5I75C

X-ray structure of the ts3 human serotonin transporter complexed with s-citalopram at the central site and br-citalopram at the allosteric site
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 40
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i75C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i75C01
3CH1B 1WF5A 2DICA 1F8TL 5EO1A 4F7EA 3MMEA 4QCIA 5FA3A 3TZVD 2GK0A 3BPLC 1R6VA 1MRDL 2J6EH 2XPGA 1QVOB 1DQML 3RWDA 1J8HD 2X4RA 4APQC 3DTXA 1DL7L 4Z8FL 1HYSD 3MZGB 2R56L 3RU8L 4RSVA 1JV5B 4HGMA 1CWVA 5F9AC 2YPVH 5DHVH 2EDYA 3VXTA 1VFBB 4K3EL 3JWOC 4LRIC 4QRQB 1JYWA 4R8WL 5CGTA 3QJFB 4G6FB 2E7LA 3L5WA 4OZFH 5HD8C 2DMKA 4HCRL 1F4AA 3Q5OA 4JHAH 2ESVB 2A9ML 3OGOE 4MJIE 2ICWA 4NQDA 3FHAA 5DWUH 1SJEB 5ID1A 2BSRA 1DFBL 3JV6B 5B4MD 1Y6KR 4GRLC 1NCDL 4MLSA 3TV3H 5CJ5A 3IJHA 2WWKT 1HZHH 2VDRL 2VAAB 1HWGB 1MHPH 4ODTH 3O8XA 4AEIL 1WBZB 4M4PA 4NUJB 4PB0L 4HCRA 1LO0L 4JPVH 2QTEA 4S0TD 3P9MA 4JFHD 1I3GH 1MRCH 3SDCA 5GS3A 1NCAL 1KEGH 3S3JA 4OCWH 2EZ0D 4I3RH 2VLLA 2YN5A 2L4OA 1JCKA 3LS5H 2H26A 1REIA 2PTVA 4LLDA 5GSRA 3VD3A 1I1AD 3EYSL 1TCRB 4J6RH 3DETD 4UUJB 1FO0B 4XHQA 3B9KB 3RUGB 2NR6C 4QRPB 2EDTA 3RNQB 5FYJH 3WDJA 4R4BB 1HSAA 3WO4B 5IQ9A 4AK1A 1MJ8L 4JO2H 5SWQA 5HGBA 3U9PL 5F44A 1RMFL 1IKNC 4NUGH 4G3YL 5J8OA 1JPFB 4P3WA 3TNMB 4WU5A 4R2GC 1GGIL 1OL0A 5I0DA 3KNBB 4YC2B 5CEXA 4HXAH 4UOJA 4LHUD 3DHMA 4NO5A 4HJ0D 1A21A 4CMHC 2CO6B 4XAWL 1MCBA 3NFPA 2L7UA 5CINL 3W2DL 3VCLA 2R9HD 4P9HH 4MD0A 2EE9A 1TZHB 1NCTA 2CDGA 3MRNB 5TE6H 4X5WA 4XCEB 3GSNB 1EH9A 1P84K 2EXWD 4B7IA 4NFCA 5JO5B 4M3JA 2AJSH 3K2UH 3CPLA 5DRXB 2EEDA 3QZWA 1DBBH 4UAOC 1V3MA 4DKEH 5SWSD 4NQEE 2IPKA 1U8PA 2HH0H 5ICYA 1VGKA 4OLWL 1RUKL 1YECL 5EO1B 4MS8C 2IANA 3I85A 1JGLL 1JI2A 4KKNA 5DQJA 2OZ4L 4QEGA 3VDBA 3QO0A 4FHBD 4P2CG 2D9QB 1B4RA 4QTHB 1UKSA 2YPKB 3UBXB 1GL4B 2EICA 5HYJD 4LGPB 1N0XL 1HXMB 5CZXC 3HR5B 2MJWA 1WT5A 4LF3A 2JJTC 5HHMB 1H8OA 2XRAH 4Z7QE 5C08B 5A43C 5I66A 1KOAA 4X6DB 4JHZA 2D4DA 4MMXC 2C7UB 1U8IA 3MRBB 4OZGF 2DI9A 2XZAH 4X0KA 4ZUTA 5HGAA 1A14H 1BPVA 2VB5A 4XPHL 1KCUH 4PP2B 3U4AA 4CDHA 2R0WL 3GEWB 1A1OB 3O3BB 1V3JA 4R26L 2BJMH 3MLWL 3GSQB 5F8QC 1MJUH 3ES6A 5IVZB 3BIAX 3RL1A 1U92B 3QCTH 4ODHL 4DN3H 3MV9D 1CGSH 2X70A 4UDTB 1KENL 2ERJB 4R4FL 2W0KA 3KYAA 3WFBH 1JNNH 3B9KD 4E41E 2F54E 5HJ3A 1MCLA 3MGOA 5HHQA 3TN0A 1YN6B 2DQGH 3NN8A 2GEEA 1NSNL 3JWOH 4RISL 1KG0A 1CLYH 4NNYB 3ZE1E 2APWA 4FFZL 1QRKA 4I18A 1JGVH 2D7QA 4ZAKB 2OK0L 4XXCA 2PXYC 1MCFA 3E0GA 4DW2L 1JPGA 3MSPA 4L1DA 3SDXE 3QT2A 3UPCA 3VE0A 4N8VG 3ULVF 3BZEB 1G7LB 1EBPA 4N0RA 3PHQB 1T1WA 4JGUA 4R3SA 3VXNA 3C6LA 4BSWA 2AV1B 4TYUA 4M43H 3MGAA 2DQUH 4OZGE 1BD2A 5DJXB 3ZSSA 1GOFA 2ITDB 4I3SH 3I6KB 1NCAH 3HE6D 1KEGL 2CIKA 1IKNA 3OKOA 4NZRH 4PJ8C 2IFFL 2CMRL 1QBAA 3DRTB 2EDNA 4PJ9C 2NY5H 1DQJB 4YXLL 4YE4L 4JN1H 3EOAA 3OKMA 4MA7L 3DSNA 1CTOA 4JG1H 4Z7WF 3T0EE 4OZ4B 3ARDD 3LS4H 3BESR 4HS3B 3SDDC 4MD5A 3EHBC 2IFFH 2OYPA 3V8CA 2Y7QA 3R8QA 5DI8A 3EOAB 4PJAE 1MFCH 4LEOA 1CDBA 3QHFL 5AZEL 5CILL 4FS0A 5I9QB 3SDAC 2PXYD 1QFWI 3WFBL 5KSBB 1JN6A 4PGEA 2KL6A 4CNIB 4JG0L 4X9FA 1SVZA 3MR9A 2P24A 5JR1H 1FHGA 3QFJD 2HJFA 4NQDD 4L29B 1G7LA 3VG0L 1BBJA 3HFMH 5JNYA 4XMPL 3V6ZA 3QZWB 1KTDA 5GGRY 1Q9LB 1BZ7B 3GNMH 4ZO9A 3QIWB 4K07A 2OCFD 3GMQB 3KPRA 3PWPE 4NHUA 5E1AB 4EJ1C 3PWJB 1X5LA 3C2AL 3WN5C 4RAHA 2NZ9D 3RNKB 3UTSE 5I75B 3CXHJ 3TJHD 4D0DA 4YHKL 3I6LD 4N0YH 4KQ4H 3MODH 3U36A 1OTSC 2EDKA 2JJSC 3FB8B 5C86A 5IB2A 4NYLA 1QHPA 1UJ3A 4P3CL 3OR7A 3QQ9D 1ZV5A 3O6FA 5L8LB 1QFWL 2DWEA 2O5XH 3MJ7A 2AV7B 2FATL 2MHAB 4K7PY 2A9MH 1G9NC 4L3EE 3KVQA 4PB0H 3CFDA 3Q0HA 1FYTD 3V52L 1UFUA 4PR5A 2HAZA 1KGCD 1IEAB 4BH8B 4J3SA 3ARYA 5KN5B 3RL2A 3EOTL 2C4XA 3R06A 3G5ZB 1G9NH 2HA1A 3Q3GA 4I48B 4JM2B 3TO2A 1LP9A 2AERT 3IDJB 4CU7A 5C0IB 2N56A 4KKBD 4PGBA 3BXNB 5EU6D 4U1JA 4F8QA 1NFKA 3MLUL 1A1OA 3GM0A 2P5WE 2EEAA 2NTFB 2KUTA 2XWTA 4Z77B 4NQCE 1FZJA 1YEJL 2NNAA 2Z9TA 3G04B 2QBWA 4ZUVB 5FHAH 2XQBH 4B41A 1ZVSB 4TTGA 2YKLL 2NTSP 3QUXB 4UV7L 2BSTA 3GKWL 4HXAL 1PEWA 1T7XA 3T1FA 3ZE1F 1KJ3L 2VE6B 2AXHA 3MV11 1NCWH 1LDPH 1UCBL 3F6LA 3IGAB 1OW0C 4NZUL 5C07B 2OI9C 1QBLH 1YMMD 4Z7VB 3QO0B 5BRZD 5I1DA 3NIFF 3GIVB 4JFDA 4M8VA 4YXHL 1U95A 3LH2L 2YSSA 1GHFL 5IW1B 3ZT5A 2JIXB 3CDGA 3CUPB 2WUCL 1CGWA 1EBAA 5T3ZH 1N3NB 1GZPB 5DD3L 5GS1C 3MRHB 4NO3B 3KLHC 2W60B 4YHOL 4X5WB 3C5ZB 3B9KA 5F21B 4PRBB 2DWDA 1NANH 4P5TC 1NMBH 1S9XA 1KCKA 3HI6L 5JW5B 1INEH 4KK6D 4JZJC 2B0SL 3IDNB 2W59A 1BIHA 4WUUD 4J4PC 1RIHH 1YEIL 2FO4B 4YHIA 1XGRB 5D7IA 4LLMA 3RTQA 4TVPE 5F7WC 2UY7A 5C71A 1RZKL 2X7LA 5D9SA 4EKXA 5J1SC 3UTTE 3HUJB 3GNML 2YEZB 2ZUVA 1WICA 4ZS6C 3O8XB 3QHZL 5B22A 2C3GA 2ADGB 1YNLL 2R8SH 1Y18A 2OTPA 3L3HB 3CCHA 2OJZL 4LPUA 3U0PA 2D03H 2GT9B 3MRFB 3A0OA 5EC1A 3RKPA 4J3OC 2PYFB 4OCXH 1EEZA 3L5WB 4BZ1L 4YGVB 3LKSA 2CDFB 2I9LB 5BS0B 2ESVE 4U7SA 5D7JB 1M05A 3IJSB 1ZEAH 4HH9B 4X6FA 3G5YA 5BVJB 1NFDA 1E4KA 3OKKB 1ACYH 2FZ3B 3FQUB 4Y2DA 3BKJL 4J4PA 4M61B 5E6IB 3PWVA 4P46B 1AGFB 3CFCL 1Q0XL 2J12B 3WJJA 4ONGH 3CSBA 4NJ9H 1VFUA 4OT1L 1PQZA 3PQYD 1JGEA 4DKAA 3RJDA 3VFTB 3T1WA 1JWUB 3LKQA 4NKOA 4R4NC 1T0NA 3P9WB 5D2LF 1U8OB 5ITBH 1OP5H 4PJIB 5GRVK 3S37H 5GGSA 1R5IA 1L7TH 2K1MA 4ALAL 4HT1H 2YBRA 3MV7B 3HE7B 1NGXA 4XPFH 3D0VA 3QQNA 1OAXL 3TN0C 1G6RA 1QSED 4X8JB 3RGVB 5HDQL 1EVTC 2XWTB 2W65B 2E8ZA 3QEHB 4HMCA 4POZC 1BM3H 4JDZB 4U1GB 4D2NA 5EB9A 4GQ9H 1WJ3A 3TA3A 5DFWH 4K8RD 3MV8A 4K3DH 2NY5C 4HUUB 4YAQA 4OCXL 5BZWB 4HPYH 1CLOH 4RMUA 2H2PD 3QJHA 5EPMB 5ERWA 5I71C 4HUKB 3QQ3B 4IOSD 3VH8A 2OXGA 4ELKB 5EO0A 3T0DA 3QDHA 3C8DA 2CIIB 4JGJA 1ADQA 2Y36L 1YEEL 3CIQA 4YDJB 1OPGH 4R8WH 2GKIA 3T2OA 5I6XC 4HGWB 4Z5RA 4Z7WB 4LDLB 1MJ7L 1UCTA 1ZA3A 1QBMH 1BREA 1GIGL 3FT3B 4LEXL 4R97B 1DLFH 1G7MB 2G5RA 3QIBC 3MJ7B 2Z93A 2WIIA 2XY1A 4S0SD 4WUUA 3PV7A 3T0AA 4WDIA 3VXUD 3TBTB 3LN5A 4DAGH 5D96C 4FQXB 4DGIH 1K4DA 3MBXH 4FQ1H 4OV6F 4OT1H 3V7AG 5C2UB 3AROA 1TXKA 5GIRA 5F88A 1S9VB 4PJIF 1RZFH 3HI1A 4LVHB 3QCVL 4HPOH 1R3IL 3DYOA 4LHUG 1YY9C 1F58L 2F5AH 2NY4C 4X7TB 4DGYH 1DEEB 1NGZB 3PNWA 2YD1A 1NGWA 3OXRB 4PB9L 4CVZA 2AKRB 3GB7A 1AQDB 1MJJA 4XGZB 3IDYC 3KXFA 2F54A 1P69B 4HJ0C 1FCCA 5CWSB 3ZDZE 2V5MA 1BVLB 4GMSL 2PR4H 1QEWA 4FG6D 3WUWB 1A4KB 5DZNA 4RGOH 2ZUWA 1YEDB 3C6SA 4M93B 2P47B 5JNYB 5GJTL 2HN7B 3H9HA 2BNQD 2MWCA 1HQRA 2P5ED 2C3HA 1T2QH 1ZT1B 4TTDC 3QXTA 4UNUA 4F7TB 4PG9A 1BGXH 1JN6B 2R8SL 2NY0D 4K9EH 2O5XL 1MFAH 2EYRB 2XNAA 3QA3A 4KY1H 3HG1B 5ADOL 3UROR 2EH7L 1TZIB 1XEDA 1CDJA 3HE6B 1YPZE 4X7FC 5IK3A 4X80H 1ORQB 3O4LE 1PVHA 3GRWH 2NY1B 4FZ8L 3L9RB 2R4RH 5J6HA 1CZ8H 1KSRA 2LU4A 3X3FL 2FJFA 5FUOL 5EO9B 5MERA 3FQRA 5HI3D 3ALXA 1LNUB 1T2JA 4HEME 2VN7A 4ZTOH 5JXEA 1BJ1H 4HWEH 4Q9QH 2J8UF 2ADJA 3NZ8B 2APVA 1FYTA 1XGPB 2HT3D 1XGYH 4Q2ZB 4XPBL 1NCUA 4LCYA 5HGGS 4MXWH 1QRNA 2C1OA 5CD5C 3O6FD 1NGQH 3V7MA 1E28B 1A6UL 5DD0H 1VFOA 2L7JA 1CGXA 4Y4HC 4HUVB 2FIRT 5ESAB 3UPRB 5T1DH 1PEZA 4H26A 1CIDA 1P9MA 5KSVB 2R39A 1GGUA 1U3JA 4XNMB 1FFPB 1NCWL 1UCBH 4HKBB 4ZS7L 1EMTL 4FXKA 4JEGB 4AIOA 5IB3A 4OIBA 2K3TA 3UTTD 2BDNL 3QWOA 5DHVB 4YAQB 5D7IE 4ZUWA 3TZVC 1KNOA 4L1HA 1I9JL 3PDOB 2FJGB 4OD1H 3ZDXF 1AGDB 3PWPA 1DUYB 4Z7WE 5HI3C 3BRFA 3UTTA 5EOQL 2VXVL 2NY7L 4GW1A 3VWKB 3GMRB 1IGTA 4RRPG 2AI0H 3KHQA 4NUGL 1UA6H 2YR3A 3D5OF 4HWZB 4QGTA 4XX1G 1OAZH 3F7VA 4PJDE 5KJRH 2I25N 4UMGA 1ZAGA 4XZUA 1WLHA 4MA8H 3MFFB 1JVKA 3JTTA 2HKHL 2EYSB 3RWEA 3RZWA 3ZLQC 2GTWA 4BELD 3LRHA 2F53D 4X83A 1EA9C 5E8EA 3RVWC 2VDMH 5FM5O 3LB6C 4MD4B 1OSPH 4JKMA 3S3SA 1S3KH 3SE4C 4BYHA 5D72L 4ZQKB 5HPMA 1BQHB 1I3RA 1A8JH 3ARBA 4LSUH 5FYLE 1C7SA 3FFDA 2FB4L 3MBEC 4AY0A 3FMGH 3HI5H 1UWEL 4U3XA 2ZJSH 1CBVL 4KUCF 3SDAA 2P5WB 3K8MA 4L8BA 4HIHA 2P7TA 3A6CL 2GJ6E 2YRLA 5GGTH 1S7RA 2ZG1A 3O41B 4Y4FD 2W9EL 4PY8I 3TIEB 5KSAC 4OZHE 2DMBA 1ONQA 2CMRH 4K8RC 1U8PB 3V4VH 1WZLA 5T5NF 1VA9A 2X9YA 4P2RD 1CF8L 2HJKB 4XC1L 4IRJD 1H5BB 3VRJA 2DQDH 2OP4L 3QDMA 5JDJA 2DLIA 4B50A 2CUMA 4BUGA 2R2HA 5GRUL 1UJ3C 4LCCB 3VFPA 4CW1A 4PJFF 2ADGA 2JKXA 2NY6D 4XPGH 1RQ5A 5DC0A 3CFKB 2YD3A 3W0WA 1HKLH 2V9RA 5EU6E 1AO7A 3QHFH 5AZEH 4JZOA 1I1AB 5IMOA 1OOAA 2VDPH 5CEXB 4OCSL 3EDDA 5E2JA 4Y5YB 3WIIL 4JY4B 3QUMB 2LU3A 3RTQB 5H2BB 2OBGA 1AD9B 2XN9D 5E08H 1WQVT 3TP4A 2R2EA 1QKZL 2BVYA 3CAFA 1YYML 3I9GH 1JGUH 5JR1L 2DQJL 3OAZH 2BK8A 3GSUB 4HFUL 5FYKE 1J8HE 4RWYH 5I1HH 1AD0B 1RHHA 2DL9A 1Q94B 3DGGB 3O6FC 4O51B 1UENA 3OV6A 3QFJE 1IILE 3VFGL 3GHEH 3F58H 5DRWA 3VRLE 5LKNA 1T03H 1P7KA 3KXFD 4NQXA 1WFTA 2BNRD 4XVJL 2DIJA 3I84A 3CK0H 1F4WH 2ZSWA 2WBJD 4H1LH 3CFEB 4PTTB 3CDFA 4Y1AE 5K93A 1TTGA 1MJ8H 4JO2L 5C0FA 5IKCB 3L7EB 4H88L 3U83A 1NAKL 4YGAB 3IFLH 4U0RB 3GSXB 4OM0L 4LPTA 3DX8A 2BDNH 3P0YH 3ULUL 4HZLA 5KS9B 1NKOA 4WEMB 4BM7A 5E8NA 3IFOB 3KXFE 3RWJB 1V7ML 3PGCA 5C09E 5KTEH 4RWHA 5JPMB 5I18L 1DUZB 1BD2D 2AK4D 1CD1B 1LO2L 1MCWW 3VD7A 2BCKA 1D9KB 1E4XL 5D5ME 1DQDL 1PFCA 2MQ3A 3GMMA 2MNUA 5DD6A 4L4TE 4ISVA 4YZFF 3VFUA 4NO2B 1HHKA 4F7EB 4YHML 4NKIH 5I8EB 2VDQL 4BUHA 2Z31A 3S88H 5CJ8A 1DUYA 3PWPB 1H3PL 4MNGB 4IRZH 4PD4K 1WTGT 2A2QT 3VFSB 2CKBL 1RJYA 4GOSA 4K7FB 3X13A 4U1LA 1U6AL 3D1MC 4IRJA 1GGIH 1S3KL 5E5MB 2OM5A 3PABB 3X12A 5D1QB 3DGGA 3RU8H 1YJDL 5ESAA 3UPRA 3F7VB 1TIUA 1AQKH 2CGRL 3GMLA 5D1XA 5A16B 1P7QD 1I9RL 1LGVA 4O58L 1FNSL 5TE4L 2DQFA 1BEYL 1DN0B 2V5YA 4N0UA 3TM6A 1ES0A 5IFAL 4LCYB 4MQ7A 3ULVL 3E1F1 1XGPA 4GG6A 2CRZA 4JG1L 1AGDA 5GPRA 1YMHA 3KPMB 2LU7A 5I19L 4ZUWB 1IL1A 4EVNB 2EDQA 1HNFA 3D39D 4YX2H 3NAAH 3M45A 2AJXH 1EEQA 2BERA 4AMKL 2B2XL 5DD5L 5ADPL 4J12A 5E1AA 2WK2A 3P4NB 5KSVA 4XBEH 1BQSA 1A3RL 1B0GB 3NA4A 2YD2A 2VXSL 3LKRB 2H6PB 1NANI 2X1PA 5FF6B 4Z78B 1JMZA 1HHJA 2Z91B 1OAYL 3DARA 2VIRB 1TVBA 2IAMB 3ARSA 2XZAL 5F70A 3HG1A 5DJ0A 4L3AA 3MR9B 4FQQB 5EZOH 1Z3GH 3K4AA 1TITA 5IM7B 2DTMH 5ALCL 2P5WA 5HI4C 3KJ4C 1OWWA 1A1NA 3PP3H 1TCMA 3HNSL 3E6FA 1EZVY 4U6HB 2FJFB 4N0CD 5IBLC 4HK3N 2EIZA 2Y7QB 5HVHB 2X1WL 4X98A 3L1OH 2J8UB 1ZT4B 2VITA 2JJTA 3WNKA 2CRYA 3VD5A 4HS3A 1JBJA 3UPAA 4ZNCD 4FXGB 1XIWD 3RWEB 3T0EC 5CFHA 1F4HA 4KRMB 5IK3B 3RAJL 1WGOA 3BQUB 2FECI 3GB7B 4FABH 3BUYA 2OTUA 4D8PB 4AEIH 1YY8B 4JFEB 1AIFA 4UU9A 5JHDA 5DMGD 3F5WB 5KSUB 1Q9KA 3O9WD 4N90E 3JV4A 1VPOL 3RA7H 4N90D 4GJTB 1UXWB 3EO0A 5FOJA 4LOUC 3ZSTA 2VISB 2EKJA 2DLHA 3ZKSD 4LKCB 3JV5A 2J88H 1A0QL 2NCMA 3L3GB 4GRLD 1EXUB 5FM4A 2AP2A 2QSQA 1JF6A 2OXHA 4KAQL 4ELMF 4JFFA 4L3CA 5KW9L 4PJBA 4CVXB 1D5BA 1IAOA 1RVFH 3EYFB 1B0GA 4XP6L 2DDQL 1CXLA 5D1ZB 3D39B 4NSKB 5H35A 5HYSA 4UINL 3W0WE 4YDLB 2H8PA 4I0KA 3V0VA 3EHBD 5LGHH 4AEHL 5IV2B 1I8LC 1S7VA 3NIGE 1G7JB 3SDDD 1I7ZB 2AABL 2O5ZH 3N1QC 3WNLA 4OF3A 3LS5L 2EIEA 2DM2A 4GUPA 1F58H 2CO7B 3OHXA 5DJAB 4XNYH 1YQVL 3DVGA 3DX9A 2GFBB 4JQXA 4XHJD 5EA0H 5CBAB 5D2NA 1P7QB 3QWRD 1S9YB 1LO3L 1FIGL 1Z6JT 1JTPA 4O5LL 4ZXBB 3B3IB 2H8PB 2Y06H 2P42B 4PRPA 2VO5A 1KIRB 5T3XH 2MCPH 5A16A 5I76A 1F4YL 4B5EA 5F1OB 3EOYG 4QHMA 3HB3C 4M6OH 4EUPB 4Z6AT 3K74B 5EU3B 3RWHA 5KSAA 2OL3A 1KCRL 2IFGA 1EFXA 35C8L 5EN2B 5JIKA 2EYTA 4JPIB 3BPOC 4YEEA 3PWPD 3FKUS 1DP0A 3RKDD 3LMJH 4PS4H 2C3VA 3ILPB 3PWUA 3V6OA 4Y8AA 4JAMA 3DIFB 1BZ9B 1J88A 3I02A 1LD9B 4PJFB 1JHTA 3LKOB 4U6HA 3SGJA 3JZ7A 5CIPB 1CVSC 4OUOA 4BFEA 4WW2B 4YHOH 5IROC 4Z18A 4PJ7E 1E6JL 2P8PB 4WFFD 5F93C 1D9KD 3LAFA 4ISVB 1MCIA 5DD6B 5L7XH 2AK4A 4ZFZA 4KJYB 2R4SH 1UYWL 2Z31D 1N5AB 4NQSA 1HH9A 1WBYA 4KK6C 2P8MB 5CZVL 1PSKL 2R0LH 1PG7L 1T0NB 1KCSL 4Y5VA 2CXGA 1YEHH 2B1HL 1LEIA 4DVRL 2VLJB 3RY4A 3BYYA 1HKLL 3CXHK 3AAZB 1DE4A 3RZCC 1H3TA 4AQOA 4BJLA 1U3HA 3KPLB 4XBGA 3O3AB 3CLFH 1B90A 3WNOA 3DWTA 3UJTL 3AVEA 2H2PC 4P46A 3P4NA 1QFUH 3BSZH 1H15A 1J0KA 1Y18B 1KENH 2FGZA 4JPWL 1DBKH 5EZLA 2NZ9C 2DLFH 2VH5L 4OCWL 3IKCB 4WJ5A 1SY6L 4WWKB 3C8KB 5E7BA 3HUJA 5E9DD 4P59L 4X9BA 5T1LB 5CS7A 1KN4L 1BQLH 1FFOB 4YQXH 2CDFA 2WP3T 4KV5F 3MACH 4PJBF 1N7MH 1LE9A 4QXWA 4YGVA 2F74A 3BKCL 4XNQA 1G84A 3QRGL 2HT2D 4JREC 4KK5D 2GT9A 4B53A 2KBGA 2FH8A 3WLBA 1YQ2A 4M7JL 4X7SL 2XQBL 2D0GA 4PRBA 3T0WA 1I4FA 3HS0A 4LRIA 4PTUB 1WFNA 2BHYA 3BKJH 4PJEF 4M02A 2XN9B 4PY7B 1F3RB 4N0UE 1DR9A 2V5RA 4WI8A 5E8DH 1QSFB 5IESL 2JIXA 4MQ7B 1BF8A 3OKYA 4FFZH 4WHYH 3C60A 5C0EA 4A2MA 4M7LT 1U95B 3MNVA 4N0UB 4YHIB 3LVEA 3WFEL 4MA8L 1RZ7H 1D5IH 1E4JA 3Q6GL 4OGXL 5D1XB 2DM3A 1CE6B 1W0WB 2ITCB 1LDPL 5C07A 4RX4A 5DDHB 1S9XB 2B1AH 2LTQC 3H8NA 4XBPB 5HHOD 1KYOK 5AYQA 1JK8B 4NC1E 5D6CB 2ZP0T 3QXDA 1RFDL 4LSQL 3UDWA 2BNRA 2CKBA 1FPTL 4D3CL 1QBBA 43C9A 1JGEB 1UB5B 3TGXA 4KKLC 4ELME 4WHCA 3K81A 5FIEA 4X6EB 4CN6A 1MAMH 3ARFA 1AGFA 2X89D 2ZUQB 5B39B 1CLOL 5CLTA 2Z31B 4Q9RL 5I8KL 1EO8L 4IBLT 1KPRB 5HHNB 1ITBB 5LGJB 4TUJB 3MV7D 4YBLB 5IJKA 2X89A 2LABA 3G5YB 5BVJA 4X6CF 1ITCA 4S1QH 1G0YR 1HI6A 4NRZB 1T4KA 1NUDA 4PJFE 3A6BH 2X09A 1LK3H 1YUHA 3O4LA 3TBSA 3VXME 1OAKH 5SV3A 5E95B 1CL7I 3T0ED 3OL2A 2RQ8A 5BQ7B 3BSZL 3EJZC 3MRDB 2Q86B 5GS2H 4P4KB 4Y4KC 1OY3B 2D03L 3NVQA 2ZUTA 3BVNA 3J7HA 3I3BA 1FAIH 1M7XA 2IWGA 3IDMB 1QNZH 4WHTA 1XF2A 4NBYB 5E03A 5C09A 3G6JE 1FYTE 3D2UB 4KDTC 5GRJL 5J12C 4F57H 5IG7A 2CLVB 3QWQB 1ROWA 2IQAA 4HG4K 4WEBL 3LKNA 2H45A 1ZLVH 2F5BH 4PBVC 5C70A 4UQ3A 3QFDA 2D7TL 3TVMA 3C60B 3QEUA 3BPLB 1MLBA 5FYLD 1A3LL 4UQ2B 1M7DB 2J6EA 4QHUA 3UTTB 5HDBF 3KYOA 4IRSD 4XBEL 3KPPA 1A5FH 2EDEA 2GJ6D 2AK4E 4Z7NE 1RJZB 2EZ0C 3UC0L 4S1SL 1G9MH 1M6OA 5ANMA 4F7CA 2BOBB 4PJEA 5SWZD 4AIZB 5C0JB 1XCTB 3ZL4H 3ZE2E 5F1IA 1A1MB 3LEYL 5HHVL 4L8DA 1TTUA 1KN4H 4ESKA 3MXVH 3PP4H 4GRLB 5I1JL 2SEBB 4RAVA 1WAAF 2YD6A 1FH5H 3A6BL 1PYWA 4WFGD 4AH2B 3MRGB 1E4KC 1II4E 1NEZB 4JB9L 5KS9E 2IC2A 4K94L 3HNVH 1W0VB 3L3IA 2VZ3A 3HTLX 2AEIT 2NW3A 3O9WB 1CR9H 4P5KA 3G6JF 2V17L 2HJLB 3VFPB 3MBED 3FQRB 2BSTB 5DT1H 5EO9A 1K2DB 1O5DT 2M8XA 4UV7H 3FO1B 3S5LG 4QYOB 3SDXF 3UJJH 4ONOA 5MP6H 2XOTA 4BZ2L 2X1XR 1BZQK 4X4MA 1A7PL 4NWTL 3BOVA 3LRGA 4KDVA 1LEIB 3HG1D 4OZ4A 4F8TA 3OQ3B 1BBJB 4GBXA 2AJYL 3OKMB 4NPYB 3BISA 1TZIA 4MA1B 1HQ4B 2Q7YA 4XP9H 5E8PB 4JANA 3NIDE 4KI5E 1AKJD 1F6FB 5SX5H 1VKXA 1T5XB 3OKOB 3B9DA 5KSBA 3ULUC 2P7TB 3V2AR 3BGFB 1YEEH 2D31A 5HYJE 4YHLH 1ADQH 4JFFE 1SJHB 3BPNC 4BSWB 1OM3H 1AC0A 4JR9H 4RFNB 2EC9T 1MCPH 4OCYH 3C2AH 5FA4B 5ILTH 3KAAA 3QUYB 3D85B 5FEBA 5IEHB 4D9LH 4GO6B 4MD4A 1JL8A 2YUVA 5GGTL 1E4WL 15C8L 3C5SA 5DK0B 1EGJL 4UINH 4JPIA 1FC2D 3SGDH 5EU6B 4OB5L 2R1WB 1FNSH 2OSLA 5BRZA 4RNRA 4FQCL 1C1EL 3QPQC 4ZOEA 4UAOB 4FP8H 4JPKH 4D9LL 4F2MA 2AXFA 1N0XH 3OWEA 2VQTA 2BVTA 2ITDA 1ZHLA 1MIML 4KHTL 4NC0B 4PRPE 3MLYL 1DBMH 3TFKD 5T5NG 3IDXL 2P5EE 3L95A 1HEZA 5KVFL 4D0DB 1FYTB 2UZIL 4WI4A 5HD8D 1FDLL 3OHXB 4OF8A 5MHSD 3NTCH 1NLBL 4AT6B 4XMKH 5HI5D 1QFUL 3DVNB 4G9DA 2ZSVA 1MCDA 1E0OB 2XQYG 2VL5A 3OKEB 1Y0LA 2AJYH 1AE6L 4D0BB 4YBHA 3TBWB 4MJID 1JGUL 3MRBA 1CCZA 2C7UA 3D0LB 1Q9LA 1IAOB 1D5BB 1U6AH 2NY3B 1K6QL 3NFSH 5C6TL 2EC8A 1F3DH 5D7KE 3EYOB 4PJ9D 1MAJA 3RUGF 3WFDL 4GKSA 1CK0L 3SGKC 3LCYA 4F80A 1CICC 4PG2C 2VLJD 4Z0XA 4OLZL 2HRPL 4FZEH 4WGWB 3V6BR 4ONFL 2YD9A 3RL1B 1RK1B 1LHZA 2G2RA 2A9NL 5C92A 3TCLA 1UEMA 4GLRH 4Y4HD 4JANB 2VZVA 4GMTL 2OP4H 3HE7D 4RMRA 1Z3GL 4JFQB 5BO1L 2IPKB 3S36L 2ATKB 4MXWL 1C12B 5A40E 5K9QI 1GXEA 1U3YA 4JFPB 3CPLB 2YK1L 4UIKL 3WIHH 1A9BB 3GMNA 3TA3D 3QUKB 2XWBB 5HTSA 1BAFL 5J13B 4NQEB 4G6MH 4ZFFA 2Y5TB 1SYSA 3G6AB 1DDHB 5D2LE 4TNVF 2PXYB 2NW3B 3SDCC 3JVGC 3GSOB 3ZHDA 2PNDA 1K8IA 3WD5H 2IBBA 1U8HA 2ADIA 3EGSA 4M43L 3C08H 3QEGH 5B8CA 5L6YH 4RZCB 3WCYA 4R3SB 4XXDB 1FORL 3VA6A 5GS0D 5ICXA 2PTTA 4PJAA 2GQHA 4BFBD 5HHPA 4PJ8B 3OAYH 4JVWA 5IHLB 3TV3L 4JFOA 5HHOB 3RVWD 3DRQB 3LQAL 4PJ9B 5DJYA 4AL8L 1QFPA 4Y8DC 2IAMA 5BW7A 4ZUSA 3MCKB 5B38B 5D1XD 3KS0J 3SDDB 2AI0L 2DIAA 3IDUA 4JG0H 2VYRE 3SE8H 2BRRL 4KJWD 4DOHE 4ETYA 3PL6B 5HJ3B 5E99L 3W39B 5KVDH 2R23A 1R0AL 5E94A 3N06B 3PWNA 4M6MH 3ABZA 1A4JB 4L4VB 4LBEB 4RMVA 5FYKH 1ORSB 1J10A 1QFWM 4X6BA 1OSZA 1CZ8L 1RUKH 1YECH 2Z8VC 3LKNB 4NCC2 3M17B 4Q0XL 5CJBA 1BEYH 1KXVC 1XF1A 1EGJH 4IRSC 5D9SB 5CEZE 1XGUB 4BFIB 3VRLF 1Q0YL 1T1ZA 4WHTB 3IS1X 5IGXH 3AM8A 1H3XA 4MVBC 5HHXH 5IIEA 1A02N 2W65A 4FP8L 4JPKL 5D2LB 3B43A 2PUQT 3U7AA 1E4XH 5TQ2H 1XZ0A 4JY6B 3WS3A 3GMLB 5ANME 2ZJSL 1CBVH 1J87A 1WZ1L 3SCMC 2Q76A 3OAUL 4M5ZH 4PJ7F 2FSEA 2GSIB 3MV9B 5CP3H 5D1QA 5CD5D 1JYVA 3F12A 4NRYB 4RDQF 4LFHD 4V2CB 1BHGA 1NUNB 5DRNB 5JMRA 1RUQH 4RBPH 4Y5VC 2B4CL 2W60A 3RIFK 1PQZB 3WBDA 1DBML 1T4KB 2GUOB 4XPHH 2LAGB 5BRZE 4MCZB 4MNGA 3MBEA 3TPKA 4NCDA 1RUAL 2A6KB 5AWNH 4IJ3C 1AHWB 4G8GA 1JF5A 5C0NC 5B3NA 3IDGA 4OUUA 5HHNA 3SDAD 4K2UL 2E6PA 1KPRA 4ZS6D 2YN3A 4I1NB 5C07D 2B8OT 4OM1L 4E41D 1A64A 5E00B 3VFUB 2MKWA 3FONB 1ZOXA 4IIQB 4KKCD 4A6YL 1V5JA 2FHCA 1A7NH 3RWFA 5GRXG 1NAML 1G9MC 2VE6A 2NY7H 1BIIA 1C5DB 1U8OA 1JK8A 4LIQH 2C5DC 4MD0B 1AR1D 3P0YL 4FFWD 2V9QA 2VRAA 1BGXL 2XA8H 5JPMA 4UOW1 3QEQE 5FV1L 4HXBL 4L8SA 3RWJA 5LCVL 2NZIA 2V17H 3FHQA 1WV7T 3H0TB 4K3EH 3WHXA 4JM2C 4JQXC 3KNBA 4RAUB 3U6RA 5KSBE 3V4PL 5F9JA 5J0BA 4KJWC 4PJAF 3DHJA 1MCQA 2JB5L 3VGHA 2XI9A 4U1JB 3VXSE 1T7WA 3MC0A 2C26A 3DMMA 3VWKD 5HYIA 1DFBH 1KPVA 4NKMA 1HSAB 5DHYA 1G6RL 1JHKL 1J05B 4JPWH 5BO1H 2VDLL 4YXKH 1U2HA 3KR3H 4P2QB 2J8OA 1ZA6A 4GAGH 4ONGL 2FO4A 1FG9C 1U8MB 5E5UB 4MAYD 4S1DC 3KPRD 4NQXB 4RFEB 1F6LL 3RUGE 3SE4A 4JO4H 1QP1A 4OIAA 4GT7A 2IH1B 3LN4A 2GJ6B 3MRQA 5FO7B 1A6UH 5DD0L 1BX2B 3NCBB 4WV1C 5IVXA 5E1HB 1LO4L 2NMSA 2XACC 1I9EA 3LQAH 1ZLSH 4E0RB 3VI4F 15C8H 3GSWB 1WBZA 5IW1A 3F62A 5HSFA 5GRYA 4LLMB 1XGRA 3D2UD 5D7IB 1WCQA 5B8CB 4ENED 2NY5L 1HHIA 1AO7B 1NBQA 1OAKL 1GH7A 3AAZA 4HCRH 5KBNC 3ROLA 3GSOA 1N8ZA 4K8RH 1S78C 3BIBX 3P73B 1OTTC 4QWWC 2DWDB 2HFGL 4M6OL 3DRQA 4YWGL 1GIGH 4PJ7B 1R5WA 1ZT7B 5SX4I 5I1HL 4F3FA 2IGFH 4KXZI 1W0YT 4K7PL 1UT9A 3RWDB 5C0CE 3WJLA 1PDKA 3C87A 4J1UB 1MFAL 5EU5A 3TH4T 4QCIB 1KCVL 5FA3B 5E2TH 4WW2A 3ZKMD 3T2NH 3ARGC 1DBBL 5CIPA 3L6FA 3K2UL 4WW1B 1FSKB 3BGMA 3S37L 1RK1A 5I8KH 3IGAA 3MLXL 5DJ8A 3CK0L 4OD3H 1JNNL 5CJXA 3T1FB 2F53A 2P46B 3VW3H 4LNVA 3L7FB 3QUXA 1NFDE 1FYHB 3BP4A 2OL3B 4GRMB 43CAB 3GMOB 1A9EA 2FWOA 3EYOA 1FN4A 1G7PA 1MELA 1C12A 5H8DA 2IAND 1I1RA 1YYLH 1KIRA 4Y19D 1IKFH 5E2VL 2P4AB 4FRWA 5D7JC 3O2DH 5BMFH 4U6YB 2I5YL 5D2NB 1QKZH 3UTOA 4R90L 2G5BA 4PUBL 4MDIB 4GSDL 1NLBH 3IYLW 5D71H 5JQHC 1KJVB 4N8CH 3AU1B 2EXYC 1AI1L 1A5FL 1I7ZA 4LU5L 4HKZA 3CMGA 1S7VB 1LP9B 1NCCL 2VQUA 1MEXL 5DEFB 1UC6A 1A4JA 2X9XA 4IMLB 1MIEL 1T6VN 2H3NA 3V95A 1VACB 2ZCHL 3U4EA 4LLYA 2FJGA 3PDOA 1WBXA 4ZTPH 3S36X 2X4SA 2NYYC 4KQ3L 4J8RA 4QLRA 4LU5H 1IQWL 2QQKH 1OARH 1BM3L 4ZSOE 1OGAE 4CJ1A 5DUPL 1EXUA 5JPNB 2VNCA 1F8TH 1HXYA 3N85L 1FV1B 3DO7A 3TN0B 1CG9B 5H37H 5FO8B 3PDGA 2DLEA 3MLRL 3ZKND 1S5HA 1M71B 3IDIB 5E9DB 4H25A 4HWEL 4Q9QL 3KPQB 1ZLWH 1BVZA 4PJ8D 4PRIA 4QXGH 1ZLUH 5D7SL 4TSCH 2FJHB 3ES6B 5IVZA 1R3JA 3FO2B 2R0ZL 1NBYB 4M1GH 5T3ZD 1X4XA 1R3KB 4GKZB 4PGCB 3K7UA 1UEYA 5I71B 2OTUB 4LHUA 1P53A 3GUTA 4PP1C 2B7DT 4L5FH 2Y5TA 3RGVD 1IKFL 5E2VH 1NUFA 2W0FB 2VL4A 1MQKL 3KPSA 4Z95L 4XCNB 4Q97A 3QDGE 3Q6GH 4OGXH 5EULV 4OFKA 2ENSA 1F4YH 4DN4L 5M7QA 4X98B 5HYJB 43CAA 2CUHA 4U6VL 5EUOE 4DJMA 2FH6A 2RHEA 5BW7C 1IEHA 5IHUH 3S35X 3HE6A 5F96H 4D3CH 1IC5H 5E0QA 3AXLA 4LSQH 5EFIB 2C4FU 3E6HA 3LHPL 5MHSE 2CIKB 3V0AC 4CVUA 3GKWH 1BD2B 1TJHL 2N1KA 32C2B 3C6LB 4M7JH 5I0ZA 4JRXE 5K9QG 4IDJL 1IQDB 2RBLA 4PBWD 5BMFL 5BS0D 1PKQB 1KFAL 3Q5TA 3P9LA 3H3PH 4TSBH 4U2YA 1A6AB 1YQVH 1S7XA 4ZPVB 4I18B 1T04B 2VKXA 4HWNA 3LEXA 5TFSH 3BEWB 3U46B 1VCAA 1Z9MA 2NY3D 1RJZA 1TETL 3W9EB 3GUTB 5T3XD 3VI4E 3V79C 5GS2D 2XG5A 4I3SL 4KKBC 1YNTA 3LRSA 1CN4A 3NFNA 2FX8H 3HN3A 1NAMB 2AJXL 3O8XD 1L0XA 5JORA 2AV1A 3MRGA 3QFDB 4NN5B 1KIPB 2OMNA 1T83A 4NZTH 3B6SA 2DIBA 5ENWA 3O3BA 2FHBA 3DXAA 3HZYB 1IBGH 2WIIB 1HXYB 4WUUB 3RUGA 5FGRA 3ZHKA 4HS6A 4P0DA 3MA7A 5AUMB 3GRWA 2BVUA 4E5XA 3NN8B 4OF0A 2IH1A 5I74B 4LP4A 3QWRA 4OBSA 4NGHH 1J11A 3MGOB 4IOFC 4RFEA 4HD9A 3N9GH 3NCJH 3O11A 1SVCP 3L7FA 3TLRA 3QNXB 1J05A 4UILH 4NKMB 4N8CL 2JK5B 2EDWA 3GSQA 1ZS8A 5CCKL 2DQHH 4GS7B 1OT2A 4UB0L 1L9NA 1L4IA 5E9DE 4U6YA 5DMIH 1C16B 1A14L 2NY0B 5GHWL 3ET9F 4X4XB 5JHDD 3WHXB 3BP5A 2NXYD 4PJIE 1AKJB 4O9HL 2X4OA 4Z7OE 4V1DD 2ID5A 2V2WB 4NZRL 3GI9L 2DQHL 3AREA 5F7MC 4JFYB 4DVBA 2BNQB 2HTLC 5E8NB 5BQ7A 3BP4B 4JKLA 1CDGA 1LO5B 3FZUD 4NN7C 1J1XL 3RA7L 3RVXC 3VDCA 2MOVA 4X6DE 3U0WL 3TZVB 3CVHA 1GGCH 1OVZA 1GYAA 4R7DA 2D7PA 5C2BH 1FO0L 2DQCL 3VWKC 1EPFA 1KB5B 3K8LA 3D3VE 3F65A 4PRHA 3ZKXC 1VESA 5T1KB 2UV3A 2Y72A 4YFLI 4DKEL 4DFHA 1FNEA 3FQXB 1H3WM 1MFEL 1JNJA 4OCYL 5CKAA 5BS0A 3SJVE 1BFTA 1E6JH 3B2VH 5E70A 3L5XH 1C5CH 2OZ4H 2VLME 1CICA 1VEMA 3GJFK 3KPOA 4OZHA 4Y4FA 1QLFA 2V6HA 3ISWA 4U6XB 4NM4H 3GSUA 3KPPB 4Q58C 3DO3A 4PPTA 5DFVD 3T09A 3UXFA 3HC0B 5DMIL 2ICES 1IJ9A 1KYOJ 5FGCE 4OZIE 5A1AA 5DFVC 1PG7X 1LK2A 3D48R 3VWJD 1WIUA 2A83A 5FYKD 4JZOB 2G9HA 3U82B 1QFOA 4E0RA 5DGRA 1A7PH 4C54A 3W0WB 5FGBC 5JW4R 2XN9A 4PY7A 4G8FB 5FYKL 2J1KA 5FUCC 1X5KA 3Q2CA 2VLMD 4F7PA 3RBSA 4OD2A 3SY0A 1OGAA 5ALBH 1DQLL 3MGTA 3EJYC 4U3HA 4XNYL 1H5BC 1I75A 3H6JA 2A0LC 5EZJA 5JW5A 3UDWC 2R0KL 5C6WH 2VABA 1AP2A 1QSEB 3RI5F 1UKTA 2BZDA 1E27A 2DQEH 4PGDA 4O2FA 3VXPA 1N6QL 1DVFA 4H8WL 1YUHB 3IF1A 4RQQA 1WFOA 2QHLA 4IRJC 4O2CA 3BMWA 1IM9A 4KJYA 4HIJB 3ARWA 1I1AC 1NSNH 1SM3H 1TTFA 4ENEC 4EOWH 2ZWLT 4EN3C 4JN2B 1Q38A 3PQYB 4MJIA 5IR1A 4I13B 2PW2B 4WUKL 2VDKL 1KLFA 4N9GA 3CFBA 3H9SB 4E42A 5CSGA 4KRPC 5AAMA 5EC2B 3UTQA 2HFFB 4MSWB 4GMTH 1I7TB 3BMVA 5DJ2B 2E6JA 3QNYA 2O61B 4Y5XA 1ETZB 4C59B 4QXGL 2W9DH 4TSAL 3ARDA 4LNRA 1ERNA 3KPNB 4MA3B 5L0QC 4LCUB 2F8VA 4MJ2A 5MEOB 5IHBA 2O5YH 3P30H 2WAHA 2X4RB 4RMSA 1MHHB 5DJCA 4XMKL 4MWFB 3QHZH 1NBZA 1DBJH 4HIXH 3WJJC 1D6VL 2ZCKL 3DURA 2XTJC 1S7WB 4ZSOA 3SOBH 1NMCC 3U2SA 1IEBB 4G8EA 3MRIB 3MRMB 5J7CC 4AIXA 3NACL 3WYRA 3MJ6A 5L6YL 4WNQA 4TUOB 2FYYA 4CBPA 2A6JB 2XKNB 2CK2A 4D9QD 4OZHF 1R3HA 2ARJQ 4BH8A 3QIBA 4LHQB 2V2XA 2HVJA 1Q1JL 4QRUB 5IVXF 3P77A 4ZAKD 3RDTD 1J1OL 4HUMB 3JV0A 3D0LA 1E4WH 1N6VA 5J1AB 5B3JF 1IGML 4FQXD 3S5LB 1WSST 2ZG3A 1WT5C 1CFVH 5JOFB 4UZGA 3M8OL 1C1EH 5EU7C 5IT2H 3RTQD 5GGSY 4PJ8A 3U48A 4PGJA 3I3DA 4XCCL 5EOCL 3C5ZD 3ZT6A 3D39E 3LSOA 5ICXB 3EO0B 3DROB 4FQ2H 4Y16C 3L95B 5C0BE 3STZA 1YJDC 1XIWC 5AAWA 5D72H 1CD9B 2FRGP 4HF5L 3IJYA 2QV2A 3W39A 2I60H 3FAWA 1OP9A 4OQTH 5IWLC 3GSVB 2F5BL 1DDHA 4PJHF 3NCEB 5BRZB 4QHNB 4N9OB 1UB6B 1BVKA 1CF8H 4KDTA 1HILB 2ZNWA 3BDYL 1N6UA 1T3FB 4GH7B 4O58H 3GMNB 4ONHB 4J6RL 1ZT4A 4G8GE 1INDH 1L6XA 5HHPB 4PG9B 3QUYA 4JFQA 3KDMA 1UH3A 1PLGL 4KMQA 2APXA 4P2OC 3FQNA 4CMMB 2VDOL 1A1NB 3TCLB 4ERSH 4HUNB 1K8IB 5K9JL 5ADPH 4I0CC 4LSUL 4EN3A 1A3QA 1B6DA 4DQOL 1F6AB 2UYLA 5E99H 4ZFOL 1MIMH 4KHTH 4TNWF 5KAQG 1NC4A 1W8NA 4R6UA 1XGQA 1KCUL 4MXQD 3I3EA 1KLUB 2NLJA 3QAZC 3REWA 5DD1H 4G8GD 2DL2A 5GRJH 4X4ZA 5ADOH 1SY6H 2OTWB 5F9DC 3KHOA 4Q6IB 2Y23A 1CXEA 5LWYL 1UVQA 3VFWB 4EQ3A 3FO1A 1T03L 5EOTA 2VDPL 3UAJD 2X4PB 3HLAA 5ESQB 5GSVB 3BN9C 5GXBB 5GIRB 5CBAA 3STLA 1X4YA 3KJ4B 4ODWB 1YMHB 3KPMA 2G2RB 1KBGH 2DJSA 3NBNA 5GRUH 4I77L 3HKFA 4RWYL 5C0CD 1FJ1B 4KKCC 2I26N 4AENB 1TQCB 3DV4B 4RFOH 1HIMH 3SGJC 4U1NB 2EDDA 4Q74A 5HVHC 2OK0H 5HYSB 4NFBA 1EUUA 3VE0B 4CVWA 4GBXC 3BKMH 4MJ5A 4LLWA 5DYOA 1D5MA 3MOAL 2CJUL 3EBAA 2YA0A 4FN0A 2CIIA 2CQVA 4P9MH 4AYFA 2CKNA 4YJZL 5ILTL 4I0PB 4XNUL 5GZOC 4L4JA 4AT6A 4HC1L 1FLTX 3U2SB 2NQCA 4U4BA 3OF6A 3V7AE 5D6DC 4YDVB 2B1AL 3PHOA 3CVHL 1S8DB 1JZ7A 4OI8A 4X99B 2VMFA 4GW4A 1ZLSL 2P48B 1NGYA 1P2CA 1X6LA 2WQRA 4X6CA 3SGEI 1QR4A 4XCFL 4EXPX 1XF2B 1INQB 3ARED 2HH0L 3BI9X 4G9FA 4QRRB 5FAAA 4KMLB 3BHBB 2RR3A 4GQPH 4GKNB 3GIZH 4N5ED 1I7TA 1EO7A 1RJYB 5DJ2A 3X14B 4L8CB 4GG8A 3TO4D 2J8UA 1I8IB 3MRPB 2H9GB 3F6IA 3RHWK 4K71C 4HF5H 5HGHB 3HR5A 3KR3L 4AM0A 4GAJL 3PQYA 5J6GB 5DEGB 4NHCH 2X1QA 3QUXD 4XNXL 3TBVA 1KB9J 3JTSA 4FFYL 4DWHA 1MCEA 4HDIA 4FQCH 4H5SB 5EZJB 1P7KB 5BV7L 3OGCA 2IAMD 5JMOC 4PJ7A 4L3EB 2HRLA 1I9JH 4OD1L 4HK3J 3QIUA 1X7QB 2XWJA 2XRAL 5D6CA 4JKWA 4PS4L 2FD6H 3BPOB 4H1LA 1CLCA 3CFCH 1RUPH 4RMQA 4F9PA 4KHXL 3IDXH 3U7YH 1A3LH 1PAMA 3ZYIA 4QXUH 5DDHA 1ZHBA 2RAMA 1NLDL 1ACYL 1CE6A 3FAXA 1A6VH 2GTZB 1ZGLM 2O93L 3TPUA 4K3JH 4JFFD 4LAQH 3M1BA 2ERJC 2VWEC 5FUOH 1FVEA 4XP5L 1FZKB 3NA9L 4NWUH 1KPUA 3TVMB 4U1IA 3ULVE 4HLZG 4DUVA 4G7YH 1P4LB 4Z0BH 2FEEL 4Y5YA 2SEBA 1AR1C 1EAJA 1NMAL 2HT3C 3EDEA 4PLKD 4OCSH 5DUMH 3L3OA 4ZAKC 3GM8A 1M6OB 4NZDA 4ZOCA 2JB6B 4U1LB 2D7OA 3IAPA 3WLWC 3O6MH 3DYPA 5EU4B 3SDXA 3B83A 3V5DB 1AD0A 1RHHB 5FYKU 3BD4A 3RZCB 4MQXD 5CBEA 3GO1H 1VB9A 5TE7H 4NM8L 2HLFC 3FB7B 1EJOL 3MCLH 4CKVX 1N7ML 5H2BA 1MI5D 2ADFH 5C08D 4N0FA 1V8HA 1KPVB 3GBMH 5DRZB 4PJCB 2IQAB 4Y2DD 1JPST 3QCUH 4BZYA 1KJMA 2AGJH 2FR4A 3MLTA 3IDMA 4PG2A 3IS0X 2MCG1 2YPLE 5KANI 1JWSA 3RVTC 4ZQKA 4ALAH 2PW1A 1QLEL 4OLUH 1IT9H 5BZDB 5K9OA 4LHJB 4HAGA 4GKNA 2VN4A 3MV8D 3WUWG 5I9QC 3TT1L 3DUSB 2NTFA 1I7RA 4H8WC 4XBPA 4XPAL 5B21A 3LDBC 3MTRA 1D5IL 3O4LB 3TBSB 1AXTH 5JLZA 1I9RH 3T0VA 3O41A 2IQ9H 1C7TA 2ATPA 4DN4H 4L9LA 1NFDF 5GJSL 3UMTA 4OLXH 1MVUA 1IGTB 1RJLB 1MFBL 4MB3A 1SJVA 1RMFH 3F7PC 3OTTA 3ZYJA 4DGYL 4ZD3H 5C0EB 1I9IH 2QADD 3AB0B 3ARFB 1C8PA 2FD6L 5CP7B 5CEZL 2H2SD 3BEVA 3HZMB 3D69A 4EI6A 4JRYD 4Y2OA 1T22A 1TJHH 2FCBA 2LTQB 4P5MA 5IB3B 5FK9A 2BNRB 1I4FB 3HS0B 3BP7B 1CFNA 1PZ5A 3O0RL 3HAEG 1QZ1A 3IRPX 1KCRH 3FRPG 5DYOB 4EUPA 1OAYH 1VDGA 4PRDB 1QSEE 4YBQC 4QT5A 2FO1A 2Z31C 5C6PB 1EIBA 1B3JA 2WNGA 1AD9A 1V7NH 5JHLH 4ERSL 2BY1A 3BD3A 1PW3A 4YBLC 1FJ1A 4NBZB 2ZCLH 4OZFB 4NRXB 4Z95H 4EBQH 2QR0A 2ILLA 1MLCB 1DQLH 4YO0A 5CUSL 3W9EA 4PTUA 2H32A 2W1NA 2W91A 1EFQA 1S7QB 3OKLB 3BEWA 3VFWA 5F96L 4Q6IA 1D5MB 3HUJF 4MJ5B 4H5SA 3MA9L 4GAYB 4MZ3A 4OLYH 4HDIB 2C1OB 3CFIC 5JDSA 2HJFB 3EJYD 1TZGL 5I8OL 1MCOH 1FIEA 2IEPA 1IC7L 3BKML 2VLKD 3CC5A 1TQBB 4NIKB 5A2FA 3OX8A 3O4OC 3VXOA 3LIZL 5EFIA 5EZLB 3C60C 4Z7UB 3LMJL 4JHBA 3U4BL 3ZTJG 2PO6B 1BMGA 4LCWB 3OZ9H 1B2WL 5FYLL 2D3VA 1AIFB 5DTFB 1CT8B 4C56B 3ULUE 3QUXC 1TJGH 3X14A 2HT4D 4JJ5B 1ZK9A 3MJ9H 3INUL 5I1AA 3FOMB 2A1WL 3KS0H 2AXGB 3QFJA 4JFPA 1NGYB 1P2CB 5EIQA 4WI6A 1FORH 3REVB 3FO2A 2FJHA 3ETBF 4UBDD 1IFHL 8FABB 4MAUH 5F6HI 5M95B 1X5IA 3QPQD 1Y6NR 4HHAB 3VI3F 5CSBA 1Q9OB 4QTIH 3UYRH 3C5ZC 5BJTB 1FVCA 1NMBL 5BXFA 5HDOA 1DBJL 3O9WC 4RIRB 1RIVH 1SMAA 4W81A 1VPOH 1YNKH 3FN0L 1Q0XH 4K3HA 3WN5A 1YC8A 2WBJC 5CWSA 4YHMH 3C5JB 1TVBB 5KOVC 4PJXF 1MJJB 5CD3B 4JRXD 3ZDYF 4JZJB 3T04D 1B9ZA 4XH2A 4KVCL 1DVFC 5F7DA 4ZDHA 1CDHA 1LO4H 3LKPA 1B0RA 3BDYH 4PLOB 2NY2B 3KGRA 1I3UA 1TNNA 4LLYB 4Q0XH 5IW6A 1U8JB 5JXED 2V5SA 5TDOB 3T3PE 4IMLA 4ELKA 3FQWB 1CDUA 3U30C 1Y0LB 3HI6H 2VL5B 3OKEA 3SBWC 3KLAA 2VLRA 3TN0D 3DVNA 4G9DB 5DMJB 1WWWX 3O8XC 4OKVB 4P23A 5KAQF 5DQDL 1JGLH 1GVIA 3BPNB 1HCFX 4YEFA 4L4TA 3ILQD 4OFYA 1MCRA 3QUYC 1ZHLB 4QT5B 4AL8H 1GZQB 3SEPA 3EYFA 2OQJA 1RK0A 2YBRB 4L3CB 1R5IB 3BFOA 4TNWK 3F7YB 3BQUA 2A9NH 4IOFD 4DTGL 4Z7NF 5JW3H 1CD8A 3BP7A 3HB3D 2NY1D 4HFWB 4G6KH 4XAWH 4EI6B 1KTRL 5FOBB 4MNHA 3MRIA 3MRMA 2QQNL 2WLZA 5FGSA 4YFEA 1A7RL 5GGQL 4LGRB 4M00A 3PXHA 5E6IC 1FL5A 2IANB 4GRWF 2FZ3A 2YUZA 3FQUA 5HDBE 5I8EA 2DKSA 1BAFH 2DJUA 1HSBB 3WHE1 4MHHG 1RURL 5MENE 4NOFA 2JLLA 4KU1A 2A1WH 1U8NB 5DJ6A 3HE7A 3IJSA 4XP1H 4RQQB 4NO0B 4XCEA 2I9LA 5TE4H 3HE7C 3SKMA 3V4UH 3ARDB 4LNRB 3WFZA 5C7XL 1ZWIA 2VABB 4OZGB 1XF5B 4FQHB 2AKRA 5KVMC 3MRFA 4BQBA 3NABL 1WAAE 4NO5B 1JZ8A 1WK0A 1DEEA 1RUQL 3U0PB 1HHIB 5J3HC 3CX5K 2EIZB 4LCWA 3SCMA 1K8DB 4KKAD 5IR1B 1I8KB 1A47A 3QNZA 4EVNA 3DV6B 3W11C 4FQXA 1NAKH 1GAFL 4R96A 3RVUD 1MPAL 1VGEL 2YEZA 5C0GB 2QHRL 5DXWA 4WTZA 5IQ9B 3DOSA 1OW0A 5ECJE 1T2XA 1ZLWK 4KZEH 4NFDA 4PJXA 5D7JA 5KZCB 1R24A 3HC0A 1J0JA 3TCXA 3U1SL 5JDSB 3FB7A 4UT7L 1U0QA 3MLUH 2WUCH 4HGWA 1QYGH 4K7PX 4LLDB 1B4JH 2OMBA 1YPZA 2A74A 5F8RC 3U79A 1IE5A 2XY2A 5J13C 3FFCD 3QIBB 3LPGA 3B2VL 3SDCB 5EPMA 4ZPTB 1TJIH 3VFSA 5F3HA 1UM4L 3E8UH 2C3XA 5ISZB 5JOPD 4OZFG 1S7WA 5A3IC 4XVSL 2X7LB 3PIQA 3H2WA 3IVKA 4J3XA 4JDZA 4UQ3B 1PSKH 4JFZH 3S8WA 4ZUUB 2JCCE 3OXSB 2X4NA 3ULUF 5F1NA 1IGYB 2A73A 2AVGA 5KG9B 4CL7A 3OAZK 2R2BB 4OZHB 4LAJH 4Y4FB 5T3ZE 4YWGH 1QBLL 4G8IA 5JLZB 2HP4A 1MOEA 3NGBB 4G5ZH 3U7WH 5J9PA 4OGAC 4F33B 5B4MC 3VXTB 1UWEH 5GGTA 3BJLA 4CADB 2AEQH 4NO3A 5K9OB 3FMGL 3UTQB 4NKDA 4IIQA 3L3JA 3FN9A 4HWBH 1W72A 3JSSA 2KQMA 1T83C 1IGFL 4QXTB 1MFEH 1ZVYA 2OR9H 3HRZA 2JJVA 2VDQH 4ZODA 2E7BA 3PXJA 4O2EB 3ZHLA 3OKKA 1RI8A 4MYWB 3LZFH 3SKUD 2Z4QA 4MCZA 2YPLB 4J4PD 5EBMA 3WMSA 4N0FB 4KRLB 3TZVA 1FFNA 4MCYB 2UVEA 4E41A 1UQSA 5JUEL 3OPZL 1T0MB 3O81A 2WBWB 5HY9B 1IGJB 4OFVA 3GBNH 4QWWD 2DYPB 3BP6A 3W82A 3SGEH 5T5FH 4XPGL 4LCIL 1WWBX 1XZ0B 4JY6A 3MRRA 4HS8H 43C9B 4JR9L 2PW1B 2CKBB 3PDDA 4PLJC 1AY1H 4P5TA 4YIQB 2EYSA 3BP5B 1J8HA 1V7NL 1Y6MR 2J6EL 4Q9BA 2JCCB 3ILQC 4YXKL 3SCMD 4Z76B 4OV5A 2ICCA 5GS0C 5ID0B 1FH5L 3CFJB 5E7FA 3Q1SH 5LAXB 1OAXH 1T6WA 3NPSB 3EDJA 1SJXA 1NC4D 3M17A 5L2KB 2FX7H 3QDJD 4HULB 2BSSA 2G60H 4K9EC 4D0CA 3V6OE 4ODVL 4X5LA 5IVXE 3PHOB 1JIBA 3IVKB 3U0WH 2YZ8A 3IT8D 3ARBC 3GSNL 1C08A 4OCRL 4JQVA 4M7ZC 3DSFH 3CFKA 1YDPA 4MAYA 4FXKB 3BE1H 5DQ9B 3T08A 1DSFH 4M8QA 3K80A 2CR6A 2GAZA 4MNQA 3SO5A 2XTJD 3QDJE 1PG7W 3JBG7 2Y6SC 4LSDA 1UXSB 2YUWA 4JJHA 4LSPL 1T89C 1XGYL 3KYNA 5HHVH 3KYMB 4PGEB 1VADA 5TE6L 4CU6A 3DV6A 3N9GL 2P8LA 3K1DA 1FNHA 2MPAL 1IZJA 4QRTA 2X6MA 3ULVD 1BWMA 4JB9H 4F7MB 3G5VA 1MFCL 4TVSa 5HPMB 1LEKB 3KPLA 4XBGB 5J1TC 5AG8A 1ZKAA 3FO0L 4N5UA 2RCSH 5J6HB 1NDGA 1IGCL 3EFFA 4FQHA 2BJML 3MLWH 4ZS7H 5L9DH 2VZSA 3BZDA 3I6LE 1IFHH 1U8QB 3ZT7A 1U58A 3JTTB 4P2RA 4NQTA 4WV1B 3U9PH 5DLML 4XZUB 2P24B 3UEZA 1DQQB 2BVQA 4FFVC 4MGXA 5K33A 3I6KA 3O3DA 2DS4A 1J8KA 4GW4B 4YFLF 5EUOB 2D2OA 2DBLL 3VA2C 3IKKA 4GW1B 5B8CC 3CXDH 5IHZB 4HH8A 5L88L 4G6KL 2HYMA 4M6AA 1XF3A 12E8L 1J7VR 3L5XL 1OP3H 4M6ML 3O11B 1BQHA 2UWEF 5DJZB 3DIFA 3WSQL 5F71A 4HPOL 1A4KA 5DVNA 5FO8A 1C5BL 4UNTA 4DW2H 5CMAA 1FV1A 3DO7B 2AQ1A 2K7PA 3KPSB 2DI8A 4YR6B 1IARB 4W6YB 3MFFA 1J1PH 1HDMA 2ZSVB 3EYQD 3P0GB 4H26B 3HZYA 3DRTA 2R4SL 4ZO8A 3ZE0E 4CVZB 5GRVL 5ENWB 3QUZC 4Y5YC 3NIFE 1NBYA 3V0WH 2ZCHH 4LL9A 4UT9H 5D5MA 1S7SB 4X4YA 2JCCF 4DKDC 5GISL 2K9UA 4YDVA 5HI5C 2X1OA 4TUKH 4Q2ZA 3LQAC 1S5HB 1T5WA 2LVEA 3D9AH 4CU8A 3MV7E 5MP6L 2NXYC 3DX6B 2YD5A 4MDIA 2G5BB 3GI8L 4OKVA 4IRSA 4XMLH 1OGAD 3L5HA 4HLZH 4PRIE 3O2DL 5D7IF 4HK0B 35C8H 3LPFA 3TO4C 3PWJA 3SKNB 1YC7A 5FO9A 5DS8B 1FFPA 4NNYA 4EBQL 4XC3L 5I1IH 4X0KB 4ZUTB 1NMAH 3BKYL 5DVKA 1X5AA 4ORGA 4KMTL 5ICZB 4M62L 1G7HA 4P59H 4LLWB 4G80A 2AK1H 4OF5A 4R7NA 5DURD 4WO4C 2H3NB 2LVCA 4P23D 2Q1EA 4LLUB 4Y1AA 2ICWI 3O2DA 4C4KO 4JFEE 4O4YH 3FTGA 2FEEI 5D2NC 4XNUH 1U92A 5IP4A 4IHOA 1DEDA 4U0RC 4I2XB 4WW1A 4APQD 1HYSC 3UCRA 5CKGA 3EO1A 4ZOAA 1NGPL 3VGAC 1FNAA 4OCLC 3HMWL 1HQRB 4J1UA 5EOTB 1ZEAL 3KDMB 4D94A 1QQDB 3MRKA 4WFFE 1OLZA 3QCUL 5D8JH 2ARJB 4RFOL 1NBVH 1JWMB 5MEOA 5DA4A 5DLMH 1YY8A 2B39A 4MD5B 5ELIA 1FN4B 1PX4A 3D0VB 1NL0L 1JUFA 1U42A 4EI5A 4KVCH 4YDKL 1YEGL 4XCNA 5KANG 2DB8A 4JO4L 4XVUD 1R5VB 1HZHL 2D0FA 4YLQT 5HYSG 3RWIB 4GBXD 4WCYL 2WWKO 4LCWD 3QQ4B 4Y4HA 2P8LB 1BFOB 3HCVB 4JLRB 4NZJA 1FDLH 4WFHE 1TVHA 4QTIL 2DMCA 5JIIA 2VKWA 5DJXA 5E6IA 1JI1A 3FRPA 3FQNB 4ZFGH 2QSCH 3KPQA 5DC4B 1VEOA 4ZO7A 4XC3H 1D5XB 2DN7A 5DO2D 5HHME 3T3PF 1OCWL 3AUVA 1IZKA 4MDJB 3K0WA 1CG9A 4KUCD 5FCUL 5I1KH 1N59A 5JZ7D 4WW2F 1H0DB 3OKNB 3D18A 4Z78A 5FF6A 1OCWH 4K23H 3ZZ1A 4M1DL 3BH8A 5CILH 4UQ2A 3DGCR 4WTXA 3MLVH 4C57C 1S9VA 2J8HA 3D25B 2R1XB 3P9MB 1JPFA 4N8VB 1IL1B 3FT4A 4K2UH 2AJZA 1U3ZA 3IFPA 4S2SB 4NRXA 4WRLA 3P4OA 2IGFL 2AJVL 2JF1A 1XFPA 2KZ1B 2OZ4A 4M6NH 3MV9E 1MNUL 1KJ2L 1KFAH 2DQFB 2W9EH 3JV6A 3Q1SL 1WCBA 4ZNEA 3MRRB 4LMQI 2F54D 4X6DA 4FQ2L 5C0CB 4TVPH 4PJIA 2VLLB 5HY9A 3X13B 3LKQB 3VH8B 2YHGA 3VFTA 4K7FA 2FECL 3O2VH 3GDBA 2QADB 3MXWL 3SKOA 5C0DB 4MSWA 1GZPA 1TFHA 3VGFA 1RUPL 4EDXB 1PKQE 4TVPL 4PRAB 4HWBA 3MMEB 5CZVH 4ZMAT 2GITA 3G9AB 3R0NA 4G8GB 4JN2A 4GAFB 4P3CH 5DJCB 4FXLA 2AJ3A 3I2CL 3T0EB 4KI1A 5E2UH 5E8DL 2ZG2A 5DRXA 4U1MB 4FTVA 4HH9A 4HS8L 3MV7A 4K94C 3BQUC 4XPTL 3P0VL 1U41A 4HZAA 4X4ME 3VMOA 2RJMA 4O2FB 5DRNA 3KPNA 3RI5K 1KB5L 4QRQA 3QZWG 1JWUA 2LV4A 1BIIB 1MEXH 4S10A 3GHBH 3WS6C 1D6VH 4JM2D 1DBKL 4R26H 3SHSA 3MUGA 2LE9A 5IOPA 2YWZA 4OD2B 3I75B 2F19L 3L3HA 4Y2DB 3S6CA 2VXQH 2XN9E 4OCMC 2DQIL 3OBAA 4LSTL 5CJOH 2R29L 5T33L 4G8FA 1MCKA 4YQXL 1AHWA 4DZ8B 4LPXA 4LRNL 4GS7C 1Q1JH 3FT4B 5DRZA 4AEFA 4JFZL 1OP5K 3RFZC 1XR9A 2X05A 4GXVL 1ED3B 5MEPA 5B39G 4DGVL 4DCQB 1INEL 5J57B 1E27B 4PGDB 1T89A 3VXMD 4YUEL 2R23B 4GXUN 4LSVL 5D1ZC 4JKPL 3SDCD 2H26B 3PGDB 2Q76B 3BZFB 1WZKA 1QLEH 5F7UA 4ELMB 3MCKA 1FFOA 3QPXH 1YNLH 4BFIA 2CLRB 2I27N 3EO9L 4C83B 4G42B 2DDQH 5LBSL 5HYQB 3O3EB 1AQKL 2CGRH 1CL7L 3DMMB 4MDJA 2AJZB 2RGSA 3O6LL 4JFXB 1QSZA 2ZKHL 3OB8A 4NT6A 3M07A 4S1RL 4LDOB 4RZCA 4L4VA 4LBEA 2QHRH 1YEKL 5GGVY 5ITBL 3MRCA 3JWNC 2J88L 2ZUSA 2QKIA 3BRDA 1SJEA 5ID1B 3PP3K 4H0HB 3QH3B 1DVFD 5HGDB 1SYSB 3G6AA 5D7SH 1QYGL 1OHQA 5IB4B 4LCIH 2I07A 5ETUB 1U9KA 2VXTH 4NO0A 1N64L 4PJGA 2XWBA 3CLEH 4PJ9A 3SE3A 5E4EC 5DUML 2WINA 2JELH 3V6ZB 4G9FD 1FNEB 3ARGD 4EDWL 1IGIL 1RJCA 4NO0D 3CUPA 1QPXA 5HBBA 4LSRH 1WWCA 5K9JH 4XHJC 4ORZC 4MXVE 2AEQL 3TIEA 3BYTA 5AEAA 1DCLA 1FL5B 5IBTL 4Y19A 3LB6D 1TVHB 1F02I 2RB8A 5EORH 3O45A 2JTDA 2BRQA 3HCVA 5JOPE 1SYVA 4R4FH 1EJOH 1EAPB 5T5FL 3BZ4B 3Q5YA 2AQ2A 3N1GC 4DZBA 1GCFA 5L2JA 1ZANH 2E9BA 4RGNC 3WFDH 1NCBH 4R7NB 3MV9A 6FABL 3WFCH 3QSKB 2WIMA 4G5ZL 4PR5B 3U7WL 3WS3B 3B8SA 2NW2A 1O0VA 1MWAA 2HFTA 5DUBB 3QULA 2APTA 3AMKA 4OGAD 4Z7VE 5AUMA 8CGTA 1IAIL 4QHKJ 3RVVC 4QRSB 4WWKC 4KGJA 4WHYG 1F4WL 2XXMB 4Y16D 4GKZA 4PGCA 2ZUYA 2CDEA 2FX9L 4PJEE 4GUPB 2OLDA 3GI8H 4W4OA 4U33A 2JK5A 4BK5A 3D25A 4WUUE 3GMRA 2HT4C 1BF2A 3DMMD 3VWKA 3G5ZA 3CDCA 3NCJL 3Q3GB 1T1WB 4LQFH 5D5MB 2GSGA 4GFTB 5IW6B 4KRPB 3RVXD 1MCOL 3D39A 5I1LB 5FCSH 5GHWH 3GK8L 3K8KA 1XCQB 3HNSH 2PR4L 5EWIL 3QI9A 1KTKE 2V7NA 3HPJB 1FNGA 3QDJB 3KJ6H 5E08L 3MREB 3OKNA 5L2KD 4TRPH 3O2WL 1H0DA 3VU2A 2NY2D 3QEQB 3RDTA 5FO9B 1F42A 1KCVH 5L0QB 1X5YA 1BZ7A 2VOTA 2BMKA 1UA6L 5GZNC 1RURH 2FLBT 3H9YA 4PYHA 1YEFH 1BLNB 5IB2B 4L29A 2OJEA 3OMZA 2BFVH 4NC1C 4LSVH 5JORB 2FBJL 3T77A 3E3QE 4TVPD 4DK3A 4YBQD 3BH9A 5C7XH 5B3JE 4DN3L 5LG1A 4ODWA 3MJ9A 1LNUA 5FHAL 3MACL 5GSVA 4ZNEE 1JTTA 4V2BA 3FOMA 3KYKH 1J5OH 4M7KL 5I1AB 4PP2A 2ZNXA 3G6DL 1IAIH 3H3PL 2DLTA 2VR9A 1UVQB 5C0BA 2H2SC 4XTRD 1X9QA 4IMKA 4W6XB 1G9ML 1KN2L 3B5TA 2ARJA 1VGEH 3QPXL 2Q7NA 4DKFL 5BOZG 1CGUA 1K2DA 3CU1A 1HINL 5SX4H 2BP3A 5HYEA 1F6AA 1VFAA 4HJGB 4HX1A 5INCA 2C1PB 3UTZB 2PO6D 3JXAA 5KTEL 1AFVL 1CE1L 2IG2L 1UJTA 3E6HB 4DK6A 5T1DL 4WI9A 1XIWB 2KQNA 5IHUL 2HMIC 2P49B 3AXLB 4W4NA 1HQ4A 4NPYA 1WZ1H 4U1KB 2XKSA 4Y4KB 5FYJE 5JIPA 4HBCL 3RIFF 3OJVC 1UB6A 4X8XA 5F7FA 3CX2A 5D5MF 3L3KB 1B2WH 5FGBA 1YEIH 1YDPB 1I3VA 3P73A 5GS0H 3EJZD 5HHQB 4H8WH 1WBXB 1P5UA 1OD7A 2MFNA 3KYOB 1VACA 4KV5E 1DTUA 3RVVD 3UTSD 1JFQH 4PRIB 3QEUB 4P2OB 3GRWL 1N2RA 4FZ8H 5F6HJ 3PJSB 4F37K 3BZEA 5EUOF 4WEBH 1NAMH 4JFXA 5D93B 3RVTD 4L4VD 1FQ9C 3PABA 3X12B 3GO1L 4AIZA 5C0JA 4DOHB 4F7CB 1NEUA 4MNQE 2BHZA 1MWAL 3PL6D 3RDTB 5I1JH 2IH3A 2OR7A 2VZOA 4YNYB 1N6QH 2FB4H 4NZTL 2APBA 4I5BB 5IB1B 4ZTPL 2DQGL 5H37G 3TH3T 1AXSB 1AFVH 2DAVA 4GRMA 2AS5M 4MXQC 4U2ZA 1QG3A 4JHWL 2DLGA 4P2QA 1T20A 2X4QA 4XP4L 1X5ZA 2VZUA 4GXVH 1Z9LA 1ED3A 5MEPB 5TJWK 3T2QA 3V4UL 5J11C 4NWUL 2HKFL 3AC0A 5TPWH 1NUGA 2FL5A 1BQHG 1DQQA 1WVZA 2O5YL 3P30L 4TQEL 4MNQD 5DO2C 4W6WB 4F15C 3ESVF 1J8HB 1NCDH 3LEVH 2CRIA 4KI5C 4XCYA 5I2IB 4GBXB 5CCKH 2IQ9L 5BZDA 4KKLD 3ULUD 1EDQA 4MA1C 3F8UB 2I07B 5ETUA 4F33A 4Q9CA 3AGVA 3R1GL 3CGTA 4NP4H 4JQIH 1HXMA 4DZBB 3MJGX 4C56E 4O9HH 3NH7L 2YPVL 3WIFB 2IPTH 5DA0B 2XZQL 4EUPH 5FYJU 4OLZH 3G08B 2Z4QB 1H3GA 4RFNC 1IGYA 1CICD 4ZUUA 2GITB 2YS4A 2YRPA 4XCCH 3RVUC 5FCUH 4HBQA 2YZ1A 4R0LB 4RAVB 1QD0A 2F8XC 4OB5H 3IRZA 1KB9K 1CFVL 1NGPH 4HUXA 3I6GB 1WISA 5F3HB 2VDRH 4ZPTA 1M05B 5DMGC 2GAZB 3J8F7 2BY2A 12E8H 1N64H 4PJGB 1CI5A 3MLZH 1WEJL 3ULSB 3ARQA 1ZLVK 1UG9A 5GSRB 4YHYC 1MAKA 5FGCB 1K4CB 4MB5A 3DUUA 3BZFA 1QRND 5DC9B 1LWRA 1V3LA 1OGAB 1HH6B 2QKIB 2A73B 3HA0A 3OXSA 2VC2L 2A6DB 25C8H 3KWWA 3U0TA 2WW8A 4ODSL 4FNLL 1I8MA 4F57L 2E6QA 5C0GA 3NCYS 4NN6B 4YFDB 4XX1E 5IJKC 5LAXA 4C83A 3CZFA 1XH3B 2N4IA 4QOKB 3EYVB 1NCBL 4UOW0 5INDB 2A6DA 5SWSA 4UUJA 2NY3C 3RX8A 3QDMB 3CLEL 4LGSB 4NNPL 4BH7B 4LASL 5JXAH 1YPZB 1A7QL 2A74B 3HPLB 3O2VL 4XWOD 2GK2A 5DQDH 3O0RH 5B38G 1CICB 4ONFH 1NCCH 3RPKA 4GAGL 4M4RA 4K23L 1MCCA 1VFBA 4OF6A 5T3XL 3TF7C 3IFLL 1S7RB 3QUYD 4LVEA 4IDJH 3VFVB 5I1EL 4M62H 3PHSA 3MOBL 1JMXA 3V5KA 3MXVL 1TJGL 4QHKI 4PRHB 1DJSA 1KB5A 2EH7H 4H20L 1FC1A 4KY1L 4R4ND 1W72B 1A6PA 2VAJA 4JFDB 2D7NA 2BSRB 3MRPA 1BZ9A 4Z7VA 1NJ9A 3LD8C 4QRRE 2EKSA 5AD0B 2C3VB 3ILPA 4J23A 4OZIF 1K85A 4M1CD 2VLJA 4OCRH 3S4SB 4DEPC 3MROA 1F45A 4NQEA 4ZFFB 5MENB 1UWGL 3AY4C 4V1DB 3TT3L 4MAUL 2DQTH 1N4XL 3D87B 4JFYA 3VDAA 4DVBB 2R2BA 3QI9C 4ZFZB 2R0LL 1IC4H 3WL9A 1AKJA 3EO9H 2PYED 1SEQH 2OR8A 2R0ZH 1G6VK 4PGZA 2J3SA 2UZXB 1NC2B 4YHPA 5HVFB 5F7EL 3DVGB 1N0LA 4JAMB 3ZL4L 3PUCA 1MCJA 3PWUB 1U91A 3ARPA 5EBWB 4N8VA 1ULVA 2QSCL 4JQIL 3MO1A 2J5LB 3ZE0F 1HINH 4UIMB 3F12B 1RHFA 4KH2A 4NRYA 3N85H 3RIAF 3WLBB 2XYCA 2FSEB 2GSIA 4U6VH 4DGVH 5E6YA 5IB1A 4ORGB 5F6IB 3OJDB 3RP1A 3RY6A 1WCBB 4MJ6B 4RCAA 3VXUA 4YNYA 1FNFA 4ZUSB 2EXWC 4IRSB 1XGUA 1CQKA 2MCPL 3DX9B 1KEMH 5D8JL 1FVCB 3OKDA 4PV8A 4JRYB 1N2RB 4PJBE 4X4YB 3NCYP 4HUWA 1A22B 1BJMA 3M8OH 3SCMB 4JCMA 2ORBL 2H1PL 1JP5A 3EGSB 3SE9H 2AXFB 4R2GD 3GIZL 2FX7L 2BOCA 4P2QD 4PJBB 2VDML 2OX5A 3CSYB 4Y5VB 1M1SA 5B38A 4LLQB 2DYPD 1DZBA 2UYLB 4XWOC 5DJYB 2Q8AH 1U8NA 4IJ3B 5DJ6B 1KTDB 5JA8B 5HHOA 4PLJD 1JWMA 2BNQE 5DTFA 3WSQH 1NLDH 2VXTL 2P8PA 1A0QH 4IOIB 5IJVA 2EH8H 4HIEA 1JRHL 4NNPH 4NQCD 3FRUA 3LY6A 1Q9KB 1SBSH 1HK6A 4Z7UF 4CNIA 2DRUA 3H9HB 5TQ0H 4N1HB 4J2XA 3DBXA 3C09C 1BFOA 3V4VL 3UTZA 1RIUH 1BVLA 1QOKA 3CLFL 2HFEB 3G5XA 2EYTB 1IC7H 1CD0A 1IGMH 1KT2B 5C9JA 3MOAH 3NCFB 3TIDA 3V4PH 4EI5B 3WDIA 1JUFB 3HRPA 1A6ZA 1GAFH 4PLNC 5ICZA 1CT8A 4C56A 5ITFA 6CGTA 1QSVA 2CK0L 3VG9B 1OF2B 4JQVC 2DM7A 5K9KB 3TJHC 4K3JL 5D7LE 2XA8L 1DQJA 4L4TB 5F9OH 4O5LH 3GSNH 4HT1L 3QUZD 3EOTH 2HG5B 4HKXB 1EHAA 4BQ8A 4F37F 1OAQL 4KROD 3V52H 5IW3A 1G7QA 3UJIH 3O4OB 3IXTA 1QLRB 4UTBH 3R1GH 2VLRB 2Z93B 1IC5L 2PO6C 5F9OL 4OFIA 4GQ9L 3R4DA 5F72S 3KPRE 5DR5L 1U8JA 1NFIB 4MJ6A 4XCFH 5C8JB 2XG4A 4PRDA 2V7HB 3T4YB 4JFFB 2J4WH 1JPSL 4OCNC 4ZAKA 1IM3B 4JZJA 2VLJE 5EO0B 1IRAY 3C5JA 1QO3A 3UO1H 5FK9B 3P4MA 1YN6A 2Y1VA 1JZ6A 3DSFL 1OGTB 3B5GA 4TOYL 1KIQB 4M1GL 2QR0B 3JWDH 2UUDH 5I17A 3TYGH 1JGDB 1WEJH 4H88H 5T1LD 5FB8A 4JY5H 4LARL 1G0XA 1CDIA 1RJLA 3OJ2C 4NDMB 4G6JL 2N7AA 3O6LH 3WL9B 2B1HH 1EEUA 1CL7H 1CFQA 1FZOA 3GMMB 1J9CT 4IEFB 5IQ7H 1ZTXH 4OF7A 5I73C 5L9DL 4P4RB 5F1KC 3WEXB 4POZD 1P1ZA 2A6IA 4QRSA 3HZKA 4XWGH 2X44D 4BSVA 4L9DA 2MTPA 3H9SE 4XPAH 3C5SB 3QNYB 5DK0A 2G75A 4PJHB 3S4SA 4OQTL 3HZMA 1FL6A 4Z7QF 3V6FB 1YZZA 2IALB 3MRDA 1EHNA 1NJ9B 4YX2L 4LVOC 1FGVL 1U3HC 3AS3A 3G6JA 4QXUL 3ARGB 5TGBA 3U30B 1IGJA 3S98A 4LF3B 4Y19E 1UH4A 5IHZA 5KS9F 3CXDL 5JW4Q 1FSKC 4Z7UA 1Z2KA 2C4FT 2QEJA 4NO2A 3NZHH 3EZJB 1HI6B 4QRRD 3T8XA 4PJCA 3T2PA 3HC3L 4BFGA 2VQ1A 3Q48A 3N0PB 2D9CA 1BQUA 4AH2A 3VXPB 5F7HA 2WQ8A 5GGRB 1T66D 3KYKL 4GRWE 4X6EA 3P2TA 5KSBF 2WINB 3LH2H 4MQTB 5IMKA 5C0AB 4WO4A 1A1MA 4EEEA 3GHEL 1MREL 1ZANL 2BOBA 4PJEB 1CYGA 2YXFA 3FCTA 3NIDF 4KI5F 4GRWB 3VXRD 2HJLA 3GSXA 3L1OL 1O7VA 4OSUL 5HGDA 1ODAA 1EHLH 2AJUL 1W0WA 2ITCA 5KG9A 2HRPH 4FZEL 4RA3A 2YKLH 3MRCB 1UACL 5BOPA 2ICWJ 1MCNA 3VFMB 2X4UB 1SHMA 3BT2H 3WV0A 1QFWH 4M1CC 3A6CH 3HR6A 1MHEA 3W0WD 2XXCB 2FATH 2ZSWB 3JWOL 1PYWB 4R90H 2BSSB 4D0CB 2GIYA 1MY5A 3VWJB 5IMOB 5FECB 4KK9C 1GGCL 4O02L 3A67L 3VI3E 3QXAA 1RU9H 4QO1A 1E6OH 1RULL 3OJMB 5C0RH 1TMCB 1FGVH 2DQTL 3MODL 5FKPA 4POYA 3EYUH 4O51A 2BY3A 2FHFA 1CU4L 2MKLC 4XNZC 2WUBL 2VLKE 4MAYB 3SO3B 2YWYA 3VXUE 4TPRL 2HVKB 2PCPA 3BIKB 4PJXE 1CTNA 2VDOH 2AEPL 2Q86A 5HPOA 3QXAB 4OZIB 1J0ZA 4HIXL 3ZO0A 2DTML 4Q7DA 3OB0H 1CDYA 2NXZB 1ONQB 2BNRE 1MLBB 1ZA6B 2YSSB 5TF1L 4DCQA 1UQSB 1FFNB 4MCYA 1XR9B 3TBVB 4Y1AD 4JM4H 3ECBB 5EH1A 5LBSH 4JDTH 5DF0A 1MY7A 3WFCL 5BV7B 2ATPB 4P23C 3SDYL 2BCKB 2LAAA 3MLVL 3UYRL 1K8DA 4YK4B 5DMKB 3DUSA 4YIQA 1X7QA 2XWJB 2AAVA 3QIUB 5K59F 4N1CA 5CEYA 4ZTOL 3MYJB 4ZUVA 4RMWA 2Y5EA 3G04A 3IU4L 4HZLB 5KS9A 2ZOKA 3ULUH 1ADQL 1JWSB 1P4IH 1T0MA 2ZCKH 1IAIM 5FUZL 4E41B 4U1MA 1KN2H 5CZKA 3T8XB 2E7MA 2QJDA 3C6LC 4U7KA 5LJYH 4PGBB 3DETC 5EWIH 4FNLH 1U8KA 2CJUH 4O2EA 5FXCH 1TNMA 3EDFA 4F58L 1PBYA 3HRZB 5FB8B 2VLKB 3VXSB 2WM0A 3CSPA 5CINH 3W2DH 3C08L 2ZPKH 4CAGA 5CBEB 4Y4FC 1OGTA 2AEPH 4RGNE 2IADB 4HC1H 2YUXA 1K3IA 3WKMH 1KJ2B 5EU4A 3SDXB 4E5XB 5AZ2L 4I0PA 1JRHH 3GZKA 3NGBC 5TQ2L 4URTB 3UZEA 3LV3B 3BUTA 2JB6A 1V7MH 4WO4D 1INQA 5GISH 1IM3A 2A6IB 1URLA 3AS1A 3OAYK 4P4RA 1WC7B 4WFHD 1L0QA 4Q9RH 5C8JA 1CFQB 1FZOB 4LPYA 4Y16A 1AGEB 3WLWD 5IIEB 4LVNB 3L5IA 1L6ZA 1MHEB 4EDWH 4AENA 5SV4A 3ME0A 3H7BA 5I17B 4XB8A 1R0AH 3PQYE 2HG5A 5ABDE 1WUNT 4HG4J 3ZDZF 1GOHA 1MCWM 5J56B 3BN3B 2BC4A 5I74C 3FCTB 3CD4A