1IKNC 3C87A 4L4TA 2DLHA 1PVHA 3UTSE 4GAYB 4E41E 4I2XE 3REVB 1YUHA 4PJFE 3NCEB 4N8CH 5IK3B 1GIGH 4YZFF 3FB7B 5IMOB 1NFIA 5EIIB 2CQVA 4Y4KA 3DYOA 3P0YL 3U7WH 3HCVB 1EFXD 1C1EL 3JTSA 4KI5D 4G5ZL 3GM8A 1LO4H 3ZT5A 1B0RA 3VFNB 3LQAH 3TLRA 1NCTA 5CUSH 3RDTA 1FVCB 1K2DB 3CMGA 3NA4A 3ARFD 2CD0A 5DGQA 2Z8WC 4OBRA 3FFCD 4AMKH 4ZMAT 4M5YH 3IJHB 3MJ8B 1RVFH 4HJGB 4QYOB 6CGTA 2CSPA 1NAKL 2IPUK 4LOUC 5T33H 3AREB 4HHAA 4N8VA 5FOBA 1BREA 3QEGH 3PG2A 5KSUA 3DRQB 4JDZB 3DO7B 1BZ9A 2L7UA 2X9XA 2YD7A 1WWCA 4Y5XA 1C08A 1CFQA 1QRNB 3PDOB 3O3AA 2FX8L 4H8WH 3UMTA 3IRZA 5I8KL 3FJTA 2Y36H 4JZNA 3UTPE 4JLRA 3QG7L 3TJEL 3BW9A 1CQYA 2NZ9C 2NNAB 3TA3C 2EDWA 3QWOA 1H5BC 4I5BB 4ZUSA 1QFWM 2YA1A 5FO8A 3FOMB 3IDYB 4FQIH 2DRUA 2EXWC 1OP3K 2P24B 5IQ9B 3O9WA 2N7AA 3L95B 4XNYH 3FRPG 3LMJL 1LO4L 3V95A 3QUMH 4OCWL 2NY2D 3FQNA 3W5NA 2NLJA 5DXWA 4XAKD 2EDRA 4BUGA 1P84J 4YHPB 4HXBL 1J1XL 4Z6AT 2X4NB 5B39G 1JV5A 4OM1H 2E27L 3BH8B 4L8CA 1U3HB 1EGJL 4NO0D 4POZC 5DO2D 1P4IL 3AXLB 2GIYA 4GG6F 5GRJL 3HAEB 2QADB 4ZAKD 1HN1A 3FT4B 1KLGA 1RUMH 4B7IA 3CFKB 2D4FA 1S3KL 3SQBA 5J3HD 4ZFZB 3TNNA 4C54A 5FYLH 4WW2F 4WWID 3OXRB 1D5IH 3Q0HA 2DWDA 2A9ML 3STLA 2D7PA 4WVRA 2VLJA 5F6HJ 5I8CB 1RK1A 3U6RA 3DIFA 2Z31B 4Y19D 1RZJH 1CE6B 3GMMB 2HAZA 3B9KB 3U9PL 2IGFH 3ARGC 4FTVD 3H9SD 4TSBH 5DDHB 2LFGA 1B2WL 2ESVA 3WSQL 3VFMA 1I9IL 3RWDB 2CRMA 4IOIB 1RU9L 3FL7A 3W0WD 4TNVF 3QDGE 5CBAB 2H32A 3JV4A 4MNQE 2KPNA 3BP6B 4PV8A 4FOMA 4BM7A 1EBAA 2M1KA 4JHZA 1DN2A 3QCVH 3RJQB 2Q76A 2UUDK 4KK8D 4PLKD 3MMEB 2OJEB 1MLBA 1KJ2B 1FSKC 3WIIL 4NKDA 4JHAH 1V5JA 1YEDA 1A3RL 3T1FA 4AENA 1JYNA 3LZFH 1FE8L 1HH6A 5EU5A 5JHDE 5GRZA 1HHIA 4JPWL 2JB6A 8CGTA 5ITBH 1XGUA 2R15A 4ISVB 4RMSA 4G8EA 5GS1A 1S9KC 3I75B 4UQ3B 4PYGA 4HZAA 5E99H 4RDQG 4PJ9D 3GSNA 3BFOA 3S3JA 3T08A 3QUZB 2RAMA 3HRZB 4HG4J 3WD5L 5C0NC 2FIKA 4JKLA 4AEHL 2V17L 4OCNC 2OP4L 5DTFA 3RWFB 5L6YL 1CI5A 1E4XH 2W92A 4RQQB 2DLGA 3MXVL 4KZEL 1ES0B 5E9DB 2NY4B 3K1DA 5K9OA 2VWEC 4FQ2L 2ZNWA 4PJIE 3QFJD 1LNUA 1FFRA 3QRGL 4XBEH 4XBGA 4E5XA 2H3NA 3PWPB 4UB0H 1CT8B 4R7NA 4HS3A 2Q8BL 1ETZB 5HGHB 4WI6A 3EDEA 5DVMA 1FO0L 2JJTC 5C0FB 2NY0C 3HZVB 4HK3N 1VFBA 1VENA 4ZUTB 3RRQA 2N56A 2GFBA 2Z91A 4KQ3H 5HBBA 1A3LH 4DAGL 1DQLH 2NY5H 3BE1H 1WWWX 5D1ZB 4YLQT 1DSFH 2VZTA 3CDCA 2SEBB 4LSQH 4DGYL 5J9PA 4WHCA 2X7LA 3KPRE 1UA6L 4JCMA 2VE6B 1TQCC 1WV7T 5FXCH 1KYOJ 1NCCH 2VZ3A 1F4AA 2QHRH 1AXSA 1DQMH 4Q6YA 3MRPB 4LSTH 5EB9A 2DLEA 2I26N 5ISZD 4HKXA 1ZHKA 1T04A 1CICA 5DUBB 1WGOA 4WY7H 3D85B 4ZUUB 4GKNB 4X7CC 3D0VA 4TTGA 3UTZA 3ZL4L 1GHFL 5IBLC 3RL1A 1FGVH 5HDBF 2MSPA 4NIKB 4JPVL 4QRSA 1UCTA 4PJ5A 5ADOH 1M7IB 1Q0YL 5D7IF 5JW3L 1GL4B 4EI5B 5EBWA 4J3WA 3S36L 5GZND 4NNYA 1H8SA 4L9DA 4KJWC 2IANE 3L3HA 4RFNB 4P5TC 5DD6B 3W11D 3I3DA 3IGAA 1M6OA 3B2UC 1RZ7L 4GSDL 4DWHA 4OFPA 3C09B 1QRKA 5JLZB 3J8F7 1UC6A 4OI8A 1J88A 1EXUB 2VIRB 4LLDB 5HGBB 4PB0L 4QT5B 3SDCD 1EVTC 4JN2A 1U95B 1L0YA 3SY0B 5HYJA 2I25N 1EEZA 1FRGL 3O6ML 1X4YA 3MBXH 4LQ1A 4M3JA 4WV1C 5DQ9B 1PG7X 3RVTD 5J1TC 4L4TD 5C8JB 4IRJC 4QXWA 3SDAB 5LWYH 1P84K 2R1YB 3UO1L 4PY8I 3MBEA 4I77L 1NBYB 4ELME 1VEPA 3VFSA 2YK1L 3QDME 5L8LB 4KK5C 2FBJH 1J5OH 3BJLA 2Q8AH 3ZYZA 3FN0L 1HXMB 5B8CA 5D7JB 2YD1A 5FYKD 4MAYD 3VXMA 3WFCH 3WJJC 4PJFF 3MRLB 2VMFA 4MDIA 3OR7B 2OSLA 4DQOH 4TRPL 3RDTD 3QQ9C 4MJ4A 3HMWH 4ZNEE 1KPRB 3TZVD 1UXWB 3SCMC 4DKDC 3UYRL 2PKDA 5HHXH 5DMGD 4MCZB 5ABDE 5F1KC 3FQXA 4H88H 1I1YA 5HI5C 1NAML 3V5KB 3NCFB 2O5YH 3HNTH 3NH7L 1HZHL 3MPCA 5C0DA 1U8NA 4Q9RL 3QUMA 3DMMC 2AXFA 4OIAA 4YHKH 4KTDL 5EWIH 1TFHA 3GSXA 4BSVB 2BNRA 4J8RA 4NSKA 4RX4A 4X4XB 1G9MH 2GSGB 1HHGA 43CAA 2DLFH 2VDNL 4FQXC 4NUJB 1JUFA 4OB5H 1DFBL 4JFHD 3W9EA 1WCBA 2WNGA 2VABB 4ZQKA 4V1DA 5SWSA 2YRZA 15C8H 4PRPE 3VFGH 1K8DA 4F7EA 3C5ZC 3EAKA 3TIEA 2LU4A 2AI0L 1YNTB 2CDEA 2WW8A 1WUNT 1C7TA 3EYUL 5DJCB 3L7FA 3K8MA 3KPSB 1PEZA 4WRLA 5C09A 5I1EL 5I16A 1A7OH 1CD8A 1YEHH 1BFTA 1S7VB 3U46B 2BFVL 1IGYB 3V9FA 3SGDI 3LV3B 4DKAA 3GJFK 1QFWL 3MCKA 3B9EA 1A22B 1T4KB 2WIMA 5CJOH 1PZ5A 5DJAA 4OF3A 4WO4C 4DQOL 3NIFE 1C12A 4TVPE 1FYTE 2PF6A 5IROC 3D9AL 1A2YA 4HG4K 4OD1L 4XMPL 3NZ8A 1A02N 2EDBA 2E7MA 2C5DC 5IB1A 1MY5A 1CLZH 3OAZH 3NIGF 1MNUL 1EHLH 4OKDA 3D39B 4RGND 5IBTL 4JANB 4ORZC 1OTUD 5IHUL 4G7YH 4M6MH 2CIKB 3SE9H 1JHTB 4I48B 4M4PA 3QNYA 4G8FA 1KLFA 4HX1A 4MWFA 4HH9B 5I8OH 4L3ED 4PJXA 4MHHI 2XKNA 4RCAA 2YPVH 1F58L 4D0DB 3IDMA 4YHZH 4XP1H 3G5ZA 4S11A 2XXCB 4OAWA 4PRBA 4HIXL 4NKOB 4Y1AB 3VRIB 2GTWB 3B2VL 3CCHA 3BPNB 3VXUB 5DI8A 1E27B 1UH2A 4PJEB 1UENA 1N4XL 2FECI 2ESVD 3NTCL 4JG0L 1MVUA 2P5EA 4YH6A 2J8OA 3B9DA 3G5VA 5ALCH 5SV3A 5GGUA 4OZHB 4N0FA 3JWDL 2VDKH 5LJYH 1KYOK 1OAQL 4PTTB 2JF1A 4C56A 1JP5A 1L6XA 1NDMA 1XGTB 3MRHA 1CXLA 4XMLH 4TNVK 5I76A 5DJ0B 4PRIE 3RAJH 3OWEA 1YEIL 4NNXB 2GTZA 4P46B 1YA5A 1RJYA 4LIQH 3LOWA 2H8PA 2YPLB 1R3JB 4OGXH 4OM0H 3N1MC 3G5YA 4OZIB 1MSPA 3RGVA 5JNYB 4GW1A 1X3DA 5GS2H 3RY6C 3TESA 1OAUH 3DI3B 6FABH 1I3RA 1RIUL 5HHMB 5KJRH 1CL7L 1PQZA 2P8LB 2NCMA 3HMXH 4JM2D 2ZG2A 5DHVH 4LMQI 4CUCA 5GGRB 1QO3B 4W4NA 1NCAH 3TEUA 4LRNH 4ZS7L 2DAVA 1T0PB 1JN6B 3B5HA 4WFGD 1CFVH 4JN1H 3QIWD 3X11A 1A6AA 3X14B 4JVWA 4FQPA 4N0UA 5K9KA 1I4FB 3LEVL 5JR1L 2WM0A 1WIPA 4L3CA 2DF3A 3NCCB 1HEZA 4WHTA 1DBAH 1MFCH 2LVCA 4EOWL 4LSSL 5FKPA 5EBLA 5C0AD 2W0FB 3KPNA 4U6HA 3UYPA 1SQ2N 4G7VL 5TQ0H 5SWQB 4XVUC 4DKFL 1FORL 2VH5L 3IDXH 5IKCB 3MV7E 4JO2L 5BZDA 4JPIA 4JCLA 4PJ8B 3HI6H 5I1HL 3NVQA 1F90L 5EU6E 4PFEA 3DWTA 2BRQA 2CUHA 1QPXA 3DSFH 4MCYB 4R7DA 5EPMB 5BMFH 5DGRA 1BAFL 3OTTA 4U1SB 4LIQL 3QPXH 4CVUA 3GJEB 4KY1H 4PUBH 4E42A 5B21A 3ORJA 2GKIA 4JQXC 2NW3B 5GZOC 3FT2B 1K4DA 5SX5H 1MFAL 3RUGE 5JMOC 1AI1L 5D72H 4OI9A 3TCXA 3MRBA 3HMXL 3O2WL 1S7XA 4P57A 2D4DA 3ARDB 3O45B 2D2OA 4X6FA 4KV5F 1RZKC 2ADFH 1T89A 3NAAH 1G0XA 2DQJL 3O3DA 1KENH 1CICD 3VA6A 4Y4FB 3RY5A 3PV6A 5T1KB 2X1XR 3G6DL 3HZKB 4M43L 1F3JB 3HA0A 4KKCD 3D2UA 2PXYB 4Y2DC 1A47A 3WS3B 4KKAD 2J88H 5EBMA 5KOVC 2XTJD 1IM9D 4PJ5D 3FO9B 4LAQL 2IFFH 4FP8H 1YMHB 4JKPH 1BQHG 4HUVA 2JTDA 1D9KB 3GMRA 2H9GB 3E6FB 5F3HB 1QACA 4P5KB 2E6JA 1MCWM 4YHYB 3FO2A 5EZJB 4LLVA 1K6QL 5KSBB 1RIVH 3IETA 5T5FH 5I18L 1AKJD 5CEZD 1W0WB 2IADB 2CKNA 3ILPA 5F1NB 1P7QA 3BYTA 1CD9B 4JRYE 3QDJA 5DFWH 5DRXA 1E0OB 3SDDD 4GRLC 5I1JL 4A2MA 1LO5A 3L7EA 5FO9A 3T8XB 3L3OA 3JVGC 1J05B 4ZO9A 1U36A 3THMH 4JDVA 3EDDA 2NXYB 3INUL 5C0CD 4WUUA 2YXFA 4QRQB 5H2BB 1CG9B 3MNZB 4HWUA 3QQNA 1BM3H 5IHZA 5D1ZC 5HYQA 3WXWH 3CSYA 5TPWH 3VXMD 1JIBA 2AKRA 2YC1A 1BBDL 4Z76B 1K4CB 1X5KA 1NSNH 1NFDE 5IMMB 4OFDA 3HRPA 1MCBA 3Q48A 4JB9L 4OLYL 2IH3A 2ZCHL 1Z9LA 4N1EA 4LK4A 4GMSH 4W6XB 2W07A 3MZGB 5GIRA 3ULUE 4S1DD 5J11C 3C6LC 4M1GH 2HT2D 4OFKA 3VD4A 3QEHA 5F97E 5F9DC 4JFQB 4MD4A 2O61A 5BVJA 4M5ZH 3C6SA 1J7VR 3P11H 5CINH 4JZOA 5FYJH 2GQHA 3WEXB 4YHML 1YPZA 3FZUD 1KJMB 4XC1H 4YE4H 4G8IB 4M3KB 5GS0H 2AJZA 2Q7YA 2GT9B 3H42H 5SWSD 1Q38A 2CGRH 3NFNA 3MV01 3P9LB 4PP2A 2VLKE 1AJ7H 4N0YH 4ONHA 5FYLD 1FNSL 1BOGB 3QG6B 4OCXH 2FWOA 4PPTA 5J12B 3MRMB 4DFIA 1H15B 4F9LA 1FZMA 4ZSOE 5HHQA 1T21B 3LKRA 4KQ4L 2C1OA 3QO1B 2ZCKL 1P9MC 4IRSD 5TPWL 4K7FA 5DURD 2VZUA 5CEYB 2C3VB 4D8PB 4WUKL 1S9VB 2GJ6E 5GJSH 5IESL 1Y6NR 4WU5A 3IFOB 5L2KB 1S5IH 3UAJC 3DRTB 1HIMH 3GI9L 5TDPA 3MOAH 1OARL 5EO9A 2B4CC 2XIDA 1BBJA 3BISA 4S1SL 3NIFF 5FGCB 5CP7A 5H35B 1WBZB 4RNRA 1WISA 3DXAA 2OTWB 3BEVA 4OKVA 5JHLH 3VXQA 4RDQF 2XN9D 4M7KH 3BQUB 5GRUL 5C0BD 1KB5H 1NMCC 4OLUH 3BWAB 2FIRT 5GRVL 3VXTB 1BOYA 3OKKB 3RWEB 3KYMB 2DMCA 1FFPB 1QSEA 5DHVA 3KVQA 2VXVL 1SJXA 1OW0C 3TBYA 3VWKA 1AIFB 2J5LC 4J1UB 5K59E 3DOSA 3S96B 3VGEA 4U0RB 5BV7L 3E8UL 1AO7E 3QIUB 4WEUD 4K8RD 1MPAH 2PCPB 2DWEB 4Z7WA 5D9SA 5FM8A 4MB3A 1I8KA 4X7SH 5B3JF 1ZHBB 4PREB 5F8QC 2W9EH 4JFOA 3MJ9H 3WS6C 1WAAE 2VRAA 4NWTL 1BEYH 2P4AB 4X7TA 3CVIL 3S37H 4NRZA 1HQRB 35C8H 3MLYL 4LSRH 4ZPVA 3BMVA 4LRIA 5J56B 3MOAL 1FYHB 3DX9A 1PG7H 3DROB 3PF2A 2Q20A 4YFEA 1CGSL 1MRFL 1INEL 3PL6D 5ANMB 3H0TB 3MLVL 5EO1A 1HHJB 1I8LC 5ACLA 2ATKB 2JB5H 1OAZL 2AJ3A 3ULUC 3BRFA 3VWJB 3OZ9H 1EERB 2Q6WB 3VD3A 1S9YB 4ODSH 3S9DB 5CSZB 2A6DB 2R2HA 1SJEA 3ME0A 1HSAA 3S4SA 4X99B 5LGKA 1UACH 3SJVA 2P42B 4DW2L 2YZ8A 1V3LA 4N1CA 4HDIB 4PJ7B 1YQVL 2BHZA 3WLWD 1A7NL 3VXNA 2KZ1B 4XWOC 2BY3A 3V0VA 4NNPL 3NFSL 1F13A 1KPVB 3T0EB 4RISL 4L8SB 2AJXL 4QGTA 5FYKL 4N9GB 3R8BB 4IM8A 4XCNA 2EIEA 5EA0L 3HE6B 4HUWB 4GKZA 1CU4H 1XCTB 4YHNB 2B1HL 2VDRH 4Q9QL 2W0PA 3GB7A 4P4KA 3RTQB 5IVZB 1ZSDA 3QQ3B 2FYYA 1UCBL 1UEYA 1YJDC 4K9EL 1N0XH 2LV4A 4BFIB 1BEYL 4OUUB 4ODHH 1A1MB 5E8EA 5JPMA 4XX1G 3BKYL 5KBNC 3D3VE 5KANI 4LCUA 4N5ED 2CKBB 4X6DE 1FH5H 4M7ZB 4H0IA 2DQUL 3ARFB 3P73B 4S1QL 3BYYA 4UINH 5EN2B 2PW2A 3FFCB 3LY6A 5HPMB 2ZSVA 3GMNB 4HKZB 4DCQB 4XC3L 3TH3T 4NZUH 1NCWL 3CFEA 3MYJB 3LN4A 5T5NG 1NCUA 2VUOA 4MJIE 3X12B 1JPGA 3EHBD 4O5LL 1RFDL 3KS0H 4OLXH 1B0GB 2CJUH 2V2XA 1JWSA 3H7BB 5T1LB 4C83A 4JQIH 3RUGF 2X4QB 3RX8A 1G7JA 4Y7MA 5CCKL 2V7HB 4FMFA 4BZ1H 3G08B 2QL1A 3BDYL 3O11A 1FHGA 2LAGB 3HG1A 3GK8L 3MLRH 1AP2A 1UVQB 3B3IA 3SDYL 4JO4H 4PJDB 5DJXA 3L3JB 1CDGA 3IXTB 4I1NB 4U6YA 1TVDA 3VDCA 5ACZB 1EZVX 3G6JE 4O4YH 2XZAL 5B38B 5CEXB 4XCCL 1AC6A 4LLMA 2GSIB 4M7LT 2DQEL 3LKNB 2ZKHL 1L4IA 1DANT 3U2SA 3C5JB 3PJSB 3IDNA 1IGFH 1M05B 2DQFB 1AQDB 4NQDD 2G75B 2KZWA 5HI4C 1KLUB 3SE3A 1NCDL 3RPIA 3QUYB 1SBSL 1NLBL 1UB5A 5BRZE 1G7PA 1ZVHA 1GRWA 3EYOA 4QRTA 5IMLB 1KPUB 3KPMB 2R4RL 3M17A 1QFUH 3BZFB 1TNMA 3VGDA 4MSWB 2PYEB 5BW7C 3LPWA 4Q97A 2FH6A 3LRHA 1ZLUH 3SGKC 3SE4A 4WUUD 3DGGA 1DEEB 2CJUL 1U8LA 4H1LG 2FD6H 5JORA 4OGYL 2CLZB 3ARBB 4NQCE 2GUOB 1NC2B 4TSCL 5AAWA 4KVNH 2MQ3A 1D5MA 3WKNA 2MJWA 4OTXH 1IAKA 3SKNB 3WUWB 1U3YA 4DVBB 4KRPD 1N59B 1MJUL 3DBXA 3O6FB 2ORBH 4U1NA 5I0ZA 1FIGL 4HK0B 4MNGA 4GG6A 2Q3AA 3TBWA 4WU7B 5I1GH 1T5XA 2NX5B 3R1GH 1AD9B 1XF3B 1XIWB 3OKNB 2XPGB 3S35L 4EQ3A 1Z9OA 1W0VB 4KMLB 4Y4FC 1NFDF 4U31A 4CU7A 4N68A 4F7MA 3GIZH 1MHPL 5D1XD 2RJMA 3F5WB 4ENED 5EZOH 3ULUF 3UTTB 5L0QB 4GS7C 4HT1H 1D7FA 1KCSL 1OPGH 1M71B 1HOCA 2AEPL 3V5HA 1FNEB 2FB4H 1NCNA 5F3BB 5DZOA 4PRHB 4PTUA 4XP6H 1MCOH 4YHYC 2NW2A 1N2RB 1ZLWH 3E3QC 2GJZB 2IAMB 3U4BL 4FA8A 4HFWB 1KB5A 5MENB 1YMMB 2F53D 5D2LB 1MREH 4OT1H 5FFLA 1MFBH 4KPHL 1IGCL 2HG5A 5E5RB 3BEWA 5EZIL 3BPOB 1VGEH 3OHXA 2ZOLB 4JO3H 1TTGA 1CK0L 5GRWA 3VXSA 1OOAA 4S2SB 4WI8A 1CFTB 3MLXL 2WBWB 5C08A 4LHUA 5E08L 2CLRB 5EUOE 3N50A 1VCAA 5F96L 3TF7C 1EO5A 3VE0B 1W8OA 3PQYA 1IKNA 2MPAH 4PJ9B 3O8XD 2HVKB 5D5MA 3VW3H 2ORBL 1QSFD 1QLRB 4PJEF 4XHJD 5F89A 1CIDA 3I85A 4WFFE 4CMMA 4POUB 3TPUA 1WTGT 4LF3B 2FSEB 3DETC 5DF0A 2EE2A 4OZHF 1NC4B 4I9WE 1LP9B 4U7MA 3EO1A 3MJ9A 5FKAA 2EDLA 2FDBP 3MFFB 2NXZC 3QUXB 2JJWA 4R4FH 5FM4A 5CZXC 2Y5EA 4UIMA 1HXYB 4UT6H 1QEWB 3FB8A 4BH7A 4NHCL 1VADB 4L4VA 4PGBA 1ZKAA 2P48B 5F7DA 4OZIF 5CIPB 2GYSA 4Y5VB 5CS7A 1V7NL 2DQCH 5H37H 3TNMA 1OTTD 4M1CD 3JZ7A 4F3FB 1M1SA 4UDUA 5BS0E 3EOTL 1A9BB 4UU9B 2X89A 3O4OB 4YGVB 2N7BA 3NCYS 3HR6A 1HWGB 3L9RA 2YZ1A 1U2CA 3VWKD 1G6RH 5D7LE 1TZIB 3OR6B 5FB8A 1CXHA 4JFYB 4XX1E 2OJZH 4JPKL 1E6OL 3D25B 7FABL 1Q94A 4PJGB 2WUBL 4TTDD 4HLZG 3CVHH 1T20B 4HUMB 3HZYA 2R4SH 2HT3C 4QRPE 5TF1L 5K59F 2APWA 3D87B 4XPFH 5C0EA 2J3SA 3OPZL 5M95B 4S1RH 2BNQE 4PS4L 4X5XB 1MCKA 1L6ZA 5IB2A 3BN9D 1N5AA 3OB0K 5IB5B 2HVJA 5J12C 5SWZD 3TA3A 3MSPA 2WANA 2FHBA 3SKMB 1H5BA 2VR9A 4NKMA 3FO1B 3U7YH 4A6YH 2RB8A 2E7HA 4JFXB 1SMAA 5CEZL 4RFEA 2FGWL 2Y6SC 5DEGA 5GHWH 3QFDA 2DDQL 3MRQB 3V79C 2VL5A 1UZ6F 2FX9H 4OIIH 1JYWA 4WWKD 4DKEH 3GBMH 3DX7A 1OM3L 2AEQH 1XGQB 3GMOA 1X5JA 4M6NH 4FXKB 1H3PH 3RWJB 5D7IA 1IEBB 4TUKH 3SJVD 4X80L 1A3QA 1CLYL 4P2OC 2D0FA 5GSVA 3VG0H 5HHNA 3BQUC 1PW3A 2BNUB 1J18A 2BRRL 4EDWL 1AGFA 4FFVC 1BPVA 4LSUH 3DVNB 43C9B 1SY6H 1EMTL 3KHQA 1UYWH 1F4XH 1FNGA 4FQJL 1ZHNA 1JPST 1F02I 3MRNA 4Q58C 2IMMA 1YUHB 1LO3H 2JE8A 3DVIA 4LASL 1JNNL 4HWEL 5TE7L 3WIHH 1BFVL 3D0LA 5IM7A 2AK4A 2P47B 1A7PH 4P4KD 1NFIB 4Y4KB 4KUZL 3T3ME 3L1OH 1E6JH 5E4EB 3ARGA 2MQ0A 3IJSA 3RVVC 2OL3H 4H5SB 1B0RB 1ZLVK 4WEBL 1LDPL 1JGLL 4NM8H 5E1AA 3UTSA 1B4JH 1AGCA 4E41A 3VXRE 5KSBF 3KPQA 2J1KA 1SBBA 4I2XA 4NYLA 5EC2A 4PJFA 1XR8A 4X6DF 4Z7QE 1EV2E 4G3YH 3H8NA 4HHAB 4OCSH 4YXKL 4N8VB 2ZUXA 5FOBB 1TJHH 4OIIL 3O41A 3EDFA 5I1IL 2MQCA 4FFWD 4RA3A 3S7GA 4G9FD 1VEOA 4LPVA 4XMKH 4P2QA 4KJQD 5KSUB 1ED3A 4HCRH 4XAWH 1I9EA 1NGWA 1BZ9B 1CLOL 2R0LH 2YD3A 3C5SB 1UWGL 3QHFL 3F6IA 4EJ1C 3OKDA 4Y5XB 1CFQB 2YBRA 4GBXD 4AYFA 5HHPA 4YQXH 3O3AB 1DBMH 4JRXE 1L7IH 3CLEH 4QTIH 3MRCA 3TN0C 2H26A 3GHBL 4JZNB 3WN5B 4JLRB 4H20H 2HFGH 3GKWL 1CIUA 3BW9B 3O6LH 4ZFOA 1KSRA 5E4IA 1U6AL 5MHSE 3QWOB 4ZUSB 5CD3B 5FO8B 3X3FH 1SEBA 3N06B 2A77H 5DA4A 1JRHL 1OSPL 3T0EC 3O9WB 4HF5H 5DRNA 2P5WD 2ZCLL 5F88B 5IJVA 3BESR 3VH8A 3O0RL 1NQBA 5TDOA 3FQNB 5HGDB 5GXBB 1BD2E 1DLHA 1I8MA 4EN3C 5I17A 1O5DT 2Q3ZA 1JV5B 1Z9SA 1EX0A 5IF0A 4L8CB 4Z8FL 4ACPA 3CD4A 4OCSL 1MJ7H 3S5LG 4QXUL 4M7ZC 4NBYB 2JJTA 1FNLA 4KMQA 5MP6H 2VXUL 1ACYH 1CD0A 1QBML 3N1GC 3UJIL 5CILH 4DTGH 5GISL 1KLGB 1F5WA 5DJ8A 3TNNB 4JM4H 4XVSL 3P4NA 3F7YA 3B9VA 2DWDB 4K94C 1WVZA 3SKJL 4Z78A 3STLB 2VLJB 3V2AR 2HTLD 1RUAH 4LCYA 3U6RB 3DIFB 1E4XI 4HS6A 5C07B 5A2JH 2X44D 4YPGA 3IDIA 1TJGH 4FXGA 1FZOA 1OLLA 4KGJA 4YEFA 3LSOB 3SOBH 1X5AA 2ESVB 5I9QC 3VFMB 1DQQA 1ZT7A 1FVDA 2AW2A 1AHWC 5D2NE 3DX6A 3CLFH 2H32B 3DHJA 3JV4B 4PV8B 4APQC 1AY1L 2NYYD 4NRXA 1MJJA 1HHHA 1UWXH 2DMBA 2Q76B 4R3SA 4OZFB 2X4OA 2OZ4H 4NQEE 1MLBB 4AG4H 3S34H 1YEDB 3ZDXE 3T1FB 4AENB 3QP3A 3D48R 1OQXA 1HH6B 1JF1A 1DR9A 2RR3A 4P3CL 1H3GA 1HHIB 1A7QL 3ULSB 2JB6B 1EBPA 1KCLA 3CK0L 3QDGA 3IDJA 1XGUB 5GPRA 1AC0A 4BSWB 4PY8J 1GOFA 4MNQA 4WI9A 5C08D 4G8EB 5GS1B 3I3EA 1U8IA 4KJYA 1G6RA 4OZFG 2A6IA 4KKLD 3PQYD 3QDHA 3GSNB 4IRJA 2B5IB 4X7FC 5ENWA 4PR5A 5CWSB 4WW1A 1JPTH 1SVZA 2APTA 1QBLH 3CVHA 2FIKB 1FDLH 5HVHB 1UQSB 4FN0A 4IRZL 4RMQA 3UJTL 5DUMH 2WINA 5DTFB 1UKQA 3O6FC 1P4LA 1BHGA 5AYUL 4NC2B 3SKUD 5K9OB 3P77A 1XT5A 5E5MA 4HPYH 3MGOA 1DE4A 5CMAA 3T65A 1JNHA 2E5EA 4UV4L 4XBGB 4E5XB 2H3NB 1MCRA 4Y16C 1CS6A 4BK5A 4R7NB 4HS3B 2H1PH 4A6YA 3SCMA 2C26A 4AZ8A 4X6CF 3VD5A 1KJ3H 3BKCL 1UM4H 1RSFA 4BQ8A 1VFBB 5L0QC 5HGAA 2GFBB 2Z91B 1BQLH 3DMMA 5F7KC 4F33B 3J7HA 3ULVC 3I6GA 3LH2L 2R0WL 4G6MH 1JHKH 4MNHA 5FUOL 2ENYA 4PJIA 1L0XA 4EIZC 4WTWA 4TVPL 1D6VL 5J9PB 2X7LB 3NA9L 4FQXA 5E56A 2D03H 2IAMC 4PJ7F 3F12A 1OLZA 5CLTA 1AXSB 2CDGA 1QFWI 1SY6A 2AJSL 5D4QA 1ZAGA 3HS0B 1ZHKB 1T04B 2VSCA 3MV9A 5A2KH 1FC1A 1HKLL 5HY9A 1IT9H 3MA9L 2NZ9D 3D0VB 1GAFH 3LKQA 3WIHA 3MJ6A 3UTZB 1HDMB 4YX2L 1S7UA 4OV6F 2VR5A 1YEEL 1ND0B 4FG6C 1KIQA 3RL1B 1RUKH 4QRSB 1NBVH 1CZ8L 1ZHLA 2EKSB 3KPRA 1MCPH 3G5XA 3T0BA 3KR3L 2OL3A 5EBWB 4NNYB 2C1PA 4HKJA 4PB9L 1VSCA 4WO4A 5IK3A 2V9RA 1M6OB 2GITA 5IROA 2HJLA 5EIIA 4ZO6A 4XPAL 2VXSH 2AXHA 4PGCB 5LGHH 1CXEA 3C2AH 3QHZH 4CN1A 2OS7A 1BF2A 1CF8L 4JN2B 2BY2A 3VFWA 1LEGA 4XPTL 1BGXL 5HYJB 4M4RA 1QKZL 1EEZB 4R90H 2B20A 2MWCA 3TH2T 3JWOL 2QR0A 3U4AA 5I19H 3MJ8A 4HCRA 1DUYA 1W72L 3DV6A 5IFHL 2IANA 3MBEB 4KHTH 2OK0L 2KDGA 1OGTA 3EJYD 1LWRA 1NMBL 4NUGL 4YDKH 1RUPH 2F54E 5B8CB 3ARGD 4NJ9L 3A6BH 3U0TA 4KDTC 1HH9A 4MZ3A 4MDIB 4QRRE 1N5YH 4J2XA 2OSLB 5E2TL 2AK1L 3FRPA 5D8JH 4AQ1B 4PIRF 3T3MF 2DM2A 1U42A 4ZODA 3FQXB 4NQSA 3RBSA 2NY3B 1I1YB 1CXIA 4X9FA 5C92A 2B4CH 1GGBL 5E6IC 3MTRA 1JZ5A 3QDMA 5C0DB 1U8NB 3NCMA 5B39A 2AXFB 2YXMA 3HE7A 1XF5A 3GSXB 2DJUA 2BNRB 3CDGA 4X4ME 5EU4B 4J8RB 3T2OA 3ES6A 4NSKB 1N64L 4P2QD 1WLHA 4Z7QF 1MI5A 4HBQA 5CBEA 4PJHE 1HHGB 5LGHL 3MRFA 4JFED 3RZCA 1JUFB 1KCUH 4ZNEA 1ZGLP 3NMEA 2R2BA 4ZQKB 2VLMD 2XKUA 4V1DB 5SWSB 3WFZA 1K8DB 4F7EB 1JFQH 3TYGL 1OD7A 4MQTB 1G7LA 1UKTA 2PR4L 3BPLC 2CDEB 2X4NA 3VGFA 4KWUA 2QBWA 3BH8A 3L7FB 4JO1H 3CFJA 2W0LA 4OCYL 1HYSC 4JG1H 5C09B 5I16B 1Z3GH 4XVTL 3GM0A 3GBNL 1KUMA 2I5YL 3S97C 4U1GC 4J6RL 3KXFB 1PKQE 3LKOB 3AY4C 5K9QI 2YR3A 5C0ND 4ERSH 2VC2L 5DK2A 3KPOA 4CDGC 4IHOA 5EDXA 3MCKB 4F57H 2O5ZH 1PZ5B 3S8WA 5DJAB 4PRPA 2ICWA 3TJHD 1C12B 3PP4L 4M9PA 4H25B 1CE6A 2XXMB 1A2YB 4UT7H 5E4EC 3ULVF 3NZ8B 3MCLH 1QBBA 1LDSA 4Q2ZA 5F7EH 4HGWA 3I2CL 3L5XL 4LSVH 2OZ4A 3ULUH 2HJFA 3CDFA 5ADPL 1BIIB 1HINL 4JQXA 5FK9A 3F7VA 3QNYB 4G8FB 4HX1B 4MWFB 4OD2A 1KCUL 2EZ0C 4MA8L 5C3TA 5A16A 1FYTA 2R2CA 4PJXB 5CP3H 2XKNB 1A0QH 3MMEA 2JK5A 4YUEH 3IDMB 1MCIA 2FO1A 1R6VA 2Z4QA 4C55A 3T0XA 3G5ZB 4NO3B 4PRBB 3O2DH 1N6VA 3K2UH 4NN6C 4OLZH 1TDQA 2FJGA 4RIRA 3BD5A 3FT3A 4I0PD 3KYKH 1DZBA 1F3DJ 3BPCA 5EORL 4LGPB 4R97C 4FZEH 3VG9B 2CO6B 1KIUA 1MVUB 2P5EB 3GNMH 5IUSA 1ZEAL 4FQQA 2C3WA 4RAHA 5DFVC 5KAQG 5GGUB 3IFPA 4N0FB 2FL5A 3WN5C 1M7XA 4UQ3A 4C56B 3MRHB 4Y2DA 4QTHA 2WIIA 5I76B 1YJDH 4K2UH 2GTZB 1YC7A 3C60C 1J87A 1RJYB 2H45A 3HRZA 4Z0BL 2H8PB 4P5TD 3SO3B 3G5YB 1OT2A 3RGVB 4N0CC 4GW1B 3RWFA 4RQQA 2V9TA 5HYSG 1GC1C 1I3RB 2WQ8A 1X5YA 4HUXA 2QV2A 1PQZB 4N1HB 5GGTL 3CZFA 1PKOA 1GH7A 4GRLA 3R0MA 4JFZL 1S8DB 4ALAH 2VLRE 4WI7A 5BQ7A 2UZIL 2CMRL 4PRIA 1RIHH 4QHKI 4AIZA 1TJIL 3X11B 1A6AB 2EH7H 1IC7H 1QR1A 1B6DA 3JVGA 4IRJD 5K9KB 4JY5H 1LEIA 4KJPD 5C0FA 3HZVA 2D7TH 4PJGF 4ZUTA 1CD1A 1WFNA 3C08L 4L3CB 4W81A 1HEZB 4WHTB 1RZFH 4RWYL 2G5RA 4KK5D 5ETUB 1S78D 5EBLB 5D1ZA 5FKPB 3KPNB 2ITCB 2HYMA 4LP5A 2ADGA 1ZVSA 4HWZA 1UM6H 4KI1A 1KELH 1VFAA 1GYAA 1G9NL 2VE6A 2HRPH 1FZJA 2NY7L 5BZDB 4N5UA 4P2YA 4G42A 1QPPA 4JPIB 4QHMA 5EIQA 3I6LE 3AAZA 3GJFH 2FH8A 2MCPH 4HPOH 3U0WL 2O5XH 3MRPA 5INCA 3C6LA 4R7DB 5F1IA 3FN3A 4S0TD 5T3XH 1MCHA 3D85A 3I02A 5IGXL 1S7TA 3EOBA 4E42B 3CZJA 3HLAA 2DI7A 1K4DB 5F6IB 2ZPKH 5CD5C 4M6AA 3A6OA 4WI2A 4OBSA 3MV7A 3E0GA 1LO2L 1DN0A 4EI6B 2ZWLT 4PY7A 5F9OL 2DQTH 4KAQL 3MRBB 2DTMH 1S7XB 4FNLH 1DBJH 4J3OC 2VDQH 3KDMA 3RZWA 4X6FB 2UWEE 5JLZA 4MYWB 3C5ZD 1EJOL 3GSQA 5M7QA 3CFBA 3MV8E 3EW3B 3O3DB 3MV9D 2VDOL 3DUUA 2XOTA 3PV6B 1YEKL 3ZTJG 1G0DA 2Y9RT 3RUGA 4PP1C 3ZKMC 3D2UB 4PG2C 2VDPL 2YUXA 5C8JA 2EDOA 3QNXA 3BO8A 3QEQE 2DQIH 4F7CA 1P9MA 1CVSC 3TVMB 4HIEA 3SDXE 5TGBA 2LE9A 2B2XL 3WBDA 5HVHC 3GMRB 4CW1A 4CVZB 4UZGA 2BERA 4D9RE 2J7LA 5F21B 3V4VL 4ZG1A 1GGCH 3NGBC 4LLVB 1V3KA 2O5XL 3KPTA 1ZLSL 1YY8A 3ILPB 4Z7VE 1W2KT 1P7QB 3AS0A 2GHWB 1QVOA 4K71B 4G8GE 5C3LD 3QDJB 4GXVL 5DRXB 5IHLB 4HIHA 5I1CL 1JHLH 4GW4A 2LABA 1LO5B 5LCVH 3L7EB 3NBNA 4CRPA 4DUWA 5FO9B 1BWWA 4CNIA 1KC5L 1PY9A 3L3OB 5DD1H 1V7MH 5I8EA 3RPKA 1MCLA 2VQ1B 3ARED 4PJCE 2I60H 3LS4L 4HQQH 3ABZA 2MHAA 3NACL 1REIA 1BZ7A 3QCUL 5HYQB 1OW0A 3CSYB 4X4XA 5L2JA 1NLDL 4P99A 3T0DA 5IT2L 2AKRB 2YC1B 1AR2A 5FUZL 1KCRL 2WZPD 4BZYA 1TZGL 1IC4L 4NHUA 1K8IA 2YEZA 2NY1B 4UOW0 1QRND 5I71B 3BKMH 2ZUVA 5HD8C 2ZP0T 5GIRB 3IFLH 2XZQL 4QOKE 1NGPL 5DJCA 3TWCL 2BC4A 3U1SH 1IFHL 3KPSA 3Q5TA 1R5IB 3WS6A 2R0KH 4Z7OF 3QEHB 4UTBH 4MD4B 1NMAL 4Z9KB 1VESA 2O61B 2Z0BA 3U46A 3C6SB 1U8KB 4KKBC 3JSSA 3NIDE 1PSKL 3LV3A 4JZOB 1MI5D 4CN4A 5FCUH 1NFDA 1YPZB 3LQAC 3MNVA 1I8LA 2AJZB 1PX4A 3G6AA 4IDLA 2Q7YB 3SKOA 3QXUA 5LGJA 2NY6C 1HCVA 1A7RL 2F15A 3HB3C 3NFNB 4PJHF 4PP2B 4TNWK 25C8H 1I7TA 5A3ID 1EDQA 5A1AA 3QI9B 1U3HD 4UTAH 1QYGL 2FWOB 3D39A 5D71L 1CDUA 5CP3A 1TITA 2QADD 3WFHA 4L9LB 5DEFA 4XPBL 3WDJA 1T7WA 1D6EA 5HHQB 2XKSA 3LKRB 3O2DA 2C1OB 3WXVH 1EK3A 5GGQH 2CK0H 3FB5A 1M4KA 3QHTC 1J1PL 3CH8A 2R1XA 3V4PH 4OF7A 2XRAL 2H2PD 4JFFE 4XVUD 3MR9B 1PYWB 4LEXH 4WU5B 3O4LA 5CLWA 2Z31D 4YGAB 2CUMA 3KLAA 5TDPB 4LLWB 2UZXB 3ARXA 3B9KD 4KHXL 5EO9B 4DVRL 4ZS6C 1BBJB 2K7PA 3QZWG 1DL7H 1E27A 4LLUA 5CP7B 4H0HB 2HKFH 4U1KA 1NGXA 3DXAB 4HLJA 4ZSOA 4MXVE 4LQFH 3OGCA 4OKVB 3WFBL 5BZWA 1PJ9A 2P8PA 4L1HA 3HC4L 3M45A 4YEEA 5FYJU 5GZOD 2GJ6A 5EH1A 3QXTA 1YY9C 1XGRA 5J57B 1L0QA 2DQDL 4TULH 1QLEH 1QSEB 4P23C 3BT2L 5K9QG 5CHNB 5DHVB 3LN5A 3A67H 3AVEA 2IALA 1A6TB 5B4MD 2WBJB 4XB7A 3TBYB 1B0WA 3VWKB 5IHBA 2LU3A 1UJTA 1R3LA 2EH8H 2AJYL 4JFDE 1IKFL 1LE9A 5GRYA 4ZPTA 1FGNH 4TQEL 1NBZA 2P8LA 1X6LA 4QLRA 1G7IA 4Z7WB 3V6FA 1FC2D 2Z35A 1I8KB 4AT6A 4JFOB 3IRPX 1WTLA 3MROA 5JPNA 4Y2DD 4LKCA 1MRDH 3X14A 4M7JH 1I4FA 4X7TB 4XNZC 4ZUVA 3MODL 5ITFA 4NRZB 3QUZD 3S3PA 4MA7L 5J8OA 4XPGH 2VJXA 3P0VH 4ZPVB 3DX9B 3GJFA 2MCG1 5KG9A 4K7PH 4R6UA 5DC0A 3GRWL 4PGDA 1AO7A 1MEXL 5E9DD 5EO1B 2NY4D 3P3YA 5K9JH 5C7XH 4S0SD 4B0MM 5D1QA 5F9WC 1PLGL 2AJ3B 2J8UF 4DK3A 4KU1A 4UBDD 5JW5A 3PWPD 1XF4A 3QDAA 1WAAA 4NZRH 1FG2A 4AL8H 1D5BA 1SJEB 1HSAB 4LCWA 5BW7A 1VKXA 4ELKB 5ICXA 1CFSA 4Z7UE 3BZEA 1QLEL 3VCLA 3SGKA 1QFOA 5HVGB 3GJEA 1BVZA 3BJ91 1F11A 1SEQH 3LRGA 4U1JB 2NW3A 4Z18A 4LU5L 3VXNB 3V0VB 1FBIL 4D3CH 5D1ZD 3MRJA 2WWMC 4OSUH 5LAXA 4XCNB 4IJ3B 2C4FU 3FQTB 4GKZB 3VRLF 1FPTH 5DUPH 3BIKA 3GB7B 4GG8A 4P4KB 1BQHA 1ZSDB 2FYYB 3ZT6A 2D31A 5BXFB 4R9HA 5BVPL 2FATH 4LSDA 4PGEA 4U6VL 5JPMB 3ARUA 3D85D 4LCUB 4HULB 3OX8A 1MJ8H 2QQNH 5IW1A 3W2DH 2XWBA 2VZ1A 2PW2B 4MB5A 5FUCE 2ZSVB 2ZUWA 3WNNA 3CFEB 1YEFH 3LN4B 5DD5L 2ICES 3FO9A 3UZEA 2QQQA 4EI5D 3HNSL 1JPGB 3FO0H 4LCIL 2ED7A 2V2XB 1AGBA 1JWSB 3E6FA 3O6KH 4P5KA 4XXCC 3MLTA 4C83B 3LKSA 1MWAH 5KVGL 2KQNA 4Q0XH 2VTFA 4NZRL 3UXFA 5GRXG 5KSBA 3LS5L 1U91A 1JGVL 4YFLI 4F37F 4LNRA 3D3VA 4X6DA 1TPXC 4K94H 3Q6GL 5JOEA 5TH2A 3HG1B 3K3QA 1AP2B 3B3IB 4G6KH 3RP1A 3T4AA 5D7SH 1EJ6A 1CE1L 1OAKH 1BX2A 4NGHL 4J4PC 4YHOL 4MJIA 3SDAD 3DI2B 1E4WL 1AXIB 1Q9OA 1YN6A 4IS6A 1TMCB 4LLMB 3IAGC 3UC0L 5FHBH 2Z8VC 3H2WA 1CG9A 3MNZA 5JXAL 4AEIH 3U2SB 4R2GB 2E8YA 3VFOA 3IDNB 5C2BH 1DDHA 1J8HE 4HC1H 3TT3L 1JTTA 3UAJD 1ZANH 3LD8C 3B43A 4GAGH 5D7JD 2RCSL 3RPIB 3PHQA 1UB5B 2E9JA 2X05A 3SE8L 3WL9B 4Z76A 1G7PB 3SHSA 2OR9L 3KAAA 5CJ8A 4D0BA 3EYOB 2R29H 4MS8C 5KVFL 4QRTB 2RFXA 4O02L 2XT1B 2AGJH 3NCBB 4H1LH 4HWBH 2M2DA 1A4JA 3RKDC 5CKAA 5I1DA 3RJDA 3FO0L 1U8LB 1YYML 1A6VL 3GKZA 3AM8C 1D5MB 5BRZA 1IAKB 5L88L 4GMTH 4PJCF 1B6UA 3WEXA 5LXGL 5AAMA 3WFDH 1KJMA 4U1NB 4NN5B 5I66A 2I27N 5DLML 4GG6B 5JOFB 3TBWB 4QWWC 1T5XB 1CBVH 3ZKNC 4ONOA 5L7XL 5A2LH 3TV3L 1T0MB 4HJJH 5EOQH 3JBG7 1RHHB 3KPSD 4K7PY 4NQCA 3FFCE 4L3AA 2BY0A 3QJFA 4OFYD 5AZ2L 2X6MA 4U05A 2R69H 4NP4H 3E2HB 4ZFGL 2HTKC 1HOCB 3TVMC 3V5HB 5CEYA 2EC9U 3T09A 5CZVL 5ESVA 1S9VA 5E70A 4PTUB 2CXKA 2QQKL 5JQ6L 4XCFL 5TQ2L 4K3EH 2NW2B 1NBQA 3NIDF 1FJ1A 1GCFA 3LIZH 3FB6B 1KB5B 1DLFH 3ULVH 1P1ZA 5DR5L 3B5TA 2AV7B 2VQUA 3H9YA 1KTDB 1PG7W 2HG5B 2D9QB 3BEWB 4MVBD 4PJDE 1AR1D 3D39D 4PJXF 3OHXB 3L6FA 2O93L 4P2OA 4ZOBA 3VXSB 4AH2A 1XH3A 1OVZA 2F5BL 4LHUB 4RBPH 1C5BL 2YHGA 1D5XA 4P2RB 1S7QA 1QSZA 3PQYB 5D5MB 1IM3A 5F89B 4CMMB 4GRWF 3TPUB 4QY8A 3O4LD 5BO1H 3FCTA 2B8OT 4Y1AD 3EO1B 3QT2A 3GHEL 1KCVL 3S88L 3VXUD 3S96A 1F4WH 2CLVB 3QAZB 3TFKC 4XAKE 2NY1C 3T04D 3E1F1 3LEYH 2BZDA 4XP9L 5HDLA 4L1DA 5I71C 3BDBA 4UIMB 1H8NA 2DQHH 3FB8B 3VI3F 3JWDC 4BH7B 4L4VB 5F7DB 1LO0H 1JGUH 5LBSL 4OJFL 3M07A 3TNMB 4MD0A 3VJ6A 5E2WH 5B3NA 3MREA 2OXHA 4TOYH 5KVEH 2AAVA 4UDUB 1J86A 2UV3A 2LTQB 4OGZA 4P46D 1WQVT 1MCWW 4YDIL 2YPLD 3DROA 4OCMC 3HC3L 1CDYA 4LLAA 4X6CA 5FV1L 4HLZH 3ZKQD 3WYRA 5IBUG 2AABH 4Y19E 5HHMD 2ATKA 1Q94B 5GJTL 4FTVE 3H9SE 1JRHI 1FLRL 3HZYB 4M7LH 5C1MB 2F58L 1CLCA 5C0EB 5LG1A 3QCTL 4C57C 1WK0A 1DUZA 4P3DA 2A6DA 3MRIA 3QI9C 4WFED 3TN0A 5BS0A 4QHLA 5IB2B 2ZUUA 4X99A 3W0WE 1N5AB 5KVDL 5C9JA 3UTTE 2HVJB 2EO9A 5E2VH 3BZDA 4L9LC 5KZCB 3TA3B 4X6EA 4HUKB 3BAEH 1MIEH 1H5BB 4WGWB 4NKMB 5D7LA 2PUQT 5GGVL 5AZEH 1CXFA 4D9LH 1BVLA 3T0EA 1H3XA 4AEEA 4WENB 4RFEB 4KI5C 5DEGB 5T3XD 3QFDB 4QRPA 4ZOCA 2VL5B 4PJAE 4GAJL 4YHNA 3BH9A 1MAMH 3ZTNH 2BNQA 1AE6H 2J4WL 4PJ8D 4YHLL 2R56L 3DX7B 3EYQD 4HJ0D 4XVJH 5IVZA 4HXAH 3GMOB 3DURA 3CMOL 1F6AB 4LSPH 4EN3A 4LCWD 3MLWL 5D7IB 3MLZH 2WQRA 4BH8A 4HFUH 5HHNB 2KQMA 5T1DL 3I84A 3VDBA 4JVUA 2Y25A 3CFIC 3PGFL 2Y7QA 1RD6A 1AGFB 3AGVA 12E8H 3CGTA 5HPMA 5KSAA 1NUDA 2X09A 4BK4A 4WI5A 1OCWL 4Z7UF 3ZDZE 1ZHNB 3RKPA 1OP5K 3MRNB 3X12A 3Q1SL 1B0GA 1LP9E 4YC2B 3H7BA 3ARDD 4FFZH 2WBJC 2AK4B 3PABA 4U1IA 4CGTA 4LNVA 4UNUA 3QFJE 4P9ML 1T6VN 2OCFD 3ARGB 5JUEH 2A6KA 1P4BL 4Y4FD 4DN4L 3WNPA 5T1KD 4X4YA 3M8OL 1WT5C 2AQ2A 4FHBD 5F1SA 4HC1A 3UTSB 1AGCB 1AHWA 4MDJA 4E41B 2PXYD 3GMQA 3KPQB 2YN5A 4I2XB 4NYLB 5EC2B 1IILE 4PJFB 1XR8B 4NKIH 4APQA 1U8HA 4L8DA 5ELIA 1D9KD 1X5ZA 3O41B 2MMXA 1MCDA 1VA9A 3O3EA 1RUQL 3RNQB 1M05A 1YECL 3SQOH 4UIKH 5JZ7C 5DHXB 1FSKB 3A6CL 1ED3B 1JE6A 4H1LA 1Q0XH 1YC8A 4HWBA 1JZ6A 1NGWB 1QOKA 5DO2C 3OKDB 5JOPD 5DT1H 1KJVA 2YBRB 4G80B 3V52L 5HHPB 4ZAKC 5ISZE 4OD3H 3HI1B 5HYEA 3JWNC 3V0WL 2DIJA 2H26B 4MSWA 2PYEA 3TC9A 4P59H 3I9GH 2A83A 3DPBA 5J3HC 3ZSSA 1IAIL 3BP5A 4ZFOB 1OHQA 2F5AL 2EDTA 4I18C 1DEEA 1IGIH 4FQLH 4X0KA 3I50L 1JWMA 2K1MA 1MAJA 3OB0H 4ODWA 3SKNA 1E28A 3WUWA 5DRNB 3O6FA 2OTPA 3VH8B 1A6ZA 2NXZD 2W9DH 5TDOB 4JRXA 2ICEA 5MEPA 4WU7A 2VERN 4JJHA 4M48H 1DLHB 4Q9CA 4XWGL 4Y16A 5KW9L 1I8MB 5I17B 3LHPL 1KN2L 5EOCH 5IF0B 4XRCA 3WJLC 1GC1H 3N9GL 4KVCL 2V5MA 1NEZG 4PD4J 4DGIH 4KK8C 3WMSA 2NY0B 4L4TE 4PLKC 5ALBH 3F5WA 3IFNL 2BVPB 2BVYA 1RURL 2EEBA 5EFIB 1KJ2L 3PHOA 3VFPA 5DJ8B 1YEJH 4FFYH 2CDFB 5FHAH 3DYPA 4HAFA 1RZKL 3F7YB 4PRHA 4V2BA 5DWUL 3MRDB 1OAYL 4Z78B 5DT1L 4L8BA 5FYKE 4I3SH 4LCYB 1TQCB 4QXGH 1YNKH 2LAAA 4HS6B 1AXTL 4HFWA 3KJ6L 5HJ3A 4OZGE 3FMGH 2HT3D 3IDIB 1JL8A 1RK0A 2AJUH 1FZOB 4FXGB 4XTRD 1A5FL 1I9JL 1J1OH 5B22A 1DQQB 4KI5F 1ZT7B 3TT1H 5C6PB 1KTLA 2CLRA 1M7DB 1V3JA 4DZ8A 4NRXB 4NO5A 2UY6A 1HHHB 1MLCB 1AFVL 3OAUH 4R3SB 5L2KD 4JR9L 3ZE1F 1QNZL 1LMKA 3N0PB 3Q2CA 4OQTL 4JFHE 2QSCH 1JF1B 5I1AA 3MFFA 4JDTH 4ZXBB 1E4KC 4P0DA 5D2NA 4OZFH 1YYLL 3QDGB 3IVKA 3IDJB 1SM3H 3ARRA 1JPSH 1MH5B 4R0LC 3N85L 4MNQB 1QEWA 2WBKA 3FONB 3H3PH 3BQUD 4BZ2L 1U8IB 4KJYB 4LCCC 4R8WH 1G6RB 3WO4C 4FFVD 2A6IB 4WNQA 1PEWA 1L7TH 1LE5B 2J6EL 4IRJB 1MF2H 2IPTL 4JHWH 4PJBE 4NQEA 4UT9H 5ENWB 1ZWIA 4PR5B 4OCRL 2ED9A 3N1QC 4U1HB 4WW1B 3CVHB 1YNKL 4Z7WF 2HMIC 5DC9B 2D7NA 3K4DA 2YD9A 1JNJA 3VFVA 1P4LB 4G6FB 3EFFB 3L3GA 4IOFD 4NCDA 5TE4L 5BV7C 3P77B 2C3GA 3H9HA 3VGHA 5E5MB 2X1OA 3QIUD 1DE4B 5CJQL 5CMAB 4PJGA 3T65B 4KDTA 1JNHB 3MV11 3UYOD 2E7CA 5JXED 1T20A 3KWWA 4XNUL 2IG2L 4LPCA 3T77B 4A6YB 3SCMB 1MY7A 4RGNE 1TQBC 3DGCR 5I30L 2YOCA 4P9HL 2AJVL 1C1EH 3BGMB 3HTLX 4G5ZH 3V6OE 2YUVA 3QQ4B 5E6IA 4NC1E 4OLWL 5E8PB 4TSAL 5HGAB 3DMMB 4J3TA 3FO1A 5E94A 5J0BA 3I6GB 1FG9C 2Q86A 4L3EE 4MNHB 5T3ZD 2RHEA 1UEMA 4MQXC 2YRPA 4PJIB 1NAKH 3C8KA 3MOBL 4FQXB 3FQWB 3MRQA 3VWJD 1RULL 4UUJA 3F12B 2QJDA 2DQGL 2ESVE 4FXKA 1CVRA 1FNHA 5C0RL 4DK6A 4HW6A 5HY9B 5F8RC 4HMCA 4OF0A 4N9OB 3LKQB 3GMLA 2PO6B 1S7UB 4ETQB 2FX8H 1XGPB 2CK2A 1J0ZA 1KIQB 1RJCA 4QCIA 5I8KH 3KPRB 1ZHLB 3U36A 3T0ED 3G5XB 4MAYC 3K0WA 3QG7H 4JKWA 3TJEH 3VFRB 2OL3B 2VITB 2C1PB 4HKJB 5I2IA 3HE6D 3CC5B 4U3XA 1B90A 4WO4B 5IP4A 2GITB 3TZVC 1MFDL 3RTQD 2DIAA 2HJLB 5DMGC 4K9EC 3VI4E 2IBBA 3QAZC 3LMJH 4H5SA 1X5IA 2VDML 4WFGE 1P5UA 3VFWB 4OCWH 1LEGB 4U1LB 4MB4A 1RZ8A 3V4UL 4HXBH 1J1XH 2QR0B 1WIOA 4F15C 3FOLA 1DUYB 3DV6B 2IANB 2E27H 2LTQC 1EGJH 4FQHA 3B83A 2UVEA 3WKML 1P4IH 1OGTB 5GRJH 5ICYA 2A6JA 4M61A 5C0AE 5T1LD 1C8PA 2IBZY 3UJJH 4PD4K 2VQTA