2IQ9H

Pfa2 fab fragment, triclinic apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSLSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKNYNPSLKSQLTISKDTSRNQVFLKITSVDTADTATYYCVRRAHNVVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
total genus 35
structure length 221
sequence length 223
ec nomenclature
pdb deposition date 2006-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9H02
2LU3A 1CFSB 1T80A 3DI3B 4IIQB 4LEXL 3UTQB 1YPZF 1DQML 3UJJL 5D2LF 3VWKD 3REVB 1J8KA 3H2WA 3D39D 3GMOA 3PQYB 3JV0A 1U41A 3IF1B 4X6DB 2UZYB 1M05A 4LKCB 2G2RA 3UYRL 2Z8RA 4QYOB 1DSFH 5F7HA 1INDL 2CRMA 4Z78A 4RAVA 3T3ME 3ULVE 5ACLA 3VWJA 4KTDH 5KVGL 5A3IC 2MCPL 4FQCL 2QADD 2B5IB 4YBQC 3LB6C 4GW1A 2X9XA 1IARB 2AK1L 5FYKU 1MHHA 5B39A 4U3CA 1CXLA 1JP5A 2PUQT 4DVRL 4MCYB 2X1PA 1PZ5A 4X6EA 1QNZL 3VFMB 2HMIC 4C4KO 4NQUA 4LLQB 2QSTA 5GGTH 1F4AA 3RWHB 5ICXA 2C4XA 3P9WB 1T7VA 4KJWC 4OJFL 1CN4A 2HLAB 4JO4H 1A7RL 3GKZA 3LEVL 1G6RB 5E5MA 1YEIL 4I2XB 3NVQA 4I1NB 4JFEB 5CD3B 2FJHB 3GRWA 3QH3A 5H37G 5K93A 3MXVH 2FX8L 5CSGA 3I9GL 3MLUL 3PABA 3L5WA 5EZOH 1A47A 3GSQA 5DJXB 5EU7C 3EYOB 5F7FA 1F02I 1ORSB 4WFED 4LHUB 2IPUG 1H8SA 1MREL 1IRAY 5IEHB 1HKLH 1ZS8B 4HXAL 4JHAH 5EUKA 4HH9A 3JTTA 3QEUA 1MHPL 5DVOA 4JKKA 4POZC 4KKNA 4NBYB 5DA4A 5EU6B 1FVDA 3QDGE 2BOBA 3GMPA 2FD6H 4PJ7F 3BAEH 3FO2A 1WZLA 5FYKL 4UT9L 3T04D 1KCRL 3HAEB 1T1YB 2C1OA 2M8XA 3OKNA 3RHWK 2AJZB 2NYYC 2EDLA 1OL0A 2Q86A 4I18A 2J7LA 2FEEI 4MLIA 3D0LA 4OD1L 4IRZH 4ZYKB 1HI6B 4ENED 3FB5A 1NBYB 5C0AE 4V1DA 3IDNA 5HYQB 5KSBE 4UNTA 1CGSH 4L4TD 4G9FB 1HWHB 1OB1A 3S37H 1IGCL 2DL9A 2XXCB 3MRCB 1ZT7A 5ERWA 2VZSA 1U8QA 3ALPA 1WEJL 2X4RA 2NXYC 3LKSB 4LLYB 1CTNA 1QG3A 1GOGA 3AXLB 1WWCA 2QV2A 3QIBD 4HZAA 5CUSL 2JIXA 3E8UH 1LK2B 3GB7B 3OJVC 1VFBB 2W07A 4P2RE 4BYHA 4U0RB 5I6XC 2Y5EA 4Y5YB 2HJFA 3B2UD 5FO8A 1QFWL 4R6UA 5EG6C 5EZIH 1KTDB 3DGGB 3MUGB 5IB4A 1YY8B 3DPBA 2PW2A 3IDJB 4O5LH 4YX2L 3ARDA 2ARWA 5L2KB 2VOTA 5KS9E 4OLUL 1JPSL 4PRHD 1ZT1A 1YQVH 3LKPA 5FYLH 4KY1H 2H9GB 5JOFB 4JM2A 1AFVH 3WXVH 4UOJA 4D8PB 1ZLVK 4LMQI 3FONA 1I9IH 2PTTA 1U8JB 1FLTX 4HKZB 2YEZB 1PQZA 5EBLA 1J0KA 3UAJC 3T0EE 2W65B 3QG7H 3D18B 1NSNL 5E1AB 3NA4A 5T1LB 2AEIT 4LFHG 1JZ5A 3GI8H 5BQ7B 4XT1C 5K9JH 4YUEL 1MFAL 1R5WA 2Z91A 1FFRA 3MR9A 5C3LD 4NQCE 5C0JB 1KPVA 2ORBH 3QWOA 4EI5A 4DN3H 5J6HA 2BVEA 3TYGH 1BFVL 1HDMB 3HR5B 3FT2A 3UX9B 2JCCA 5KSBB 1UWGL 5D7LA 4EDXB 1CDBA 3IJSB 5KW9H 4R97C 3PWLB 4EUPB 1E4KC 3FQRB 1DANT 5M94B 4Y4KB 4NGHL 4PLKD 4QHNB 1SJXA 5D70H 3TVMD 1NCDH 3C9NB 4XCFL 3C6LD 4M1CC 4OLXL 4R2GC 1T3FA 3CAFA 3DV6B 2CLRB 2DN7A 5JDJA 1AXTH 3NZ8A 4AENA 1M7XA 2OR8A 4X7SH 5A40E 3VFNA 3DYMA 3QDJD 1LK3H 4G80A 3UTTA 1J1XH 4X0KA 2C4FU 3G5VB 4DTGL 1ZSDB 3EYSH 2KQMA 3VG0L 3O3BA 3DX8A 2FNBA 4JPVL 5GRXG 5KS9B 1EEZA 3L3GA 1JYWA 5C07B 5F89A 2Z4QA 1TJGH 1RJLA 1CLYH 3P0GB 4PRDA 2YMXH 4OCSH 5T3ZL 3ARED 3MXWL 4IIQC 1RJCA 3M45A 1MLCB 3TFKC 2IANE 4GBXC 1RUKL 1ZHBA 2WUBL 4ELKB 5K33A 1GC1L 4MAYC 1U3HD 3I6LD 1JTTA 3T0EB 3DECA 1DLFL 1UJ3B 3FQWB 1D5ZA 3TJEL 1B4RA 2QQNH 3HE6A 1IEHA 1A5FH 1JNJA 1WWBX 3TT1L 3ZDXE 1NFKA 3PV7A 1RZFH 3FOMA 1I8LA 4DN4L 2OMNA 5T1KA 1DBML 4OI7A 3VFWA 5HGAB 1YEGL 2WK2A 4M43L 3GM0A 1A9EB 3VRIA 1QFUH 5I16B 1R3IL 5FYLE 5IR1A 2YPKB 2A77L 3ZSSA 1G9NH 4M6NL 3L3JA 1V7ML 2B5IC 4XCNB 3C5ZB 3GBNH 1EFQA 5DJAB 2WWKO 5EBWA 3ALWA 4PJFE 1JV5A 5DHVA 3GIZH 4JG0H 4L3EA 4PJ9B 5B3JE 1TZGL 1NKOA 2A9NL 1CL7L 3BMVA 2QHRH 4CN1A 1HYSD 1CD8A 1NEZG 1D5XB 3HMWH 4ORZC 5ISZA 3SE4A 1IM3A 3ILQD 1BX2A 4G6JL 3CDCA 1A6VL 3M8OH 1RAMA 5HYJA 1O7VA 2ZG2A 2R29H 4AMKH 2VKWA 4GH7B 4ALAH 2YC1A 3HC4H 4F3FA 2JJVA 3K46A 4Z7UA 1JFQH 3WE6A 2EICA 3LKNB 3QXDA 4RRPA 4C56E 2DBLL 2R69L 5HXMA 1T7WA 4X6FA 4JPWL 3LV3B 5A2JH 4QHMA 1JWMB 1OY3B 3ARPA 5DJCA 1J10A 5HI4D 1CCZA 3V79C 2FATL 4NNXB 1S5HA 4RMQA 5HHVL 5TF1H 3DHJA 5KZCD 5HYSA 1OGAD 3QZWG 2IJ0C 1FV1B 2UUDH 3TO2B 1VGKB 1XF5B 4MQTB 4MLSA 4X4YA 4XNYL 4JANA 2X7LA 4Z7VF 2C7UA 2R23B 1ZLWK 4O58L 3UYRH 1HN1A 1OAXH 1N26A 4ZNEE 1A4JB 4P3DA 3WD5L 2HJKB 2YR3A 4Y16B 4DCQB 4RX4D 1LNUB 1U91B 3NA9L 3GMLB 2VABA 1KG0A 4HPOL 4J4PA 3BN3B 3MRFA 1T21B 4U1LA 4FQCH 2B1HH 2X89D 3O0RL 4DFIA 1YMMA 2YA2A 1LP9A 1Z3GL 3TN0D 1WQVT 1INQA 3SPVB 3UBXG 3WBDA 1D5BA 2Q20A 4DVRH 3D9AH 2ZPKL 3QEHB 6CGTA 1CI5A 4U1HA 4H8WL 1G7QA 5C8JA 1A3RL 5FM5M 3S34H 3IVKA 5IFAL 2F8OA 2FZ3A 1X5FA 4PJAA 3LEVH 2H6PB 1AGCA 2IBBA 4BFGA 1QSVA 3EOTH 4P9ML 3ZTNH 2DQDL 1GOFA 3C87A 1CK0H 4PV8A 3BGMB 3AU1B 1EVUA 3QB7C 4C56B 5EA0L 5H35A 3IDGA 2B2XH 4H0HB 2DJ4A 1GIGH 1PLGL 2HFFB 1JHKH 1HQRA 3F7PC 3GKWH 5I1JL 3LN4B 3SE9H 3WIFB 1JL8A 3FTGB 3OAYK 1H3VA 1EHLL 5EO9A 5KSAD 2YKLH 4D9LL 4Z77A 1MHPH 4TNVF 1KTKE 2NW2A 4KRNA 1GOHA 3UTZB 1EAPB 3V6OC 3T3PF 2VXVH 2E7HA 5IFHL 3MLTB 1JGLH 3L3KB 4YPGA 4KDWA 1UH3A 2F5BH 4UT9H 3TT3H 1AJ7L 1KCRH 4KFZC 5F8RC 3F7VB 1RK1A 1LO3L 2FIKA 4Z7NF 3HLAB 1F3JA 4NWUL 4KUZL 4OD1H 5HI5C 2OJZH 4KDTC 4HW6A 1XH3B 3CH1A 1BFTA 5EIIA 3WEXA 3RFZC 3ARRA 5JORB 4E9LA 3EO0B 1PYWB 3RL2B 2P8LA 4AIZA 5C0CA 4DK6A 4OKVB 4WO4A 1OCWL 1P2CA 1DEEB 3OHXB 2VLLA 5D96B 2BVUA 5IMOA 5E8DL 3B4NA 4N90E 3QUXA 4K8RL 4NIKB 4CNIA 3UTPE 5SWZD 5FYJD 5SX4I 2YRZA 1RJZB 5IB5B 3LN5A 4Y4KC 3FRUA 4R3SA 2VL5B 2NY2D 4GXVH 1KB5H 1XGTA 3X12A 4FQLH 5J0BA 5IWLC 4YAQA 1I7UA 3LS4L 3VFTB 1KN2L 3QFDB 1IE5A 3KLAA 5JHDE 3VXUA 5CEZL 1LGVA 4XMKH 3ARYA 1F4XH 4N8VB 5E95B 4N8CL 3STZB 4NKOB 1TQCB 1IFHL 1JPSH 2Q7NA 4WNQA 3O11A 1CFVL 4I0PB 4CL7A 3OJDB 2FO4A 1G7PB 1ZHKA 3BN9C 5D1XC 1CVSC 1JTPA 3O8XA 5DEGB 3TIDB 3M1BA 1OP5H 1NGZB 1Q9WA 4OZGA 5DXWA 3HN3A 3RWFA 4PJEA 2R0LH 1J05B 5M95B 1WBYB 5GGRY 5HHME 2X41A 3AUVA 4NQEA 4YDJA 5LGJB 1G9MH 3HNTH 4G8GA 3VXSA 2D7OA 4N5EC 3MNWA 1MHEA 4ONFL 4Q9QH 4PIRF 1UWGH 1CICD 3GNML 5AWNH 3W0WD 3OX8A 1YY9C 3MGTB 3K80A 5E8NB 1DZBA 2BMKA 2VN7A 1RZIB 4FQ2H 1I7TB 2V2XA 2ITCB 3C5ZC 2EXYD 4XCFH 3HNVH 5INDB 5F1OB 4P5MB 1I4FA 3FT3A 3JV5A 4LL9A 1A2YA 3MC0A 1FYTA 3O81A 1KJ2A 4U1IB 4IRSA 1KPRA 3QWQB 3KPOA 2CIIB 2AJYH 5EPMB 5T33L 4NJ9L 5FEBA 3V5HB 5F1IB 1LO5B 3RUGF 5I17A 1CXFA 2CO6B 3GSRA 4Z5RA 1F4YL 1IC5L 4KI1A 3SBWC 3K8LA 5FB8B 7CGTA 2Y07L 3VDAA 3SO5A 1I8IA 5E2UL 3JVGA 4P46D 4M9OA 4JPVH 2QHLA 5FUOH 1TTFA 2R15A 4XPFH 1S9VB 4PRAB 5IVXF 2A6DA 1Q9KA 2BNQD 5JIPA 5FDWB 3FN0L 3X3GL 4DGVL 4HIHA 1FDLH 5D9SB 5LKNA 3MV8B 4BSJA 1C08A 3U82B 2H2SC 4H5SB 1QO3B 2WINA 1AGFB 3TA3B 1JZ3A 5DEFA 1UWXH 2AI0H 4YQXL 1OWRM 4WWID 5DJYB 4MA1B 4Y5XC 1KJ2L 4ODUA 4OAWA 3ZE0F 2GTZA 5DRXB 1N4XH 1UB6A 2MMXA 1ZA3B 2GSGB 1QKZL 4JPIA 3WNNA 4LRNL 4Y16C 1IC4L 5IMKB 3K8KA 4M43H 4G6ML 5E08H 2OR9L 4AEHH 4X99B 1YECL 2AV7B 2IG2L 1W0WA 2HKFL 2MTPA 3DX7A 4FZ8H 4GRWF 4PTUB 2HT3C 5J57B 1HZHL 3C5SB 1QBBA 2CIKB 1ACYH 1PFCA 3O2VL 4YXHL 3QNYB 3QIUC 5C0BD 4G7VH 2P5EA 2GTWA 3QZWB 3SDXA 1BQLL 3CVHL 3D69A 4HIIA 2FBJL 4DZBB 5HHPA 1X9QA 1N0XH 2APTA 4L8CA 1QRNA 3CNKA 2KL6A 5EUOA 5IQ9A 3ZMRA 5BVPH 4IOIB 1IAII 1BVLA 5C0GA 1MCIA 2DBLH 1QLEL 3RZCD 3MACL 4LSVH 4O00A 2P47B 1A64A 3GIVA 4ERSL 3RDTA 4MQSB 4LVHB 2HT4C 5TGBA 2P24A 5D72L 2EDDA 5IG7B 1FNAA 2B0SL 1YEFL 4EVNA 4KKCD 3O45A 1VEPA 3BP6B 2ZNXA 1KUMA 3TBTB 1ZHNB 3MGOA 4JO3L 1YDPA 5HHVH 4LSPH 3CFDA 3KPQA 1KB5B 5F9OL 1QBLL 3PNWA 5JUEL 3QNZB 1QA9A 4D2NA 2EYTB 2VDOH 2CJUH 4HV8B 3FO1A 1IMHC 3TNMB 1MF2L 3MMEB 2OXGA 2DDQL 4LKXB 1DVFA 2MHAA 1AIFA 1S9XB 3S97C 1P5UA 1W0VB 4UQ2A 3L3OA 3P4NB 4P23D 3OKMA 1MIEL 3FOLA 3IXAA 4WIQA 1A7QL 4HUKB 4NM4H 3DVFA 2EE6A 1P4LB 3NN8A 3B3IB 5DJDB 2EC8A 4ODTH 3L9RB 3DVGB 3U46B 2YD2A 3P30L 3AVEA 3FAWA 1VKXA 1MCRA 4JB9H 5D96C 4H8WH 4CVXB 1KC5L 1U3ZA 3D1MC 4K3EH 1HHIA 4L8DB 5HY9A 3WO4B 1U8HB 3VFRA 1ORQB 4U1SB 4WV1C 4Y19A 5ID0B 1CLZL 4MZ3A 1UCTA 4OCRL 3WMSA 5F1SA 4J2XA 1CF8H 2ATPB 4NM8L 4OD2B 1KIPA 1QQDB 2DQDH 2EEBA 5E2VH 5E4EC 4BUHA 2BFVH 1O5DT 2Z31B 3DBXA 3F62A 3KR3L 4HPYL 3DTXB 3VMPA 5IM7B 2YD9A 1KULA 3I6GA 4KHTH 4FG6C 5FXCH 4TN9A 1K5NB 5CIPH 3U4EB 1BIHA 4AM0B 2E9WA 2EIDA 4QOKE 1ZT4A 5IF0B 2Z35B 3AS1A 2DMCA 1QZ1A 1YYLL 1II4E 2HTLC 3AROA 2IFFH 4LASH 3SCMB 3ARWA 2E7LA 2LABA 2H41A 2SEBA 5MEOA 4R7NB 5BO1L 2BXYA 1FGVL 3ARFD 4FQJL 5E6ID 3U9UB 4QRTB 5DMYA 3F6LA 2EXWC 4ZUWA 4FQXA 2R2EB 1J12A 1OPGH 5BZWA 3BZ4B 1MCJA 5DS8B 1U6AH 3L5XH 2IPKB 5AG8A 1UM6H 3ULSA 2OTPA 4KUZH 2W0LA 2PW1A 2VLJA 1NMBH 4OSUH 1UC6A 3FQUA 3HCVB 1T89C 1FFQA 5I1AB 4YHPB 1OCWH 1R3HA 4WWKA 4KJPD 1Z5LA 3T0XA 1LE9A 4WFGD 4RA0C 4P2QB 5I76A 4NO0B 2YBRA 2XQYK 2VLKA 5FKPA 1WSST 3RWDA 5C09A 43C9A 4LCYA 3MLRH 4TRPH 4GQPH 1QOKA 2F54D 3NCFB 2PYEE 5AEAA 3TM6A 2XWBB 1OW0C 4NKMA 1ZWIA 3V4UL 2FECL 2CXGA 5CEZH 4YFEA 4P2OA 4L8SC 4JM2F 1U8LA 4PY7B 2MKWA 4NPYB 4EZMA 1I7RB 2IC2A 1J8HD 4J8RA 2FGZA 1A7BA 3H9HA 2VDLH 2EZ0D 1F00I 5INCB 1M71B 2GY5A 4QOKB 2W92A 1V5JA 1F42A 2EC9T 2ARJB 2GYSA 3O6FA 1X5ZA 4PRID 5IB1B 1C12A 2F5AH 1JWUA 5J6GA 4GT7A 5GGVH 1JF5A 3PV6B 5GSRA 1NDGB 4NKQB 4HZLA 3R1GH 1C1EL 2WBJD 1YC8A 2A38A 4G8IB 2IWGA 4XC1L 4DVBB 2JCCF 1D6VL 4IS6B 4MA1C 4TPRH 3VWJC 5EIVA 4KROD 2GEEA 3V6ZA 3MJ8A 4P5KA 1J88A 2N7BA 2IH1A 1EZVY 4L9LB 4LSSL 1SJEA 4G6AD 4JG1H 3PGFL 3HE7B 2OSLB 3G5YB 4NZRL 4ZDHB 5BRZE 4NZJA 5L7XH 3GNMH 4I48A 1K4DB 1DUYB 1FC2D 2QQKL 3VWKA 2G5RA 5F7NC 3WFDH 3D39A 3QDMD 5EO0B 1GGBL 4FNLH 4YXKH 4JN1H 4Z76A 1NMCC 2UZIL 2UVEA 4GMSL 4ZNCD 2QSCL 2NY1B 4FXLA 3IDXL 5F7MC 4F8TA 1NMAL 2PYEB 1LE5A 1WJ3A 43CAA 4YWGH 3HC3H 1I8MB 1UKQA 4XXDA 5DC9B 2FO1A 1VGEL 3S88H 2YS4A 4M93C 1FAIH 5ALBH 1RZJH 1IC5H 1MCCA 4LARL 4FTVD 5CMAB 2RJMA 4EKXA 1HKFA 5I8CA 1ZVSA 2DD8H 5A3ID 4LCWE 3KAAA 3O4LE 4LVHC 4UV7L 3D85D 3X3GH 1L0XA 1DN0B 4KMQA 1CXHA 4EN3B 3WJJA 4YBQD 4PGEA 3LB6D 4QRQB 1U2CA 2QR0A 4POUB 3ALXA 3L5HA 1UQSA 4LSTL 4DKAA 1N3NB 4MJ4A 1U8NA 3STLB 4I3SH 1MRDL 4ODWA 1HHKA 1CXEA 2C5DC 2WW8A 5HSFA 4I18C 4D9RE 3UPRA 4F7PB 3RGVD 1S7SB 3DMMD 4C59B 3BH9B 2L7JA 1OTUC 2R2BA 5DQ9A 8FABA 3QPXL 1WCQA 4HLZH 5CIPB 4N5UA 2IG2H 5SV3A 5DD6A 2HKFH 1OAYL 3EFDL 2NQCA 4XMLL 5DQJB 3O2VH 1ONQA 3ARSA 1KJ3H 3PP3K 4F7EA 2ICWB 3AAZA 3L7EB 5F96H 5HVWA 1DDHB 5DZNA 2Z92A 3ULUH 3O6KL 3RU8L 1KB9K 4OZHB 3CFJA 4JFFD 1OWWA 4Z7UF 1CFTA 1GGYA 1N64L 5L8LB 1CD1A 5TE4L 1MVFA 5I1GL 4BJLA 3QXVA 2C1PA 4NN7B 4EQ2A 3HRZA 1BFOA 4M7LL 2JK5B 4I0KA 4XPBL 4RMVA 3GMMA 2F58L 2PTVA 5E8EB 3ARDC 4KHXH 4L4TA 3VGHA 4WRLA 2R8SH 4LCWB 5BXFA 2Z31C 4YFLF 3TPKA 1M6OB 3O4LB 3PHOB 4P4KB 3C5JB 5AAWA 3EZ8A 4DOHE 4JM2C 2A6IA 3QIBA 4HUXA 3PDDA 4WU7A 6FABL 1KOAA 1JYXA 3FKUS 5ALCL 3FFDB 3G5XB 4GLRH 5E56A 1YNKH 4PJHE 1OSPH 1U8PB 3OKDA 1ZEAL 1L0YA 4JFXA 3UZEA 1FPTH 3SCMC 2E9JA 2ZCLH 3I75A 1DFBL 5DHYA 4OBRA 3KWWA 1CDCA 4U1MB 1JMZA 4LSQH 5E00B 1LP9F 4QEGA 1I3VA 5KSUB 3F6IA 2NX5E 2AKRB 3WDHA 3Q6FB 4JJ5B 3ARGB 3L6FB 4PRHA 2DWDA 2W1NA 1MIEH 1VFUA 4IOFC 3KS0J 4BZ2L 4EI5C 4ELMA 4D0CA 3CVIL 3JZ7A 4LU5L 2WUCL 5F71A 5J1AB 2BVYA 4H20L 4ZTPL 2P48B 3OAZK 3EYVB 2GJZB 1EMTH 4PJAF 3FT4A 5I1DA 5JDSA 3WLWD 5L2JB 2XKSA 1A21A 3EO9L 1CXIA 1GC1C 4UUJA 3WIHA 5TDOB 3QQ3A 5MENE 5D7KD 3MBEB 4NUGH 3CFEA 4I3RH 4KZDL 2QL1A 1T83C 2K7PA 2R0KH 4X8JA 4ZAKB 3UTSD 3TH4T 3K7UA 3UAJD 2F8VA 3FB7A 3FO9A 3IAQA 5HDLA 1TJIL 3F8UB 2H32H 3C08H 3RWGB 3NCJL 3KR3H 3KPNA 4S1DD 5JOPD 4MNQB 3E6FA 4ZUUA 4D3CH 5HHQA 4MNHB 4NUJB 1NCCH 3CSYA 3HI1B 3DVIA 4PJ5E 12E8H 3TVMA 1S7XA 2A0LD 3C6LA 2AAVA 5I19L 3PL6D 1I1FA 3QNXA 4JQXC 1AGBA 3ULUE 3SDDB 4GUPA 5I8EB 2DRUA 3SJVB 2OL3A 4PJHB 3WIHL 2X1QA 5D2NB 2IF7A 4M3KB 3QDJA 2M26A 3D25B 3PWJB 1BGXH 1MPAH 2J2ZA 1JGUL 1BIIA 2VITB 3HE6C 4M61A 5D8JL 5JHLL 2I25N 1WGOA 3VH8A 1FNEB 2JJSA 5DRZA 5IW6B 1CQKA 1I8LC 4ZUSB 1JUFB 4QXTA 1A6TB 1RVFH 2KZWA 3PWUB 3QCVL 1HSAB 3EBAA 3TH2T 4QXGH 3MUJA 4HS8L 5IIEA 4JM4L 2I9LB 3AREA 2XA8H 3W39B 4X4MA 3HE7C 1B4JH 5GGUB 3CJJA 3LKOB 1I1CA 3RA7H 1U3HA 3AM8C 5JO5B 2NY0B 2DLFH 1KN4L 5SWSD 3VGFA 2HAZA 3GSVB 5EFIB 4N1HB 2XY1A 3VI4F 3IT8D 2CR6A 5DJZB 3TFKD 3WS3B 1JTOA 2F19L 3NABH 1FGNH 1QPPA 3SE4C 4EOWL 5T1MA 2NY1C 3FQNA 4HJJL 4JKWA 5DRWA 4JO1L 3PQYD 4JEGB 4RCAA 4NZUH 2CKBH 3HZKB 3MPCA 5C0FA 1I1YA 5ESAA 2V2TA 4P3CH 3X14B 4HLJA 3IETB 3T77A 5FV1L 1HK6A 3EOAA 2AJSL 5DDHB 5HGDB 2VZ1A 3V5DB 1EHAA 2W9DH 2BCKA 4OZGF 2QTEA 4Y7MA 4KPHH 4ZS6D 4CADB 1YN7A 2E8ZA 4PJEF 1CT8A 4H8WC 4DW2L 5KOVC 1XF4A 1JHTB 3LS5H 3CVHB 4GAJL 4PJIA 3ZTJG 4JRXB 4LLMB 1AQDA 3TPUA 5E2TH 4QRUA 4JE4B 5FCSH 2R0WH 4U6YB 2ARJQ 1RU9L 4IHOB 4OCYL 1DL7L 1I9RH 4N0UB 3SKMB 3MLZL 1MJ8L 4JY6B 5MEPA 1GHFH 3BIKA 4JHWL 1JE6A 4J4PC 1XAUA 2BXZA 1SYSB 1ZA6B 4RAHA 5FAAA 2VXUH 4JFED 4XVSL 5C2BH 1ETZA 1OGAA 3WFEH 3V0WL 4BK4A 3UDWC 1GGBH 4WW2B 4PGDB 1RK0A 1TMCB 1R5IA 1UZ8A 1TIUA 3OPZL 4M48H 2Q8BH 4OV5B 4PY8J 1YEEL 4LHUD 4DAGL 2V7HB 1KSRA 3S6CA 1I8KB 4ZOEA 4KVNH 2VDMH 3HZMA 2FLBT 4RX4A 4HD9A 1WAAA 1U8OA 1A7PH 2PTUA 1BBDL 3BJ91 5IVOA 5EU6D 2AJXL 2XZCL 4P4RB 4NN7C 2X89A 4TULL 1PG7L 2I26N 3QCUH 4MQXC 2F74A 2CLVA 2X4QB 1WZ1L 3TN0A 2NY4B 2X4PA 2BDNH 4NNPL 1YEDB 4DUVA 4WTZA 3ULVD 3DRTB 5HHXH 1MY5A 4UV7H 2ZOLB 1V8HA 1JGVH 1I3RA 4F7MA 1DQLL 4K8RC 2BSTA 1FJ1A 4UOW1 5GJTH 4U3XA 4BH8B 1EEYA 3ZYOA 1YEKL 1T7ZA 4LGSB 5DJ8B 4G9FD 1UB5A 5HYFA 3ZYIA 4RFNC 3WDIA 1KCVH 5HD8C 3B8SA 3D0VA 5LCVL 1OARL 3I2CH 1UH2A 3Q5YA 3MRGA 3EYFB 2CQVA 2AQ2A 1XZ0A 3IB4A 3L3DB 2HH0H 1L0QA 4XCEB 2ATKA 4Z0BL 4NHCL 1V3MA 5FF6B 1EO7A 1SQ2N 3ARGC 3RPIA 5D7SL 2YXFA 3UJIL 3SKNB 5KSAA 5ADOL 4Q6IB 3WIIL 1G7LB 4XMLH 1C7TA 3MA9L 3SDXF 1A1NB 1X5IA 4F2MA 2C9AA 1E4XL 2DLIA 1QFOA 3FQTA 4XP4H 3ROLA 4GG6B 5L2KD 2I60L 4KJYB 4E42A 5I30L 2MQCA 3K4AA 5EUOF 4Z7NE 3O9WB 1JPST 3ZKSD 3CFCL 5J13B 3MBEC 5DA0B 5KN5A 2VZ3A 1JNLL 1GZQB 2GITA 2OP4L 3DSNA 1KFAH 4ZAKC 4NQDE 2JLLA 4AEFA 1EZVX 5FYJU 1WICA 3T1FA 4UTBL 2XFXA 5T1LD 1F6AB 3BKML 4KKAC 4N0YL 4MD0B 1SY6A 4P57A 4UT7L 4LSUL 1GAFH 1H5BB 1OHQA 2G75B 2WNGA 3FB6B 1FFNB 1RFDL 3BZEB 2XWJB 5SWZA 4R4FH 3V6FA 3SKJH 3MRRA 5GZND 2F8XC 1SYVB 1VCAA 1QVOA 1MUJB 5B39G 4HX1B 1G7JA 4OUUB 2VDPL 3MLWH 2H2PC 3F58L 1F4WL 1UCBL 3QA3A 1ZEAH 4OM1L 1T66C 2GCYB 4OIIL 5D2NC 4Y4KD 1QPXA 4YC2B 3DSFL 2CKBB 1AO7E 4R9HA 5T3XH 2OR7A 4N0CC 1CR9H 4O2EB 1T6WA 5J06A 1N2RA 4AQOA 1YNLL 5FUZH 1ED3B 2ICES 1XCTB 4X6CB 4NQXB 1SY6L 3TBVA 1QSEE 3LRSB 5JW4N 4H20H 1Z6JT 4DUXA 1E6JH 1T1ZB 3G5ZA 5FYJL 3GJFA 1CE1H 1ZLSL 4GW4B 1D5IH 5CLTA 4K7FB 2ITDB 4XAWL 5FUCC 4E5XA 2NY0C 1EBPA 3BN9D 2XTLA 2AJUH 5C07D 4WI9A 3RVWD 1VSCA 4IRSC 4Q74A 4ZO6A 3OXRB 5A2IH 3N06B 5J3HC 2DM2A 4KRPC 3MGAA 4G7YH 3ZYJA 3T0ED 3BD3A 1T1XB 4NJAL 1A14L 2ZUUA 3JTSB 1CICA 1FNSH 4XC3H 2NR6D 3D87B 3JVGC 3VGDA 3W0WA 2ADFL 5CCKL 2OCFD 2OTWA 4KQ3H 3DRQB 1DBKH 1MSPA 2DICA 5TDNA 4HDIB 5DT1H 5FCUL 1ZMYA 1BM3L 1EV2E 1DUZB 4R7DB 3MNZB 4JVPA 4OZ4B 2QQLL 3WLBB 3QBTB 3AB0B 5ACZA 4HJ0C 3S35X 1YN6B 3GHBH 2ZCHH 1JYNA 1JRHL 3C5ZD 4K7PY 1R3JB 4XNXL 4NQTA 5ENWA 1WC7A 1A4KB 3BO8A 5J11B 2CUIA 2GY7B 5D8JH 4X5XA 3BH8A 4BQBA 2AXFA 2J8HA 4PJ9D 5ESQA 5IVXE 3U0WL 4A2LA 5TDPB 5EC2A 4QTHB 3TIEA 4P46A 3B83A 2EKJA 5ID1B 2CDEA 4U7KA 4YR6B 5KOMC 2B1AL 5KVDH 2BNQA 2R2HA 3KPMA 3N9GH 2D31B 4HS8H 1WFOA 5CEYA 1Y6NR 3SDAA 2R1XA 5CJ8A 3PP4L 4HHAB 4M02A 2DLGA 4X6BB 4GSDL 1QHOA 3C6SA 4PLOB 2EIZA 3NFPA 2BY3A 3BP4B 4FQHB 4XZUB 4L3CA 1FVCB 3ZE0E 1OAKL 4EI6A 5TE7L 4NO5A 3SHSA 4UTAL 5DMKA 1IL1A 4TUJB 1GJIA 3MLVL 4NHUA 4TNWK 1QFWM 5T3XE 4HMDA 2FL5B 3MV9E 1UENA 4W6YB 1FZKA 1HH9A 1QRKA 4JO1H 4GRWE 3TO4B 3ECBB 4ODSH 1ZTXH 1FO0A 1TNMA 4LMQE 2NZIA 3P4MB 5D93C 4EIGB 4HIXL 1LEKA 2GAZA 4LBEB 3RDTC 3DV4B 1VB9A 5GRVK 1JN6A 4KK5D 4Y16D 1MLBB 2NY4C 3QWRD 1KB9J 3QJHA 5C0BA 3DX6B 5CZVL 3MFGB 4G5ZL 2IAMB 2EDRA 1KGCE 4RAUA 5FYLD 2VKXA 3OJ2C 3QAZB 5CBEA 5L9DH 1BZ7A 1UWEH 3OG4B 2H1PH 3MRPB 4RMUA 2K1MA 1T5WB 2A74B 5J56B 1MEXL 1DLHA 2XZQL 1IAIL 4PRBA 1INEH 2VSDA 3OR6B 5C08E 4HBCH 5C7XL 2DQTH 3OAUH 5C71A 4FZEH 5LWYH 3IAPA 2AV1B 3VRJA 1X7QB 2C3VA 4PP1C 5ITBL 3RZCA 3MLZH 4XBEL 1Y6MR 4OI9A 3KXFE 4FQQA 1AE6L 1N59B 4JHWH 5J9PA 1FO0L 3TJHC 1VADA 3KPLA 3EJYC 3O6ML 3KYMB 1A3QA 3Q3GB 1M4KA 3GFUA 4PG9A 3CLEH 1AI1L 4Q6IC 4U05A 4WUKL 4C56D 5SWQB 3HG1E 5JIHA 4NYLA 3I02A 4XP1L 3MODL 5DI8B 1LVEA 1N6VA 3GJEB 1YEEH 4CVZA 2EH7H 5JMRA 5GRJH 3WUZA 3I50L 4WEBL 15C8L 3GGWB 4MJ5B 4JFZL 3KHOA 3DIFA 1XGPB 5HHNB 4BZYA 1BBDH 3MV9B 2HFGL 2HA1A 3MCLH 4ISVB 4P23A 2H45A 4Y89A 3VFUB 4X9GA 5J1TC 3RZWA 4OLVH 5DD3L 5DTFA 2D7QA 3CK0L 5FYKE 2X4NB 4HQQH 3JV4A 4FFYL 4XNUL 3BRGC 3BPOC 5IROA 1A6ZB 1OSZB 4DKFH 3U6RA 4YHOL 2V5RA 3MJ9L 1U8MB 1YNTB 2IALA 3F5WB 1EHNA 5F7EH 1LEGA 4Y8AA 3BEVA 1S7RA 2DF3A 4YNYB 3PJSA 5H2BA 2BSRA 1JWSB 4L4VB 4P0DA 1DANU 1YEKH 1NAKL 2E7LC 4OLYH 1SMOA 1L7IH 5C08B 5GGQH 2DQJH 3UJTL 2Q7YA 4PJXA 1U8KB 4NZTH 1WBXB 5CP7B 2O5YL 4ZFZA 5BV7H 3KXFB 1IGIL 4OZIB 3SE3C 2R9HC 4ZXBB 4XPHH 2ZZUT 5D7SH 4AH2B 2UYLA 2G5BA 2VLME 4G42A 5JW5B 4RRPG 1FSKB 3HPJB 4LVOB 4PP2A 3DHMA 4WWKC 3VI3E 1Q94A 3L1OL 3TESA 1WWWX 3DWTA 1ZVYA 3HG1B 4HWBH 3O2DA 3T08A 2FR4B 3P73B 4FG6D 2YSSA 5E2JA 1R5VA 5E99L 3G6JE 1H8OA 3ARFA 4I0PD 4KRLB 5E6IA 4C57C 4OI8A 5HYSG 3BP7B 2UWEB 3MRIA 3MROB 4DQOH 4JZNB 1H3PH 1RMFH 4JFPB 5ILTL 1F13A 5I75C 3BKJH 3QO1A 5MP6L 1NH6A 3U2SB 5HDQL 1VDGA 2EXWD 4M7JH 3NZHH 2ZWLT 2GUOA 1ODAA 1UYWL 4XNQA 1NGWB 3MRDB 4RZCB 5SX4H 2HFEB 3AFLA 3VCLB 5GGSB 4XCCL 5IW1B 1RHHA 4PJDA 4E41E 1NL0H 3V5KA 1H3TA 5L6YL 3MOAH 4QRRE 5DQDL 3O2DL 5JPNB 2F54A 3O4OB 3F58H 3O2WH 2R4SL 3W9DA 5CEXA 3AB0C 3BPLB 4KK9C 5K9KB 4S0SD 1G7IA 3MCG1 3O3AA 4JDTH 4OIIH 3UEZA 1NCAH 4ELMF 3IXTB 3KNBA 1OAUL 1S9YA 3UTPD 1BQHA 4YHZL 2Z8WC 3RY5A 2FJFA 1LEIA 1FL5A 2GT9A 1SVCP 5GSVB 3NCMA 1T6VN 4CUCA 1OGTB 2G60H 3CDYA 5IT2H 5I1EH 5FA4A 2MPAL 1J8HA 3MFFA 2Y7QB 4Z0XA 4XRCB 4NDMB 5EU5B 4OF3A 4OGYL 5GXBB 3BW9B 3N0PB 4WI3A 1CS6A 3VWKC 2XN9B 2ESVE 4RGOL 5LG1A 3DROA 5F1NB 4ONGH 3GUTB 4I5BA 4PRIA 3A6CH 1G7HB 3OGCA 1QBMH 3S4SB 4JFYB 2UWEF 4LNRB 3G6JB 5D7LE 2WBJA 1PX3A 4CN6A 5CFHA 4YDLC 4AG4L 2YWZA 2XIDA 1IGYA 5CJQH 3TCLB 1B6DA 1F90H 1DQQB 5ERWB 3MV8D 1RIUL 3WFBL 2Y23A 4GKZA 1S3KH 2QKIA 3BXNA 2P8PB 4PUBL 1GZPB 3KYOB 3BESR 3TA3D 3P4OA 4LLAA 3B2VL 1IKFH 2NY6B 1DBAL 1A14H 3EFFB 4U6XA 3VJ6B 1IAOA 3WS6A 5LQBL 1X5HA 4MJIE 1CYGA 2VQTA 3BE1H 3QDMA 3KYNB 1HIMH 2VQ1A 4MA8H 3C09C 4E41B 4KZEL 1BM3H 1KCSL 5TPWH 3WJJC 1RZ8B 4FA8A 3VFVB 5GHWH 4QRRB 5EO1A 4P59L 1MAKA 4R4ND 3VGGA 1P69B 2VDKH 4JFDB 1R24B 2VXSH 1XR9A 1TZIA 3X11B 3QAZC 4WFHD 3QXAB 4KQ4L 5D7JB 5D6DA 1U0QA 1AQKH 4FTVA 3U0WH 4CW1A 1TJHL 2APXA 4M5YH 1MCPL 3INUH 4Y4HB 5EH1A 4F9PC 4XBPB 5B8CA 1EO5A 4FXKB 1SEQH 3KYAA 4YE4L 3D85A 1LHZA 3IJHA 1TVHB 2NNAA 3PP4H 1KIQA 3F7YB 3T2PA 3ZKMD 3H42L 1UXWA 4U49A 3A0OA 4BFBD 2VL4A 2ESVB 4EDWH 1D6EA 3KJ6H 4ZFOL 5M7QA 2A6KB 3IDMA 2A9ML 3IFLH 5F3HA 3VFPA 2BSSB 1I7ZA 5I1CL 5CLWA 5TE7H 4GRMB 3WUWB 4MYWB 3VD9A 1MJ7L 3BWAB 2V2WA 4KK6D 2DL2A 3MLVH 4BKLA 4H26B 2EYSB 2BNUB 3RIAF 5BV7B 3EW3B 5DZLA 3WSQH 1A3LL 4RFEA 1E6OH 3RGVA 5AG9A 2ADGB 3DMMA 3OXSA 3RX7A 4PGCB 1H3XA 1LO4L 3CFBB 3LRGA 4G43A 3W11D 3CDGB 3DUUA 4GAYA 3PF2A 2ZJSL 2NCMA 3NIGE 4JRWA 3U4BL 1G7MA 1C16A 2GSIB 2LE9A 4TUKL 1F58L 4Z7QE 2QSQA 4PJIF 4MJIB 5DUBB 5HYJE 1P7KA 3LDBC 4TNVK 5GIRA 4I4WB 4Z7UE 1OTUD 3WHXB 3QJFB 4MDJB 1EGJH 3RVXC 2BOCA 3QIBC 3FJTA 4JFFA 4CGTA 3ZHKA 1HHGA 1R6VA 1BEYL 4YO0B 4M8QB 4OQTA 1RURL 5ADPH 3WJLA 1S78C 2VXTL 2W9LA 1IAIH 1F6FB 4ZUTA 3QHZL 5JLZA 4KI5F 4MDIA 3UBXI 5ITBH 1N5AA 4GKSA 2J3SA 4PTTB 1DN2A 3IJYA 4ZOCA 1T03H 1CDHA 5GS2H 4ZXBC 4JDZB 1RZGA 3O6MH 4BK5A 1OF2A 3P77A 3TWCL 3V0VB 3DO3A 4FXGB 1SMAA 2Z31D 1WAAF 3QEQB 3HS0B 4LVOC 1QSFB 1PEZA 4GJTB 3KJ4B 1FE8H 3D48R 3MODH 1K4CA 4K7PX 4M4RA 1YMME 4K3JL 2DQEH 5HI3C 3I50H 1AP2B 4OQTL 4HS6B 1XIWB 3KG5A 1NBZA 1S5IH 1AD0B 4JFZH 4GKOA 1FL3A 3P0VL 5CINH 5BS0B 1CFNA 4MA7L 1MOEA 1U95A 4B5EA 3WNMA 3KPSB 1XF3B 3KHQA 3SCMD 1X5LA 4OCMC 4PJAE 1OAZH 3ZHLA 5I1HH 4NZDA 1A7OL 4OT1H 3N85H 5E03A 4HKXB 1VERA 1DP0A 3RY6C 4ZS7H 5B38A 5CZKA 1MRCH 4Y5VB 2DB8A 4WW1A 3TVMC 3QUZB 3VD4A 3C6LC 1T5XB 5IHLB 5KJRL 3X13A 1N5YH 2NY5H 3KLDA 1H15B 2Z8SA 3UTSA 4JO2H 5T3ZD 1AHWB 1FIGH 2AXGA 4K2UL 5IBTH 3LEXB 4P2QD 4UINL 4NO0D 4H0GA 1L7TH 3S3SA 1Y18B 4D0BA 2CLZB 2JJSC 2IGFH 1IVLA 3AGVA 1QEWB 2NZ9C 1N8ZA 1MJUH 2Y06H 2R0ZH 2X9WA 2EDXA 4FS0A 3EOYG 3PL6A 1S7UA 2YUZA 3P11L 3EJZD 5IMLA 5FK9A 1QYGL 1WVZA 3Q6GL 1S9WB 3FRPA 1ZAGA 3DO7B 1SM3L 5IBLC 2P45B 4M5ZH 4M6ML 4ZSOB 4JY5L 4L29B 4NCC2 5E99H 4U3HA 3EO1A 4UBDD 3G6DH 5T5NF 2EECA 4LDOB 1I85C 3K4ZA 3AS3A 5IK3B 4QOKD 1A6AA 3I85A 3IGAA 5FECA 3U0PA 1PSKH 5DJ6B 4NSKA 4H1LA 4X9FA 3VFGL 5MP6H 3SQOH 3UO1L 5C70A 3WL9A 5IGXL 2V5MA 3SKOA 4JFOA 2WANA 2I5YL 2W0PA 2H3NB 2BSED 3HI6L 2X4UB 4RISL 1S7WB 3VI4E 4FFVD 2OLDA 5SWSA 4ZUVA 4AIXA 3P4LA 4MX7A 3Q3GA 1CFSA 5HPMB 4YLQT 4IIQA 4X4XB 3HFMH 2DQHH 3L5IA 1UEMA 3UTQA 5EORL 3HE7D 3RX5A 1LO0L 2IPTH 2Q8AL 4GFTB 3ILQC 3V7AG 3REVA 1FH5L 4QXWA 1IC7H 5F70A 4JQVA 2YUWA 4FN0A 1OAUH 3CMGA 3IF1A 3PQYA 4L5FH 4X6DA 3GO1L 5IHZB 1YJDL 1BECA 4LKCA 4PYGA 2MSPA 2ENYA 5D7JC 4QYOA 1RUQH 2ZSWB 4OTXH 3TZVB 4PRNB 3VW3L 2D3VA 3IDUA 2NY1D 2UUDK 5DGRA 5EOQH 2PYED 4RGNE 4PJEE 4Y4HC 5IW3A 4KI5C 4O9HH 5HI4C 1A0QL 2AJVH 3RAJH 1JNNL 4GAGL 4YHLH 1BF8A 4Q58C 4NQEE 4DKEH 4LPVA 2YZ8A 3FMGH 1MIML 4G8GE 4RWYL 2CK0L 4S2SB 2DOCA 3VXSE 3MLSL 1KEMH 1KPUB 3QCTL 1T1WB 4OLZL 1U9KA 4DGIH 1LDPH 2PKDA 5D5ME 5I8OH 1NBVL 1P2CB 4MCYA 2A83B 1J1OL 3VFMA 3NTCL 4LLQA 4EN3D 3HKFA 3LPGA 3RWHA 2AW2A 3NBNA 3VXTB 3ZKND 1P1ZB 2HLAA 1GL4B 1MI5E 1U8IB 1J0ZA 1G6RA 1JZ7A 3MLYL 4I2XA 4XVUC 3B2VH 1WBZB 3EAKA 2BERA 3ZDYE 1R0AL 3OWEA 4JFEA 3TN0C 5CD3A 2FJHA 1LDSA 4YIQB 4WUUE 5GRUL 5I9QC 2VR5A 1JGEB 4UDTB 3O6LH 4HT1L 1KEGH 2JB5H 2F53E 5DJXA 3EYOA 4X7TB 2XRAH 3FQXB 1ORSA 4LHUA 4KK8D 1KCSH 4U6HB 3MCKB 4PREB 2LQRA 1QSZA 4KRMB 5IEHA 3H3PL 1ZS8A 1ZLVH 5DRNB 1H8NA 4EXPX 3V0AC 3LH2H 4FFZL 4JDVB 2Z93B 4LCIH 5EU6A 2DQIL 3B9AA 1X5GA 4KQ4H 2X6MA 3AMKA 1M1SA 4JHZA 2XTJB 1MCPH 5J7CC 2CMRL 1AR2A 2O5XH 1G6RL 1T1YA 3HAEA 4OGXH 1CGXA 2M2DA 3P0YL 2AJZA 4UT6L 3RX8A 3SEPA 5HDBE 5AD0B 3MOQA 4YE4H 3BDXA 3OZ9H 5FHBL 5KSAC 1RI8A 4L8BB 3ET9F 4NN5B 3K2UL 3H42H 4ZYKA 1HI6A 4OCXH 2WZPD 3A6BH 4JAMB 1NBYA 5EBGA 2Y1VA 1QLFB 2VLRE 4M7LT 3P40A 5HYQA 4YBLB 3HZVB 1MRFL 4IDJH 4G9FA 2X70B 4PR5B 4LCWD 1A7NL 3LEYL 3MRCA 5D5MB 3T4AB 4RSVA 3O4LD 1G0XA 4K8RD 5F9AC 3F7RA 3WNOA 4P4KD 3MV7E 3LKSA 4LLYA 1HOCB 4KGJA 1K2DB 4LPCA 3UYPA 4NP4H 3TBWB 1XIWC 4QHUB 2V7NB 3WCYA 5JA8B 3NFSL 1LK2A 1MI5B 3GB7A 4X7EC 1VFBA 2P5EE 5HD8D 3ZT6A 1ZANH 5CJOL 4IMLB 1ZVHA 3ULVL 1WZKA 4Y5YA 5I18H 4WUUB 2D0GA 5IOPB 5CEZD 2AABH 1KTDA 3DGGA 3MUGA 3S35L 1YY8A 1QRNE 3IDJA 3GSRB 4HKJB 4HG4K 5E8OB 2F53B 5EUOE 3TNNB 1N7MH 5L2KA 2Z9TA 3ARGD 1QUNA 4UOW0 4JRYE 4Y5VC 3QUZC 5CSZB 1UM5L 3UPAA 2H9GA 5JOFA 1F8TL 1BEYH 3QXWA 4AIOA 3V6OA 2OJEB 4D8PA 5JZ7D 4UV4L 1EO8H 1YYMH 1U8JA 4JZJB 4HKZA 3QHZH 2YEZA 1AHWC 3EDDA 4WFFD 3IRZA 4XP6H 3ELAT 2W65A 2DM3A 3RP1A 4Y1AB 3D18A 5E1AA 3D6GA 5T1LA 3QRGL 3MBED 4PRPE 5JW4M 5BQ7A 4YHKH 1QR1B 1FORH 1OP5K 4TQEL 4ZAKD 5GISL 3H9YA 1XGRB 4OAWB 4G6KH 2X4TB 3S7GA 1K8IB 1RZKL 3T4YB 1N6UA 5C0JA 4KKAD 1HDMA 3HR5A 2E7CA 1R3LB 2VLRB 5CKGA 5KSBA 1SJVA 4EDXA 4MNQD 3IJSA 5LGHL 3PWLA 4EUPA 3FQRA 4LIQH 4Y4KA 4QHNA 2J6EL 2YD4A 3C9NA 2EC9U 4QT5B 3MV7B 1ACZA 2VC2L 3T2NL 3V7AE 4P9HL 5IWLA 3DV6A 2CLRA 5HJ3B 2R4RL 3IYLW 1UA6H 4NO2B 3SDDD 3V52H 1QLRB 3WYRA 4J23A 2ED8A 2VDQL 4NO3B 1SBBA 3SJVD 4S0TD 4PJBB 3BRFA 2DMBA 4R8WL 5ESVB 3VFOB 4S1RH 5DLML 3T2QA 4J3XA 5GGRB 4XP9H 5FOJA 1ZSDA 1I9JH 3IDYC 3QUKB 2EXYC 5KS9A 1XR8B 4JRYB 5C07A 5KVEH 3IFOB 4PJXF 2W59A 3K1KC 3ARVA 4OIBA 5DD5H 4TSBH 1MLCA 3LKQB 3UTOA 4ELKA 1CD0A 2BY0A 1J7VR 3S8WA 2NY0D 1ZLWH 1YDPB 1NLDH 2OQJB 2ZSVB 3T0EA 1DSFL 1UJ3A 3FQWA 5FA3B 3PDOB 5C1MB 4O4YH 4PRPB 4KTDL 1GRWA 5J3HD 3ZSTA 1UWXK 1JNHB 2XACC 5B4MD 3LN9A 4MVBD 5HGAA 3PWPE 3NCEB 4UIMB 1A9EA 3BSZH 3S3JA 5I16A 4EIZC 5K59F 1FYHB 2DI7A 3EOBB 2YPKA 3FZUC 2VLJE 4XAKE 4LEOB 5E9DB 1VPOH 4XCNA 3C5ZA 5DJAA 1G6VK 4F33B 3H3KA 1B0GA 4PLNC 2Y72A 3QUMH 1TQBB 5GGTL 2WM0A 4PJ9A 1CE6B 5HGBB 2FSEB 3E3QC 4JGJA 1NC4B 4HJ0D 4JO4L 5B21A 3ULUD 2BVQB 3BZFB 4RQQB 1D5XA 4JRXD 2I07B 1JZ8A 3NAAH 4NFCA 5H94B 5IGXH 4PJDF 3MXVL 3OL2A 3SBWA 1IEAB 1JHLH 2I5YH 4U0QB 5LXGL 1BVZA 2AEPH 4D94A 2NMSA 4ZFOB 3LKNA 5H8DA 3D5OF 4PB9H 1A6WL 4FRWA 4MXVE 4OBSA 3SY0B 5LAXB 3LPFA 1HKLL 2C3HA 4LIQE 4M03A 3LV3A 1JWMA 3FB8B 1CIDA 4LLVB 5D7IE 3BKYH 1LO0H 1MVUB 4NNXA 5AAMA 2JKXA 3B5TA 3LIZH 2KPNA 2YK1H 3HR6A 2BJML 2FD6L 2DLEA 2VZUA 3AMLA 4R4BB 3BAEL 1KENH 2BNRE 3IFNH 1FV1A 5HHOE 5LGKA 3TO2A 1VGKA 4Y5XA 1XF5A 5EDXA 4JVUA 3TBYB 3AS2A 3KDMB 2R23A 1Q0YH 3TBSB 4XH2B 3K4DA 3RZCC 1A4JA 1D5MB 2HJKA 2HKHH 3IKCB 5DJ0B 2XTJC 3JV6B 2YHGA 4Y16A 4DCQA 3QWRA 1LNUA 1U91A 2N1KA 4IRZL 4KKCC 3GMLA 3OTTA 3GBML 1KF9B 3PWPB 1JNNH 2OZ4H 5E5RB 3UP1A 4NFBA 1B2WH 2G9HB 1T21A 3ZE1E 1CGSL 2EEDA 3JSSA 4X5LA 4L3AA 3S37L 2UV3A 3QCTH 3SPVA 2NY4D 1SHMA 4ZQKB 4HCRH 4YBLC 2B20A 3V2AR 2DS4A 3QEHA 3A67H 1ZGLB 3N1GC 4ZODA 5D1QB 2B8OT 1DQTA 4P23C 4OF6A 2H6PA 1H3GA 5CJXC 1NCWH 4R26H 3VH8G 1U2HA 4LLDB 4O5LL 4PP1D 3BGMA 5GRUH 5IROC 3AU1A 4R96B 4RGMC 4K3DH 4C56A 1TCRB 2J8UE 3TJHD 2DTMH 1YQVL 4JFHE 2KKQA 3WNKA 3JWNC 2HFFA 5FYLL 3LN4A 4KY1L 1J11A 1AFVL 3WIFA 3WXVL 3FTGA 2Y4SA 1OTSC 3H3PH 1T0MB 2FH8A 4LPWA 5D7IB 1I9IL 4Z7WE 4FFZH 3VGAB 3ES6B 5IESH 3QG7L 1EAPA 1LQSR 2BNRB 3UTZA 3MA7B 5HHOB 2B4CL 3MLTA 3L3KA 2O5ZH 5GPRA 5FKAB 3LVEA 1T20B 4LAQL 4ZNEA 1OP9A 3O9WD 2ZNWA 3FL7A 3P0YH 3F7VA 1RULH 2MQ3A 1NDMB 3ISWA 3ZYZA 2ORBL 4DN3L 3HLAA 4HIEB 2VO5A 2XQBH 3TYGL 5F6HJ 1IILE 4BSWB 1PBYA 4XB8A 1XH3A 3QULB 4W70A 5JORA 1Y0LB 3EO0A 1PYWA 3RL2A 5DK3A 3THMH 4O02L 2W9EL 4OKVA 1NGXB 4HS3B 1DEEA 3OHXA 4J3WA 3OR7B 5D70L 1NCDL 4ZTOH 3QHFH 4YHNB 3ARFC 5E6IC 2J88H 4XHQA 1ADQH 4OZFH 1RJZA 3BMWA 1AXTL 5IB2B 5IB5A 2Y36H 2IEPA 4P5TB 2VL5A 5DFTA 1F97A 4X7SL 3NFSH 4WU5B 4YGVB 1CDUA 1LK3L 1J1XL 4UIKH 2W38A 3H6JA 2VIRB 4IMKA 5CD5C 2OL3H 3QFDA 4X4ZA 1FNHA 3EYSL 2E8YA 2N4IA 2X1XR 2ZG1A 3S35H 3D3VE 5TFSH 2J8UB 2R56H 2R9HD 1JPTH 2QQQA 4N8VA 3STZA 4NKOA 1Z9LA 4X9BA 3LCYA 1TJGL 5FM4A 3NIDF 3OMZA 4LLUB 4WENB 2YMXL 3CC5B 2D0HA 1BD2B 4I0PA 4OCSL 3QUMB 3BQUB 1TVBB 3OJDA 4JJHA 1G7PA 4Z7WB 1EAJA 5IBUG 3ZT5A 1VFOA 1PX4A 5DEGA 3TIDA 2ADJB 2BZDA 3VG9C 4RMSA 1NGZA 3FN3A 1A5FL 2AEQH 4JKLA 2FHBA 1RZFL 3N1QC 1JZ2A 2BHZA 3W9EB 1J05A 1F3RB 1WBYA 3BPCB 3QHTC 4TQEH 4Y2DB 1L6ZA 2CDFB 5LGJA 2WP3T 2EZ0C 3GSNH 2Y9RT 3DXAE 5HVHC 1JBJA 2V5YA 3BEWB 3EGSB 1G9NL 4PRHE 2XZZA 4WTZG 3GBNL 4U31A 4ELME 4MNGE 1FHGA 4LQFH 4IRJB 3MGTA 3GIZL 4JG0L 5E8NA 1RZIA 1I7TA 2ITCA 1T7XA 2QHRL 5INDA 4P5MA 3VRLE 4YHMH 2P8MB 1TQBC 4KROC 3HMWL 4F9LA 2YUVA 1BJ1J 2VDQH 3RWCB 4YHIB 3U7WH 4NC0B 4U1IA 3M8OL 4ACPA 4MD4B 3B9KB 2R29L 2CIIA 4R0LB 4G6AC 4AMKL 4R8WH 5EPMA 4QHKI 1SEBB 3V5HA 1PKQB 4TSCL 5F1IA 2COQA 1JFQL 1FFPB 1LO5A 1BQUA 5E6ZA 1J9CT 1BFSA 5FB8A 3D3VB 4HF5H 3VXME 2EDYA 3ORJA 3DVNB 4MQ7B 1S9VA 4PRAA 3RKPA 1VFAB 5HYEA 1Q1JH 4KTYA 3WKNA 1AXIB 5FDWA 2EDFA 5D9SA 5JOEA 5TF1L 1RUAH 3MV8A 1NQBA 4ESKA 4H5SA 2P4AB 1QO3A 4HUNB 4M1GH 2DJUA 1AGFA 2P44B 3TA3A 3GSOB 1OAXL 5D6DC 3HB3C 5DJYA 3LSOB 2DLTA 3QDJE 5DR5H 3KPRE 4GAFB 5DJ2B 5DRXA 2NW3B 5C0RH 5C3TA 5B8CC 4XNZC 1CLOL 5IMMA 3QO0B 1NCNA 1ZA3A 2B1HL 4WHYG 1MWAL 3DXAB 4MAUH 1XGUB 4W68A 2XQYG 1B0RB 5IMKA 3TO4D 3U9PH 4X99A 2AV7A 2H8PB 4MNGB 3D9AL 4PTUA 4TSAL 4NKDB 1BVKB 3PHQB 3C5SA 2CIKA 4AY0A 4N1EA 4O2FB 1RD6A 3QNYA 3S34L 3BKCH 1XT5A 3I6LE 5TE6H 2E27H 5EU3B 2IAMD 4K9EH 1IAKB 2XNAB 3QZWA 3BUTA 1JGDB 5ANME 3EOTL 1X6LA 3RI5K 3RGVC 1A1MB 3DMMC 4OGZA 5F6HI 3ZTNL 5D1QC 4TNWF 4DZBA 1CK0L 1VENA 1M7IB 4QNPF 5SV4A 3NOIA 3EJJX 5LXGH 2B2XL 4IOIA 1JPFB 1GIGL 5EC1B 3CSPA 3VXMB 1JHKL 1HXMB 3GKWL 3MV01 1A6WH 3SE9L 1KIRB 2XKUA 3PWNB 5IHBA 5IG7A 2YKLL 4X6DF 4OZFB 3GM8A 2EH8H 2ENSA 5ABDE 3U30B 3BP6A 1WISA 3OQ3B 3TBTA 1HILB 1ZHNA 3WJLC 1WFTA 2BJMH 2VXVL 1KB5A 2VH5L 1UM4H 1JGLL 4B53A 5TH2A 3Q5OA 4YXLH 3QNZA 2F5BL 3OKEB 3TT3L 2CXKA 3LHPH 1RUML 4JCLA 5FM5O 4XGZB 2EYTA 4HG4J 2FEDD 1ZHLB 2VXQH 35C8L 3KPRB 4HV8A 3PG2A 2GJ6E 3TNMA 1J1PH 3MMEA 4LKXA 4MJ6B 2PN5A 5T3XD 3ZZ1A 1S9XA 2VN4A 1CQYA 2OJZL 3MV9D 1W0VA 3P4NA 3GBMH 2GK0B 3NIFE 4F8QA 4M7KH 3CXHK 3RWIB 1R3KB 5DF0A 3IS0X 1YUHB 1IGFH 1P4LA 3QFJE 3B3IA 5DJDA 5EBMB 2E6PA 4NRZB 3T8XB 1WCBB 3DVGA 3L9RA 3U46A 1KACB 1GGUA 4S1SH 1FG2B 5C9KA 3RVXD 4CVXA 1YMHB 3BD5A 1OGAE 3PGCB 4GXVL 1KB5L 4CU7A 4L8DA 1KJMB 4FQLL 1U8HA 2BVOB 1FL6B 1ORQA 4U1SA 5ID0A 5ANMB 1S78D 1FZOB 1KGCD 4L4VD 2KBGA 4MSWB 4P5TC 3C8DA 4Q9BA 2ATPA 5FO9B 3BT2H 4OD2A 4BFIB 4HGWB 3GSNB 1QQDA 1WAAE 2Q76B 4XMKL 5D6CB 5C08D 1F4XL 1P5VA 5GS0H 2Z31A 3WLWC 5H37H 4J6RH 5DUPH 2ID5A 3KXFD 5IEKB 3DTXA 3MYJB 5I15H 4ZXBD 5IM7A 1K3IA 4NQSB 4ORGB 1BJMA 3GDBA 1RV6X 4PJGE 4B50A 1K5NA 3U4EA 4AM0A 3QDGB 3BQUC 3CFIC 5IF0A 2Z35A 3ULVF 3BDYH 1J5OH 5DD1H 1CDIA 1KBGH 3HG1D 2B4CH 5HI3D 3SCMA 4LPTA 4F15C 4P99A 2R0LL 4R7NA 4XMPH 4S1DC 4LAQH 3U9UA 4QRTA 2GJ6B 2R2EA 4P2YA 3BZ4A 5DS8A 1G9ML 3NMEA 3HNTL 1P84K 3KPPB 3R06B 2IPKA 3IKKA 2A0LC 1H9VA 1HH6B 3PL6C 4HULB 4Q9QL 5GQBA 5C0AB 1Q9OB 1AY1H 1XGYH 4YZFE 5EWIL 5AWNL 4XCYB 3QFJB 3HCVA 4O02H 2W9EH 4NC1C 1OD7A 1X5XA 5EOCL 5I1AA 4YHPA 3RTQB 4FQ2L 4WY7H 3HNVL 4P2QA 4NO0A 3FAXA 5JA9A 4XPTL 1T83A 3ARZA 2E9IA 2FGWL 3G04B 3SDCB 2DQCL 1UZ8B 4P2RB 1YJDC 4QRSB 2GIYA 2AJYL 2XWBA 2OYPA 1WT5A 2VAAB 5JW4R 4PG2C 2VERN 3B9KC 5J12B 1T22B 4R0LC 2NZ9D 4DZ8B 4K3GA 2VWEE 4C54A 1A22B 1XGQB 1T7YA 4PY7A 4NPYA 5FUOL 4XPFL 1K6QH 1I7RA 4RFOH 1FDLL 4JQXA 4PJGB 3LQZB 1IGJB 3EUUA 5INCA 1M71A 2VLMD 4XWGH 5I1IH 4QOKA 5SWZE 5IBLD 2PXYB 3SKUD 2XN9D 2ARJA 2AI0L 5IB1A 4JQVC 1SJHB 1WLHA 2X1OA 5KSVB 3PV6A 3VXOB 1NDGA 3S3PA 1N4XL 3RKDD 5IJKC 4G8IA 1CLCA 4DVBA 5KSBF 4IS6A 4NQCB 3W5NA 4HJGB 2JJUA 2ICEB 4G6FB 3W81A 3MRHB 5E08L 4K55A 4ZS6C 4AEHL 4UQ3B 4XVTH 4WHTB 4L9LA 1QD0A 3O3EB 4FZ8L 3HE7A 2OSLA 2NY6D 3G5YA 4ZDHA 1ACYL 3AM8A 5DUML 1K4DA 1DUYA 4HWEL 1UACH 3PP3H 3EKCA 5EO0A 4FFWD 4JREB 5DYOB 4G7VL 5E8PB 3EDEA 4E41D 5I73B 1QFWI 2BC4B 5E4IA 5ELIA 4QRRD 2PYEA 5TQ0H 1N0XL 4JFDD 3DURB 5KS9F 1I8MA 4DK3A 5BVPL 4TSCH 1IQWH 5D7JD 4LSVL 4ETYA 1DQJB 1WFUA 5CS7A 5DD0L 3DX9B 3GMQB 2AQ1A 4Y4HD 1A6PA 4FQIH 5HDOA 4KI5D 3P3YA 4Q9RH 3HMXH 1CFBA 5DEZA 4HEME 2IANB 3CGTA 3P9MB 4LSPL 1DN0A 4F37F 3GBLA 4EN3A 4K71B 3HA0A 1DTUA 4QRQA 2YD5A 3DNKA 2ESVD 4KC3B 3U30C 1E0OB 4XPAH 1N3NA 2VDOL 2CJUL 3M17B 5TQ2H 1XEDA 1NFIB 2D4DA 3ABZA 3F12B 3STLA 1CG9B 3JWDH 3GEWB 4XB7A 1TTUA 3C2SA 3ULVC 2ZKHH 1CLOH 5D71H 4QTIH 4K7PH 3MBXL 5HGHB 4XVUD 3MUZ1 4F7PA 1MWAH 4NM4L 3BH9A 5GS1B 4JN2B 1KCUH 2D9QB 2BNQE 4G3YH 5CIPA 4ODTL 3C60B 3UDWA 4KAQH 4TSAH 3CH8A 3I6KB 2D0FA 4PJFB 1KT2B 4JB9L 4MJID 5DQJA 2Y25A 4K3EL 4NT6B 2HN7B 2DJSA 2ICWA 1YEJH 3L7EA 2EYRB 2ICWJ 1AGEB 1DDHA 4OIAA 4RNRB 4AL8H 5DVNA 5FGSA 4OZHA 1HEZB 2P1YA 2FX7H 1CF8L 1PAMA 4PBXA 4BA8A 3WKMH 1OVZA 4ZFFB 5I2IB 5E2VL 1TZHB 1BQHG 4U0RC 2EDKA 2OK0H 1NKRA 2BFVL 2GFBB 4Y5YC 2JK5A 1HSBB 1RZKC 1MJJB 5E8EA 5JW3L 4KHTL 4MCZB 5FIEA 4LCWA 1FVEB 5L88H 1HE7A 1JF1B 1M6OA 4Q2ZB 3O4LA 3PHOA 4EBQL 2BVTA 4P4KA 2EDNA 3C5JA 3U7YH 3ROOB 2IFFL 2NTFB 4LASL 5F88B 1Q9LB 2VH5H 3BX7C 3ZDXF 1S9KC 3FFDA 1IEBB 3G5XA 4P9HC 4DKDC 3QEQD 2YD8A 1QSFD 1FRGL 3EHBC 4Q7DA 1RUMH 1U8PA 1MFEH 1OPGL 4J3UA 5IV2B 35C8H 5AYQA 3U79A 1U6AL 3B43A 3MRMB 1XIWD 3L5XL 4U1MA 1HNFA 5E00A 3QPQD 1UM6L 4QF1B 5KSUA 5BS0D 2AKRA 3Q6FA 2J4WH 4JJ5A 3ARGA 2PYFB 1NMBL 3L6FA 1TXKA 4OSUL 1NGPH 4HUWB 3KPSD 1W72L 1JK8B 5GZNC 3PUCA 4Q0XH 5C6TH 4LAJH 5DSCB 1CL7I 5J1AA 3CUPB 3ZHDA 1QFHA 4PPTA 1BZ9B 4N1CA 3EYVA 2GJZA 3SDAB 4IEFB 5L2JA 2CDGB 3QQ9D 4M1DH 3QUZD 3BRDA 3MLRL 5GRYA 4TRPL 5TDOA 4Y2OA 1JCKA 3MBEA 1CGWA 3DUSB 4LP5A 4ZAKA 5JNYB 4QXUH 4WJ5B 5C92A 1WWAX 4U1KB 3SDCC 4C83B 1X4ZA 3B6SB 3JWOH 2ICCA 1A6UH 2CGRH 1NGYB 2JELH 3ARBB 3RWGA 2BHYA 5ICYB 4KJQD 2EE3A 4C55A 2BP3A 4MNQA 1RZ7H 1NC2B 2R1YB 4MNHA 1MNUH 2VDLL 4NUJA 1S8DB 3HI1A 1BOGB 4XWOD 4NKIH 5HBBA 3RVWC 1NLBH 3SDDA 4TTGA 2F5AL 5I8EA 3MOBH 5GGVL 3SJVA 1JZ6A 4PJHA 3R1GL 2PXYC 5D2NA 3T0EC 4QRPE 5IVZB 3D25A 3PWJA 1UJ3C 4TPRL 2VITA 2NR6C 4YDVB 3WN5B 1GGIH 5AZEL 1QFPA 1FNEA 4LHQB 5IW6A 1PY4A 4ZUSA 1JUFA 4KXZI 2XG5A 1A6TA 4JG1L 5L8KB 1U42A 1W8OA 1ZKAA 2IBZY 3PWUA 1HSAA 3E6HB 2H26B 2AS5M 5EWIH 5L7XL 3MZTA 3VXQB 2I9LA 4I9WD 4YFLI 4U6TA 1FP5A 3WFDL 3W39A 1F45A 5EOCH 2OI9B 4FNLL 5GGUA 4YXKL 4JN1L 3LKOA 5JO5A 1FAKT 3TV3H 4CMHB 4XPTH 4PJ9C 3GSVA 5EFIA 2V5TA 2FGWH 3ZL4L 3C8KB 1FIEA 4JREC 2DQCH 5DJZA 2AQ3A 4O51B 2VDNH 3WS3A 5K9OB 4YWGL 3HC3L 4APQB 5I73C 5FHAH 3S88L 1FAIL 4GS7B 2QBWA 2X4OB 5ALBL 5K59E 1RZJL 5JHDB 1BJ8A 1MWAB 4ONHB 3HZKA 1D9KB 2DD8L 2ERJB 1UGNA 4KMLB 5DMJB 3RQ3A 3X14A 1NFDE 5DMIH 3PXJA 4BSVB 3IETA 3TZVD 3NH7H 1JPGB 3CLFH 5DDHA 3CXDH 5HGDA 3V5DA 1QR4A 2VZVA 4WFGE 3C2AL 4CADA 3FZUD 4HWZB 5F7KC 4PJDE 1JHTA 2HRLA 3CVHA 4ZO7A 4JRXA 4K71C 4LLMA 1M7DB 3VMNA 1AD9B 4I3SL 4QRPB 1RJYB 3GSXB 3ZKQD 1NEZB 4BFEA 4ZMAT 4PGBB 1U93B 2F54E 4U6YA 5HHMB 5I1LB 4RBPH 3SE8H 4IHOA 1F11B 3GSWA 4KK5C 4N0UA 3SKMA 4JY6A 5BJTB 1KJVB 5GS0C 3K74B 4ODXB 2VUYA 5JXAH 5GS2D 1SYSA 1ZA6A 3SGKA 5GS1C 3HUJE 5DUMH 5B38G 1H3UA 32C2B 1KJ3L 3UXFA 4HWEH 4PJ8B 3RIAK 5F96L 1B88A 4WW2A 4PGDA 5EZLB 1HHJB 3NGBB 4OV6F 5MI0B 1LO2H 3ULUL 1LD9B 5E1HB 4OV5A 3NACH 2V7HA 2B4CC 1QACA 5E7BA 1HQ4B 3MLXL 1I8KA 3DYOA 1PD6A 5IQ7H 3SGEI 3V7MA 3KLSA 3OG6B 3CXHJ 1G0DA 2V5SA 3JUZA 4ETQB 2NTSP 4P4RA 1P4BH 4OCNC 4KHXL 1MFDH 2R8SL 1NFDB 2XTJD 9CGTA 5JPMB 1MCLA 5DD0H 3EIFA 1FG9C 5CGMA 2J5LB 5C0IB 3HI5H 3TEUA 1YEDA 3U36B 1AC6A 5I0DA 5IB3B 3UBXB 5ETUB 3DRTA 2ZOLA 1S7VB 4NCC1 3FRPG 1EFXB 5I8KH 2BY2A 1YNKL 2K3TA 4HUUB 1U3YA 3RVUD 1ZGLP 1XF2B 2XG4A 1OSPL 4BH8A 2R1WB 1FPTL 5DWUH 2ZCLL 5DJ8A 1DJSA 2A6JB 4LSQL 2RHEA 1NCTA 3FN9A 2LAGB 3EYFA 5CHNB 4CJ0A 1ZXQA 5BOPA 3L3DA 4H1LG 5C9JB 3MBXH 3QI9B 4XCEA 1MCOH 3QISA 1MI5D 4V2BA 5FF6A 1T2QH 2YOCA 3MRBB 3SKNA 5I1KH 4XNMB 3KVQA 3HUJB 1EMTL 4Q6IA 1G7LA 3VXNB 2XPGB 5E2WH 4WUUD 2RFXB 5K9QG 1A1NA 5DO2C 3VXRE 2F53D 3UC0L 4GG6A 2PO6B 4NUGL 1OTSD 4I3RL 4FQ1H 4KJYA 2R0KL 1P84J 2XICA 5F3BB 2X1WL 3O9WA 1EEQA 3G08B 2RIKA 4LPYA 4J1UB 3RJQB 1GZQA 1A1OB 4IMKC 4UAOB 5MERB 2X05A 3SQBA 3C08L 4XP5H 4MWFB 1P7QB 1I3GL 3BISA 2BK8A 4Y1AD 5FDYA 4D3CL 1NAML 1NJ9B 1F6AA 1NCCL 5JW3H 4MD0A 1G9NC 3ZDZE 1TQCC 12E8L 4NFDA 1H5BA 2WBWB 2W60B 3V6BR 4GQ9H 2G75A 4I0PC 1FFNA 3FB6A 4UMGA 3BZEA 4EBQH 2XWJA 5EU7E 5EN2B 3VDCA 5IHUL 2EKSB 1SYVA 1MUJA 1XMWA 2VLRD 4HX1A 4OUUA 3V4VH 3KYKH 2NLJB 1BGXL 2BY1A 4JFFE 1MPAL 1FRGH 2GCYA 2DQFB 4CMMB 2CKBA 2X4SB 3MV7D 1AR1D 3SE3A 1RVFL 5BVJB 4O2EA 4NRXB 3HZYB 3P9LB 4QXGL 5CD5D 2C3WA 4OFYD 4OM0L 1W72H 4GW5B 2IQ9H 1E4WH 5CJ5A 4IDLA 1ED3A 2XA8L 1XCTA 4X6CA 4NQXA 4U33A 1B4JL 3LRSA 4H1LH 3FFCE 3WFZA 3RA7L 1T1ZA 2FLRT 2CPCA 1ZE3C 2DLFL 4UU9B 2GW5A 3VXRB 4LHUG 2OI9C 4GW4A 3O3DB 1WV7T 4D9QE 1HXYB 4K7FA 2ITDA 4PJCE 1UZ6E 3NFNB 4JRYD 3FO0H 3NABL 2XKNB 1FGNL 1HHHB 2P7TB 2O61B 4CMHC 1JJUA 4A6YH 4F9LC 2C3XA 4WHDA 2DM4A 4S1QH 3QEGH 3JWDC 5LBSH 3OXRA 1SVZA 1KNOB 1DBJH 4LVNB 4NZUL 2CKBL 3QG6B 1ERNA 4P3CL 4BELD 1T1XA 1KELH 2KDGA 3HAEG 1A9BB 1MHCB 3JTSA 3MJ7B 4MMZC 4HUVB 4PRPD 4ZPTB 2ERJC 2W9DL 2YRLA 3DRQA 4KPHL 5I71B 4HDIA 4HXBH 3PHSA 4WTWA 3LS5L 1DUZA 4R7DA 3MNZA 4KUCD 1P4IH 5DK2B 2A73B 4OZ4A 5E2TL 3WLBA 5GZOD 5CP3H 3EYQD 4HFWB 1RIVL 2R0WL 1YN6A 3TA3C 1T0NB 4P3WA 4FHBD 4IM8A 3GJFK 4NQVB 3UCRA 3UTSE 4HSQA 1GVIA 2AEWA 5E9DD 1R3JA 2ADIB 1A4KA 1QP1A 3ARQA 1I9RL 1E28B 5AZEH 1GH7A 1T2XA 3BWUC 3LQAL 3M07A 5TDPA 5EOTB 1GHFL 3LKRB 4JFQB 4QTHA 1NC4D 3EDJA 4OF7A 1YPZE 5ID1A 4MD5B 1CFQB 5D2LE 4YR6A 1Q72H 4AT6B 2D31A 2VXUL 3J8F7 5C2BL 4JKPH 3FFCB 4HHAA 3WFEL 2RGSA 4R4NC 4X6BA 4NBZB 4QHLB 2Q8BL 4M48L 4LQ1A 3BP4A 4FQHA 4XZUA 1FVCA 1JI1A 3MQIA 4PJ8C 1KTLB 4FQPA 4PJCB 4RMRA 4KVNL 2VDML 3ZL4H 1UADC 4W6WB 3MSPA 1OP3K 4TUJA 1A7PL 2CRIA 2NXYB 1IZKA 2X40A 2FL5A 3VXPB 1FL3B 3HB3D 5DC4B 7FABH 3QIWB 3QCUL 4D0DB 3ZKMC 3ZE2F 3TO4A 3QUYB 4P2CG 3ECBA 2BDNL 5I6XB 3MRJB 3P4MA 4PV9B 2UY7A 3PWVB 1MCWM 2I9TB 2VZOA 4G8FB 4LBEA 2J8OA 3DV4A 2VISB 5HHXL 1S7QB 2IMMA 2CKNA 3HAEH 1MLBA 4KK6C 1JGVL 2J5LC 4M6OH 1T04B 2LV4A 3DX6A 1PZUB 3C2AH 4ONOA 3PWPD 1CBVH 3OV6A 5GJTL 5SWSE 2F9BT 2IAMA 4WI6A 2N56A 3HNSH 3VDBA 4EUPG 2D03H 3WFHB 1KCVL 4XX1G 3W11C 3MRPA 1T5WA 2A74A 3I2CL 3IDIB 1BQSA 3OR6A 1ES0B 4F9PA 4RIRB 2HH0L 2QSVA 2AV1A 4TOYH 1X7QA 3KLHD 2DQUH 5BZDB 4X6DE 5JXED 1YPZB 3J7HA 5D2LB 5D1QD 1N59A 4DWHA 1RUPL 5BRZB 1EERB 3QI9C 1IC1A 4NRYB 5T1DH 3GZKA 3PIQB 4PJ7E 1L6XA 1UXSB 3KYMA 4FMKA 1KYOK 3TC9A 4XP4L 5SWQA 1EHXA 4PGJA 4KMTL 4R97B 5DI8A 3GJEA 4MA3B 2FECI 3RPKA 4CU6A 3WO4C 2FEEL 3ILPB 3MLXH 4MJ5A 3GGWA 5MEQB 1EXUB 1KFAL 1GPOH 4R2GB 1V7NL 1CDJA 1XGPA 1B0WA 5HHNA 3MV9A 2VQUA 1VACB 4ISVA 2IBZX 1AKJB 3VFUA 1G9MC 2BNRD 1W72B 1BLNB 5HHOD 4UAOC 1BAFH 4LCCB 5EZJB 4QY8B 1EX0A 2X4NA 1GAFL 2YPLE 2Q6WB 3ZKXB 2GQHA 3BP5B 1A6ZA 1OSZA 4R4FL 1U8MA 3SKJL 2OX5A 1YNTA 3U0TB 3F5WA 3X3FH 3NCYS 4N9GB 4LSRH 3ARUA 2VTFA 2ZCKH 5JIKA 2YD3A 4YNYA 3MLWL 2DKSA 4N68A 4WVRA 4A6YB 4O2CB 1JWSA 4L4VA 4U1NB 1MFCH 1FCGA 4UDUB 4GBXB 4Z8FL 4XI5C 4MXWH 3GMRB 1IKNC 4MAYB 4WCYL 5FOBB 5C08A 2I27N 5T3XL 5KVFH 4EUPH 1U8KA 3WO3B 1CR9L 5EU6E 1WBXA 5CP7A 4C58B 2HTKC 4P5TD 5KG9B 1KIUA 1MCKA 3KXFA 5FUZL 4OZIA 2VE6B 4JQIH 2D7PA 4ZXBA 4HK0B 4AH2A 4PJ7B 1E6JL 5J89A 1F3DH 3D2UB 3LZFH 1NUNB 5JW5A 4ZO9A 3HPJA 4OZHF 1CE1L 1D5IL 1B6UA 3HPLB 1EPFA 3HG1A 3UC0H 4JFHD 1W2KT 2FR4A 2AJUL 3P73A 5DK0B 2V17L 1IGTA 2Q3AA 1BD2D 1D3CA 2EDQA 2A1WH 4G9FE 3BQUD 1U58B 5CILH 5IKCB 4H88L 3BP7A 2UWEA 1KLGB 1IGMH 1MFBH 1WT5C 2DTSA 3MROA 4G7YL 4JZNA 4JFPA 3EJZC 1LWRA 1Z2KA 1I3GH 1FNSL 4LVNC 3U2SA 2IFGA 4XC3L 2OTUB 1IM9B 4HKBB 1NAMH 3RY6A 1DEDA 3RIFK 4KQ3L 2YPLB 3CFKB 1DBKL 2I24N 1NGWA 3MREB 3MRDA 2EIBA 4RZCA 5DT1L 1KXVC 4Y2DD 3TH3T 4DOHB 3QDHA 3U1SH 2HFEA 4UBDC 3VCLA 5GGSA 2E3VA 5IW1A 2E7MA 2ED7A 1BPVA 1H0DB 5I71C 2HRPH 5L2KE 1WIPA 5IHUH 1T4KB 3GHBL 3MNVB 2ZCHL 5JPNA 5JTWA 4PS4H 5IJVB 5E6YA 1AGDB 4IRJD 5C0ND 5K9KA 3V6OE 3IXTA 2NX5B 3VE0B 3TYFB 2WIIB 3T09A 5GSVA 4GG8B 2R39A 4FFVC 5KVDL 5D1ZB 2MWCA 3N9GL 3V9FA 4RMWA 1OGTA 3REWB 4OM0H 3W82A 3B9KD 3WFCH 2Y7QA 5EULV 2P5WE 4XRCA 4L9LC 1K8DB 1NEUA 4NDMA 5EU5A 5KTEL 3RWEB 3BW9A 4JR9H 3S5LG 3GRWL 4HC1H 1I1RA 5SX5K 1Z0MA 4AEIH 5MHSD 1X5YA 2XN9A 5F1NA 1CGUA 3Q2CA 3GUTA 3D3VD 4P48A 4ZOBA 1G7HA 5MENB 2DIJA 3S4SA 4JFYA 2XA3A 1OM3H 1Q0XH 4LNRA 1V3KA 1PG7W 1I85A 3G6JA 4AEEA 4YHYB 4M62H 5JIIA 5EU4B 3TCLA 4MS8D 4XX1E 1DQQA 3BIAX 1TENA 5B22A 5C6WH 4ODSL 1ZTXL 2P8PA 1GZPA 3KYOA 2Q87A 4LHJB 3QIWC 3BGAA 3EFFA 3VJ6A 1BBJB 3QUYC 4URTB 2MFNA 4PB0L 4PJ5B 4X7CC 1MQKH 1TETH 2VMFA 2WWMC 5ECJE 1FLRH 3H8NA 4PJHF 2JJTC 3KYNA 4H25B 4OQ1A 4C4KT 1MAMH 4E41A 1CVRA 3CMOL 4EN3C 5CKAA 3DXAD 5KVMC 5L9DL 2Y5TB 1RZ8A 1UWEL 3VFVA 2H1PL 2XZAH 4QRRA 3SDYL 5ICZB 3ZKNC 1C5CH 1EJOH 4G8EB 4GKNB 2YA1A 1RIVH 5C07E 3QRFM 2Y6SC 1INEL 4JFDA 1R24A 1DE4B 1FNGB 4TVPH 3MRKB 4HBCL 2DQTL 3OAUL 3X11A 4FZEL 5LWYL 3QXAA 5D7JA 3IU4H 1G1CA 3LQAH 3GMNB 4LGPB 4Y4HA 1EA9C 3WHE0 2PR4H 4QCIB 4XBPA 4KK8C 3RNKB 3B5GA 4FXKA 2P5WB 4Z7VE 1TVHA 2ZUTA 3F7YA 4X80H 3CLEL 3OKLB 4N8VG 2W0KA 2ESVA 2A6KA 3ZT7A 5HGGS 3VXMD 3H0TB 4QLRA 2EH7L 4CBPA 2BSSA 5GRJL 1S7TB 2DIAA 3DOSA 2ZOKB 4GRMA 3WUWA 3BWAA 2E9BA 4N0FB 4B0MM 2LVCA 4X9IA 4K23H 3S96B 4H26A 3MCLL 2EYSA 5A16B 5JMOC 2BNUA 2KZ1B 4YDIL 4OLVL 2ADGA 1EJ6A 3CPLB 4PGCA 3CFBA 4HQQL 3CDGA 5AUMB 3RI5F 1UG9A 5GJSH 3B9VA 1OAQH 3DUHA 1FN4B 4POYA 2Z8VC 3MX0A 2KH2B 2GSIA 4DKFL 3ULUF 3KPRD 4LCCC 5DUBA 4MJIA 2HJLB 4OB5H 5F7EL 3ZKXC 2KUTA 2IADB 4I4WA 4HWBA 4P4KC 5D4QA 1IBGH 2FB4H 3WHXA 3QJFA 4MDJA 3MZGB 3L3IB 5IFJB 2XXMB 4OD3H 1MFNA 4F7CB 4OLYL 1HYRC 4YO0A 4M8QA 5D1XB 3X17A 1L7IL 1U36A 4M8VA 4F7TB 5GGQL 5LVEA 1O0VA 2DQJL 2BRRH 3ZTJH 4NZTL 2EDEA 2H32B 3QQ4B 2AGJH 5BV7L 4WEMB 1NAMB 3W2DH 4XPHL 2YPVL 4PTTA 3IU3B 5C0DB 1RUPH 4I77H 4LOUD 4WW2F 3T3PE 1ZOXA 2IH3B 4LNVA 4K07A 4JDZA 1RIHH 3MRQB 3BFOA 4Z7VB 3GI9H 2XWTB 5JZ7C 1FFOB 3Q48A 4G9DB 4HFUL 3V0VA 4J3VA 1RY7B 4KWUA 3MO1B 4HWBL 4FXGA 1HINH 3QEQA 3HS0A 5I66B 1KLFA 1QSFA 4X5WB 2FWOB 4KMTH 1ND0B 4TVPE 4F80A 1AP2A 4HS6A 1XIWA 1AD0A 4DQOL 4DGYH 3B9DA 1B0GB 1H3PL 1RMFL 1V7NH 3QDGD 5BS0A 4CJ1A 3BKJL 2DI8A 2JB6B 3EHBD 4I0CC 4KKBD 1I3UA 3KPSA 5F9JB 1XF3A 4M7JL 2Q1EA 4ZPVB 3NZHL 2DKMA 3KGRA 2PCPB 1P7HL 4LCUB 4HKXA 2GJ6D 2BVPB 4XPGH 3G6AB 4HUMB 4JLRB 2HLFD 4GMTH 4Y5VA 1NL0L 3KPTA 3QUZA 1T5XA 4EJ1C 3MOAL 4YK4B 5C0AD 4ODVH 2FJGB 3O2WL 3SDDC 1H15A 5JQHC 3BVNB 3O41B 2A2QT 3QFJD 2AK4E 4LEXH 1AHWA 4JDTL 3RTQD 1NCAL 4Z8FH 2O93L 4JZOB 3LEXA 1MH5B 4WCYH 1DQMH 2W0FB 3UJJH 4W6XB 1RZJC 3QYCA 1Y18A 2YXMA 2CLZA 3HC0B 1NANI 3MRLB 2G60L 4Y5XB 3CZFB 1QEWA 5IT2L 3GSUB 5F7DB 5I1EL 4GRWH 2P42B 4P2RD 3SDCD 5J4MA 2PNDA 1INDH 1BJ1H 5D1ZC 4HIJB 4GG6F 1PKOA 5KVGH 4ONGL 2MCPH 1YA5A 1S9WA 3A6CL 4BH7B 1QBML 2L0DA 3L7FB 3DO7A 3B8YA 3MRNB 3RWJB 1A8JH 2V17H 4ZSOA 1YEHL 4L29A 5CJQL 1F90L 2AK1H 2ZUXA 5AZ2L 3QIUB 4H88H 4NQDB 1S3KL 5IK3A 1QNZH 4YHYC 1E27B 2PXYD 5B4MC 4WDIB 4MVBC 5DJ6A 1IKFL 4UB0L 4OJFH 2DWEB 1A7RH 3FCTB 1YEIH 4LLWB 3BE1L 3CCHB 2H3NA 4PY8I 3RL1B 1HIML 1PVHA 2L4OA 2WWKT 4YDKL 2X4UA 1S7WA 4NQCD 1RPQA 2FX8H 2HG5B 3H9ZA 4MA8L 5TPWL 4G6FD 3I9GH 3MLUH 1MCEA 4M3JA 3S5LB 5GHWL 5HPMA 4X4XA 3ULUC 3RUGE 4U1JB 3OB0K 2VDKL 3BHBB 2VXSL 1MREH 1T2JA 1XCQB 3U4AA 2AK4B 3R0NA 1FZJB