5E95B

Crystal structure of mb(ns1)/h-ras complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
94
structure length
92
Chain Sequence
SSVPTKLEVVAATPTSLLISWDAPAVTVDYYVITYGETGGPVQKFEVPGSKSTATISGLKPGVDYTITVYAWGWHGQVYYYMGSPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/inhibitor
molecule keywords Mb(NS1)
publication title Inhibition of RAS function through targeting an allosteric regulatory site.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 92
sequence length 94
ec nomenclature
pdb deposition date 2015-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e95B00
3QHFH 4YHLL 5EO0A 1NEUA 1EHLL 1BZQK 4NCDA 3TVMA 2EXWC 1H5BA 3SQBA 3QJFA 3T65B 4OF8A 3JUYA 3LN5B 5C0BE 2QEJA 2MSPA 2QQKL 3JTTB 3WLBB 3DBXB 5EU7E 3MLTB 4P5TC 1JHLH 2YA1A 2VXQH 3RZCA 2D03H 1P7QD 5E2UH 3WFHA 1SYSA 5DJYB 2AJUH 2ZUXA 3OGCA 3QUMB 4L4VD 4OT1L 3ARTA 4Z7OF 3X3GH 1EEZA 4M7JL 5D1XB 5IQ9A 3ULVE 2W0PA 4YDLC 4XPTH 3B5TA 1DQJB 3TN0D 4P2QB 3ZL4L 3H3PH 4OBRA 5DUBB 1M05B 3VD3A 1YY8B 2BNRB 5I1AA 4RA0C 3WJJC 2H32B 4NC2B 4PV9B 3KS0J 1KEMH 4X6DA 1PZUB 5ITFA 1HSBA 3HMWL 5J06A 1G6VK 1IQDA 4C55A 5E08L 3S5LA 4DCQA 1KXTB 3BDBA 4OLZH 1OPGH 1CICC 3HE7B 1FL3A 4P2OA 3O11B 1OAYL 4YXKH 4G8GA 2ZG2A 3QWRD 1F58H 3TO4D 2JJSC 4JQVA 3BKMH 3T08A 4CNIB 4HAGA 4U7KA 1UM5L 1YNKL 1RVFH 4X9BA 3WKML 3W5NA 4WU5B 5IUSA 4WI5A 1AO7B 1NFDF 3QQ4A 3AGVA 3QA3A 4R9HA 1JP5A 1IGJA 3VXMA 1RZ7H 1CFVH 3UROR 5I8OH 2P47B 4PJFB 4QRRA 4UQ2A 1E4KC 4M6MH 3NACL 3C2AL 2WSKA 4HKZB 3D69A 5HDQL 1YPZB 1HHKB 2X42A 1IT9L 2MHAA 5CSZB 5TE6H 2EIZB 3SE9H 4X6FB 5ANME 2PN5A 1NGWB 1TPXC 4OGAD 4NKQB 3L7FB 5DK2A 3KLDA 5IB3A 4AT6A 8CGTA 2DL9A 4CVUA 3NBNA 3MJ9A 3TVMD 2YXFA 3MYZA 4K7FA 3QR2A 3VGAB 4JY5H 1T7YA 4BQ8A 4QTIL 3TN0B 4G6ML 3DO7A 1A1OB 2A83A 2NY7L 4L3CB 5ICXB 1KCRL 2V5MA 3C5SA 1JPFB 3H0TB 1XFPA 3HPLB 1Z0MA 2F58H 3VXRA 3REVB 3WSQH 2G60H 3UTPE 3IGAB 5EU6B 3CK0L 4G7YH 1UG9A 5IIEB 2HJKA 2P5EB 3NCBB 4JO2L 3RA7L 1XMWA 1DQLL 2WIIB 4Z8FH 3KXFB 1PYWA 43C9B 4PG2C 4PYHA 2Z9TA 3M1BB 3EO9L 1K6QH 4CMHC 4CDGC 4XZUB 5GRWA 4LIQE 1KEGL 4RGND 4QGYA 1U8LB 4NHUB 2VDNL 2CMRH 1LEGA 1RUMH 5HJ3B 3SOBL 3CH8A 3QEGH 4LLYA 3ARBC 4PLKC 4CJ0A 5MHSD 5F21B 4AM0A 1J87A 4YHZH 2NW3A 5C6TL 3GKWL 1GHFH 5CBEA 2R23A 5IFAL 1EIBA 3OB8A 4ZFOB 1OWRM 4N0RA 5HHPA 3FONB 4W4OA 5DJ8A 1B88A 3W39A 4P59H 1AIFA 4G8GD 4HIEB 3G6JF 4XCEB 4LPCA 4TOYH 2VAAA 3C5JA 1MH5B 1QPXA 4GS7C 1OHQA 2VDRH 5E94A 2DDQH 1MUJB 1RK0A 1MAMH 3N9GL 4WW2B 3T4AA 5CCKL 3L3DB 3VXMD 1C1EL 4LDLB 4W4NA 4ORZC 4UZGA 5L8JB 2P43B 4GRWE 3MLWL 2BRQA 4QRRD 4LCCB 4NQXB 2A6JB 4FQLH 1U8IB 4ELMF 1B2WL 2FIRT 1TVBB 4Z77A 5KS9A 3UTZB 4L8DB 4K23L 3GSRB 5E1HB 2HJFB 3PGFL 3OKOA 1MIEL 3MGOA 4JQXC 4N8VG 4OZFG 4X4XA 1BQLL 4YHOH 4FP8H 4DW2L 1DUYB 3FMGL 1LHZA 1BVKA 3WNMA 5J6HB 3AMKA 3R4DA 1CE6A 4ZSOE 5ERWB 5IVZA 2QLVB 3V7AE 1I9RL 5E2UL 1A6AB 3NIGE 1WZ1H 4JDZB 2AJUL 1Z6JT 5LBSH 3VXRD 3QDGD 5D5ME 5C0DA 3X3GL 3MJ9L 1NBZA 5I1KL 4KDVA 3OXRB 3BT2L 2XKNA 3HE6C 2O5ZH 2OSLA 3MFFA 3F7QA 3U1SH 2GK0B 4MNHB 4LARH 3GJFH 2GT9B 3IJHA 2YWZA 1DANU 4ODVH 3IKCB 3H3PL 3MBXH 4HIJB 2QJDA 5INCB 3PV6B 1R3LB 1IKNC 4D0DA 2HWZL 3ULUC 2CRIA 1JNHA 1OF2B 2EC9U 4N9GA 3ZE0E 3GBLA 4PUBH 3RWFB 4HHAB 3WUWA 2AQ1A 1SJEA 1KNOB 2C1OA 5IW6B 3QUKB 1GSMA 1LVEA 2DWDA 2CXKA 3VFTB 4XMKH 3E6HB 1MCPH 3K0WA 1CG9A 4JPIA 4S2SB 5HGDA 4RMVA 4N5ED 1BD2B 1Q9KB 1T80A 3QO0A 5J0BA 2ZCKL 3T0EA 5CJOH 4ZG1A 1F58L 2VIRA 1G6RA 1ZLSH 2B7DT 3OG4B 4PV8B 4NHCH 3HAEA 2MOVA 3AM8C 4BK5A 5I15L 3RVWD 1JHTB 1U3HA 1CFSA 4OCRL 3AFLA 4PLJC 1JTTA 3DX8A 1HKFA 4K3DH 2ATKA 5D93B 4PJDF 1S5HB 1JBJA 3D1MC 1GC1C 1C7SA 4X9FA 3HNVL 1LK2B 3NVQA 5I8OL 3NCJL 5ACZB 1RZKL 4WI9A 5FYKL 1NGXB 1XGPA 1M6OB 2ZKHL 5AYQA 1MHEA 4NQEB 4JPKL 3EYFA 2VQ1A 3ZDXE 2WUCL 2X7LA 5FEBA 1OTUD 2F5AH 3KJ6L 1TIUA 2NNAB 4F37F 2W0LA 5C9JA 4XAWL 4W6XB 5JXEA 1LK3L 4FN0A 5F9JA 5F6IB 2WAHA 1NPUA 2A73B 2K3TA 3QDGB 5EBMA 4OIIL 5GHWH 5DFVD 3DX7A 2O26U 1J8HA 2BSSB 4HUVB 1KLUA 2E27H 4OLXH 2V5RA 2ZG1A 3IU3A 2DQIH 1EX0A 2BNQA 1UYWH 3Q6FA 1Z9LA 1F97A 1QBLH 1DL7H 4NKOB 4JPWH 4NJAH 2CO7B 3S35H 1T03H 3WN5C 4CUCA 2HKHH 4I2XA 1IBGH 4L8SC 2PCPA 1Q1JH 1D5BA 3IDNB 3VGDA 1MJUL 2H26A 4UUJB 3QIWA 5E9DB 5JORA 3HMXH 4WUUE 1TETH 5GSRA 1NANH 2OTWA 5KVFL 4UOW1 2Z93A 3VGEA 5IFHH 4XBGA 4P2OC 2QADB 1HH6B 4PJIF 5MEQB 5FGRA 4Z8FL 3I2CH 3S3PA 2P8LA 1TMCB 4RFOH 2C7UA 4RRPA 1KIRB 3IAPA 4GRLA 2WBJB 3BD5A 3ZKMC 3LAFA 3RKPA 3WNLA 4MGXA 4LBEA 4PG9B 4H26A 5JW4M 4XCNB 1EEQA 5SWSE 4YAQB 3D18A 4P48A 4YHZL 2X4OA 1K4DB 2W60A 1I1AC 2F8OA 2W91A 3KYKH 5ALBL 5EIIB 4LHUG 3CH1A 5F7DA 3TJEH 5EUKB 3K74B 4BSWB 2SEBB 3IF1A 1OAXH 4OZHA 4DJMA 3NA9H 1TZHB 3QEQE 3O3UN 4P3CL 1MNUH 5GS0D 1U3HD 2VITB 4NKDA 4LCUB 3MA9L 4CADB 4HJJL 5C07B 5FYLL 1AE6L 2CKBH 2NY5L 3IJSB 3JZ7A 5DWUH 4J4PD 2FGWL 2XI9A 3QG7L 2VXTL 3LRHA 3BQUD 1OWWA 4NZUL 1DQQB 2Y7QB 3WFCL 1FYHB 4Q9QL 4LNVA 4G6AD 3W9DA 5DDHB 1G7IA 5HYSB 5GS0L 1YEGH 3VG9C 3L6FA 3G5VA 3EOBA 4MA7H 5HHNB 5JXED 3VI4E 3ZYZA 3QAZB 4FQXC 5C2BH 4HIIA 1V7ML 4JFDE 1J8HD 2VUOA 1TTUA 2RAMA 4KTEH 2VZ3A 2WBWB 2XNAA 5JR1H 1B9ZA 5T3ZD 1H3VA 1QHOA 2IFGA 4N1HB 4C56B 2ITDB 1T4KA 1BFSA 1DQTA 2VSDA 1CLZL 4KJYA 1WZ1L 1HHGA 1N5AA 3LIZL 1L0XA 2J3SA 5LBSL 5JIIA 4HFWB 1JNNL 1HXMB 3ZTJG 3QIWD 1FH5L 4P3WA 1WZLA 4KI5E 5AG8A 4YXLH 2DD8H 2KPNA 3P77B 4EDXA 3SKOA 4IIQA 2E7LC 3HZKB 1KBGH 1ZT4A 1RZKC 1KJ2H 4LLUA 3CXDL 1Z5LA 1QD0A 1GOFA 5E24E 4GRLD 1DN0A 5F89A 4QYOB 4JFPA 1B0WA 2X4PB 4MD5A 2VLME 3FN0H 3QXWA 3H9SE 4RWYH 4ZFFA 4Q2ZB 4M1CD 4G6FD 5CZVH 4XMKL 1F4YH 2ARWA 5DD6B 3QG6B 1A9EA 1EFQA 1UEMA 1L7IL 2R9HC 5SX5H 4DAGL 1S8DA 5KJRL 2V5SA 3MODH 2VDPH 4BZ1L 3KPPA 3W2DH 4FQ1H 3CVHA 3S8WA 2FECI 1IRAY 4GG6E 1GYAA 2B20A 3VDCA 2FX7H 3K1DA 4GW1A 4KMQA 5JZ7C 1K8DB 3FRUA 5T1DH 4V1DE 3DJ9A 5AZEL 4YJZL 3Q6GH 5JNYB 2R4RL 1JN6B 1FZMA 1H8OA 1JWSB 3T2NH 1GL4B 2VERN 5D72H 3BEVB 4GQPH 2Z31A 1HSAA 1XH3B 1T6WA 3FO2B 1S7XB 1A7OH 3MNZB 4LEXH 1SY6A 3L3JA 4HWBA 1QTYT 1G1CA 4PJHE 1I1FB 4WTWA 4YBQC 2V17H 4KKLC 4WO4B 3IU4H 1HKLL 1H0DB 3QI9B 3KLHD 4EIZC 3O6LL 3NZHL 4ZOCA 2A6DB 4JDVB 5GRVL 2PXYB 3SE8H 1RZGA 3HNTL 2NY1B 1W2KT 1UXSA 1R6VA 1X5AA 5B8CB 4RDQF 4K8RD 2NR6C 4NNXA 4JPWL 4LLWA 3S35L 1JFQH 2LTQC 3U7AA 2VDKH 3MPCA 2C1PA 1T03L 4QGTA 3TFKC 2BJML 5FUCC 2WIMA 5I75B 3CSPA 3HR6A 2OZ4H 4KJWC 4PJEE 4OCWH 4KRPB 2VISB 1Q1JL 1AH1A 7FABH 3TBVA 2FJGB 1G0YR 1CGSH 5FHBH 3OWEA 4NJ9H 2O5YH 3K8KA 4X4ME 2NY5C 2VMFA 2VAJA 5IFHL 1GCFA 2Y36H 4AK1A 2OBGA 2BMKA 2XN9B 3TV3H 3QUXA 1F6AA 3RU8H 3LKSB 2EYSB 4RFOL 2VDMH 4ZUTB 4OQTL 3DHJA 4J8RA 1FO0B 2MMXA 5HTSA 3SDDC 4OD1L 5IWLA 5MERB 4EN3A 2Q7NA 1CN4A 5EA0H 5A2KH 3EUUA 5D7IA 4XNXH 2VDLH 1I7UB 3VJ6B 5CGTA 4OLWL 3MGTB 3DRQA 3SDXA 3OKNA 4DGVH 4JPVH 3HLAA 3MXWH 2FH8A 1TITA 5IV2B 3LY6A 4XPGL 4Y7MA 5T1LB 2ZPKL 3KYOB 1QKZL 3TH3T 3IDJA 2DIJA 1A4JA 3D3VB 2GSIA 2JIXB 3HZYB 1HQ4B 2WQRA 2GUOA 3FQTA 1NBYB 1WWAX 2I9LA 3P11L 4KTYA 3B6SA 4LSPH 1KCUH 3GKZA 2CKBL 3UBXI 4NNPL 2FATL 3ULVH 2Z31D 4RZCB 5J7CC 4NP4L 3NGBC 3MRMB 5C1MB 4LFHG 4XP6H 3IDIA 3LKNA 4IRJC 5I18H 1LP9F 3VFSA 3CVHL 2J8UF 2X9WA 5IF0A 4WI3A 3HFMH 3U30B 1QBML 2A74A 4MYWB 4G9DB 4MS8C 1YEGL 2W65B 2EH8H 1MPAH 4KJQD 4GG8A 2PYEE 3CMOL 5HXMA 4KHTL 3V4UL 3NIGF 4OQ1A 4XWOD 4WI2A 2CDEA 4R2GB 3KPNB 3KPSA 4NBYB 5SWQA 3WYRA 3BIAX 5D5MF 1IZJA 1YEIH 5JPMB 3O45B 4HWBL 4QWWC 3UTTB 3AU1B 4YPGA 5D7JA 5C8JB 2H3NA 3O3AA 3WIIH 1Q0XH 1E6JH 5EN2A 4RBPH 4BFBD 4NUJA 1T5XB 2VLKD 5IK3A 4UTAH 2FX8L 2Z92A 4QXGH 3QEHB 2D9QB 2H2SD 4P46D 4EUPB 1BIHA 2QSCH 4LSTH 5F3BB 2YPVH 5DEFA 4IHOA 4M48H 3TT1H 4A6YA 2BOBA 2DD8L 3ZE0F 3BXNA 4WTZG 4ZDHB 3QUXD 5JPNB 4POUB 2GSGB 3GM8A 2HVJB 5CP7B 4GAYB 5DYOB 1UA6H 4MMZC 3R1GH 4EN3D 4NDMA 4ZO8A 1JPGB 3U36A 1MIMH 1XGQA 3VXOB 1MJJA 1JIBA 1XCQA 1QEWB 4NZTH 3WNNA 3TP4A 1XCTB 3BO8A 3FOMA 1I1CA 1EERB 1F4YL 3JWOH 4YX2L 3IDMA 2QHRH 3BPLC 2ZCHL 4P2QE 2PO6D 2AGJL 4K7PH 4ZS7H 1YUHB 5DA4A 3REWA 5HVFB 3PWLB 3QDJD 2BNRE 1B0RA 3FQXB 1DVFC 4PJGA 2FO1A 3DX9B 3RVXC 1HINH 1KLGB 1Y18A 1F3JB 4LVHC 4E0RB 2DQFB 4XP1H 2BNUA 1A7OL 3CC5B 2HVKA 2EDEA 5F3HB 1LWRA 5CP3A 1K9TA 1N3NB 1T66C 5ADOH 4N8VA 4OZFA 5F8QC 1YC8A 2UUDK 3QIBD 2W9DL 1L7TH 2VLKB 5FOBA 5IJVA 1FNAA 1KYOJ 1QR1A 2PW2A 2EYTA 2V7HA 2PKDA 4U05A 4PP2B 2YRZA 1AO7E 2CJUL 4TUJB 5F70A 2JJUA 4P46B 3QPQD 2NW2A 4PJXB 4WI4A 3KPSD 4WFFD 3QH3B 1UKSA 4PJFE 5JLZB 4TQEH 5GRXG 1NGYB 5D7JD 4HK0B 5GGVY 3LRGA 1TZIB 1YPZE 2VB5A 1U93B 3TYFB 3QO1A 1MCOH 4HZLB 1CQYA 3N1FC 5H8DA 4GKNB 2L7JA 4M02A 4A2MA 4KK6D 2GEEA 5IG7A 4LPVA 4U3HA 3OAYH 2Z35A 4RFEB 5FV2A 1CFQB 2Y36L 5F96H 1FSKB 4GRWH 1EXUB 4Y5VA 3U2SB 2PO6B 3O81A 3RU8L 4M61B 2BK8A 3ARPA 3O4OC 3QDJB 3V7MA 3GHBL 4GBXC 3QDMD 1FE8H 5LQBH 1JWMB 5EA0L 4MCYA 1KCLA 3D25B 3OHXB 5DVMA 3HRZB 5EU6E 4I4WB 1AD0B 1RHHA 2QV2A 3DYOA 4S1RL 2P5EE 1OARL 2HFTA 2EXWD 3WHE0 5FF6A 1TLKA 1KN4H 4KKAD 5BXFA 3KXFE 4BFIA 4HUNB 2UVEA 2VN7A 2EDQA 1MCJA 3OZ9H 1AP2B 2YBRB 4P5TD 1F8TL 1EEUA 5EZOL 4FFVC 4P3DB 3V5DB 5CJXA 5HYQB 4EQ3A 2X4SA 5IB1A 4FXGA 5HDOA 2WQ8A 2ICES 1CR9H 1KCUL 3UJIL 1KIPB 4OFKA 4GKSB 4BYHA 4JDTL 1WISA 1K2DA 4YDVB 1SHMA 2P8PB 5E00B 3I02A 5I19L 1NGPH 5IW1A 2AJ3A 1XF2A 3PP3H 2DLFH 4HS8L 3E6FB 3ILQC 4PREA 3RUGE 4PB9H 3FB7B 4L3EB 3MBEC 1JZ6A 1G9ML 3I50H 4HS6B 4FQCH 5CD3B 4NKMA 4HH9A 3GI9H 4NN5B 2GKIA 5DD5H 1OB1B 1WZKA 1QQDB 3CDGA 5C86A 3NH7H 3QXDB 2F9BT 1VFBA 2HFGL 4ZTPH 4MJIB 4JQIL 1DTUA 4IMKA 4G5ZL 4K2UH 4KI5F 4X5LA 3VWJA 3VRJA 3MRDA 1DBMH 1LEIA 5JTWA 1URLA 4YQXL 1T22A 5I8KH 4HXAH 1U41A 2YHGA 1NAMB 1N6UA 3QDMB 1AGCB 5DSCB 2IQ9L 5HVGB 2PETA 3C6LC 1IKFL 3F7RA 2ADGA 3DXAA 2QR0A 1F45A 5E2WH 4O5LL 3JV5A 2XTJD 1JGEB 2IWGA 2BVTA 1WEJL 2OM5A 4JGMA 5IGXL 1S7SA 1MWAB 4NRZA 4P5TB 4RAUA 3RIFK 2MTPA 5E5UB 5DMGC 4LHUA 4WHTA 2IQAB 1Q9OB 4FQHB 1OM3L 1FAIL 4GG6F 5DLMH 4KQ4L 4NUGH 3MLXH 5MHSE 1YNLL 4K3EL 1IILE 2IGFL 5IMLA 2YSSB 1ZHBA 1WTGT 2KBGA 2QHRL 3V6OE 4G6KL 3EZ8A 2PW1A 4O58L 3P73A 4YDLB 1ZGLB 5CEZD 5I1EH 4MSWA 2IALB 1ODAA 4ZTOH 1AQDB 5IEKA 1PY9A 4PJ7F 4J1UA 4U7MA 1EGJH 1AQKL 4PTUA 4PJHF 3PQYA 1BFVL 5IJKA 1WGOA 1A6VH 4MHHG 4YIQA 2FHCA 2PR4L 4IRSA 1T3FB 4YHYC 3PHQA 2QQNH 3CPLA 5DJAA 3OKKB 4C59B 1U8QB 3MOAL 1DFBH 1T1YA 2OTUB 1BD2E 1UQSA 4XHJC 1CICB 5ADOL 4LCIH 3LQZA 5D1ZA 2YZ1A 2W0KA 2O61B 2ZJSH 1K5NA 4N9OB 1U8JB 3W81A 1L7TL 4UT7L 4TULL 1OGAB 4LCWA 3E8UL 3MLUH 1I3RA 4TUOB 1N8ZB 1IVLA 3K2MC 3UPAA 3MCKA 43CAA 5HHXH 4HS3A 5LKNA 5K9QG 4Q9RH 2UYLB 4RAHA 1FDLL 5I8EA 4DZBB 2R0KL 5BCAA 2HT2D 3PDOA 5FO8A 3BISA 3WXVL 3RTQA 5DURB 4NQEE 3FHQA 1O7SA 1XGUA 1QOKA 2PTTA 3MUY1 1GXEA 1BJ1H 3RBGA 4HLZH 3O0RL 4HK3J 2G75B 1N59A 3QDGE 4P5MB 1QPPA 2FEDD 3GI8H 4U1LB 4CVXB 1TPXB 3C60C 1JL8A 5BVJA 5GPRA 4JM2F 3N1MC 4PJAB 1P6FA 4ZFGL 3VFOA 1SJXA 1DLFL 2HLAB 4FQPA 2KUTA 3ETBF 1ZA6A 2CKNA 5IVXF 2RCSH 1P2CB 2DRUA 4ETQA 3MV8D 3TA3C 3NFSH 1FE8L 4I9WE 4LHUD 3N06B 5L8KB 4OLUH 5HDLA 4KTDL 4X80H 3FHAA 4IS6B 5E9DE 1H15A 1LGVA 2J88L 3FT4B 5CHNA 1OP3K 1LDSA 2YD6A 3GMQA 2LE9A 4MZ3A 4UIMB 1UWGL 1G0DA 1RUAL 2J2ZA 3CUPA 1NLDL 1XF5A 3BH9B 1PFCA 2MQ3A 3N85H 5E56A 5HYFA 1AI1H 2R8SL 4LLQB 5D7SL 1ONQA 2KL6A 1R0AL 1S9VB 1BAFH 3QISA 3ARDA 5CINL 4CMHB 1YYLH 1FFPB 4ODWA 5F1IA 4YXHH 2QBWA 1CK0H 5EOCL 5GRZA 1CR9L 5HPMB 3L3KB 1I85A 4Y5YC 3RFZC 4NBZB 2YS4A 1T20A 3DHMA 2E8ZA 3ARBB 3DNKA 3HE6D 3HN3A 1HQRB 3QULB 2X4TA 3BUYB 4YLQT 3QIUC 2DLHA 5J57B 2DLFL 5EOCJ 5C0EB 1W72H 3QXTA 1F90L 3IETA 4DKAA 3ZHDA 3OV6A 3PGCB 3STZB 3LQAH 1VFAA 3G5XB 3L3IA 4LCWD 5CJ8A 3ULUD 3AY4C 1TXKA 4GS7B 4HX1B 4L4TD 5C07E 5JOPD 4XNUL 1EHNA 3JWOC 3I6GA 5GGSA 1WAAE 5DVKA 1BP3B 4L5FL 3AAZA 1DUZA 2VWEC 3DMMC 4QRTB 5F7EL 5TH2A 2MQ0A 4PJ8A 1KV3A 3LKRB 4M1DL 3MV11 2ED7A 1Z9SA 4I48A 2IAND 5ICYB 3MV8B 3CFCL 1IAIL 2UWEA 2XV6B 1YNTB 3H3KA 2E9BA 1KPUB 3SGEI 4J3OC 3PGDA 5BQ7A 3NAAH 2Q8BH 1MREL 3IS0X 5JXAL 4XXDB 1EUUA 3WHXB 3RP1A 4FXKB 3PWVA 4ZQKB 4C56E 5JW5A 4AL8H 5LJYH 4FA8A 4U6XB 2XYCA 1A3LL 5C71A 1CT8B 3DX6B 3L7EA 1TQCC 2QQLH 3MREA 4TVPH 2NXZD 4WFEE 3T09A 2HFEA 3OXSA 1KCVH 5DRXB 3FQWA 1WBXA 2J4WH 3RHWK 4DTGL 4F7CA 5KN5A 1CD8A 4K94H 3EOTL 3ULSA 2AJSH 1D5IH 4HPOH 2XWTB 3TIEB 2Y5EA 1C5DA 3KG5A 3LKQB 3CFKA 2VZ1A 3HE6B 5CIPB 5E1AA 1SVCP 4G42B 1E4WH 3DROB 4E41B 7CGTA 3F62A 2Q76A 5IMMA 1UB5B 2FJHB 3QCVL 1FNGB 4F7PA 1QLFB 3O41B 4X5WB 3MNWA 4U2ZA 2EEBA 3ARDD 3CFIC 3TBSB 4UTBL 3HI1B 1GZPA 4OD2B 4L4TB 3UYRH 1FNEA 1WBYA 2Z8RA 1U2CA 3V0WH 4UBDD 1RUPL 3CD4A 5H94A 3DPBA 4IMLA 1CFTA 3VWJC 1KGCE 2XY1A 4JM4H 1UB6A 3LRSB 4X6EB 1IEBA 3SDCA 3B3IB 4YZFF 3WIHH 1AJ7H 5HHOB 3TC9A 4OZ4A 5TDNA 1JGDB 1YYMH 4XVJH 1BVZA 1KPVA 2IANB 2AK1L 4Y8DC 5J6GB 4JFEA 1IC1A 1YPZF 1OOAA 3P30L 5SV3A 5D6CA 1MRDL 1XF1A 2GJZB 3GUTA 3F65A 4UDTB 2GCYB 1ZVSB 3P4LA 3D48R 4MNGB 4ZUSA 4HPYL 5EBWA 3ZKQD 5MI0C 3KPQA 4Y4HA 4HKBA 4I8DA 4NZJA 3VFRA 2ZUQC 2DL2A 4MDIB 2Q20A 4AIZA 2I24N 1NCCH 4XNQB 3SCMC 2R69L 5C0JB 1NCTA 4OM1H 3QEUA 2X4UA 2VZOA 3MX0A 4JY4B 3BP7A 2PTVA 1WFTA 3HZMA 1JCKA 2DF3A 4R0LA 3BFOA 5T5NF 1ADQH 1MFDH 4OCYL 1X5JA 4WFHE 1IM3A 1E27A 2R29H 5EZJB 1JNLH 3TGXA 1LNUB 1JYWA 1J5OH 1JGLH 4BSVA 5DUPL 1VADB 2WWMD 1AGDA 2APVA 5AWNL 3QNZA 4KROC 2HH0H 3WN5B 4Y4KC 2ARJA 1RFDL 1MVFA 2EICA 4OKVA 4YFLF 4L8SB 4N0FA 5DFTA 1KB5B 1QO3A 3FTGA 2Y25A 3GSXB 4K3HA 4ALAL 4X8JB 4RWHA 3IRZA 5JQ6H 4XPFH 3FCTA 5CWSA 2ZNWA 2XN9E 4JFXA 3F5WB 1CD0A 4N68A 2RR3A 1TJIL 1S78C 1RURH 1MCNA 1EPFA 3LMJL 5FO9A 2AV1A 1YDPA 3K8MA 2Q86B 3OKDA 1T0NB 3I3DA 2UY7A 1BAFL 4U3CA 4LFHD 4F3FA 1CK0L 1MY7A 4UV4L 1ZKAA 4OGYH 1ETZA 1ZHLB 1B4JH 5KSVA 3GM0A 3TIDA 4L1HA 4OLVL 5I1CL 1D6VH 1PX4A 4MDJA 2XQYG 2F53A 4YUEL 3G6DH 4F8QA 3OR6B 5DTFA 3RTQC 1I1AB 1Q9LA 4OGZA 4XVTL 3UTSA 4XX1E 3SDCD 2R2CA 3RL2A 3D3VE 1W72L 4MJ5B 2V9QA 5DFWH 4GW5B 1E4XI 1TZGL 3QCUL 4JKLA 3LQAL 2LVEA 5F9DC 1YEFH 4KRMB 4EZMA 5D4QA 5EOTB 3VH8G 2DQDL 4BH8B 4HF5H 3RWDA 3QUMH 4JFED 3V0VA 1UZ6F 3GEWB 1YEDB 4GLRH 4NO3B 3QZWB 4R90L 3BP4A 4X83A 1KELL 2DN7A 3QWQB 4N0UA 2NTFA 4WNQB 4LKCB 1RULL 3DI3B 3EDKA 4J3TA 5AZ2H 4Y4HD 3B43A 2EE6A 4LQ1A 1U91A 5A2LH 4WFGE 1R5IA 1PX3A 2YUWA 3D0VA 4AQOA 2ESVD 3SKMA 5GJTL 2H32H 4NCC2 4YDKH 1QRNA 3EYOA 1A14L 1FVCA 1R3JA 3VG9B 2BVQB 1X5IA 2DM3A 4X9IA 4Y5XB 5GRUH 2X70B 3T2PA 5FA4B 1QLRA 4FQXB 3RGVA 4WY7H 3WO4C 3UTTE 1BQHG 3WFDL 3GIZL 1QACA 2AVGA 2B5IC 4FZ8H 4PPTA 2J12B 4KDTA 3VMPA 4CN1A 4Z7WA 5AUMB 3WL9A 3FN3A 4NN7C 2R2BB 3OKMB 4YBQD 1OCWL 4JE4B 1CXFA 1NFDA 4KKLD 5DS8A 3VXQA 2LU4A 4OUUB 4P4KC 5K9OB 1OAUH 2Z4QB 3BEWA 5E70A 1XF4A 1HI6A 1RZFH 4Y2DC 5FUZL 3RX5A 1S7VA 1ZVHA 4AEHL 1F3RB 4ZAKC 3U0WH 4XNYL 4M4RA 4X7FC 2WNGA 4S1QL 3FJTA 4TVSa 2CDFB 4WI7A 2BSTB 4KPHH 5FO7B 3F7YA 2MNUA 3SE4A 1CDGA 4ELKB 1FNLA 4JB9H 4HMCA 4E42A 2XQBH 1WQVT 1F4HA 1RHFA 4KJWD 2RB8A 1NUGA 3UYRL 2B2XH 2R2EA 2X9XA 3JTSB 5DMKB 1EDQA 3V0WL 2HN7B 3BJ91 5IBUG 5D2NC 3DWTA 3S37L 2F53D 3V7AG 5IHUH 3RJDA 3O6FA 4JLRA 2A77H 4JM4L 3BN9C 3UPRA 3UTSD 5HHQB 5F7NC 1AJ7L 1U8HB 5E2TH 5LWYL 1F11A 2ESVB 2WV3A 5ITBH 3OJMB 3GRWA 4OD3L 4J3WA 4OZGB 3FO0H 2BRRL 3WFBL 3UXFA 2XZAH 5F88A 1BGXL 1I3UA 5ETUA 3OAUH 2Y1VA 5AD0B 3NIDE 3BGMA 4ZNCD 1X4XA 4HFUH 4DKEH 3CVIL 4NGHH 3QYCA 4TUKH 4YHNB 4JANB 1YN7B 3RGHA 1J7VR 4GRMA 4LNRA 1KENL 5DJZA 4UNUA 3UC0H 2VLKE 3M8OL 2I27N 3J8F7 2B4CL 3O9WD 4L9LC 3SJVB 1CLCA 3IFNH 4I3SH 2ZUUA 4PJXE 1LDPH 2G2RA 2EE2A 2WMPA 5IHZA 3L5HA 1J05A 1XR9A 2ARJQ 4M5YH 4X7DC 2R29L 3HPJB 3ALWA 3G6JA 3S9DB 2PF6A 4L8CB 1CU4H 2YD7A 1PKQA 4QF1B 4ODUB 2LTQB 2CRYA 4NZRL 1GGIH 3NCCB 4KKBD 3LQAC 3U48A 2E7MA 2X4RA 3U0TB 3PL6C 4U1KB 1YMHA 1AD9B 1KCKA 2IPUG 2YN5A 5BS0B 5I0DA 1FL5A 4K3GA 5MP6H 1I1YA 1KC5L 4LRIA 3UJJH 4PTTB 4ZD3H 4YHPB 5HI5D 3LV3A 5JQ6L 1UH3A 1WV7T 4YO0A 4FABL 3L5XH 5LCVL 4ELMA 5J13B 4UV7H 3DUSA 3BIBX 2BX5A 3U79A 12E8L 4UAOC 4IRZL 3VCLA 3VXSA 1NBVL 1OLZA 1A7RL 3WS3A 3Q48A 5L9DH 4M3JA 4LU5L 4NRYB 3U6RB 4RIRB 2XZCH 3SDDB 1N4XH 3UDWC 5KS9F 5BRZD 5D1QA 2YUXA 2YKLH 4QRQA 3V4VH 1WCBB 1J0HA 1JV5A 1ZWIA 4WRLA 4E5XA 4IOFC 4HUWB 4L8BA 4Z7VB 4PJBB 1UZ8A 3WLWC 1QFOA 3O6FD 4PFEA 3T0AA 3IFLL 2VR4A 1CF8H 1WAAF 2E5EA 1PVHA 5J3HC 2DQHL 2Y06H 3F12A 4HEPG 2CRMA 3FQNA 2P24A 5DJ2B 3NFNA 5B39B 3O9WB 3RVVD 3EFFA 2AXGB 4QRPB 1RIUL 1L4IA 1ZT1B 2O5XH 2VZTA 3CSYA 4WW1A 4MA8L 2FR4B 2B39A 4RMQA 1NMAL 1PY4A 2IBZY 5EFIB 1CFNB 2YPKB 1C12A 1D6EA 4X4YA 2A9NH 4ZXBC 1AXIB 1R5WA 3MRIB 1XR8B 3IS1X 4LL9A 5C08E 3WD5H 3NGBB 3GJFB 5TDOB 5DQJA 1CFBA 1EEYB 2N1KA 2A9ML 4IRJB 2HLFD 4L3EE 3DETD 1KTRL 5GGTH 3RNKB 4I1NB 5DQ9B 3VW3L 3DUUA 5FUOL 1BBJB 2GTZA 2VQTA 2H26B 5GRUL 2RFXB 4QOKA 1BM3H 4WY7L 3EDFA 2BY2A 1HH9B 2WW8A 4MJIE 1RJZB 2HA1A 1FVEB 4HLZG 1P1ZB 1A4KB 2MQCA 4FZ8L 4O2CB 4N90D 5DRZA 5TDPB 3RAJL 2YMXL 4YWGH 3LEXB 3OKLA 1I8LA 5SWZB 1V3MA 2MCPL 4NQSA 1YEKH 1IAIM 1QP1A 5FA3B 1FC1A 5BRZB 1SM3H 4NO5B 2MPAH 5IB5A 2D3VA 3LPFA 4PIRF 2YZ8A 4ONGL 5KSUA 1FV1B 4Y16C 1MRFH 4MCZB 3W82A 3HC3H 5DO2D 3C5ZA 4Z0XB 1S7TB 4KPHL 3T1FA 1QSEA 1T21A 1A7QH 4OIBA 2PTUA 5JOEA 1HDMA 4JB9L 4HUXB 2B4CC 1JPST 2G5BB 4N0CC 4J3XA 4ZNEA 4MA3B 4RMSA 4RGOL 5JOFB 3EOAA 3HG1D 5J1SC 5TPWL 2ADJA 1JHKH 5JMOC 4U1GC 3EIFA 1MAJA 1FN4B 1IMHC 1HXYA 1WFNA 4UINH 4X6CB 3TZVA 4CKVX 1T1ZA 4YBLC 2GFBA 3BPLB 3V9FA 4HUUB 1OW0C 1IARB 1U8PA 3EJJX 4LQFH 3O2VL 3WXWL 1N0LA 4GAFB 3OPZH 4EEEA 5JHLH 2X5PA 5ITBL 5KSAC 4KU1A 5A1AA 3OJ2C 1DVFB 3QXAB 1IC4L 1EAPA 1NDGB 3WHE1 4H25A 1VFUA 3GMRB 3OJVC 2XZAL 3VI3E 3KDMB 4PGZA 2ILLA 3LH2L 3OAUL 4PJIA 2CDGA 4I0PA 4LVHB 1Q72H 3IXAA 1WICA 3BZFA 1N7ML 2QKIB 5FB8B 4JZNB 5T3XH 2Q7YA 3GJEA 3X13A 4QTHA 5INDB 1OGAE 3S35X 1H3GA 4NBXB 2AJYH 5EOQL 4AMKL 2DMBA 3CDCA 2R39A 5EBLA 2OZ4A 3JV4B 1LDPL 5L2KB 2HJLA 3D39B 4QOKD 5L7XL 4XCCL 5KTEL 1W8OA 1B3JA 5F9AC 4M5YL 1EO7A 3BN3B 1WT5A 1CE1H 3FFCB 2NX5A 4F33B 1V05A 3NFPB 3PIQA 4O2EA 1P4BL 4JZJC 5T1KA 4XC1H 4KRLB 5F89B 3MBED 5KVDL 3LS5L 3RIAK 4MJ4A 3ARGA 3TPUA 1LO0H 3D85D 3SKNB 1BF8A 4ZD3L 5JHDE 1CL7I 3STLB 3CAFA 4PJAE 5DMYA 4R26L 4OM0H 3GFUA 2CKBB 1KIQA 1AR1C 4UV7L 3C5ZD 4LOUC 5CEZE 4Q0XH 5B22A 5C0BA 1GZQA 3CU7A 5L9DL 3H8NA 3QFDB 3BESR 4GBXB 2AJVL 5J12C 3TNMA 5GGRB 4YDJA 1R3KA 1JF1A 3RY5A 3C6LD 3BDYH 4XCFH 3TZVD 4Y8AA 1QLEL 4HIHB 3MUZ1 1DANT 1GRWA 3Q3GB 1UACH 4J3VA 3STBA 4LMQE 2NY2C 2AABH 3LPWA 2XPGB 4G3YL 4ZS6D 4F7TA 1N6VA 5DMGD 3IJYA 2EC9T 2J6EL 5HGHA 1YY9D 5DQDH 2FGZA 4XC3L 1HHIB 4KJPC 32C2B 5EC1B 3F7VB 4XTRC 4XBPA 4IOIA 1KIUA 4PGEA 4JFZH 3VFPA 1TVHA 4MXQC 4ODSH 4U1MB 5DJXB 2JJVA 1IC7L 3RDTC 3T0VA 1QHPA 3RHWF 1MFAL 1KJ2B 5F1KC 1XF3B 5GGTL 4ISVB 3BH8A 3KPRB 5HI3D 3T0BA 5C0FA 2A6IA 1HZHL 3F58L 1OTTC 3MBEB 4ZUUA 1RY7B 4IEFB 2X10A 4KK9D 3LEVL 4PR5A 3D85B 5IB2B 3L95B 1MFEL 1T1XB 4C83B 3RL1B 1MHPH 1VPOH 3RWJA 1U3YA 4M6NH 4F7MA 2YK1H 4U7SA 4MLIA 5JUEL 1ZANL 2OL3H 5DJ6B 2NX5D 3TCXA 3VWKC 5ID1A 3I6KA 4MJ2A 4XHJD 3HRPA 4U0RC 4FMKA 2XACC 1HIMH 1MHHA 4ODXB 3UTQA 2AQ3A 5T1KD 1CS6A 3MV8E 3MRJA 2KQMA 1CIUA 5C0RL 1UGNA 3EGSB 3WIFB 3ARGD 5D1QC 5EZLA 1F2XK 2F74A 3CMGA 2E8YA 5ANMA 3FT3B 4AY0A 4CMMB 5BZDA 3KNBA 4HJ0D 4LPTA 3SO3C 3HC0A 2FX9L 1MRFL 3T04D 3TBYB 3C6LB 1EJOL 3C6SB 4F7EB 2MWCA 3ECBA 5C0BD 3GIVB 1EHXA 1CWVA 4RISL 3IDJB 4ZFZA 1BVLB 4EQ2A 4TRPH 2YA0A 1RZIA 3JVGA 3GSUB 4EDWH 4M6OH 4OCSH 4U1IB 5F7LB 3O3DB 1NJ9A 5GGRY 1IEAA 5TF1L 1BFOA 1LO5B 3IDGA 5TF0A 1ZEAH 5CD5C 3C60D 2JCCB 3ULVD 2D31A 4LDEB 2WINA 2AEPL 4JKMA 4E41E 1CGUA 3MLYH 4JHZA 2FD6L 1FRGL 3NIDF 4Z78A 5GS1C 3FO9B 3ULUE 3O2DA 2HG5A 1VKXB 3E3QC 3L5JA 5DRNA 4L4TE 3ARRA 5JOPE 3EHBD 3BPNC 4P23A 2AK4B 4Z76A 5DD3H 3B2VH 3CLFH 4YHYB 35C8H 2JE8A 3GSQA 4XVSL 4O4YL 1WBZB 1I7ZA 3P9WB 3S7GA 4PJXF 1A1MB 5ESVA 4YPGB 5HHOE 2JKXA 3PJSB 4JAMB 3A6CL 1FO0H 2BZDA 2IADB 2IANE 3WEXB 1BQHA 4XGZB 4S0TD 4G8EB 1K3ZA 1MJ7H 1INEL 3UX9B 2B0SH 5EPMA 3MRFA 1J88A 4WIQA 4MNGE 1B6UA 2BSRA 1YEHL 1JNJA 2Q6WB 1YJDH 4PGDB 1NH6A 4H5SA 1JZ7A 1M7DA 1N0XH 2XA3A 2CIIA 1MI5B 2X89A 3O4LB 2DTMH 3QIUD 1GIGH 1B0GB 1P5UA 4KDWA 4NFBA 4NM8H 4PRPB 3B5HA 2CGRL 5E8EB 5IOPB 3QNYB 5EO9B 1NCAH 3O8XC 1ITBB 2AEWA 3MCLH 1A6PA 1EFXB 4HWZB 2VTFA 3MRLB 3MRPB 5IROC 4R4BA 2FRGP 4HDIB 4YC2C 1FVDB 3ESVF 5I73C 1G84A 1RMFH 3BX7C 2JK5B 1RU9H 3C60B 1LP9A 5ACLA 2J8UA 1FFQA 5A2FA 1QVOB 5F6HJ 1EMTL 2XWBA 4Q0XL 1ZA3B 3IFPB 3DO3A 4XNZC 4HG4J 4DKFH 1XIWA 3C08L 4ZSOA 2EDNA 2JJTC 1NMBL 4Y4FC 5FCUH 1P4LA 4PJGB 3V6FB 3TA3B 1U92A 2DLEA 2FHBA 3V6ZA 3Q0HA 1Y18B 3A67H 2VDOL 4M7KH 5D5MA 3UTPD 3MA7A 1FFOB 1ACZA 3H7LA 4I0PC 4U6HA 2C9AA 3MZGB 4MNQB 2IFFL 4LGSB 1LE9A 1HEZB 3P4NA 1HHHA 1GGBL 2R1WA 4PB0H 2I07A 4BZYA 5GGVH 3V5HB 1WJ3A 3NOIA 1KT2B 2AABL 5BZWA 2ORBL 5KBNC 4W70A 5CLWA 4JG0H 3MFGB 1UXWB 4I18C 4BELD 1MLCB 2LABA 1B6DA 3AMLA 4MAYC 5I16A 2IAMA 5GGUB 1AHWA 3EYUL 4Y5YB 3QUZA 4ODSL 2ICEB 4MVBC 1ZT7A 4Z95H 4PJ9A 1DBKL 1D5ZA 4QRSB 1BZ9B 3BGFC 4KI1A 4WU7B 2ADIA 2HMIC 4OKDA 2FIKB 3QIUB 3B9KA 5E99L 1CXHA 3KYNB 2DQUH 1IGML 4BFGA 1XGRB 4PP1C 3ZYJA 3O2DL 1FNSH 2VKWA 2VJXA 4HKJA 4LIQL 2P5WA 3UMTA 1G7JA 3LKPB 1PG7H 4U33A 4X98B 1X7QA 4NM4H 4APQC 3CGTA 3OKYA 3L3HA 2ICCA 3PXHA 4U1NA 3BHBB 4OI7A 1NFIA 2OL3L 3GNML 3GMOA 4YPJA 2X89D 4OI9A 3MMEA 4M43H 3X14A 1G7MB 4R7NA 4MJ6B 1H3WM 1QA9A 3DMMB 1BJMA 4S1SL 3W0WB 4WWKC 2PYFB 4OLYH 3EJZD 2Y6SD 1EO8L 2YUZA 2ZOLB 1NFKA 4I77H 4KVNH 1T1WA 4NOBA 5F1SA 3FB8A 3GJFK 1BIIA 4XP5H 1V8HA 3VH8B 5D6DA 3TJHC 1XGTA 3AROA 3MYJA 4D3CL 3VD4A 1RIVL 4JG1H 1XIWD 4L3AA 4K7PX 1T5WA 3P4MB 1FGNL 1HN1A 1TQCB 1VGEH 3SDAC 2GAZA 1EGJA 3B9AA 5JDSA 2HP4A 3HNSH 4YNYB 1FBIL 3ARZA 5CEXB 1F6FB 3BP5B 4LF3B 1G7PA 1MJ8H 2R4SH 2CLVA 4LHJB 1I7RA 2APWA 4WUUA 2DKMA 4NNYA 5T33H 3G08B 3VI3F 3DV6A 1SBSH 1PD6A 3A6BL 1MRCH 4XPAL 1FORH 2EIDA 3DVIA 4MQSB 1LE5B 3WS6A 3CZFA 1VACB 4R4NC 2EDHA 4PGCA 3HCVB 1JUFA 4AG4H 3S4SB 5I1DA 5EO1B 1KTDB 2OLDA 1C8PA 1HILA 1SMOA 2EDBA 5DRWB 5DJDA 2IAMD 3S96B 3CLFL 3S34L 1A7NL 2W9LA 5SWSA 3QUZD 1ZTXL 2XXMB 4HT1H 3QPXL 3I3EA 2OS7A 4PJ9D 5GISL 3CCHB 3GGWA 3IFOA 4G43B 5FHAH 2DQGH 5HVWA 5J1AA 3RWHA 5K59E 2NY4C 1U42A 6CGTA 4HXBH 2XFXB 3P0YL 3HHRB 4OZGE 3QEQA 4XMLL 2FLRT 1E28A 3U4BL 5GRVK 3Q1SH 2B0SL 2EKJA 5FM4A 1TCRB 3GHEL 3S36L 2WP3T 1YJDL 3JWNC 4B0MM 1N0XL 3FT2A 3MJ6A 5MI0B 3DIFB 2VXVL 4FNLL 1OSZB 3RX8A 4LLVB 5L6YL 4NO2B 2ICWA 4TSBL 2XRAL 3IAGC 3SJVE 2ZUQB 5IBUB 1A5FH 2NYYC 5CEYA 2JB5L 1I7TB 2GIYA 4MQXC 4Y19B 1NGQH 1IC5L 1JGVH 3SCMB 4Z5RB 1ZHNA 2DI9A 3U4EB 4WV1C 4N5UA 3BE1L 2N4IA 3BMVA 2C4XA 1H3TA 4DZ8A 5EU4A 3OR7A 4JFDA 3I9GH 3NPSC 2QL1A 4PS4L 2HFFB 2J1KA 4OSUH 4FXLA 4AIXA 3DSNA 2OR9H 5DHXB 3PABB 2ZUTA 1S7WA 4CW1B 3HZVB 5ESAA 1FG2A 4KV5E 5DI8B 5C0GA 2UY6A 5J9PA 2OJZH 1M71A 3SHSA 3ARFC 5FUCE 5BS0E 1YEJH 2CLZA 4KROB 3MV7B 2FO4B 4Y4KB 2LQRA 4P23C 4NQUA 3ALXA 1T7WA 1MHCB 5E8OA 4WUUD 4C4KO 3HR5A 3MRCB 4FQJH 1M7IA 2CPCA 4QHMA 4KMTH 2APBA 4KXZH 3U9UA 4GQ9H 2F8VA 4KRNA 1NAMH 1K5NB 5TQ0H 2LAGB 5IM7A 4U6YA 3CLEH 3EO1A 1RZJH 4C58B 5DEGB 2AKRA 2NY3C 3I75A 4LHQB 3BZEA 4P4KD 4Z7VE 2VOTA 3H9SA 4PJBE 1L6ZA 3MRKB 1QG3A 5M94B 4EI6A 1DBBH 3NMEA 5D9SB 5F7UA 4Y2DD 1I9IL 1I9JL 2OJEB 4Z95L 2ZSWB 2FECL 4BKLB 3O6KH 3ROLA 2R0WL 1OAKL 2I26N 2FB4H 1FNSL 2PUQT 4GG6A 4QRPE 1IAOA 5L88L 3QEQD 5E5RB 2GTWB 4KAQL 1PG7L 3CSBA 4EI5C 3C8KA 3V4PH 4V1DA 4X0KB 3EYSH 2DM4A 3VRLE 4DEPC 2AV7B 1D9KA 1CZ8L 5FECB 3MRQB 1YQVL 3KVQA 3MRNA 4QKXB 4P2YA 5D71H 3NTCL 3H3BC 2C26A 4TTDC 1D5XB 4MAUL 4OF6A 2VLLB 4PJHA 5EC2A 3VFNB 1KACB 1J1PH 4OLYL 5F9OL 5HGBA 1R3IH 4I77L 3BKCH 2NLJA 3V79C 4OGXH 5KAQG 4LGRB 4KVNL 3DGCR 5ID0A 1Q8MA 4H88H 1A6TA 3UZVB 4UU9B 5EWIL 4NWTH 2X09A 3NABL 4WI8A 3G6AA 3MLRH 4XP5L 5L2JB 3ES6B 4Z6AT 1BHGA 3GSOA 2OX5A 3WBDA 1BJ1J 3WO4B 3VG0H 4JG1L 4Z7UB 3GB7A 4KH2A 1T83A 5SWZE 3V5KB 3MOBL 2E3VA 2Y72A 3QQ3A 4L1DA 4CVZA 1VGEL 3HS0A 4I3RH 4NQVA 5D8JL 3MO1B 4EVNB 2F54D 3LS4H 5CZKA 5BRZE 1LD9A 1NBQA 4OCLC 4AIOA 3MV9B 2FSEB 2G9HB 2YC1A 1SYVB 3ZZ1A 1WSST 4P4KB 2DYPA 1AHWC 3ULUF 2R1XA 1DDHA 2ICWJ 1WIPA 5SX5K 4X4MA 3MLVL 4Y2DB 1YJDC 4KI5D 3VFWA 3VFGH 4F9LC 3RWGB 5BJTB 4ZAKB 2I5YH 1U58A 1MFNA 4F37K 4XWGL 3T0WA 3AS0A 4PRNB 3LQMA 4G8FA 1I75A 2IC2A 3MUGA 1C16A 4AH2A 4POZD 1LEKA 2HRPH 1FLRL 4MD4A 3LKOA 3BKYH 2VLMD 4MB5A 3L3OB 4JM2A 3U7YH 3H9SD 4R3SA 4X7TA 4NPYB 5IEHB 4M8VA 3TBWA 4O2FB 5LAXB 1DBJL 1L9NA 3BW9B 4X6CE 1ED3B 1PZ5B 3RIAF 4OAWA 4N1CA 5D2NB 5IVXA 3ABZA 1WZMA 3BP6A 1UH2A 3AREA 1S9XA 1H3PH 5F44A 1I3VA 3DTXA 5GRJL 3TO2A 4PRDA 2LU3A 2ZZUT 5E6IA 4XB8A 1KJVB 4G80A 4V1DD 3EZJB 1RK1A 1NC4A 1IGTA 1OP5K 5DHVA 1HHJA 1C5CL 1YMMB 1NC2A 3W5MA 3ZO0A 5I1HH 5MEOA 2ITCB 3VE0B 4LKXB 1ADQA 5C3LD 1JI1A 3EYQD 4UQ3B 1A7PL 4QHKJ 4F9PA 2HTKD 3BKJL 3CDFA 4GMSL 1INDL 2R1YB 3FFDA 5J11C 4JFQB 4FTVB 3MOQA 4G9FB 1JZ3A 3ROOB 4TVPD 3TCLA 1I4FB 2ZOKA 2EXYD 2F54B 4L9LB 5FK9B 3LN4A 3GSNA 4B50A 5L2KE 3D39E 5BMFL 3MRGB 2V2TA 5IVNA 1DEEB 2C3XA 4YHLH 3FQWB 3ZT5A 4OZIB 4TPRL 2IMNA 1EHLH 3CFBB 5I1IH 2GJ6B 3CFKB 3FFCE 4IBLT 4OSUL 4UDUB 4ZXBD 3RVTC 2GJJA 3X3FL 2W07A 1RJLA 2QQKH 4GAJL 1S7QA 1INQB 5DVOA 5HGAB 1QFUL 1ACYL 3SPVA 2Y07L 4OBSA 2CIKB 4M5ZH 4BM7A 1Q94B 5BVPL 4KK8C 1W72B 3CFEA 1W0VA 1OTSC 1G7LB 2BOCB 4LEOB 4QXWA 3PL6B 3U9PL 5FKPA 2VLRD 4OT1H 3B83A 4P2RB 4JRXB 4M7JH 5TE7L 3T65A 4FQIH 3WJLC 3LN5A 5C7XL 1Z0NA 3AXLB 3JTTA 3WLBA 3DBXA 2H2PD 3WDHA 1BZ7B 2ZUVA 4UAOB 2BDNH 5TQ0L 2Y5TB 5DJYA 5I66B 1BX2B 1N2RB 3QUMA 5DC4B 3HUJB 4JM2D 1FZOB 3BUTA 1JPTL 3HMWH 2IPKB 1Q9WA 5D1XA 2H9GB 5GGSY 1VHPA 5SX4I 1KTKE 5E08H 4LLDB 1ZV5A 4URTB 4Y16D 1IAMA 1CGVA 3PUCA 1DQJA 3SGDH 3ARED 4P2QA 5I8CB 1OAYH 5DUBA 1M05A 1YY8A 2BVPB 2BNRA 3KLAB 1IGCL 2H32A 1G7HB 4N0CD 4YGVB 3SGJC 4PV9A 2GW5A 3S3JA 3WKMH 1OAZL 1UM5H 4U1HB 5BV7L 4N8CL 4WJ5B 5CGYC 2WUBL 3VGBA 5JIKA 2H45A 4BQ6A 4S11A 3EDDA 1NC2D 1MLBB 3HE7A 2IG2L 4GKZB 3X11B 1PDKA 4ZXBB 4ERSH 3K2UL 3O11A 4ZUVB 3NACH 4RBPK 3C2AH 2DQEL 2COQA 2P46B 3KPRE 3RVUD 1J1PL 1UKTA 2UZIL 2VL5B 5HDQH 4HG4K 3D9AH 1IT9H 4CNIA 2F19L 4RA3A 2PYED 4K71C 4WU5A 4PJEB 1AO7A 2VLRB 3KYMB 1CQKA 4XX1G 1RJYB 4XNMB 4IDLA 1XGYL 4JY6B 4WEUD 2GK2A 1NANI 2AJXL 4PJFA 2IBBA 3VU2A 4QTIH 2WBKA 5MEPB 4G6MH 1YDPB 4HKZA 2NY7H 5FAAA 1YPZA 5CLTA 1HHKA 5H37G 1KCRH 3GSNL 2EZ0C 5CSZA 2C5DC 2EIZA 1OT1A 4X6FA 5A3IC 1NGWA 4ENEC 5JW3L 3L7FA 1MCKA 5B3JE 1AY1L 4JO4L 3CK0H 1MCEA 4OV5B 1UEYA 3VFGL 4EOWL 4JO2H 3FOLB 4Y16B 3VFVB 3RA7H 5B4MC 2YXMA 3EJYC 1QFWM 3TN0A 1DQLH 3ALPA 3ESUF 2XQYK 1A1OA 3FB5B 3ARWA 1U6AL 4L3CA 5EU5A 5ICXA 4HAFA 4OCXL 1JPFA 2CLRB 3EO9H 3H0TA 3HPLA 5KVGL 1KEGH 3B4NA 2VDNH 3REVA 4D94A 1HOCB 4JRYB 2EDJA 1GAFL 4Q6IC 3IGAA 5EU6A 3SOBH 4OZGF 2JCCE 2ED9A 5IIEA 4LSUL 2AI0L 4F80A 4U1GB 5C6TH 3GKWH 4HUMB 2AJZB 2WIIA 1N5YL 4YBLB 1SJVA 3KXFA 1HYSC 43C9A 2VLJB 1SEQH 3M1BA 1O0VA 3E0GA 2VXSL 5K9QI 1WCQA 4S10A 4XZUA 3MR9A 3SKJH 5KSAB 4NHUA 3JWDH 3P9MB 1IM9D 2PYEB 5HJ3A 2AK4E 2E7CA 2BERA 5KSBB 1T2JA 2DBLH 4TN9A 3WUZA 3N9GH 1KJMB 3VXUB 4QEGA 4U0QB 3T1WA 1C1EH 4ZFOA 3RI5K 3FONA 3MLWH 4HIEA 4XMPL 2FEEI 4XCEA 1B2WH 1MH5A 2R56L 2CUIA 5FYJL 4PBVC 1U8NB 3N1PC 4TNVK 3OKEB 4KV5F 3F6IA 1MUJA 1AO7D 3PGFH 3OAYK 3HI5L 4N1EA 1MIEH 2FZ3B 4WW2A 1FG9C 1BQLH 1MQ8A 4AENB 3L3DA 4XTRD 5DD1L 4PRAB 5I1IL 4DW2H 3FMGH 1MI5E 3O4LE 4LCCA 4NQXA 2A6JA 3G04B 5GZNC 1U8IA 5F7FA 2BCKB 4PRPE 3VMOA 1TVBA 4M5ZL 4OCNC 4OCMC 3UTZA 1I9RH 4JZJB 4L8DA 4PJCB 4ZMAT 4XHQA 4YR6B 3GSRA 4HV8B 4XRCB 2HJFA 2Y9RT 2CQVA 5DUML 15C8L 3JXAA 3MJ9H 1WFOA 3B8YA 5I1KH 1DUYA 3BT2H 4FQIL 1UC6A 5IMOB 4Y2OA 3LOWA 5J6HA 5ISZB 4Z7VF 4PJBF 4J23A 3FO1B 5BW7A 3AUVA 5ERWA 2BDNL 3BAEH 1TQBC 4PJGE 3KPTA 5E6IC 3N50A 1A6AA 2HWZH 4JDZA 2JJWA 2XIDA 4ONHB 3INUL 3MTRA 1IM9B 4FG6C 3DSFL 3HI6L 5J12B 4JJ5B 5EU6D 3OXRA 4MNQE 2Z8WC 2GK0A 3RBSA 5HHVL 2P5ED 1T6VN 4MNHA 3V6OA 2GT9A 4F9PC 4XVUC 2A0LD 3VRLF 3IKCA 3PP3K 1X5LA 4HIJA 3KXFD 3HTLX 2ZCKH 5GZOD 2JELL 3GO1L 5INCA 3PV6A 1RUKL 2NY2B 2EO9A 1R3LA 2VZSA 4D0BB 3O3EB 4J2XA 3ZKNC 4Z7WF 5I15H 1OF2A 4OCRH 3RWFA 4HHAA 1KNOA 5IW6A 5GIRB 3QUKA 3VFTA 3E6HA 1G9NH 4XP9H 4F58L 4S2SA 4ERSL 5C2UB 1DN2A 2EDFA 1IGIL 3HNVH 1CBVL 1TJGL 4PRIB 3NCJH 1RZKH 4OFYA 5F1NB 1BD2A 5FYKH 1Q9KA 4IDJL 3RDTB 1AGFB 2ZKHH 4JPKH 3D9AL 4PV8A 2WUCH 4WUKL 5K9JL 3KJ6H 1JHTA 3QUYD 1WITA 4XAWH 3MLSL 1UVQB 1LK3H 2BHUA 1UADC 1Y6NR 3DVGB 3VFMB 4OIIH 1JYNA 1U95B 2IPUK 1F42A 4EIGB 5C0IB 2B1HH 1S5HA 4ZFOL 3QXVA 1LK2A 1RZ8B 5LGHL 2HKFL 3TYGH 3SQOH 2HT4C 1NGXA 3S88H 1L0YA 1M6OA 1PBYA 2VWEE 1CD1B 3VWKB 1D5MB 5D2LB 4NQEA 4DVBB 4U0RB 3W0WE 4WDIB 2F5BL 5DR5L 1ZLVH 1QNZL 2NNAA 2D7TL 5CMAB 3RPIB 2A73A 3QDGA 1MJUH 5D1XC 3I84A 1DQDL 1A2YB 5IKCB 2BSSA 3SO3B 4HUVA 4IJ3C 5EIQA 5KVFH 1FIEA 2WANA 3KWWB 4MWFB 3FN9A 4NKOA 4XI5D 4X6CF 2NXYD 4Y88A 2HT3D 3FQRB 1BOGB 5DZLA 3BD4A 5HI4D 5HD8C 3IDNA 2AAVA 4LSQL 1U36A 4UUJA 5E9DA 3KPLB 4EBQL 4P4RB 1NDMA 5TGBB 2OI9C 3QCTL 1AC0A 4BUHA 1XZ0A 5ALBH 1HH6A 5KANG 5MEQA 3ET9F 3OF6A 5I17B 4W6YB 1SEQL 1KIRA 3LDBC 2VZVA 2WBJA 3RUGB 2XKSA 3Q5OA 3SKJL 5IB4B 5GS1B 3JWDL 4P3CH 3BSZL 4PG9A 4OTXL 3QUYB 1Z2KA 4RSVA 1OD9A 4XCNA 3H9YA 3NZ8B 4JFFD 3MA9H 2DBLL 1E6OL 4ODBD 1S7RB 4YAQA 4HJJH 5DJ0B 2BVOB 4QLRA 3BPNB 1A9BB 5E5MB 1Y0LB 2VR5A 5IBTL 4HC1A 1P5VA 5FYLH 1K4DA 1AE6H 4MB3A 2NY5H 5AG9A 1N6QL 2OP4L 1ZSDB 5EIIA 2FGWH 4KVCL 3QG7H 5CJQL 1MCIA 2VXTH 5EUKA 4OFYD 1BD2D 4NZUH 1VGKB 1FZJB 3WFCH 4Q9QH 4BSWA 2XWJB 2SEBA 5EUOB 2DM2A 3HAEH 2B8OT 4JVUA 1TZHA 5GS0H 5KG9B 4HZAA 1F4XL 3S3SA 5F6HI 2VITA 3D6GA 4LCUA 4CADA 4PJDB 5C07A 1F2QA 3IJSA 1V7MH 3SGKA 3VGAC 1OAQL 4ODHL 1WAAA 3TBTB 1P9MC 1DQQA 1F02I 2Y7QA 4FFYL 2HMID 4ORGB 2NXYB 4NQED 5DDHA 4F57L 5HYSA 4Y19E 1CLZH 4KZDL 4DVRL 2KH2B 3LIZH 4F2MB 5HHNA 1O5DT 3O8XB 3RWIB 3R8BB 1JNNH 4FQ2L 3PP4H 2OMBA 1FH5H 4APQD 5DVLA 2IH1A 5I73B 1PQZB 1SVZA 2DQCL 4C56A 3CXDH 1A6UL 2ITDA 4XNZB 3JSSA 3BAEL 1NSNL 1TJHL 3TO4C 2EYRB 5K93A 4Y4FB 2FBJL 3MV7E 4L29B 1I8KB 4EKXA 4I9WD 4V2BA 1BECA 4HFWA 1AXTL 1HXMA 5E9DD 4JFFB 2BXZA 3QXUA 1UFUA 4HJGB 3P77A 1L7IH 2QADD 3HZKA 4DAGH 5DHYB 2P8MB 5KJRH 4PY7B 3OF6D 4QHUB 4BZ1H 2WBJD 4QYOA 4J3UA 3CSGA 4QXUH 2XY2A 2X4PA 2Q8AL 4OGAC 3AVEA 5AZEH 4Q2ZA 2R4RH 5C0AB 4DFIA 3LZFL 4DGIL 2V7NB 4I18B 5JO5B 3TVMC 1G9NL 1H5BC 4X6BB 4XP9L 8FABB 4MAYB 5DD6A 4TSAL 3U4AA 3QG6A 4J4PA 1IAKB 2AQ2A 5MEND 3BQUA 4R7DB 2BC4B 2R2HB 2NZ9D 3BI9X 3RZCC 1X6NA 4O9HL 1KB9J 2A2QT 2K7PA 2VABB 2WLYA 5FXCH 3RPKA 1K8DA 1J10A 3MZTA 1HKLH 1FYTB 1CDBA 1FL6B 1CGXA 1NCWL 3P3YA 5JNYA 3O6LH 1JN6A 1CCZA 3NZHH 1JWSA 4ZPTB 2DQTL 5C07D 3GSVB 4HC1L 5GS3A 3BEVA 3HNTH 2B1HL 4APQB 1XH3A 1GGYA 3EO0B 3FO2A 3PNWB 1S7XA 3BPCB 4HKXB 3TYGL 5I0ZA 3SQOL 3MNZA 3S88L 1QUNA 3QJHA 5B3JF 4DKDC 1QFWI 4WGVB 1I1FA 2KZWA 3D2UB 4NSKB 2BJMH 4YHKL 2VXUL 4WO4A 3QB7C 4RGNC 2LVCA 1H0DA 3ARYA 3NCEB 3QI9A 4QCIB 3JWDC 4WWKB 1CDUA 3AB0C 2A6DA 4JDVA 1NEZG 4M7LL 2PXYA 5BO1L 1DJSA 4YDJB 3ELAT 5TQ2L 4D8PB 4AEEA 1UWEL 1EA9C 3V6OC 1S9WB 4Z7UE 4K8RH 5AYUL 1S5IL 5B8CA 1I1RA 2JCCF 4PLOB 5FM5O 4BFEA 4C56D 4D9RE 2XG5A 4RAVB 3ME0A 3DV4B 4OQTH 4JQVC 3MUJA 4HW6A 2XOTA 2OXHA 3DYMA 4WFED 4OD1H 1UJ3B 3MV9E 2AS5M 4MQXD 2VISA 3SDAB 1GVIA 2FJGA 4GUPA 3PWNB 1R24A 4O02L 2Q1EA 4OLWH 4CN6A 1U8MB 2XN9A 4P57B 5HYJB 5MENB 3LKSA 2EYSA 4XPGH 2MCG1 2ZPKH 1QKZH 1YECL 2XG4A 4GW4B 4ZUTA 1NKOA 5AEAA 1FO0A 1SQ2N 1IL1B 3ARFD 4H1LB 5MERA 1WIOA 3P9LB 2UV3A 1B4RA 2YEZB 4FFWD 4QHLB 4UMGA 3P11H 1IQWL 1I7UA 4MXWH 3VJ6A 1FNFA 3MGTA 5D2NE 4NNPH 2FATH 4NP4H 4P5KB 5IV2A 1E4XL 5T1LA 3KYOA 1KGCD 1G6RL 3CVHH 4M1GL 3D3VA 1QBMH 2DWEB 2NY4B 2JIXA 3HZYA 3Q5TA 1HQ4A 4OJFL 4GJTB 1NBYA 5J56B 3B9DA 3CMOH 3T8XB 4JREC 4KHTH 1MCDA 4KK5C 3V4UH 1YMME 5FGBA 3LB6D 1U8OB 5CUSL 3MRMA 5H2BB 1SY6H 3L5WB 3MLZH 4HWBH 3DGGB 4FFZL 5DJCB 1BWMA 3ULVF 2ZNXA 4FTVE 4UIKL 4G9DA 4G9FE 1FJ1B 2W65A 4BH7B 2F54E 4WO4D 5A16B 3QI9D 5D7LD 5GS2D 4YGAB 2P48B 1UH4A 2FX8H 5FKAB 4EI5D 2PXYD 4OZIE 1NAKL 3PP4L 1BFOB 2NY1D 4WV1B 5E0QA 3KPNA 3RWCB 1G9NC 4JO1H 2GJ6E 3BIKB 5D70L 3EOYG 5T3ZL 3O45A 5JPMA 3UTTA 1KTLB 3AU1A 25C8L 3NPSB 4WFHD 3TNNB 4N5EC 4W4OC 5C8JA 1FZKB 2RGSA 4TTDD 4JGUA 2EO1A 1X44A 2CH8A 4Z7NE 1T5XA 1V3KA 4G8IB 3ARFB 4KRPD 4CJ1A 1KG0B 3QEHA 5IHBA 2F8XC 4EUPA 5F3BA 2J5LC 1JWUB 1QBAA 3L5IA 4P2RE 3NCFB 4GAGL 1S3KL 4JRXE 4R8WH 2ZUYA 1S9YB 4YX2H 2FNBA 3FB6B 4ZDHA 1YN6B 4WI6A 2XN9D 4XBEL 5JPNA 2ZCHH 1I8MB 2OL3B 2AGJH 2GSGA 2YD3A 1U8KB 4U1JB 2HVJA 5CP7A 3H2WA 4GAYA 1C08B 3L3GB 1BLNB 1OTUC 2R0ZL 1P4IL 4QXUL 1JPGA 1UJTA 4JKPL 4KFZC 3HUJE 3CU1A 1P7KB 3VXOA 1QEWA 2OK0L 3E2HC 1XCTA 2NY3B 2F15A 3SGKC 1MF2L 5A40E 4N8PA 1L0QA 4WVRA 4H5SB 2OXGA 5AAWA 3FAWA 1YUHA 2Z91B 4JR9L 5T1LD 3PWLA 2CD0A 4TTGA 1PEZA 3D3VD 3FQXA 2JIXD 5HYEA 4WHYH 4TVPE 2W9DH 3DX9A 2E6JA 3ILPB 5D7LB 2WLZA 4FRWA 1KLGA 2RJMA 2CJUH 4EI5B 1QFPA 1T89A 1F3JA 4R4BB 3SY0B 2O93L 2N7BA 4F15C 3P4OB 4E0RA 4NWUL 2AERT 4DEPB 5I74C 2DQFA 2IH3B 1LP9B 3CC5A 1OVZA 3PWJB 5F3HA 3X12B 1T0MB 2CK0L 5DEZA 2FHFA 1N3NA 1FIGL 4PJ5B 4WFGD 3D0LB 1RUQL 5IMKB 2ICWI 1PG7W 2VLKA 4MX7B 5DZNA 2Z0BA 4PP2A 4TUJA 2VLRE 5F93C 1R5VA 1SJHB 5KZCD 4P46A 4NRXB 4PJXA 4R2GD 5DC0A 1HWHB 5CBAB 5J4MA 3QH3A 1GOHA 1JRHI 4K8RL 3UTTD 2A38A 5JLZA 5ILTL 3BWAA 4PGBB 3IB4A 1NGYA 4HK0A 4LLMB 4JFHE 2I07B 3T0EC 3QZWG 2ENYA 5T1MB 1TZIA 2N56A 1A21A 4YHIB 1U93A 3TYFA 5DK0B 5GS0C 3GHBH 3G5ZB 1FFNB 3RI5F 1U3HC 2A6KB 4GKNA 2H6PB 3IXTB 1BPVA 1NGZB 4EXPX 1MFCH 4NQDB 1CDIA 3VFUB 4R96B 1U2HA 1QSVA 4J4PC 1IGFH 4S1RH 3UJTL 4RFEA 1OARH 1CFQA 3OG6B 4TNVF 2WP3O 3BQUC 3U2SA 2PO6A 4LP5A 4M61A 3QDJA 2V2XB 4MQ7B 1IEHA 3O3BB 2EKSB 2I60H 4GRWF 4OB5L 1F8TH 4S0SD 5EZOH 4OIAA 3RKDD 1K4CB 4YE4H 5I2IB 5M7QA 1OTSD 1JWMA 5JXEC 4X5XB 4JRYE 5ELIA 3DURB 4QHKI 3D25A 3OHXA 3HRZA 3KHQA 1CLOL 4I4WA 5ACMA 1AD0A 4DUWA 4MXWL 3O2WL 1U3JA 3UJIH 4N0UE 1S7UB 1VA9A 1JGUL 1JMZA 4M8QB 4JDTH 5I6XC 4P9HL 5C0CB 4AEIL 3S36X 2YPLB 2VLJE 2P7TB 5I19H 4GXUN 4JFOB 4KKNA 2YBRA 4HS8H 2V2WB 4P3DA 3QIBA 1ORSB 3U0PB 5I76B 1G9MH 5HDBE 2FWOB 3V5DA 2YRLA 1HCFX 5CFHA 1DQML 5HYQA 4HEME 4DQOL 5KSBE 5KZCB 3QIWC 4BJLA 1KIPA 1BEYL 3VXUE 3EDEA 5FDWB 4GKSA 1SY6L 4LASL 3MLZL 4YDVA 3UAJD 5I1GL 1WUNT 4JKKA 5CP3H 2P8PA 5E00A 5LGJB 2HFGH 4JQIH 4LLAA 3HB3D 1FGVL 4G5ZH 4OZFH 3E6FA 3LHPH 4GRLC 3FB7A 4YQXH 2ERJC 1II4E 4L3EA 5J11B 1BF2A 4HCRA 4HS6A 5CD3A 5JDSB 1T7ZA 4JN2B 1J12A 2IQ9H 3MRBB 4YHML 1A3QA 5E8NB 4JO1L 4ZOBA 4ONFL 1HCVA 1OB1A 1QQDA 1IKFH 2W92A 1IE5A 3QXDA 3VGGA 4MJIA 2I9TB 4QHNB 1AGBB 4PRBB 3L9RB 4O5LH 2NMSA 1WEJH 3C8HA 4PJCE 5IGXH 2JB6B 2X40A 1NAMA 3VD9A 3BPOC 1ZLUH 3QDMA 1AGCA 1OY3B 5DSCA 1OM3H 1FAIH 1I8IA 3KPOB 4KQ4H 4YH6A 4R8WL 1KJ3L 1ZGLP 4XH2B 1YNLH 4K3EH 2GY5A 5DA0B 2IGFH 1SEBB 4QRUB 5ISZE 4YFEA 1ND0A 4G6KH 4O58H 3BWUC 1WC7B 2DJUA 4J6RL 1JYXA 1JGEA 5IBLD 3MJ7A 1MWAA 1G7QB 2W9EL 4P5TA 3ZE1E 1BBDL 4NT6B 1ZK9A 3QFJB 4M62L 1AQKH 3KLHC 2IQAA 1Q9OA 4FQHA 1A7BA 1C7TA 3ARVA 1BFVH 3ZDXF 4UT6H 3GMPB 4P49A 5FFLA 1PG7X 2PR4H 1MEXL 4HBQA 5BOZG 4QY8B 4CRPA 2OQJA 3MOAH 2IJ0C 4K8RC 5B4MD 1ZGLA 3EJYD 2IALA 1AQDA 5CJBA 1W0WB 5C09B 4UILL 2HTLC 4ZODA 2M1KA 1TNNA 5BOPA 4UT7H 4TULH 4WWID 2Y23A 2APFA 3E8UH 3WJJA 2E9WA 4PRHB 1RIHH 3UO1L 3OJDB 2ZCLH 4QXTB 4D9LL 5IESL 1T3FA 1KSRA 4RNRB 4RMRA 1HK6A 3SE3A 3QQ9C 1QSFB 3OKKA 3CFJB 1FDLH 1U8QA 4LPWA 5GSVB 2R0KH 4OFPA 4IIQC 4PRIE 2OTUA 3EKCA 1CICA 5C08D 2NQCA 3WXVH 4UB0L 3WO3B 3OL2A 2O61A 4Z7UF 2ADFL 4L3ED 1OGAA 1ZS8B 2VC2L 3ZKSD 2JJSA 4TUOA 3BYTA 3O0RH 4ZUWB 3T4YB 4H8WL 1N8ZA 2M26A 4K71B 2UYLA 4ACPA 4DZBA 3K81A 5B39G 3QNXB 2XA8H 4ZFGH 3B2UC 3VRIB 1DLFH 1ES0B 4MJID 5D2LE 1K8IB 4HK3N 3M17B 1E4KA 3QWOB 4HCRL 4JHWH 5GJSH 3IVKB 2ATPB 4K3JL 3R0MA 2LFGA 1CL7L 2G75A 4KTDH 2RQ8A 4P5MA 5FOJA 1MFCL 4U1LA 1IFHH 2IF7A 3EYVB 3NIFE 4CVXA 4A6YL 2J88H 3UBXB 1IGFL 2Z31C 4PJAA 1UWGH 1RUAH 2HLAA 4CGTA 5FV1L 1NUNB 1NLDH 5GZND 4X99B 1ORQB 1P2CA 2FYYB 2I60L 3GMNB 1DSFL 4KJQC 3UYPA 2R8SH 4YE4L 1L9MA 5D7SH 1R0AH 3GMMB 5CINH 2X9YA 1KB9K 5HY9B 4IS6A 5EOCH 4XWOC 3FT4A 1WF5A 5B38B 4GLRI 1W0YT 5E6ZA 4Q6IB 4UIMA 4YBHA 3VI4F 3IDXH 1MCWM 2FJFB 4DWHA 4JGJA 5C08B 2L4OA 3BH9A 2LV4A 4PJ7B 4LLQA 4G7VL 1KUMA 1F90H 1S9VA 3MACL 1FFPA 3E3QE 3GZKA 4DUXA 4P46C 5ENWB 5HPMA 2VSCA 3L3KA 1UWXH 5JW4R 4XNUH 3BZDA 5IFJB 3ARBA 4DN4L 4W6WB 1HQRA 1LO4L 3QULA 3SN6N 4RFNC 5EZIL 3BUYA 3QUXC 1CICD 2EH7L 4XVUD 4L5FH 3CX2A 5EUOE 5F7EH 2AXFB 3LHPL 5C0EA 4CL7A 5E7FA 5KW9L 3PGCA 4RQQB 4M1DH 3STZA 1VERA 5IWLC 1OGAD 3G5XA 3L1OL 4EN3C 4RGMC 3CFCH 1IAIH 5FYJU 2KQNA 2V6HA 2X05A 4PJDE 4HX1A 3ZKND 6FABL 2P44B 4Z7NF 3MXVH 4Y1AB 2ZSVB 1MREH 1AGEB 5JXAH 1DDHB 2AEQL 1AXSB 2D4DA 4D0CB 3GBML 2PO6C 2X4QB 5DURD 3ZTJH 3QHZL 1QSEE 4QRTA 3GSWB 1A3LH 4JHBA 3LKRA 4QT5B 1UM6L 2C3VB 3ZE2E 5ICYA 3HC4L 3MV8A 2R0LH 4ZNEE 1YNTA 5D96C 3KAAA 1KPRB 1KPUA 5CAYB 1D3CA 4V2CB 4JFYB 5ICZB 4XXDA 5JHDD 3H42L 3MRHB 4DTGH 3HUJF 3MRRB 3EOTH 4JQXA 3WHXA 4JZOB 3V52H 4FXKA 4ZQKA 4U6XA 2HT4D 1DE4B 4FOMA 1CT8A 3EFDL 3DX6A 3BDXA 3QCVH 3QIBC 1KN2L 3VXPB 1JK8B 1JYVA 2C4FU 1H8SA 4U1SB 4JFFE 4UT6L 3PWPB 3QPQC 4H8WC 4UTBH 5DRXA 1NC4B 2E6PA 3CIQA 2V9TA 3Q5YA 2XWTA 4L9DA 3TIEA 1NLBL 3LKQA 3HE6A 3NN8B 5CIPA 1RUPH 4G42A 5F71A 5CEZL 2GITB 5D7JC 3DROA 4E41A 2A1WL 1UB5A 2FJHA 5EBGA 3MCG1 1FNGA 1QLFA 3C9NB 3O41A 3KHOA 2X4NB 4X5WA 3RWEB 1GGCL 4YFLI 5HYIA 4P0DA 4GSDL 2AK1H 4KK6C 5C0AE 1RIHL 1A6ZB 3TBSA 3HI1A 2ZCLL 5DXWA 2EDKA 4M03A 4OD2A 4L4TA 3P30H 1QR4A 1MRDH 5ESQB 1BMGA 4PJEF 2X1XR 3ARBD 4PLKD 4WHCA 2IPTH 4DOHB 1F00I 4HPYH 5JW4Q 3LRSA 4X6EA 3B3IA 3R06B 5HHOA 5E8PB 1X5HA 1AKJB 2IANA 1AFVL 1FYTE 5J6GA 2R69H 3LSOB 3AM8A 1Z9MA 3OX8B 3GMLB 1M1SA 2GJZA 1MSPA 4UDTA 3ZTNL 2GCYA 3LEYL 1GGTA 4RMWA 1ZVSA 5JHDB 4O00A 5KVMC 2ZUSA 4MNGA 4NO0D 2XA8L 4OCYH 4UOJA 4KKAC 3VXNB 4WCYL 2EDWA 1T04B 1MVUB 4HWEH 3G5YB 4JHWL 4MDIA 5GJSL 5DUPH 4XNQA 5EORL 2CXGA 5AWNH 1G9MC 2FCBA 4CU6A 5C0JA 4KUZL 1QYGL 4BQBA 3DYPA 1RFDH 4ETYA 1IFHL 4GXVL 4JY4A 5I30L 3U7WL 3BZ4B 4H20H 3DRTB 4ALAH 1Q9WB 2NPLX 3MSPA 4NQCB 4IJ3B 5JMRA 4U4BA 5EZJA 1TJIH 2Q87A 2X2YA 3EAKA 5T3XE 1V3JA 2VN4A 4LSSL 1P7HL 1LNUA 3LMJH 1X5FA 1VADA 4BZ2L 4XAKE 3JV6B 2X1PA 3WN5A 5E7BA 3W9EB 4L8SA 4HBCL 5DD0L 3DVFA 3MJ8B 4UV4H 5EU3B 1KB5A 3TM6A 2D9CA 5I1JL 3GSXA 3MUHL 5HDBF 3SE3C 3DVNB 4X8JA 3VXTB 3T77B 4OLVH 5I1CH 3IDXL 5KSBF 2OI9B 3F5WA 5HYJE 4YUEH 5MENE 5T5FL 4E41D 1NEZB 3FAXA 4XVTH 1FPTH 1CDHA 2Q86A 1T0NA 5F7KC 1TZGH 3LDBB 3MNVB 3QCUH 1R3HA 2DQDH 4LSRH 2FL5B 1ZHLA 5H35B 4L4JA 4R90H 3KPMB 4C4KT 3WE6B 1KELH 4FQQB 3BVNB 4NO0B 3OR6A 4Y5VC 4WHYG 1RULH 1I1AA 1C5BL 3C87A 5B3NA 4DGYL 2XTJC 4ZPVB 2D0FA 3OGOE 4MJ5A 4GW5A 5HHOD 1A1NB 1VEPA 4OLEA 1LO3L 5LVEA 1P7QB 3ULUL 3HKFA 5EOTA 5GJTH 5TJWK 4BH8A 5I71C 1A14H 2EE3A 1YEDA 5LXGH 1OSPL 4NO3A 2YRPA 4PJCF 3MXVL 4L4VB 3QZWA 3S98A 4PLJD 4WNQA 4LKCA 4HIXL 3WFDH 5IR1B 3GIZH 5CS7A 1DEDA 4R4FH 1V3LA 3MV01 3RZCD 5EU5B 1EO5A 2R0LL 5CJXC 1OCWH 2BVQA 3MROB 4LCYB 1OGTB 3TPKA 2YD1A 3B8SA 2H1PL 2H8PB 1GPOL 1ZHKB 4Y5XA 3ZE1F 2X70A 2J7LA 3H7BB 3H9HB 5EB9A 5FA4A 4FQXA 5FUZH 3V52L 4AEHH 1D7FA 1GC1L 5FGCB 4XNYH 4S1QH 3TT3L 4DN3L 1KF9B 3OB0H 4TSCL 4HMEA 1IGYB 5AUMA 3RY6A 4XCYB 2R2BA 3OKMA 3TO4B 3MR9B 4OUUA 2BHYA 3FQUB 4O51B 5K9OA 2Z4QA 2D7MA 4MD0B 3CFDB 2WZPD 3TWCL 2OR7A 1NCDL 1MFBL 1CLYL 4AQ1B 3BGAA 2Z8SA 2HT2C 3S37H 3U46B 5L0QC 4IMKC 4I5BB 4P2OD 2CDFA 2E7LA 4ZYKB 2BSTA 4RX4A 5FO7A 2C3GA 1DR9A 5LWYH 4PJFF 4U6VL 4ELKA 3ZKMD 1KB5L 2FEDC 4OD3H 5E2VL 5K9KB 3PWUB 4TNWF 3JTSA 2VRAA 5DMKA 5EO0B 2BRRH 3WFBH 2HN7A 3VD7A 4D2NA 2IPTL 1BGXH 3TVMB 1H5BB 3QJFB 2DMKA 3K7UA 2P1YA 1I1AD 3CVIH 5A2JH 4P2CG 5HHQA 5FYKU 1U8HA 4RMUA 2ESVA 1KENH 5E8DL 3RZCB 3M8OH 4XP4L 5D2LF 5D7LE 4Z0BH 4WTZA 2B4CH 3KJ4C 3WFHB 1SYSB 4OZGA 4FZEL 3OGCB 3QHFL 1EEZB 1LP9E 2J8UE 4XPHH 5IQ9B 1X6LA 5AD0A 3NIFF 5CZXC 4YFDB 4PJ5E 4YHNA 4HWEL 4JANA 1YN7A 2GHWB 1JHLL 2VXQL 2D03L 1X5ZA 4WTXA 4WGWB 4NZRH 3SJVA 5I1AB 5IJKC 4RGNB 1KC5H 4X6DB 4IRSC 5M95B 4H20L 1HSBB 3AB0B 4KK5D 1OD7A 5ITFB 4JCMA 4FQXD 1IQDB 2APXA 4LDOB 4FABH 3S5LB 2D7NA 4DCQB 4XPTL 5LCVH 3HPJA 1FL3B 4L8CA 2K7QA 4P2OB 4B7LA 5D1ZC 12E8H 4QF1A 4X9HA 4IRZH 4ODUA 4NC0B 3A0OA 4G8GB 5JQHC 1NBVH 1A7RH 3U0TA 2ID5A 4U1KA 4LU5H 1AD9A 5BS0A 1VB9A 3RUGF 1KULA 1KEML 4NQDE 1DZBA 4PTTA 2K1MA 4YHPA 3QQ4B 3QA3B 5DT1H 2VKXA 4OLZL 1OPGL 4GXUM 1IGJB 3VXMB 3NCYS 4WW2F 5KVEH 1PSKH 1ITCA 4QRRB 4RX4D 4UQ2B 3IFLH 1FPTL 5FYKD 2W1NA 4YXKL 5DMIH 5E4EC 2DQHH 3D69B 2P5WE 3BKML 4NRYA 3U6RA 3V8CA 4RIRA 2MHAB 5EUOF 3SDDA 1WVZA 1RIUH 4M9PA 1RVFL 4LSRL 5SX4H 1WCBA 3OMZA 4MA8H 1MCWW 5DK2B 5IB3B 3ARXA 4HUWA 4AT6B 4PJBA 4Z7VA 1NMAH 3WKNA 5C0CE 1RAMA 4K7FB 4AYFA 2YUVA 1RZ7L 1CFVL 2YPLE 2R9HD 4JEGB 1OT2A 4I0CC 4M6ML 3C09C 3K4DA 3DO7B 1TCMA 2A9MH 3IYLW 2A83B 2NXZC 5DJ2A 2YOCA 2QQQA 5B39A 3O9WA 3C5SB 4QRPA 2AXGA 3GRWH 5TE6L 4X7SH 3SE9L 5JZ7D 1ZT1A 3VW3H 2E7HA 3RQ3A 5LXGL 2CK2A 5FUOH 1VENA 3VXRB 3ZE2F 4JREB 2FR4A 4MZ2A 5EFIA 3OAZH 1CFNA 2YPKA 1MOEA 1BOYA 3MRIA 2HJKB 1XR8A 3S4SG 4JY5L 1ZGLM 1JVKA 3GJFA 5TDOA 2VE6A 1EEYA 3WFEH 4CU7A 4R4FL 4IRJA 3RAJH 3R0NA 1PYWB 2YMXH 4NOFA 3RNKA 4YEFA 5DQ9A 2ZP0T 3ARDC 3SJVD 2MCPH 2Y4SA 5KOVC 2F58L 5C6PB 4UNTA 3WSQL 1BBJA 4A2LA 1LEGB 2G60L 1CVRA 1I85C 1H3UA 2RFXA 5K33A 4LLYB 4G7YL 4UBDC 1NDMB 4AM0B 4ONGH 1HH9A 2NW3B 4W68A 1RJZA 1FVEA 5CBEB 2R23B 1XZ0B 1P1ZA 1A4KA 4O2CA 5TDPA 5HHPB 2NR6D 5DJ8B 1MQKH 3W39B 3LEXA 1AIFB 2GY7B 5SWZA 1K6QL 1B90A 3TFKD 2VAAB 3C5JB 5BS0D 2CMRL 5FA3A 4RGOH 1RUML 5E94B 5BRZA 4NO5A 1WIUA 1RK0B 3QEGL 2VR9A 5TPWH 2J5LB 1FV1A 3T4AB 4MCZA 3LPGA 5FYLD 1GHFL 4Z0XA 1S7TA 4DK6A 4P59L 4PJ8C 3O2VH 3WXWH 3T0ED 3BJLA 4TOYL 4HUXA 4Z77B 3QFJE 5KS9B 2G5BA 4MA3A 3SDDD 2VDRL 5JOFA 2DDQL 1IC4H 1XT5A 1JE6A 1MAML 1CGYA 3OKOB 3E2HB 3MGOB 1EVTC 3LH2H 4X4XB