2AK1L

Crystal structure of cocaine catalytic antibody 7a1 fab' in complex with benzoic acid
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
DIVITQDELSNPVTSGESVSISCRSSRSLLYKDGRTYLNWFLQRPGQSPQLLIYLMSTRASGVSDRFSGSGSGTDFTLEISRVKAEDVGVYYCQQFVEYPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody 7A1 Fab'
publication title Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
pubmed doi rcsb
total genus 46
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2005-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ak1L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ak1L01
4NP4L 2HT4D 2EYTA 1OM3H 2Z8RA 1GGIL 3VA2C 5KANI 3K2UL 1IKFL 3OGCA 3WV0A 1CLCA 3QI9B 1FE8H 1OGAA 2B1AH 3V7AE 4YHYB 4MNQE 3LSOA 3HC4H 1MHCA 4ZOEA 4MQ7A 2E7LA 3B5HA 5INCB 2R56H 4R4BA 4DTGL 4I3RH 1LGVA 1P4IH 3DJ9A 5C08E 3BP4A 2MMXA 4YHZH 5C09B 1EHXA 4ISVB 3F7PC 3OR6A 1YN7B 1SBSL 3MNVA 1FN4B 5L2JA 3AVEA 4WFED 2EEBA 4K23L 1AGEB 5J0BA 5I1LB 3H3BC 1CLZL 4X4XA 2Z9TA 1BZ9B 3ULSB 5TGBB 3UPRA 1W8OA 4FQXA 4NOBA 2E9IA 3C6LD 1UKSA 2ZPKH 3BGMB 2MCG1 5I1EL 2OQJA 3G6DL 4ZDHA 4JCMA 4N8PA 4ZS6C 3ZYIA 2ZG3A 4XVJL 3IJYA 1WIPA 3QFJD 3RVTD 1KCKA 1JZ3A 3QUYC 3P4MB 4PG2A 3V6FA 3DX6A 4ODVL 1G6RB 4U1JA 3WIIH 1WZKA 4NN6B 3MR9A 3ULUE 4PJGB 1K4DB 1A1OA 2RIKA 4WJ5A 5ACLA 4P4KD 4DW2L 5T1KB 1KACB 3W9EB 3VXRD 1RSFA 5JXAH 4IIQB 4P2QE 3W81A 3L3KA 4ODUB 3P73B 2D4DA 3PWPB 3OB0H 3T2QA 1EZVX 4ERSL 5DT1L 2IAMC 3HTLX 5EOTA 5HBBA 3SGJC 1ETZA 3SGDI 4M3JA 1AO7A 1FV1B 3NIFF 4LPTA 2VDPL 2XTLA 4GW5B 2BVOB 3C5JB 4NFBA 1QA9A 5KVDH 4X9GA 2C5DC 1KB5H 1ZT7B 3T65A 3L3HA 4MVBD 4FFVC 1KTKE 1IC4H 4JFEE 1AC6A 3MOBL 5I0ZA 1S7SB 4H1LA 1M1SA 3LB6D 4ALAH 3DX8B 3W0WD 1AY1H 2C1PA 3F7VA 4BELD 3RL2B 3LH2L 3RWIB 4X5XB 2A83B 3EYSH 3V5DA 1YEEH 3PQYB 4XWGL 1QSEA 2X4SA 5GS1B 1YNKL 2FCBA 3REVB 4XPFH 5HPOA 5B8CA 5CZXD 4MHHI 4M61B 4Y2DC 4Y4KA 2XN9D 3OB8A 4L29B 5IWLA 1A14L 3UTTE 3QDJE 4L9LA 3KDMB 4OD2B 4PV8A 3ZE2E 3O41B 3D48R 3TVMA 3PP4H 5IW1A 2HN7A 3IDYC 1HCFX 2ZUWA 5DMKA 1BGXL 1D9KB 4R8WH 1Z9LA 4KFZC 3MLSL 4Y5XA 2W0FA 1ZEAL 2OZ4A 5BS0A 5IIEA 1F6LL 3TBVB 3UAJD 1U8MB 3O4LA 3Q5YA 3B9AA 2FJHB 1BF8A 1CDBA 4OM0L 5HHMD 1NCAL 4ZAKC 4J3OC 3P0YL 3D25A 2BSSA 2KZ1B 1DEEB 3DWTA 4X4ME 2FHFA 3HE6C 5D1QD 5DMIH 1A64A 4OCSL 2EE3A 3D3VE 4UT6L 1V05A 4MYWB 4KQ3L 5DTFA 5T1MB 5JW3L 5TH2A 1NC4B 1Q9LA 2XYCA 4FQJL 1D5MA 4M4PA 1MFCH 1EUUA 4RGNE 2NW2A 2G75A 1I8KA 3PDDA 5TQ0H 4BK4A 5ADPH 2NZIA 3A6CL 1P84J 5C0FA 2NY4D 3VFOA 5BMFH 1BFSA 1KCUL 2DQCH 3B2UD 3H9YA 3L3IB 4OM1L 5F6IB 1BQHB 4YBLB 4AMKH 4JFFD 1MWAA 4ZUVB 1A6UL 2NY6B 5KSBE 4UTBH 4MD4A 1LP9E 4HKBA 3RIAF 4QHMA 1N4XL 1H3PH 4O4YL 5DRWA 1NCCL 3MNWA 3HRZA 4QRTB 1JYWA 2O61A 1KCLA 3KPLA 1CWVA 5FA3A 4Z76A 4K2UL 3RPKA 5TDOA 4QHLA 4OZ4B 2X4TB 3FOMB 2VLRB 3FHQA 3BAEL 2X7LB 4LLQA 1A1NA 5D1ZD 2LV4A 2N56A 4G8FB 4KROB 5T3ZE 5F7UA 5IB1B 4FQCH 3U0TB 3B2VL 3U36B 3WEXB 3B8YA 3KPMB 5EU6E 3BPCA 4GW1A 1MF2L 4WNQA 2UVEA 5CD5D 1I1AA 2Y6SC 2YWYA 1NANH 4LQFH 1CTOA 3KPOB 1T0NB 4H25A 4LLWB 2IBGA 4AM0A 4MA8L 4Z7UB 1K2DB 5E8EA 5DD5L 2R39A 4LHUA 5GJTH 3VXSD 2X4QB 1OTTC 4S1SL 3SPVA 3T0EB 3U9UB 3BE1L 1PG7X 2JJSC 1YYLL 3RIFK 3FRUB 3MJGX 3HPLA 3BPNB 1FL5B 1JUFA 4LRIC 1EFXB 4YFDB 1BFVL 1H5BA 3OR7B 4I8DA 4KGLA 4HULB 1R3JA 1I1YA 2CIKB 2XPGB 4Y19E 4QRUA 4CVZB 4N0UA 3ROLB 5IVXA 5E00A 2DWDA 1HNGA 1EEZB 1ZSDB 3C8KA 1DJSA 1WZ1H 4LCCC 3EO1A 1WAAA 3M45A 2H2PD 4DGVH 1FORL 3PHOB 3UDWA 3SCMC 1HEZA 4NUGH 3H42H 1OCWL 3ILPB 4ZUUA 3RAJH 4NNXA 5F1NB 3F8UB 3RNKA 1IC1A 5IB3A 3T0XA 3R0NA 1G9NC 1IGTB 1JFQH 5L8LB 3KYMA 3C6LA 3RY5A 5KVGL 4QT5B 3ZKNC 4HK3J 1I9RH 2ED9A 4K3JL 1G0XA 2WV3A 5HHVH 3E6HA 4MNQD 3QFJA 3KS0J 1MWAL 1RZKH 2EIDA 2D0FA 3VFUA 2VZSA 1K3IA 5DYOB 1C16A 4XHJD 4HMDA 2GAZA 2NXZB 4MXQC 3QRGH 5BVPL 3VW3L 4HIXL 3GJFA 1ZMYA 1C7TA 4PRIE 3OKMA 4P4KA 3C5ZD 3KPRE 3TM6A 2VLKB 3VXRA 4YH6A 2P7TB 32C2B 3LKQA 3QXAB 1FBIH 2I9LB 4RFOH 5EOCH 1LHZA 2AW2A 2YK1L 4WHYH 1NAKL 4OI7A 5E8OB 5HDLA 1R3IL 3PGFL 4QCIA 3VDCA 2X6MA 2B39A 4EI6B 3IDNA 5C0GB 5DUMH 5I75C 2OL3H 1QFUL 4C83B 4EN3B 3OAYK 3P4LA 3VE0A 3SGDH 2AS5M 4JY5L 2Q87A 3ULUD 5D7JB 2K7PA 1YEIH 5KS9F 2XZQH 4M6OL 4MJ2A 4X7EC 4HAGA 4QKXB 4P2QD 4Z0XA 1KTRL 1IQWH 3HUJF 4YXKL 4NP4H 2HMIC 1I3GL 1GGIH 1IZKA 3K2UH 1IKFH 3W0WA 1XCTB 4HS3A 2UWEE 1QBLL 4DTGH 2HFFB 4XNYL 3FFCB 2JTDA 5AAMA 2P5WB 5C3LD 4EVNB 1A4JB 3OKOA 4QRQB 2XN9A 4XPBL 4YWGL 4UUJA 1DQML 1GZQB 1SBSH 3G04A 3PJSA 1U8IB 4I2XB 2W60B 4K23H 3FT3B 4OKVA 1QVOA 4NQUA 3NCFB 5FDYA 1CLZH 3DSFL 3TNNA 1OQOA 4JFED 3QQ4B 3ARXA 4OIIL 3MLUL 5CJOL 4ZOBA 2ZJSH 2X05A 5I1EH 1IL1B 3G6DH 4QXGL 2HVKA 4FTVB 4OLUL 4KRMB 4PJEF 5IEKA 4XVJH 5KVMC 3ECBA 3AREB 3X14B 5FO8B 5L0QC 1GZPB 3P2TA 4MXVE 1XIWC 4ODVH 4ODXA 1G9ML 1FL3B 5F1OB 5IR1A 4S1DC 4Y5YC 4JKLA 3FOLA 3NCEB 5DHVB 4HMCA 5D1XB 4DW2H 5B3JF 5D1QA 4LQ1A 5KG9A 4O00A 5GGRA 2L7JA 5KSAD 1XGUA 3B3IA 3P30L 2XT1B 3H0TB 2VXUH 3PXJA 3BP7A 4ERSH 5DT1H 3TA3D 5FV2A 1EHLL 1RHHA 2OK0L 1HHKB 2ORBL 2VDPH 4P23B 1T0MA 1IGJB 4NT6A 1X5JA 4DFHA 3MCLL 5DRZB 5CEZH 4NWTL 5IJKA 1U36A 3QH3A 4NO2A 5E4IA 3PWNB 4X6CE 3NN8B 1IAOB 3D3VD 5DD6A 3MOBH 4GRMA 4PGEB 4JFFA 1HHHB 3VFVA 1C5DB 2V7HB 3T0AA 3HR5A 3LH2H 5A40E 3DV4A 4I0KA 2EXYD 2L7UA 4OQ1A 4RGND 1G84A 4JANB 4XWGH 4WFFD 4RGOL 1YNKH 4PRNA 3WNLA 4LLUA 1DN2A 1A14H 2AJYL 4M6ML 5D1ZA 4JLRB 4Z7VE 2EDNA 3FONA 1U8OB 4YHPB 3VXPB 2X1WL 3M1BA 5TF1L 3KR3L 3ZSSA 1BGXH 5BQ7A 4XVTL 5AZEL 1BHGA 3MLSH 5I73B 3P77B 1ZEAH 2HKFL 3MA7B 5DK3A 1AR1D 1KIQB 1PVHA 4OM0H 1NCAH 3QO0A 3CDGB 3P0YH 4H26B 5SWSD 4IDLA 2H2SD 3VXSA 3PL6D 3EOBB 1X5ZA 5T1LB 5MEOB 2JCCB 2GK0A 4KKBC 3BH8B 2VDLL 2OTPA 4PJ9B 4OCSH 4FQHA 2R9HD 3HB3C 4UT6H 4L8SC 4KK9C 4XTRD 4KQ3H 4MNGB 4DAGL 1NGYA 5EU6D 5JW3H 3PIQB 3LKSB 4NRZA 4FQJH 3MRHA 5BJTB 4LEOB 4XH2B 2IG2L 3F12B 1NGXA 4MAYC 5FOBA 3ULVF 1CXLA 3VG0L 1G7MB 3A6CH 4WUUE 3MRBA 3MXVL 2ICWJ 5HVFB 1Z3GL 3MFFB 2ZOKB 4LAJH 5ACMA 4ZNCD 1B0GB 3TBYB 1KCUH 2VNCA 5FCUL 4I18A 1OAXL 3BGFC 4OM1H 3V0AC 2EKSB 3ZT5A 1CGXA 3ZKQD 2QHLA 4J1UA 5ITFB 2UV3A 2OS7A 5D2LF 3MRIB 5INDA 2PETA 1R3LB 1A6UH 1T6WA 3KYNB 4EXKA 5J57B 5DLML 3B9VA 2ZSWA 1N4XH 4MNHB 4O4YH 3BI9X 3MACL 2VRAA 4HS6B 4PFEA 1INEL 1NCCH 2CGRL 3O81A 5CJQL 2AV7B 1TFHA 1KN4L 4GLRI 4H1LH 4MNQA 4K2UH 1JF1B 2ARJQ 3GBNL 3BAEH 5EPMB 3MPCA 4AZ8A 3RL1B 4G6FB 3B2VH 5L9DL 3C5ZA 1MF2H 3CZFB 1I1FA 5GS2H 5CGYC 5A3IC 1VCAA 3VFTA 5GJSL 2A73B 2VUOA 3L3OB 4BQ8A 4XC3L 5KSVA 4DGYL 1DUYA 4MJ6B 2OTUA 3AS2A 5HDOA 4BSVA 2C3WA 3JTTB 4KK8C 4MA8H 5DD5H 1YEFL 1YEKL 3HI5L 4L3EB 5EORL 4S1SH 1A4KB 3QXDB 3BE1H 1YYLH 1ZTXL 5HYIA 1WCQA 3LMJL 2CKBB 1UWXH 1XCQA 3QIWB 4PRID 1BFVH 5I8OL 3KPRD 1LQSR 5ICXA 2FDBP 3FHAA 4P2QA 2AXHA 2YUZA 4JN2A 3S5LA 1JGDA 5KANG 1DQTA 2Q76B 4EJ1C 4MA3B 4U0QB 3WLBA 1JYNA 1AP2B 2QADD 1MHHB 2AEWA 3EGSB 1RUQL 1EERB 1RUKL 1JVKA 3BRFA 5F9OL 1CGYA 3B8SA 5D6DA 4G80B 5GGVY 1FORH 4M8VA 4OAWB 4DK6A 4HUXA 2HJKA 5D6CA 3FO1A 5MERB 2O5YL 4C56E 1RJZA 2WBJC 1OCWH 3C8HA 4DZ8A 3MRGB 4Z5RA 4Y1AB 2V2WA 4JFEA 1KLGB 3QDMB 4ETQA 2HTLD 5KVGH 2I9TB 3D85D 3GSOB 3DURA 2RB8A 3QXTA 4K3JH 2RFXB 4X83A 3S88L 4TNWF 2EYRB 2VITB 4PJHB 1DQJB 1MWAH 5DK0A 1ZT4B 2VDQL 1ZVYA 5EU5B 3ILQD 1ZWIB 5BVPH 3VW3H 4F57L 1IMHC 4HIXH 1HCVA 5D7IE 4JHWL 1NLDL 2Y06L 3O8XD 2HTKD 4PGJA 3MRLA 3BOVA 4OF5A 1YC7A 2F58L 5KSAA 4WHYG 4PGDB 4XP9L 3VXME 4XZUB 1EJOL 5F89A 5M95B 1D5XA 1UENA 1DLHB 1JN6B 5DJDA 2YK1H 3SDDB 4PREA 3IS0X 3C9NB 3CCHA 3JWDC 4K7PL 4YBQD 1NAKH 3TA3A 1R3IH 3PGFH 4U7MA 3VI4E 2P1YA 1OAKL 1RZJC 2HLAB 2Q20A 3FCTB 1H3VA 2CIIB 4GUPA 4TSAL 4UBDD 1QFUH 4M62L 4MD5A 1OB1B 4DKEL 1D5ZB 1UB6A 1A7PL 1G7HB 4JY5H 2IQAA 2OSLA 4D2NA 3HZVA 3S3PA 1LEIA 1YDPA 4I0PD 4X4MA 5E2JA 4M6OH 5FGBA 1J8HE 3D3VA 4NQSA 4YXKH 3IXTA 4X6DB 3STLB 2F54D 4NO5A 1I3GH 2AEQL 1CICB 4CRPA 4PP2B 3LVEA 4HJJL 1SQ2N 3ULUL 3RVWC 5FKPA 4IOFD 1QBLH 4DOHB 3BZEA 5C0IA 4XNYH 3KVQA 5EU3A 1M4KA 4LKCB 1UXSA 2X4PA 1WJ3A 5CP3A 2GJ6E 4XPBH 4YWGH 4NGHL 5ANMB 1DQMH 1R5VB 1AXSB 1NDGA 2IH3A 3U7WH 5CSBA 3DSFH 3QO1A 1BJMA 3KLHD 3FFDA 2Y7QB 1T2XA 3HMXA 3MLUH 4OIIH 5CJOH 4ZUSB 3LEXB 3H9ZA 4UQ3A 4F8TA 5D96B 4QXGH 1UT9A 3L7EB 4OLUH 1K9TA 1T5WB 1LP9A 1DQLL 5E8NB 2DLIA 4S1RL 4BH7B 5GSRA 2Z35A 3OWEA 4KRPD 1X7QA 1G9MH 5J56B 2FIRT 1INQB 1RUML 5SWSA 5I2IB 4K8RD 1WSST 4UAOB 1L7TL 1XGYL 3PL6A 1KT2A 4KJWC 1FFQA 5MI0B 4X0KB 4KTEL 5AUMB 1C12B 1HNFA 3P30H 1U41A 3GUTB 1G7QB 5TE6L 4OF8A 1ONQA 4N8VB 5EU6A 2R1WB 3KNBA 2Q86B 3GJFH 1NBVL 3RX8A 1EHLH 1L0YA 4Z7NF 1S7UA 4OUOA 3H9SE 2OK0H 3GNML 2ORBH 3WFDL 2CSPA 1BJ1H 3UTZA 2F8VA 1EO8L 2P44B 4GBXB 2YA0A 3MCLH 2WIMA 4NWTH 5CJXC 1O7SA 5CIPA 1EK3A 1T7ZA 3O2WL 1CFNB 2NXYC 2Z91B 3V8OA 2LE9A 3BP5B 1MRDL 1AXTL 3G6JB 2GTZB 5AD0B 2LTQC 1XEDA 4R9HA 3OKLB 1JL8A 4OFDA 5IOPA 1KPVB 4XCFL 4NQVB 2Q3AA 5LQBL 3MRMA 2EIEA 4Z78A 4RGOH 4OZGE 2MQ0A 1YNTA 3NA4A 4HIEB 4M03A 4S2SA 3WJLA 1NCBL 3QJFA 5LAXA 2QQQA 2AJYH 4G6AD 4GLRH 4M6MH 4CMMA 3BQUB 3T1WA 5H94A 3FT4A 3TYFA 5TF1H 3KR3H 2PCPA 1S9XB 5EUKB 3VFRA 4GKOA 4XVTH 5AZEH 1T1WB 1CTNA 1AGFA 4H0GA 3RUGE 3PWJA 2HKFH 5IB4A 2FL5B 4Q7DA 2CH8A 1IGYB 3ARFC 5JPNB 1KENL 1FFNA 4KKCD 4OJFL 3JVGA 1AHWB 3RZCC 3ARDB 3AMKA 4Y8DC 4JY4A 4HUVA 5EN2B 1XF5A 2NCMA 3A0OA 3B4NA 2VDLH 2EO9A 3KAAA 3Q3GA 4J8RA 2ED8A 3RX7A 5J1AB 3HPJB 2P5EB 4APQC 1IKNC 4DAGH 4PRIA 3KPRA 4FFWC 3D0LA 2EE6A 4UIMA 3MBEB 5I1IL 4OGYL 4PJXB 4YHLL 3DXAE 1ED3A 2IG2H 1VKXA 3UTSB 3AC0A 3RWFA 2Y6SD 3VG0H 3LQZB 3MXVH 1Z3GH 2A6DB 2BRQA 5T3ZL 4DJMA 4Z7UF 3MLRL 1CLOL 5FCUH 1B90A 1OAXH 1M6OA 3S35X 5DK2B 1NBYB 1T1YB 1J05A 5FM5O 1GPOL 5DFTA 4MCYA 5DMGD 4KDVA 4K9EC 5LBSL 5DLMH 3FO0L 4D8PA 4CADA 4YBHA 5JTWA 3TZVC 5MENB 4LFHG 4RAVB 2OXHA 5BV7L 2OCFD 1DR9A 4H1LG 4XXCA 4B53A 2VZ3A 3MACH 1INEH 2CGRH 3D85A 5CJQH 1A9EA 5HI4D 4FP8L 1KN4H 4NHUB 1NPUA 4GKSB 4I4WB 4QHUA 3RWJB 1N5YL 2UWEA 3TH4T 4F15B 3GBNH 5ID0B 4OF7A 4HIIA 2Y23A 1QSFB 2D7MA 1QHPA 4U1NA 4C56D 4NO0B 3O8XA 5ADOL 3AXLB 5L9DH 2NYYD 3TJEL 4IRJB 1S7VA 1A6WL 4CBPA 5F3BA 5GJSH 3MRDA 1FVEB 4LEXL 4XC3H 5D2NA 4DGYH 3SO5A 1LO4L 4AENB 1BIIB 4HPYL 4CMHC 4U1MB 1MCBA 1UEYA 1WQVT 4WFHE 1Q94A 1YEFH 1YEKH 3VWKC 1JZ2A 3HI5H 4ZPVB 5EORH 2HT2D 2ITDA 1EPFA 2BHZA 4R3SB 2VL4A 4YE4L 1DVFB 1H3XA 1ZTXH 1B2WL 2V2TA 1LEGA 3LMJH 2FWOB 3BISA 3O3BB 5I8OH 4I0PA 1WBZB 4R97C 3I2CL 1EEYA 1M7IB 5FGSA 3WL9B 1A6AB 3GMMB 2PTTA 4ZOCA 2PXYC 3U79A 2F54A 3MFGB 4F3FB 3OKDA 3T8XA 1ZGLB 2EDQA 3VFSB 1MCPL 1UH2A 3IYLW 3FB5B 2EDJA 4OLZL 4QXUL 4BZ2L 2DQHL 1RUQH 1NGZA 2BP3A 1RUKH 3O11A 2DLGA 4CDHA 3U9PL 1DEDA 1CT8A 3B9KC 1CFTA 1JWMB 3PWLA 4WHTA 2O5YH 1KIRA 1VFUA 4G6JL 1R5IB 2R23B 3V4VL 2AGJL 2NTFA 4G8GB 1J8HD 2YD5A 1MELA 4GKNA 4NQCE 4H5SB 2VKWA 1JZ4A 3S88H 1WBXB 5F9WB 4JAMA 1BD2B 1XGTA 2ZUYA 4PY7B 1BIHA 2YRZA 3E2HC 3TC9A 4GO6B 1OGTB 1A5FL 3IVKA 3O3AA 4J3XA 2FECI 4HXAL 4JHWH 1NLDH 1KYOJ 4YDIL 2GJ6D 4ZXBD 2Y06H 2C4FU 1KUMA 4LSTL 3IDIA 1DANU 4P2OB 4OSUL 2F58H 2DKSA 4RFEA 2SEBB 4XGZA 1J88A 4XP9H 1EJOH 3L5IA 3BESR 5D4QA 1JNLL 2NY5L 4HWNA 1Q9WB 4K7PH 4LLAA 4EQ2A 5CD3A 1YYML 4UQ2A 1INDL 5E0QA 2DYPD 3LV3B 1OAKH 3I02A 5JLZA 3MOAL 4OZHB 5KW9L 4TSAH 4M62H 2N4IA 4DKEH 3IFOA 4U0RC 1A7PH 3DYPA 3IU4L 1MCWM 5E94B 1QBBA 4LHUG 3HLAA 5FOJA 5JORB 5JDSA 4K3DL 1J12A 5GGSB 3MZGB 4U1HA 4PRHB 3M17A 1U95A 5FGRA 3D18B 2ESVE 1KPUB 4P3DA 1G7JB 4YGVB 2AEQH 4G9FE 3LQMA 4DKDC 3UMTA 4XRCB 4PJIF 4JREC 3RTQB 4HJJH 3TF7C 3ULUH 3CVHA 1JGEB 2OM5A 2VQUA 4Z77A 3STBA 2VZUA 4CDGC 1QYGL 2WWMC 3O3DA 5T5FL 2FO4A 5L7XL 1JNHA 1XZ0A 2NY2C 3AGVA 4NGHH 2ZZUT 2R2BA 3V6ZA 3MJ7A 5EU7E 1GC1C 1EJ6A 1WGOA 1U8NB 4QY8A 1Z9MA 5JOPD 4M1DL 2BHYA 2ICEA 1QO3B 2JIXB 3BVNA 1MAML 4WW1A 5EWIL 4EI5C 2EKJA 3OJ2C 1UWGL 2IAMB 2YHGA 4P9HC 1K6QL 1R3KA 5DS8A 1DQLH 2GT9B 4XCEB 2ERJC 5EC1B 5MHSE 4JKKA 4S1RH 4PJ8C 3MA9L 4XI5C 3GSWA 5KSUA 4DN3L 1RUMH 2DL2A 3DVNA 3X3GL 4MA7L 1L7TH 4NC0B 1XGYH 1S8DB 3PNWA 3UBXB 5E9DE 1T1ZB 1HHIB 3KYOA 2A6KA 3KPSE 3D0VB 5DEFB 3TIEA 1ZHBA 1EO7A 1EX0A 4KTEH 4PJ7E 5I1JH 4GXUN 5TE6H 4ZO6A 4UV4L 3GSVB 5JNYB 4LF3B 1JI2A 3UX9B 5F21B 1NBVH 1UQSA 1MH5A 3T4AA 1D5BB 3DHJA 1HYSC 1TZHA 3PV6A 4U3CA 1UC6A 4NBYB 3WFDH 4HJGA 2PYEE 1EO8H 3HFML 4ZO8A 1BOGA 4A6YA 4LU5L 3OKNA 4Y2DB 2IWGA 5DJAA 4U6VL 3HZKA 2EYTB 4BA8A 3O2WH 5LCVL 1GL4B 3IDYB 1MRDH 1AXTH 4NQED 4YDKL 5FECB 4LIQE 4TYUA 4R4BB 3PGCB 3CFCL 3U83A 2AJVL 4Z6AT 4XCFH 5EU4B 3DXAD 1NUGA 5C71A 5LQBH 3OR6B 1FPTL 1WTGT 3LAFA 1WWWX 4ZAKB 3GK8L 1XF4A 2VSCA 4WHCA 3DV6A 3DO3A 4QO1A 2AXGA 1JZ8A 4ELKA 4WU5B 1NCBH 3C60D 3DVFA 3CVHL 2VISA 3CDCA 1DBJL 3B5TA 2DQIL 5FAAA 3U30C 5JO5A 1HHGA 4G3YL 4C56A 1X5GA 5CBEA 2BVQA 2YPKA 3NACL 3PGDA 5FA4A 2VR9A 3DX6B 5CP3H 1DUZB 5L2KB 4U1JB 5IQ9B 1ZK9A 2W92A 3AAZA 1KENH 1U0QA 4HEME 3RVUD 4ZOAA 4OJFH 3I75A 4X9HA 2FATL 2E8YA 4N0CC 5F7HA 2ZUVA 3K8LA 4GRLC 3LOWA 3U2SB 1QHOA 5JZ7C 2QQNL 3CFEA 3BWAA 5EOTB 4GAGL 4PJCE 3BSZL 4ELMB 5I1IH 3GMQA 4Z7WA 5CZVL 4OGYH 4YHLH 3AS1A 1CDJA 5ISZE 4JZJA 3UCRA 1UEMA 3NFNA 4HKJA 2YSSA 1FYTD 5T3ZH 1KB9K 1D6VL 3L3HB 4TUOA 3H9HA 4WFHD 3MLRH 3O6FC 3UC0L 1CLOH 4D0DA 1DDHA 5EOQL 1TJHL 3FQXB 4WENB 1OD9A 1F3DH 3QUZC 2C1PB 3F7VB 3F58L 1FNHA 1OT2A 5EIIA 1PAMA 1XGRA 1Y6KR 1GPOH 3LEYL 3PWUA 1MCEA 4QTIL 4A6YL 5LBSH 2GYSA 3OAZH 3FO0H 1J8HA 5DI8A 5E03A 4YHKL 4QF1B 1LE5A 5BV7H 5CIPH 5B8CB 4NRYB 2EDWA 1WBYA 4UIKL 2A74A 4FP8H 1N5YH 4Y16D 1FZOA 3I84A 5K9OB 2AV1B 4PV8B 5C07E 3TVMB 2HN7B 2OR7A 4R7NB 3VG9B 4CVWA 3ZDYF 4O51B 5J13B 3DVIA 2ZSVA 2EXWD 1SVZA 3CSBA 4HCRL 3X11A 1TJGL 4Y5XB 3U48A 5D72L 5BS0B 2GJ6A 5DJYB 4ZXBA 2F5AL 5ADOH 3WLWC 3F7YB 4R4FL 3O4LB 3TJEH 1A6WH 2DWEA 4KI5E 5IB5A 4JJHA 3MLWL 4LEXH 2MFNA 4Q9CA 4YDJA 4K55A 1LO4H 4NQCD 1HILB 3OAYH 5DSCA 3GSNA 2V17L 4HPYH 3K8KA 2BSSB 1YY9C 3MRNB 1BVLB 1VERA 1MCQA 4Y5VA 5I74B 1ZANL 4KMTL 4RRPA 5HY9A 2DYPA 3UEZA 3QQ9C 4LCCB 5CKGA 3QXWA 1VFAA 4JGMA 5DTFB 5DVNA 3DARA 3PXHA 4WI2A 3SCMB 4YE4H 1B2WH 1Q9LB 3T2OA 4HUUB 4N9GA 1D5MB 2PKDA 1S7WB 3S4SB 4E41E 3ARBC 2NW2B 1I8KB 3ZLQC 3I2CH 3KJ4B 1FGVL 3GSRA 1IQDB 1MCPH 4KKAC 5F7WC 3DECA 3ZKND 5EFIA 4OLZH 4QXUH 3NPSC 3T1FB 4BZ2H 2DQHH 1T21A 2ZUUA 1EAPB 2YD4A 4NDMA 3U9PH 4MD4B 3E8UL 4QHMB 4G6JH 1E4JA 4RDQG 3V4VH 2AGJH 1AGBB 2HFEA 5DRWB 5I1AA 2ESVD 4HHAB 5FA3B 4X6DF 4G9FD 2PO6C 3HZMA 4QXTA 5H2BA 1Y18A 4LLQB 4KK5C 4D0BB 5IMOB 4YUEL 1CFVL 1TZIA 5ETUA 4NIKB 1MI5E 4YQXL 2NY3D 5GS3A 3NIFE 4IBLT 1MCDA 4WGVB 2C26A 4JDTL 4OZGA 4GW1B 4P46D 1I7TB 4WNQB 4HXAH 1YEDB 3V7AG 3CFBA 1ND0A 1I1AB 4YDIH 5F1IB 2P43B 4LSTH 2BC4A 5DURD 3FN0L 2IALB 4O2FB 4OSUH 4PTTB 3KLDA 5FFLA 1NFDE 1IEBA 4YHOL 3U7YL 1JK8B 1JNLH 2NY5H 5CBAA 2OI9B 4X5WA 4LHUB 5CEXB 1KG0B 4ZPTA 3PWVA 1YYMH 5CEYA 2DB8A 5TDPB 3RUGA 3PABB 1INDH 3SPVB 5F7EL 3RX5A 1ZA6A 5MHSD 1ADQA 4TUJA 2W0PA 1P7HL 3MOAH 4TRPL 3V0VA 3HPLB 1WFNA 5KW9H 1XR8B 1JUFB 4RCAA 1UADC 4HC1A 4U2YA 1BWWA 2VZVA 3IU4H 4N0RA 4QRPE 3GSNL 3NFPB 1CZ8L 1T7WA 5E9DD 5E4EB 2FR4A 4K3DH 4KTDL 1KJ3L 3KPSD 3WN5A 1HQ4B 2DWDB 3QHZL 5ERWB 4NQEA 1KXQE 3MCKB 5F3HA 3C8KB 2AK1L 5CHNA 4ZYKA 3EO1B 1NUFA 5HJ3B 3U4EA 4XVSL 3DXAA 4L3CA 3NH7L 5L0QB 3S5LG 2EH8L 2WAHA 3N06B 4OLXL 1QYGH 4POYA 5T5FH 4JFXA 1F97A 3ARZA 2EDOA 4EQ3A 5L7XH 3RZWA 1U8LA 4ZUUB 1W0WB 3RNKB 4MCZA 1MNUL 3CPLA 2GTWA 1RU9L 3C60A 5D5ME 3E1F1 4M1DH 3ZE2F 5F6HJ 4ESKA 2YRLA 1MAMH 2FYYB 4KRLB 3E6HB 5EWIH 1EXUA 3NCYS 1UWGH 3WS6C 4LRNL 3G6JF 3LN9A 2ATPB 3EJYC 3VFUB 1N7ML 1QD0A 4PV9A 1K6QH 1C16B 3NABL 4H88L 3LKNA 5I16B 3MV7E 5HYQA 1FG2A 3N0PB 1NSNL 5CJBA 3WSQL 2F5BL 1PYWA 3D69B 3MA9H 5D7KE 1SEBA 3TNMB 3QZWG 5ESQA 4N9OB 5JIKA 4DN3H 5EH1A 3X3GH 4MA7H 2P8PB 1OTSD 2GY7B 2NY1D 4P5TC 3LKQB 1A1MB 3BX7C 3I6GB 5TE4L 1I7RA 3VI3E 4QCIB 4X9BA 1DQDL 4UV4H 2BCKB 3BXNA 3V5KB 3IDNB 5DO2D 3IF1A 5I1CL 2APVA 5DC4B 3W5NA 4OUUA 4KU1A 2HLFD 4QGTA 1FYTA 3HFMH 2BXYA 4GG8A 5DVOA 4LU5H 1G1CA 4UTAL 4XWOC 1RULL 4Z0XB 4U6VH 5LCVH 1EBAA 3AM8C 1ADQL 5IT2L 5DJ0B 4HS3B 5KSBF 5HYSA 1PKOA 1G7IA 4YDKH 4HC1L 5DZOA 3CFCH 2AJVH 1PDKA 4PJXF 1P84K 2BOCB 1X4YA 5ISZD 5TF0A 3V6OE 1FPTH 4YXHL 4UUJB 3PJSB 3G04B 3GK8H 5MEQA 4Y16A 4HFUL 3DGGA 5LKNA 4PG9A 1F3JA 2WSKA 3TNNB 4KXZI 4YNYB 5H37H 3CVHH 3RRQA 1DBJH 1HHJB 2WBWB 1J87A 2DQIH 2F53E 4L8SB 5E1AB 4G3YH 2RJMA 1UZ8A 4OLWL 4LBEA 3NACH 3NOIA 4S11A 1O5DT 5HHMB 4ODXB 3ESUF 1OHQA 2WBKA 5IR1B 4MAYB 4P2RD 4NQCA 4I48A 3FOLB 5E24E 4FXGA 3RIAK 3OJDA 4JO4L 2JJUA 4J4PD 2AKRA 2XTJC 2FATH 1P1ZA 1U8KB 4KMLB 2ZG2A 5GGRB 1XGUB 2VL5A 3PDOB 4TVPE 5C07D 3BGFB 5EC2A 2CMRL 3BP7B 1NGWA 3BEWA 4OV5A 3U7AA 2W65B 2QQNH 3K2MC 2MPAL 2AXFB 4GAGH 3RY6C 1AGCB 1LO2L 3BSZH 4KI5D 3NGBB 5CZVH 2FLBT 5GRWA 1T0MB 1A6TB 4LGPB 3H3KA 2NY4B 4H0HB 4OQTL 4HKZA 4HIHA 3FB7A 3EDEA 4XPGL 4QOKE 3QI9C 1U6AL 4NO2B 4U49A 7CGTA 3VRIA 5GS0C 1D6VH 3L5WB 4LAQH 1T03L 3IRPX 3UC0H 5EOQH 5DC9B 5DD6B 1TJHH 2AEPL 4L5FL 5I0DA 2Z92B 1BMGA 1A6ZA 1RZGA 1NCWL 3F58H 3HR5B 4IMKA 1FCCA 3V79C 4UU9B 2XKNB 2JB6A 1A7NL 3LEYH 4MB4A 1F4XH 4JFZL 2EDLA 4QTIH 4A6YH 5DRXA 2BY2A 3FN3A 4YHKH 2OTWA 2ESVA 5TDNB 4GW4A 4F8QA 2NR6D 5KJRL 4G9FA 1I4FA 4UIKH 4BH8B 2M2DA 3CDYA 1H8SA 2QEJA 4HFWB 1FZMA 4ODBD 3F7QA 1M7DA 4HZLB 3U46A 5AG9A 2I07A 3M1BB 1I8LA 2XWTB 1U3HC 4HCRH 2ADIB 3R8QA 3MO1A 1TJGH 3IT8D 2EEAA 1JPFB 4P46A 2Z0BA 5D72H 1KTLA 1BQLL 2F5AH 2V7NA 5KS9E 4R4FH 4EOWL 1H9VA 3MLWH 3O3UN 4WI8A 3HUJE 2V17H 2J8HA 4HX1B 1MCSA 3QNXA 1SJHB 1H8NA 1GGTA 1ZANH 4R0LC 2GK0B 4KMTH 2V2XB 4DEPC 5C0NC 4LP4A 3RVVD 1NH6A 2X4UB 4R2GD 2ADGA 1T0PB 2WBJB 1PKQB 1P5VA 4JM2C 5HYJB 3IU3B 1A3RL 5E9DA 1A22B 4XP1L 1NGXB 3QIBD 4U1LA 1FGVH 3QP3A 5HPMA 3KPSA 2M26A 5E5MA 4LCWD 2DS4A 1KPRA 4ODWA 2ZP0T 4PR5A 2XY1A 2NW3A 2JB5L 1FYHB 2Z93B 4I18B 2UWEF 4PJEE 5DFVD 2JJTC 2FIKA 2DIJA 1J1XL 1AQDB 4FFZL 4OZHF 1KV3A 1VFBB 3MLTB 4QRPD 2AJSL 3E8UH 3ALWA 3SO3B 3I6LE 4XX1E 5DUBB 5B3JE 3UJTL 2C1OA 2A38A 1KJMA 4JDVA 4LLDA 5F9AC 2J8UB 3QQNA 4QLRA 1CDYA 1X5YA 2KQNA 5B4MC 1HH6B 4YUEH 1CFVH 4X9FA 1KELL 1FL6A 4YQXH 4JDTH 4DQOL 3C5ZB 3SJVE 2E7HA 3OB0K 1CD0A 2BRRL 3E6FA 1E4WL 5KSVB 3FN0H 1DUYB 1NQBA 1TNNA 3AB0C 4BSVB 3TH2T 4P0DA 4YHOH 3U7YH 3MRRA 1VESA 3OXSA 1T20A 4GT7A 2NLJA 3CFDA 1I3VA 3RDTD 5FXCH 3QUKA 1OD7A 4HV8B 1FQ9C 4ZUTB 5F7EH 1PQZA 3MV7D 5KZCD 4TRPH 3VJ6A 4RNRB 1XCQB 2VERN 5D7KD 1UVQA 1HXYB 1IGML 5ICXB 3GSNH 2CRMA 1CZ8H 1FC2D 4JN2B 4X6CF 4KTDH 1F6FB 3S5LB 1KJ3H 1IZJA 2EDDA 1BVKB 4YBLC 1ERNA 3QHZH 3WLBB 2X42A 3MJ6A 2H9GB 2W91A 2AK1H 1W0VA 5IG7A 4HD9A 4IHOA 3EYQD 3I3DA 3MSPA 2OR9L 4XVSH 4YJZL 5ISZA 4Y4FD 2EH8H 3C6SA 4OLXH 5D6CB 4HXBL 3VCLB 1RJZB 1IAKA 5DEGA 3LN4B 3VWJD 1MNUH 3U0PA 1E6OL 1RU9H 4Z7VF 4ETQB 3FO2A 2ICCA 4LMQE 3QJHA 4XBPA 3VFNA 5A43C 4NNYA 5GZNC 3CC5A 4LRNH 5F97E 1HSBA 1N7MH 5DK0B 1FG9C 3NABH 4H88H 4K94C 2FJGB 3UP1A 3VXNB 4Y4HC 4P2RA 3SEPA 1NSNH 3WSQH 4LHQB 2F5BH 4AIZA 1EHAA 3ULVE 4J4PA 4HS8L 1JMZA 3ZDXE 3DETC 3ZTJH 1JYVA 1U8PA 5C9KA 5KSAB 4LIQL 5C07A 3HN3A 4NSKA 1D5XB 3MLYL 3T0EC 2NXYB 4PIRF 5TE4H 1CI5A 5HHOE 4M1CC 3SDXB 4PREB 3QUMB 1JHKL 3CCHB 3VXOA 5E2VL 2F53D 1SMAA 3BPNC 1DQDH 2R2EA 5D2LE 2H8PA 3D9AL 2BZDA 3UXFA 1CDIA 2LTQB 1T3FA 4XPTL 5HI5D 5DJ2A 5IVZA 1A3QA 1LE9B 3B6SA 1ORSA 2A77L 5I1CH 4MD5B 5E2UL 4WDIB 1UB6B 3ALXA 5FHBL 3RWCA 3HAEH 3BDBA 2UY7A 1LEIB 2CDGA 4UTAH 1PZ5A 1RULH 5HVHC 4CU7A 3EOTL 4TVPD 4PP1D 2XZCL 5F9JA 4NO5B 3F5WB 4MLSA 3CXHJ 3G5YA 5ESVB 4C55A 1ADQH 5IT2H 1JJUA 3TN0C 4HC1H 1YPZF 4J2XA 4ELMF 5EU3B 3EHBC 3QEUA 5EDXA 3KPPB 1HWGB 2HVJA 2X4PB 3EJZC 4YXHH 2C7UA 4N68A 4W4OC 4B0MM 5H37G 2X1XR 2X41A 4HFUH 5JOEA 2LAAA 2QR0A 3QO1B 5TFSL 1KEML 4JFHD 1WISA 4UQ3B 3MV9E 5CCKL 1M71A 2NXZC 4JPWL 4HKXA 4F7EA 1NFIA 1LP9B 1ZHLA 4OLWH 5SWQA 1T6VN 1SHMA 2VMFA 4XC1L 5IUSA 5GSRB 4KWUA 4CN4A 1X7QB 3LS4L 3ORJA 4MS8D 1FAIL 2YRPA 5SWZE 5SWSB 3BUTA 3H6JA 4JO4H 2C4FT 1A6VL 3PL6B 5I76A 4PRDB 1YMMD 2QSTA 1T89A 2Y25A 1IARB 4OZFA 1J86A 4NRXA 2XTJE 4GJTB 2CMRH 1ONQB 2VB5A 1II4E 1LO0L 3WDJA 4JZNA 2MPAH 2Z31C 3VGFA 1L7IL 2P24B 3OBAA 5D7JC 1T4KB 1LO2H 2ENSA 1WIOA 2UY6A 1CGSL 3HS0A 3QIBA 5DGRA 4HK0A 3VRJB 4LCWA 5LGKA 2H6PA 4OQTH 5BRZB 1AE6L 4XPGH 5CIPB 2KDGA 5AAWA 1U6AH 2GJZA 4NNPL 1DQQA 5B39A 1LDSA 5EA0L 1T03H 3SE3A 1QLFA 1ZVHA 2BHUA 3SGKC 2MHAB 4L5FH 3T3ME 1MUJA 1K8IA 3R06B 3WJJA 3R4DA 4X99A 3HI1A 4YZFF 1NCWH 1ZLSL 1TCRB 4QRPA 5FUOL 5C09E 5EB9A 5DQ9A 1A7NH 3EDKA 4JFZH 4D94A 2CD0A 4Z78B 1XH3A 3K81A 3TO4D 3OXRA 1I8IA 1YNTB 3BO8B 1ZXQA 5KJRH 4CMHB 4S2SB 1ZHKA 3BEVB 4AEHL 1FZKA 3L9RB 4C58B 1FNEA 3I6KA 3QJFB 5LAXB 2CLRA 4CMMB 3AREC 5H94B 1JWSA 3K4DA 1AD9A 2X4OA 2DI7A 3TYFB 5CZKA 1ZA3A 1MCKA 2PCPB 1V5JA 4LLYA 3VFRB 4M02A 5D7IF 2AERT 4JVWA 1RUAL 1BQLH 3C09B 1EIBA 4EOWH 3I6LD 5D1XC 4PJGE 3W9DB 3RKDC 2PXYB 4HDIA 2AJZA 3HHRB 4JM4L 4S0TD 5HGHA 4QWWD 3P4OA 4HUVB 3PWPE 2WK2A 1SYVA 3RDTA 1XF5B 3VI4F 3NIDE 4OTXL 2H32A 4LCUA 4P5MA 3SKUD 3IGAA 3MV7A 5DXWA 4GG6B 4HW6A 4TNWK 1IC5H 3IJSA 1FIGL 5KN5B 3B9KB 4N5UA 3SJVD 4KC3B 3D0LB 2G9HA 5LGJA 4UIMB 4EBQL 3EZ8A 4P57B 4U1SB 2MQCA 3K46A 1A3RH 5F70A 4XP1H 1R24A 5D7LB 3G08A 1VKXB 2FBJL 2CRZA 2GSIB 4KJQC 4JPVL 4RZCA 4HUNB 4LK4A 4OCXL 1KLUA 2JB5H 1YN6A 4OFYD 1CFQA 3E2HB 1Q8MA 3G5VA 4JRWA 4Y4FA 3MREB 1J1XH 4JDZA 2ARJB 3WIHA 4FFZH 3PQYE 5DDHA 2W9EL 4MCYB 1NLBL 2AJSH 2W9DL 1J0ZA 3VWJA 1HQRA 5KTEL 2OJEA 3MV8B 3EO0B 3D85B 1BQSA 1A9EB 2XXMB 3BZFA 3UJTH 3GKWL 3CSPA 2MKLC 4XP6L 4ZUWA 1T2QL 2J1KA 2FJFA 4MDIA 1KELH 1RJCA 4PRAA 5H35A 5K9JL 3CGTA 3V6OA 4Z7NE 4U1NB 1HOCA 3O45A 1RZIA 3O8XB 4U0RB 3T4YB 4DQOH 3SE4A 1W0YT 5EO1A 2BRRH 1E4WH 4ONHB 5D2NB 5DQJB 2Y07L 4BJLA 2R1XA 4GXVL 3GSXA 5DA0B 5L8JB 1SY6H 4PJ9C 5BZWB 2NZ9D 3QUXC 3S96B 3VU2A 2F53A 5KAQF 1OAUL 2VWEC 5IBUG 4CNIA 2FH6A 2D03L 2J7LA 4JREB 3MJ9A 3AROA 3D39B 2IBBA 3HKFA 3HMWL 1SEQL 4YO0A 4W6XB 1LEGB 2KZWA 5I66A 3ULVD 3DYMA 2DKMA 1CQYA 1IGMH 4RRPG 2PW1A 2NY2B 1MCOL 5E99L 1PZUB 1QOKA 3S36X 2F54B 2MNUA 1HH9A 3T8XB 5HGDB 4P9HL 5HHOD 4N5ED 4XP4L 1X5LA 3WHE0 5GGTA 4NKQB 3EOAA 3KPQA 4EI5B 3QIUD 5FYLE 2R0ZL 2ATKB 5C0BB 4R4ND 3ZE1E 3WFBL 5ACZB 3FB8B 2ERJB 1IAII 1CT8B 1AGDA 2OR9H 2E7MA 2AJ3A 1TZGL 2DQEL 1A7RL 4PJ8B 1GYAA 4HXBH 3QEGL 5ICYB 3AS3A 5KAQG 3LHPL 4J3UA 5J3HD 4D9LL 2G5BA 3DSNA 3MRFB 4JZOA 5GRJL 4HBCL 3T3PF 4HSQA 5J7CC 3VDBA 5FV1L 1BZ7A 4ZFOA 2VLRE 1YC8A 3TCLA 3L7FB 4E0RA 3MYJA 3WIHL 3K4AA 3DMMD 2BMKA 1NCDL 3DBXA 4XVUC 3BFOA 3L3JA 3CK0L 1MCIA 2ADFL 4NYLB 3ZTJG 4XNZB 1RZFL 3FQRA 1MQKL 4GMSL 1YMMA 4HS8H 4OGAC 3MRPA 1A21A 3SDCD 4RFEB 1BZQK 5I9QC 4Z7UE 4LIQH 1KXVC 2DM4A 3GKZA 3MLYH 1IEAA 4NKOB 1JWUA 3C87A 1JHKH 3MV9D 1G7PB 1ZS8B 5E2VH 4P2YA 4RFNB 5IVNA 3ETBF 3QPXL 5IROC 3D9AH 3QIWC 5KS9A 2Q6WA 3HAEG 3J7HA 1BFOB 4XPTH 3S37X 1YECL 4E5XB 2A77H 1CDCA 2A6JB 5E2UH 5ENWB 4MDJA 2Z8VC 3IFOB 4TUKL 1J0KA 5FHBH 3HUJA 5SWZD 3QPQC 1AR2A 2ITCA 3LKRB 5JDSB 3BKML 4F2MA 4U1HB 1FNGA 3EOTH 3G9AB 2XZCH 2A6IA 3MJ9L 2PTVA 3KHOA 3RGVC 5JW5B 3U30B 3GBML 3W82A 4LASL 1GHFL 2BNUA 1CR9L 3ES6A 1NGPL 3TO4A 3O3DB 2DLHA 2V9TA 4TVPL 4WW2C 4X6BA 1B4JL 3RPIA 1WICA 1QZ1A 5HHXL 3V6ZB 3O6KL 1OSPL 5GGTL 4QY8B 3MC0A 1VEMA 4JFOB 4J3VA 2ICEB 4PJEA 3BVNB 5TFSH 4WO4C 4GRLB 4C54A 5LJYH 1GAFL 1KEMH 4TPRL 1TETL 2VLJB 5CCKH 4JQXA 4JPWH 1R3KB 1U8JB 1UB5B 3EYVA 2IPUK 5C09D 3ET9F 1I9EA 4XC1H 3SKOA 2R1YA 2CQVA 3EDJA 3LS4H 4G42A 4PRBA 3GSWB 1V3LA 2VLKE 2VO5A 1FAIH 4V2CB 4NKMB 3BD3A 1JZ7A 4IRZL 4ZFOL 3SDDC 3SDAD 4RAUB 1A6VH 4JFQA 5C0AD 2UUDH 4HWUA 4C59B 3O6FB 4JHBA 4EUPA 2EZ0C 2R56L 4PGBB 3RI5F 2E5EA 1H3UA 4D9RE 5IMLB 4MB5A 1LO0H 3IXAA 5E95B 3SJVA 5GXBB 1DSFL 1L7IH 1U58B 1KJ2A 1TZHB 1CE1L 3RJQB 1TTFA 4IMLB 1CGSH 1F4WL 1CFBA 4PLKD 5JXEC 2X4RB 4I9WE 2LABA 1FC1A 1P9MA 4U6HA 1CICC 5KBNC 1CL7L 1AE6H 3UTQA 4N0FB 3BIBX 5IB2A 3PWPD 2ADJA 5F88A 3QQ3B 2IH1A 3Q5OA 4OFYA 4ONOA 4NNPH 4QEGA 2E8ZA 1FJ1A 5EA0H 4FQPA 1T80A 3BPOC 5DJ8A 3S9DB 5FYJE 3O9WD 4B41A 2D3VA 4G8IA 1N59A 1ZLSH 3FFCE 5FUOH 4YAQA 2P5WE 4KKLD 1TMCB 1HXMA 2LAGB 4NM4L 1PFCA 2QL1A 4RGMC 4I2XE 5CEZD 2AXGB 4TOYL 5HYSG 4AEHH 1YNLL 1TVBB 3IFPB 1OW0C 4UOW1 1Q0YL 2VISB 5E6YA 2HH0L 4U4BA 1F4HA 4LVHB 5JO5B 4GQ9L 3EDDA 3WHXA 5CBEB 3PQYD 3LKPA 1S9WA 4KY1L 4OCWL 1I7ZA 1RUAH 3GMOA 3TJHC 3BHBB 1MLCB 1U8HA 1ES0B 3VGGA 4RMTA 4PJFB 3MRQA 1V7NL 2YN5A 5MI0C 4OI8A 1H0DA 1JYXA 1HDMB 4JM4H 2CXGA 5CWSB 3NA9L 3FTGA 4FNLL 2J8UF 1D9KD 5GGUA 1FCGA 2ICWA 3NPSB 4OTXH 5CP7A 3L5HA 1WIUA 3CH8A 5L88L 3BWAB 1KYOK 1CS6A 1FIGH 1U91B 3ISWA 4EBQH 4Z7WB 4G6ML 2PW2B 15C8L 5ESAA 2FBJH 3PG2A 4O5LL 1CL7I 4OZFH 5HHOA 2OX5A 2YSSB 3G5XA 3GFUA 4XXDA 5C6PB 4NZJA 1D6EB 3QIUA 4NO3A 2PO6B 5D2LA 5GRUL 5IK3A 5K9KA 4ENED 4JPVH 5F7LB 5KOMC 4OCXH 5IKCB 4GSDL 5GZOD 1LNUA 3ZYZA 3QWOB 5IMMB 3MGAA 4MAUL 1MJUL 1NC4D 1KJ2L 4KJPD 5HGGS 1WT5C 2JF1A 3OHXA 1N8ZA 3GIVB 3CH1A 1NCTA 2V9RA 5EZOL 4KHTL 1XGRB 3PWUB 2W9EH 3TBTB 1NLBH 4X7TA 1SJXA 4XPAL 4Q97A 5KTEH 1XGPA 5C0EB 3DO7A 5GRXG 3BQUC 4BK5A 4IDJL 1WBYB 2DTSA 1OY3B 2BSRB 1RIUL 4PLOB 4XB8A 3I3EA 4ZSOE 4LSDA 5FYLD 3DMMA 3FMGL 3WXWL 3SBWA 4XP6H 1T2QH 3TPKA 2NY6D 4O02L 3VH8A 3JBG7 3Q2CA 2ZUTA 43C9A 2DI8A 5K9JH 4ZXBB 4F7CA 1U8QB 4KH2A 4YDVA 4JY6A 3SDCA 1AHWC 2IPKA 1MRCL 5IB5B 2DAVA 1P69B 3GMRA 1CBVL 4W81A 1UZ6F 4YDJB 4GXVH 4PJ7F 1NJ9A 3GSNB 4NBZB 3DUSA 2FEDC 2VLRD 2JCCE 3MV9A 3ZT6A 2YBRB 2R29L 4XMPL 1CD8A 1OAUH 5HY9B 4GKZB 3NZ8A 2D03H 4KROD 3VXQB 3LKOA 2ZUQC 3HMWH 1SEQH 5SWZA 2X9YA 1X5XA 1P4LB 4N9GB 1WCBB 5F9DC 2MCPL 1MCOH 5E99H 1A9BB 2H32H 4P9HH 1K4CA 1B9ZA 4XP4H 2R0ZH 3ULVL 3DGCR 2IMNA 1T21B 3A6BH 1MLBB 3WFBH 4GAYA 1EFXD 1FO0L 2A1WL 2GSGB 5JA8B 2DQFA 2E27L 3UZEA 4YHML 3B9DA 4OFPA 4NWUL 4O2EA 4LCIL 1TZGH 2DQEH 1A7RH 2P45B 3QEGH 1LEKA 3LHPH 5HD8D 4D9LH 5GRJH 5ALBL 2DM7A 2HFEB 4HBCH 2HYMA 1AD0B 4P5TB 4OCLC 5I1AB 2PF6A 3ARPA 4TNVF 5INCA 3HZMB 5K33A 1TITA 4D9QE 2Q7NA 3ARRA 4QXTB 3DIFA 4GRWB 4KZEL 1WEJL 5C09A 3WIHH 4ISVA 4HEPG 1DBAL 1NCDH 4YGAB 4IRJC 3CVIL 1YN7A 4U6XA 5J4MA 2JJWA 1FN4A 3CK0H 1AGEA 5I1LA 1BFTA 3X12A 2ADFH 1WWBX 1BZ9A 3OJMB 3ULSA 3DRTA 1VDGA 3SDAA 1RZFH 5C0AA 1MQKH 2BC4B 4GMSH 3BGMA 1UCBL 3EJZD 1U2CA 4UNVA 1KGCE 2KBGA 4B50A 5DVMA 1KC5L 4DZBB 1R3HA 4L3EE 4DGVL 4JRYB 2A9ML 4LGRB 3P4MA 4AYFA 4ZPTB 3PWVB 1TVHB 1X3DA 3C2AL 1L9MA 1G6RA 4PJCF 2RBLA 1ZA6B 4LCYB 1IRAY 2JELL 1YECH 4F9PC 4OLEA 3W9EA 2VLKD 1WUNT 4TUKH 5LVEA 4IIQA 4ODUA 2VQ1B 3PWPA 2XZAL 5I8KL 1UXWB 2ICWI 3BKMH 4U1GB 3RWEA 3MRJB 4X8XA 3MJ9H 4D9RD 4FN0A 1P2CA 3O9WA 3EDFA 1FV1A 4NQEB 1RZKC 2P47B 3GBMH 2JK5B 4GW5A 4ZYKB 3BH9A 4F37F 2BVOA 4EN3D 3BN9D 3U4EB 4LASH 3KGRA 1GHFH 3V5HB 4L3CB 5F7DA 1CR9H 1T66D 4PJAF 4QHKJ 1GCFA 1SMOA 4DFIA 1ZT7A 1NGPH 1HE7A 1S7QB 4TVPH 4FQQB 4ETYA 8CGTA 5FO9B 4HUWB 4CKVX 1B4JH 4Y1AE 4PPTA 3QDME 5HHXH 1S7SA 3RFZC 4MCZB 3O6KH 1OSPH 3JV6A 3HG1D 5F9WC 1OLLA 1OWWA 4ONGL 5I19L 1AI1L 4I77L 3B5GA 3UJIL 3RWIA 4PJHE 1GAFH 2A83A 4X5XA 4PLJC 4TPRH 5FK9B 5FYJD 5DJZA 1TETH 3HE7D 3PQYA 4R96B 1JHTA 4B7IA 5GS1A 1G1YA 4MZ2A 3KS0H 3FFCD 4POUB 1SYSA 1WVZA 2P5WD 2XZQL 3KLSA 3Q48A 4L4VD 3ZDZF 4EIGB 4HWEL 3RWGA 4L29A 5J6HB 3KDMA 5DJ6A 3O41A 4IRZH 1D9KA 1XF1A 3K1KC 2AK4D 4LLMB 1I7RB 3EFFB 1HKFA 2DM2A 5T3XE 1U8MA 1YEHL 2FJHA 3BXNB 4NOFA 1QRNB 4HIJB 2KPNA 1DSFH 3WNNA 4GOSA 1CXIA 3QNYB 1CE1H 5ID1A 1F4WH 3VRLE 3ARYA 5HI3C 4OUUB 3W11D 1FYTB 5E6IC 2ZJSL 4ZFGL 4DUWA 1CL7H 4X6DE 4JFYB 3JUYA 3O0RL 3DRQB 3RTQC 4L8DA 5CUSL 3RWHA 5T1DL 5T1MA 3QULB 1MHPL 1G6RL 1NC4A 5EO0B 2CLZB 3IJHB 4GG6F 1KJVA 2FGZA 1U3HB 5HSFA 4DOHE 1MVUB 2EYSA 5JQ6L 4P23D 4Y0GA 4WIQA 2VQTA 4N1HB 2VXSL 4M48L 4BFEA 1XGQA 2NY0C 4NM4H 3EAKA 4PY8J 5ANME 3TLRA 2DLFL 1IM9D 5J11B 1FNLA 1CK0H 5MEQB 4TTDD 2VXUL 3S3JA 4TOYH 1SJEB 1BQHA 5I8CB 1YNLH 4PJ5B 4R0LB 4JKMA 4ZUVA 4IRSC 1Q0YH 2HH0H 4DEPB 3PHQA 1CGVA 1G0DA 4GQ9H 1BBJB 3U6RA 1UZ8B 3GO1L 4KY1H 4OCWH 1IGIL 5CEZL 1U9KA 4JM2B 1YUHA 3VD3A 3BUYA 3IFNL 4DCQA 1V7NH 4I48B 4OZ4A 4FXGB 4Z9KB 3OJDB 1NFDF 3FOMA 5FYKE 2VLRA 1WC7B 2X7LA 1T7YA 1ZT1B 1EEQA 4POZD 2K1MA 1V3MA 3NA9H 4NKDB 4G8FA 4FNLH 1MIML 2OMBA 4CW1B 3U0TA 5DRNB 3U36A 9CGTA 1YMHB 4M43L 4QTHA 2X1PA 2ILLA 1JPSL 1AH1A 2ZKHL 5L88H 3ARGD 4G6KL 3L3GA 2DBLL 4LLWA 2VLMD 4OZFG 5EBWB 4G6MH 4Z7UA 1K2DA 4UB0L 5C0CB 15C8H 2X4QA 4O5LH 4U6TA 4EUPH 5T1LD 6CGTA 3U9UA 3IDMB 3TO2B 3VRIB 5GRUH 3FZUD 2E7LC 5IFJA 4I13B 4QNPE 4F9LA 3JXAA 4GSDH 1FL5A 3G6JE 4OZIF 1EFXA 4PYHA 4MAUH 4W68A 1A6ZB 1MJUH 1KJ2H 3K8MA 3MRCA 4X7CC 5FIEA 4D0CA 5MP6L 4UDUA 5IHBA 2CIKA 3DROB 5EZOH 4KHTH 5C2BL 3MLPA 3J8F7 5DRXB 4CVZA 5B39G 4HUKB 3PF2A 3RJDA 4XPAH 3ROLA 5D5MF 4MQXC 1CDGA 1X4ZA 3W5MA 3S97C 4FQXC 4GW4B 4UILL 4BYHA 2VDRL 4IDJH 1ZSDA 3AB0B 1RIUH 1NUNB 4LOUC 4PGCB 3IAGC 1M7DB 2YC1B 2J5LC 1Q0XL 3SQBA 3FMGH 3V6BR 3WXWH 3QCUL 4PG2C 3GM8A 4MMZC 2I07B 4O02H 3ILPA 1JRHL 5F1NA 5I17A 4OFIA 4F80A 3ALPA 3GI9L 1NDMA 3A6OA 4QT5A 1MRCH 5FYLL 4M8QA 4PBWD 1CBVH 3VI3F 3QNXB 1S9VA 3ZHDA 1UJTA 2R29H 2XFXB 4XMPH 2DJUA 2P5EE 4G6FD 2Y5TB 3AY4A 1N5AB 2PUQT 2VLKA 2P7TA 2XV6B 4PJXE 4PJDB 3TWCL 1OT1A 4F7MA 2MCPH 4BFGA 3UTSE 3QXAA 2I9LA 5A16A 4WY7L 3EYUL 2DQDL 1KGCD 4GQPH 5E8OA 5E5MB 5GGSY 4OIBA 1CN4A 4EI6A 1BECA 3P3YA 5C0GA 4ODWB 3LQAL 4R26L 2NW3B 1NBQA 2DIBA 4C83A 3HR6A 4EN3A 3ULVH 3K7UA 2FIKB 3SN6N 2A1WH 1FO0H 1N2RB 2E27H 4YHMH 4Y4HB 4NWUH 5FDWA 2Q1EA 4LCIH 5B8CC 5MENE 2XI9A 4Y4KC 5JW4M 4JRXB 4P9ML 5B38A 5IWLC 1ZE3C 3HG1A 4L9LC 5ALBH 1UG9A 5C0DB 4R90L 1XCTA 3TVMC 1I7UB 3CZJA 3WS3A 3VG9C 1KJMB 1XMWA 5J13C 4JDVB 3RNQA 3HE7A 4LLDB 2IFFL 3ZKMD 2HFFA 4Y5XC 1DLFL 1X5HA 3FFCA 2BVTA 5FB8B 4KZEH 1WEJH 4BKLB 1QSFE 1JRHI 2P5WA 2R69L 1DBAH 3ELAT 1A4JA 4L4VA 4QRQA 1JTOA 3CVIH 1FL6B 1GZQA 3ZHKA 1XF3A 4I2XA 3GJEB 4WUKL 1ZHNB 3GDBA 1I1CA 2LVCA 3QDMD 3SY0A 3VXTA 3L1OL 2NY1B 5I74C 1UCBH 1RVFL 3CMGA 4XT1C 2CRIA 2EDEA 2AK4A 4JQVA 4AK1A 4G8EB 4MZ3A 5HVHB 1KC5H 1RK1B 3X14A 4HK3N 4P59L 1CD1B 2A9MH 5FO8A 2NLJB 1MJ7L 1TPXC 4JPKL 3C2AH 3QUKB 1FL3A 2FSEB 3TN0B 1PQZB 2IADA 5DZNA 4KK6C 4BQCA 2JELH 2VXTL 3KJ4C 3VJ6B 4DVRL 3VD7A 5A2KH 1PY9A 1UVQB 1SM3L 1SVCP 3H0TA 3DYOA 1U2HA 3CFJB 4KDTA 5I8KH 2AP2A 2XZAH 4PJIA 1MJJB 2VOTA 3DTXB 1A2YA 5BZDA 3OAZK 2APWA 3MUHL 2AJXH 5EIQA 5T3XD 4FG6C 1Z5LB 1I1RA 5C08D 4NHCL 1ZV5A 4M7LL 1I85A 4P23A 3STZB 2D31B 3AMLA 3GMLB 5K59F 4ZFZA 1F45A 1IM9A 3PWNA 4WTXA 3NN8A 3HNTL 3CMOH 4ZFFA 1HHHA 5I19H 2V7HA 4ONGH 3FO2B 1AI1H 3C5SB 4XBPB 2NX5B 4I77H 3SDYL 3UJIH 4ZNEA 1BPVA 1BD2E 2WW8A 2CK0L 4JANA 3IETA 4K7PX 2H1PL 2Z31B 1HSBB 4FQ2L 3BP6B 1I1AC 4M93B 2MKWA 2P48B 2IANB 4OD3L 4P2RB 4HWEH 1H3GA 2VE6B 4AIZB 3IAQA 3QAZC 5HGAA 1OP5K 5C9JA 1MAJA 3MUGB 4JLRA 5FYJL 1BF2A 2OI9C 1U8OA 1H3TA 2CJUL 3GB7B 4ZSOA 3VXPA 1ZGLM 4IM8A 3TFKD 3P77A 2DKUA 2AXJA 4JPIA 2P49B 3MA7A 1YEHH 3ARGA 1VACB 2QSCL 1KIQA 1H5BC 3F6IA 4OZHE 1M05A 5E7BA 5GIRA 3CDGA 3MOQA 4YHIA 1KEGL 2I60L 2HT4C 5E4EC 3D2UD 3QHFL 3RWCB 4PJFF 3U7WL 5LXGL 5T1LA 5FYKD 2VAAB 4OD1L 2CDGB 4X6EB 4PRHE 4ZFGH 1PZ5B 3O0RH 2QHRL 1NEUA 2E9WA 5CUSH 4L4TB 4YEEA 5T1DH 4F7PB 1MHPH 1G6RH 3PIQA 5K93A 3LKSA 4WEUD 1KBGL 3UDWC 1HSAB 4F7TA 2R8SL 2Q8BL 1EH9A 2MWCA 4XH2A 4Q6IA 3F12A 1MQ8A 3H3PL 3G5ZB 5JQ6H 4O2CB 1G7MA 1NUDA 4GBXD 1G9MC 3MFFA 2VXSH 4M48H 3SKNB 1T22A 1V8HA 4RWHA 2X70A 1P6AB 3QDJD 3UTTD 2HVJB 4L8CA 3C6LC 2DLFH 1MVFA 4WWKD 1U93A 3U0WL 5HYFA 5ITFA 4HG4K 5HVGB 3RVTC 3ZTNL 1FVDA 1C08B 3KYNA 2QKIA 5E8PB 1L6XA 2HG5B 1Z9OA 3GSUA 1RJYB 4M3KB 2CDEA 1NFIB 4MNHA 3GO1H 3BMWA 4HS6A 4P4KC 1IGIH 5IJVB 1OPGL 1S9YA 2AV7A 4L8BB 3OGOE 1RZ8B 3MYZA 3IFNH 2RAMA 2VUYA 1JF1A 2CO7B 2YKLL 1VPOL 3HZYA 2R0WL 2RR3A 1JF6A 3BQUD 4NN7C 1MEXL 1Q9OB 5ALCL 4NRXB 1UJ3A 2OLDA 3RL1A 1MIMH 3JTSA 4XX1G 5J9PB 5C3TA 4GFTB 2BVEA 4M43H 4EIZC 4U6YA 2BY1A 3CZFA 1MCRA 4R2GB 4HJ0D 1JPSH 2ZKHH 5IQ7L 1Q1JL 3MV11 3N50A 4G6KH 1U3YA 3VFPB 4MJ6A 2DBLH 3WYRA 1VGKB 2BVUA 4KQ4L 1JV5A 3HS0B 4EUPG 4MVBC 1URLA 1J18A 4LCWB 3TH3T 2H6PB 3ARDD 3QSKB 4UB0H 5JQHC 2YUWA 4UNTA 1CXEA 1JZ5A 3LB6C 4M1GH 4X98B 3C8DA 2V9QA 5C0JA 2B4CL 3E3QC 5HHNB 3QXDA 3RVXD 3QCVL 1QLFB 3VFMB 2CKBA 2X5PA 1QPPA 4X4YB 4PTUB 1X5IA 3MBED 5MP6H 4QRPB 5CZXC 5DQ9B 5C2BH 1QNZL 4PJBB 1RJLB 1AP2A 1F5WA 1MHHA 1A8JH 2E9BA 3EGSA 2VDRH 4UILH 5ITBL 3FQNA 1ZHKB 4UDTA 3QUXB 3V8CA 1FNEB 3I6KB 4S0SD 1U42A 5T3ZD 1F13A 4OAWA 3UAJC 1Q0XH 1OF2A 2X4OB 5MERA 3QCUH 1M7XA 3MRGA 1JRHH 3DUUB 3GMNA 4XP5L 2MJWA 5E5RB 5L2KE 5EUOB 1KLGA 3QDMA 5T5NF 3ZDXF 2I9TA 1YY8A 4LGSB 3GI9H 1I8MA 5D1QC 5FYLH 3QISA 1BX2A 2RFXA 4J7RA 4YFLF 2EYRA 1QR1B 1DQJA 1FVCB 2KL6A 5DHXB 1ZT4A 5I1HL 5HHPB 2HJLB 2OP4L 4GRWF 1QSFD 5E2TL 3IGAB 4MJ5B 1F90L 1YPZE 4NO0D 1F11A 5DUPH 3MMEB 3NGBC 4ELME 5GRVK 4Y19D 3OF6D 2NY4C 5C8JB 4PGDA 5LGJB 1L9NA 2V5RA 2YPVL 4XZUA 3TWCH 1D3CA 1BJ8A 4NZTL 5IJKC 1CGWA 3B2UC 1DLHA 1R24B 4MWFA 3BKJL 3C9NA 3EYUH 4WY7H 2DQDH 2HWZL 2ZOLB 3KLAB 3CSGA 3GZKA 4G43A 5C08A 2CPCA 2HLAA 3FCTA 1UH3A 5DEZA 3LQAH 4R26H 4L4JA 2CIIA 1IGCL 5T5NG 2YUXA 1D5ZA 5HDQL 4NQXA 1DVFD 3RY4A 2VDML 4JDZB 4PB9L 3TBSB 4XBGA 3MROB 4XCYA 5DDHB 5I8EB 2X44D 4NJAL 5J6GA 3DVGB 4X6DA 3VWJB 1HQRB 4P9MH 3STLA 5DF0A 2APTA 2DMKA 3FB6B 4WI9A 4GS7C 5D1ZC 1KSRA 2GQHA 5I9QB 4R90H 2CKBL 4CN6A 5F71A 2GCYB 3AU1A 2IFFH 1NEZA 1DLFH 2JE8A 5E1HB 4ZUWB 5CD5C 1CE6A 2RCSL 2A0LD 2FJFB 4MDIB 2VABB 2R69H 2DL9A 3T2NL 4HGKC 4PRAB 2VSDA 1R5VA 3O4LE 1AXSA 4KKNA 6FABL 4WUKH 1OTUD 4NCDA 3MGOB 3HC0A 5CS7A 5EO1B 5GRYA 3L1OH 1OSZA 4O9HL 3LEXA 1RVFH 1EV2E 3VH8G 5FO7B 2DDQL 1MFBL 1W8NA 1T5WA 3RGVB 4NC1C 1BD2D 4P59H 5E8NA 5GISL 4LVOB 4HPOL 1WFUA 4BH7A 4PLJD 3BRDA 1MJ7H 4JPKH 2IPTL 2FZ3B 4HH8A 4YZFE 1IM3B 1INQA 5CILL 1J8KA 3ME0A 3D2UA 4RA3A 2VXTH 4DVRH 5IESL 2FX8L 1G7LA 4P2OD 4WW2B 1MIEL 3T0WA 4X0KA 1SM3H 2PW1B 5AUMA 1C12A 3GUTA 3QZWA 1KXTB 2DQUL 2QTEA 4N8VA 1B0WA 1HWHB 4I18C 2R1WA 1QKZL 2H2PC 5DMJB 2Q86A 4WO4B 7FABL 3T3MF 2B1HL 5FKAB 3QDGB 3IKCA 1JIBA 5JW4R 4NHCH 4M7LH 3TCXA 1DZBA 4ZD3L 3PV7A 1GGBL 4GBXA 3SO3C 4X8JB 1UACL 3UTTA 3QDJA 4AIOA 1KCSL 3WO3B 4WWKA 5T3XL 2Z91A 4PRHD 4YR6A 3HNTH 1HIML 3X13A 5HTSA 4EDWL 4NZUL 3G6JA 1RV6X 5BVJA 4XHJC 5AD0A 2D4FA 4ZS6D 3SDYH 2O5ZL 2O93L 2CK0H 4E0RB 3MYJB 3QUYD 2BMKB 2H1PH 3C5ZC 4FQ2H 3L3JB 3MGTB 1RMFL 4PJGF 5SV3A 4OD3H 4Q58C 4HIEA 4DKFL 3BWUC 4QYOB 2UYLB 1JNNL 3FQRB 2MTPA 2JIXD 1X5FA 1YMMB 1AIFA 1RK0A 3MRPB 5FYJH 2CJUH 2GFBB 3NIDF 3TBWB 1S9XA 5EUKA 5D9SA 5GGRY 1T1WA 4NFDA 2IAMD 3BPOB 1HKLL 1ZKAA 3ULUC 2FL5A 2QSCH 5JPNA 2W07A 4I5BA 1EEUA 1KEGH 2I60H 4JM2F 3ARDA 2UZIL 3QHFH 4E42B 1KN2L 5LXGH 4RGMB 5EN2A 3SKJL 1Y0LB 4OD1H 1MCWW 4M6NL 4X5LA 5CMAA 4FFVD 2G2RB 4G9DA 2AEIT 4ZODA 5J1AA 3HPJA 5KSBA 1FNGB 4JJ5B 2QHRH 5EG6C 4MSWB 4PBXA 1JGLL 5D6DC 1KBGH 1AKJB 3MBEA 4PJXA 1CCZA 5EO9B 2F74B 2W1NA 2R8SH 2Q8BH 5FYKL 3H3PH 2C4XA 1E28A 3ES6B 4WV1A 3LQZA 4KPHL 4WFEE 2EE2A 2A6DA 4Y2DD 5D93B 4X6BB 2DN7A 1KB5B 5I1JL 3U0WH 5J12C 5DK2A 4PJEB 3KHQA 5F72S 3ZTNH 1LMKA 25C8L 5IBTL 4E9LA 4JN1L 5BOPA 4XCCL 3ARVA 5SX5K 1MFNA 3EYVB 2R2HB 4M7JL 3BZ4B 1OPGH 1S7RB 4ZAKD 5I71C 3SKOB 5DJXB 3RHWK 2P42B 1E4KA 4GKSA 4I4WA 5KSAC 4H8WL 3RWJA 1A02N 5H8DA 2YKLH 2N7AA 4MQXD 1VPOH 2R0WH 3HE6D 2EDRA 3TA3C 1MEXH 5IP4A 1TIUA 5ALCH 1F42A 1QSFA 3MZTA 2DBJA 3HNVL 3QA3B 1BREA 4NO0A 3WBDA 1L0QA 3CD4A 3MNZB 4Y19A 5IQ7H 1Q1JH 3OF6A 5L2KD 4Y89A 1JPST 1FVEA 1OOAA 4WUUD 1KJ2B 2OBGA 4LSSL 4OV6F 5FGBC 4KQ4H 2WQRA 2Q7YB 3T3PE 2Y72A 4U6HB 4PBVC 1GJIA 2B4CH 3V95A 5FM5M 1WFTA 4V1DB 4R3SA 3ZE1F 3ROOB 2EXYC 3E3QE 3QCVH 1DVFA 4RGNC 4XB7A 4A2MA 2C3VB 2FWOA 3BRGC 3SKMB 3O3BA 1WBZA 4RQQA 3X3FL 1M7IA 3WL9A 3GMMA 1YJDL 4PJDF 1ZVSB 1ZGLA 3V4PL 5HXMA 5IVOA 3F62A 1QNZH 1DN0A 5IGXL 3ZYOA 3FB5A 4EEEA 5ITBH 1FFOB 4OB5L 1S7XB 5F6HI 4UZGA 2YPLB 1JWMA 1YEGL 4FQ1L 4G7VH 1AR1C 2V5TA 4K7PY 2R23A 3S36L 3FO9B 1BM3L 3LKPB 1S9WB 2ZUQB 1I7ZB 4XP5H 3QEQE 5HHME 2GHWB 3QG6B 4X6FA 1BQHG 2H2SC 4JVUA 1U8HB 3VGAB 3PL6C 4JFDB 4PD4J 2P4AB 3L95A 1WBXA 4NZRL 4WWID 2R9HC 4IJ3C 1BD2A 4PY7A 1FLRL 1OTTD 4XTRC 3ZMRA 2NNAB 3FTGB 4KI1A 1ORQA 5I1HH 3VXUB 2ICWB 2OP4H 5E2TH 1MHEA 4KAQL 5IBLC 5JPMA 1F90H 1N6VA 5BW7A 4ZS7L 3GGWA 4P2OA 4HWZA 4MJIE 2BNQB 2YPVH 4NZTH 3W39B 3BKJH 1UM5L 3WKML 4W70A 2HWZH 2E6JA 2WMPA 3GBLA 2NMSA 5IK3B 3JV4B 4RMQA 2VDOL 4OZHA 1IGCH 2X4NB 5FEBA 5HDQH 3SCMD 4PRPB 3ZYJA 2UVFA 2YA1A 2FGWL 4KDWA 1ZOXA 1REIA 2YS4A 4K7FA 3CH1B 3HA0A 2VDMH 4PB9H 5JORA 2IPUG 3V2AR 4NJAH 4PRHA 4X7TB 3D18A 4DKAA 1KPUA 1XGPB 4YGVA 1YZZA 3WJLC 1P5UA 3DO7B 4XRCA 4DUVA 4QRRB 1L6ZA 4HT1L 3S37L 1JGEA 2CKBH 2B20A 2KUTA 3CLFL 3QUYA 2WINA 2XG5A 1T04B 1RPQA 3NCCB 2WP3O 4MA1C 2RCSH 3C09C 4MXQD 3VH8B 3T2NH 3P40A 4NFCA 1H15B 4PS4L 3V7MA 1U8NA 4F7CB 6FABH 4MQSB 3VXMD 2JIXA 1QO3A 3JVGC 2IJ0C 3SDCB 1VA9A 3SQOL 4XNMB 3GMRB 3UJJL 4O9HH 2HAZA 5CFHA 2IAMA 1FDLL 1GOHA 1NJ9B 2MQ3A 3SGJA 2DDQH 1DE4B 3MV9B 1MFBH 2BSED 4F33A 1N6UA 2GT9A 5BXFA 5GISH 5EC1A 4HPOH 1J5OL 2Z8SA 3NZ8B 2VDKL 2IPTH 5FHAL 1VGEL 5CILH 3O2VL 3BYYA 3EYOA 4M4RA 4NJ9L 1I1AD 1B0RB 2H26B 1PKQE 1S8DA 1VFOA 3K80A 4G7YL 4X6CA 3UBXA 5HYJE 5IESH 2FX8H 1HHIA 2AQ2A 1LD9B 1UA6L 4LVNC 1MIEH 3D0VA 4U7SA 2QADC 2HMID 3FRPA 2DQUH 3REWA 4HH9A 5EBLA 3GSVA 4QHNA 1QKZH 4HAFA 4LF3A 7FABH 2B1HH 3QWRD 1VADB 4HZAA 3RI5K 2XNAA 3CX2A 4JR9L 4GAYB 3DX9B 3N1PC 4ZD3H 4M7LT 2OL3B 1GGBH 1JPGA 5IHUL 1TCMA 5MEPB 4Y2DA 1UACH 1QTYT 4XXCC 3Q0HA 4QRSA 2HTLC 4Z7VA 2FHCA 1KCSH 3P9MA 1LEKB 5T3XH 5I15L 3OX8B 2AVGA 1HIMH 2IBZX 3L3DB 4EDWH 4NZUH 3QEHB 3KWWB 5FECA 2NY5C 2J8UE 1FH5L 3ILQC 3N9GL 3PGCA 4NQDB 4ZTPL 4PLNC 2O5ZH 3DIFB 4R6UA 4LKXB 5EU4A 3O8XC 1F6AB 4X7DC 5B38G 2HTKC 3LPFA 1XIWD 5FM8A 1L0XA 4U6XB 4ZAKA 4S1DD 1RMFH 5D2NC 4DKFH 5IV2B 3X12B 4WU5A 5DR5L 5IW6B 1JNNH 3DRTB 3SDAB 3OQ3B 3HE6A 4YBQC 5C0AB 1CXFA 5E6IB 3N1GC 2YZ8A 3V0WL 2B8OT 5D70L 1HN1A 3B43A 5F44A 1QLRA 1T1XB 1R3HB 4UBDC 2EE9A 1HKLH 2B0SL 3GRWA 3H9SD 1DUZA 5L2KA 5JHDB 4WUUA 5IQ9A 1OAZL 4NCC2 1P7QD 4I0PC 5C92A 1P7KA 3LDBC 2BVPB 3GIZL 2NY0B 2Q8AL 3QXVA 4I3GA 2UZIH 3KPTA 4J3TA 1KN2H 5IHZA 3SKJH 2FO1A 3U2SA 4M6NH 3FQUB 3RWEB 4IOFC 1YPZA 4IRSB 1P2CB 2E7CA 1JGLH 3O9WB 1CFSB 3G6AB 2PN5A 4ELMA 2I27N 3CDFA 3S8WA 3BH9B 1NC2D 4OI9A 5CKAA 5FYKH 2HFGL 5T33L 5F7DB 4JKWA 1UWEL 2BNRB 4KPHH 4RSVA 3KLHC 2HJFB 1UZ6E 3FQXA 2R4RL 1Q9KA 3JV6B 3K3QA 1QQDA 2B5IB 3N1FC 1G6VK 25C8H 2CLVA 2H45A 5IBTH 4Z7OE 4KRPC 5DD3L 4JN1H 5DJZB 1CDHA 1ULVA 4XCCH 1FSKB 1JHTB 5FUZL 3BDXA 2D0HA 4CJ1A 5EBMB 4K8RC 4QF1A 4X9IA 4FMFA 4M7JH 4OIAA 4XNZC 1SYSB 4KJYA 2F9BT 4NRYA 2L0DA 4EDXB 5DD1L 3L6FA 3RWGB 5IFAL 4H8WH 4PJBF 5K9OA 2AV1A 5DJ6B 1LK2A 4LSUL 5GRVL 2JCCF 1GRWA 2H41A 3OGCB 4R7NA 3TT1L 4KKBD 2F8OA 4O51A 1OGAB 4RFNC 3SDXE 3LSOB 1MHCB 1TENA 2JJSA 4MQ7B 1A47A 3HB3D 4KK9D 3HNVH 4LRIA 5DJYA 1JHLL 3NCMA 1DTUA 3F7YA 4HCRA 3BP4B 4UNUA 3QEQD 3LEVL 5EUOF 3MNVB 4MAYD 5L2JB 2WP3T 5IEHA 1HILA 5ID1B 4OFVA 4LSSH 3MRNA 1BVLA 4X4XB 3UPRB 4FQXB 2GJJA 4LCCA 2AI0L 2OQJB 4ZDHB 2JLLA 3GRWL 4L8DB 2Y9RT 3FQWA 5AZ2L 4MMXC 3RWHB 1R6VA 1BAFL 2BFVL 2J5LB 3IJYB 4YX2L 3SCMA 1MSPA 4HUUA 3UBXI 3V6FB 1NL0L 1KJVB 1S7WA 3S4SA 4WFFE 3X3FH 2Q3ZA 2EYSB 1N3NA 2X89D 4MJID 3MR9B 1YJDH 4WJ5B 1A1OB 1IQDA 3V4PH 1XGQB 4G6AC 1GH7A 5IGXH 2EC9U 1MY5A 3WMSA 1XT5A 3L3KB 3C2SA 3T1FA 1P53A 1EAPA 4OB5H 2WNGA 4Z7QF 1F2XK 5D7IA 1ETZB 5E7FA 2DQTL 1YEGH 4FQ1H 1AO7B 4ZQKA 4YXLL 1TQCC 3PHQB 5TE7L 4BSJA 3KXFE 3U6RB 3S36H 1BM3H 2FD6L 5CGYD 5A3ID 4KKCC 3VXMA 1AGBA 1QA9B 4MXWL 1QEWA 1YUHB 3BUYB 4HHAA 5SWSE 2YN3A 3T65B 5M7QA 4DCQB 4LAQL 4KK8D 1IFHL 4NZRH 4D0BA 4H1LB 5IMOA 1FLRH 1BWMA 3CSYA 4TNVK 4QTHB 1I7TA 1F4XL 1R5WA 1YEDA 4KAQH 3V5DB 4BZYA 1QSEB 5F1IA 2X4SB 4PJAE 1TTUA 2L4OA 4ZS7H 2IALA 3L3GB 1B4RA 4O2FA 4PTTA 3ARTA 2VXVL 3O6ML 3WFCL 1MCHA 4Y4KB 1J10A 1RUPL 2GK2A 1JK8A 5BRZE 1IVLA 5CEXA 4L9LB 1KG0A 1UM5H 3WKMH 1FFPA 5TDPA 3PABA 5IW1B 1UCTA 3D1MC 2OZ4L 4KMQA 4AIXA 1MY7A 5DMKB 1C8PA 3QWRA 5IFJB 2DJ4A 5DMGC 2VDOH 1XR8A 2NPLX 2W0FB 5IIEB 1WWAX 2R2CA 1FZJA 1GSMA 2FGWH 2Y5EA 3MRCB 4D0CB 2WBJD 3NFPA 3ZDZE 5HYJD 4UDUB 3CX5J 2LU4A 3D25B 5HI4C 4RMUA 4WW2F 1HQ4A 5ERWA 3MCKA 5CJ5A 1GOFA 2IMMA 4FFYL 4PJHF 4HT1H 4P3CL 1OP5H 3S37H 5HJ3A 1VEPA 4LVHC 4FOMA 4LP5A 3CLFH 2VH5L 5TH2B 1XIWA 1TPXB 2NYYC 3B9EA 2C3HA 5E56A 1G9NL 4Y5YA 3IDGA 4AH2A 2UUDK 5JHLL 5A2IH 1B88A 2G75B 1W0WA 5I17B 4F37K 4PS4H 5C0FB 1QP1A 1F58L 3JV0A 1KTDA 1NDMB 3VFOB 3ESVF 1I3UA 3UTOA 3V52L 2FYYA 4M8QB 3SQOH 3UJJH 2HT2C 2ATPA 1FDLH 2C3GA 1S9VB 4GMTL 3H9SA 5I16A 4GG6E 1J5OH 1MWAB 1ZLWK 1F02I 5E2WL 3D69A 1P6FA 2VDKH 4JEGB 1P7QA 3TNMA 5D71L 1V7ML 4UINH 4HKBB 1UKQA 5FHAH 5I30L 1VGEH 3IDJA 3O2VH 3VRLF 4TTGA 4NJ9H 2P8PA 4JZJC 3MNWB 4G7YH 3HRZB 3JUZA 5D7LE 2JJVA 4F7MB 2O61B 1A1MA 3KPLB 3I6GA 1UA6H 5A16B 4M9OA 4Z76B 4MJ4A 5TDOB 4QHLB 3INUL 3BPLC 3DNKA 1A1NB 2BCKA 3V5KA 3P4NA 1MCLA 3RVWD 3BIAX 1NC2A 3NBNA 3BPCB 3EZJB 4JR9H 5HDBF 3ZO0A 1MAKA 5IHUH 5FDWB 3HAEA 4H25B 2ED7A 3QAZB 3MV8E 5DVLA 1UM6L 1HINL 5B38B 4AM0B 1S7TA 5I15H 3PDGA 5E8EB 2BXZA 2GW5A 3HG1B 5D8JL 1Y6MR 2X40A 5CLWA 4LPUA 4BQ9A 5DJ0A 1E27A 3WS3B 2E7BA 3X17A 3H7BA 1FH5H 3RNQB 3HE7B 3N9GH 4WHDA 2X1OA 4ZTPH 4I0CC 3LD8B 2APXA 3NCBB 2X9XA 4N90E 2BOCA 1I9IL 4ZXBC 3OKEA 1H5BB 4L4VB 1PX3A 1QLEL 1R3JB 1XF3B 1I1YB 3MUY1 3DI3B 3VGBA 4MQTB 3WNPA 4QRUB 5TPWL 5DR5H 5J8OA 5D2NE 4KJWD 4YNYA 1NEZG 3SY0B 3VXTB 4Y5VC 4N0UB 5IVXB 1HHJA 5E00B 1UH4A 2AK4B 3V0WH 5LGHL 5D70H 4L8SA 5E1AA 4OZIE 3L5JA 4DUXA 1GIGL 2B0SH 3QEQA 1HEZB 3D39E 4TSCL 5FM4A 4MAYA 3CFIC 2PYED 1OAZH 2IADB 3NCJL 1JF5A 2J6EA 3UYOD 4NNXB 5IB3B 3GIZH 2Q8AH 4RMRA 1U8KA 3KYMB 4J23A 3C6LB 2XQBL 3PDOA 3IDXL 2F54E 2NXYD 4PJIB 2W65A 1JI1A 4QNPF 3QFJB 2AXFA 1A2YB 5BZDB 4JO1L 1AGCA 5C0BE 1EVTC 3EW3B 5DGQA 5F8QC 1IJ9A 2GAZB 3U4BL 4Y2OA 2X89A 4MJIA 1RUR