2IQ9H

Pfa2 fab fragment, triclinic apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSLSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKNYNPSLKSQLTISKDTSRNQVFLKITSVDTADTATYYCVRRAHNVVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
molecule tags Immune system
total genus 35
structure length 221
sequence length 223
ec nomenclature
pdb deposition date 2006-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9H02
1OTTC 3TA3A 2X2YA 3FO2B 2JJWA 1EMTH 3U7YH 3P4MB 4OLYL 5F3HB 5BZWA 2NY5C 2GI7A 1YEGH 1I7RB 3VI3F 4XVJH 5TF1H 2EDXA 3W0WB 3QIUB 1BIIB 2WUCH 3DX7B 3PQYA 5DUBA 2Z4QA 3KPLA 4KXZH 1MJUL 3FTGA 2VISB 1IMHC 4OQ1A 2J8UF 2VE6B 3D3VA 2XG5A 2E7LA 5K93A 5IB1A 3QFJA 3EHBD 2FB4L 1NAML 5D7LD 3HZMA 4JY6B 1EVTC 1DEDA 1RZGB 1U58B 4QRSB 1YEIH 5E7BA 1SM3H 4MNGB 3BGFC 1QNZH 2I60L 3IGAA 2NMSA 5DHVH 1D5MB 5CKGA 3T1FB 4EXKA 2AXFA 4YHLH 3ES6A 5GZNC 1IGYA 3BT2L 4C59B 3EO9L 5FYJH 2OXGA 2QSQA 2W9DL 3KGRA 1U3ZA 3MRCB 3QA3B 4L8DB 4G6KL 4OKVA 5F3BB 1H5BC 3QDMA 4KTEH 3MQIA 4Z7WB 5D7LE 1MHCB 3MUGA 4Z95L 3BGMB 5CJ5A 4XP6H 2D0FA 1FNHA 1NDMB 1RK1B 1OPGL 3IXAA 1J8HD 2YD4A 1YPZB 4MB3A 3IXTB 1W0VA 1QO3A 2F5AL 4HMCA 4Y4HC 4HUVB 3ARDD 4PJBA 4E41E 4RX4D 3WNPA 4JZOB 3TBVB 4LPYA 5JW3H 2AVGA 1A4KA 4PJXB 3LKOB 3JWDL 4S1RL 1G1CA 1T5WA 3V4VH 5SWZB 3SQOH 4ONHA 1S7RB 2KBGA 2J5LB 4YC2B 1YMHB 2ZCKH 3S98A 1X5HA 2B1HL 4HH9A 4EUPA 1DUYA 3PGDA 1XF2A 4ZQKB 5E56A 2CRIA 4JFHD 5EU7C 4GUPA 4JM4H 1TPXB 1B9ZA 3KPRD 5HGBA 1DTUA 4LSVL 5B8CA 3V2AR 1A14H 1F3DH 5IJVB 3LIZL 1B4JL 2NXYB 3GSUB 1A4JA 4Z6AT 1X7QB 3V5KA 4K55A 3IF1B 3HUJB 4BFIB 5IB5A 1WIOA 4LNVA 4Q2ZA 4ZFZB 3U4AA 5T3ZH 5BVPL 5D2NC 3KJ6H 1U8LA 5F9DC 1TJGL 4XMLH 3BZEB 4POZD 3DJ9A 3C60D 5D6CB 4HUWB 4NQXA 4H5SA 4YO0A 5F72S 5E5MB 5B39G 4G80B 4GO6B 3MGOB 1E4WL 4QTHB 3ARXA 1G6VK 2C7UB 1TVBB 3RHWK 1N2RB 2QR0B 1HIML 2HTLD 4PGDA 5IKCB 5BW7A 1A3QA 5AD0A 1M7DA 5ACZA 2VIRB 1TITA 5J1AA 4OGAC 3MBEB 4O9HH 2OS7A 1NJ9B 3LKPB 4PB9H 3OG4B 4PJ7F 3EYVB 4ONGH 1SJHB 3CUPB 3SE4A 1IL1A 3BP6A 5FOBA 3SDDB 3UBXB 5C0GB 4L4VA 2Z9TA 1F6AB 4G42B 4F9PC 1K2DA 2BMKA 4LGPB 4DKAA 5D2LA 3T2QA 4ZUSA 1J1OL 4FQXB 1LEIA 1KIRB 5IVXF 1F6FB 5F9WC 5A43C 5CZVL 1N0LA 4WI9A 4LVOB 4NPYA 1V7MH 5HJ3B 3KR3L 5A3IC 4G6FB 2ZUUA 5D7JB 2IANA 5DFVD 2VLKD 2EH8H 1NGYB 2VQTA 4WENB 2VLRA 3ARGD 1BBDH 1KPRB 3ARFB 5JZ7D 5FO7A 4E9LA 2EDWA 1HHJB 2A6JA 1Q9WB 3LRGA 3KS0H 3TPUA 4OF0A 3QWRA 4KKCC 5D7IF 5I1DB 3SE3C 3QEGL 3SDAC 1LD9B 1FFOA 1UEMA 2NY0D 3WIFB 4X6EB 3GSOB 5BXFA 1DQLL 2WWKO 1JUFB 3MRHA 2VLKE 1Q8MA 3CVHB 5C0AD 4GG6F 2PYFB 2A1WH 4ZAKA 3UDWA 2V2XB 3S37H 5HHMD 5FO9B 3X11A 3RVTD 3KPNA 1F13A 2V7NA 4M93B 5L2JA 3AROA 3FN0H 2GCYA 4A6YH 2P7TA 5DJZA 1JGUL 4GW1B 1IGML 1S5IH 3HMXH 2DM4A 4JZJA 3SE9L 5BCAA 3ET9F 3MJ9A 4O4YH 2OR9L 4ZPVB 1HINH 4PRNA 4AEHH 1Y6MR 1JGLH 4ZD3L 1CDCA 1BQHA 3I9GL 2DICA 1JF1B 3V5HA 1QR1A 4ZFOL 3KYOA 5CEZH 4YBQD 2HFEB 1ZA3B 4U7KA 3DX8A 4PJ7A 3TF7C 4KZDL 4XNMB 1Z9OA 1F11A 3V9FA 1UM4H 2AXGB 4LCYA 5I75C 4PJHE 3O6ML 2GITB 3VRLE 5IVXA 1N6UA 3V4UH 4P46D 4LKCB 1CE1L 3LKNA 5I6XC 1SEQH 4HKXA 1JWSA 1SYVA 4GBXA 3T4AB 4GRWF 1R3HB 5EO0A 2PTUA 1BWWA 3VU2A 3BFOA 5E9DD 3I6GA 1DZBA 3QT2A 4M62H 3PE9A 3AY4C 2H8PB 1QEWA 4X4XA 1D6EB 2WBJB 3M1BB 1RJYA 2ENYA 6FABH 1AQKL 4WEUD 5C86A 4JPWL 2GT9B 4G8EA 3M8OH 1CLOH 3OKYA 4HIHA 1CVSC 3K8MA 3SO3B 2LVEA 3PGFH 1U8MB 1VACA 2CXGA 4L9LB 5D7IA 2ENSA 1TCRA 4Z7UF 5AAMA 3ZL4L 1AE6H 1Z3GL 3REVA 3C6LB 4Z9KB 5E9DE 1UA6L 1VEOA 4NO3B 1HXYB 1P1ZA 1QBMH 1AGCB 4LLVB 5GRUL 3MRNB 3TNNA 4FQIL 3P9MA 3WKMH 1CLZL 5I1JL 4PP1C 1RUQL 4IIQC 3OX8B 6CGTA 1IC1A 4RBPK 2XKSA 4FQ1L 1RUPH 3JTTA 2BSTB 2E27L 4BELD 1HHGA 3V6FB 4HQQL 1XGYL 4ISVB 1GGCH 3IDJA 1A6TA 1C08A 1G9EA 4MSWB 1Q0YL 2YC1A 4LSTH 2FEEI 2EKJA 4Z7OF 4F8QA 2YPLA 4ZUTB 5C70A 1UZ6F 1QFWI 1AKJA 3MV01 3KAAA 4M7KL 4MXVF 3DROB 2FZ3A 3T3PF 5ADOH 1KCLA 1GGBH 1SMAA 1A7OL 4RFEB 4JVWA 2BOCB 1G6RL 1WCBA 2H6PB 1CU4L 1JBJA 1BFVH 4FQLH 1KPUA 4MNHB 3T65B 5ACLA 3TYGL 2WSKA 2WW8A 1EO5A 1GC1H 4S10A 4U6XB 2XN9D 1V3MA 4R97B 5F70A 1JF5A 1JZ5A 1FV1A 5L0QC 1VEMA 5IIEB 1OB1B 3ZDXE 5DJAB 1PX3A 5CP3A 3A67L 1DQDL 2ZUSA 2P49B 3QI9B 5FYKU 4U3CA 4NQDD 4O2CB 1OAZH 4TNVF 4YHKH 1E4XI 2NY7L 3S96A 1F5WA 2B4CC 3JZ7A 5HYJB 1YYMH 2VXVH 1I1AB 1GGIH 1NCDL 2XN9E 3IU3B 1XIWD 4M1GL 1OM3L 3VGAC 4Y5XC 1RJZB 2RQ8A 3VFUB 4LPVA 1CGTA 3RUGF 5IB4A 3S35H 1J9CT 4Z7UA 4ZFGL 3LS4L 4FTVA 3MLXL 2OI9B 5JMRA 4NQDE 3KLHC 1QD0A 3SDYH 2IFFH 1EFXB 1FGNH 2VZTA 3QIWA 3WKNA 4PPTA 4BQCA 5IF0A 2E7CA 4APQC 3EOTH 3MV9B 1NUFA 4K7FB 3S3SA 2IAMB 5DSCB 2DQUH 4AL8H 2A74B 4JM2D 4HWEH 5DTFA 1AXTH 4M3KB 4NUGH 1FNEB 3SY0B 5IBTH 2AK1H 1RMFH 3U0WH 1YMMA 5CBAB 4XI5D 1TTUA 5EU6D 3WO4B 4YEFA 4AM0A 1NC2B 4OSUH 2HTKD 5DVOA 4OGZA 2EDHA 3RVXC 4OLVH 4XWOC 2GJ6A 3FAWA 4GRMB 4M43L 2GK2A 5J9PA 3HC0A 5CD3A 1AO7A 1TVHB 1HDMB 3EJYD 5FEBA 4NRYB 2IALA 4G8FB 4JY5L 4XXCC 3LPFA 3H9YA 4LLUB 4F33A 4OZIF 1ADQL 3FJTA 4QHNA 4P3DA 3SJVB 4LVEA 5AZEH 2RGSA 1JNHA 3CU1A 4MDJB 5GSRB 4OI8A 1U8PB 5EU6E 5GRXG 3VMOA 1LE9B 1HHIB 1M7IB 1CICA 1YY9C 3MRBA 1AXSB 3GGWA 5IW6A 4LEOA 3KXFB 2J1KA 4R96A 4M7ZB 3EYUL 3TGXA 5I1KL 5A40E 4FZ8L 5EO1A 5TE6H 1QQDB 3ZKND 1KFAH 1YQVL 3LDBB 1M6OB 5GSVA 5LBSL 1O5DT 4XH2B 4HUUB 3L3KA 3C9NB 3SHSA 3BPLC 1I4FB 4NC0B 1P5VA 1IBGH 5GRVK 5DO2D 5F97E 2DLFL 1U3HA 3RUGA 1S9VA 3U1SL 4Y7MA 5I71C 5D1XD 1KENH 1KIPA 4PRDA 4MGXA 1NL0H 4P5TD 3S5LB 3VXRB 1QSED 1I8LA 4XP4H 3X12B 4NKMA 2DI8A 1GRWA 1KGCD 4G6MH 2P5ED 4RMQA 4XNQA 4EQ3A 1R0AL 1A5FL 4GAGH 4HJJL 5HDBF 3RGVD 3ULUH 3FO1A 4IHOB 1K4DA 2A9NL 3FN3A 3VRJB 2ADIB 2CLZB 4P3CL 1AHWB 1G0YR 3QEHA 4PS4H 3F7VA 2B2XH 3QQ3B 2GJZA 3C5SB 1YEFL 3NCYP 4YDLB 4HKJB 4DQOH 4JY4A 4MNQD 2DM2A 1QSEE 5ELIA 1EJOH 4X83A 3JXAA 3NCJL 3AC0A 1YYLL 2P5EE 3RGHA 1CFSB 2NW3A 3QZWG 1B0GB 2FGWH 5C0BD 3TPKA 4RGMB 2ZUQC 4UV4H 3W9DB 4QT5B 3IAGC 5JIPA 4HS3A 1T83C 3INUH 1M71B 3JV6B 4OZIA 4JPIA 3N9GH 3AMKA 2MQ0A 3C6SA 1AIFB 3MNZA 4RMWA 1C5BH 3KWWA 4O02L 5DJCA 5EOCJ 5K9KB 1XGRB 1I1FB 2EYRB 3KLAB 2IQAB 4PJCA 5ILTL 4MNQE 3VXSA 5ALBL 5TDPA 5CJOL 3UROR 3WE6B 5J1SC 2QADC 2D0HA 2CGRL 1BJ8A 4X9HA 4DKEH 1UJTA 2G75B 5FDYA 4WDIA 3L5IA 3LB6D 4HUNB 4NQEB 4LSRH 4U1JA 3F7YA 4GW5A 5ESQB 1MPAL 2Z8RA 1OAKH 1NLBL 4YQXH 1J0HA 1VADA 2OQJB 2AJVL 5HHNA 3SCMA 5F96H 3RWEB 1BD2B 3FFDA 2Y36L 3LKRA 2C5DC 4NJ9L 3MYJB 3VWJB 4KRPB 1LP9E 4UILH 4R90L 4FFYL 4PRPB 4IOSD 2FR4B 2BSRA 3BKJL 5SWQB 3EAKA 2OBGA 4AEFA 5JDJA 1CGYA 5C0ND 1HEZB 3L3JB 3BPCA 1JHLL 4PJGF 5GGSY 3WD5L 1MFAH 3L3GB 2D4DA 4QYOB 1EEYB 1OW0A 4JN2A 1QUNA 3QJHB 5GGRY 4OT1H 5C8JB 1I85A 1UVQB 2F19H 1VGKA 3FT3A 4X5WA 1H3PL 4JQIL 3DTXA 4A2LA 5IP4A 3MRJB 4KJYB 2XXMB 3CZJA 2R9HD 1ZT4B 2Z0BA 5KSAB 3FFCB 3MRDB 3ELAT 5I1LB 1J1PH 4KTDH 2ZUWA 5MEND 4MCYA 1KTLA 3WIHL 1NBQA 1B88A 1EXUA 4JFYB 4Z0BH 1TZGL 4Y19E 5L88L 1HXMA 3BMVA 4PLKD 1J0IA 4KAQL 1T7XA 1MJJB 2HG5A 4PUBL 5DJ0B 1NUNB 4OQTH 1YEJH 1QFHA 1ORSA 1WWBX 3O6FC 3QG6A 3FKUS 4NP4H 4K07A 4UT7H 4W81A 1BJMA 1IQWL 4PTUA 1AD9A 5LWYL 5DI8A 1TVDA 1XZ0B 5MENE 3OXSA 5CWSB 4RQQA 5HYIA 1TJHH 4KROB 4MJ4A 3O4LD 3DSFH 1F2XK 2ICEB 3WJLC 3S5LG 2YA2A 3EYOA 4QRQB 1MRDH 3BDBA 4HCRH 1XGTB 1WJ3A 2V5RA 3JWNC 2X70B 1QFWM 4WWID 4PREB 3UO1H 5ERWA 1P4IL 4XNUL 1XF4A 2Z35A 1F4XH 4KK6C 1CLYH 4OUUB 3D2UA 2RR3A 5I8OL 4CVXA 4TUOB 5L2KA 1A3LL 2ZUXA 4G8GE 3U7WL 5BZDA 4NHUA 4XWGH 4RISL 5DR5L 3O4LE 3T3MF 5IVZA 4A6YA 3PV7A 3DMMC 4DCQB 1W72H 5TE7L 2HVKA 3RVWD 3ULVL 3HMXA 4PJGA 3HNSH 3S36H 2J3SA 2KH2B 2VXTL 4RAUB 3TP4A 2XTJD 3RBGA 2BVOA 1MFDH 3MOBL 4F7TA 4FQ2H 5ITBH 3MJGX 1LK2A 1T1YA 3ZTJG 1T66D 2FX7L 4F2MA 1G7HA 4XPFH 4O5LH 3TYFB 1IC4H 4MA3B 3PV6B 1CTNA 1HQRB 4NN6B 4AJ0A 2C1PA 2AGJL 2QV2A 4NZJA 4GKZA 1IM9D 1F4YL 2H9GA 4PJDF 1F42A 2DF3A 3GMQA 1N59B 2AJSH 3HE7C 3QFDB 4W4OC 3QDJD 3T04D 3CJJA 3QIBD 1T0NB 3WIIH 3MRFB 1DBBH 4ZUUA 3G6DL 1MSPA 1NMBH 4GS7B 3OQ3B 5I2IB 2FO4B 3DX6A 3T4YB 3UTPD 1R24B 5DEGB 1NUGA 1R5IB 1WUNT 1YEEH 1OWWA 1E6JH 4C83B 1PGRB 1LO4L 2EH7L 5FYLL 2F5BH 3C2AH 1ZEAH 4K3EL 4G9FB 5BV7C 2HT2D 1PG7W 4M00A 1S8DB 1F6LL 2CK2A 1H5BA 3MRMB 1CE6B 2K1MA 3U6RA 4JB9H 2DQTL 4YHPB 3QDJE 1KJ2B 4JFPB 1A3RH 3TNMA 2IBGA 4ZXBB 2AABH 1QRND 1QRKA 2ZP0T 2PCPA 4QOKA 5HVWA 5F7KC 3ULSA 3OJMB 1DSFL 1H3WM 3EO1B 4Y4HA 1RFDH 1P7QD 1IC5H 2CK0L 4N0FB 4JKPH 2EIZB 3GI8L 5C0JA 4FS0A 3QUYD 2NR6C 3VJ6B 3ILPB 3PP4H 4OZHB 4J4PC 1WV7T 4WI3A 3BP5B 1N4XH 3CFIC 1VFAA 3O41A 4G5ZH 3QUXC 2J88H 1S9XA 1U41A 3KYKH 2FHCA 2VABB 1QRNE 4OLXL 1UEYA 1OARH 2VKWA 2ZG3A 4E5XB 1KJVA 2DQCH 2DAVA 3LH2H 5FCUL 3ZKQD 2Q8AH 5T3XL 4QRUB 5ICZB 4MJIA 1T3FA 1BOGB 3C08L 3RZCC 3HLAA 1SVZA 1OHQA 4M61B 1MI5A 1ODAA 4WI5A 5JMOC 1N6QL 3V4PH 1J18A 4JPKL 5F9JB 3AAZA 2APBA 3MOQA 1RZ8B 1MHHB 3FCTA 4TSAL 5D2NA 3U9UA 3TA3B 4XNYH 1CF8L 1JNNL 2HWZL 4PJDA 3FZUC 5BZWB 4U1MA 1ZTXL 2R29L 4HKZA 5KVEH 4YBLC 1A22B 4K8RC 3ILQC 4OM0H 4UTBH 2E9IA 4EXPX 1OP3H 2JKXA 1UCBH 5DUBB 2Z4QB 1QPPA 2LU7A 3FTGB 4X7SL 3D3VB 5DC9B 2E9WA 5IB1B 4MHHI 3DO7A 3QFJB 1TDQA 4OM1L 3RFZC 2BDNH 3KPQA 2IMNA 1GVIA 3SPVA 3HZMB 5IVOA 4F9PA 1JPSH 4O51A 2P45B 2VDRL 3TJEH 3QHTC 5D8JH 1FL3A 1ZVYA 3L5JA 4KK5D 3ARSA 3IGAB 1PEWA 1CDBA 2AXFB 4ZNCD 2H2PC 4NZRH 3ES6B 1IGYB 3R8QA 4XNZC 4ZO6A 1INEL 2X40A 1Y18A 3C8HA 5MP6L 3FOLA 5BOZG 1O7VA 4OKVB 1FCGA 2JIXA 3QDMB 4BQ9A 1YNTA 4DAGH 5C07A 3MUGB 1D5XA 3HA0A 5FOJA 2Y06H 4OBRA 3MRPA 1FN4A 1G7JA 3DECA 3UPCA 3IXAB 4OTXL 5DFWH 1JYXA 3P30H 1QYGH 1W0VB 1QO3B 1NFDE 3UPRA 4PJBB 1PSKL 3SE3A 4GRLC 3SDAA 2OP4H 3CCHA 1A4KB 2IF7A 2LVCA 1TZHA 3CLEH 3ZE0E 1I7UA 1T5WB 1UWGH 1ACYL 1ZKAA 3UTSA 4EOWH 4ONHB 2HA1A 3RVVD 2HMID 3TIDA 2DD8L 3IKCB 4EUPB 1DUYB 3PGDB 1XF2B 3V0WH 3PWNB 5BO1H 4XCFL 5SX5H 4GUPB 3SKOA 4HT1L 5DUMH 2E6QA 1E27A 3I75A 5HGBB 4OCWH 4OGXH 1WT5C 1H3GA 3HB3C 5CUSH 3WMSA 1DUZA 1A4JB 4NWTH 3V5KB 1RUKH 2JCCE 5TE4L 1YY8A 5IB5B 1F02I 5KSBF 1H3UA 4Q2ZB 4ZSOB 4PJ8D 3G5ZA 1U36A 3MX0A 5J1TC 2UY6A 4MA1B 5C92A 3CVHL 1U8LB 2NQCA 4FFVC 5EZOH 4MQXD 1FBIH 3K4DA 4XPTL 4Y4KD 1DJSA 4NQXB 4H5SB 4HWUA 4YO0B 3O4OC 1KCSL 1S7XA 2HT3D 1RJLA 4QF1A 4F8TA 2NLJA 4MJ5A 2P24A 5KVMC 4Y1AE 3GHBL 1BFOA 4PGDB 1P4LA 3B9VA 1E28A 5AD0B 5I9QB 4L3EA 1M7DB 4OIIL 5ACZB 4FQHA 4G9DA 3G5VA 4IDJL 2EDEA 4PGEA 4LSSH 5F6IB 5J1AB 3K1KC 1FJ1A 3O8XD 4K3JL 3RU8H 2DWEA 1IL1B 3BP6B 5FOBB 4KQ4L 1FDLL 4L4VB 2BSSA 4JG0L 2BMKB 4JCMA 3G08A 4F7MB 3QXTA 1TTGA 3RDTC 3AY4A 5D2LB 4ZUSB 5LXGL 5BV7H 5I15L 1XF1A 3QDGD 2Q1EA 4HAGA 4LSUL 1LEIB 3UC0L 3I3DA 5F7YC 5FUOL 3HE6D 4MDIB 5E6IC 5I1AA 1K5NA 5MHSD 3H42L 3UTZA 2YEZA 4NPYB 1QVOA 5HHXL 3OB0H 2FLRT 4DVBA 3LQAC 3V95A 5CEXB 1SEBA 3KYMA 1OD7A 2IANB 4I13B 1NCWH 2C4FT 4Y0GA 3DSNA 4HPYL 2VLRB 5HPOA 3W2DL 2NY1C 3WNOA 2OK0L 4YFLI 1IGFH 2B1AH 2OZ4L 3S97C 4JPVH 5FO7B 1TMCB 4XT1C 2A6JB 4IIQA 5B4MD 1MCHA 3P11L 1K6QH 3TPUB 4Y2DC 4FABH 2BFVL 2DLGA 3BPOC 3D0VA 1FFOB 4EIZC 4DVRH 1MAML 1WWCA 3RIFF 4XPGL 5BXFB 5EPMA 2N1KA 3VFWA 3MRHB 4PJAF 3QRFM 3K81A 4JRYA 2Z31D 5KSBA 4BSVA 5L7XL 4ZAKB 3HNVL 3X11B 3KPNB 2V7NB 1QLEH 3QWOA 5L2JB 3VFMA 4WO4D 5I8KL 4TUJA 2GCYB 5J11C 1JNLH 2NY2D 2P7TB 5DJZB 2V6HA 4JFZH 2EC9T 5FGSA 2Y07L 1H15A 4JZJB 3I2CL 1EH9A 4NRZA 5BS0A 1A6PA 4PRNB 1FGVH 5E2UH 1BQHB 4ZOCA 4K8RH 3BZFA 1QR1B 2XKNA 3O6KH 43C9A 4UI2A 3BVNA 4I4WA 4M48L 3DX8B 4AEIL 4PJ7B 4U1SA 5CJQL 5IBLD 5KOVC 3JUZA 3ZTNL 3LEYH 1S7WA 1F11B 1KEML 1UJ3C 2ZCLH 4LCYB 2VLJA 4QRPD 3GSRA 5FGBC 5I8CA 4UIMA 4LKXA 5DVKA 4Q6YA 5IVXB 3BYYA 4EUPG 1WZ1L 3E8UH 2H2SC 1L6XA 5CZXC 3LKNB 4HKXB 1JWSB 1SYVB 4GBXB 1NCCH 2VDML 5IHUL 5L9DH 3QYCA 4Y5XA 5EO0B 1T21A 3BIKA 5TQ0H 1FAKT 3I6GB 4H20H 3HAEA 4TNWF 2IBZX 5HGHA 3H3PL 2VN7A 1QEWB 4X4XB 2WK2A 1RJYB 4F80A 4LNRA 5T33H 4QRPE 4EJ1C 1XF3A 4XCEA 4HUKB 4G8EB 4APQA 1Q0XL 4HIHB 2UWEF 1D9KD 4MAYD 4OQTA 1RY7B 5D7IB 1VACB 4U1IA 2D7NA 4LQFH 1TCRB 2JK5A 4PRID 2A73A 3REVB 1NCBH 1BREA 2APXA 1BEYL 4PJAA 5JOPD 12E8L 4TRPL 1ERNA 3FO9A 4DTGL 1KLFA 4F3FA 3TNNB 3P9MB 3DXAD 1OAQL 4UUJA 1IEHA 1AGDA 1NCNA 3AS2A 3DYPA 4XNXH 4TQEL 3STBA 1WIUA 4HCRA 3JTTB 1BQLH 3EYFA 2NY4C 4YIQA 5GRYA 5GGQL 4MB4A 3IDJB 1A6TB 1C08B 2NXZB 4HSQA 4GW4A 4U2ZA 4XXCA 2ED8A 3MLYL 4JGMA 5GJTL 2YC1B 2YKLL 4PRIE 4UMGA 3EYSH 4Q97A 1O7SA 4HIJB 2VERN 2YPLB 1HK6A 1AKJB 5JOPE 2D9QB 3MV7D 3MLPA 2FZ3B 1LE5A 4KI5E 5DQJA 4OBSA 1ZGLM 3UZEA 1E4JA 1FFPA 4ODHL 3CVIH 4OZGE 1WCBB 4CN6A 3AGVA 2A0LC 3P4LA 5EN2A 1KPUB 2QKIA 3MXVH 5C09A 2F58H 5DJ2A 4GQPH 3I3BA 1RQ5A 2HT4D 2XZAH 1FV1B 1HH9A 4GRWB 3MOAL 5C08D 2HKHH 2HJLA 4S1QH 4D0CA 32C2A 1QFWH 4P23C 3OB8A 3S96B 2QQLL 1R5VA 4V1DD 4ODVH 2WINA 3DUSA 3IDMA 2PUQT 3QJFA 4MA7H 1PKQE 4S1SH 3NGBC 2UWEA 3MYZA 1N64L 1LK3H 2R2CA 1JHKH 1OCWL 1BZ9A 3IDNA 1LVEA 2P5WD 5AUMA 1R3KA 2W92A 3P4OA 4Z7UB 1FORH 5KVFH 4FTVB 4ZOBA 1BQHG 1MCBA 4RNRA 4ZUWB 3LB6C 3LQAH 2EXWC 5IF0B 2V5MA 3EDEA 4V1DE 2JELH 3D0LA 3U48A 5JHDD 3ARFC 4G6JH 5DVNA 4LCUA 1DVFC 15C8L 1TCMA 3QAZC 4AIOA 4ZTPH 2CR6A 1L7IH 3UZQA 1MLCA 1MCDA 5DTFB 1I9IL 4XAKD 3MZGB 4GKSA 4Z7QE 2F9BT 4KUZL 1T83A 2P5WE 3WFBH 3TT3H 3MJ7A 2NPLX 5FXCH 1YMMB 2HH0L 1OP9A 2AK4D 3T2NL 2M1KA 1MNUL 4EN3D 4AM0B 5DK0A 5C6PB 4NUJA 3QUMA 5JHDE 4WTZA 2GJ6B 1MRFH 5J9PB 3HC0B 4F7EA 5CD3B 1AO7B 1JYWA 3O81A 4F37F 3P0GB 5DMJB 1YJDC 2OSLA 5GHWL 2GIYA 2X1WL 5D70H 1MUJA 4F57L 4P3WA 5EIQA 3FQWA 4LBEB 1Y6NR 3SBWC 4F33B 2A6KA 1RIUL 4HF5H 2AQ1A 2ITCA 3JWOC 4QHNB 4PJFF 3OTTA 1JNHB 1YNKL 2AK4E 1CICB 2Y6SD 3MRBB 5IQ7H 4NJAH 3GGWB 3S36X 5IW6B 4IRSD 2R0LL 4LEOB 5ITFA 2IGFL 4GKOA 2RIKA 1LEKA 1YN7A 4R96B 4CKVX 4LLQA 4UBDD 3ME0A 3NTCH 2PO6D 1IKFH 4LGSB 2O61A 1MRCH 3FO0L 3Q3GA 3TWCL 2X4QB 3BDYL 2F53D 5GSVB 2GY7B 5CZKA 1I9RL 5DRXB 1V7NL 2NY3D 2DQDH 3L3KB 4XP5H 3CFEB 3FB8A 2GY5A 1U3HB 1S9VB 1Z9SA 2AXJA 4LHJB 1KIPB 4PRDB 1DEEA 4H1LA 5DQ9A 3ARUA 3P77A 3GSWA 2EDKA 5EZJA 2R2BA 5LG1A 4NKMB 2CMRH 1CZ8H 1EBAA 2CO7B 1IQDA 2M26A 3FO1B 2DLEA 1D5ZA 1RZIA 2F53E 3HN3A 3RWIA 3CXDL 5I19L 1K4DB 3VFGH 5JR1L 4K71B 1MFBH 4U3XA 5HDOA 25C8L 5IWLA 2MSPA 3F7VB 2D7TL 4U1KB 2GJZB 1M05A 3O6FA 1RUAL 4WTWA 5K9JL 4JY4B 2R0WH 3TBSA 3TCLA 1H0DA 4PJEF 5JOFA 2N56A 4I3SH 3ZHDA 5E4EB 3CFCL 3WJLA 3VFVA 4TULH 3HTLX 3EJZC 2L7JA 3ULVD 1IAMA 1UH4A 4S11A 1ZGLP 4HS3B 4D0DA 3SKMA 4FXGB 4OZIB 4JPIB 3LQZA 3C6SB 4YDKL 3MNZB 4PJFA 3KWWB 3V52L 5DJCB 1FZOB 3NCBB 1NH6A 4PJCB 3B83A 1ES0A 4M5ZH 5IFJA 2UYLA 3VXSB 2VAJA 1HYSC 4YHZL 3KPSE 2DIBA 4JFED 5TDPB 2JJVA 3WO3B 1GJIA 4JFQA 3GBNL 5AG9A 3WSQL 3BQUD 4OCRH 4B5EA 4WDIB 1HSAA 3DMMA 4CAGA 2A77H 4X8JA 3GSNH 3ULVE 4WHTA 3F7YB 4E41A 1CD9B 4R4NC 4GW5B 5B21A 4QO1A 5ICXA 1ZS8A 4U1LA 3FB5A 1VADB 1MQKL 5HHNB 3SCMB 4YXKH 3Q48A 2JF1A 5F89A 3LKRB 2X9WA 3BIAX 3W0WD 3QIUD 2CJUH 4LOUC 1CXHA 3VXMA 2BSRB 4NSKA 4JKLA 2J7LA 1A6WL 5D1ZC 3BPCB 5CLWA 2W0FB 3DUHA 4EEEA 1I1AC 3M45A 1PAMA 3C5JA 4JN2B 3UEZA 2BY1A 3KNBA 3R1GH 3HE7A 4W4OA 2BVPA 1VGKB 3FT3B 3T0WA 4I18C 4X5WB 3DTXB 1AI1H 3CSGA 3OZ9L 5CIPA 3CX2A 2V17H 3W0WE 1KLGA 1OTSD 3J7HA 3GUTA 2FCBA 3U30B 4MCYB 1KTLB 3R06B 5FYLE 1EXUB 2DQIH 3PJSA 1FIGH 5KTEH 1U8HA 4PJEA 1HXMB 4LF3A 3F6IA 2R0ZL 4WUUA 5DMGD 5JIHA 1NGWA 1JYNA 5FUZH 3DURA 3DIFA 1LQSR 1IGCH 1PG7H 1ORSB 4EI5C 4KKAD 3QG6B 2EE2A 1CYGA 3V6BR 2XQYK 4I77H 3D9AL 1S78D 3Q6GH 3IVKA 1AD9B 5DI8B 5T3XD 1V8HA 3ZKMD 1EGJH 1EBPA 3OXSB 4UU9A 4YBHA 4RQQB 4XGZA 1ZANL 1IT9H 3RPKA 4ALAL 4YK4B 3MA7B 5GPRA 1AH1A 4J4PA 3EFFA 4A2MA 5SWZD 3EYOB 1JJUA 2W0PA 4KDWA 2PTVA 2XKUA 3QUXA 1I7ZA 4G7VL 1NLDH 4Z7WE 3CFJA 3GHEH 1JWUA 3WUWA 1KJ2L 1EHAA 1YJDH 1BIHA 5ERWB 4X6DF 4JFOB 1XF4B 3X17A 2Z35B 4X4MA 1T5XA 3UYRH 3LEXA 3JWOH 4CVXB 1KXVC 4Y89A 2VXUL 4DW2L 3K8KA 4R6UA 5T3XE 3RZCA 2NXYD 3VW3L 2ZPKH 4N0UE 4CRPA 5BZDB 4NHUB 2APVA 1FRGH 5IVZB 2AEPL 2YMXL 4A6YB 5SWZE 2HVKB 4RCAA 1QBLL 4O2FA 4PJGB 4Y16C 1HWHB 4XTRD 2DKMA 2GFBA 2AJZB 3GK8L 2DTMH 4HPOH 4H25A 2BVOB 2EDYA 1G9NL 2ESVA 4PGJA 4F7TB 2I5YL 5CSZA 1LK2B 1T1YB 1MCOL 5IFHL 1CXEA 1A7PH 1GPOL 1EERB 3FQNA 3Q6FA 4F2MB 1KN2H 1G7HB 1NFKA 5JQ6H 1Q72L 2C1PB 5CAYB 1PD6A 4H0IA 3MR9A 4GKZB 2XQBL 4TPRH 1QFOA 5C0FA 2H9GB 4DGIL 5C6TL 3MBED 4UTAL 4OD1H 3GMQB 3SDDD 4OLYH 2Q6WA 4EDXA 1QA9A 2BZDA 1B6DA 5HVFB 4ZUUB 3C09C 1GSMA 2J6EL 2B0SL 3BKCL 3DX6B 4CU6A 4FQXD 2HMIC 4EVNA 3DHMA 1MJUH 1I1CA 4I0PC 1OP5H 1OAUL 4YDLC 3UBXI 4U2YA 1UH3A 2G5RA 2YUZA 5IMOB 4G6FD 5HD8C 4FMFA 5D7JD 4X4ZA 1H5BB 1CXLA 2FB4H 2ICWA 3U6RB 1NAMH 1GGUA 1U2HA 4UOW1 3TNMB 3DRQA 2PCPB 4QOKB 3ULSB 3ECBA 3QCUL 5B38A 1NMCC 2FNBA 4JLRA 4X6DA 4Y4HB 1CGSL 1EHNA 1UM6L 3QPQD 4GRLA 3BT2H 3QCVL 5C0JB 3PHOA 4UV7H 3EO9H 4PLJD 3I6KA 2W9DH 3HR5A 4K94C 4R26L 5DRZA 1A7NL 1AR2A 1RZKL 3O41B 2E8ZA 1X9QA 4Z95H 1JI1A 4P2QA 1DQML 2W9EL 4KK8D 3QB7C 1KJVB 4N5UA 3U0TA 1DLHA 4B7LA 2F5AH 3LSOA 1GGTA 5MEQA 1WT5A 1KXTB 1ZOXA 4MJIB 1T3FB 1RD6A 4YFDB 4YDVB 3HLAB 3QQ4A 2DKSA 3E6FA 1CDIA 1EAPA 2R4RL 4U0QB 3AAZB 2YPVL 3FCTB 5D2NB 3U9UB 3HE6C 3NIGE 5D1QC 3VH8A 3WHE1 4PJDB 2B1HH 4GLRH 1KB5A 4XMKL 1IAOA 4U1MB 4RZCA 3UJTL 4PRAA 4HKZB 4AMKL 5ANMB 1XCQA 4RAHA 4LSVH 3UTTE 1PY4A 2ZNWA 1IARB 3LIZH 1B4JH 1CK0L 5E0QA 3U4BL 3ZE1F 5HVGB 1G84A 3BW9A 3B2UD 4X80L 1A21A 4BSJA 4F7CA 4F58L 3STZA 1OQXA 5BVPH 3IU4L 3MJ8A 3ZKSD 4NNPL 1TJGH 3SPVB 2VAAA 1MCEA 1HHKB 2HYMA 4O51B 3ZKXB 3RDTA 2L4OA 1CDYA 5E70A 1FL3B 3L95A 3PL6B 1JZ8A 1E4WH 3CFBB 4FG6C 3CSYA 4JFFB 1HIMH 4KV5F 5F9WB 1ONQA 5E6IA 4HKBA 4KKBC 4RGNC 3O9WD 5C0EA 4LLAA 1PZUB 3GSXA 5FGRA 1Y18B 1NC4A 3D39E 3IFOA 3FOLB 1CG9A 2D7PA 1X6NA 1JYVA 4WU7A 4OLEA 2JIXB 4JO3L 2EEDA 2J12B 3C6LD 2BC4A 5C07B 4CVWA 3B9KC 5B39A 1D5XB 4F15C 1J1OH 1MJ7L 3MRPB 1FN4B 1G7JB 2D4FA 4MZ3A 3BOVA 1GZPA 2UZYB 3NIDF 2BVQA 1IC7L 1G9MC 2FIKB 3BO8B 1YPZF 1A1OA 5CZVH 4Y2DA 1R3LA 1UFUA 2ATPA 5HHVL 3SDAB 4WTXA 3KR3H 1XGPA 4NQDA 1LO0L 1TZHB 1FNAA 4DEPC 1I7UB 3C8KA 2V9RA 4PJXF 4HBQA 4BZ2L 1KN4L 1SJVA 4I2XB 3UTSB 3WUZA 2BHYA 3TIDB 4KH2A 1MFEL 2YSSA 2AXHA 3KPMA 4G6AC 4Q9BA 2K3TA 3SKOB 3KLDA 1E27B 2YD1A 3I75B 2OTWA 4KVCL 3O0RL 1X5AA 1ZV5A 3MRQA 3QEGH 5F7NC 1H8NA 2UZIL 4LCIL 4U6HA 4QGTA 5K59F 1YY8B 1DQLH 2Z8VC 2JB5L 2E9JA 3HUJF 3VXPA 1X5ZA 3G5ZB 5EOCL 1OP3K 3AVEA 1DP0A 3NABH 2MQ3A 2X42A 2FDBP 5EORL 3VG0L 2Q8BH 3P0YL 3QI9D 1LMKA 1S7XB 1UJ3A 1RJLB 4QF1B 1U8NA 2CO6B 1IILE 5I75B 1IGMH 2NLJB 5CEYA 5B3JE 4MJ5B 3SE9H 2BERA 2P24B 4M1CD 4FQJL 1OGAA 5FGBA 1BFOB 3MUZ1 5HYJD 1P4LB 2OR9H 3MJ9L 4WCYH 1E28B 4L3EB 1SY6A 4ZD3H 4KI5C 5I6XB 3I9GH 1C7TA 4KRNA 1NGXA 4FQHB 4G9DB 3G5VB 4AEEA 4PGEB 3ZYOA 1FJ1B 5FECA 3PF2A 3ZDYE 5IBUB 2BSSB 4JRXE 2OXHA 4JR9L 2CIKA 3G08B 3QA3A 4XCNA 4KZDH 5F3BA 1YDPA 5A2FA 1BFTA 3O6MH 4GAJL 1SJXA 1NDMA 1K5NB 5I1AB 2B20A 3MV9D 3UTZB 2YEZB 3QPXL 1QVOB 4JFDA 2FYYA 2AI0L 2IAMD 2YRZA 4F37K 3MLRL 4DVBB 4WGVB 1CCZA 1SEBB 3TBWA 4LL9A 2DLHA 3KYMB 3HHRB 1LO2L 5F1KC 4JGUA 1B0RA 1H3XA 4HLJA 1UCTA 2GJJA 5EG6C 3FONA 1FFRA 1OAXL 3K7UA 1F58L 1AQKH 2ZNXA 5FUCE 1CBVL 1NC2D 4JPWH 1UZ8A 1XGUA 4X9FA 3MV9E 1CL7H 1MFNA 3D0VB 1XF5A 2XT1B 5SX5K 4QRRA 3Q5YA 5EPMB 1KBGL 4GKNA 3VFWB 3ZL4H 4JRYB 1X4ZA 1X7QA 1Z3GH 4BSVB 1WWAX 3HUJA 1DL7L 1UA6H 5TQ2L 3SJVD 3QWOB 5GRUH 3VWKD 4H8WL 4FQIH 4HULB 1CLZH 4TUJB 5I1JH 2OL3L 1RUQH 5GRJL 3GSNA 1H15B 4RA0C 4FQ1H 3MCG1 1PW3A 1LWRA 3KXFD 2E27H 1ZSDA 4NRZB 5BS0B 1BECA 5DT1L 3MGOA 4HQQH 4YH6A 1XGYH 4KJPD 3T77A 4QCIA 4HXAH 1IVLA 3BZFB 3EYQC 1Q0YH 2XKNB 5D7SL 1ZLSL 5KSUB 5IROC 43C9B 2BJML 3VRIA 3BVNB 4I4WB 5L0QB 4S1DC 3DHJA 1KYOJ 4U1SB 4M7KH 4HZAA 5DD0H 3SJVE 1BAFL 1L7TL 3IDXL 1S7WB 1A7OH 4FNLL 1QLRA 4P23A 2VLJB 4G42A 1G6RH 1MY7A 3GSRB 2IQ9L 1CU4H 1RVFL 3VXRD 5I8CB 4UIMB 4LKXB 3KXFE 4ZYKA 1ULVA 1KCRL 5ECJE 2ICES 1KIRA 3ARBB 4XRCA 3G6JB 4YXHL 1VESA 5C0CA 2EDDA 3VGAB 4Y5XB 4M4PA 4NQTA 1T21B 4G3YL 4ZDHB 2FBJL 2PETA 4WWKC 4OFYD 3HAEB 3A67H 1DQDH 1QFPA 5HGHB 4L8BA 3OB0K 4I48A 1NGYA 2SEBA 4KHXL 2NY7H 1S9WA 2ICWJ 4B0MM 4LNRB 4YDJB 1XF3B 4XCEB 3ARFA 4APQB 1NAKL 5FHBL 5T5NF 1DVFA 3FHQA 4OKDA 1P6AB 1NCDH 4XBEL 5GGSA 4U1IB 4M1GH 1OM3H 4HIEB 2WIMA 5H37H 4HS8L 4MCZA 5GGRA 2A73B 3WIFA 1YN6B 2F8XC 1TFHA 2DQFA 4ZFGH 4PJAB 4ELME 4KJWC 3MLXH 2LU3A 1F97A 3FO9B 4F3FB 2QHLA 5EUOE 4Y19A 4UUJB 2FGZA 1NPUA 3SGEI 1QTYT 5IBUG 3TVMC 1DR9A 3EYFB 4YIQB 1NBZA 2GSIA 4GW4B 1FNSL 3D6GA 1ETZA 3N0PB 3SBWA 4NQED 3V8CA 1UYWH 1WISA 3P9LA 4Q74A 2FWOB 2Y5EA 1J86A 5GQBA 1J12A 1CT8A 1LE5B 1RIHH 5DQJB 2HRLA 1C5DA 1FFPB 1BD2D 3BIBX 4M43H 3VWJD 1NGPL 4KRPD 4GMSL 5EN2B 5C09B 2QKIB 2HLAA 4PRPD 5DJ2B 4YHYC 4PJIB 3DRTA 4JY5H 2HAZA 3HMWL 5EIIA 2XQYG 1ADQH 1EEUA 3C5ZD 1HH9B 3T08A 4CL7A 5GS0C 1MELA 3BPLB 5TDNA 4G8GA 2W59A 1FH5L 5HHQA 3OKNA 2GK0A 2HJLB 4KUCD 4D0CB 5I71B 4HBCL 32C2B 2O5YL 5ADPH 1RJCA 1NBVL 1V3KA 1R5VB 1QSFE 3DUUA 2WINB 3DUSB 5KSAD 1D6EA 4CUCA 3IDMB 1S3KL 1JIBA 3EYUH 3QJFB 5I1KH 3CNKA 4NQCD 3O2DA 4FZ8H 1X5XA 1E0OB 1YQVH 2DYPA 2IFGA 5TF1L 5LBSH 3IJSA 3WNMA 1BZ9B 3IDNB 3QDAA 3B8SA 5AUMB 3P4OB 3V0VA 4NQVB 1WAAE 2DLFH 2LAAA 2JJSC 3U1SH 2H1PL 2P4AB 4RFNC 4RNRB 4HHAA 3P2TA 5ISZE 1T22B 1HXYA 3D0LB 2EECA 5L6YL 1WBYA 1PG7X 2K7QA 3B5TA 1NCAL 4LCUB 3WXWL 4L3CB 3FMGL 4NQCE 4WEBL 1R0AH 1A5FH 4HJJH 1YA5A 3RVUC 3FAXA 1CFTA 4KROD 5KS9F 4RWYH 1MLCB 4LLDA 4LRNL 4GKSB 4ODXA 4Z7VE 4OZFH 3WFEH 4W6WB 2A9NH 3NFPA 4P3CH 5TDOA 4OF6A 2E3VA 5DJ8A 2VXQL 4QHUA 4X6BA 3MJ7B 2B5IC 2E7HA 1DN2A 1AR1C 3AM8C 4ZUTA 5FYJL 5DK0B 2CIIA 4NUJB 3QUMB 4N1HB 2VZ3A 5GS1C 2NZIA 2CDGA 1DE4A 2ZKHH 4F7EB 3NCJH 2VKXA 1AGEA 2QADB 4UQ2A 1CI5A 2OSLB 3MMEA 2PTTA 1MUJB 2WIIA 2A6KB 1I3GH 2ITCB 3TJHD 3I3EA 4EDWL 1EVUA 3VD5A 4O02H 1A6VH 3X13A 5KJRL 5HGAA 1PYWB 5E8OA 5ILTH 2X4NB 1LEKB 5CJOH 5T1MA 2W38A 1MCFA 2CGRH 2PYEB 3QZWA 1QHPA 2J8OA 3SKJL 3LPWA 3ROOB 2O61B 5D1ZA 1V3LA 3T0EC 2JB6A 3Q3GB 1I1AA 3CIQA 4JM4L 5J13C 1TENA 1S78C 1RZ7L 1V05A 2R8SL 4KPHL 2FJFA 4X7DC 1MPAH 5I1HL 1MCPL 3IU3A 2IADA 3UYPA 3FB8B 2CLRA 1O0VA 2A6DA 5JOEA 1NLBH 4I18A 2AJVH 2EDRA 1TQCB 2W1NA 2J4WL 2Y36H 4NJ9H 1DEEB 5JQHC 4H1LB 4WU5A 5CHNA 3P77B 5DQ9B 5HI4D 3GSWB 4K23L 4R90H 3TN0C 4FFYH 4XPAL 5EZJB 3KDMA 1NCTA 1RAMA 1AC6A 3BKJH 4PY8J 1EFXA 4M7JL 3RHWF 1SVCP 4LP4A 1JHLH 1IQDB 4Q6IC 3WD5H 5HXMA 3RAJL 1RZIB 3RWIB 5J57B 1X5KA 1OT1A 5HYFA 1ZA6A 2RCSL 4C56E 5BQ7A 5KS9A 2X1XR 1S7TA 4HV8A 2C3WA 1OTUD 2A74A 3NCFB 4ENED 5HHOE 5A2IH 4FFWC 1H3PH 1M05B 4ZXBD 4EI5A 3O6FB 4JQIH 4MX7A 3WDJA 8CGTA 4CJ0A 1GHFL 3MCLL 3L7EA 5CBAA 3TCLB 1YQ2A 4L5FL 2YN3A 1FFNA 1H0DB 4X9GA 4LU5H 2NX5A 5JOFB 3WIHH 1URLA 2V7HB 4YUEH 1NANH 1TZGH 4QTIL 1P69B 5L88H 4RAVA 3VFVB 4NHCL 5E2TL 4KAQH 3SKMB 3I50L 2N7AA 4PUBH 5DZNA 5CMAA 4PR5A 4ZTOL 3MLWL 3LQZB 2CDFA 4DUXA 4Y2OA 4OUOA 4PJFB 1C1EL 4M1DL 5IW3A 1ES0B 5IFJB 1IQWH 2UYLB 5CFHA 5HDLA 5GSRA 4PBWD 5LWYH 4PJ9C 4JFQB 2ZCHH 4HK0A 3RKDC 2IBZY 2YWYA 1TETL 1HSAB 3DMMB 4ELKA 4LDOB 4X8JB 1BBJA 4Y16A 4WHTB 4E41B 3PHSA 2EYSA 3H9SE 4LPWA 3TA3D 5HYSA 1J11A 1ZS8B 4NOBA 4RFOL 5E2WL 1ZLWH 1WFNA 3FB5B 4NQUA 1P4IH 4XNUH 4N0YL 3IDIB 5DC4B 5E2VL 5F89B 1UB5A 5I8OH 2VRAA 1A3LH 3VXMB 2EZ0D 2VLME 3PQYD 3S37L 2J8HA 2I9TA 2HFGL 4NSKB 3MRIA 1EEZA 4RISH 5DR5H 1FNLA 4JO4L 3D3VD 4LSPL 2NYYD 4YXLL 5TE7H 1UG9A 3ULVH 1E4XL 1HZHL 3C5JB 3GSQA 4WTZG 5EOQL 2XFXA 3QFJD 4XC3L 3KNBB 4ZMAT 3QPQC 3HE7B 2VXTH 3WN5C 4IHOA 2NY5L 3MOBH 1GL4B 5GS3A 5KBNC 1I1RA 2YA0A 3HG1A 5F7FA 1PEZA 1KLGB 2FX7H 4DKFL 3PQYE 2W07A 4I0PA 2GTZA 1IZJA 4AZ8A 3QNZA 2FJGA 4AQ1B 2AGJH 5BV7B 4NWUL 3PJSB 1F4YH 4Y4FC 1U8HB 4LF3B 2XV6B 4WUUB 5D7KD 5H94A 4Y1AA 3QDMD 2X9YA 1NGWB 4NFCA 4WNQA 4TTGA 1UKSA 3DURB 3DIFB 5JHLL 4GFTB 3NFSL 3W9DA 1YZZA 4ODWA 3G6DH 5K9QG 3QWQB 4N5ED 5E6ZA 5T5FL 5JPNA 3CC5A 3TZVC 4KC3B 4KK9C 4HGKC 3VD4A 4BFEA 3WEXA 3IVKB 3BAEL 1KIUA 1FSKC 1I3VA 4HFUL 4UU9B 2AQ3A 3BP4A 1GZQA 1LO4H 1J0KA 5FYLH 4XGZB 1DQJA 1HH6A 4HK3J 3EJJX 4K3EH 4LASL 1XR9A 2YD3A 2JLLA 3X3GL 3EFFB 5AWNL 1QBAA 2DQTH 3QDME 2CRYA 3QUXB 4R2GD 4XP9L 1I7ZB 1T6WA 2G75A 1OT2A 3CFJB 1JWUB 4K3DL 3SGKC 3L3DA 1JZ7A 4NFDA 2YD7A 2WBWB 2BNRD 3DVGA 3OAUL 4NT6A 3VE0A 3LEXB 1DSFH 2I07A 4I3RL 2CK0H 4FN0A 4PJBE 1DBML 3RIAK 4BSWA 3GI8H 3RWEA 3RZCB 1KT2B 1CFBA 3I6LD 2MCG1 1A8JH 4KJQD 4MLIA 3S34L 4JKMA 2PR4L 2E8YA 4O2FB 5GRWA 5D1QA 4MXQC 2GFBB 2XG4A 4OLXH 4H25B 3HI6L 4YBLB 4YGAB 5DZLA 5IK3A 5CSZB 2BNRE 5FCUH 5C8JA 1QOKA 4HG4K 5T3XH 1PZ5A 1CGUA 2IG2L 3VI3E 3C08H 3RTQC 3TBTA 5IFAL 1R3IH 3SKUD 4QWWC 3MR9B 1N6QH 4R8WL 3FFCA 4JPKH 5C0FB 4TSAH 5CGYD 2J8UE 1CF8H 1JNNH 2HWZH 3MGAA 4EBQL 4JFYA 2Q6WB 4EDXB 1IJ9A 4L4VD 1QA9B 1T04A 1ZTXH 4HW6A 3NCCB 2R29H 1CDHA 2HJFA 4ZO8A 3DARA 4WW1A 1WEJL 1BGXL 3OR7B 4P9HC 2GHWB 1VGEH 2R39A 2CUMA 4XNZB 4XCYB 3RNKA 5DF0A 1NCUA 4X7SH 1C12A 4EIGB 4L29A 3VD7A 1PBYA 4PJHB 1CLCA 4OM1H 2BXZA 2ICWB 2IAND 4H0HB 5KANG 5LGKA 3PWLA 1CGVA 4N9OB 2AQ2A 3OAYK 1BQSA 4L4VE 3A6BH 3B9KA 2VLRD 2GUOB 5DJDA 3ECBB 3EDJA 2MKLC 4GSDL 5B38B 4GMTL 4J8RA 4JLRB 4U1HA 4X6DB 1CIUA 1W0YT 3QWRD 4GRLB 5H35A 1INEH 1CIDA 5HPMA 5MP6H 3QQ9C 4Z5RA 3PHOB 1WBXA 4OUUA 4KMTL 2A83A 3LAFA 3I6KB 4PIRF 3HR5B 1FGNL 3K4ZA 3WXVH 4OZHF 2IANE 5DRZB 2R15A 4ZAKD 3RWGA 4LDEB 1Q9KA 4P2QB 4DCQA 5A1AA 5GS2D 2C3VA 4OTXH 3U0TB 4V2CB 5IOPA 1DLHB 4FXKA 1FVEB 4QRTB 4RAUA 3LSOB 5MEQB 1NSNL 5IMKA 1PSKH 1OGTA 4OI9A 5AYQA 4PV9A 4S0SD 2DDQL 1T1ZB 1FL5A 3E6FB 4FFZL 1WZLA 2MPAL 5IR1A 1ACYH 1EAPB 4JO2L 4D9RD 2PNDA 3VH8B 1U6AH 2EE6A 4X7TA 1KB5B 1IAOB 4P59L 4RZCB 1L0XA 2HLFC 3O4OB 4XCFH 4PRAB 2CD0A 4HT1H 4ACPA 3U9PH 1XCQB 2FATL 3K3QA 4DN4L 2HN7A 2X4PA 35C8L 5TE4H 4F7CB 1D5IL 3STZB 4R3SB 1P84J 3DVNA 4GBXD 1R24A 3G5YA 4LK4A 3CVHH 3UYOD 3MJ8B 3U30C 5B22A 4D9RE 1QG3A 1FG2B 3TBYA 5E5UB 3E6HA 2VAAB 3ARRA 5HI3D 1OP5K 4XPTH 4G9FA 4PJ7E 3RDTB 1KCSH 3L95B 1KCUL 1MWAA 3HC3L 4XVUC 3RQ3A 3CSYB 3GHBH 5LAXA 5E6IB 4HKBB 5C0EB 1BF2A 3GSXB 4OIIH 4PY7A 1VPOL 1NC4B 4ZS7L 4X6FA 3SKNA 3IFOB 4IDJH 3EO1A 1CG9B 3HPJA 3IFLH 4WU7B 1NL0L 1RU9L 4K3JH 4KQ4H 1FDLH 4JG0H 4MD0A 2BC4B 2NY1B 3KHOA 3VCLB 4PJ5A 5LXGH 3V0AC 5I15H 4TVPL 3L1OL 4LSUH 1X5IA 3UC0H 2CKBA 2BVQB 3MPCA 5FUOH 1A1OB 4Y2DB 3NAAL 3SDXF 1R3LB 3BPOB 3H42H 4D3CL 1JTTA 2ATPB 4XP1L 4QHKJ 5HHXH 1XGPB 4NQDB 1GGYA 4PS4L 2DQEL 3C8KB 4IOFC 1IGIL 5D7IE 2NXZD 4DQOL 4HPYH 3P0VL 4WFHD 4D9LL 5EA0L 2YPLD 3W2DH 3TO4C 1AKJD 4GJTB 2OK0H 4HIXL 4GG6E 2YSSB 2OZ4H 4JN1L 5IEHA 3KPMB 4NCC2 5J11B 3AS1A 2UV3A 4BQ6A 3P11H 2OTWB 4EKXA 2P5WA 4U05A 3V7AE 2BFVH 3IFPA 3MRQB 1MAMH 3ZZ1A 4U6HB 3N9GL 1KLUA 2VZ1A 4MQSB 4H0GA 4XPGH 4HJ0D 3VXPB 5E7FA 2AW2A 5B38G 5IROA 3ZMRA 5L7XH 3RY4A 1F90L 4WFHE 3HNVH 5D5MF 1X4YA 2YPLE 4OB5L 4XVSL 3MFFA 4LHUA 5I8KH 4JM2B 1UJ3B 4NZDA 5DHYB 1T6VN 1U8NB 5CCKL 1P84K 2Y07H 3H3KA 5CEYB 5DMIL 1OGAB 4I5BA 3QEUA 3I2CH 2ZWLT 5J56B 1JPTL 3B3IB 1JZ4A 4M7LL 5LGJA 5EU6B 2LQRA 4D8PA 2GW5A 4YQXL 1NGXB 1ED3A 4P9HH 4ETYA 1FYTA 4M48H 5FECB 4UILL 4AEIH 4WWKA 4GRWE 2CIKB 4XCNB 2Y23A 1WC7A 5FGCE 1YDPB 4FTVD 3ZTNH 3K4AA 3WLBA 3TFKC 1KEMH 2PN5A 4K9EL 3RP1A 4XHJC 4P2YA 5D2LF 3QIWD 4U1GC 2B4CL 4YHNA 4NN7C 4HC1L 3VH8G 4NKDA 3OR6A 1WZ1H 3HZYA 4JFDB 2FYYB 3SDXA 5E03A 1VKXA 2VDMH 4KKLC 5IHUH 1F00I 4DZBA 3TBWB 3TH3T 2EXYD 3E0GA 2DL2A 3IETA 2ZUTA 4LMQI 1B0RB 1L4IA 1MF2L 1LO5A 5IT2L 4Z7UE 3H3PH 5ESVB 3WIHA 4FTVE 1YMMD 3FONB 2UUDH 2BVEA 4LLWA 4LMQE 4CN1A 5IM7A 3NPSC 3THML 4PTTA 1DBKL 1UZ8B 3IKCA 3D87B 3NCEB 1XMWA 1XGUB 1Q0XH 4IEFB 2GJ6D 3PWNA 1EPFA 5DD1L 1J8HE 2XA8L 3TVMA 1AO7D 1XF5B 2NY4B 4JKKA 3VFTA 5ABDE 4QRRB 1NMAL 4P2RA 4GKNB 4WGWB 1FLTX 1QSEB 3F8UB 5DQDL 3KHQA 2Y5TA 1BMGA 1BEYH 3KYNA 1Z0MA 4TRPH 4ZSOA 4Z7OE 4DTGH 1YMME 5D5MA 4M02A 1K9TA 1OAQH 1UZ6E 1EAJA 3IYLW 5CILL 1CICD 4QXTA 3DSFL 4MXVE 5GGVL 4TQEH 3GSNB 3T3PE 3L6FA 3IDYC 2V2TA 2GJ6E 4HCRL 2PXYC 4JFHE 1GC1C 1ZSDB 4ZUVB 1AO7E 5GGQH 1ITCA 3KPRE 1PLGL 4QCIB 3T77B 2ZUVA 2IBBA 5GJTH 2KUTA 3MLYH 2YKLH 3QXWA 2WAHA 3KPSA 4XVTL 5JDSA 3VRIB 3R4DA 3ZDZF 3IS1X 2BK8A 3W9EB 1ZLVH 2M2DA 1NGQL 1U3HD 2FEDD 4XMPL 1I8MA 4M9PA 3OF6A 1MLBA 5E8PA 4ODHH 3CLFL 4P4KC 1QLRB 4P23B 3ZKXC 3BRDA 4F7MA 2HVJA 4BFGA 4F7PB 5DJXA 3EDFA 3SN6N 4ZYKB 4CU8A 3PL6C 4MVBC 2ADGA 4C55A 4XRCB 3NGBB 1X3DA 5DZOA 3UMTA 5C0CB 4MDIA 5CGMA 3GJEA 3GM0A 2DN7A 1LP9B 4RGOL 1EEQA 3MOAH 3DV4A 4YR6A 3G6AA 4X98A 2JJSA 4L8BB 3RUGE 3ALWA 4I48B 2SEBB 3VXUA 1S9WB 4JHWL 3BI9X 5FYJD 2QQLH 4H88L 3P73A 1A1MA 5C3LD 3K0WA 3QUZC 1DVFB 3LN4A 3QAZB 4Q58C 4HWZA 5GGSB 3WIIL 5JXEC 4XAWL 1U95A 1N64H 5DRWB 5J4MA 4ONFL 2WWMC 4S2SB 1NMBL 4KRMB 2QJDA 4MCZB 5GGRB 4PLOB 4J2XA 1D5BA 2DQFB 5AYUL 1YEEL 4NO0A 1CFVH 4YNYA 2F5BL 3C2AL 4NGHL 3V8OA 4Y19B 3AM8A 5DWUL 2OM5A 3H7BA 4P5MA 5GS1A 4BUGA 1A02N 3CH8A 5F7LB 3FRUA 1G7QA 3VXSD 1R6VA 3QEQA 3F12A 4FHBD 15C8H 1P53A 1A3RL 1XAUA 4P2OC 2AABL 3OMZA 1FCCA 1NBZB 2GSIB 3VD9A 1I9IH 3GMMA 2R56L 1ETZB 1CXKA 2FJHA 3C8DA 4KUZH 1SQ2N 3P9LB 2HH0H 4OZIE 2E6PA 4KTYA 1CT8B 3PDOA 3T2NH 5C0AE 5D93C 5ESAA 4YWGL 1S7UA 5TGBB 1RURL 1C5DB 3SCMD 5HHME 1LEGA 3RX5A 2NZ9C 3QUML 1LDPL 3VXSE 5I8EA 2HLAB 3F65A 4KZEH 5GHWH 4RMUA 3DRTB 5DUPL 1UB6A 3T0EA 5DK2A 4F57H 4FP8H 2ZSWA 4KQ3L 2VNCA 5EIIB 3ZTJH 1RIUH 4JFXA 2CR3A 3BKML 5F8QC 4AH2B 5HVHC 1MVFA 5TDNB 1BZQK 4G8GB 3RRQA 4I3GA 1MVUB 1JGVL 5HHQB 3OKNB 2GK0B 1YNKH 4N0UA 5EZIL 3W11D 1L9MA 3O4LB 2N7BA 4DWHA 1IRAY 1Q1JL 2R0LH 1CVRA 2XPGA 2IGFH 3TN0A 3DUUB 2C4XA 1FLRL 3BE1L 3ULUC 3MBXL 4U1NA 4JO1L 4Q6IA 4RWHA 3FO0H 3TWCH 2XY2A 2DYPB 3BDYH 2F54A 4Q9RL 1I9RH 1V7NH 3IJSB 5HDBE 1UC6A 4ZS6C 4X6CF 3TC9A 3V0VB 1I8IA 2FX9L 4KU1A 4HHAB 1IKNC 4OJFL 3VXQA 4HMEA 5LCVL 1V5JA 1UGNA 4UT6L 3WL9A 1WBYB 1QLFB 2DMCA 5CD5D 5J3HD 3NA9L 5EWIL 4NKQB 1V3JA 2X4OB 3QHZL 1HI6A 5SWSA 4EQ2A 1CFTB 4ORGA 3EZJB 4LLDB 3CXDH 4ODXB 5I19H 4MA8L 3NFPB 1P2CA 3FT2A 5TDOB 5DJ8B 3NPZB 1M1SA 3E2HC 4QHUB 4X6BB 5CEXA 5LGHL 2D7TH 4NZUL 2GSGA 4K3HA 2J2ZA 3PWJA 4HIJA 4HGMA 3GIVA 1RUAH 5K9JH 2CIIB 1B4RA 3D2UD 4C58B 4LQ1A 4PJ9A 2CDGB 3WLWD 5L2KD 1DE4B 4RMRA 3RWHA 1AGEB 3X14B 5HHPA 4K2UL 4UQ2B 3V6ZB 3MMEB 5E5RB 3F7PC 2PTTB 3SE8L 5GZOC 3CFCH 5MEPA 2WIIB 1F4WL 1F8TL 4ZNEE 1FAIL 1OTTD 5DD5L 1C16B 4PRHA 3K1DA 2OP4L 4YDKH 5INDA 3V52H 3SDCC 3X13B 4CMHC 5HGAB 4AG4L 5E8OB 3DX9B 4KMQA 2WV3A 4EOWL 4YHZH 4RSVA 4XBGA 1RZKC 2XI9A 1U3JA 3GBNH 5T1MB 5L2KE 3MACL 1T7ZA 1JI2A 1QRNB 3MA9L 3QZWB 3WSQH 4LCCC 4QXWA 5D1ZB 2X6MA 3FQUA 4FQQB 2JB6B 1BLNA 1VFOA 5DDHB 3F7QA 1P7QB 4NBYB 4UB0L 2FJFB 3WN5A 3ARBC 4WJ5A 2IADB 5IVNA 2CLRB 2A6DB 1MCNA 4I18B 4IMLA 4UOW0 1MQKH 4X6CA 4HMDA 2NY6C 3LD8C 4WU5B 5CHNB 2CLVB 4IRJD 1ZT1A 3KDMB 5GZND 1S5HA 3BD5A 4ZUWA 4E42A 1A6WH 2BSED 4YX2L 3VGBA 3D25A 4DFIA 5DLML 3H6JA 3U0PA 4Y4FA 3UTTA 1ZA6B 4AIZA 3LQMA 5BQ7B 1RZFL 5KS9B 1S7TB 3BD3A 3GIZL 4HV8B 1S7QA 1LHZA 1JZ3A 1SBBA 3G9AB 1A0QL 4EI5B 1UM5L 4JHAL 5FV2A 4MX7B 4QOKD 4C57C 3O2WL 3OZ9H 3TZVA 1C5CL 4NYLA 3PWVA 3L7EB 4Y4HD 4JQXC 1FFNB 3QULA 2P43B 2NX5B 3VGHA 3EOBA 3OKLA 5BV7L 4RAVB 1RHHB 2R0ZH 5EOTA 1AXIB 3SGKA 5CMAB 4PR5B 2CDFB 3D39A 5T5NG 4GQ9L 2G5BA 4LBEA 5C0RL 3L5HA 5EO9A 1IZKA 5CGYC 1BVLA 3D9AH 2Q3AA 1A7QL 4PJCF 5A2KH 4NC2B 1CTOA 4HK0B 5GJSL 7FABL 4MJID 1ZANH 4ALAH 2EKSA 3UJJL 1J05A 5J6HA 1MI5D 1KXQE 1KCKA 2XWTA 3MNVA 4G8IA 4ELKB 4D9QD 1NFDB 1FE8L 1BBJB 4Y16B 1C8PA 2EYSB 3MO1A 5HYSB 1KJ2H 2X4QA 3L3HA 5F1SA 2X4RA 5DRXA 3SGJC 3QCTL 1FZJA 1UB5B 1MIML 5DXWA 1H9VA 3B4NA 3CFEA 1N3NB 4GH7B 1OAYL 4DW2H 2WWKT 3RTQA 2I9TB 1HHHA 2CQVA 1QLEL 3MRIB 4KFZC 1EEZB 3MV8A 3BN9C 1MI5E 3FQRB 2YMXH 2AEPH 3AREC 2CUHA 5ID1A 4OGAD 1QBLH 4D9QE 3GSQB 3BJ91 2XFXB 2P44B 3L3IA 5D2NE 4Y8DC 4Z78A 3GK8H 5DHVA 4PJDE 1LGVA 1KCVL 3WS3A 3C09B 1MCOH 5IFHH 3HG1B 2AEWA 4LEXH 1GPOH 2FL5A 4U1KA 4QEGA 2EC9U 3S88L 4I0PB 2GTZB 1TXKA 1Q72H 1WZMA 3QNZB 2FJGB 5A3ID 2XQBH 2H32H 2ZCLL 4DGIH 4TSCL 5H94B 5SV3A 4Y1AB 1ZWIA 5EBMA 1KGCE 2JIXD 2BRRL 4XZUA 4WNQB 4AY0A 5D4QA 5C07D 3E8UL 1AJ7L 4QXGL 4ODWB 5C3TA 4PJ8B 2XICA 5JPNB 2J6EH 4NCDA 3Q0HA 2B0SH 3CC5B 2L0DA 4FXGA 3BKCH 1JN6A 4DOHE 2AJ3A 2OCFD 1NMCB 5E99L 4MYWB 3WEXB 1S7SA 1EO7A 4JRXA 3EKCA 4LPXA 1OAUH 2EE9A 1FQ9C 2OJEB 4KKCD 1FZOA 3BP4B 1GZQB 3SDAD 1DQJB 1HH6B 3N1PC 2W9LA 1XR9B 1U3YA 5I17A 1F4AA 4WI6A 5GGUA 4CN4A 1JGEA 5KW9L 3UTSD 4X9IA 2VDPL 3PXJA 5GRZA 3L3DB 2BNUA 4ZPTA 5C07E 3ESVF 5C0BE 2DTSA 1HSBA 5TFSL 4KKNA 2BNQA 2QHRL 4HXBL 5SX4I 1BP3B 3DVGB 3QCUH 4BQ8A 4NT6B 3VE0B 5A2LH 2I07B 5MEOA 1MQ8A 3K2UL 5JXAL 1CGSH 1UM6H 3GBLA 3QCVH 1UXSA 4BSWB 1ZLWK 5IMLA 2ARJQ 3KG5A 4NC1C 3V6OC 4R26H 1A6UL 2VOTA 3N06B 2VL5A 2XACC 1A7NH 1RZKH 1K3ZA 3HE6B 3QXVA 3UTSE 5D1QB 3ROLA 3MXWL 2W0FA 1DQMH 2W9EH 5IQ9A 2VSDA 5IK3B 3BRFA 3MUY1 4ELMF 3OGCA 3EYSL 2R69H 2XNAA 4L1HA 1PZ5B 3IKKA 5EUOF 5C6WH 1TQCC 4LSDA 3TBTB 2X4SA 3RWJA 4L3ED 4N8CL 2YRLA 5T1LA 2R4RH 2YPVH 3PXHA 3R06A 2Q87A 4URTB 3LEVL 4XMKH 2DMBA 1T04B 3UJTH 1KB5L 4TTDC 2FO1A 5JA8B 3O6LL 2R1XA 4AMKH 5F44A 4NNYA 4TVPD 2HJFB 5F7EL 4WW1B 1Y6KR 5HTSA 2MMXA 2EEAA 4RGNB 1CK0H 3U4BH 5HYSG 3RNKB 4IJ3C 4X80H 1C12B 4N9GA 5DA0B 4L4TA 4L29B 3MRRA 3DV6A 3ABZA 4S1QL 3WBDA 1U8QA 3IU4H 3A6CL 2KL6A 3LKSA 4NNPH 4Y5VC 1W8OA 3PWLB 3MA7A 1MY5A 1QKZL 3B9KB 5CJ8A 5I30L 1FHGA 4F15B 2VH5L 4JGJA 4S1SL 3DGCR 3PWUA 2KQMA 5DJDB 4TVPE 4PP1D 1HQ4A 2OTUA 4J8RB 1PQZA 4U1HB 1VHPA 3DOSA 5H35B 1EIBA 4JFOA 3NA4A 5EU3A 5HPMB 5D96C 4Z5RB 3EHBC 5KVFL 1WBXB 3T2PA 1Q9OA 5CINL 2G2RB 2A83B 4DEPB 5IB3A 5INCB 3MLTA 1JPGA 2LAGB 4OGYL 2EDTA 4JO3H 4GAYA 4JRYD 1N5YL 3HZKA 3ZT6A 1A6ZB 3RWGB 1KJ3L 1Q9KB 3TO4A 1ZK9A 4JRWA 2C3VB 5FCSH 3CDGA 3R0MA 5IOPB 4FXKB 1XR8A 2EICA 2AJZA 1IC7H 2YD8A 4WUKL 3REWA 5IMKB 1F3JA 4OFYA 4ELMA 5HHVH 1OGTB 1LO0H 5BS0D 4PV9B 2R1YB 1X5FA 5EUOA 1FL5B 1YNLL 4BZ2H 5IR1B 2UVEA 3G9VA 3NH7H 1FZKA 4U31A 5KSBE 1MRFL 4X7TB 1MFEH 2DM3A 2FH6A 3FRPA 3ARDC 5AEAA 1I8KA 3B6SA 1OSZA 4B41A 1T2QL 4KVCH 2VLJD 4NN5C 3O0RH 2XTJE 3MNWB 2DQGH 2IH1A 5DD6A 2HN7B 2UZIH 2X4PB 2P42B 4LCIH 5BS0E 2D03H 2C26A 2JB5H 2OJZL 3DVNB 4K3GA 3G5YB 4PG9A 5EOCH 2ATKA 4PV8A 3TBYB 3E6HB 5IMOA 4LSQL 1TTFA 1HILA 5GS2H 5EORH 3VG0H 1IKFL 3P0YH 3KLHD 1MWAB 4U7MA 2VLJE 2VZUA 4FQJH 5I74C 5LAXB 4APQD 3QISA 2WUBL 5EZLA 2AEQL 4PY7B 1SY6L 4X6FB 4CVUA 1OF2A 1PVHA 2OR8A 3SKNB 3HPJB 3UTPE 2YXMA 4OI7A 5IB2A 4POZC 3C60C 1QSFA 1BM3L 3RNQA 1BVKA 4MD0B 3EZ8A 4JR9H 4AYFA 4BH8A 2H3NB 4PJ5B 2D7OA 4QHMA 3MLZH 3FOMA 4R9HA 3CAFA 2HTLC 1A7BA 5DVLA 2BVUA 3RBSA 4Z76B 2X05A 2CKBB 2P8MA 2EDQA 3UP1A 4GAJH 1MREL 3RVXD 1RZJL 4LDLB 4J3OC 4DGYL 2AI0H 2QQQA 3MLRH 3S8WA 4MS8D 5ISZA 1HKLL 2DRUA 3F6LA 2D31A 5FYKL 3GBMH 4YDVA 1LO2H 1T2XA 3MV11 3P40A 5GGVY 3VDCA 3CZFA 3B8YA 3GRWL 3OJDA 1A2YB 3WFCL 4PJAE 1UACL 5IEHB 3DNKA 1F58H 4Z7VA 1YY9D 1CBVH 1XFPA 1Q9LA 2P5WB 3UJIH 3RWDA 3IFPB 2PXYA 4XCCL 4BJLA 4R4FL 2W0KA 5C09D 5ANMA 5DFVC 1KLUB 3ZT7A 4OLWL 2CPCA 2XA3A 3ARGC 1KBGH 5JHDB 5F9OH 1BOYA 3F62A 5JZ7C 4ZO7A 1KPVA 1DL7H 2VO5A 1WTLA 1L0QA 3P3YA 2Q3ZA 5TQ2H 5JA9A 2NTSP 5MERA 3MFFB 4UT9L 1B0WA 4OCYL 2ID5A 4R4BA 2VDKL 2KPNA 4H8WH 4LHUB 5TJWK 1FZMA 2OL3H 1PDKA 4P4KA 5GRJH 1HHKA 2NY0C 4YGVA 4OD3L 3BGAA 3O2VL 4HLZG 4I5BB 3QEUB 1Z5LA 3PL6A 3RI5F 3ZYZA 1JPFB 5DT1H 2FECI 2W91A 3CFBA 5LGJB 4D8PB 3TH4T 4JFFA 4ODTL 1TQBC 1ZLSH 5D7SH 1OD9A 1IGTA 3RVTC 4Y88A 3MLSL 2BJMH 2FH8A 1ED3B 1FYTB 2H41A 2WP3O 3GMLA 3QR2A 3NZHL 4PGCA 5A2JH 4WWKB 4DN3L 3K74B 2MJWA 5HBBA 1WC7B 1L7TH 3IDXH 2ZSVB 2EDOA 2DJSA 3WLBB 5AG8A 2YK1L 4ODUA 3ULUF 2IQ9H 1RVFH 3K46A 4YHNB 1G7IA 3NZ8A 4NKDB 1U2CA 3QH3A 3QUZA 4OD2A 5FDWA 3OR6B 1KCRH 5AZ2L 3BESR 3HZYB 4YBQC 4FRWA 3SDXB 1FPTL 5JXEA 1VKXB 4YXHH 3BO8A 2FIKA 2UWEE 4IRSB 4DZBB 1J1XL 1UENA 1U8IA 2E7BA 1T4KA 3D18A 4G3YH 1OL0A 1FO0H 2FBJH 1G7PA 3IETB 4GRWH 3CDYA 4R7DA 3QXDA 5CP3H 1KSRA 1LO5B 3UXFA 1ITBB 4I2XA 3TT1L 4L1DA 1JL8A 1A1NA 1UKTA 3RPIA 4LLWB 5IM7B 4LVNC 3HRPA 4PTTB 4P46C 3PWPA 4O58L 5DJYA 3DBXA 4C56A 1N5AA 1NAKH 4WV1B 5FHBH 2VZOA 1EUTA 4P9ML 5FUZL 5HHOA 3TVMB 1T20A 4JQVC 4P2OA 4XBEH 2QADD 3VFTB 4NRXA 1F3DJ 1MFCL 3QXUA 3O3EA 4HS8H 1WF5A 4P2RB 3N1QC 2Y5TB 2R23A 3KYNB 2AS5M 5D5MB 5E1AA 5IMMA 4QXTB 4OF5A 3L6FB 2V2TB 3BH9A 4POUB 2DBLL 4Z8FL 2QBWA 3EBAA 4YHYB 1YJDL 5T1KA 2GYSA 4LVHC 5C71A 1N8ZA 3UYRL 3KPSB 3NIFF 5JDSB 2R2EA 3VFSA 3GMPA 1FC2D 2V5YA 3LZFL 3BEVA 4DZ8A 1T2JA 1CDJA 4OLZL 1MCCA 3BISA 3E1F1 4OCXL 4WI2A 3O11A 3FT4A 1I8MB 5IW1B 1ZVSA 1MLBB 5E8PB 4LCWA 5I1GL 1Z6JT 2ARJB 1NGPH 2D0GA 2HVJB 3H9SA 3L7FA 4GMSH 5DJXB 4M03A 2ADGB 5MI0C 1R3JA 3HMWH 1A6AA 4KVNH 3GJEB 1N0XL 3G6JF 3NACL 1JVKA 1B6UA 3DV4B 4LAQL 1QSVA 4YR6B 3G6AB 4X98B 1FH5H 1VERA 3BQUB 4RFNB 3B2VL 4PRBA 4QNPF 4HBCH 3VDBA 2O5YH 1IKNA 3O6FD 3VXUB 1NBVH 5FM4A 5EDXA 3P73B 1A1MB 4OD1L 2Z91A 5C2BL 1S3KH 1F2QA 2R2HA 3QDGE 5DK3A 1AD0A 3KS0J 3LN4B 4LHUG 4HWZB 1FP5A 3O2DL 5D71L 2UUDK 1U95B 3PHQA 5D9SA 2J6EA 4FQCL 5MHSE 3VDAA 4PG2C 1U8KB 1P6FA 4Z7NF 3SOBL 4Q9QH 1DFBL 1D5BB 1VEPA 4NO0B 2H1PH 2B5IB 3VFNB 4YNYB 3GEWB 4BH7A 3RA7L 2AV1A 3IDUA 4HX1A 3H7BB 5CKAA 1A9EA 4KK6D 1TNNA 4P5MB 5GS1B 5L6YH 1G0XA 3FRUB 1G7QB 3HC4L 3QEQB 3QUKA 1NCAH 3F12B 2AV7B 3WXWH 1F4HA 2W60A 1XIWC 3FMGH 5K33A 4WEBH 1IGJB 3B43A 4LPCA 5TPWL 3CMOL 5IV2A 1BJ1H 1VFMA 3AU1A 3GMMB 4LRNH 1Q94A 4ODBD 3DMMD 3VMNA 1WCQA 4IRJC 2FJHB 3HI1A 2VXQH 4E41D 3GI9L 5KSUA 3PDOB 4UV7L 3NOIA 5ESAB 3SDCA 1S7UB 4PJFE 4U0RC 1LEGB 3AS0A 2B39A 4CU7A 2NNAB 1ZLVK 4EI6A 3PP3H 5I8EB 4JM2C 3VXMD 4RRPA 1HCVA 2P47B 4J3VA 4LCCA 4D2NA 1UB6B 2IPTL 3T0EB 5DK2B 1G7MA 3S7GA 4PJIF 2ZSWB 5J13B 3BP7A 1J5OL 5DRNA 1J88A 4O2EB 2ZOLA 2FHFA 3P4NB 4JFXB 4XI5C 3ARBA 4EDWH 3G6JA 3HE7D 4M8VA 2HTKC 4N0UB 1ZAGA 1XGQA 2WANA 5EU4B 3FL7A 4YZFF 5KANI 5KJRH 3FB7A 4ZDHA 4X7CC 3VI4F 1HOCA 3EJYC 3G04A 2XPGB 1IAIL 3TN0B 2XRAL 3VXME 4UOJA 1NQBA 3UTQA 4OCMC 4CNIA 1CDGA 4U1NB 3SKJH 3RJQB 4YDJA 5C9JA 4Q6IB 2BNRA 5E4IA 2F54B 1I3UA 3MZTA 1RZ7H 3DGGA 1WFTA 5IG7A 2R8SH 4KPHH 1T7WA 4WUUD 2YZ8A 5DC0A 4P4RA 5I1HH 1GAFH 1MCPH 1UWEL 4HWBL 3E3QE 3HI5H 4HIEA 1I8IB 1DQQA 1OLZA 4GXVL 1MJ8L 1JV5A 2J4WH 1YN6A 3VXQB 3ZE2F 1U91B 2J8UA 4K23H 3WL9B 4XPAH 4H26A 5BRZA 5DJ6A 3ZKNC 2VR9A 4JQXA 4M7JH 2EEBA 3MRKA 5M94B 2HKFL 1DDHA 5I76A 2EDFA 2FSEA 4Z0XA 3RAJH 1HI6B 5SWSB 2NR6D 1KULA 4ORGB 4Y5YB 4J4PD 5DO2C 1E6OL 4PJEE 4K7PX 1P2CB 1UQSA 3FT2B 1WIPA 1X6LA 2RCSH 4WUUE 5DGRA 1ZHLA 1REIA 5D1XC 3QUXD 3OKMB 4P5TC 3O3AA 2GSGB 2AJUL 3PWJB 4JVUA 3GIVB 3BSZL 4OLUL 2WP3T 1WFUA 2FWOA 4TSBL 1GHFH 3MCLH 4L5FH 1YEKL 4PJ9B 3RGVC 5IGXL 4KRLB 1EO8L 3DXAE 3LHPL 3RWHB 2LV4A 5HHPB 3RZCD 1W72A 4UNTA 4QTIH 5MEPB 1AGBA 1ZE3C 4NHCH 5E2TH 1I1YA 1FIEA 1WQVT 1SJEA 1JWMA 4PJIA 3I50H 4UINL 4ZTOH 3MLWH 4PRHB 5INDB 3FZUD 1L6ZA 1C1EH 4M1DH 3SGJA 2ESVD 3WFHB 3HPLA 2E5EA 4K8RD 3ILQD 4X4ME 1MAJA 2R0KL 1JNJA 1QFUL 3MV7E 2YXFA 4XBGB 3QDHA 3LKQA 4TUKL 2Y72A 3FQUB 4HIIA 1TETH 5I1IL 1E4KC 3AREA 3L5WA 1YECL 5F1IA 1BLNB 5DMKA 4M5YL 5F9AC 4BZ1L 2Z93A 3WN5B 4RFOH 4WJ5B 5E2WH 1DLFL 3GMRA 1DANT 4IMLB 4IRZL 3STLA 5IESL 4ZOEA 4N0YH 4X6CB 4YEEA 3VA2C 2ESVE 5C08E 5E2VH 3MRGA 4NQVA 3T0BA 3NABL 1ZT1B 2H2PD 4HZLB 1S5HB 2HFGH 4E42B 3DYOA 3D25B 3IAQA 3LS5L 1ZHNB 1T22A 1T1WA 4ERSL 4JG1L 4JO4H 2Q8BL 4LSPH 4YXLH 4Y4FB 3U0PB 1TNMA 1E4XH 1HZHH 5EOQH 3UTTB 4L3CA 3U46A 4RMVA 4X9BA 4AIZB 4RIRA 4XC3H 1S7QB 4WCYL 2F15A 4FMKA 2NY5H 2FHBA 4IM8A 3NMEA 1Y0LA 1C7SA 2AJXL 2VTFA 4NOFA 2ORBL 3TZVB 3HS0A 4JZNB 1IFHL 4DKFH 4NYLB 3PWVB 2RFXA 4GXUN 5C0NC 5JTWA 2I9LA 1FSKB 3QULB 3OPZL 4GRLD 2ICWI 1B2WL 3EOBB 5I1CL 3OKLB 4LFHG 2XY1A 4NWUH 1BPVA 3T0DA 2ZZUT 3QO0A 5EOTB 4UDUA 2VL4A 1RIVL 1WWWX 5JHLH 2HRPH 2AP2A 3D39B 2R9HC 4XAKE 3NFSH 4P2QD 2G5BB 5EC2A 2XOTA 5T5FH 5EO9B 4DUWA 5E8DL 1BVLB 1MIEH 3BAEH 3OGOE 4X6DE 4HFUH 3HB3D 4YE4L 2DS4A 2L7UA 4P99A 1PYWA 4PLKC 3LN9A 4LASH 2EKSB 3JV0A 1DBJL 1J05B 2KQNA 2X4NA 3V6OA 5J6HB 3X3GH 1MCLA 5AWNH 2XWTB 4K94L 2RHEA 3MNVB 3QNYA 4G8IB 4TVSa 3S3PA 2PYEA 2X44D 2XZQL 4XP9H 3O9WB 5D72L 3ROOA 2QQKL 3MO1B 1FVCA 4K3DH 1JZ2A 1W8NA 4FFVD 4JDTL 2YD9A 3L3HB 1CL7L 3BKYH 1INDL 4P2QE 2E6JA 3MODH 1XCTA 3MUJA 5HI5D 2X4RB 2X89A 1LO3L 4JANA 1K4CA 3QNXA 3OAUH 1FZJB 2DIAA 1INQA 4U6VL 4I3RH 1OSPL 5ALCL 3HCVB 5GGTH 4XPHL 1DBMH 3RTQB 1HHHB 5DD3L 2O5ZL 4GG6A 5GISL 4TOYH 2WLYA 3KPOA 3MV8B 2LABA 2OL3A 4Z77A 5HDQH 3S34H 5ID1B 5KVDH 2PR4H 3UBXG 3L3IB 5KAQF 4BUHA 4KWUA 1YUHA 4Z78B 5DHVB 1FG9C 1X4XA 4X0KA 2OYPA 3IRPX 3HI6H 3RDTD 3DVIA 4HXAL 3WS3B 4NM4L 2G60H 4B50A 2F74B 2FL5B 2IEPA 2IG2H 3KPPA 3HFML 1UXWA 5E6ID 3U83A 5IFAH 2VQ1A 4MAUL 5DD0L 3RVWC 1EX0A 2RB8A 2Q76A 3D85D 4LARL 2OLDA 1NC4D 4R8WH 5C0DA 4XPBL 2XTJC 1ZWIB 5EBMB 4Y5VA 5EU5A 2MKWA 2DQJL 3LV3A 2V7HA 4XZUB 4EBQH 3GKWL 2C1OA 3B9EA 4UAOC 2NY1D 4U6YB 1T66C 4MJ6A 2AERT 3HNTL 5DEFA 1JN6B 1WEJH 1BGXH 2AJ3B 4RDQF 4JAMA 1FO0A 2WNGA 1S7SB 4JRXB 4Y2DD 3UCRA 4M6ML 2MWCA 2APWA 1HCFX 5D7LA 4K9EC 5I17B 5GGUB 1FL6B 1JGEB 3BEWA 3QIBC 4PP2A 1KELL 2ADFL 2BY3A 1PX4A 2XTLA 5A16A 1K3IA 5JORA 2BNUB 4OFKA 4ZPTB 5C9KA 1HSBB 2BNQB 4KHTL 2P46B 1J7VR 4GSDH 5JW4M 5HYQA 3BZ4A 1JRHL 1HYRC 4GMTH 5MEOB 1G9ML 1IEAA 1H8SA 3JWDC 2Q86A 2VZSA 5IUSA 2HT2C 1JPST 1UXSB 3IDIA 5F88A 5IMLB 4MD4A 4KMTH 3RI5K 4JFEE 4NQSA 2VL5B 1HN1A 2BP3A 3ROLB 4E0RA 1J8HA 1ZT7A 2R4SL 3ARWA 3SEPA 2VDQH 3BUYA 5IQ9B 3ARDA 5FV1L 4RX4A 3U79A 2X1OA 3OGCB 1NSNH 2XNAB 3QUYC 4X5XB 5FB8A 5SX4H 1OGAD 1UYWL 1AP2B 4WHYH 2X4SB 2DDQH 1YEHL 3RWJB 2H2SD 4FFZH 2MPAH 5CZXD 1RIHL 3TV3L 5T1LB 3JVGC 4JO2H 3ZE1E 5CP7A 1EDQA 5FHAL 3U36A 4JKWA 5TF0A 5I73C 4J1UA 3HRZA 4BK5A 2D2OA 2P48B 4P59H 3KPRA 4B53A 2R1XB 4MS8C 4NNYB 4OFIA 4DGVL 2QSVA 2FATH 1MH5A 4DN4H 1OGAE 5BMFL 4MNGE 4KI1A 3RL1A 2MQCA 3VWKB 35C8H 4N9GB 4L4TB 5F1NA 1D5IH 4JFDD 3MRRB 3DV6B 3F58L 4KV5E 1U8QB 3C60A