2IQ9H

Pfa2 fab fragment, triclinic apo form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
223
structure length
221
Chain Sequence
b'QVTLKESGPGILKPSQTLSLTCSLSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKNYNPSLKSQLTISKDTSRNQVFLKITSVDTADTATYYCVRRAHNVVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVCTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IgG2a Fab fragment PFA2 Kappa light chain
molecule tags Immune system
publication title Molecular basis for passive immunotherapy of Alzheimer's disease
pubmed doi rcsb
total genus 35
structure length 221
sequence length 223
ec nomenclature
pdb deposition date 2006-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iq9H02
3TFKD 1Q0XH 1RJLB 4HJJL 4KRPC 1LP9A 1I8LA 2AEWA 3IDMA 4NHCL 2WWMD 2XKNA 3SDDC 4LCCA 5C6TH 2LABA 3ZL4L 3S35H 1BWWA 1KCSH 4NQVA 4X6FB 1QR1B 2A9ML 4ZO8A 4DZ8B 5DJ8A 3SGKA 5F89B 4G9FD 1OGAD 1QR4A 4OF6A 2BNUA 4GO6B 1UJ3C 3QISA 4LSTH 1VKXB 3MPCA 3V0WL 5CGYD 4ZTPL 5JDSA 5CIPA 4U0RC 1VGKB 4JRXD 5LAXB 4WCYH 4PJCE 2NY7H 3LEYL 1I85A 4XP1H 4XNMA 1VKXA 1O7VA 4PFEA 3MNZA 5DEFA 15C8H 3ZTNH 3SHSA 1D5IH 5T33L 4GQPH 1GAFL 3RY6C 4JQXA 4ODWB 4XVTL 3QG7H 3MV8E 3WDIA 4FQLL 2Q7NA 2CKBL 1NJ9A 5EUOA 3O45B 1KB9J 1HILA 5AYUH 5J56B 2E9BA 1XCTA 3TZVC 5IW3A 1HI6A 3K4DA 5EBWB 1MAML 1PX3A 2BC4A 5JPMA 1V3JA 3EYVA 3F6LA 5JUEL 4EBQL 4ZUUA 3U1SH 2EXYD 2J8UE 2COQA 1ND0A 4ZUSA 1ZLUK 4R90H 4OAWA 4WGVB 1A7QH 5D9SB 2DN7A 3TIDA 1J1PH 1G7LB 1FNEB 2MPAH 3GJFK 1IGYA 4F33A 2QR0B 2DYPB 3VD4A 1C5DB 4X99A 3L7FA 1JZ7A 3KPSE 5B22A 1T1YB 1RUKL 5GS0H 4JRWA 4MA3B 5DC0A 1K3ZA 3DOSA 4U3HA 3KG5A 4U7MA 1U8MA 2Y5EA 1ED3B 4GXUM 4GW4B 4FA8A 1V05A 4YHNB 2Y07L 1T89C 2NTSP 4JFQA 2APXA 2VN7A 4R4NC 2Z9TA 4IIQC 4KVCL 5ERWB 4UV4L 3H7BA 4OCXH 3HZKB 3NFSL 4PRBA 1IGCH 4JY4A 3WIHL 3AM8C 3DROA 5IROC 1JPTH 1ACZA 1G7MB 2FX9L 1AP2B 3BD4A 3SPVA 2NY4D 4B53A 3MJGX 4QRPE 4D8PB 1MPAH 3JWOH 1IQDA 1AKJD 1TTFA 1KCUH 1S7QB 3HE7A 3MSPA 3HMXA 3V4VH 4WI3A 3MV11 1DN0A 3DUSB 3KYKL 3VWJC 3QQ9C 2YA0A 4S0TD 4JLRB 4NQCB 4L4VB 3M45A 3TNMA 1OT1A 1NANH 2HFGL 3VI4E 1FL6B 1UKSA 1J18A 4LIQL 5IKCB 2F5BL 1PBYA 3UYRH 4TRPL 3C8HA 4DQOH 2NTFB 1TZHB 5J13C 3P77A 2UYLA 2CLRB 5AAMA 1T21A 1HH9A 3O9WB 3R8QA 1T1YA 4JDTL 3U30C 1YEEH 2Q7YB 3U0PB 1UKTA 4P48A 3OKLB 4OCLC 2DQJL 4ZS7H 2E7MA 4MXQD 3M8OH 3BP6A 4UAOC 5FO9B 1JWMA 4GRLA 4OI9A 4OZGF 3KYMA 1NGZB 2KDGA 3QO0A 4TUKH 4L8BB 4H26B 1P7HL 2F74A 2DD8H 1XR9A 4N8VB 2EDWA 3NH7L 1KN4H 3DX9A 4H5SA 3VXRE 4KAQL 1KF9B 3CSYA 2J8OA 5DJZA 3FOLA 2PYEE 5DVLA 3QFJB 3GKWH 2BNRB 2IPTL 5HGGS 3FL7A 3DX6B 2YUZA 2ZCHL 3FB5B 3TNNA 3BUTA 3V0VB 4IHOB 4OM1H 4KVCH 2Y7QB 5IWLC 1BD2D 1SM3H 3BDBA 5EBMB 4WJ5A 3M8OL 4XWOD 5F7EH 2GHWB 3O4LA 1JL8A 2Y23A 4FXGB 1MFBL 2Z91A 1A6PA 1NLBL 5C92A 4M7LL 1MRCL 4KKAC 4RFEB 2XOTA 2C1OB 1PSKH 3QPQD 4GLRH 4JFFE 5DJYA 4YBQC 1RHHA 4WWKD 1NC4D 3O4OB 4LFHD 5DVOA 2MCPL 1NC4A 4AIZA 3VH8A 2A38A 4QHLB 2X1QA 1Y18A 2Z0BA 3VFWB 2I60L 3O0RL 4A6YB 1MY7A 1CFBA 4HD9A 3HFMH 4KXZH 2BFVH 3FHAA 4XNXL 1IAKA 5JNYB 4KQ4L 3BP6B 3ILQD 5FO9A 3UPAA 4HG4K 2R29H 3CFKB 4FS0A 3QRGH 4PJ9B 3L3OA 4NRYB 4HV8B 1FNLA 4BSWA 1I7UB 3N1FC 4AIOA 2H9GA 3WSQL 1XT5A 3GSVB 1QFWM 1AGCA 2YMXH 2VITB 2H1PH 1IAKB 3R0NA 5JNYA 3QIUA 3P4OB 1RVFL 1UB5A 2FD6L 3QNYB 1ZLVH 3SE9L 3L3DB 5CJ5A 3FMGL 1U2HA 1QKZL 1U58A 3F5WB 2OTUA 1R3JB 3K1DA 4X83A 2IMNA 2H41A 5IB2B 1F58L 1BAFH 3B9KC 3NFPB 5I1DA 3O11B 2MMXA 4JPKL 4GRWB 3WCYA 2AABL 1IGFH 3INUL 1CGXA 4P57A 1MFAH 5GRWA 2Y6SD 3ECBB 3D9AL 4MCZA 4MD5A 4Y19D 5E9DD 1DDHB 4LNRB 1CR9H 2BVTA 2HLAB 5C0BB 1CVSC 3ARUA 5T3XE 5GGVL 2B1HH 1U95A 2CIKB 1IGJA 5I8KL 2GTWA 3MC0A 2X9XA 3JUZA 5HY9A 1RJYA 4DKFL 1BZ7B 3DGGA 43CAB 2OZ4H 1T1WB 3QZWG 1BIHA 1IGIL 1OP5H 4OLUL 3OAYK 4NFCA 1IEAA 3CLEH 4DWHA 1MUJB 2UZYB 5JW4M 1MFBH 2HT2C 4TUJB 1KJ2A 1DBJH 3PL6C 3VGDA 1UZ6F 4LFHG 2XFXB 3BEVB 1Q9KA 1I8KA 4XPGH 4YK4C 1DE4B 1T7WA 2RQ8A 4R4FL 2VNCA 4HUWA 3OKYA 4DKEH 4OQTH 5KOMC 1JRHI 3DNKA 3JV4B 4H8WL 5KANI 1T83A 1HSAB 3VXOA 3W82A 2E7HA 2FSEB 3QXUA 1BECA 4H8WH 3T1WA 3QEGH 5CCKH 4FFYL 2E8YA 4FQ1L 3HE7C 2DM3A 1KIPB 4PJFA 3P0YL 1EBAA 4HIEB 4JREC 1LK2A 2DI8A 3CC5B 4W4OC 2CLVB 5CEYB 4O2CA 5I1AA 4FG6C 4P4RA 5J9PB 4OZGB 1P4IL 3EYFB 3GMLB 4GAGH 2Q3ZA 3GSNH 3QR2A 4OFYA 2D03H 3QI9A 4LIQE 1KULA 3MV9A 3OXSA 2F54D 4CKVX 3NGBC 3IVKB 4GBXD 1FFOA 3HUJE 4UTAL 5IMKA 3RWHB 2P43B 4X4XA 5HI3C 4KRPD 4MLIA 3P73B 4K7PH 1NGXA 2DLFL 2XKSA 2CDGB 4KKLD 2QHLA 2PF6A 4WUUD 1FFOB 1TVBB 1MFEL 5AZEL 1FRGH 2VXVH 4JFDE 3MRIA 4Z95L 3WJLA 4JM2F 2HG5A 3FFCE 3UBXB 3VFTA 1DR9A 4PJHA 4EDWH 4UZGA 2R9HD 5CJOL 4OLXH 1EAJA 1KNOB 2I60H 3O0RH 3X14A 3SE3A 5DMIL 4PIRF 2AJZA 4HCRL 4ZS6C 4P3CH 4QCIA 2CO7B 5HYJA 1E4XL 3QRGL 4GRMA 5CP7B 3K81A 3KGRA 4QT5B 4BZ2H 3WS3A 5DLML 3KDMA 3HUJB 2XG5A 5L8JB 3G5XA 2UVEA 2GW5A 1HKLH 4ORGB 3MLTA 4PRIB 3MJ9L 4L5FL 4HKJB 1N7MH 3EKCA 4KRPB 2D7TH 4OZHA 4PGJA 4NCDA 5HGBA 4Z7QF 2P5EE 3IFOB 4CDHA 5JW3L 4ELKA 5JQ6L 1W72B 1HNFA 2ED7A 2YPLB 1XGQB 2OSLB 5JZ7D 4ZODA 5ITBH 3VRLF 5LXGL 2ESVB 3N1PC 2GAZB 3LKOA 5MEOA 3BZ4A 4NNPL 2R69L 2EE3A 1Z5LA 4XNMB 4PRPD 5DD3H 4Z7NE 5IV2B 1W0VA 3T2OA 4HH9B 4XVSH 5FYLD 1Q9OA 2NX5D 3H3PH 4JDVA 2AJYL 3TBSB 3V5DA 4X9HA 1BX2A 1LWRA 1I1YA 1GPOL 2DLEA 3QDJB 4PJAF 3QG7L 5JHLH 4JANB 1TJIH 3JWDC 2NNAA 3IU3B 4W81A 5KW9H 3MRNB 5C08E 4OUUA 1I3GH 1NFKA 3RA7L 2YK1H 4L4TA 3UO1H 3EYVB 4JZOA 1UQSA 2BNRE 1I1YB 1J8HD 1NAMA 2GJ6D 4XCEB 2YPLD 3OKNA 4R7NA 5L7XH 4DOHB 5AZ2H 1OAUL 2P8MA 4L4TD 4U1LA 3W9EA 1FRGL 2VXVL 4UBDC 2KPNA 4JM2C 4Q9BA 4XXDA 2YD1A 1OCWH 3KPPB 5DUML 4GFTB 4HS8L 1RV6X 1GOHA 1BJ8A 1OARL 1KACB 3RPKA 1LK3H 3AROA 3O3BA 5B8CB 3S35L 1E4KC 3PP4L 1OW0C 2EYSA 4IEFB 4ZSOB 3V6OE 1E6JL 3MRLA 1T7ZA 2X9YA 5IT2L 1QBAA 5DJCA 4HW6A 2VXTH 4JDZB 3VFUA 1JNHA 1FDLH 3F65A 5HI5C 1QRNA 4HJ0C 1MLBB 2EDHA 4WEMB 5HYFA 2HVJB 4PJCA 5F7EL 5BV7L 4UT9H 2AERT 1SBSL 5C0RH 5IB5A 3RVXD 3BE1H 5DEZA 3DUUA 1X5IA 5I1JH 2J6EA 5IFJA 5LGHH 5JOPE 5GGSY 5DWUL 4OIBA 1YQVH 3EZ8A 4JANA 4KTDH 3W0WA 4OI8A 1CXFA 1J11A 2JIXA 5E8EB 4HIEA 2VO5A 3G08A 3OZ9H 1DVFB 3EGSA 5E00A 5TGBA 2PXYD 1K2DB 3VWJB 1I3RA 4JZOB 2DQTH 3BIKB 4HK0B 4F7MB 4TTDC 4KHXH 1MCLA 3MREB 4Q58C 3GBNL 1EFQA 3EYFA 3GMLA 4M6NH 3QEQB 5GS0C 4NQCE 5HVHB 3AMLA 5AUMB 5IVZB 2QKIB 4G6MH 2FRGP 2G2RB 4G5ZL 1U92B 1WK0A 3IFNL 1AO7B 4RZCA 4PRHD 4QXUH 1SY6L 2R15A 3HC0A 3NCJL 5DJ2A 3MJ7A 1ODAA 2AXJA 3HCVA 1B0GB 1HHHA 1VGEL 2VDPL 4ESKA 5AG8A 1CK0H 4WUUA 2Y6SC 4RMWA 1IGYB 1YNKL 5M7QA 5C6PB 5CZXC 5SX5K 4DN4H 5D1ZD 5C0FB 3HRZB 1WISA 5I1CH 4J3TA 3V4UH 3FRUA 3O6FD 1C08B 4OGZA 5GGUB 4KK6C 3SKOB 5SX4I 5C2UB 2GI7A 1RZJL 2NY5H 4RFOL 3VFTB 2HT2D 5IFAL 2D3VA 4ODSL 4XCCH 2YUVA 4HUXB 5T1LD 3PGDA 4LCIH 5A40E 3BXNB 1PLGH 1LO2L 2A0LC 5F7FA 2DQEL 3IXAB 4W6YB 1IM9B 1BVKB 1F45A 3CXHJ 3FB5A 3PG2A 4XMLL 3VXRB 1M6OA 2DQEH 1MF2H 3RDTD 5A1AA 3TESA 5I17B 3GB7A 3Q48A 1NAMH 5DJXB 1UH2A 1P84K 1ORQA 3U9UB 1JNLL 2X70B 4GLRI 4IIQA 3KLAB 2NLJB 4XMPH 4O58L 1JHTA 3VXUD 3RGVD 3LQZA 1U3ZA 3R06A 3U0TA 3B9DA 4P2YA 1FN4B 4FFVD 2HA1A 1HWGB 3D18B 4FQCL 4TULL 1LGVA 2VOTA 1Y6MR 5KSUA 5C1MB 1NFDB 4ZSOE 2KH2B 2JCCF 3OKKB 1C12A 5TE7L 2DQIL 5T1MA 3RX5A 4WFGE 4OLZH 4JQVA 4YGVA 5JXAH 1UG9A 4U2ZA 4P2QB 3GBNH 1UACL 1Y6KR 2PXYA 2GJZA 2WUCH 4XCYA 4PJXE 5F3BA 3AB0C 1UVQA 3QDGA 1YYLL 1M4KA 5GGQH 1VGEH 4XCYB 2OTUB 3ZDYE 4FQLH 2OM5A 2P5EA 5DGQA 4E42B 1J0IA 1A4JA 5D93B 4LEOB 2FBJH 2X44D 4P57B 1DL7H 4GRLC 5C0CB 5IESL 5DJZB 5JORA 5HPOA 3FAWA 2ITCB 1A1OB 4OIIL 3T0ED 1MCPL 2UUDH 5F7MC 5MEQA 1MRDL 4I9WD 1S7UA 2BDNL 2DLIA 4NT6B 3DGGB 1GH7A 5JORB 3OR7A 3EHBD 4WO4C 3ROOA 3S8WA 1ZSDA 4LGPB 1YMMD 5BS0E 4TSBL 5IP4A 4FZ8L 1ZLUH 5CEZE 3BRFA 1JVKA 1YA5A 1QNZL 2NY0D 4LBEA 3HNVH 2VKXA 1NL0L 4HFWB 4F15C 1JYXA 2F8XC 5CBEA 3LKQB 4G3YL 4NN6C 4LCWA 2BSTB 1WFUA 3F12A 3U6RB 1FIEA 3MRHB 4FQQB 3AS1A 2IFFL 1CICA 2AQ3A 5FXCH 2F8VA 4F9PC 3T8XB 1U8OA 1NGPH 3LKQA 2VIRB 1L7TL 3C5JA 3H7LA 4PJ5B 25C8L 3L95A 1MHCA 1HILB 4LU5L 2HRPL 1MCDA 3X12B 1CDGA 3L3OB 4NRYA 2O5YL 1TNMA 3VFMA 4FQIL 4O2FB 5FOBA 2YWYA 4EI5C 5I8CB 5K9KA 3KYKH 2I5YL 1YEEL 4Y5VA 3LEXB 2AEPH 4ZUSB 1I9JH 2AQ1A 1S9VA 1LEIB 4PRHB 4HGWA 3BKYL 4XB8A 2ENYA 5IM7B 2HWZH 5EN2A 4M43L 5IBLD 4ZAKB 2Y9RT 4NRZA 4PJ7A 4H8WC 3U79A 3W9DA 1RD6A 3QUML 1X4XA 2IGFH 3B9EA 5IM7A 3U46B 4R96A 4Z78B 3G5VB 4H1LA 3RGVB 3RX7A 4H5SB 1N6QL 4YZFF 2BERA 1UM4H 2EEBA 2YHGA 3K46A 4BZ1H 3HHRB 4Z0XB 4UOW1 3BZEA 4ZD3L 3MRQB 3RPIB 5C8JA 2BK8A 1V3MA 4J6RL 4HQQL 4KRMB 3SKUD 4L3EA 2YRPA 4PJBA 2NXYC 3RTQC 4WJ5B 1K4DB 1MVUB 5D2LB 5BVPH 2J3SA 3VW3H 3LEVL 4UDTA 5GJTL 4M48L 3QUYB 5EIIB 3I2CL 3QSKB 4OLVH 5ACZB 3TBVB 5JW4N 2NY3C 2WQRA 3AB0B 1BVLA 5FYKE 3CLFL 4ONGH 3P9WB 1OAXH 1UCTA 2BOCB 2CKBA 1T7XA 5BRZA 3SGDI 1AGDA 3RVXC 1K3IA 3VFGL 1F4WH 2FB4L 1PD6A 1JCKA 2VLRA 4XH2B 3UJJH 5TPWL 2E6QA 4UQ3B 5DC4B 1FN4A 3UTTE 3FQWB 2CRIA 4HMCA 5D7SH 1E4XH 4PJ5E 5FECB 1U3HA 4P3DA 4RIRB 2EDXA 3BH9B 1IAIH 3GBML 5DEGA 2VWEC 3MUZ1 1Q0YH 1I9JL 1LNUA 4CU8A 5FYLH 4YAQB 1BFSA 4NO2B 1NGZA 3QDGD 1KCKA 2D2OA 3LKOB 5DWUH 3FO9B 1CD1B 3QXAB 5CJXC 5IHZA 5FIEA 3DVFA 2VLJA 1AC6A 5DMIH 3OAUL 1PG7H 5TPWH 3WO4C 1S7RB 4PG9B 2F53A 1YNTB 3D25B 2GTZA 2YPVL 3Q5OA 1OVZA 2CSPA 1A9EB 1G7JA 1HINH 2OMBA 2WBWB 4KFZC 4Y5XB 5CZXD 3RIFK 7FABL 3IDXL 4NP4H 2ZG1A 4A2MA 3WS3B 5L2KE 5ANME 1MI5A 4NN5C 4PD4J 2ITCA 2P4AB 2BXZA 4JPIB 3PWNB 4WW2C 5DD1H 3UJTH 4PV8A 4Z8FL 4XP5H 3PJSB 5F7HA 4M4RA 1WAAE 5GS2H 1LP9B 3SDXF 3SY0A 1O5DT 1HN1A 4JPIA 3T09A 1JGVH 3TYGL 4Q97A 4WHDA 4MA7L 5T5FH 2YUWA 4G6JL 3RL1A 4ENEC 4UILL 3OJVC 3VU2A 3NZ8B 3OPZH 1MEXL 2HT4D 1RUPH 2EDJA 4IRJB 5KANG 5IB1A 1KELH 5TE4H 2VZ3A 5E1HB 1NBVL 2VH5H 3GSXB 4Z76B 4LKXB 3ILQC 4OM0H 1ETZB 5LAXA 1EJOL 1CE6A 1GZPA 1BD2E 4M43H 3TBTA 3BIAX 1NCCL 1VEMA 1CE1H 4FFZH 2BP3A 1EMTH 2YD4A 5CLTA 1OGAA 2GQHA 1QVOB 3RL2A 1AR1D 4XVSL 1CLZH 1RZFH 1QZ1A 4FQXB 5L9DH 4K94C 4LHUD 4G6JH 3K2UH 3TN0D 4PRPB 5TDPB 1S8DB 3GSOB 5TQ2H 2V5MA 1AR2A 2R2BA 3VGAC 4JJHA 1FJ1A 2CK2A 4K7FB 4KJQD 4YDVA 3MRRB 3X3FH 1L4IA 5FYJH 1ZKAA 2VH5L 5GRUL 1KELL 1W8NA 2H3NB 3LZFH 1BX2B 5TE4L 2X4RA 3OKMA 2PCPA 4ODHL 1VEPA 4U1GB 5FUOH 4LRIA 4P5MB 1ZVHA 2P8PB 4Y4HD 2BVPA 3M1BA 4M7LT 3RNKA 4LLDA 1SYSB 4X9FA 3P30H 1DUZB 5AZEH 2VYRE 1MFEH 4PRID 1YECH 4OZFB 4NYLB 2R0LH 2FNBA 2R8SL 4D9RE 4MJID 4HIHB 3ZYIA 3O3AA 5HVHC 1QSEE 5HHQA 1JUFB 3KHQA 2P8MB 4JAMB 2NW2A 1QRNB 1Q8MA 4WI9A 1EEUA 1F4XH 2UY7A 3ARDA 4JG0H 4QHMA 3V7AG 5FDWB 5C0FA 2VE6A 5IEHB 4HHAB 2X6MA 5F71A 5FGCE 4Z76A 4OD3H 1VFBA 3MUGB 2EDYA 3CU1A 1OPGL 1U42A 1A6VH 2EYSB 3NN8B 3ZKMD 3JV0A 4WI6A 2JK5B 1DL7L 1N6VA 4LSUL 1WSST 5DF0A 1JWUA 4XRCA 5CEZD 1OGAB 3TYFB 3MRJA 5FFLA 4OD2B 2KL6A 3PWVA 4D0CA 1RULL 2OP4L 1MFCL 3T3ME 5CWSA 4HWEH 1J0JA 4YJZL 3VD7A 4NKMB 5CD3B 2EH7H 3EFFA 5DYOA 2R23A 4FABL 1T80A 1T1ZA 4XP9L 5TF1L 1VFMA 3VXNB 1HYRC 5J9PA 2EIEA 5HPMB 3VRIB 4JZJB 3ARXA 3BPLB 3CVHL 4RGNE 5I1HH 1MJJB 4LLDB 2V5RA 2X4QB 4R97B 2VDKH 4WEBL 3WD5L 2R0WL 3F7YA 4YWGH 2PTVA 1FNGB 5JPNA 4YHML 1E28B 3RWEB 1DSFL 2Z93A 4P5KA 4G8GD 4JGUA 5DURB 5AWNH 4WHTB 4TRPH 3RVUC 1LO0H 1T5WA 1XZ0A 2P5WA 3PWLB 1BGXL 3OKDA 3QPXL 4YDKL 3RVWC 3IT8D 3S4SG 2D7MA 5IGXL 4K8RH 4J4PA 1VB9A 4NKQB 3QFDA 4KTEL 3A0OA 1FP5A 4ONFL 2R56L 5IOPB 3ZSTA 4Q6IB 4ODXA 1W8OA 3GRWH 4LHUA 5BCAA 1UM5L 2F54E 3AS3A 4LLUB 1CDUA 4U6YA 1N64L 5ITFB 2YZ1A 5ACLA 4YNYA 1RUPL 3U36A 5D96B 1QFWL 4CMHC 2CLZA 3KYOA 1R5IA 3OKEB 1FVCA 4ZUWA 1FZMB 2CGRL 4FQ2H 4L4JA 4FXGA 3VG9B 5HYSG 3TN0C 5KVDH 4MD0B 4CJ0A 4YUEL 3VXRD 2YBRA 4CVZB 2QSVA 5IW1A 4ZUTB 5ALBL 5GIRB 1A5FH 3NZHL 1OGAE 2OL3L 4J1UB 5K59F 1ZLSH 3OXRA 5HGBB 2E9JA 4WEUD 1E6OL 4IRSD 5IVNA 2J4WH 1M7DB 4RMTA 3V6FA 3HN3A 4U3XA 3NTCL 4M9PA 1HWHB 1S7SA 1MCSA 4ODUB 2APWA 2H6PA 2RCSL 3MRCA 2HFFA 1BQHG 2Q3AA 3OG6B 3U82B 3QDMD 4YHOL 5GS2D 4NN5B 3CVIH 3SCMD 5GS1C 1JV5B 3E3QE 3ZT5A 1NBYA 4L29A 5MI0B 4OZ4B 5MEPA 3ARED 4FTVD 4K8RD 3ARTA 3GJEA 2ZUVA 4GBXB 2MCG1 3MA9L 3OJ2C 3SDXB 3ZDZF 2GJZB 2R1YB 1BVZA 4QWWD 4CMMA 4PJDF 5EO0A 2W0PA 3KJ4B 2X4TA 1PX4A 4JB9L 3O6KH 4EN3D 3DO3A 1IILE 1EXUB 4JRXA 4TSCH 3OB0H 5T1DL 2BXYA 4FZ8H 4KJYA 4ZUWB 3H8NA 1NC2D 4CUCA 3OR7B 3O6LH 3G6DL 4V2BA 5T1DH 1TCMA 1WFOA 3BISA 1UC6A 3LV3A 3QDMB 2PW2B 5D8JL 3E3QC 3TT1H 1AQDB 2W38A 4A6YH 1T3FB 2VQ1A 2WUBH 4D0BA 4WW1A 4KJQC 4OKDA 2VB5A 2Z31D 4WHCA 3QCTL 1N8ZA 5JLZA 1LE9A 3FO1B 4PJHE 2F5BH 3QJHA 3CSPA 4S1DC 5T3ZL 2AJSH 5CGYC 4F7TB 5A2FA 3V6FB 2ERJB 3L5WB 4MB4A 4W4NA 5TFSL 3O6KL 5EORH 4I0PB 5GGVH 5JIHA 3DV4A 1QSFD 1ZHKA 4G9DA 4MA1C 3AGVA 4JHAH 5JLZB 4XBGA 4NIKB 2ZUQB 3QEQE 3IDXH 2YA2A 1ZSDB 2LU3A 4OZFG 2ZNWA 3FN3A 1FAKT 3VWKA 2C3GA 1T1XA 1T03L 4UDTB 2YXFA 1BJ1H 5I74B 1JFQL 2DI7A 4DUWA 4IMKC 1YN6A 1N64H 5ESVB 3NTCH 1AP2A 4XX1G 3SPVB 4D9LH 4U1SB 5EZIH 1ZXQA 1WIOA 5FM4A 1FYHB 3JBG7 4Y88A 1D6VL 3ZTNL 2BSED 5GZOD 2QSTA 4XPBH 5JTWA 4YHPB 4YDJA 5D2NA 3QWRA 5I2IB 4HJ0D 2CDFB 1X6LA 2AV1A 3PIQA 3REVB 2AGJH 1J12A 4YUEH 3RZCB 3P9MA 4S0SD 1RIHL 4M7KL 1G9NL 5DSCB 1TNNA 3BSZH 4LPXA 1U92A 3TN0B 3I85A 4LLYB 5CZVH 3BZEB 4M7LH 1AQDA 3T2QA 1F3JA 2C4FU 5D7SL 4MQ7A 2D9CA 4I3RH 1XGYH 1UXSB 3HPJB 1QRNE 1J1PL 3MV8B 2JB5L 3BKCH 5DSCA 5IEKB 3MLVL 3QJHB 3LB6D 2FIKB 3EO0A 2NX5E 3FOLB 4Y4HC 4CGTA 1R6VA 4YQXL 4I48B 3TIEA 2LV4A 1ZHKB 1NMCC 3GK8L 1JZ6A 1UCBL 4UAOB 2EC9U 3H0TB 3BXNA 1MRFH 5J3HC 3ESUF 3VXSD 3BPLC 1YY9C 3VMOA 3SBWA 4TUOB 1M6OB 5F6HI 2W07A 1QTYT 3P4NA 1I1RA 1DQJB 3QNXB 4BKLA 5J6GA 3WNPA 2PNDA 5E6YA 5D2NE 1XGRB 1U91B 2NLJA 1KPUA 3VFOB 1VFOA 3KPOB 4YDIL 3TFKC 1LP9F 1EK3A 1ULVA 1RUMH 2VZTA 3EDDA 3MRDB 1AGBA 1S3KH 4R7DB 3DX7A 4U1HA 4I3GA 4X6DB 1BZQK 3IJHB 2BVQA 1WBZB 4XT1C 3K2MC 2VLRD 4DJMA 4EN3B 1JPGA 3B6SB 2NY6C 2OYPA 3CFCH 1NFDA 4OCWL 5HGDB 1I1FA 3L5XL 2PUQT 2BHZA 4JN1H 2M8XA 1F6LL 1JGVL 1T89A 4TN9A 4ZOAA 1F6AB 1R3IL 4AJ0A 2DF3A 4NQEE 5I8OH 3C6SA 5D5MA 2JB6A 5EBGA 3Q1SH 3ALWA 1PZ5A 4MS8C 1X5ZA 4NJ9L 3PWJB 5T1LB 4HAGA 2E6JA 2IQ9H 1T7VA 1FL3B 2I27N 4UDUB 3C9NB 3IETB 4L3ED 3BGAA 1V7MH 3T4YB 4OGYH 2IANB 4PV8B 4XNZB 1KYOJ 3DI2B 2AJYH 2AV7B 4K7FA 4MD4B 4YDVB 1XIWB 3LKSA 1QHOA 1MCFA 2ZCKH 3BYTA 4NM4L 4IOIA 5JW5A 4G6AD 1OF2B 1XF3A 1Q94B 3TPUB 3MLPA 4PJXB 1T4KB 2BHUA 3ES6A 5BOPA 5D4QA 3LZFL 1NBVH 4IOFC 3EO1B 4F58H 2QJDA 3P0YH 3CDGB 4Y4FC 5BZDA 1GYAA 4ZXBA 2VISA 3RDTB 5E2VL 2FJFB 1NFDE 2NY5C 1F11A 3MXVL 3Q6GL 5I71B 5E2VH 5F89A 1SVZA 3HI5H 3WFEH 3DXAD 5EA0L 3BGMB 1HNGA 1PKQE 3CLFH 3UP1A 3HE7D 1U8IB 5M95B 4MJIA 4N5EC 1IE5A 1P4BL 2VE6B 1CFVH 4GS7B 1LDSA 2FJFA 4ORGA 1EGJL 5EOQH 2LVEA 1AXIB 5D2LF 4OM0L 1N4XL 2BNQA 5HYIA 2JK5A 4K3EL 5TDPA 2VUOA 3KLHC 1NDMB 1HXMB 3DRTB 4LEXL 2FWOB 5DQ9B 1GC1L 1HHKA 2FECI 1EMTL 1CLOH 1AGFB 2FL5B 3KPQB 4PY7A 4U6VH 3MXVH 3Q6GH 2GAZA 4WU7B 3Q6FB 3VFPB 1TTUA 5D7JA 2YD8A 4JG1L 2BNQB 3MLVH 2YEZA 1RMFH 5T5NF 3NCJH 3F7PC 1M71A 5DYOB 4Z7UB 1R0AL 3MLRH 3FOMA 4KY1L 3QEQD 4DFHA 4N68A 1SBSH 2X4OB 1L7IL 1U8QA 2DQDL 3WKML 4WU7A 4K55A 2GK2A 2HH0H 1T22A 1WWWX 2NNAB 2XY1A 5HHQB 2DTSA 3TGXA 3WNKA 2AP2A 3BKMH 1O0VA 4BSJA 4CN6A 3MXWL 1IGFL 3INUH 4PGCB 1KYOK 3I6GA 4HUVA 3IDUA 3ET9F 4P5TB 4PLJD 4PJEA 3W11C 5K9QG 4QRRA 3FB7B 5DA4A 4EN3C 1A14H 1DQLH 1TPXB 2P8PA 1YNTA 3D25A 4L3AA 4Q7DA 4PP2B 1A14L 3PL6D 4KY1H 3MV9E 2UWEA 4R0LB 4YDLB 4J3XA 1JYWA 1DQML 4ONOA 2IAMB 1MFNA 1LEKB 1Q9KB 5DD5H 3LCYA 1FG2B 4X9IA 4OD1L 2X7LA 1TVBA 1A3LL 3HNSL 1OP3K 5ACZA 1TMCB 2ATPA 4UINL 3D0VA 2Y36H 3IB4A 5F1NA 2WK2A 5C2BL 1FSKB 1NGYB 2W9EH 2FR4A 3KDMB 1JTPA 1XGRA 1FNFA 1J88A 2XZCH 3GFUA 5E03A 5GSRA 1GPOH 4TNVK 2ARJQ 4KK9C 4OLYH 1XIWC 1W0WB 5E6IA 4JO1H 5L6YL 1JYNA 5JQ6H 2FR4B 5KS9E 4Y4HB 1EEZA 1U8QB 3BPNC 2IC2A 3MV7A 2VDPH 1TQCC 4HKZA 3RBSA 2ESVA 3RNQA 2EYRA 4R3SB 4BUGA 3QPQC 4PJIF 2DQUH 2UV3A 3UTPD 4YHYC 4EUPB 1Y6NR 5F3HA 1RURH 3UC0L 1I4FB 2ATKA 4Y4HA 5EWIL 3D39B 3JWNC 3BIKA 5I1HL 3TJHD 1GCFA 1PEZA 2HMIC 3OR6A 3HTLX 1RZ7H 4PUBH 2Z92A 4NBXB 5E1AA 1K85A 3PWJA 5T1LA 4O4YH 5E6IC 3KR3H 1HH6B 3UYRL 3DVGB 3VXQB 5BS0A 3WL9B 1X9QA 2CDEA 3QBTB 5J1TC 1X6NA 5E0QA 1U8KB 3P40A 5F88B 1IGTB 5I0ZA 4M1DL 4P46A 1NAMB 2XN9D 2E7CA 3D0LA 2HG5B 2BOBB 3FT2A 4TVSa 5IV2A 5MI0C 4NWUL 3BPOB 2CRMA 1HHGB 1Z3GH 5E8OB 5BV7H 4WCYL 4F2MB 5C0EA 4U6XA 4LCCB 2ZOKA 3OGCB 3FQXB 3BPCA 3EDJA 4C56B 4DZBA 4LLVB 3RKDC 1I8IA 4ELMF 2BNRD 4FNLH 1PYWA 3ABZA 5FGCB 4UTBL 2JTDA 4NDMB 3O41A 4K3GA 3W2DH 1CT8B 5GQBA 2WW8A 3TP4A 4XBPA 3QUMA 1JF1A 3ZKND 4P2QE 3UZQA 5KVFH 1MCKA 3QDHA 4D94A 1WIUA 2Y07H 3ARVA 4O5LH 4WV1C 3DVNB 4K23H 1RY7B 4YBLB 4U0QB 5DJDA 2XA8H 3LQMA 3T4AB 1ORSA 2VXQH 2JJWA 3EOBA 3LKPB 1MRCH 1R24A 3U4AA 4ETYA 1TCRB 5B39G 2MFNA 4JFEE 1CE6B 4KUZH 1ZT4A 3KAAA 2BSTA 3ROLA 2WLYA 2AEQL 4G80A 4YXHL 4OV5A 4FQQA 4FHBD 4JB9H 3QFJE 5IBUB 5DO2D 4BH7A 3LPGA 5J1AB 2A6KA 1AGCB 1J0KA 1X5XA 3KPMA 1EXUA 5MHSE 4NSKB 3J7HA 2X4NB 3X12A 3MRRA 1IZJA 1GRWA 5F6HJ 5IFAH 3IXTB 4E0RB 3FQTA 5ID0B 1PG7X 3CX5K 4YHMH 1P9MC 3LV3B 3QDMA 3TC9A 5KVGH 5J1AA 5HI3D 5I1DB 3C09B 5D1ZC 2NZIA 3NCCB 5HHOB 2AJSL 1CFNA 3L3KA 3SDXA 2CJUL 4ZXBC 1VHPA 4X80H 3N50A 1U8PA 3FO1A 5SV3A 1CT8A 3SDCA 4OM1L 1GOFA 4O51B 1D9KD 3RZCC 4F7CB 1XFPA 4Y7MA 4APQD 4CW1B 3W9DB 1H9VA 1U95B 4A2LA 3FRUB 2AXGB 3TT1L 3BSZL 5JIIA 4PJFE 1CWVA 1NLBH 5I1LB 5C9JB 3MBXH 1H3TA 1FHGA 1ZHBB 4MXVF 5EULV 4X8XA 4L9DA 5DJDB 5FO7B 3VWKB 3TA3B 5L2KA 4HWNA 4GG6E 4CN4A 5T3ZE 4XVTH 5C0JA 5D6CA 1VFBB 3MUGA 1G7IB 3FN0L 4EI5A 1G9NC 5I1LA 2B0SL 2NX5A 1WCQA 3D3VB 4PJGE 5DS8B 4LF3B 4X6BA 1QSFA 4F7TA 4OCMC 1XCQB 3CMGA 5I18L 4P46D 3AC0A 3QFJA 12E8H 5ERWA 4GQ9H 2P24A 5L0QB 2CDFA 1AQKH 2BRQA 3DTXB 3REVA 1GGCH 5J0BA 4JFPB 5ICYA 3GRWL 4LVNC 2FSEA 3EIFA 1KGCD 3F12B 4XC1L 4X6BB 4HMEA 5C3TA 5IJKA 1ZMYA 4H1LG 1A4KA 5ECJE 1DEEA 1URLA 2AXFA 4TVPE 3B4NA 4LVHC 5GJSH 3JTTA 1X5KA 3T8XA 3BMWA 3DETC 2A6DB 3ULSA 3C6LB 1MJ8L 4ERSH 3U0PA 3EO9L 3DI3B 2IEPA 3FB8B 3JWDH 1IMHC 2DWEB 1ADQH 4IRSC 5DRZA 5FV2A 4EN3A 2IBBA 5I2IA 4NHUA 1DUYB 3EAKA 2WUBL 1K5NB 4JFZL 3OB8A 4HS3A 5TH2A 2DI9A 4HWZB 4UNUA 4OCWH 5D7IA 4MVBC 4UV4H 2ZNXA 4I48A 3TIEB 2K3TA 2EDQA 1QHPA 1B0GA 3QQ3A 1EZVY 5HD8C 5HDQL 3DX9B 5LGJB 1CFSA 2UY6A 1OM3L 2NMSA 2HP4A 5CHNA 4UTBH 4NRZB 2C3HA 2YMXL 5CIPH 5L2JB 4NQCD 5F88A 5C0IA 1FNSH 4JFHE 4YDIH 4M7JH 3FQUB 1AIFA 3UAJC 4P5TD 3WE6B 5EBMA 3QA3B 1BBDH 3BPNB 1DBAL 2CUHA 3JZ7A 3O4LB 5DJ0A 1H8SA 1RZ8A 1JGUL 4YNYB 3PV6A 4JREB 1EV2E 4DZBB 3QDGE 4NJAH 5H94A 1ZT7A 2FJHA 4S2SA 3BQUC 5D2LE 5DFTA 4NC2B 1DANU 2N1KA 3MZTA 1LILA 4LAQL 3WFDL 3TNMB 5I1GL 3N1GC 2G5BB 1N7ML 4ZUTA 3WFCH 2DBLL 1YMMA 5CILH 4X4ZA 4PG2A 2P8LA 1KJVB 3WUZA 2A6DA 1RJYB 1IAOA 3C09C 1ZANH 5HYSB 1YJDL 3U2SB 4MJ4A 2CXKA 4EI6A 2A0LD 1FC2D 3MLTB 4PRIA 3WLBB 1FH5L 5GGRA 5DD1L 3UJTL 4LHJB 1VFAA 1S7SB 2M1KA 1RK0B 3CCHA 3GUTB 2DLTA 1K6QH 3VMNA 1QSZA 3WFBL 1Z0MA 3IDGB 2DLHA 3NPSB 4U1NB 2Q86B 4HIXH 3STLB 4FMFA 4X4ME 3QO1A 4M62H 4N0YL 4XP1L 5ETUB 5FYKD 3E6FB 4XMKH 4OGAC 3EO9H 3O4LD 2PXYB 3ARPA 4LBEB 2V7NA 4LVOC 1FZKB 2ADFL 3BKJL 5GRUH 5IBLC 3TA3D 3VFSA 1FGVH 2E9WA 4Q2ZB 4LCUA 1QLRB 5CZKA 1U93A 5GGTL 2WQ8A 1NCNA 4XC1H 3SKJL 5HDQH 1NGQH 1I7UA 4D9QD 1FORL 1VADB 2NYYC 4U6VL 2BSRB 3DX6A 3STZA 5D72L 3K3QA 1ZTXL 1FJ1B 2X4TB 3G6AB 4KVNL 1OCWL 3L95B 5DUMH 3DXAA 1G0DA 3N9GH 4KUCF 1CF8H 2DAVA 5DA0B 4ODTH 4YPGB 3WXVH 3H9HB 3L7EB 3RWCA 4PJAA 4QGYA 1MWAB 2ADJA 1B3JA 4D0BB 4RSVA 2Q76B 3H3KA 4UIKH 4W6WB 4BYHA 3H3BC 3SQBA 4DUVA 4MJIB 3BVNB 4F8TA 4N0UA 4YHNA 4QRQA 2IH1A 1U8JA 3P30L 2WNGA 4JY6A 5C0GB 4Q9CA 3ZDXF 1JN6B 4EJ1C 3N1QC 5E4EC 3HI6H 2V2WB 4QNPF 1IBGH 2QTEA 3IFNH 4DEPC 1AGEA 3BW9A 4BK5A 3CZFB 3EJYD 4L9LA 1QACA 3GSRB 3GHBL 1VACA 2K7PA 4GT7A 3BH8B 4PP1C 4C55A 2OR9H 1SHMA 3EDKA 1CFTA 1QQDA 3Q3GB 1FGNL 2ORBH 3IRPX 4LRIC 3RX8A 2IAMC 1CFVL 2HVJA 5IB1B 3ISWA 3JV5A 4MXWL 3LRHA 1UCBH 3MJ6A 3SDAA 4DGYL 3MCKA 5LQBH 1ZAGA 5DUBB 2X4OA 5EU3B 3BP7A 5DD3L 2VDNH 5C07B 5CGMA 1T22B 3KHOA 3W0WB 4JO3H 3QXVA 4X7CC 3EGSB 4IM8A 1HSBA 4P59L 2ZOLB 3L3GB 1IBGL 1QEWA 4ZDHB 4HKBB 5BRZE 2JB6B 3QJFA 1KCSL 4F8QA 2UYLB 3CXDH 5A2LH 5BW7C 4Q0XL 3IAQA 1PQZB 1UM6H 1ONQA 4Z18A 1CGTA 2CDGA 3QXAA 3C87A 2AVGA 4HULB 5IHZB 2GY7B 1UB6B 4RZCB 4OIAA 5ESQB 3VDAA 1N5YL 1TZIB 3MXWH 4KVNH 3QUXD 1INDH 1OTUC 4I9WE 1FZOB 5DR5L 5LBSL 4FZEL 2F53B 4OLWL 3PNWA 4HSQA 1CD9B 3I6LD 4FXKB 4MQTB 2HAZA 1FPTH 1V5JA 5C6TL 3S88L 4NHCH 5FK9B 3W0WD 1D5IL 1TXKA 3DO7A 5EU4B 3C5SA 3EZJB 4GAJL 1MVUA 1BJMA 1KEMH 2HVKA 4FQHA 4NP4L 5C0ND 4AG4H 3CZFA 4L9LB 1KNOA 3X14B 2WIIA 1MELA 5SWQB 2MQ0A 4LDOB 4M1DH 1BLNB 1ES0A 4ZFZA 4LRNH 5EDXA 1DN2A 1WAAF 1DQMH 4ENED 5FDWA 1A6AB 1QRND 1DQJA 3QNXA 1PKOA 2R56H 3TZVA 4WFGD 3IS1X 5F1IA 5EWIH 4PGEB 1OARH 1KJMA 3VA6A 2R4RH 3MBXL 1FBIL 4UQ3A 3CH1B 5C71A 1NGWB 4LDLB 1U8IA 3ZE1F 1MI5B 1EEYA 3M07A 5GGVY 5I19L 2AJXH 3ZKXC 3IDJB 1ZVSB 3GSXA 1RUKH 5F6IC 4M8QA 1ETZA 1P4LA 5H37G 3WLBA 1T2QH 4MJ2A 5FUOL 1ZHLA 4JR9H 35C8H 1GC1H 4ALAH 4PV9A 3IFLL 3C6SB 1M7XA 2OJZH 4M6NL 4EBQH 5JUEH 3OL2A 4GAYB 4R90L 1GIGH 2XWTB 1J0YA 1SBBA 3RGHA 4APQC 1B2WH 4CNIA 1CIUA 5ADOH 2VLKB 4P2RB 3QCVL 1P4BH 2YEZB 4RFNB 2FHBA 4NQXB 4PTUA 5HD8D 3I6LE 4DEPB 5F96H 5DRNA 4CN1A 5I8EB 4KMTL 3MGTB 4MVBD 4O4YL 1CDIA 2WP3T 5I1KH 1QKZH 3OJDA 3BQUA 3QUYD 1GGIH 1RJZA 4B50A 3IU4L 5HHOE 3NFPA 3G08B 3N1MC 4Y5XA 3S37H 4WV1A 2G9HB 4GKNB 1IC5L 1YEDB 2A77L 4TSAH 1X7QB 4PJEB 1MNUL 4X9BA 1MJ7H 4E42A 1XF3B 3ARFB 2VXQL 3LDBC 1I9IL 2YA1A 2DTML 4YEFA 1FAIL 1J8HB 3MJ9H 2J4WL 4XGZA 2R2EA 4BFGA 4DQOL 4MZ2A 4LLWB 5D71H 1U3HC 5SWZD 3GSUB 4HX1B 1F4XL 1GHFL 3QUZD 2E5EA 2CRYA 5I66A 4ZXBB 4IRJC 3AREB 4X6CF 5SWZE 3WIIL 3FJTA 2BNQE 1NC2A 3CAFA 4XMPL 1HYSC 1CGVA 4L1HA 2F53E 1G0XA 3CUPA 4MD0A 3T1FB 1EGJA 4U31A 5I66B 5JXEA 1HIMH 1MHPH 3PHQA 3V0AC 1QSVA 4EOWH 2BY0A 8FABB 3OKOA 4LCIL 4FQXC 4GG8B 1NMAH 3C2AH 5D7KD 3KLHD 3EDEA 1D5MA 1YY8A 4XHJC 1EFXB 2H1PL 4OQTA 3RHWF 4RAUA 3PDOA 4OBSA 4PGDA 4XZUB 3QUZB 3S3SA 3EJYC 5C0NC 4FZEH 5E6ZA 1KGCE 5AUMA 5IVZA 3SDAC 5FB8A 2XWJB 3QCVH 2CLVA 2X4PA 4I18C 3PIQB 3D3VD 4FP8L 4QYOB 5J6HB 3DJ9A 1BM3L 3C6LA 3QZWA 4XNYL 2X4SA 1MIMH 3FHQA 4UIMB 5EBLB 4JFDA 5CSBA 4M1GH 3RKPA 4OLZL 1YEHL 4ALAL 3HC4H 1OSPL 3PGFH 3QP3A 3MV01 3LIZL 2HTLC 1VPOL 3GMQA 1F3JB 4J6RH 4X6DE 2L7JA 1G6RA 4R4BB 1VA9A 3O2WL 3ULVE 4S1RH 3QNZB 3CLEL 1MAMH 1A21A 3RGVA 1I9EA 3FTGB 3ZDZE 3LH2L 5F9AC 4HUXA 5INCB 5KSBB 4M3KB 4LLMB 1XGYL 3U9PL 1OB1A 1RFDH 1YYMH 3MLXL 3R1GH 2HKHL 4MA3A 4R4BA 4AEIL 4U3CA 2LTQC 1Q9WA 1I8IB 3IRZA 4XPBL 1R5IB 2QQLL 2FCBA 4JJ5B 4GG8A 4XI5D 2RR3A 4WW2F 5E56A 2GITB 1DTUA 4LLQA 5E70A 4RFNC 3TH2T 3QHFH 2IH3A 2V2XB 3MLYL 1JWSA 3MFGB 3V0VA 4G6FD 4YQXH 3LQZB 1MWAL 3JTTB 3HI1B 5GSRB 4GMSL 3ZE0E 2EC8A 2XQYK 1QSFB 5FYLE 4G8GA 2JIXB 5E8EA 2BVYA 1IGMH 1IGCL 3WIHH 5DGRA 1L7TH 3P77B 1S5HA 3SEPA 2BZDA 3HE6C 2AJ3A 5JDSB 1I75A 1K5NA 2YOCA 4ODUA 3U9PH 4YHLL 2XN9B 2W0FA 1JZ2A 1MCWM 1UWEH 4NQCA 4TPRH 5F7DA 5ENWB 4NO5B 4OCSH 4Y4KC 1RZIB 5D2NB 2P5ED 2PR4H 1FNGA 5CGTA 3FRPA 2VRAA 2YN5A 4ODWA 5D8JH 3ZE2E 5EO9A 3P9MB 3FCTA 5E1AB 1NH6A 3FQNB 1INQA 1KG0A 5FYJD 2X10A 1TZHA 4LSQL 1WFTA 1RZJH 2NY5L 4RFOH 1A6ZB 1D6VH 2AJVH 3K7UA 1JI2A 1HH9B 4HS3B 5TH2B 4QRPA 2FEEL 4JCLA 5BMFL 2DL2A 4B41A 4I0CC 4HC1H 3WBDA 1G7PB 3QIWA 2QSCL 3QXDA 4K7PY 3RI5F 4EQ3A 3EYUH 4LVOB 3ILPA 1FCCA 5IVXA 2FIKA 3EO0B 2EO1A 1G1CA 2K9UA 1YNLH 5HGAB 5I30H 5IHUL 1UVQB 3DSNA 1RFDL 1YYML 4NWTH 4XPGL 4MB5A 5D70H 2UWEE 3KPPA 2IGFL 1EAPA 1A0QH 3RZCD 5CJQL 4JFQB 5AEAA 3ZYZA 3TNNB 1GL4B 2LU7A 3NA9L 5AYQA 3DV4B 1FE8H 3S36X 2PW1A 3WFDH 4EKXA 4W6XB 5E2TL 2VAJA 2B4CH 4NKDB 1J1OL 3OG4B 3NZHH 5KN5A 3T4AA 4G6KH 2FJGB 4QRRD 5CZVL 3KPRD 3LPFA 4N8PA 4JO2L 3DUSA 2D7PA 4NUGL 5EUOE 1X5HA 1NQBA 1XGUA 2DRUA 1E4WL 5DHYA 4JLRA 3SDCD 1D5BB 1RIVL 4PLOB 3MNZB 2PTTB 2XRAH 1AXSA 1KLFA 3O6FA 3TJEH 5DTFA 3VFNB 5AAWA 4GUPB 1SJHA 3VA2C 3UTQB 2PYEA 1BQSA 4ZOEA 4JG0L 1QBLL 1N2RA 3CVIL 5L8LB 5FA4B 2P1YA 4FQXA 2R1YA 2W9DH 4RNRA 1RIUL 2A9MH 1JMZA 4ZNEA 4PRPA 3FT4B 4TNWF 1N3NB 1U8NB 4XI5C 4POZD 4D0DB 1M71B 3VE0A 1WC7B 1N5AA 1HXYA 2GFBA 3A6OA 1RIVH 4UIMA 3ZMRA 1H8NA 1CQKA 1FCGA 1SVCP 1IAIL 5TQ0H 3FT4A 4Z7UF 3STZB 1PQZA 5CKAA 2B1AH 4M5ZL 5DEGB 1C5CH 1ZWIB 5B39A 3FN9A 5IMLA 1V7NL 4TNWK 4I2XE 5J4MA 5ANMB 2RJMA 4WUKL 4PR5B 3NCFB 4N0UE 1OB1B 2A74A 5KAQG 4ZXBD 2Z8VC 1A7BA 3LD8B 4Y19E 5JO5B 3V5KB 2PYFB 1AY1L 3DROB 5LJYH 4HAFA 2WAHA 3DMMA 3SDAB 5DHYB 1GGYA 2HVKB 4FQHB 1G6RL 4Y16A 2IH1B 3ARSA 4PR5A 2BOCA 1CQYA 3MCLH 3HZYB 2FX9H 4LOUD 3V8OA 3B43A 4HWBH 3MCLL 4K07A 3EFDL 3U7AA 1JZ8A 4RCAA 4Z7WA 2G5RA 5C09D 3RU8L 1NMCB 2XTJD 3BGFB 4RGMB 4J8RA 4ISVB 3O2DA 5KS9F 3S5LG 3D0VB 3BQUD 1DBAH 1MY5A 4N1EA 3BH8A 3O3DA 5HHNB 3HNTL 2ZP0T 4MNQA 5DD5L 1PJ9A 3FQRA 4XP4H 3SDYH 3RFZC 4OZGA 4JRYB 4ISVA 4D0DA 3CFDB 4HZLB 1DLFH 1NGWA 4B7IA 3MGOA 1HHKB 1TTGA 2R4RL 4NO5A 3T2NH 4FTVE 4CVXA 4OLWH 4N90E 2F54A 3MFFA 2EYRB 1LK3L 3SDAD 4P23B 2VDQL 3TBYA 1K8DB 2FX8H 1HHIA 3MRDA 2VABA 4Z7UA 1FFQA 1A7NL 1L0QA 2JJTA 4OSUH 2Z8SA 1QEWB 4ZDHA 4XP6H 2F54B 2MWCA 1F8TL 2NY6B 2DWDA 4LMQI 4LRNL 1MH5A 5L7XL 1GZPB 3MRBA 1QUNA 2FHCA 1AH1A 2OL3H 4LP4A 4WO4D 3S3PA 4KMLB 1PZUB 4AL8L 2OCFD 1ZE3C 5CMAB 3IVKA 3ZLQC 4XAWH 1I85C 5T33H 2NY0B 2ZUXA 3H9SA 1KB5L 4FXLA 2NXYD 4IOIB 3T0EC 5JW5B 3EYSL 3MX0A 3H0TA 4Y4FD 5GRVK 4KMTH 3JUYA 4Y1AB 2CK0H 5IFHH 4ODHH 4QWWC 1A1MB 3VGGA 3JWOC 5IT2H 2Z8WC 3S37L 2XQBL 5C0AB 4V1DB 5T3ZD 3V95A 5B3JF 3IU4H 5F9OL 1E4WH 3NFNB 5E08L 1ES0B 1TQBC 2AEIT 4PJ8D 2GKIA 3RNKB 4AZ8A 4OCRL 3ARBA 3IFOA 4P59H 5IBTL 1DBKL 4G6ML 3QDAA 1IAOB 5C09B 4HS8H 2VR9A 3C08L 1OTTD 2XFXA 3GIZL 5FECA 5KN5B 4WUKH 3HNTH 3U7YL 4GRMB 2Z4QB 3X11A 5JOFA 5LQBL 4NQED 4OZHE 1AE6H 3O9WC 3WLWC 4RMVA 5SWSE 3Q5TA 4N90D 1J9CT 2DQCL 3B5TA 3JV6B 3RL2B 4YAQA 1AD9A 4HKJA 1AXSB 4WGWB 3G04A 3VFUB 4PREB 5E94B 2R4SH 5F9OH 3V8CA 5GRZA 2PYEB 2IAMD 4Q6IC 4PJFB 1S7WA 4MAYD 5C0DB 3VXMB 4OTXL 1ZV5A 3C2AL 1UXWB 4RGOL 4GS7C 1TFHA 1U93B 1ROWA 1F4YH 1TVHA 4MNGB 5AWNL 5I1AB 1FYTE 3NACH 5MEOB 1S78D 5FO8B 2VLKD 4NSKA 1FO0L 4OGAD 5EOCH 1QSEB 3IGAA 4KJPC 5EPMA 4HH8A 4OFYD 3ULUC 2VR5A 5HHOD 3VXPA 1SJXA 1AE6L 4XHQA 1OAQL 4PJ9C 1AKJB 1BIIB 1IARB 4XX1E 5E7BA 5D7LD 5J12C 3MUHL 3DSFL 5J1SC 1ZT1A 1CFNB 4XVJL 1ZWIA 4XNXH 6CGTA 3RWJB 2QADB 5GZNC 3GJFB 3IJYA 4Z7OE 3EO1A 5HHME 4TULH 5C09A 5IFHL 2PW2A 1MFDH 1OTUD 1FAIH 3RY5A 3UTZA 4U05A 1SJEA 3RJDA 5DHVA 1A1NA 4P23C 4BFEA 2GYSA 4XPAH 2YK1L 4PJ8B 3UBXA 3GSWB 4MNQE 5MENE 5KSAC 5IQ7L 1FFNA 1EO7A 5EOCL 1JNLH 5IB4B 1T0MA 4G7VH 3VDBA 1GGCL 2ZKHL 1A3LH 4PY8I 3IDIB 3LMJL 4NGHH 4NQVB 4WI7A 4JY4B 1KCRH 2JCCB 2O26U 3B9VA 3RIAF 2A9NL 1UENA 1KB5B 3WIHA 3LQAH 1IL1B 1Z9SA 3D3VA 5DS8A 3IF1B 3I6KB 1P5VA 2BSSB 2YRZA 5BXFB 4XNUH 5JMOC 3DXAE 5FYJL 5CEXA 3LKPA 1A6TA 2CR3A 4R6UA 2JIXD 3SDCC 1KN2L 4PY7B 5HI5D 4JFXB 3VFGH 1FVCB 3PL6B 2DKSA 3QZWB 3ZYJA 1YMHA 4HXAH 4Y2DC 5GRVL 3KPRE 1A4KB 1CU4H 5CEXB 1T0NB 1XGQA 2EICA 1S5HB 2OSLA 1WCBB 1A3RH 5CEYA 4FTVA 3K4ZA 1U8LA 3HS0A 1B2WL 2GK0B 3THML 1OM3H 4Y4FA 1IQWL 5DI8B 2JB5H 1AHWA 3BKCL 1A02N 3VRJA 1KC5L 1JPFA 3NVQA 2DKMA 5KSUB 5ILTH 5K33A 2VN4A 3VG9C 1CG9A 4I0PC 4LLMA 4POZC 4Y4KB 4LGRB 1GGBL 1GJIA 5I8EA 2IAND 4K71C 1MCPH 2C3XA 4KROB 3VRJB 4QHKI 4X7EC 1A6ZA 5DURD 5H8DA 3PXJA 4HDIA 1FVEB 3DRQA 1JGLL 2DQGL 4L8BA 4OF0A 1S7RA 5DD6A 2V17L 3OR6B 2R2HB 4OV6F 3FQUA 3E6HB 2CLZB 3KYOB 1WWAX 5I17A 2VXSL 5C7XL 2VQTA 3GZKA 4AM0A 1CGWA 3SE8L 5FO7A 1RJCA 1B4JL 1M7IA 1CDBA 4PBXA 5JIKA 3C8KB 4QY8B 3WXWH 5JR1L 2A83A 4Y2OA 1HZHH 2FEEI 4WWKA 4KKBC 2YKLL 1IC1A 5SWSD 4D0CB 1YUHA 3CSBA 2MQCA 1WF5A 3PGDB 1KJMB 1WTGT 4YPJA 4MX7A 3KJ6H 4RMUA 3ZYOA 4OF7A 1YMMB 4QLRA 1IAIM 3QUMH 2H6PB 1K8IA 4RX4A 1P4LB 4FMKA 4PTTA 2FO1A 1CR9L 4XNZC 5T3XH 2BCKB 4K2UH 2JJSA 4KHTL 1IC7L 3H9SE 4XBPB 1OLZA 3SDDB 3ULUH 2AXFB 3QIWD 1IC7H 5C07D 2YRLA 3NA9H 3WDJA 4M5YL 1B0RB 1BMGA 4QHLA 3ULVH 2XICA 4GQ9L 5GSVB 3WJJC 1IM3A 1T03H 4KKCC 4YX2H 2Q86A 2OR7A 4U1NA 4HXBH 1H3PH 2DL9A 5DK2A 1U9KA 3O9WA 3FQTB 3EW3B 1TVHB 3B2VL 1KENH 5DQJB 4MZ3A 1OW0A 1KUMA 4P46B 1JPSL 1G9MH 2R2HA 3K2UL 3LY6A 4JKWA 5T3ZH 4TOYL 2IPUG 5ALCL 3H9ZA 2BMKB 1DCLA 5DEFB 2OZ4A 4P9ML 3MJ8B 43C9A 1QSEA 4Q6IA 1U8PB 5FUZH 1EEQA 2AV1B 5F3BB 1QBMH 1IC4L 2VXUH 2VLME 4KC3B 3EJJX 4CW1A 4WWKB 1EJOH 1UACH 3MBEC 4XGZB 1T2JA 1N8ZB 1F13A 2DMCA 3NIFE 2ICWJ 3RY6A 2V7HA 4QHUB 4Y2DB 5C08D 4NRXB 2YD9A 1DJSA 4Q9QL 4ONHA 3PWPB 5DT1H 4S1SH 1GC1C 2GJ6E 1KBGL 4YK4B 4DVBB 3H42H 4PB9L 4S1SL 1KB9K 3MV8A 5T5NG 3W11D 1G7MA 3QEUB 2NX5B 5FGBC 3QAZB 4KQ3L 5ALCH 3WN5B 3L7FB 3S5LA 1ZLWK 2GITA 1S9YA 5MEQB 3V6OC 1NCBL 5I1IL 4N9GA 4APQA 4F9LA 3O2VH 4AEEA 5MERB 2IH3B 2V2XA 2CMRH 4MWFB 1W2KT 3ULVC 2VQUA 4P2OA 3UTTB 1CN4A 2GCYB 5ICXA 32C2B 3ROLB 4IRJD 1ORQB 3U9UA 1F6FB 3F58L 3JXAA 5BXFA 5AZ2L 2H26A 3VFWA 5C0JB 4WU5A 3RP1A 1QLFB 1OHQA 4QTHA 2EH8H 4LASH 4PLNC 3MNWB 3MV7D 5BQ7B 3LS5L 5A16B 4YBHA 4MAYC 4NKMA 5CD3A 1DVFA 5JW4Q 4HLZH 1I3RB 5I15H 4JFFB 4ODVH 1MWAH 5IQ9B 1FH5H 3VXTB 1NCBH 5I1IH 4OD3L 4M03A 1A2YA 4JFZH 5A2JH 1SEQH 2Q8BL 5HPMA 2IQAB 4LVNB 2YUXA 1F2XK 4YGVB 2HT3D 3P0VL 1G7HA 4OZGE 3DMMC 1XH3A 3RVTC 3P0GB 1J1XH 2BSRA 4JM2B 3MOBL 1U6AL 2H8PA 1G6RB 4QRUA 5E99H 1R5WA 4X80L 5F21B 1UWGL 1DVFC 4IRSB 2FO4B 2ZSVA 1D6EB 1YJDH 1AHWC 4DN3H 1NMBH 2X41A 1KJ3H 1RK1B 1NEZA 2IALB 2MTPA 1WT5A 3L3JB 4PLKD 4PJGA 1YPZE 5DMKA 5GS0L 3W39A 4NNYA 2E8ZA 1FL3A 4XPTL 2OI9B 4I5BB 1WBXB 4P23D 3FZUC 1KV3A 1F3RB 2WIMA 1IT9L 1YQ2A 3VXSE 1U8JB 4R4FH 4Z7WF 1NEZB 4U6TA 4UV7L 1BQHA 4MCYB 4AEHL 4LLUA 4P49A 1JN6A 3IAPA 4KZDH 1RI8A 3FN0H 4XC3L 5J11C 2VWEE 4NO3B 1J10A 2FH8A 4OCNC 5JHLL 2X7LB 4CVWA 1XEDA 3KPSA 1YDPA 2ATPB 3E1F1 2H2SC 1NSNL 2EECA 1BFVL 1CZ8H 4U1HB 2AJUL 3LOWA 5A16A 1Q94A 3OBAA 3VG0L 3C6LC 4Z7QE 4F57L 1IKNA 3SOBH 4NO0D 2B7DT 2YS4A 3RUGF 1SYVA 3BJ91 1OGTA 1MIEH 1Y0LA 3QI9D 3QQNA 2LAAA 3RIFF 2WUCL 4WWKC 4Y16C 4BKLB 5J6GB 4YBQD 3P4MA 2YD7A 5IBTH 3B5GA 3FB8A 2L0DA 1EEZB 2D0FA 3IDJA 3MV7B 2NTFA 1MLCB 4RDQG 3FQRB 5GJSL 2NY7L 4KZEH 3GMNA 1CF8L 3C60D 5CSGA 2IBGA 4ODTL 3WXVL 4UTAH 5EUKA 5EC1B 3TPKA 2DOCA 3AAZA 5EO1B 3MGOB 5FUZL 2WBJB 3D2UD 1E4KA 2CGRH 3O4OC 2VDLL 3QJFB 5AYUL 4NZRL 3QULB 5CS7A 1MF2L 4WI5A 1ZVYA 5KVFL 5L2JA 2X40A 4UT7L 3EHBC 1NGQL 4JHZA 3V52H 1A5FL 2E6PA 3V79C 3BIBX 1Q9OB 3OHXA 5ETUA 3T08A 1N5AB 3DYOA 1GOGA 4I0PD 2Q8AL 4JG1H 2VZOA 4QEGA 4YH6A 1PAMA 4G8EA 2APVA 1MQ8A 3BQUB 3VH8G 1ZK9A 3MNVA 1FG9C 1JZ3A 3GI8H 4LMQE 4WRLA 3I50L 3VGHA 1BZ7A 4RGND 4PG9A 5HHXH 3CDGA 5D7IE 4XCEA 2EDNA 4MAYB 1S7XB 4AT6A 5IJVA 2F8OA 5I1KL 2JJSC 4C58B 3AUVA 3V4UL 4MS8D 4DVBA 1O7SA 4U4BA 1KJVA 1KTRL 4G8FB 4XCFL 4UU9A 3ECBA 2JLLA 2BVQB 3IJHA 2HTLD 5J8OA 4HIHA 3IFPB 4P9HC 4GRWE 1MCWW 3ARQA 3DURB 3NPSC 4JFEB 5HSFA 1I7TA 3KLDA 1QQDB 3NCMA 3Q3GA 1HHJA 3JVGA 2OJEA 5EUKB 3RVTD 3CGTA 5DDHA 3WKMH 1AXTL 2APBA 3B9KB 43CAA 2GCYA 4S1QH 3SJVE 2R69H 5JQHC 1D5XB 3LS4L 1GGIL 3QIWC 5HGHB 2FBJL 3SDYL 3E8UL 4HC1A 5C07A 1RU9H 1QLFA 1U8OB 4JGMA 2F9BT 3QDJE 5C0AD 3H3PL 1EHAA 4JPVL 4JFFD 5FM5O 5BJTB 2YXMA 3QNYA 2D7OA 3GO1H 3NH7H 5DRXB 4JFFA 1DSFH 3DHJA 4R2GC 1CIDA 1X3DA 4HH9A 3O3EA 1W0WA 5DQ9A 3LN5B 4KKAD 2DQJH 3TBSA 3DXAB 3CZJA 1WCBA 1I8MB 4EUPH 4PJBF 1AO7D 3RWHA 5IMKB 2E7LA 1A7PH 4PJXA 1LO5B 2J12B 2YD6A 2XZQH 4BQBA 5HDLA 4RA3A 4MDJA 1HSBB 5LKNA 1TITA 3KVQA 5HY9B 4OJFH 4XNQA 2EE2A 1DQQB 2VDQH 4N1HB 4YHZH 4K7PX 5L88H 1P7KA 3HZMB 1LEKA 4N0CC 3J8F7 3ZHDA 1PKQA 5HHVL 4ZO9A 1JF6A 1BD2A 3UYOD 3GSNB 1DEDA 3RUGE 3W5MA 2XQBH 4HX1A 1LE5B 2CIIB 1CL7H 4WWID 3TO4D 1KLUB 4GMSH 3BOVA 4PJDE 3R4DA 5BV7B 3E6HA 4JGJA 2HJFB 4Z7WB 4ZFGH 4HUWB 1C16A 5EU4A 4AQ1B 4U1IB 1IQDB 3VXOB 2VDOL 3RWDA 3GBMH 2VXSH 2HKHH 3PQYA 1YEJH 2NXZD 4I4WB 4MSWB 5C0AE 1RZGA 3HAEA 2DBJA 1WFNA 5GHWH 4L4VD 4Y8AA 4FFWC 2KZ1B 2VZ1A 3B3IB 3TVMA 2F53D 4R7DA 1TZGL 1ZA3A 3RY4A 1EFXA 4KI5F 1MREL 4G3YH 1KIQB 3PQYB 4A6YL 4C83B 5IB3A 4C56D 4XZUA 1ZLWH 1VSCA 3D85A 1QFWI 4RBPK 1P53A 4PTTB 2OI9C 4OIIH 2NY3B 3SCMB 4YE4H 4BZ2L 4ZAKC 4CDGC 4HFUL 4G5ZH 2X2YA 2FX7L 4HBQA 3KXFA 4IMLA 4YE4L 1VESA 5DJ6A 5F6IB 4M48H 4P2OD 4BFIB 4EXPX 1WEJL 2D7TL 2XTJE 5FOJA 2NYYD 3WHXA 2HN7B 5KS9B 1WJ3A 3B9AA 5KG9B 4L9LC 4Z7WE 1B0WA 4JFDB 4OLUH 3RUGA 4XBEH 1OD9A 4CADB 4G43B 4O2EA 1KTLB 4OZ4A 5MEPB 3C8KA 4QY8A 2NXYB 1E28A 1N0XH 3ZDXE 4HWBA 3VXUA 3GJEB 1ZEAH 1V7ML 3QIWB 4PJ7F 1AIFB 1CICC 1JE6A 3KPSD 2VLLA 3IDNB 4RQQB 2CDEB 4OB5H 4DGIH 2OR8A 4LLWA 1NGPL 2F19H 3FZUD 5HHVH 5LWYH 3BZDA 4PJ9D 3ZT6A 2XPGA 3MOBH 1QO3A 3ZSSA 5GS0D 1K8IB 4EIGB 5I18H 1A6UH 4LPUA 4PBWD 5HHOA 1OP3H 3BUYA 4M7KH 4JFHD 5FAAA 1IGIH 2ZKHH 4EDXB 3B3IA 3TVMB 3QWOA 2OBGA 2BVEA 3RVVD 2ESVE 5IEHA 4LLVA 3BDXA 2D31A 2VERN 2EE6A 1Z0NA 2D9QB 3HC3L 4K9EC 5IG7B 4P3CL 3D85B 2C1OA 5IR1B 5C86A 1CBVL 2EZ0C 1ITCA 4H25B 1RHHB 2NY2B 5DMGD 3I6KA 4CVZA 5C70A 4N9GB 4APQB 4F3FB 1MJ8H 3GSNL 4KK6D 5D6CB 3OAYH 4EI5B 5B3NA 2FLBT 1VFUA 2ADIB 5F7DB 3PWPD 1RIUH 3SDDD 3NIGF 3MLUH 3DVGA 3JVGC 1NDMA 4O2EB 1UXWA 5E6ID 4JO2H 4NUGH 5E00B 3EOBB 2BC4B 5JPMB 4CMMB 3P3YA 5F9WC 3BI9X 3DTXA 3MLXH 2SEBB 5DRWA 1UA6L 4JZJA 4TYUA 1E27B 4GRWF 3IGAB 5HDOA 4PBVC 4TOYH 4M62L 3L3DA 5FYKL 5DVMA 1WWBX 4L29B 1HYSD 2B0SH 4LPCA 4M7ZB 4F2MA 5C0EB 4TTDD 5JPNB 4HS6A 3O2VL 2LE9A 1A47A 3CJJA 1UJ3B 5FA3B 4U6HB 4YR6A 3RKDD 3RTQB 5HVWA 1U8MB 4HUNB 4U0RB 5IVOA 1AY1H 1MCHA 3T0DA 5ELIA 4JO4L 4QHNB 1CTNA 4EZMA 4OAWB 2XA3A 1JF5A 1F00I 1AJ7H 2FEDC 3DLQR 3VFVB 1Q9WB 3QUYC 3U46A 3QUXC 1NC2B 4ZG1A 4RGNC 4M6MH 1G7LA 1UYWL 4TPRL 1BD2B 2OZ4L 3I3BA 3QI9C 4Y5YC 3NOIA 1PDKA 2BX5A 1U2CA 4Z7VE 3BT2H 3IXAA 2JKXA 1F02I 2VTFA 4H0HB 4WW1B 5I15L 5L2KD 1F3DJ 2EE9A 2B1AL 4HCRH 4M5ZH 4TNVF 4N8VA 2PYFA 2JCCA 1A7OL 3FMGH 3F7VB 2HTKC 5FYJE 5I30L 3HMXL 4PGBA 3TBWB 4KDTC 3OKOB 4GSDL 3NABL 3D9AH 3I50H 3MRFB 1IM9D 3HNSH 3QUZC 1MJUH 4JZNA 5E9DE 1SEQL 3HZKA 3QT2A 1G9ML 1U8HB 3QXWA 4NQEB 5MHSD 2QQKL 3U0TB 5BS0D 3RWGB 3S4SB 5IKCA 5I8OL 4D8PA 3PUCA 4GAJH 3O3DB 2E7LC 1RVFH 5EU3A 4PJIE 3LN4B 4UBDD 1KIQA 3TCLB 4KPHH 4LCYA 1KCLA 5FYJU 3GB7B 3WKNA 3VXMD 2E7BA 3B5HA 5JHDD 3QPXH 5HYEA 4POUB 4NN7C 3FRPG 3CPLB 4J3SA 4CVXB 1JWMB 3TVMC 4J3WA 4R2GD 2FDBP 2WINA 3NA4A 4X6CA 5FF6B 2ARJA 3U4BL 1IFHH 2VMFA 3VCLB 4I5BA 3FFCA 3BP5A 5BS0B 3CIQA 3OKDB 4EVNA 4LSSH 3MO1B 3OKKA 4Z77B 4Z6AT 1BEYH 2VR4A 4CL7A 1NUFA 5B39B 1MQKL 3RWIA 4XVUD 4YO0B 5FK9A 3VG0H 5HYQB 3F58H 1WIPA 1CE1L 2XN9E 2K7QA 4LPYA 1NCCH 1UA6H 1DQDL 1A7RL 1R3HB 5C0CE 5CSZB 3MRKB 5D5ME 4ZTOL 4FQJH 4RWYH 4YWGL 4N0FA 2VLMD 1A6AA 1AGBB 3RRQA 3IKCA 4K8RC 5DFWH 5GGQL 3P4MB 3U4BH 3OPZL 3U7YH 4NQTA 1I1AA 4ZMAT 2MJWA 5GZOC 1FIGL 1MQKH 2NY2D 3X3GH 1SMAA 1H3XA 4Z7OF 5KAQF 1V3KA 4UU9B 4QOKD 4Y4KD 1WQVT 3D3VE 3HRPA 4PJ7E 2HLFD 5FKPB 2DQUL 2VAAA 1EUUA 2OL3B 1P6AB 3WS6A 4QOKA 3T0EA 4WTZA 3UTPE 4JRYA 4HIJB 4HWZA 4GAFB 4MJ5B 2AKRA 3S3JA 1HE7A 3DGCR 4UDUA 4MDIB 5FA4A 4YHKH 1U3HB 5E94A 1CFTB 3K8KA 4KROC 3TBYB 4C4KT 4L1DA 3G5ZA 4XAKD 4BH7B 3SE4A 4MJ5A 1Z5LB 5BOZG 2MHAB 2ZZUT 3KXFD 5IVXE 2DDQH 4F15B 1HXMA 3DRTA 4KTYA 5KVDL 1PG7L 2BNQD 4P9HL 4WNQA 2Y36L 1HXYB 2AJVL 1FLTX 4JN2B 5E24E 3QDJD 5DRNB 4LSUH 1E4JA 4PJFF 1SJVA 2XACC 1WBYA 4JM2A 4NZTH 2VLJB 1UKQA 4JFYB 1CS6A 5C9KA 3C5JB 4WHYG 2ADJB 1KCUL 5D71L 2JJVA 1CFQB 4JN2A 1YY9D 2O93L 4PYGA 5FKAB 1LDPH 1U58B 2FO4A 3F5WA 4NN6B 1S5IH 1F4AA 3RZWA 3MRPA 4JHAL 3LRGA 4Y5VB 1N3NA 1U8NA 1SYSA 4P4KD 4YFEA 4JVUA 4P99A 1CXIA 2I9TA 1B88A 3GM0A 1DVFD 3K8LA 1WZKA 1DDHA 4LNRA 4NM8H 3T0EE 1JGEB 3BEWB 4MA7H 3TT3H 1RZ7L 5ADPL 3GO1L 3UDWC 1EPFA 4FXKA 3H6JA 2Q76A 2NY6D 4A6YA 1BFVH 3MMEB 3MRLB 1NSNH 1PLGL 4NOBA 1MVFA 4DGIL 4QRSA 2OP4H 2VISB 3RDTA 1XR8B 4Z0XA 2Q6WA 4CAGA 1IEAB 1F11B 2Y1VA 2A6IB 3HMWH 4MNQB 3SO3B 2UZXB 1LHZA 4XP9H 2EKSA 5FYKU 5TF1H 5DQDH 3GSVA 4UT9L 5FDYA 3UC0H 4U1IA 2OMNA 3S4SA 3ARWA 1FVDA 2VJXA 4B5EA 1NGYA 4M61B 3FQWA 3GBLA 5BQ7A 3LQAL 2DD8L 3ARFC 2HTKD 1LMKA 5ADPH 1MLCA 4MNHA 2MSPA 2VSCA 3ZKSD 5I73B 5I19H 1I1FB 2LTQB 3GJFH 3QEHB 1R5VB 3TCXA 3VE0B 5C0CD 2CKBB 4PGCA 2HJKA 1MAKA 2ZCLH 2X05A 3L1OH 4L4TE 1N6UA 4JR9L 1QYGH 3G9VA 4HIIB 3O8XB 4ELKB 2H8PB 4AENB 2BY2A 3HZVA 5EZLB 1EHNA 1XF4A 4G7YH 4G8GE 1E6OH 1T1WA 4OQ1A 3GMOA 4EVNB 4QRQB 1S9WA 3T0BA 4EIZC 2GTZB 3EYSH 4QRRE 2JELH 3VFRA 4YHZL 2GSGB 1DFBH 4U7KA 3WFHA 1L7IH 3WNOA 2EEAA 3EOAB 5GGSB 2FEDD 5KJRH 4EUPG 4PRPE 1OAZH 4G8IB 3WFZA 2VL4A 1JTTA 4UT7H 3ZDYF 1MCNA 1R3HA 1JIBA 1MI5E 3A67L 3IS0X 1FDLL 4OT1H 3IDYC 2VLLB 2VLJE 5EIIA 2GY5A 1QPPA 4RAVB 1ZT7B 1HSAA 2FJHB 4S2SB 3IKCB 5HXMA 1BVKA 1NEUA 1F3DH 1JWSB 2Z91B 4X5XB 1QO3B 2VDML 4P0DA 5TDNA 1JPTL 1KPUB 1JHLL 2JELL 1CGSL 5D1QB 4PJHF 4HJGA 4HWUA 1YN7B 3S37X 3HI1A 3NACL 2FHFA 1OP9A 5H2BB 4ETQB 5F72S 3S9DB 2VZVA 4U2YA 1J87A 4KDVA 2BJML 3SCMA 4ZPTB 1HQRA 1ZS8A 5ACMA 5E5UB 3CVHH 3S34L 1RUML 1XGTB 4X7SH 5GS1B 5DJ6B 2A73B 4XP4L 4HJGB 3HR6A 2XZQL 3E8UH 4LKCB 3VH8B 1CL7I 4GXVL 4Y1AE 2HT4C 1U3YA 1MREH 4JPVH 2IF7A 4WFFD 1I7ZA 3RUGB 5I9QC 2DM4A 5HJ3A 5E2UH 4OB5L 4NNXA 2B1HL 2WV3A 1JYVA 2C26A 3HS0B 3MOAH 4O9HL 2GJ6A 8CGTA 1CGSH 2NY2C 1GGUA 4NO2A 4OFDA 5CUSL 3P9LA 4BQCA 2BVUA 3GKWL 3Q6FA 2O61A 3WS6C 1LDPL 1INQB 1KG0B 3EYQC 1JNNL 4AIXA 4PRIE 4M7JL 3TJHC 4JKPL 2AEPL 1LD9A 3PV7A 2DM2A 1L9NA 5CKGA 2FGWL 2O61B 4N5ED 2BHYA 1DP0A 3BJLA 1CYGA 3SGDH 3UX9B 3QDGB 1EVTC 3BMVA 1EBPA 2X4NA 4XAWL 1AD0B 3V2AR 1PY9A 5E2UL 3CNKA 4D9LL 4NC1C 4HPOH 4RMSA 2QLVB 4NO0A 3L9RB 4LEOA 4Y16D 3OJDB 2P49B 3ULUL 1S9XA 3F6IA 1HK6A 1RIHH 4M5YH 2IJ0C 1ZGLA 5DZLA 1BF2A 3DUHA 2BRRL 4U1GC 1RSFA 4BFBD 1JGEA 3BEWA 4LARH 3BRGC 3DURA 3Q2CA 3C2SA 4H20H 4MA8L 3ROOB 1ZHBA 5DDHB 1XGPB 4RISL 4PJCB 2R0LL 5GRXG 5EZIL 5B21A 5E95B 1H3VA 3SE4C 5DT1L 5IG7A 1OAKH 2Y5TA 5FGRA 3T65A 4JFXA 4MSWA 2H2PD 4Y19B 1UT9A 1ZHNB 4CNIB 1MCCA 1YEKL 2P45B 4LL9A 1I8LC 3SDDA 5C08B 3QUKA 1NKOA 3MZGB 2CKNA 1EERB 1HI6B 5EBWA 1N4XH 1L6XA 3IXTA 4E0RA 5EFIA 9CGTA 3OV6A 2R4SL 4MNGA 5J57B 5F44A 2ADIA 1AQKL 1TDQA 4RDQF 4HKZB 8FABA 3VFPA 3VJ6B 5D9SA 4KJWC 2VDRL 3QEHA 3ULUD 4IIQB 4M6ML 2VUYA 4GG6A 1GVIA 1WEJH 5I8CA 3SJVD 1NUDA 4O51A 1FNSL 1LP9E 1CG9B 3HNVL 3ARFA 2EXYC 4GBXA 4LCWD 2AXGA 4HKXA 5CWSB 4DN3L 1X4YA 1ZT1B 3MROA 5F8QC 5EN2B 4Z7VB 4GW4A 4JQXC 3P2TA 3I6GB 4CADA 4HUVB 1NCWL 4OZFA 1DUYA 4L8DA 4XPTH 4Q9RH 5KVEL 4JKKA 1C12B 1X44A 3GMOB 3O3AB 3FB6A 4Y4FB 1SJEB 1WV7T 2WLZA 1KSRA 2VDNL 3FCTB 1NLDH 3VFRB 3CDCA 3FO2B 1FNEA 1CLOL 5GGSA 5T3XL 1XGPA 3RPIA 3V5HB 2I5YH 5I8KH 2A83B 2ZUWA 1QBML 1PGRB 4Z8FH 4NQDE 1NMBL 4BSVB 3OAZH 4OFVA 3OX8A 1UWGH 4I77L 4GH7B 4HF5L 2BNRA 3LAFA 3NIDF 4D9RD 2J8UF 1MJUL 3SKOA 2XRAL 3PWVB 5DO2C 3QDME 2B5IB 1GZQA 4W4OA 5C0CA 1H8OA 4HIXL 4JQVC 5E8PA 2GUOA 4I0KA 4TVPD 3TV3L 3D87B 2X9WA 1DN0B 4NC1E 3U36B 1T1ZB 5E99L 2ZUUA 2W0LA 3BKJH 4FOMA 1M1SA 1J1OH 4NUJA 1IAMA 1P2CA 1ZT4B 4HCRA 2QQNH 4KQ4H 2H32H 3S96B 2KBGA 3FFCB 4LSTL 1G9NH 4XWGH 2CUMA 4DVRH 1UZ6E 2QQNL 1MIEL 3WIFA 3MCG1 5HJ3B 1H0DB 4P23A 5CINL 3QO0B 4HIJA 1ZTXH 5GGTA 4Q9QH 2H32A 3O9WD 3WLWD 2VABB 4NKIH 1Z3GL 5D96C 4RBPH 4LCWB 1XH3B 1KTDB 4GW5A 3HUJF 4KQ3H 3QQ4B 3I2CH 3MLRL 3ARGD 4Q6YA 5DJAB 1QFPA 4JVPA 1LO3H 4QXTB 3KS0H 4HPYL 5TQ2L 3DECA 3CFEA 2EDLA 2Z35B 4R0LC 1PFCA 1G7QB 4GRWH 3D0LB 4XB7A 5EU7C 5DVKA 3NIFF 5IMOB 3H9SB 4K3EH 5SWZA 1L6ZA 3U48A 4IRZL 2CKBH 4F33B 2FIRT 2X42A 4G8EB 3ZHLA 1QBBA 1EAPB 4PJGB 4TVPL 4Y1AA 1G7QA 2ENSA 5HI4C 3VXRA 4Z7VF 4F37K 2HKFL 3OKNB 4OFIA 4N9OB 1CXEA 1PVHA 5I9QB 3G6JB 1C7SA 2R2EB 1BJ1J 1YC7A 5JW3H 2P7TB 5E4IA 1LE9B 3C5ZA 4WI4A 1A7QL 3IDMB 4DGVH 5ISZB 1YEFL 5GIRA 2C3WA 1MWAA 3R06B 2AJXL 4QF1A 4HPYH 3S36H 2I9TB 1YDPB 4F7PA 1OWWA 3N85H 2VLRE 2OXHA 1LVEA 2AKRB 1AI1H 4P2OB 3UTTA 5BZDB 4GKOA 3HAEH 2BNUB 5GXBB 3S96A 5HHMD 3QO1B 3MRFA 4UNTA 4XPFL 2EIZA 4BJLA 4NJAL 2YD2A 5DTFB 5E08H 1I7TB 5ALBH 1EX0A 1OGTB 3BWAB 4DTGL 3NZ8A 3IJSB 4XC3H 3OJMB 2ZPKL 3V9FA 1ZA6B 3DIFA 4HUKB 5LGKA 1IRAY 5TQ0L 2UZIH 3K4AA 1XR8A 2QADC 1HINL 2VKWA 2VAAB 4OLYL 3HZYA 4KUZL 3GNML 1RULH 4RNRB 3TH4T 1G84A 1WBYB 2HFTA 4XPHH 4ODVL 3JWOL 3V4VL 4WTXA 5D1XD 2ZJSL 1NJ9B 1TIUA 1BVLB 32C2A 1AFVH 2DQHH 2P44B 1CI5A 43C9B 2JE8A 3T0XA 1G7HB 3UAJD 4P9HH 4X7FC 4OD1H 4QTIL 2H2PC 3CVHB 4IDJH 2CR6A 2R2BB 4HS6B 2XI9A 2O5XL 4QRUB 1LO2H 4LCCC 5E5MB 1OWRM 2B5IC 4PRNA 4MA1B 2ZOLA 3L3GA 5GRJL 4U6HA 4YR6B 3RTQA 3ZT7A 3RTQD 5KSBF 3BVNA 4L8DB 5CUSH 2R39A 4KJWD 5ITBL 1HHIB 2W65B 3L6FA 1NAKH 4Z5RB 1D3CA 1UB6A 1S9KC 1RURL 4YDKH 1EO8L 5HYQA 5K9QI 3WJJA 2C5DC 5DJ0B 5INCA 3PDGA 5KSBA 2EIZB 1BQHB 2I07A 1NGXB 3H42L 3HRZA 4PB9H 1RZFL 1EH9A 3NMEA 4UT6H 5IMLB 1G7IA 3ULVD 3K1KC 1FBIH 4KXZI 4N0FB 2CQVA 3W5NA 2XXCB 2PKDA 4M9OA 4JZNB 5DMKB 1RPQA 3KPOA 3GIVB 4GKSA 3BDYL 4X7DC 3UTQA 2DQCH 2IPTH 3HKFA 1CU4L 1DQDH 1OOAA 1I8KB 3TA3C 3LH2H 5JIPA 4PJGF 5J12B 1RAMA 4NFDA 2NY0C 3PJSA 5HYJB 3ZZ1A 3GMNB 2W0FB 1LO3L 1F4HA 4KKCD 3ULSB 3F8UB 2EH7L 2IQAA 2HT3C 2AEQH 4YHOH 3T3MF 1AR1C 3TN0A 2EKJA 4X4XB 4OF3A 2D4FA 5B38G 2WINB 2ITDB 4L3CB 2AI0H 1CD1A 4U1KB 4X7SL 3WNLA 3PHSA 1JPFB 3ARYA 3QQ3B 4HUUA 5EU6A 1G6VK 4O2CB 4Z78A 1DLHA 4K3HA 5IW6A 2YSSA 3B6SA 2XTJC 3MA9H 4PD4K 4OT1L 3QQ4A 1NFDF 3N0PB 1MAJA 3MTRA 5HGDA 2WANA 4Z95H 1GGTA 4MYWB 3TBTB 5C0IB 1JHLH 2YPKA 2Z8RA 5I76B 3HB3C 1Q1JL 5F9JA 1LNUB 5HYJD 2JJUA 3V6ZA 4QRRB 2QQLH 3ILPB 5AD0B 3MRBB 1OF2A 4ZNEE 4MHHI 5IIEA 1CDJA 3TF7C 1OAUH 3K74B 4R26L 4J12A 2OS7A 5IF0B 1BWMA 5B3JE 3MLSH 2IANE 4YBLC 3P4NB 4ZUVB 5JHDB 1K6QL 3T4YA 2G75B 3CX2A 4U1MB 1AGDB 5SWSB 4BH8A 1ZEAL 4MD4A 1W72H 2IADB 1P9MA 5TFSH 5EIQA 1FZJA 3IJYB 3WHE1 1ZLVK 1MFDL 3ZHKA 3CFDA 1T2XA 3QWOB 4X6EB 3KPLB 1BREA 3D48R 4YHIB 2OQJA 1RZGB 4ZD3H 2DQFA 3S6CA 1A1NB 1NCDH 4P3DB 2J88H 4RIRA 3STBA 4ETQA 1DE4A 3O6LL 4H25A 4L3CA 4UQ2A 4ZFOA 3MBEB 5D5MB 4M61A 5GGRY 1NDGA 3DBXA 2NQCA 1KT2B 1WWCA 4WO4A 3O6FB 2XG4A 4L8CA