2A6IA

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide klasipthtspl
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
total genus 50
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iA01
3BP5A 1HHGA 4N0RA 5I17B 4LIQH 1YECH 3E2HB 4CN6A 3RA7H 3U0PA 3OZ9L 2SEBA 3CZFB 5CJ8A 1GAFL 3DX6A 3EOBB 1ZVSB 4PJ8C 1CGSH 1OPGH 5BRZA 3WFEL 1TCRA 3BKCH 2J2ZA 4GQ9H 4QHNB 4Y16D 3PP4H 4NJ9L 2CIIB 2VLJA 4YNYA 4B0MM 4Z0BH 1JE6A 3CSYA 3TBWB 5C0CB 2D03L 2GEEA 1YJDH 5E1AA 3TN0D 4RMTA 4YHLL 3NH7H 3H42H 1KYOK 2NX5A 3R1GH 1AE6L 5DMYA 1DQJB 1R3JA 1HDMA 4PRHA 1FAKT 3NFPB 4PJBB 3VG0H 1TNMA 3C8KB 2B5IB 3QFDB 1RV6X 5JOFA 3B2VH 1U8QB 3VRJB 1JV5A 2ZJSH 5CJQL 2G9HB 1NGXB 3DX7A 2X89D 4G6JL 5DMIL 1S7SA 2ESVD 4RMWA 3SCMC 3BN3B 4Y5VC 4YK4C 2B0SH 5DEFB 3T0EA 2QHRH 1F6AB 2PXYC 4OF6A 1H15A 1A1OA 1SYSB 2P5EE 5ALBH 1EEZB 3HZYB 5EO0A 4BH8B 3QUKA 3H9ZA 3QWRA 3NCJH 4HD9A 1Q0XH 3ARDB 1S9YA 5JIKA 2F54B 1T0PB 4NRXB 3SGJC 2ZWLT 4WWID 3NACH 2QSCL 1IGCL 1ZK9A 4Z8FL 4EN3D 4HS3A 5J11C 5DUPH 3VDBA 1CIDA 3RNQB 5A2LH 2OI9C 3GSXA 2G75A 3CFIC 1OSPL 4Z7WE 5ECJE 5ESVA 1IL1B 5C0RL 5LWYH 2XKNA 1GRWA 5D2NB 4Z7VA 3NIDF 4NQED 3CFEB 1KEGL 1L0QA 3V2AR 3EYSL 5F89A 3MYJB 3LKSA 3VI3F 1VGKA 3VWKB 3MV9E 5M7QA 1BVLA 3K2MC 2CD0A 3ARBD 4PJCA 4QKXB 4AIXA 1AQDA 1WAAA 35C8L 4R96B 5TDPA 3T2NH 4K7PH 1PY4A 3ULVE 3SE9H 3IXAA 5KANI 1LP9E 1X5IA 3CGTA 2AEIT 4Z7UE 1YYMH 4GRLD 1CL7I 12E8H 2CO7B 3M17B 5TQ2H 1S8DB 3W9EA 1A7QL 5BV7C 1I4FA 3EYVA 4MS8D 4Z77B 5AG9A 2A9NH 5MHSD 1T4KA 3W0WD 4AG4H 5JHDA 1RZFH 4NWTL 2FBOJ 4QO1A 1Y18B 1RUQH 5CZKA 5H35A 4KI5C 2CXGA 1J18A 4LAJH 5CP7B 5ID0B 2H9GB 2NY5L 3SO3C 2H1PL 3WIFB 2YPLA 2FATL 1BD2B 5DRXB 5HHXL 3Q1SH 3GJFB 5BZWB 1BZ7B 1FNGB 4DFIA 3ARTA 2ZSVB 1VEOA 2JCCB 1JZ4A 4WFFD 1VESA 5MP6L 3WLWC 5IWLC 4JM2F 3L3IB 3MRJB 2R1WA 1KIPA 5D2NA 1CK0H 5ESAA 3TH4T 1OP9A 2RB8A 4IJ3C 5ESAB 5BO1H 1GZPA 3T77A 3I6GB 1QLFB 1N0XL 3OAUL 3T3PF 4H5SA 2E3VA 3MRDB 4LEXH 2PR4H 4ZD3H 1TVDA 3STLB 5ISZD 1N64H 4QHNA 5SX4H 4UT6H 4WI8A 3EFDL 4I48B 1H3VA 1BZ9B 3V0AC 5CMAB 1B4JH 4M8QA 4K8RH 4P2OA 4Y2DD 4OT1L 4CMHC 5IV2A 3SGEI 4BH8A 5DVOA 1YDPB 4KI5D 1TETH 4PJHA 1V3LA 4JKWA 5D7LB 3U4BL 4OM0H 4JHZA 4YQXH 1NBZB 1TNNA 3G6DL 1KPUB 4DVBB 4MNQD 5L2JB 3DMMB 2J8UA 5JA9A 1IGML 3ZKMC 3SKNB 2VQ1A 5HHVH 3TH3T 5CBEB 1NGXA 2QQLL 3RU8H 3S3PA 1TQCB 3VRJA 5F7DB 4YHYB 3CAFA 1IFHL 1U3ZA 3BAEH 3CSBA 2IAMA 4H25B 4PJIB 1MCRA 5GRWA 5BZDA 4FA8A 1D5BB 4L4VA 4MCYA 2X4SB 3BUTA 5IMMA 3WFZA 4PLKC 4PRDB 2X4PA 3TH2T 4FG6D 3AVEA 2DTMH 2E8ZA 2AK4E 1WAAE 5C0CA 4KHXH 4YDKH 1NUNB 1WGOA 1A4JB 3KPNB 4V1DA 3BN9C 4BSVB 2G5BB 1SM3L 3A67H 4WNQA 1FL5B 5BRZB 1Y0LA 3BE1H 4PG2A 4QHLB 4DW2L 2DTML 5I2IB 4F2MB 3HCVA 3PV6B 2PYEE 2I07A 5EU5A 2F15A 4UV4H 5DUPL 2E6QA 3KPQB 3F5WA 4G8GA 1JGEA 1WBZB 4LSRH 2BOCA 4I3RL 3W0WB 4RBPH 2QTEA 5CGMA 4AENB 3ZTJH 3FKUS 4LKCA 3EJYC 5T33H 3RDTB 3EOTH 2A73A 1FDLH 4MB3A 3U6RA 2AJZB 2FWOB 4W6YB 3GM0A 3HMXA 4I1NB 4Z7QF 5GISH 4XAKE 1J8HE 4NC1E 4DN4H 5FKPB 5L7XL 3DX9A 1QFUL 1YZZA 4PJ5E 4QRQB 1J1OH 2F8XC 1OCWH 1VB9A 4LL9A 4NQDE 3RWIA 4PP2A 4JHWH 2PYFA 4AYFA 3RI5F 4HXAL 1RZGB 3RVUD 4NQEB 4DKEL 1VADA 3QDGE 1AGDA 5F21B 3RKDD 1K4DA 2V2TA 1HDMB 2XZAH 5T3XE 4MXVE 3MCLH 2DMBA 4LPUA 1PG7L 1VACB 4PY8I 5D5MF 5A43C 3MRCA 2BOBA 1JHTB 2H26B 4Q97A 4IRSD 2UY7A 4G6MH 3RGHA 2I27N 3RUGF 1TCRB 2E9WA 5D1ZA 3QUZA 4G5ZL 3ARDD 1F02I 1A1NA 1EFQA 1A9EB 1X5KA 3JWDH 3QNXA 4ORGA 5EULV 1GAFH 2C4XA 1YEDB 5IGXH 4OIIL 3WCYA 1CQKA 3V0VB 1F3RB 3LRSA 2FCBA 4TRPH 4OLEA 4MWFB 4Y1AA 1SYVA 2BC4A 3QAZB 1A6WH 4I77L 4M6ML 4Z6AT 1KC5H 5T3ZD 1HQRB 4ZUWB 3VXRE 4U3CA 3QZWG 1OD7A 4QGYA 3VD5A 3QFJD 2PF6A 4XWOD 2AJSL 5DJ2B 4NNPH 2NXZD 3RWDB 5TE6L 1B88A 1REIA 4YWGL 3RZCA 1KJMB 4KMLB 1HILA 4XNQA 4PP2B 1I85C 1CFVL 3G6JB 3EHBC 4JLRB 2Q8AH 3VXQA 1F6FB 1NGQL 2R0LH 1KIRA 3T8XA 1INEL 3S4SB 3GI9L 1NMCB 3PWVA 4XWGL 2NY6D 4FABH 3AC0A 4XPBH 1RZJC 3TLRA 12E8L 3BSZH 4JFDE 4NSKB 5TF1H 3CC5B 1RURL 4AT6A 2YZ1A 3R0MA 3QI9C 2JK5A 4KQ4H 5K9OA 2OP4H 4ZSOB 4WW2B 1EHAA 3MV8D 2VDKL 4Y19A 3B9DA 4WI4A 1JYVA 1OW0C 2VAAB 1T1XA 1KIQA 1NCBL 4JG0H 4QHKI 4XPFH 2XIDA 1WAAF 2F5BH 2HJLA 2YK1H 3VMOA 2B2XL 3HTLX 1YMMB 3I9GH 4U6VL 3EBAA 4HK3N 2DJSA 3LMJH 4L1DA 2NR6D 3GI8H 1YMMD 2NXZC 5SWZA 5GIRB 1EEYB 4NC2B 2BDNL 1HEZB 4ZUUB 5T5FL 1TZHB 1YY8B 3CLEH 4OSUL 1GPOH 4WO4A 4X6CB 4XAWH 4P48A 1A3RL 4NCDA 5D1QA 5IHZB 3BP4A 2G5RA 5JW5B 2E7BA 1MWAB 2OYPA 4WFED 2R39A 1NAMH 1KTDA 4FFWD 2D03H 5KW9H 1XF4B 5IB2A 1M4KA 1F3DJ 4OZHF 3ISWA 3RDTC 1ZT1B 4WFHE 3HNSL 2KH2B 3S36X 2BERA 1PDKA 5L2JA 3OB0K 3RL1A 1NAKL 1TTFA 5CJOH 4NRYA 3HMWL 4ALAH 1MHPL 4GRLA 1A9BA 4NWUH 3BKJL 1GJIA 2VISA 3QFJB 4RZCB 3HPLB 4E5XA 4YEEA 3ZYOA 4M7KH 1EPFA 1GC1H 4Y88A 3I75B 2C1PB 1W8OA 4Q6IA 5IMOA 3VE0B 3ULVF 4GMTL 1RZKC 1FVCA 2NTFB 4E41A 1IM3B 2AEPH 3LN9A 1GZPB 2RQ8A 1P4LA 2YS4A 4OZGF 4S1RL 5TE4H 1NMAH 3RTQC 4RGMC 3P11L 3QEUB 4HKZA 2I24N 1LP9B 2X5PA 5E2VL 3QXDA 5MENA 4QXUH 4Z7OF 5DEGA 4IRJA 2VAJA 1IM9A 3RPKA 1PKQE 1MFEH 2VWEC 2Z31D 1YC7A 3PUCA 1GGTA 5ITBH 5C7XL 4NUGL 3O45A 3WSQL 2L7UA 5C0NC 5DJZB 3QCVH 3L3HB 4Y4FD 3LAFA 3DX8A 4ETYA 4HGWB 3L3DB 4LEOA 1RUPH 1I3GL 3C5JB 1FZKA 4MD4A 4O58L 4NZUL 4PRPB 4ZSOE 3P4MB 1WBYB 2MHAA 5AAWA 5BVJB 4R3SB 2QR0B 2Z8WC 4FP8L 5BW7A 4Z0BL 4K71B 3PWPB 5KZCB 5SWZD 2UUDH 2XQBH 1OP5H 2NY7L 4D9LL 1XAUA 3ARSA 4WGWB 2Z35B 4RWHA 3HR5B 3AY4C 1EX0A 1PJ9A 3VMPA 5DD6A 4WUUD 1DQQB 2CK2A 1NSNL 1CVRA 3QDHA 4HK0A 4U33A 5TDPB 3ILPB 4XCEA 5IQ7L 5CGYD 2I9LA 5FA4B 4NO0A 4PRIE 1XF4A 5IB2B 5GGRY 4HMCA 1DLFH 4XVJH 5EA0H 3BIKB 2C9AA 4R7NB 1ZVYA 4LSVL 3DBXA 3IVKB 4OKVB 1CXEA 1JGVH 4M61B 2IPUG 2JCCF 2YA1A 1KJ2B 2CK0L 2MTPA 4HT1L 3FCTB 3R8BB 1HSAA 5INDB 3KNBA 4NBXB 3HFMH 5FYLE 4X6CA 3QO0A 5IEKA 1QD0A 2BY3A 4LP4A 4PJ7E 5FHAL 5JW4R 1UJTA 4HQQH 4NRXA 4FQHA 3U82B 3P4OA 5SWZB 4OTXH 3G9AB 1RZ8A 1YPZB 2XTJC 4U1IA 4PB0H 1J8KA 3JUYA 3QUYC 3L5IA 1DL7L 4YHML 2HYMA 3LSOB 3H3PH 1E4WL 3QISA 2AP2A 1OQXA 2AJXL 2XZCL 2P48B 3LKRA 4MSWB 3LHPH 2MKLC 2HFGH 1FV1B 4RZCA 4E5XB 3PV7A 4KDTA 4E41D 4UI2A 5BJTB 1N5YH 1S5HB 1GVIA 1LQSR 3RWHA 5I75B 4JFHD 2JK5B 1K2DB 2EXWC 1P1ZB 4KXZI 2DDQL 5B38A 4X7TA 5D7IA 2V2XB 4LSQL 3GMMA 1MI5A 3BT2L 4POZC 2Z4QB 1M7XA 5AYQA 1BIHA 3Q6GH 5CINL 3C6SA 1MCPL 5JW3L 3VRIB 4RGOL 2OJZH 3VXQB 3WNNA 4Z18A 3TWCH 1S5IL 2VIRB 4O5LL 3F12B 2X7LA 5ISZB 1TZIB 3D39B 1LVEA 4KROB 3BP4B 4WI7A 3FT4B 3OKDB 2BMKA 4XP4H 3RVWD 1H3GA 3MR9B 3RVWC 4Y2DC 5J1TC 1ZSDB 3V5DA 4ZUWA 3I85A 1HQRA 1BLNB 1YY8A 3IDXH 2W0LA 4GAFB 1H8NA 3BVNB 4ONFL 5JZ7D 5E6ZA 4EQ2A 2FJGB 4YFEA 3OKEB 4NO5B 3QNYB 1JPSH 4Y4HD 4JFEA 1T5WB 5D1XD 4PJ9B 2Q86A 3I3DA 4ZFOA 1LP9F 2Y25A 3KG5A 4ZOEA 5T1MB 3DO3A 2N4IA 2NMSA 2YWZA 5J9PA 1MFNA 2HLAA 1U95B 2BNRA 4OGZA 2CRYA 4JJ5A 3R0NA 5B21A 5B39A 4KQ3H 4U7KA 2R2EB 4DOHE 5GGVY 3C5ZA 3TBSA 3D48R 1FE8H 4IHOA 5DA0B 3RGVC 2VR9A 4W6XB 1E4KA 2JTDA 5EU7C 4XWGH 1RHFA 5DD0H 1FNSL 1DUYA 3PL6A 4AY0A 3PWVB 3QHTC 1ZA3B 2VERN 4WDIA 9CGTA 1PW3A 2FLBT 1HYSC 1U8OB 2FLRT 3IDNB 4XNQB 1JNHB 3P73A 4Y5YC 3R8QA 4HJJH 2VLKE 3ZE1E 3MSPA 4ODSL 2D31A 2DQIL 4EOWH 4FXGB 3ARFD 4G8GD 4JN2A 2F53B 1BQHB 2I26N 5T1DH 3CIQA 3GUTB 3EOTL 2ZPKH 2PW2B 1EZVY 1M7IA 1XIWC 3MOBL 3LQZA 4QGTA 1U8IB 4J3VA 3TYFA 2BVYA 2YD2A 5CEZH 2P5WD 5DI8B 5DHYB 4OLXL 5TGBB 4NDMA 1D5MB 2X10A 2DJUA 2OLDA 5HVGB 3KVQA 4DKAA 2CDEA 3ZDYF 1BZQK 4G80B 1O5DT 4APQC 5D7KE 5L9DL 2DM7A 1DBBH 1OGTA 2VXUL 3CU1A 1CZ8L 4OLWL 3KR3H 2QV2A 3RGVB 4ZYKA 3V6OA 1QFOA 1HKFA 1SM3H 4JZNB 3E0GA 2RIKA 3D69B 4MA7H 4M7JH 3QB7C 3KXFE 3VXUD 4ZTPH 2XN9E 3FQUA 2HRLA 4MB5A 1MAMH 1UJ3B 5C0EA 3QUYB 3MLYL 4NN5C 1RZJL 2X41A 4LNRB 4M48L 4XPGL 1UJ3A 5J11B 1KCVH 4HIXL 2V2TB 1ADQA 4PLOB 4MXQC 2R2HA 4YZFF 4JQXC 4KVNH 1N6QL 5CHNA 2HAZA 2V2XA 3GO1H 4ZFFB 3ESVF 2MPAL 4MA3B 4TVSa 1A47A 1T5XA 2BSTB 2J4WL 4TUJB 5MEQB 5C6TH 1AIFB 4P46B 3ZE2F 1QA9B 2PW1A 4P9HL 4AIZB 5ICXB 5IG7B 1P6AB 4AK1A 2BXZA 4CU8A 1T7ZA 4OD3L 1NQBA 2ENYA 5HDBF 2NW3B 1PGRB 4V2BA 1T1YB 2X4OB 3LDBB 2YUWA 5C0GA 1A14L 1ADQH 4LF3B 2XTJE 4OZIF 1HSBA 1RZ8B 3TCXA 4YGAB 3TNNB 3U46A 1JMXA 4CL7A 2BSSB 5DURD 1KTKE 2WK2A 2YUVA 3GMNA 4NKMA 4LCWE 4EZMA 5HI5C 5EUOB 5I19L 1LMKA 3NN8A 4AM0A 1VDGA 4ODBD 5I1CH 5DMJB 1CK0L 3MACH 3QO1B 3JSSA 4POUB 3GJEB 3QG7H 4PV9B 5L8LB 1G7PB 3QZWB 4KJQD 2R9HD 2YMXH 3LKOA 2ZNXA 4GW5A 3IFNL 1CDGA 3V0WL 4K3DH 4ZUSB 3IJSB 4ISVB 1N3NA 3V6ZA 1P1ZA 4RMRA 4PJAF 4WGVB 4P46C 4I5BA 3BEWA 4MXWL 4UTAH 3NCEB 3O3AB 4HK0B 1AQKH 2BZDA 2R2EA 3O6FC 1BJMA 3BI9X 2IF7A 2C3VB 2BNRD 5L88H 4ODVH 5LGHL 4O02H 5IHUL 3PHOA 2A6IB 4Q0XL 2ZUYA 1OB1B 4GW1B 3EJYD 4KUZH 3OAYK 2EDXA 4U1IB 4O00A 5HTSA 2EIBA 2JELL 1UVQA 4YFLI 5DRZA 2WV3A 4PJHB 1WICA 3P4MA 1CFTB 1NCCL 1T2XA 5DD3H 4ZO9A 1NUDA 4UNUA 4Z0XB 4YBLC 3GK8L 4PGZA 4W6WB 2VSDA 5K59E 5DWUL 2BMKB 3OKDA 5E4EB 5DDHA 5SWQA 2R4SH 5DC4B 2JJSC 5BOZG 2VLKA 3G5XA 4G3YH 1I3VA 1XH3B 4G42A 5IWLA 1S3KL 4PJCF 2P5ED 2FD6L 4ENEC 1XT5A 3O9WC 3QH3A 4QRRD 3SE4A 2XFXA 1ES0B 3B83A 3G6AB 5CKAA 1DSFL 1MHPH 3ZT5A 5D1XA 3P0VH 1Y6NR 2XPGB 5AUMA 4L3CB 4M1CC 3TJHD 2XG5A 5FO8A 1J10A 5E08H 5C08B 3VXUA 1OY3B 4P2RA 3QEHA 4FTVB 2PTUA 3QDJD 4PREA 1FCGA 3EYUH 3GHBH 4UILH 1DANT 4XCCL 1UEMA 3T08A 4TQEL 2LU3A 3OX8B 2WBJD 1YA5A 4NRZA 4NZRL 3WJLA 2YN5A 1Z9SA 4CVXA 1CD1B 3GSNL 1FV1A 5GGSB 2QQKL 4LHQB 3CNKA 4EN3B 1EEZA 3HZYA 4LCUB 5EO0B 1MIEH 5D4QA 4HG4J 4JPIB 1SEBB 4Q2ZA 1WBYA 2XT1B 2BSRB 1XGUB 3VFUA 2VXVL 1P69B 3BZFA 3LB6C 5TFSH 2H2PC 3BHBA 2AJVH 1B0RA 4EDWL 2QBWA 1NMCC 2AQ2A 2CKBA 5JXEC 2NPLX 4WI5A 4X6BA 2QQKH 5DJZA 5SWSE 1ITCA 1WFUA 3A6CL 4O2EB 3QCTL 4ZQKB 4J3OC 3VFWB 5F7WC 1WFTA 2GKIA 4ZTOH 3SDDD 4FHBD 3ARRA 3MLRL 3PP3H 3C8KA 3L9RA 1FQ9C 3MV7D 4N0UE 4HUWB 1BX2B 3J7HA 3T2QA 4LLYA 1UT9A 3FQNA 4NQVB 2FJFB 5F89B 4LHUD 1I1YA 4M9OA 3FOLB 3O9WD 1WSST 2R0WL 5IBTH 3IDMA 1ZA6A 1L6ZA 1GH7A 1RK1A 4OLYH 4L8BB 2O5ZH 1QBLL 4R4BB 2X1XR 3CDYA 5D2LA 3CFJA 2GJJA 3FO0H 4EQ3A 4U1SA 4YHOL 5TPWL 5H2BA 2EXYD 3U0PB 5IHLB 2VO5A 5DRWA 1QFWL 2ENSA 1J0JA 1T1XB 4YAQA 3H6JA 3MOAH 4OKDA 3QUMH 4TSBH 3HZKB 1TLKA 5J6GA 3SE8L 4LLVB 5IT2H 3UJTH 2DD8H 4CJ0A 1N6QH 5TPWH 2AJYL 4R8WL 1QFWI 3OR7A 5D7JB 1OP3H 2A6KB 1N3NB 1FL6A 4NUGH 3WSQH 3WKML 4HJGA 4NM8H 1KGCD 4LVOB 1EBPA 4GW5B 4TPRH 5KSBF 5ICYB 3ARFB 5FYKH 1U3HB 1P7KA 1PKOA 5IHZA 5HY9B 4LSDA 5DO2C 2VN4A 5HYJD 1C12A 1RZIA 2FH8A 1BGXH 1MVUB 2VITB 2XZZA 4P2RD 3PWJB 3CFBB 3QIWD 5IW6B 2VLJD 1MCLA 5C0IB 1DQDL 4P57B 3CFKB 1F8TL 4GKZB 4ELME 3C08L 3FB7A 4BM7A 5HHME 2YSSB 3GSUB 4MA8L 2GW5A 3HC4H 4XHJD 1BVZA 4FQ1H 1NANI 3EFFA 3RJQB 5HYQB 3G5VB 4N5EC 3HPLA 4HS6A 43C9B 1Q38A 1FLRL 4LRIC 1NFDE 2UVEA 2HJKA 3GBMH 4L8CB 1TITA 1T21B 3SDXA 1L0YA 5E8NA 1FZOB 2IAMD 4HWZB 1KJVB 4PJFB 5D1ZB 1QLEL 3O6LH 2IQAB 4DVRH 4XGZB 2YRZA 1A6UL 4K8RC 5GSRB 5IJVB 5D8JH 1KTRL 3SDDB 3S4SA 4XPTH 4Y8DC 4CDHA 1SJXA 3O2WH 3RIAK 2OS7A 5C0CD 1CDUA 1X5GA 2AK4A 4XCCH 1AC0A 3JV0A 3NTCH 4TVPH 2Y5TA 1FE8L 3QRFM 2NLJB 3HC0A 3DYOA 4LSRL 1U8PA 5CZVH 4K2UL 3T0WA 3ARGB 4TUOB 3OHXA 3IJHB 2OR8A 2P24A 1BJ1J 5JW4Q 3BYTA 2EYRB 3MBEC 3DGGB 4G43B 3ZKND 1P84J 1LEIA 4LBEA 4XAKD 3QCUL 4PRPE 1B0WA 3X14B 5D2LF 4PJ5D 2IMNA 2R0LL 3L3GA 2F5BL 5KSAB 4Y4KD 1II4E 2OZ4H 4L8CA 3CK0L 1E4KC 1UB6A 4IEFB 5AZEL 3TF7C 2GTZA 1NEZG 3QDGD 3MO1A 3UJIH 1JIBA 3VFGL 4Y4FA 5GRZA 1NL0H 3TYFB 5D1ZC 5HYFA 2EYTB 1RUAH 4ZSOA 4RQQA 4JGUA 4QRRA 4XNZB 1FO0H 1H0DA 1CBVL 4DZBB 2HP4A 3V6FB 2DIBA 5K9KA 3JBG7 1Z9LA 3VG9B 2YD7A 3HUJF 4JKKA 3D3VE 4QHKJ 2K7PA 1OTUD 5HYSA 1CICA 1G7IA 2IANB 1FZJA 4RWYH 3GSWB 4HWUA 3OG6B 3P77B 4QHUB 3OHXB 1YEIL 5I6XC 4RGNE 3BZDA 1GOFA 3KAAA 1NFIB 1W0VB 3GMQA 5DZOA 5FB8B 1UADC 2EZ0C 1CGWA 2UWEF 2H2SD 4LEXL 2O61B 3L3JB 3ARPA 2EDRA 5DJXA 1WIOA 4BZ2L 4XTRC 4P9HC 3RPIB 1KB5H 5T3ZE 3O8XA 4UIKL 4Y4KA 2BNRB 4M48H 4XPGH 1KUMA 2V7NB 4GG6A 2FB4H 2RCSL 3CVHB 4KQ3L 3VFSA 5E2WL 5TDNB 3SKNA 1MRFL 5EN2B 1BECA 5AYUH 3QXTA 4LARL 4DCQA 3GB7B 5J6GB 1IGFL 5F7YC 1AXTL 1SYVB 2BC4B 2LU4A 3RY5A 4XCYB 1A7OH 3DPBA 3ESUF 1RJLA 4XXDA 1F3JB 1UWEH 2DQDH 1IEAB 1F3DH 3KPMB 4J23A 4CW1A 1WK0A 5EIIA 1DN2A 4HC1L 1GIGL 1X3DA 3DO7B 1R3KB 2ICWJ 5E2WH 5KS9F 3QIBD 4G9FB 1J1XH 4PJGF 3NMEA 3EFFB 3FQWA 3T2PA 1CG9A 3C2AL 3PXHA 4LSTH 1A0QL 4MX7A 3RZCD 2VSCA 5IESL 1IQWH 4JAMB 1WEJH 4WY7H 3BT2H 2A74B 2D7OA 2G2RB 2VZ3A 3AS3A 4JPKH 4X9IA 3A6BL 4JZJA 3TBYA 5SV4A 2ARJA 3C2AH 2YD6A 1TVBA 2ZKHL 3TO4C 2MPAH 3O41B 2OCFD 4F33B 3MRJA 5D9SA 3AXLA 3GSOB 2X4SA 2DQHL 2PO6A 5E5MB 3SE9L 1DVFB 1LNUA 3C5ZD 5LXGH 1WQVT 4CRPA 4LLMA 1D5ZB 5KS9E 4P46D 5DYOA 3HE7A 1G6RA 2OSLA 4NQTA 5I8CB 2GHWB 5F9WC 2ED9A 1R5IB 2EC9U 3MJ7A 3EDJA 4M7JL 2YD3A 5T1LD 4APQD 1DQLH 4HUVA 2C7UB 4RMSA 3OAYH 4HW6A 4HUXA 4XRCA 3VI4F 4D3CH 3KGRA 2NY4D 4BSJA 4GG6E 5E99H 3QUMA 4Z77A 5GRVL 4TNVK 4WFEE 1RZJH 4P3WA 3VFNA 3V4UL 1S9KC 1WC7B 4PJXF 4U0RB 1F00I 4I0PC 4OTXL 3OR6B 5D70H 1R0AL 1I7ZA 4UU9A 1DBKH 4N8VA 4CU7A 1I9RH 4JREB 4MDIA 3WXWH 5HDLA 3PABA 4PJCB 2GJ6E 4CN4A 5FOBA 4PGCA 3LKSB 5FM5O 4XNUL 1NSNH 3IFPA 1MSPA 5CP3H 4AMKH 3IFPB 1F4XL 3JUZA 2MNUA 3N85L 2NQCA 2HKFL 1N5AA 4Q6YA 3QXUA 1FHGA 3OJ2C 4XP6H 3DYMA 3C60B 2CMRH 2DS4A 3TYGL 4BA8A 4GBXB 4U6YB 3RNQA 4YJZL 1I7UB 3TV3H 2GY5A 2ATKB 4K8RL 3VFPB 4IRJC 5L0QB 4H1LB 4CNIA 1QFWM 4V1DD 1JFQH 2R2BB 2P8LB 3QUMB 3U4BH 3WEXB 1FZMB 3RUGA 1YEJL 2JJSA 4FFVC 3ECBA 2P1YA 4RA0C 5D7LA 4RBPK 2C7UA 1QLRA 4R3SA 2APWA 2PXYB 4N8PA 4HH9A 4NKIH 4Z9KB 2R1XA 2MJWA 1B4JL 3DROA 1I1AC 2QSVA 5E4EC 3WEXA 3MLZL 2IBGA 5KW9L 4WI3A 1C5BL 2R29L 1DEEB 1U3JA 3IS1X 1EFXD 3QEHB 1FYTD 1DVFA 1LNUB 4R26L 5EIQA 3CDGB 3NFNA 2QSCH 4QTHA 2AJ3B 3AAZA 2D0FA 3C60A 4JO1H 4IDJH 4NGHH 3H2WA 1C16B 4J4PD 3N06B 3RWCA 4PJ8A 3PF2A 3IDYC 4J4PC 4KMTL 1MLCB 1GGUA 4HCRA 4N0YL 4Y4HB 3FT2A 2D7PA 3LN4A 2A6JA 4NKMB 5LAXB 2BVTA 1N59A 2P8PA 2ZSVA 3HHRB 5KJRL 1TETL 1QR1B 2EDJA 5ESQB 4GRMA 1ZVSA 4IS6B 1S9YB 3UZVB 3V7AG 1WWCA 4G6AD 3E2HC 4HBCL 4P5TA 1KENL 3EO9H 4KRPD 4DK3A 5HHMB 1G7HB 5DC0A 2YN3A 4P46A 2K3TA 2VDRL 5TDNA 1ONQA 4R90H 3TC9A 4D0DB 1U8MB 2VXVH 5DVLA 3REVA 2IGFH 1GSMA 4RAVA 3HE6D 2BX5A 2DQEL 3CVIH 3NVQA 5ADOL 3L3JA 3UJTL 3WHE0 1UYWL 2XRAH 4S1RH 5TE4L 3AM8A 5FB8A 4HH8A 1QQDA 5HHOD 2DL2A 4EVNA 3SGJA 3TBYB 4XBGA 5I1EL 2OJEA 3DRTB 2A9MH 5E2UH 1ZLUK 3MYZA 4ZUVB 4FXKA 1FN4A 3QO1A 4K9EH 1ZT7A 4HWEH 5JDJA 4JZNA 2DICA 4L8SC 4XPAH 3QCVL 1JNLH 1OTSD 1QNZL 4FZEL 4L3EB 5EC2B 4WWKD 4BK5A 1NPUA 2EEBA 4CADB 1P5UA 1QSVA 2BNUA 2BY1A 1IGTA 1KCSH 3VFNB 3UTZA 3ARDC 4R2GB 3WIHH 1HSBB 3J8F7 5D93C 2W38A 3HPJB 1YY9C 3B9VA 3PQYB 2XQBL 3CJJA 4NKDB 3THML 1A6TB 4OI7A 1B3JA 4G6JH 1T3FA 3VWJC 3DRQB 4L4TB 5IKCB 2OX5A 1E28B 5DYOB 3CDCA 1DUZA 3MLWH 1MCEA 5GGVL 2R0WH 4TUJA 4GG6B 1FBIL 4P5MB 4N1CA 1JV5B 1NCDH 3LDBC 2X4QA 3RL2B 3AFLA 1NGQH 1H5BA 3KS0J 5EOTA 4R4ND 1CICB 4EBQL 5DJ6A 3QUXB 5E1AB 1IGIL 1A4KB 5F6IB 5SWSB 4OD2B 1E4XI 3QDMD 1LO0L 4M9PA 5K9KB 5I16B 2ATPB 5B4MD 1INQA 1KN2L 1F4AA 4P9ML 4UBDC 5FYJH 3GRWA 3VGEA 2P8MB 3ULVH 3DSFL 2FYYA 2Z91B 4PBXA 2WIIA 1T0MB 4JJ5B 4MA1C 2BCKB 2Y07H 4DKDC 4M43L 4Y4FB 4GJTB 5JW4N 4XBEH 1HH6B 4GMSH 2ADGB 5T5NG 3QNXB 1AXSB 2YPVH 4JFEB 4ZAKC 1CFBA 5I1IH 2B20A 3DUUA 5BQ7B 3TEUA 3Q6FB 5IROC 2WIIB 2F58H 3QUZB 4NO3A 2P5EA 1Q0YH 3O6FB 4MXWH 1KCKA 4UTAL 1UM5L 3UTPD 4OZ4A 2GQHA 5EN2A 2HTKD 5GRXG 2VZOA 3O81A 6FABH 4M62L 1PYWB 3TIEB 3I50H 3RY6A 5M95B 1CE1L 3RUGE 4HPYH 3QIUB 5D6DA 1FVDB 3LQZB 1NGYA 4Z5RA 4CVUA 2OMNA 3B6SA 4OFDA 1VERA 1S78D 2JJWA 5TJWK 5E0QA 5KTEH 4U6VH 4PRNA 5JORB 3C2SA 2DIJA 3MRGB 4M93C 1FSKB 4IOSD 2I5YL 5GZOD 3O2VH 2C5DC 3MRBA 5LQBL 1GGCH 2GAZA 1WLHA 2VLME 5I19H 1P7KB 2OXGA 1XMWA 3HR6A 4JY6B 2CUIA 4A6YB 2VXTH 5CUSL 5KN5A 1A3RH 4N68A 4QY8B 1UQSB 4EXPX 1MCJA 1A6VH 2PO6D 1JPFA 1QSED 2OTUB 5EZOL 4WJ5A 4LFHD 2IMMA 2GUOA 1SJHB 3KLDA 4NOFA 4D9RE 3M8OL 1GYAA 3VXUE 4KDWA 3MJ8B 2VE6B 5JMOC 1BEYL 5GGTA 3TA3B 5IFAH 1K4CB 4KXZH 1K8IB 1QBAA 4TULH 4HMDA 3VXMD 4PD4K 4P3DB 4F57H 3P4NB 4PG2C 5FUOH 4CVWA 5F1KC 4MAUH 3ZDZF 3QWRD 1F4YH 1UWXH 3LZFL 3UROR 1OAXH 4IIQC 1SMOA 1IAKB 4P59H 2DQDL 3GSUA 3K8MA 5F9DC 4WHTA 1JI2A 1X5ZA 4BFIA 1RMFH 3QHZL 5I73B 1MCCA 3PGFL 5GRJH 1OARH 4P4RB 1A6WL 4YXKL 1I8MB 2Y4SA 5DFVD 3HAEA 3SKJL 5KSVA 2CQVA 4X99B 1LILA 2AXGA 4X80H 4NQVA 1XF5B 2HMID 4U1KB 1HCVA 4DKEH 1NCAH 1DDHA 4PJEA 2DI8A 1UWGL 3IDJA 2VC2L 5IVOA 4LCWB 4MVBD 3WO4C 4R4FL 5KOVC 3A6BH 4RFOL 3EZJB 2DM3A 4FFZL 1I8KA 4P2QE 3W9DB 1U8MA 5F71A 2ERJB 1QOKA 4UT7H 5F7HA 2P7TB 4F8QA 2JIXD 5IKCA 2FR4B 2VC2H 3I3BA 4LCWD 3TCLB 5JO5A 1E6JH 4WHCA 1RZFL 1MI5D 2O5XL 4H1LG 2APFA 3CUPA 1W8NA 2FIKA 1MNUL 4UT7L 1HQ4A 1BFOB 1JGLL 2LABA 2R1YA 5IGXL 1X5LA 3A67L 3EUUA 5B8CA 2Y72A 2NZ9D 2EIEA 4IDLA 1OAQL 5F93C 1RJYA 5MP6H 1CWVA 4JB9L 3TO4B 1HI6B 2NXZB 4KU1A 3T4YB 3K4ZA 1CE6B 5BW7C 5I0DA 5A2FA 2OK0L 1FNSH 3O4LE 4BSWB 4XBGB 2VITA 4PJ5A 5HHPB 1PG7H 1GHFH 2NY1D 1T03H 2GSIB 4PJFF 3WYRA 2OR7A 1FVEA 4URTB 4HUWA 2NTFA 5C0JB 4D3CL 3DBXB 4NQCB 3IVKA 3TN0B 3KYAA 1UCBL 5A3IC 2QQNL 3SN6N 1OGAA 1V7MH 5IBLD 5IMOB 3I02A 3G6JF 2DBJA 5GGRA 3B2UC 4ZQKA 3EO0A 4I4WB 4U2YA 4GQPH 2MQ0A 3LS5L 4XP1L 1OAYL 3NAAL 3SY0B 5C6TL 2AI0H 5GRVK 1T4KB 1KLUB 1MJ7L 5I66A 3C5SA 2OBGA 4JFQA 3VFUB 1EDQA 3UJIL 3UTSB 1E4XL 1S8DA 3W9EB 2DL9A 4XZUA 3MXWL 1CS6A 2X9YA 5C08A 4DZ8B 1XF2A 3V7MA 2C1OB 1RY7B 1EAPB 4KK9C 3SY0A 3MZTA 4GBXA 4U6YA 4MLSA 1J05A 4MNQA 2ZZUT 1CT8A 4CDGC 1LO3L 2JJTC 5BXFB 1K6QH 1SBBA 5DJ0A 2A6JB 3UPRB 5FECA 5IVZB 5ILTL 4EUPG 3VGBA 4JR9H 5C09E 1XF3B 3BQUA 3HI6L 4F80A 3TZVC 4AZ8A 1TENA 3TESA 5IFAL 2I9TA 3FAWA 3BE1L 1UM5H 1FL3B 2CPCA 3TVMD 1U42A 1OGAD 1KN2H 1I1AA 3IDXL 3S35L 3OGOE 3MRRB 3O4OB 2AXHA 3P9WB 2LTQB 1SY6L 4K23H 5C86A 3ILQD 1EERB 1SMAA 5ELIA 3OTTA 3K81A 3OXSB 1QP1A 2CKBB 1QEWB 3BZFB 1MCWM 4KMQA 5BRZD 2LVEA 4E0RA 2MQ3A 4NN6C 4YXLL 1FNFA 4HKXB 4OF3A 5JIHA 1KN4H 5IP4A 3MNWB 4S0TD 3ECBB 3ZE1F 1P53A 2DQIH 5D8JL 3UTTD 5ACZA 1OB1A 3UZEA 1D5ZA 4I5BB 5KSAC 2J88L 3AGVA 3S96A 4O4YH 3SDAB 5CHNB 1HWHB 5L2KA 3PQYD 4EUPH 4YUEL 4DUWA 5HGGS 4P23D 1XCTB 4J8RA 4XNZC 5IMKA 2H3NB 3R1GL 2XQYG 1JGUL 2X4RB 5CCKH 1WJ3A 3GBNL 1BHGA 1XF5A 3RWEA 2Y07L 3DUSA 3ILQC 4MDJB 5E6IA 1X5JA 4YHKL 4FFZH 1UH3A 1OL0A 1Q8MA 1I8MA 3NACL 4OM1L 1F11A 1U8HA 3MRMA 4NKOA 2AQ3A 3GMNB 4NQEE 5JHDE 4C58B 4PRAA 5F1NB 1WC7A 4MWFA 1G9NC 3LS4L 4H0GA 4ZTOL 1I8LC 1H3UA 1V3JA 4QF1A 4LPYA 2UUDK 3V6OC 2PW1B 4AIZA 1FNEB 4ORGB 3U83A 4DN3L 2VR4A 4F37K 4ZXBB 2HJFB 2NW3A 1T5XB 2BSTA 2N7BA 5MEQA 3BRGC 1OM3H 1J12A 4L8DA 2DN7A 1LO4H 2AJXH 1JP5A 4JY5L 3RKDC 4M6NH 4GBXC 5CKGA 1IGCH 4MMZC 1FNHA 5IT2L 1NC2B 5IBTL 3SO5A 1B0GA 3DETD 3Q5YA 1CF8L 3MFFA 5HHMD 4ZUSA 4X6DA 1D6VL 3CVIL 4YE4L 3MLRH 5EOQL 3GSWA 3BMVA 2R2HB 4A6YA 4FP8H 3DHMA 1DUYB 4ODUB 4BUGA 1G7PA 1W0YT 3QZWA 1PG7X 1RUQL 3L1OL 3IU4L 3MFFB 2BVUA 2DQGL 1D6VH 2LU7A 5F7EL 5C92A 2JB5L 1MCOH 4PRNB 5LGJA 3B5TA 3PDOB 4KJPD 1FGNL 3RWDA 3SDYL 4DGVL 1AO7A 3KHOA 4BFGA 2OL3H 2UWEA 4HIHA 3MOQA 4MJ5A 5GS3A 5ICZB 1WF5A 4Z7QE 4BYHA 2VL4A 3SBWA 5I8KH 1MFCH 3QI9A 2W1NA 4PB0L 4U0QB 1F8TH 3IJYB 1E27B 3JVGC 4YHNA 3LZFH 5JR1L 5JUEL 1S7WB 2YD4A 1EFXA 1FG2A 2K1MA 1WTGT 5ISZE 1EFXB 1T22B 4IOFC 1JGEB 1WBZA 4OUUA 4XH2B 4DCQB 1KB9J 3O11B 4X6EB 3WN5B 3U9PH 1AY1H 2EKSA 4LLWA 4LGPB 4LDLB 1MQKL 2J6EA 3ROOA 5D7SH 1H3TA 1S7TA 3U4EB 4OQ1A 2IFGA 1M6OA 3T0DA 1AR1C 1G0XA 4NM8L 3ZTNH 1Z5LA 3O9WA 1JMZA 4M6MH 4PJDB 1ZHBA 4KTDL 4Z78A 1QSFD 5DQJA 4JGMA 4XCFH 1VPOH 1Q9OA 3K4AA 3ZE0F 3GIVB 2ITDB 2ZUXA 4PRDA 4U3HA 2WWKO 3O4LA 2YRPA 3PL6B 4MCYB 4JO4L 3FZUD 4KKBD 3SDCD 1MFAH 2E27H 2W0FA 4EIZC 4NFDA 4PJFA 4WENB 4YX2H 3IFLL 3JV4A 3IB4A 4XPFL 5CBEA 3WN5A 4NBYB 1T6WA 2IWGA 1F4WH 5EFIB 3VXMB 4JR9L 1A02N 4KGJA 4AMKL 4WI9A 4LK4A 5D6CA 2EDKA 5DQ9A 4OUUB 3TA3D 3L95A 3WS6A 3U9UB 4LLDA 3OKEA 1MFCL 1TQCC 2HTKC 5DQDL 3KLHD 2Q86B 3QULB 3PWLA 3GK8H 5I1IL 3V5DB 3FMGL 3TM6A 1CGUA 1RULH 1KBGH 3BDXA 1BZ9A 4E42A 3TIDA 4XC1H 3ZKXB 4OAWA 2F53A 1S7XA 4RGNB 1KEMH 4NKOB 1Z6JT 4LBEB 2AK1H 3OB0H 4YR6A 4Q9RH 2V6HA 2ZUQB 4P4KB 3LEXA 4PYGA 2NY4B 1TJGH 5J13C 4M7LL 3DUSB 1Q1JL 2NLJA 2CKNA 2XACC 4YWGH 4F7PB 2AJVL 1JHLL 2J12B 1XFPA 5C09A 3BIKA 1CD0A 4M4RA 3SGKC 3GMMB 2JCCA 2B1HL 4U3XA 3IFOB 4O02L 4NO0B 2IQ9H 4PGEA 3RJDA 4NQDD 1SBSH 5GSVB 2Z31A 3BKJH 2VABB 2Z4QA 3LY6A 4OD1L 4LRNH 4KY1H 4UIMA 1RIHH 2H9GA 1CDCA 3REVB 3PWUB 2Z35A 1AH1A 1KJ3L 2IAMC 3IGAA 2EDBA 3VFVA 4ZFOB 3TO2B 5KSBB 4YDKL 1NBZA 2C3HA 2BRRH 3M1BA 3V6OE 3OKOB 3AREC 4P9HH 5CGYC 4ZODA 3DVNA 3QEQA 5ILTH 3MRFA 2AV1B 4GRWF 1BLNA 4O51B 3QPXL 5DLML 4M6NL 1BFVL 3QEGH 5DR5L 4MHHI 5E6IB 3WE6B 2FJFA 4MA1B 1N59B 1A7NL 4OSUH 3PWJA 5IR1B 4TUKH 5IESH 5MENB 5F7KC 3MLXL 1OOAA 4QNPE 1R3HB 1OM3L 4Y5XC 4UDTB 3CDFA 4EXKA 4UT9L 5EG6C 3QI9D 1Q72L 4M1CD 2A2QT 4R26H 4F15B 4K94H 1CGVA 1XIWB 5L9DH 1T1WA 3F7VB 3OMZA 5C0ND 5FECB 3BZ4A 4Y19E 5DJ0B 3UC0H 2EDTA 4MQ7B 3S96B 4HG4K 1PY9A 4YHYC 1XGUA 3N1GC 4JPIA 1KTLA 1J5OL 1BD2A 1PAMA 3EO1B 3HZKA 4R2GD 3EO1A 4YBQC 4ODWB 3RNKA 3U0TA 3C09B 2R1XB 4G6KH 3V95A 1OWRM 4I0PA 5H2BB 4XNMB 5A2KH 3JWDC 1KLUA 3GI9H 5IUSA 1XF1A 1ZLWH 1RK1B 2Q87A 5D93B 3IKCB 3QQ9C 2E6JA 3MRRA 2CMRL 1UZ6E 1WEJL 3HZVA 4AEIL 3QO0B 2FX7L 1VCAA 1M71B 4JFFB 3FCTA 5I74B 3WE6A 1YMME 1T2JA 1M71A 4JFFA 1A7NH 1P4LB 4XP4L 4WIQA 4PJ5B 1ZLSH 5HHPA 2X4UA 3CSYB 4Y16A 2B5IC 3BP7A 5FYJD 4NT6A 4X7DC 1MJJA 4M8VA 1IL1A 4JANA 1I3UA 1QHPA 1GGIH 4Q9BA 2E9IA 5IBUG 3TJHC 4KRPB 4OZFH 3HAEH 2ZCLH 5KSBA 5C0BA 3HUJE 1I7TB 4MQSB 3S97C 2DDQH 3RZCC 3NAAH 4ODWA 3RNKB 3U0TB 1BOYA 3F58H 4NRYB 4TULL 3BWAB 1AGCA 2EDQA 3HMXL 3IF1B 4CVXB 2F8VA 2WAHA 3FL7A 5EOCH 1PLGH 4I4WA 4WJ5B 5D2LE 4FQ2L 1HK6A 1OAXL 5JO5B 5F3HB 2H32H 3TCLA 1ZLUH 2FECI 1J88A 4GAGL 5E95B 3H3BC 2P7TA 2VDNL 1RMFL 5DFVC 2XPGA 3I6LE 3VW3H 3EYQC 4OCRL 1EJOL 2OI9B 5I74C 2QQLH 3KPOA 3RU8L 3ARVA 1Y6MR 4RIRB 1EV2E 4G8IA 3IXTB 1KTDB 4U1NB 3WNLA 4LCWA 3GSOA 4PJIE 3G08B 3PL6D 4EOWL 1YYLH 1RUKL 3HB3D 4Z5RB 3AUVA 5KSVB 4FQXB 3WDJA 5IB5B 1V7NL 2QADC 4Y5YA 4PFEA 4UINH 2ILLA 4HHAA 4J2XA 1BFVH 4ONHA 3V6BR 3VXNB 5HHQA 4JM4H 3NBNA 5E5UB 2EDNA 1HHKA 2X70A 4KDTC 1RUAL 5C08E 1JNNL 1MOEA 3CZFA 2AEWA 3EOAB 3QT2A 1WZ1H 2HH0H 3P4NA 1CBVH 3H3PL 3M07A 1I9EA 1IEAA 3KPMA 3BP5B 3GSRA 3TA3A 4OM0L 1AXIB 3NCMA 4P0DA 4ELMF 4DKFL 5E8DH 4YHIA 3TN0C 3SE8H 3QIBA 1KT2B 4NO2A 3VA6A 4F15C 1TCMA 2ITDA 1YEIH 3V6ZB 3O8XB 3W5MA 4TTDD 3FFDA 4LVOC 1CFQB 4AQ1B 1RZKH 1JNLL 1MFDH 1JI1A 3HLAB 4PJ7A 2P42B 1EHLL 2YBRA 3DGCR 3T65A 2IBBA 3IDIA 3MRBB 4OUOA 5DZNA 5GS1C 5I1LA 2MCPH 4NQXA 2IPKA 3RWIB 5MI0B 3L7FB 5B38G 1CU4H 4K3JL 3STZA 3MRGA 4F7TB 5EWIH 1G7IB 2IANA 3DWTA 1JUFB 2Y6SD 1BF2A 2R0ZL 3QEGL 1ZEAH 5DR5H 3TIDB 3KYMA 3TNNA 5F96H 4XMKH 1CXFA 1U58A 3HB3C 4X4YA 3H9SA 3NH7L 1BREA 1A6TA 4ZXBC 5CBAA 4DZBA 3UEZA 5T1LB 3SQBA 5F9JA 2OR9H 1F6LL 1T20B 3LH2H 4UBDD 3FB8B 3ARWA 2HRPL 1K4CA 1S7UA 1IRAY 5DS8A 1KIQB 4U4BA 2PTTB 3QDJA 3VXTB 1RU9H 4K9EC 5EC2A 2FEDD 4IOFD 1S7QA 4JDVB 4PJGB 3GBLA 5EU5B 3UCRA 1TXKA 1CLZH 2D31B 4IRZL 3L3GB 4JFFD 2BVPA 1T0MA 1QSFB 4LIQL 3KJ4B 4M1GH 5F7FA 1JHLH 2KQMA 4M3JA 3I6KB 4HDIA 3PHQB 4MNGB 3T1WA 4N0FA 3VXSA 3FZUC 4KKBC 4KKAD 3W11C 2GAZB 3SQOL 5I18H 2YPLE 4JFHE 2PYFB 3HC0B 4XPHH 4YE4H 1P4BL 2IJ0C 3SPVA 2HFGL 1K4DB 3QUML 3RZCB 4P5TD 1R5WB 2D3VA 4HZAA 1CFSB 5ID1A 4HPOH 1N4XL 5GGQH 4P23B 4LLWB 5TE7H 3H3KA 1E4JA 1TMCB 1QBMH 2DWEB 3UP1A 3PG2A 5IIEB 4MJIE 5JDSA 1JGVL 1KPUA 3F7RA 3BKML 2P5EB 1INDL 4Z7UA 3BDYH 3OJDA 2W9EL 4KJYB 3S34H 2CJUL 3BH8A 3U30C 2UWEE 5FA3B 4PJHF 1I9IH 1LEGA 5CZXC 3W0WA 2D9QB 1U8JB 3U2SA 2BFVL 4XNXL 4JM2A 1ZLVK 1C5CL 5ADOH 1OAZL 4HUUA 4OF5A 1MY7A 4AL8L 3MRIB 5E6ID 3VH8B 1UZ8A 4DFHA 1S9WA 1FBIH 4J8RB 4WNQB 4PD4J 1BGXL 1G6VK 3ZTNL 3GJFH 2BVOB 1RZ7H 2D4FA 4S1QH 1IQDA 3D87B 2A9ML 4R8WH 4AEFA 3SDAA 4X7TB 5D7IB 4LU5L 1DEDA 4R97C 3EYUL 1HIML 3X3FL 1DBJH 2X9WA 4QRQA 1MELA 3U7WH 4JO4H 1C7SA 2FX9H 5J3HC 4EJ1C 2A83A 5EU7E 5FKAA 2XY2A 5KBNC 4JFPB 3O3UN 2KL6A 5SX4I 5I1HH 3D18A 3OR7B 4NOBA 4WW1A 3NZ8A 4X6DF 3PQYA 4NKDA 2BNQE 3JV5A 1SEQL 5IV2B 4JFYA 2P45B 1MHEA 4M8QB 2R8SH 4IRSA 4OZIB 2R4SL 1R3IH 3W2DL 1NEZA 1YDPA 3O6MH 3QHFL 3IRPX 3QDAA 4XI5D 5C0BB 3T0BA 4Z76B 2FHCA 5IW3A 1U8HB 3MRMB 4I0PD 2RFXA 2V17H 2VQTA 5A2JH 4IBLT 4HFWB 5I15L 5I2IA 1CDBA 4GSDL 4XPBL 3MR9A 4JANB 4HKBA 1J0HA 2BFVH 4KTEH 2ZG1A 1QR1A 2R56H 4HLZH 5HVHB 3MQIA 1NBVH 1YQVH 1MI5E 3MRDA 5JPMA 4POZD 3PP4L 2OP4L 4NJ9H 2X4UB 5E08L 4TVPD 2MOVA 3MBEB 1RPQA 1R6VA 3N1MC 4JKLA 5GZNC 4YHKH 1LE5B 3AAZB 1E6OH 3UTTB 4JQVC 2NY1B 3HZVB 4G7YL 2GK0A 2CR6A 2IAMB 3D3VA 4H25A 4PJIA 4WTXA 4F8TA 1AFVH 5D71L 1ZGLB 1CXLA 4DGVH 1RJZA 2XWJB 4PLJC 5EBGA 5DRXA 3DMMA 1RHHA 1WZKA 3C5SB 4QXTB 5FK9A 3JWDL 4XAWL 2VH5L 1QFHA 5MEPB 4K7PY 4XNMA 4HWBA 5D72L 2M26A 5ERWA 3SQOH 1BM3L 4PJBE 5I18L 1RIUL 4Y4KC 1VA9A 1OGAB 5HYIA 5FHBL 1CD1A 4JDTL 2DQEH 3NIGE 1DBBL 4N9OB 1UJ3C 1UYWH 2MMXA 2XRAL 3B9KD 2NX5E 3K4DA 4MQ7A 4P2RB 3VWKA 4GAJH 2J5LC 4UAOB 4Q9QL 3NGBB 4JKPL 5I71B 2HT4C 1VEPA 5HYJB 5F88A 3CFEA 2X4TA 3BX7C 5IQ9B 4BSWA 4HKZB 3MCLL 3BEVA 5B22A 5J56B 5KVDH 4R90L 2R23B 5HPMB 1VGKB 5IFHL 2PCPB 4WV1A 2Q8AL 4Z7NE 1A7PL 1I1FB 5HHOA 4G42B 4YPJA 3VFRB 1QVOB 4JAMA 4RMVA 2APTA 3MGOB 5FOBB 5IHBA 2WWMC 1X4YA 4X7SL 3EW3B 4I9WE 2XN9A 3STBA 2GYSA 1G7JB 4G6AC 1JL8A 2NXYD 3WV0A 1DQQA 1BBDL 3GRWL 2VDML 1QO3A 3HNVH 1HQ4B 1JZ6A 1FDLL 4P4KC 1FRGH 5EZIH 5E5RB 3DV6B 5C09D 4H20L 1F90H 4F7EA 5K9QI 4WUUA 1RU9L 1U3YA 5FXCH 4JHAH 5JXED 4NQCD 3GHEL 4H8WC 1NGPH 3RVXC 4NHCH 1KELL 1MIEL 1NAMB 5IB1B 5E99L 3WHXB 4ETQA 4WW1B 3RHWK 3LPWA 4K3DL 1ZGLA 3D25B 3DLQR 2E9BA 2Q7YA 1D5XA 5F44A 1HN1A 4PJAE 4XT1C 2D7QA 5IVXE 4AEHL 3BEWB 4XMLL 3D5OF 3TPUB 5GGSY 3N50A 4PGEB 1NC2D 2AXGB 5HI3D 2GSIA 4OQTH 5DJDB 4M7ZB 3RFZC 2PO6B 5E5MA 2FH6A 2EDDA 4P4RA 3F6LA 2XYCA 3CH8A 1ITBB 3VGHA 1BBJB 4IMKC 3K46A 2BVPB 3FQRA 2Y7QA 2J3SA 5GRUH 1T0NB 3TO4A 3LEXB 4MQXC 4OLXH 3BPNB 3PWPE 3V6FA 4KROD 3L5WA 4L3EE 1ZHKB 3MNVB 1T89A 4QRRE 1GZQB 1K8IA 5JXEA 1FYTB 4JEGB 2JIXB 4NPYB 3ZHDA 1IC5H 1KFAH 4WW2A 4PGBB 1P4IH 3QULA 5EUOF 3IKKA 5H37G 3BGAA 3P30L 4NN5B 2X1PA 3NZ8B 4L29B 4JO2L 5L6YH 4QYOA 4M03A 1ZANL 2IPTH 4LLDB 3AMLA 3MV7A 3ES6B 3VXMA 1KELH 1IAOA 1HZHL 2G9HA 3DUHA 4P23A 3JVGA 5JHDD 4TRPL 2IPTL 3HZMB 4NP4L 1N8ZA 4KZEL 4WTZG 5DT1H 5DJXB 3TVMC 3SDXE 3OKLB 1PX4A 2X4NA 2FHFA 1T03L 3O41A 3V0WH 1DQJA 1R3JB 2GTWB 4GLRH 5D5MB 4HFUH 5J57B 2GITA 5D1QB 3C09C 1Q9OB 4LNRA 5SWSD 1NGYB 3DTXA 2NZIA 1JK8B 1ACYL 2YHGA 3RAJH 3PJSA 2QL1A 4Q74A 3QRGL 4X4XA 1J86A 4MNHB 2X42A 1KULA 4YXHL 4ESKA 1R24A 3NA9H 4X80L 2I25N 1DZBA 4CMHB 2A9NL 2EIDA 2KZWA 3ET9F 1KV3A 2JF1A 5GS2D 1HNFA 1J5OH 4A6YL 4KJWC 4GFTB 1PX3A 2CH8A 3TPKA 2ESVE 4DGIL 4R6UA 1CIUA 1HHKB 2B1HH 1MREL 4NUJB 2KKQA 4I3SH 1NUFA 1ZT4B 1N6VA 5T1LA 3M8OH 3OJMB 3WLBA 4P2OD 4HF5L 1JK8A 1A4KA 5EIVA 3DXAB 5I9QC 2ADIA 3X13A 4KDVA 3MROA 4BZ1H 5L8KB 1JTOA 2GTWA 4G9DA 5D5MA 1DN0A 2HVKA 1U8PB 4I3RH 4H20H 4H0IA 5DD0L 1OAKH 5IVNA 4MNGA 4KY1L 2IADA 3QQ4B 3R4DA 4QT5A 2Z93A 1YEHL 3V8OA 2Q8BH 3MJGX 4DQOH 3CX2A 5D7JA 1DLHA 4OT1H 4OGYL 3IETA 2F5AH 3NCFB 2BRQA 4PJIF 5I1JH 5CZXD 1F4YL 3SO3B 2NY7H 1CZ8H 1KJVA 3DECA 4XP9H 2EYTA 2NZ9C 1FYTA 3TT3L 2VLJE 3GSRB 3DUUB 4U6HB 3OKYA 3CPLB 3L5XL 5FOJA 3QR2A 4FQJH 4MJ2A 1RIUH 3KPQA 4L4VD 1A6AA 1VFOA 2C3GA 4MZ3A 1AXTH 2D9CA 5LCVH 5MHSE 4GMSL 3H9SB 1N7MH 1JRHI 3FQRB 4L8BA 1NDMA 2YC1B 2XZQH 8FABB 4ZUVA 1QBLH 2P8MA 3RRQA 3QJFA 1NJ9B 4Q9QH 2CR3A 1KB5B 3MRCB 3S8WA 3MBXL 1XCQB 4QOKB 3S7GA 5SWSA 1TVHA 3QIUC 5TDOA 3ARGA 4X98B 1KIUA 1OT2A 2YD9A 3LEVH 4JE4B 1AY1L 3FT4A 5JOPD 2V7HA 3VDAA 4M93B 2Q7NA 4X4ZA 4U1JA 4PJAA 4NQEA 1HHIA 4N0CD 5IF0B 3MUY1 4XVTH 3IKCA 1RFDH 1KT2A 4NO2B 4YHZH 2QSTA 4JG1L 2W0KA 5E03A 1IZKA 3S34L 5IJVA 5DFTA 4S1QL 1IKNA 1TTUA 1BJ8A 2YPKB 1MI5B 5K59F 4NQUA 1AD0A 3GZKA 2V9QA 4RISH 3S4SG 4M5ZH 2AJZA 4WWKB 5I76A 4QYOB 1XGTA 4NC0B 1KNOA 3K2UL 2ADJA 4HIEA 4P5TB 2UZIH 1FPTL 1KJ2L 5BJTA 4J7RA 1X6LA 3K8KA 4ONOA 5GGSA 5LBSL 3NTCL 1PD6A 1TTGA 3ME0A 2EIZB 5E8PA 4WFGD 4GG8B 3UTZB 5EUKB 2DMKA 4HKXA 3INUL 5EO9B 3FFCD 3QAZC 2X44D 4G8GB 1K8DA 2DYPA 2XG4A 1TJHH 2YKLL 4HUNB 3G04A 3TNMA 5KVFH 4FTVA 4PREB 1WBXA 3MRQB 1UENA 4NJAH 5JQHC 1QVOA 3L3KB 2CRZA 4KUZL 1A6UH 1QNZH 1T1WB 3F7VA 3VJ6A 5C8JB 4QHLA 4MAYB 2XTJB 5FYJL 5H94B 1KPRB 1C16A 1GOGA 1IT9H 3KPSE 3O0RL 1KBGL 2V2WA 4JRYD 3HFML 3KPNA 4V1DB 1HIMH 3QUXC 5F7NC 3X3FH 2WUCH 1MCWW 4YDVB 3OV6A 4PG9B 1KEML 3X11B 1MVUA 5BS0A 3UBXA 2MCG1 1VFMA 4GRLC 1NDGA 3MV9D 4HC1A 2O5ZL 3C60D 2HKHH 1EUTA 4RDQG 4FQQA 5F1IA 4PLJD 5DDHB 5SWQB 1J87A 4LHUG 5GZND 2Z31C 1OVZA 4XVUC 1U8NB 5C2BH 2AK4D 5IMMB 5GJSH 5HDQH 1TDQA 3FB6A 4TOYL 3GI8L 3Q6GL 5D7JC 1PEWA 4RGND 5BS0E 4O2EA 1S9XA 3BRFA 5FYLL 4UUJB 2FX9L 1UACL 4X6BB 2W9LA 4KKNA 3EZ8A 4LLVA 2IG2H 4KVCH 1T04B 3SJVE 4CUCA 2OXHA 3EYVB 2NYYC 3BIAX 1MFBL 3DV6A 3GEWB 4ERSH 5D1ZD 4Q0XH 1YECL 2VWEE 1MRCH 3RWJB 4OB5H 4PJXB 5JOEA 2DQTL 4MAYC 4R4BA 3EDDA 3UTTA 1AQDB 2CLVA 4F3FA 3EO0B 4M1DL 1BFTA 4J3WA 3QHFH 1T7WA 5E1HB 5F97E 3BH9A 3MBEA 3CH1A 3DX8B 2HFEB 1X7QB 4K7FA 1NAKH 3HN3A 5L2KD 4NN7C 4WV1B 3OKKB 3QXAB 1M7DA 1NGWB 2DKMA 4PJ9C 3SKMA 3C6LA 2YZ8A 5CEZD 3GJEA 4XNUH 4BQ6A 2R1WB 5DSCA 3MXVH 1SJEA 5DJ8A 4PTUA 4EI5B 5C3TA 5HYJA 3NFNB 2HLFC 2M8XA 4UU9B 2A0LC 3BFOA 4TSAH 4XTRD 5FYKE 4ODXA 2NY2C 1S7XB 5LCVL 1RURH 2PXYD 4FZEH 3P0VL 4OLUL 2ZOKB 1P7QA 4DQOL 4C83A 1MFEL 1H8SA 5E94B 4E41B 3SEPA 4KRNA 3LIZH 3WIFA 4R0LA 3GBNH 1PQZB 4LF3A 1ORQA 1JCKA 1DP0A 3MLSH 4ZAKA 5GS1B 2VDRH 1F45A 2IH1A 2XKUA 4YHLH 2GSGB 1ND0A 3GMLA 3HG1E 5ICXA 3QDMB 4IIQB 4JFEE 4ZG1A 4GBXD 4K94C 2IALA 2X89A 1G6RB 4YUEH 2WANA 4ZOAA 4CMMA 1DE4B 1KCUH 3VGGA 5DJCB 5EZLB 3ZO0A 2EC9T 4D9QD 2ICEA 1FH5L 3KYNB 3WJJA 3QIWC 1RUPL 3O4LB 3KJ6H 3U0WH 1EUUA 1JN6B 3UXFA 4PJ8D 1YUHA 3MNZB 5HDBE 3MGAA 4FOMA 2A6DB 1MHCA 2DQUH 4I77H 3MLVL 1XH3A 4HUUB 3UTOA 4KWUA 3MFGB 4PGCB 3WFCL 4QLRA 2EO1A 2ZOLA 3GMPA 5ESVB 5GGQL 4N0UA 1H3XA 5TE6H 5C0DA 1CDHA 2Q6WB 4JVWA 3U7WL 4XXCA 2IAND 1I9RL 2LTQC 2ZUUA 4LLUA 1A6ZA 2N1KA 3I6LD 4ZUTB 3ZYJA 5DRZB 4XPHL 4BK4A 3UAJD 3ZE0E 4HC1H 2F8OA 5GXBB 5FUZL 5EWIL 1GGIL 4ZXBD 1BIIA 3H8NA 2VDNH 2ADFL 4ZFGL 2A6IA 1DTUA 2L0DA 5LXGL 3E3QE 5CILH 1V3MA 2AKRA 2FHBA 4JHWL 1EO5A 5IG7A 1H9VA 5CEZL 3LKPA 4U6XA 1F5WA 3TYGH 4ZDHB 1K5NB 5LGKA 3L6FB 2OR9L 4ODHH 1BQHG 4U1GC 2Z31B 3G6DH 2RHEA 3VXRA 3MACL 1X5HA 4Y0GA 2WBJB 4PJDE 2UVFA 5KSAD 3OXRB 5LBSH 1IFHH 3EDEA 5FV2A 1D6EB 3GMRB 1LK2A 4JY6A 1N2RB 2OTPA 3MPCA 2NX5B 1NBYA 3BPNC 1VKXA 5EU4B 2Q1EA 3T3MF 3CCHB 2WBJA 1WUNT 4OCYL 3N1QC 1R0AH 3UJJH 4Z7WA 2JLLA 3PDDA 1FYTE 1JNNH 4PJDA 4C57C 3OAUH 3B3IA 4QRRB 5ACLA 5KSUA 1NUGA 5A2IH 4ODVL 5I8EA 1V3KA 4GRWB 5DMGC 3UX9B 1PYWA 3TIEA 2GK2A 2JB6A 5F9JB 3O11A 2E7HA 7FABH 1FNEA 1U6AL 4PJ9A 3WIIH 2VQUA 3LMJL 1U91B 1JWSB 1BPVA 4ZPVB 5JTWA 5IM7B 4OZGB 1JWSA 1JWUB 5DQ9B 2GFBB 3QNZA 4PBWD 5MEND 1AP2B 4PRAB 3ARUA 5TGBA 4L4JA 5GGTH 3VXRD 2P46B 3OAZH 1FFQA 1V7ML 2PR4L 4ZD3L 4HIHB 1OTTD 1U8IA 4MJ5B 5ICZA 4HFUL 4LRIA 3SKJH 4LHUA 4P2YA 4UV7L 3ULSA 2FYYB 3T65B 4GAGH 5I1KH 1JHTA 4F9PA 3DNKA 2BHUA 3SPVB 3Q0HA 3N9GL 3QRGH 1EA9C 4KPHL 3FT3A 2F74B 2VDPH 4H26A 3QQ3B 1T2QH 5FCUH 5MERA 1IEHA 2BVQB 5IK3B 4KROC 2ZUTA 1M6OB 4LOUC 25C8L 4LPTA 1IILE 1W72H 4LVNC 2YRLA 3ARXA 3ROOB 5L6YL 1KLGB 4OBSA 3QWQB 1K85A 4P5MA 4JFFE 5JIPA 1QLEH 1CDIA 3TBSB 4CKVX 4PJEF 4UDUA 3KYKL 1Q9WB 2IALB 2XI9A 4HS6B 4X5XB 43C9A 3OF6D 5KANG 2FL5B 3VFOB 3QXWA 4Y1AD 1U95A 4GS7B 4JZOB 3N1PC 3T0ED 1RIVH 3VWJD 1ZS8A 4MS8C 3DARA 3UTSD 5I9QB 4C56A 1IGMH 5EOCL 3ZKMD 4KKCD 3W82A 3DVIA 3UC0L 3FN0H 1DFBH 2Z9TA 4M6AA 5KVMC 4CADA 2ZOKA 4ODSH 1CLYL 1NCAL 1LEIB 3EOYG 4WUUE 4MAUL 3SGDI 5F70A 5IJKC 5INDA 2IPKB 2EDFA 4KJQC 4DTGH 3IDIB 4KHXL 4GUPB 1U3HA 1UXWB 4PJHE 3L7EA 4KI1A 4E9LA 1GXEA 2XZAL 3VGFA 1EO8L 4ZNEE 5EPMB 5FA4A 3NCYP 5J8OA 3VRIA 1B0GB 4NNXA 1XGRA 1UG9A 3BAEL 2H8PA 1HKLL 1QRND 2YD8A 3KYOB 4NQSA 5K9JH 4U1LB 4GS7C 1WWAX 1XZ0B 5DF0A 2Q3AA 4UT9H 3T09A 3SDXB 3PGDA 4KKLC 5GHWH 5E9DD 1OAQH 3UTSA 3RZWA 3MOAL 1YEFL 4BKLB 4WHYH 3MLVH 4RWYL 1Q9LA 1T5WA 2ZG2A 3CFJB 1AFVL 3WFCH 2Q20A 5FFLA 3RP1A 2NNAB 4U7SA 5CS7A 1RIVL 3WFHB 4N5UA 2F53E 2YSSA 4Y4HC 4LSSH 3L3DA 5J12C 1SY6A 3HNVL 1FO0A 3E1F1 5DHVH 4BQBA 2P5WB 1VSCA 4MDJA 2C4FT 4KZDH 2EYSA 3B8SA 1FJ1A 5BMFH 5ITBL 5J1AB 1NDGB 4KK6C 3VXPB 3OBAA 1C5CH 2WUBL 2BNQD 4LCCB 4XBEL 3KNBB 1ZGLP 1AO7D 5IMKB 5HD8C 5D7JD 1C08A 2VXQH 4RIRA 2BJMH 2AJYH 4TSCL 2V2WB 3HNTH 3VFWA 4UT6L 2P5WA 1DJSA 2HWZL 3BDBA 1CLOH 1MPAH 1Q0YL 1HOCB 4JO3L 1R5VA 1LE9A 2DQCL 4TPRL 3MCKA 1JZ2A 4M62H 3HS0B 4OZFB 2DTSA 2W65A 3MA7A 3MX0A 4X5WA 4YHMH 3ZYZA 2PO6C 2GCYA 2PUQT 5HGDB 3MC0A 5HHNB 2NXYC 4K3EL 1P2CB 3OX8A 3ULVC 1IC4L 5LG1A 3EJJX 4KK5C 4E0RB 1IT9L 5ALBL 2H2PD 1QSEE 1MCOL 5IMLA 3ULUF 4OFKA 3Q48A 4F37F 3DSFH 4FN0A 1U8KA 4PJ9D 2R15A 1CGTA 2AQ1A 1MCPH 5JW3H 1I8KB 2E7CA 1CXHA 1DANU 3OPZH 3W9DA 2X1OA 3S88L 1NLBL 3D39E 4YEFA 2AK1L 1VEMA 3L3HA 4Z95H 4D0BB 4OB5L 3ZE2E 5IEKB 4IMLA 5IJKA 2A0LD 1U8NA 4BFBD 3MA9L 5C9JA 1VPOL 4I18A 2V7HB 4U1KA 1FVEB 3BKYL 4NNYA 4YDLB 4M61A 5FYLD 3RVUC 3QDGA 5J3HD 5DQDH 5IVZA 3DOSA 1PVHA 5T3XL 1UGNA 4Y89A 3TBVB 1NJ9A 3BXNA 3BJ91 3DVNB 4N0CC 1EVTC 2HVJB 1QUNA 4F9LA 1J05B 4MNQB 1A8JH 4NZTH 3BKCL 2NX5D 2XV6B 4OZHA 3L3KA 4GW1A 4K94L 3OR6A 4BKLA 1B6UA 2O93L 2LE9A 3SGEH 3O6LL 4DVRL 3VD9A 2EIZA 3BZEA 4Y2OA 3C6LC 4WVRA 5I66B 5E8EB 5CD3B 5HHNA 3KLAA 3ARGD 3IETB 4HIEB 1D7FA 1MEXL 1EXUB 1H15B 4KK5D 2E7LA 2BP3A 4HIJB 2ZUQC 1R3IL 2APXA 3ORJA 3W2DH 4N9GB 4ISVA 4KQ4L 4XB8A 2DLTA 1FC1A 3JXAA 5DMKA 2OSLB 5D7KD 4LQFH 5C0JA 3MV11 5FHBH 3BN9D 4M7LH 4EI5C 1WIUA 4L5FL 1DQTA 3QQ3A 3QG6B 1U8QA 5JOFB 3ZMRA 1C08B 4YDJB 3FT3B 3P11H 5DEGB 3S35X 1AE6H 4P5TC 1F58H 1IGJA 2IG2L 3AXLB 4KVCL 4WRLA 1NAML 3CFDB 2ED8A 3G5XB 1RULL 1MCDA 4IRZH 5GS0D 1MIML 1NC4A 3L5JA 5I1DA 4HEPG 2ZJSL 3C60C 4JZJB 5JLZB 4PBVC 1XGPA 5TQ0L 3QUYD 1IC1A 4UMGA 4LRNL 1JJUA 3MRFB 4YHPA 2J6EL 5KAQF 1YEGH 2WBKA 5IHUH 1HH9B 4L4TD 1U36A 3H42L 1OW0A 5E56A 2HN7B 4ZPVA 1LO4L 1SEQH 2KUTA 2N56A 4Y5XA 2FIRT 3RA7L 2FGWL 4WO4D 4EN3C 4XPAL 1G7LA 2ADGA 2EKJA 4YZFE 2ORBH 3AM8C 5E6YA 2HJLB 5BOPA 5BVPH 2CUHA 4L9LB 2ESVA 2CKBL 4GRLB 1NCCH 5DD3L 3T3ME 3QIWB 2NW2A 4XX1G 3WIHL 2Z91A 4HCRL 1AR2A 4UIMB 3C9NA 5C0BE 5CJBA 2FR4A 5EOQH 5I15H 5JW4M 2VABA 4DAGH 4XNYH 4QRPE 1CDYA 3PJSB 2ATPA 3PWPD 1DLHB 3D85A 3BW9A 1NLDH 1HYSD 3RTQD 4W4NA 5EPMA 3BPLB 2ZP0T 1OQOA 1S3KH 3KPRA 1L9NA 5DURB 1FGNH 1Z5LB 4FTVE 5C07A 3BQUC 2NY0C 5FO7A 1N7ML 4PV9A 3V5KB 1RFDL 5TF1L 3P77A 4BH7A 3NCYS 4ZYKB 5I1GH 5E8OB 4G9DB 3TV3L 1ZWIA 4N8CL 1SJVA 2QJDA 3GNMH 2LAAA 3TT3H 5CJ5A 1ORSA 2HFFB 4BQ8A 4PS4H 4U49A 3LPGA 5GIRA 4M7LT 1NCNA 2LFGA 1CR9L 3RX8A 3OPZL 4UQ2A 4PB9L 3OKMA 4NCC2 1CLZL 2X4OA 1J8HB 4IRSC 4YBLB 3UBXG 1OGAE 2WSKA 2BOCB 4Y19B 1QBML 32C2B 5T5NF 3JZ7A 4G6FB 1UFUA 2WBJC 4MMXC 2I07B 1ZHLA 2WP3T 2ITCA 1BD2E 3MJ6A 3CXDH 3FTGA 4LLQA 3TZVB 3MGTA 1JNHA 1G7MA 4FQJL 2ZOLB 5IW1A 2VDQL 2G5BA 5BV7L 5KN5B 5L7XH 2O5YH 4KKAC 1INQB 1MJ7H 5D96B 4A2MA 3BO8B 2ZNWA 3UTTE 2ARWA 5MERB 2FRGP 1EJOH 3G6JA 3SKOA 5DJ6B 3WFBH 5EOTB 1YEKL 1AQKL 1N0XH 3OGCB 5C3LD 1TQBB 2AK4B 1ETZA 1PLGL 1Z0MA 1FVDA 3QIUA 4ZNCD 2EKSB 4O2FA 2MWCA 3PIQB 1IAOB 3S5LA 4OZ4B 1LEKB 2NY6C 1BIIB 3RAJL 4Y1AB 4G5ZH 3V5HA 1WT5C 1KYOJ 2GSGA 3FRPA 4HBCH 5E8NB 5T1DL 4JRYB 3F58L 2A73B 2IH1B 1G6RL 2AJUL 4YHNB 4TNWK 4NDMB 1A3QA 2XTJD 4YHPB 3CLFH 3S37X 2FATH 3O3BA 4R0LB 3G5VA 4LSPH 4Z7VF 4KZDL 1WWBX 1LO3H 2EE9A 5HI3C 4JCMA 3E8UL 3RWEB 5DVKA 1WFOA 2CIKB 5EZJA 3HCVB 5IEHB 1I1FA 1UH4A 2Y7QB 2APVA 5DSCB 3CFKA 5E2TL 4M3KB 3QUXA 3DXAE 1JN6A 3V4VL 4ODUA 1ZA3A 2NY3D 1ROWA 3CFBA 4LVNB 1NCTA 3QHZH 5IW6A 3HMXH 5J1SC 1X7QA 3S35H 3CDGA 2PKDA 4FQ2H 1FIGH 2NCMA 2X4QB 5GGUB 3SBWC 3KHQA 5B38B 4HIJA 2BY2A 3T2OA 2HTLC 3VXRB 1FNGA 3KDMA 1DUZB 3KPLB 3ARBA 1AI1H 4MQXD 1EAJA 2ZUVA 2BNRE 1UWGH 3FRUB 3VW3L 1AKJB 2E9JA 3RWJA 1ND0B 3ARED 5DK0A 3D0LA 5K93A 3U6RB 3HI5H 1LDPL 3QA3B 5T1MA 5IBUB 1U92B 2C4FU 2P4AB 4YGVB 3GSQB 3KPTA 5JOPE 4DVBA 4LDEB 2VLRD 1PQZA 1XGQA 1IKNC 1RHHB 2P8LA 4WUUB 3T0XA 2FJGA 1S9XB 4G6FD 1G9NH 5F9WB 4W68A 1P7QB 4L1HA 4LLUB 3CD4A 4W70A 4ZPTA 3U36A 1LDPH 4UQ3B 3WNOA 5D5ME 1HZHH 5CEYB 3PV6A 3D3VB 2ATKA 3VG9C 1CCZA 4LNVA 1ZSDA 4JRXD 2GIYA 4PTUB 3WDIA 2VDLH 4I48A 4R4FH 3VGAC 1FL5A 1LE5A 1HSAB 3EYFB 4Q9RL 3LN4B 4LVHC 4I0KA 4XC3L 4MXQD 1BOGB 3L3OA 5C2UB 1NFKA 1L9MA 1KGCE 1BOGA 3NCCB 3ALXA 15C8L 3MLUH 3LV3A 4OFPA 4WFGE 1CU4L 4K3JH 2FJHB 3V52L 4B53A 1JF1A 2DWDB 3I84A 5INCA 2AJ3A 1BX2A 5CSGA 1PSKH 1U93B 3IAPA 2EZ0D 4DZ8A 3ULVD 1XF2B 3QDJE 1DBAH 4UQ3A 1J9CT 4XZUB 4GW4A 1K8DB 2H6PA 5JPNA 4OQTL 3ZT7A 4LLAA 5AZEH 5EUKA 1T7XA 3T1FB 3PWPA 5ACZB 1J0ZA 3D2UA 1MCKA 3W0WE 2W0PA 4OFIA 3TA3C 1QLRB 4KAQL 1CICD 3H0TA 2ICWA 1LD9A 3HG1A 5GRUL 2L7JA 2VL5A 4P2OB 3FRUA 3TN0A 4NQCA 3S36H 3FHQA 1UKQA 3RVXD 2B39A 3B9KC 1RJZB 2XWJA 4HT1H 3I2CH 4FG6C 4FQQB 5DUMH 4PY8J 1TQBC 2XXCB 5LAXA 3VXUB 4NM4L 1ZLSL 1EK3A 3MV7E 1I1AB 3QPXH 3U4AA 3NABL 5FO8B 2GJ6B 1WIPA 2P49B 4NHCL 4YPGB 1AKJD 1FLRH 4R96A 4S10A 3PL6C 4PJ8B 1YQ2A 3T77B 5INCB 2I9TB 1PKQA 1JZ3A 3DV4A 3RGVD 3ZDYE 4K71C 5F72S 5TQ2L 4OCYH 1FH5H 1XF3A 1GGCL 2R69L 3NIFE 3ZKQD 4QTHB 5IEHA 1MLBB 3B5GA 2VDMH 3MLXH 4R7NA 3EYSH 1T1ZB 3CXDL 3KXFB 2XKNB 3UDWA 3FMGH 3Q3GB 4HV8B 1NBQA 4X6CF 3G04B 4K3GA 1OP3K 1VFAB 3BP6A 3FN9A 1J1PL 4OCXH 3UTQA 3RX5A 1QACA 2IBZY 1CFTA 5DUBB 5DD5L 2WINB 3CPLA 1CICC 2CGRH 4KI5E 5C0RH 1NCWL 4O9HL 4XCYA 4GXUN 4PLNC 1JF5A 3ARDA 5JHDB 1XGQB 1MHEB 3MLWL 5GGVH 3KLHC 5HGAB 3DI2B 4D9LH 3HI1A 4UUJA 4MA8H 4UOW1 1B2WL 4JPVH 3EIFA 5FYKD 2EH8L 2VKWA 3LQAH 4Y4KB 5ID1B 4M43H 1AKJA 4NN6B 3HE6B 3NPSB 4PJEE 2V17L 2WWKT 3L7EB 2DBLL 1C1EH 1MWAA 4TOYH 1U6AH 4HJ0D 3WIIL 4MLIA 2Y23A 3A6CH 5GGUA 1KJ3H 1LO0H 1IM9B 4OLZL 3VD7A 2ICWI 5I8OH 4JRXB 4Y16C 1O7VA 4LSVH 3D3VD 1WISA 3K7UA 3WJJC 4FFWC 3VG0L 3VXSD 4G7VH 1ED3A 1GC1L 4FQ1L 1EEYA 2ARJB 3LEYL 4WHYG 2ADIB 3TZVA 1MHHA 4FXLA 4TNVF 4JN1H 3ROLA 4AM0B 2ITCB 5CGTA 3VE0A 4AL8H 1A6AB 4RQQB 4MX7B 4KV5E 4J6RL 1U8JA 3HMWH 3AREB 3I75A 3QP3A 4N90D 4X7SH 4XI5C 3P3YA 3GGWB 1NMAL 5DS8B 5E8PB 1LEGB 4X8XA 4OV6F 5ALCH 1AGBA 1MH5A 2CDFA 2SEBB 3DI3B 3QXVA 4HUXB 1XR9A 2VDOL 4XXCC 2EXYC 4Z7UF 5DVNA 4QRSB 1S9VA 4GAYA 5BV7B 1F3JA 3AS1A 1WWWX 4Y19D 2VJXA 5DEFA 2VZSA 3V5HB 2DMCA 4KMTH 5C7XH 5JDSB 4X4XB 1J8HD 5HVHC 1IM9D 3LVEA 2IADB 3PIQA 2BVQA 5IK3A 1S7VB 2IANE 3DTXB 3MLTA 4QHMA 3RPIA 1C5DB 5HGBA 4U1JB 3IDJB 4PRHB 5FUOL 1A3LH 1KJMA 3GSNH 5EUOE 5JW5A 4L5FH 2NXYB 4HPYL 1RK0A 2NY1C 3O2DL 5CD5C 1S7VA 4YFDB 5AD0B 5AWNH 5TFSL 3VWKD 4JY4A 1KOAA 4XGZA 3O6FA 3FQTA 4DN3H 5GRYA 3LEYH 1CD9B 1OD9A 1FZOA 2CDGB 1F42A 5FCSH 4NZRH 1P9MC 4OF7A 1KCLA 1YEJH 1BMGA 4MNQE 4M00A 5CUSH 4QXUL 4OBRA 5FYKU 4MHHG 1R3KA 1YN7B 4LPWA 5I1AA 32C2A 4XXDB 1A1MB 5FYJE 3G5ZB 3WO4B 1O0VA 4Y7MA 4ONHB 3VXNA 1YPZF 2HG5B 4XMPL 1FLTX 3GB7A 1ZV5A 1F58L 3MMEB 3MLZH 2I60L 4GMTH 4KK9D 3DSNA 1JTPA 2V7NA 1LWRA 2YEZA 2CLRB 3ELAT 5I1DB 1ORSB 2HFFA 1T80A 3QUZC 4OLVH 1I1AD 3VI4E 1GOHA 3QQ4A 4QT5B 3DGGA 4G43A 5EORH 4BH7B 1YEHH 2EDWA 3T8XB 5FYJU 1CF8H 1G1CA 3MA9H 4NQXB 3TZVD 5DJDA 2AABL 1X4ZA 4LDOB 4QHMB 1SBSL 3HZMA 5DD5H 5TE7L 4KI5F 4UOW0 3VWKC 5C07B 2IFFL 1L6XA 5D70L 5B3JF 4APQB 2GT9B 5DEZA 4CN1A 3E6HA 3MV7B 1JRHH 3ARQA 3MROB 5EH1A 2FECL 5I1HL 4JFDD 5FM4A 2CJUH 3HPJA 2OZ4A 1MH5B 3WFDH 1IC4H 4HWZA 2FEEL 1FAIH 3UZQA 1IGTB 4HWNA 4ZUTA 4JPWL 2D0HA 4G8EA 4LIQE 3S37H 4L9LA 2AEQH 1TJHL 2HJKB 1WTLA 4FQCH 4HLZG 4O9HH 1I7RA 4U1SB 4XBPB 2J1KA 1DBKL 5JUEH 4M5ZL 4Y5XB 3BP6B 1MHHB 4X9HA 4J4PA 5HHQB 2B1AH 4WU7A 3VWJB 1ED3B 1JFQL 1VFBA 4HAFA 5ADPL 4RX4A 3BP7B 5T3XD 5C08D 2CLZA 1I1YB 4G6ML 5IB5A 3C8HA 3EGSA 2A6DA 1Z9MA 1QQDB 3O6KH 3VMNA 2EDEA 4NKIL 1CGXA 1CLOL 1D5IL 3FQNB 4YHZL 5GQBA 1PKQB 2XICA 4O2CA 3TPUA 4AIOA 3ZDZE 4IMLB 3P4LA 4U1NA 5GJSL 5HDQL 4PJGE 4ZO6A 4OCWL 4YO0B 5HGHA 1W2KT 4PJBF 1CL7L 5J06A 3D25A 1T7VA 1VGEL 5J13B 1GGBL 2DAVA 2DIAA 3DX9B 4OCXL 1KB9K 5FV1L 1HWGB 4IIQA 3NPZB 4MXVF 5BCAA 4OZGE 4HPOL 4LCIL 2BHZA 4NYLB 1S9VB 4GAYB 4OLZH 4HZLA 2BDNH 3CMOL 3ULUH 4AENA 3LRGA 5FF6A 4ZAKB 3S9DB 3BWAA 5FK9B 3QFJE 4WU5A 2KZ1B 4QNPF 1JBJA 2EXWD 4PV8A 3SCMA 4ZAKD 1YNKH 1I1CA 2XN9B 4FRWA 4WTZA 3P9LA 3PNWA 4GW4B 3LSOA 3FB5B 3WS6C 4JN1L 3CXHJ 4NZTL 1AR1D 3SJVB 4HWBH 2NY3B 3G5YB 5M94B 3VFRA 3W5NA 2DBLH 4JY5H 5HSFA 1YPZA 1XIWA 3I6GA 2GY7B 1ZT7B 2UYLB 3P4OB 5D1QD 4FQHB 3UYOD 3KS0H 1G9NL 3C6LB 1DFBL 4WEMB 3DV4B 3NA9L 4NT6B 1A4JA 2D4DA 3QH3B 3F62A 1T83A 2FBJL 4LOUD 1M1SA 5CIPH 5JNYB 4EVNB 3JWNC 2R29H 3CH1B 5DTFA 3SKUD 5F3BA 5DWUH 4AJ0A 3FHAA 2BY0A 2X4PB 4LLYB 1NLBH 3MRLA 5FUCE 3CX5J 1RSFA 3BPCB 3GIZL 4R2GC 1YEFH 4WI2A 4O51A 4X7CC 2XWBA 3FO2B 4LSPL 2ICWB 4OLWH 1PG7W 5ERWB 2VQ1B 3SOBH 5CWSA 4BZ1L 3OKOA 3HI1B 1N26A 4S1SH 5C0AB 1I85A 3QWOB 4OGXL 1V8HA 5C0AA 3MREA 1EHXA 4XX1E 5L88L 3PGCA 1FFRA 1I4FB 1JYWA 1A5FH 1AO7E 2E6PA 5DUBA 1U9KA 1YNTA 1SEBA 4LQ1A 1XZ0A 1P2CA 2ICES 2C3WA 5E7BA 3UTQB 3IXAB 4PJ7F 4GKNB 1A6PA 4X8JB 4MJID 2GCYB 4RFOH 2WW8A 1EO8H 4QTIH 4ELKA 3MRLB 1IEBA 4BZ2H 2FZ3A 1XGRB 3UYPA 3VCLA 1JYNA 3V4UH 2LQRA 1T1ZA 3IJSA 1MWAH 2FB4L 4Q58C