4HH8A

Crystal structure of bovine butyrophilin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
211
structure length
211
Chain Sequence
b'APFDVIGPPEPILAVVGEDAELPCRLSPNVSAKGMELRWFREKVSPAVFLSREGQEQEGEEMAEYRGRVSLVEDHIAEGSVAVRIQEVKASDDGEYRCFFRQDENYEEAIVHLKVAALGSDPHISMKVQESGEIQLECTSVGWYPEPQVQWQTHRGEEFPSMSESRNPDEEGLFTVRASVIIRDSSMKNVSCAIRNLLLGQEKEVEVSIPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 1 member A1
publication title The extracellular region of bovine butyrophilin exhibits high structural similarity to human myelin oligodendrocyte glycoprotein
rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 40
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh8A02
1HYSC 3MOQA 3QEQD 1Q72H 5INDB 3O6FC 1DBBH 4IRJA 2BMKA 4F9PC 1G7IA 1FG9C 4DQOL 4EVNA 4M02A 3NA9L 5LQBH 5FO8A 2APFA 5H94A 3OF6D 4LSTH 4HIHA 2HFGL 2WUCL 4PY7B 4NM8H 3HAEG 4RAVA 5DJ8A 1KF9B 3ARVA 4DN3L 1RZGA 3O8XB 3HAEH 4G80A 4GW4B 4YDVA 2GY5A 1ZAGA 3RNKB 3V0VB 5KSAB 1ORQB 2CKBL 1T89A 4L3EA 5GS2H 3LVEA 1G9ML 2PO6D 3VGHA 2VXVH 2WLYA 3P40A 5JDSB 4IHOA 5GGRB 5EBWA 3VXTA 3VXUD 2E8ZA 3QI9C 3L7FA 4G43B 2FIRT 5BJTB 2FWOA 4Y4KB 4YHLH 1B3JA 5IOPA 1Y6NR 4NPYA 4YC2B 2PCPA 4M62H 3UYRH 3E2HC 4LLUA 5CEZH 1H15B 4YK4B 3ZSSA 1BX2B 1U42A 3MROA 4YE4L 3IXAA 3RWHB 4CMHC 1AD9A 5HGBB 4ENEC 5F6IB 2YS4A 2VDPL 1AY1L 1N6UA 3CVHB 5F7NC 5HY9B 4XAWH 3SOBL 1PY9A 3OKDB 3L9RA 4Q9BA 2Z8VC 2NY6D 3VGEA 5GGRY 1UJ3C 2Y6SD 1NCBH 3UJJL 3QCTL 4EN3D 3RZCB 1YC8A 3IDGA 3I6GB 3I6KA 4FG6D 1Q1JL 4UBDD 5JIKA 5GZND 2I5YL 4HLJA 2J6EH 4IOIA 5DUBA 4JN1L 3EUUA 4UV7H 1FRGH 2COQA 1D6VL 4ZS7L 3CDFA 5F70A 1DN0B 1QG3A 1NEZA 5BZDB 4X0KB 5C2BL 5ISZE 1E28B 3O2VH 1YY8A 2Z0BA 1KJMA 2ARJB 1YEEL 3RWJA 3C60A 1CICA 1QFWH 4XNMB 3SGDH 4MAYD 3HE6B 3WN5B 3IFLL 4FQIH 1G1YA 5CJQL 4RDQG 3EYSL 4TTDD 3CMOH 4YBQC 5JPMB 5MEOA 4AIZA 5DFVC 3V8OA 2EIZB 4HH9B 3ULSA 5IMKB 1JWUA 4TVSa 5DQDH 4CVXB 1N7MH 1OGAE 1NGZA 2EO9A 1BWMA 4WI2A 4MJIE 4PJ9D 5C0CA 2VQUA 2R1YA 1RZKH 3REWB 2WIIB 4P46C 4X83A 2HH0H 2JK5B 1WT5A 4X5LA 2EDOA 3AB0B 2CR6A 3WE6B 2O61B 1I1FA 2Z93A 4A6YL 4N0YL 5KSBE 1KN4H 2UZIH 5DHVH 1SJHA 3PWPD 1EX0A 4HKXB 4YLQT 3GMPA 2JCCB 2AEQL 4LQFH 5IMOA 2BC4A 1GZPB 4I77L 1GXEA 2Q20A 4XAKD 3KPOB 2RQ8A 1S78C 1FSKC 4WIQA 1KPUA 1BQLL 3KNBA 5JQ6H 3RVWD 1K2DA 3CLEL 4ODUA 3MYJA 5DJ0A 3E8UH 3U9PH 4DWHA 3F62A 5C08D 3K8LA 1I1AD 1W0YT 3G9VA 1Z6JT 2JB5L 3R4DA 4PRPD 5DD6A 1RIHL 4DW2H 5IHBA 3OAUL 2G75A 2CIIB 2ICCA 3S3SA 4Z7VB 2AQ2A 2AXFA 5EOCH 3GIZH 4DKFL 4APQC 3VXPB 3HFML 1I7TA 1IAIL 5FGBA 4BK4A 4OI9A 3TN0B 4NWTH 5EIVA 5LVEA 5SV4A 3HZKB 3P11L 2CRIA 1JK8B 2R23A 1A4JB 3NABL 4Y2DB 1WICA 3QUMA 4P2RD 1NGPH 4XRCB 4CN6A 2D7PA 2QR0A 4XVUC 3H9SE 2NY1D 2YEZA 4I2XA 1X9QA 1PG7L 1WV7T 1XF2B 2E27L 43CAB 4G8FA 3EFDL 4NN5C 4XGZA 2VR5A 5CZVL 1EERB 4WTXA 2VZUA 4R97B 1UCBL 2WQRA 3BISA 2ZOKB 4GQ9L 1S7XB 4JFEB 3CZFB 5EUOA 3CSYB 3VXME 3QHZH 3VG0L 2FX9H 4UQ3B 3S4SA 1ROWA 3IB4A 5JQHC 2HG5B 4ZUUA 2Q7YA 4ORGB 1YMMB 3O4LB 2VKXA 4HGWB 2IMNA 4WU5A 2YK1H 2WQ8A 2VH5L 4PJXA 2AJUL 5KTEH 2HT4D 3EO0B 4FQHA 4G7YH 4AIOA 2EE3A 1T03L 4X5XA 4F9PA 3PIQB 2I26N 4JFZL 4PB9L 3V4VH 3QQ9D 4RX4D 3O3BA 4YUEH 5M95B 4U6TA 1KCRH 3HZYB 1UYWL 1A6TB 4KK9D 1KV3A 1FJ1B 3PG2A 2C3WA 1W72A 3CGTA 3TO4C 3WL9B 1NLDL 1KEGL 2VLJA 3SE4A 1C12B 3QXVA 3TA3D 5LAXA 4MD0A 1RZKC 1DE4B 1FO0H 1JPFB 3Q6GH 3VCLB 1CQKA 5I8KL 4PGCB 1S3KL 2VLLB 2A38A 5F8QC 4RAUB 3IFPA 3ARRA 4MAUH 1HH9B 1A3QA 4JFXA 3RL1A 3FAWA 4YHNB 3BIKB 2BY0A 3VXSB 2YUXA 3BDYH 5INCB 1YQ2A 3IU3B 2UYLA 4RGNB 1DQDH 5CP3H 2FR4B 3PHQB 4X9IA 4ZAKA 3OX8B 4HK3N 1S7VA 3SDAB 2I07B 4C58B 4WO4C 3W11C 1CG9B 4N9GB 5HHOA 2A9MH 4DZBB 4JO4L 3T08A 3O9WA 3MRIA 3KWWB 3QUZA 1TDQA 4TNVF 5I1KH 1YEGH 4PJIA 5BZWB 1FDLH 5HHQB 3NCFB 1MF2L 3SDXA 4TVPD 4L8SB 4JDTL 5I1CH 3TH4T 4M9PA 3MNVB 3ARBB 5FYKE 2DQUL 1T5XA 4J12A 4Y16D 1P4LB 3BKYL 1KEML 3IKCA 4NQDB 5IHLB 1BQHA 1J88A 1I7RA 4D0BB 5MP6H 2YRLA 1QZ1A 4WUUD 4M7KH 2P5ED 4P57B 5DT1H 1WBYA 12E8H 4TRPL 1BVKB 3MLZH 1A2YA 5CMAA 2AEIT 4P4KC 1WCBB 1WC7B 5ENWA 4HFUH 3DMMA 1HHHB 3QFJE 5DJZA 3G5YA 3KPSA 4PV8A 5ESQA 3W2DL 1BJ1J 4CNIA 1XH3A 2DQIL 1YJDH 1IC4L 2JCCF 2VZ3A 4TUJA 5E8OB 2B1AH 2CRYA 2EE2A 4KROD 2QQLL 3FMGH 4QRTA 1OSZA 2HJKB 1GC1L 3D18A 5E56A 3E6HA 4XP5H 4LSRL 5HI3D 4JGUA 4P46A 4AMKL 4LASH 1VADA 3VDCA 2DQJL 5C0FA 2BRQA 4NUGH 3PWUA 3C2AH 4PJ8C 4E0RB 2QSTA 3OAZH 1PFCA 1Z5LA 4J3TA 5BOZG 2X70A 1CLOH 2PTUA 2FX8H 3DHJA 4BSVA 1MQKH 4PYHA 3G5ZB 3ARFA 3RY6C 4U1MB 1HNFA 3WNMA 4Z7VF 3KPRB 3T4AA 3QCUH 2IALA 3A67H 4RFOL 3F7VA 2X42A 3LKRB 1HXMA 1FYTD 2H1PL 3SGEH 3EYOA 3FFCA 2GK0B 3QDJB 3WS6A 1RZ8A 4FQQA 4NO5B 3G5VA 4L8DA 4NQSA 4NQCE 4LSDA 3QT2A 4KU1A 4LMQI 4QHNB 3P4MA 2H2SD 1J0YA 3H3PL 5A2LH 3MLUL 4WW2B 3G6DH 4X7CC 4KGJA 1T66C 1T5WB 4PJAF 5D2NC 5B3JE 4F7CA 4APQA 3FO9A 3DYOA 1CDBA 4MD5B 4HBCL 3VE0B 2R0LL 3SKMB 3CZJA 1Q0YL 4HULB 1KTKE 3NA4A 5M7QA 5I19H 4K9EH 3SDYH 3RBGA 3B9KC 2DWDB 3SO3C 1G0YR 5FHAH 4HIXL 4PRHB 1TZGL 3TH2T 1OTUC 1HQRB 3DSFH 2ERJB 4PJCF 2V2XB 1KIPB 5I15L 5E95B 4LFHD 5IROA 2L4OA 3B9EA 2XFXA 4LEOA 4Y5YC 4QWWC 5I1AB 4RGMC 4FABH 1O7SA 4WFED 4V1DD 1AC6A 4OCXH 4JJ5B 1F00I 1RHHA 2KH2B 4XBEH 5ALBL 3QA3B 3V2AR 1M7IA 4NHUA 5HI4D 5D1QC 2YD3A 4MXWL 1Q8MA 3PHSA 2V9RA 4WWKA 1VFUA 1N2RA 1DQJA 1LK3H 3IETB 1S5HA 3EOAB 3I75B 5JLZB 3HNTH 5D1XA 4KZDL 1N59A 1ZT1A 1ADQH 1J0JA 4XP6H 2CDEB 4WI8A 2E8YA 1FORL 4DGVL 5LBSH 4J3UA 1KTDA 3D85D 3T0EE 1J1OH 4M7ZB 5GSRA 1L0XA 1HI6A 4WTWA 4Y1AE 3VMPA 4R0LA 4JANA 1ACYL 4XI5C 1YJDC 1ERNA 1B2WL 4FP8L 4XCEA 4RCAA 1MREL 1U8OB 4RNRB 1WZKA 4GBXB 1OQXA 1PD6A 3KXFE 3ARED 3QIUB 1MPAH 3T1FB 1M7DB 2C3HA 5I18H 3A6BH 5FCUH 3EFFB 4NRZB 5IB1A 4ISVA 5KANG 3PDOB 2AXHA 3WNKA 1ZEAH 1MH5A 3DARA 4NBYB 3WUZA 1LEIA 2VDNH 1D5BA 2VZTA 3GMMA 3H42L 1UA6H 5K9KB 2Z9TA 3G6JA 3HMWH 5IKCB 2ICEB 3ILPB 4LPCA 3MBEA 4XMPH 3RIFK 4QF1B 2EDLA 4K7PH 5E8EB 1JPTH 1U3JA 1OM3L 1A8JH 2DBJA 4JFDE 4I48A 4LRIC 1AD0A 5DA0B 5F71A 1LEKB 2F54D 5IJKC 1IILE 3D48R 3O6LH 4P2OA 3O3DB 1AP2B 4P5TA 5LJYH 5ALCH 3C5ZD 1D9KD 2XZZA 3VXQB 1V3LA 3VI3F 1DZBA 1JPST 2NY4D 3LKSB 4PRIE 5FYLL 4CDHA 4WO4A 1G7PA 4JG1L 1H5BA 2P49B 3EIFA 3ZHLA 1D5XB 1EFXA 3DUHA 4M93C 4P9HH 2JB6A 4DTGH 2M26A 2AI0H 1MQ8A 2E7BA 2YKLL 3CCHA 4OUUA 1AQDB 2WIMA 1CGSH 2YHGA 4FTVB 5KBNC 4X9GA 4HZAA 5E5RB 5CBAB 4K9EC 5CILL 4HJJL 4GLRH 1F4HA 4D9QE 3PQYD 1H0DB 1QSFD 2XPGB 4YDIL 4P2QB 4MMZC 4OLXH 4UDUA 2HA1A 5BVJA 3BPLB 3NPSC 2NY6C 4C59B 1VA9A 2VXQH 4P4KA 2RCSH 3C9NB 3SQOH 1ZGLB 2Y6SC 3DSNA 3UAJD 4EN3C 3D9AH 3HC3L 1FCGA 3FO2B 5FYKL 5IB5A 4FG6C 2DDQH 4UBDC 4OGZA 1JWMB 4UMGA 4MHHI 4WFHD 5KSVB 5GZNC 5CP7A 1GOGA 3MUJA 3RNQB 4F7EB 1IGFL 3ESVF 5J3HD 1DDHB 4B41A 3CDGB 3T2QA 3O2WL 4PJ7B 5CIPH 2FYYA 4M7LL 4XPHH 4HCRA 5J6GB 4DAGH 4BH8A 1DBAH 3BJ91 1KJ2H 2PCPB 1CFQB 1VGKB 4RZCA 5DVMA 1VENA 2GK2A 4PJ8A 4MAYC 4G9DB 1Z9LA 1JHKH 2PYEB 4TTDC 2ATPA 3MROB 4JFPB 2G2RA 1U8HA 5AZEL 5ICYA 1KLGA 4YXKL 2D31B 3SGJC 3C09B 1RUML 4WI5A 8FABA 4JY4B 2XY2A 4Y8DC 1QBLL 2FLBT 4PJ9C 4X4ME 4I9WE 1DBJL 2YPVH 1IARB 5IK3A 5BVPL 1X5AA 4HIJA 3IDMA 2K7QA 1J05B 2BY3A 3MRDB 3QIBB 5GZOD 4EQ3A 5KAQF 5E2VH 1QR4A 4Q9RL 1ZHKB 4S1RH 1QKZL 1F13A 5D2LA 2XWTA 4LKCB 3EYUH 2CKNA 5BS0B 3WFBH 1A9BA 5D2NA 1MCFA 3SDDD 1IQWH 1LVEA 1ZA3B 4FFZL 3MCG1 4PBXA 4LARL 3RVWC 1UB6A 5DQJB 4YDKH 3GSNH 1C16A 3QUKB 4MGXA 3HI6L 4NC0B 1E6JL 3U46B 4QGYA 2DMKA 5E8PA 5I8EA 3S3JA 3EDFA 3TNNA 2BHUA 1JRHL 2DKMA 2AKRB 4Z18A 3E3QE 3RU8L 3EOTL 3FOLA 1E4KA 3MV7A 4NM4H 2HN7B 1CLCA 4DGYL 4OQTL 4GW1A 3K2UL 3S36X 4Y5YA 3RWIB 5E7FA 1LEGB 4P9HC 3AMLA 3DGGA 5DRNA 2I9LA 1EJOH 2J88L 1N64H 1NDMA 2Q87A 1AO7E 1DUZA 5KVGH 4XNZB 5DI8B 4LSSH 5EOQL 3EJZD 2VLKA 4TSCL 3UPCA 3QZWB 4HXAL 4ZUWB 3HUJE 3MFGB 1T2JA 2NY1C 3AM8A 5C6TH 2R56L 2AV7A 3ARYA 4PY8I 4TSBH 3ZDZF 4HC1H 2AJVH 3BH8A 3KDMB 1EAJA 3MRCA 2F74B 1RZIB 3KNBB 3B83A 1K2DB 4PUBH 3BIBX 3DX7B 4MYWB 1ETZA 1X4ZA 5D96B 2NX5D 4OCMC 1K6QH 5CS7A 1IZJA 1S9VA 3NBNA 4D9RD 1MCSA 2X10A 1ZXQA 3PWNA 2YRZA 1EZVY 1KB9K 5EA0H 4N0FB 1OAUL 4YIQA 2HT4C 3GJFK 3M8OL 3ZTNL 1NCDL 3DTXB 1QBBA 4TPRH 1SMAA 4AT6B 4LVOB 3QQ9C 3W9DB 4F37K 1J0ZA 1CU4H 4NN6C 4KK9C 4NKIH 1ZT4A 3EYQD 2BNRD 3KPPB 5ESVA 1FNLA 4OB5H 5FEBA 2ADFH 1W0WB 2V7HB 4R2GD 1EGJL 3PJSB 4C83B 3DROB 4MQSB 1X5XA 3OZ9H 4LRIA 4Z7WA 3TA3C 3GIVA 4OZHA 1D6EA 2VWEC 4WENB 1UC6A 5IJKA 2WSKA 4HPOL 2PO6A 4ONFH 2H32H 2XXMB 4ODTH 4QOKD 4LNRB 1QQDB 5E94A 4LPYA 1GZQA 1KB9J 1HSBB 1CGUA 1QR1A 5DRXA 2E7LA 1NLBH 3F7QA 5LG1A 2IADA 3L3OA 1BD2D 1F6AB 3NIGE 3FQXA 3MGTB 4PR5B 3GI9H 3MOBH 1BP3B 1T1ZB 5GGQL 2GITB 3Q6FB 4UNTA 2XWJB 4KQ4H 4BUGA 3O6FB 3HR5B 4V2BA 1NAKL 5B38A 3VFVA 1FAIH 1IGTB 4MNQD 1N6VA 4LP4A 4PJ7F 5DFWH 2W9EL 3K4DA 5JOPD 4QHUA 3MLXL 5MERB 5IEHA 5T3ZH 1LNUA 3FTGA 4HKZB 4OZFH 4EN3A 3DO3A 5FM5M 1P53A 3BEWA 4ZFFA 3QIWA 1T1WA 4JQIL 3VXRD 3ZL4H 2IBGA 5F96H 4Y16C 4J3OC 1KXVC 1ES0A 1FLRH 5EZJB 5DEZA 1CDJA 2WWKO 1INDH 1XGYH 2ZJSL 3MRLA 4L5FL 3UPAA 3RWCB 3QI9B 1T1YB 2V17L 1C1EL 3B43A 2VIRB 5D72H 3RL1B 3LKNB 4Q58C 1AXSA 4LHUA 4HJGA 1UXWA 5E6ID 3JV4B 1D5ZB 1HHGB 3BP4B 2AK4D 5TH2A 3E2HB 3J8F7 2QKIA 2UYLB 3C6LD 4Y4HD 3MUY1 5LXGL 1D5MB 2Q3ZA 4ZSOA 4ZUVB 5IFHH 4KHTH 1QYGL 4CMHB 1RJYA 2GHWB 4KROC 2ESVD 1S7VB 1U3HD 2BVQA 3CPLA 5T33L 1BBDL 4PJ9A 4X6DB 4JEGB 5K9QI 1C5DB 2DS4A 2YD8A 1GOHA 4H88L 3BXNB 4HWBL 4JHAH 5HI3C 5C9JA 4P5KB 1NBQA 5I8OH 3UBXI 2F53B 3O11A 5CWSA 3QG7L 3RGVD 1JFQH 2XXCB 3KYOA 1UJ3B 1FNFA 5GS3A 3AXLB 1GPOL 3ZT6A 3M1BA 2GAZB 5ACZA 3FT2B 3MO1A 1YNLL 2NCMA 4M6ML 2R4RL 5FUCC 3VFPB 1ND0A 1TQBC 4YO0A 1EEYB 4KJYA 3KYMB 3QO1B 5H2BB 3NZ8A 3ECBB 1TCRB 1BVLB 1I1AA 5JOFA 4LLQA 2VZ1A 5MENE 5CMAB 1OARL 5AAMA 1KTRL 2HRPH 5GJTH 5EU4B 4B0MM 4N68A 1KCKA 2H2SC 4OGXH 5C0AB 2P44B 2OXHA 2VDQH 3S4SG 5JIHA 3EJYD 1S5IL 4UINL 1QFUH 4YXLH 3F65A 5IB4A 5AWNL 2R0WH 3OBAA 1X3DA 4QRRD 3IDXL 3TT3L 5AG9A 3V8CA 1PKQE 3FONA 1KG0B 4PJGA 3ZDYF 1P5VA 4JY5H 1NFKA 4N1CA 1UM6H 3SBWA 5T3XE 2V9TA 1G0XA 3LQZA 4P46B 4FHBD 3RL2B 2UWEA 1QSEA 1YA5A 3TIEA 3DURB 5IQ7L 1AGCB 1Z5LB 1H8SA 5ERWA 2F58H 5TDNA 2X70B 2Q76A 4XNYL 4X7EC 1JYVA 1S7WA 4IIQA 4KKNA 4TOYL 4TULH 4QRPD 1HQ4B 4FXKA 3T4AB 3D2UB 2P24B 1YNKL 1FSKB 5I76B 4D0DB 1DVFD 1R3JB 3HAEB 3P9WB 4OT1L 2Y23A 5HI4C 2MQ0A 1A02N 2C9AA 4NRYB 1WIOA 5EZIL 1XCQB 4IS6A 5IQ9B 2RJMA 1QVOA 3G5VB 3RIFF 1LD9B 1T2QH 3LAFA 1CD8A 2YA1A 5JNYA 5BV7L 1A7OH 3OXRB 5I17A 1B4JH 4ZFOL 1JP5A 3WCYA 3P4NB 1BAFH 1I1YA 2EE6A 4LEXL 2AJZB 5F9AC 4NHCL 4OFVA 3CXHJ 4NQVB 5HYJB 2VDMH 5C0EA 1OCWL 2FX7H 4RX4A 2HJFA 1T20A 2WP3T 4QRQA 1F58L 1DBMH 1FPTL 5SWQB 1HKLL 4JG0H 4LQ1A 5FV1L 1A6UL 2IPTH 4GT7A 4X80H 4QT5A 1JNLL 4U1SA 5IJVA 4QRUA 3S96B 2DQTH 3AREC 1N4XL 2ZUWA 3G5XB 5T1KB 1HHJB 4OD3H 5K93A 1DQQB 2DM2A 4NN5B 3PGDA 4Z8FL 1CZ8L 3N1FC 4R26L 4W4NA 1ZV5A 4QLRA 1T83C 4N1HB 2D4DA 2HFFA 5I0DA 4O9HH 1NGQH 3JTSA 2NNAA 4PRDA 2CLRB 3QNZA 1BQHG 4BFEA 5FKPA 5C0BE 2EYRB 1FAKT 4UTBL 3FO0L 4KJWD 5HGHB 3MZTA 1S5HB 3G04A 3NFPA 4RIRB 1WEJH 3KYNA 1K4CB 4XPTL 2B7DT 4FZ8L 4BFGA 2G5RA 3S35L 5CBEB 5L2KD 2MFNA 5EBGA 4EJ1C 3FQTA 3C5ZC 1D9KC 5F21B 1MJJA 2J5LC 2Q3AA 1QHOA 2BCKB 2NY4C 1A3RH 4PTUA 3QPXL 5F1OB 1G7LB 2C1OA 1CT8A 4Q2ZA 2IPKA 4LKXA 4OLWH 4X7TA 3ZDXF 5DC9B 4WW1A 2GJ6B 3TO4B 5L8LB 1FFOB 2WW8A 2Y25A 3VXNB 4D94A 3FFDA 5D7KE 4E42A 2D7TL 4O5LH 3BIAX 3GSRB 5FO9A 3MREB 4KVCH 4FZEH 1NGWB 2MCPH 5D5MB 4NJ9L 4C57C 4WUUA 3MLYH 4YHOH 3T3PE 2H8PB 2P5EA 4P3DA 1SJVA 5C07B 1JNJA 1MH5B 5J1TC 2YA2A 3MQIA 3L1OL 5F88B 4X6DF 2X89A 3MRKB 5DHVB 3D39E 3X11B 4JVUA 2IPUG 3UAJC 3H7LA 4N90D 3E1F1 2J8UA 3MRNB 4JVPA 1NCNA 4PV9B 2NTFB 4JQVC 5GIRB 3CFEA 5C09D 1JIBA 4HH8A 4LCYA 4NBZB 4S1SL 3T3PF 2B8OT 3K4AA 4R4BA 5I1LB 1JI2A 3MNZB 5J3HC 3T4YB 1N3NB 5HGDB 4A2MA 1FNSH 4WO4B 4OCYL 5GSVB 1A1NB 2GCYB 4KV5F 2IANE 5CGYD 3MGOA 3MLTA 2YR3A 2JB6B 4AY0A 4CMMB 1QPXA 4OD1H 3V5DA 1ZOXA 1CS6A 5SWSB 1J8HB 1YEIL 1CXLA 4KMQA 3VGGA 5JORA 3HNVH 5KN5A 3TEUA 1YN6A 2L0DA 5D7LD 3BOVA 2VLRA 1HZHL 2W0FB 1TJGL 1FYTA 4TTGA 2YMXH 4P4RA 1AJ7H 4QYOA 1UXSA 4HGMA 1RK1B 3U7YL 4HFWA 4P4KB 1LWRA 3A0OA 5D8JL 3R8BB 3FB8A 1V3JA 1WTLA 3LEYH 4YNYB 5IVOA 5IB5B 1OW0C 3FJTA 2NY7H 3B2UD 3C6SB 3GK8L 5H35B 5C8JA 3U0WH 1CFNA 3DYPA 4U7KA 1CF8H 3SDDC 4PGEB 1JWSA 5C6WH 2AW2A 4YPJA 5CFHA 5J06A 1IAIM 1RJLA 2ZKHL 4RFNC 3JZ7A 3UX9B 3V5KA 1TFHA 2YOCA 5E4EC 3FQNA 1NCAL 1KC5H 1JV5B 4NGHH 5FUZH 2ED7A 4AEFA 1ZHBB 1TNNA 2YD7A 4QXTA 4X7SL 5B39B 4K94L 4G9FE 5C7XL 4Y19E 1A47A 1SY6H 3DECA 4CN1A 2GTWA 4WHYG 4LCCC 1ZLVH 2FCBA 3TFKD 5BRZD 3U1SL 4DKEH 1DANU 4HK0B 4K3DL 5C86A 4G6JL 3MRFB 4LCIL 4XPAH 3KJ6L 1KBGH 4JVWA 4S1DC 4V1DA 3BSZL 1KELL 1YEDA 5CHNB 4OM0L 4RSVA 5T3XL 2EH8H 3KPLB 4M6OL 4I0PA 2F19H 3JWDH 1G6RL 3EJZC 3P2TA 4PJBB 4JB9L 4XC3L 2X4RA 3CDCA 3SKJL 1IGML 3LMJL 3IDUA 4JFHE 1FBIH 5HSFA 1SVCP 1FO0B 1U91B 2AQ3A 5IHUL 3LH2H 1BIIA 5EWIL 3DVFA 1YEKL 4MXVE 1G84A 4UIKH 5TFSL 1YYLL 5D2NB 1ED3A 3IXTA 5JHLL 1S7TB 3GBNL 2XG5A 4ODVL 2N7BA 3G6AA 3NCBB 3MV8E 1I7ZA 4LHJB 3B9KB 1N6QH 1R24A 4NO3B 4HK3J 3SO3B 3V52H 4YHML 3ALXA 3DVNB 4GRWH 2FH6A 3FOLB 3PV6A 4FQXD 5FM5O 3UTTD 4EUPH 2FO1A 5DLML 4K55A 5TQ0H 3TWCL 4GSDL 4RMVA 4PP1D 4ODSL 4ZNCD 5EO1B 1F8TL 4Y5YB 4RGMB 1BIHA 4JO3H 5F7EL 3EYQC 1DUZB 2OZ4H 5D1QB 1FFPA 4Z7NF 1RU9L 1G7HA 3PP4L 1C7SA 4AH2A 4OKDA 4R2GC 2M1KA 2GJJA 4L4VB 2ZZUT 1Y6MR 4OF0A 4AEIL 1MFCL 4OF7A 2IH1B 4PP2B 5A2FA 4PJHB 4M5YH 1BMGA 2X4UA 4LCWB 5KJRL 5IFJB 1XF3A 2EYSA 2NLJB 5DK2B 3UDWA 1XGUA 1Q94B 3S3PA 2DM4A 2CUMA 4O2FB 5A2KH 1SJEA 1RZFH 1J86A 4JPVL 4I4WB 4JAMA 2MCG1 5E7BA 3WLWC 1XF4A 4FQCH 3SY0B 3HG1A 3S9DB 2DI8A 5KVEH 4GXVL 1KPRB 5D7JD 3TV3L 4D8PA 2VRAA 1FNGB 4S1QL 5DS8A 1OD7A 1KIQA 1IZKA 2DD8L 4PBWD 3C5SA 3INUH 3QEQB 1S7RA 4A2LA 1CXHA 5E2UL 1Y18B 3IDIB 3U30C 3DRQB 3FB5A 3X13B 2OL3L 4F7MB 1AI1H 1HHKA 1T3FA 4JY6A 2RFXB 5FHBL 1B90A 4F9LC 5D1ZD 1ZT4B 2XRAH 5ESVB 2XZQL 2HYMA 5F1IA 4JRYA 4OZHB 4L29B 5FDYA 4XXDA 3JWDC 2W38A 4RAHA 4ZODA 4DQOH 3DXAE 2G9HB 2W0KA 3NA9H 4KRMB 4U4BA 2D4FA 4PJ5E 4K8RL 4KKLC 2HFGH 2WUCH 4NKDB 3VXUB 4M1DL 1IGIL 3VFMA 5JDJA 4DN3H 4Z77B 1U58B 1OGAD 5EFIB 2KZ1B 4M93B 4MJID 5E6IC 3PWVA 1B88A 4IBLT 2CKBH 2P8MB 4XHQA 3C6LC 5DJCA 4Y4HC 4BZ2L 3LZFL 4FS0A 1G9MH 2XIDA 4MLSA 1PYWA 2P8PA 1U3HC 5B38B 4CVZB 1MY7A 5TQ2L 3NPSB 2ITDA 2NY6B 3RGVC 2EZ0D 3ET9F 5FDWA 1MHHB 2H26B 4OZIA 1F3DH 2PTTB 3WFHB 5IW1B 4EN3B 2QQKL 3V6OE 1IM3B 4ZFFB 1P1ZB 4YE4H 1FZOB 3WHE1 2SEBB 3JWOL 3HZVA 3SE3A 4XH2B 3I02A 1GYAA 2VDPH 3KXFA 3UP1A 3FN3A 1ZE3C 4JLRA 4NNYB 2Z4QB 3FKUS 4NFCA 3SOBH 3IGAA 4H1LA 2CMRL 2IJ0C 5I2IA 3QG6B 3UJJH 3QCTH 2WBJA 4PJBF 3MJ9A 3UJTL 3QXWA 4NZRL 4PG2A 4NOBA 1Q1JH 3R0MA 1KNOA 4MAYB 1T0NA 3FOMB 2I5YH 3EJYC 1ZHNA 3OKKA 3EOBB 2D7QA 5DVOA 1D6VH 5IIEB 1HWHB 3BEVB 4ZS7H 2LU7A 3TPKA 1J0KA 1J0HA 3ZKSD 3CPLB 3DOSA 3IJSA 5D70L 4PJ9B 5C2BH 4PIRF 2OI9C 5KSAD 2JF1A 4JDVB 3BP7A 2VAAA 1YEEH 1LO3L 3O11B 5I75C 1AGBA 1XIWD 3VXMD 5EIQA 3IFLH 2EC9U 5CJQH 3EYSH 1I3UA 5FA3B 2EDYA 4YQXL 2ITCB 3MLVL 3PWPB 2H9GB 5CJBA 2DLGA 2YBRB 3RKDD 5DQ9A 1TQCC 3SO5A 5I1DB 1B6DA 3DV6A 3U36A 4MA7L 3TO2A 1DVFC 2FBJL 4F33B 5TDOB 1MCNA 5C08B 5JMOC 5JOFB 4LLQB 1LO2L 4BSJA 2NX5A 4A6YH 4N0YH 2G60L 4PRPB 1G9EA 2AEQH 4XZUB 3QRFM 1Z0MA 4I77H 3VRLF 3IJHB 4PJHF 1WFUA 1TJHL 3TT1L 4QHLB 3G08B 5EN2B 3CLEH 2FJFA 1S9YB 32C2A 1XGPA 3BGFC 1NAML 4GAGL 2FO4B 4M1CD 1YPZB 4F15C 3LN4B 3S5LA 4OCRL 2JB5H 1G9MC 5GGSA 3WDJA 1RIHH 4P2RB 4EDXB 3OAUH 2UWEB 3ROOB 5E8NA 5I1JL 2NY1B 2AQ1A 5FYLD 3QEHB 3U2SA 2D0GA 3SQBA 4DKFH 4H0IA 3HFMH 4Y5VC 1IAIH 4LCUB 4AENA 4UB0L 3T04D 1S7WB 5F3BB 5I1HL 5DF0A 4F2MA 1AH1A 3P11H 4P5MB 1IMHC 1A6WL 3NABH 5HYSA 3EO1B 4MQ7B 5DA4A 3LN5A 5TF1L 1PG7H 4KJWC 4PJFB 5IF0B 2E27H 3EDJA 3ZE0E 3EFDH 4KY1L 1KJ3L 2AABL 2VLME 4LPVA 5ICXA 5DHYA 2IAMD 4QCIB 4O2CA 4QHMA 5CIPB 4LHUG 5CZVH 4ZPTA 1UCBH 1I1YB 4GQ9H 3RTQD 4XXCA 2YXMA 3VG0H 4U6XA 4RGNE 2X41A 1KJ2B 3WFZA 4OLZL 1C08B 2OJEB 1MCWW 1RZJL 1SY6A 4K7PX 4MJ6A 1JUFB 4KUCF 4NN6B 4OFPA 4NO2A 5JHDB 4X6FA 3I50L 2NZ9D 4K3GA 3RI5K 2GY7B 4EQ2A 2VH5H 1GGIL 2AJUH 1I4FA 2BRRL 4YFLF 1Q9KB 3TA3B 4MMXC 3GSXA 4X6CB 4JKMA 4ZPVB 3MV9E 5DZNA 4JFZH 4PB9H 2EIBA 1U8KA 3CC5A 1CFTA 1UYWH 2V2WB 2HFFB 3FB6B 4J4PA 3MV11 2JJUA 2Y5TA 3IDNB 3CVHL 3FHAA 4ODWA 3OGCB 4L4TD 2O5YL 4OZGF 1V8HA 1NLDH 1KEGH 2XI9A 5T1LD 3ZO0A 1UJTA 1FL5B 1RZ7L 3IU4L 3L3IA 1PQZB 3GSNB 1YEHL 5FM8A 1A3LL 4JFFD 5JW5A 4YPGA 3HLAB 5I8KH 3HZMA 4Y2DD 3FQTB 3MRRB 3HC0B 4ZUSA 1S3KH 2ESVA 2ICES 3SE9L 4LDOB 5IB3B 1T0MA 1FFNA 3LDBC 5CGYC 2IPKB 1B9ZA 2FNBA 5FGRA 3S34L 4M8QA 3DO7B 1LO0L 2QHLA 4GG6B 4HLZH 4OZ4B 4Y16B 4Y88A 4ONGL 3Q1SL 4LLDB 3IDJB 4WUUB 1RMFL 5AYUL 4PGDB 4LK4A 4C4KT 4JO4H 4HUXA 3VI4F 4J8RA 3BP6B 4PRBB 5IVXE 3GNML 3KPRE 4L8CB 1LO5A 1MF2H 1INQB 1UB5A 4Y4FD 4JDTH 4RMTA 1BFTA 4JHZA 4WJ5A 2DQUH 4YAQA 3B2UC 2CQVA 2EC9T 3ARSA 4GKSB 3BKYH 4OD2A 1HEZB 3AS2A 3ZKMC 3VFRA 1KEMH 2D9QB 2XN9D 5C0RL 1CR9L 1IAKA 1I9EA 2X4TB 4R4BB 4TRPH 8CGTA 4I1NB 4KROB 4LLAA 3P0GB 1A7BA 2E9IA 1EFQA 3BP5A 4HIEA 2W60A 1CFSA 2JKXA 3NCMA 3QDGE 1MWAA 1K8DB 2DIJA 2XZAL 1QO3A 2D2OA 1F3JA 4X5WB 3WS3A 3W2DH 4YX2L 3D3VA 2KUTA 2DQIH 5GS0L 2EEDA 1C8PA 4MCZB 4M4PA 1IC4H 4U1KA 2D3VA 4KQ3L 4PYGA 3TFKC 4NUJA 4IJ3C 1S9WA 1MJ7L 2QQLH 1ORSA 2VABB 2P7TB 4OGYL 3BRDA 2RAMA 1GC1H 1TQBB 2XQYG 1FCCA 5JR1L 2X1WL 4LSRH 4MDIA 4BELD 1OSPL 4AMKH 1ONQA 5CSGA 2DQJH 2QQQA 3HMXL 1K3ZA 1F4XL 5E2WL 4YGVA 1OAXL 4LLWA 3UPRA 4C56E 4Y1AD 1A1MA 4NC1C 2H32B 2UUDK 1AHWA 1WAAF 2LU4A 5EC1A 1TMCB 1CFNB 5T1MA 5I1GL 3H9ZA 4M6AA 4RFOH 1CVSC 1G9NL 1T4KA 3K1DA 2YPKB 2H1PH 2K9UA 1JZ3A 2GSGA 3OR6B 5HHME 4AL8L 5K9QG 5CUSL 2CKBA 5SWZD 3FQNB 5EIIB 4OBRA 2CXKA 4YHZL 4BK5A 4Z78A 4RQQB 3H3PH 4K7FB 3MLUH 4U1GC 4PJFF 3OGOE 3QWRD 4FQXC 3DUUB 3RUGE 4ZTPL 4HHAB 3C8HA 4FRWA 1CQYA 4Z7OF 3AUVA 5GPRA 4PP1C 3H9HA 2YZ1A 3VFUA 4HBCH 2R0LH 3OKMA 1NFIB 1O7VA 5CJXC 2C1PA 5GRUL 2PW2A 4OZFB 1NFDE 4HIXH 2J3SA 1G6VK 4O51A 3UJIL 1AQKL 2P45B 1TZGH 3RUGF 1P9MC 5I15H 3BZFB 4YDJA 3BZ4A 3FT4B 2BFVL 1MLBA 3SJVE 3WEXA 3X14B 4X6CF 3GHBL 3GM8A 1XR8B 5ALBH 3MRGA 3D85B 4MXWH 3KJ4C 1QRKA 2G5BA 5HHXL 3STZA 3KS0J 1X6LA 2IPUK 4WEMB 4D9QD 1DLHA 3MFFB 2DF3A 4KZDH 1ZSDA 1DSFL 1I7ZB 3FRPA 3HTLX 4AQ1B 1FVCB 2ZSWB 3OJMB 3QH3A 4LLMA 3SDCD 1A0QL 1U8QA 3AREB 4GG8A 1FORH 2CLZA 2VO5A 5DJYB 4DGVH 4JN2A 3STLA 5SX5H 4FTVE 1JGUH 3IT8D 2W91A 5JO5B 4PGBA 4IMKC 1ACYH 5TF0A 2FSEB 1B2WH 4FP8H 2NYYC 1MREH 4Z7QF 3UTSD 4M4RA 2LAAA 3WDIA 1GC1C 3GSQB 3MRPB 4KUZL 3QEUB 5I73C 4GG6F 4WGVB 1A6AB 4LPTA 2AJYL 2F54B 5AD0A 1TENA 3HC4L 3C5ZB 1D9KB 1YYML 4XMKL 1UWGL 2J5LB 4WFFD 1B0RA 1KACB 2NY4B 3H42H 2O93L 3OTTA 2X40A 4L3EE 5HD8D 2X4SB 3QO0A 4JM4L 1IBGL 1OM3H 4NNPL 5JIPA 4X4YB 4I9WD 3ARQA 2DQHL 4PJDB 3ZYJA 4D8PB 5FKAA 2Q1EA 2WUBL 3LS4L 1HDMA 3D0VB 4IRZL 5SX4I 4ELMA 4Z7UB 2JJVA 4POZD 1B4RA 5FYLH 4HT1L 5D7LA 3O2DL 2PYEE 4JG1H 3BVNB 3PQYB 1K8IA 2R1WA 4GUPB 1QSFB 1FYHB 3VWKD 5MHSD 1QLRA 2EZ0C 2YKLH 5HI5D 3JV6B 5DEFA 2MQ3A 4U33A 1KJVA 5HDQL 1J8KA 2BVOA 3B9AA 4YEFA 4GFTB 5CILH 1R3HA 4HJJH 1FZMA 1JHLL 1NGXB 3JTTA 1JGLL 3KLSA 4I0CC 1CE1L 5GGUB 4YDIH 5DSCB 3HKFA 2W9LA 5E5MB 3FO1B 4X7FC 4CADB 4GBXD 1R3IL 1DEEA 4G42A 3QNXB 3QIUD 2WZPD 4Z76A 1M1SA 1NC4D 2PF6A 2DQGL 1EAPA 3HC3H 1RUKL 5FYKH 3B5HA 4M61B 5GJSL 3VH8A 1AO7D 1MUJB 3S6CA 4NP4L 3TPUB 5FOJA 1SHMA 4NO0D 2I9TA 3H9YA 3B4NA 1T0PB 1ZA6B 4HX1B 1IGFH 1UZ6E 4RMSA 3O2WH 4M7LH 4M8VA 4WI9A 5GGVY 5DD0L 2IFFL 1S7QB 5EO0B 4P23D 5KSAC 2HRLA 3LKPA 3VDAA 2OCFD 2ZSVA 1HOCB 4KKCD 1ZANL 3LSOB 1XIWC 2DOCA 1I3RB 4ZYKB 4I18A 4MDJA 3CUPA 5C0CE 3ARGA 2PXYA 4Z0XA 1SM3L 2VZSA 5AZEH 4YXKH 4QNPE 4XC1L 3LRHA 4L3CB 3ZKND 3VGFA 3RKDC 4AEEA 1Q38A 1RUMH 3SDDB 1QBLH 4ZUTB 1FC2D 1DBJH 4GH7B 1OP9A 1WF5A 4OLVL 1OP5H 5BVPH 2Z91A 4RFNB 1JF1A 1QSVA 1R5VA 1G1CA 5K9JL 5E4EB 4JKLA 5D7IB 5EO9A 3TZVA 1I7UB 3V79C 4YGAB 2X4PA 1K85A 4Q9RH 1CDCA 1QKZH 1MI5A 4LU5L 4NQEA 3RGHA 1E4XL 3OR7B 4P2QD 4GJTB 4LCCB 2OXGA 1MIEL 4FFZH 5DMGD 1CIDA 4LARH 2Y9RT 3AU1B 3HI6H 1KLUB 4HDIB 4B53A 4BA8A 3TIDB 3DVGA 4M1CC 2EDHA 1NC2D 2NZIA 3IJSB 4NYLA 1JRHH 2CPCA 2H3NB 3K1KC 3MR9A 3RU8H 3C2SA 3EOTH 5GRYA 4D0CA 1K9TA 4G8EA 5AUMB 2DYPD 4CN4A 4X98A 3WHXA 2IANA 2A6IA 4N8CL 2B2XL 4MXQD 4DGYH 4OQTH 1GJIA 5DUML 3K2UH 3TYFB 3PNWA 4E41A 1M6OB 1JL8A 5DQ9B 4I2XE 2J88H 3CFBA 4BJLA 5LGHL 5JPNA 3MODL 1JPGA 4WV1A 3DRTA 5EOQH 4KTYA 3BD3A 4TSCH 3CFJA 4HXAH 3F12B 5EOTA 2YSSA 4KMTL 3QRGL 2NX5B 1LHZA 5E2TL 5D7JA 5EUOE 1HHIA 2R56H 5F97E 4R4FL 1F42A 2DQDL 2IAMC 2BDNL 4HS6A 3CFIC 4G3YL 3EYVB 1JGEA 2H6PB 3RTQC 4JCMA 3ZE1F 5BO1L 2Y72A 5E9DA 4IMKA 1TETL 4N0UA 2E7HA 1JI1A 4K71C 2R69L 5GGTA 5LWYL 5D1ZA 2BNRB 2VE6A 5CJ8A 2NZ9C 2WK2A 1TNMA 4R2GB 5EBLB 5DD3L 4NDMA 3FT3A 3M8OH 3V5HA 3UTPE 3ZTNH 1NCDH 4U1JA 3QUYA 4G9FA 4OSUL 1FFQA 3QULB 3GSOA 3D0LA 4PJXF 1MFDL 2VLJE 4QOKB 3EOYG 4ETYA 2P47B 3R06A 3RPKA 2XA8L 1I85A 4GRLA 4PGJA 1EGJH 2DB8A 2ZUTA 4H1LG 4WEUD 3BO8A 3W0WD 1BD2B 2OSLA 3FQRB 1OOAA 3MRBB 3TGXA 3O0RL 2WV3A 1DFBL 4HPOH 3LHPL 4L8BA 4ZQKA 4HIIB 3ARZA 1WIUA 4Y2DC 2VNCA 4NWUL 3S36L 2A6KB 5HHNA 1SEQL 3U30B 5C92A 4MNQB 2IBBA 1GHFL 2QADD 4X7DC 2J8HA 2C7UB 5EUKB 3QXDA 5DVKA 1CE6B 1IC7L 3PP3K 4Q6IC 5HHOE 1PJ9A 4S10A 3MV8A 5GGQH 5KG9A 4JM2D 3TLRA 5MEND 2F53E 1SEBA 1GAFL 3VXRB 4PJIE 1LE9A 2P5WD 1NAKH 1FG2A 1JNHA 3B3IB 4M48L 3SDXE 3ULVF 5K9OA 4JFYB 3CC5B 1R5WB 3ZSTA 2W9EH 1U3ZA 2Y5TB 3LV3A 5B4MD 3MLXH 1HXYA 4ZXBD 2BJML 4Y4FC 5INDA 5D71L 4NBXB 5K59F 5HYQB 4JQIH 5E6IB 2AK4B 4HEPG 5T3XD 3BKJH 4PTTB 2WANA 3SDXF 3C6LB 4Y4HB 5JW5B 5H37G 3VG9C 3BGMB 4YPGB 4PY7A 4F7TB 3HZMB 2ZJSH 4L5FH 3KPSE 2FEDD 4U49A 3O8XA 1U3HB 2V17H 4R8WL 4GW4A 1C1EH 1T0MB 3ARPA 3RNKA 4GRWB 5IW3A 3V0VA 5KSAA 1RQ5A 4EUPB 1BQSA 5D7IF 4X9BA 3LEVL 3CU1A 3SKOB 4ODXA 1JMZA 3RGVB 2NR6D 5ETUB 4JRXB 3S5LG 3I2CL 4H20L 5GXBB 5LXGH 5JDSA 2QJDA 4X4XB 5GGRA 4DCQB 1LP9B 1QYGH 3T2NL 4G43A 5BJTA 1QLEL 4Y4KA 5HYEA 4DUVA 2IH3B 5T33H 1P6FA 1BBDH 2NY0D 4ZOCA 3MLRL 4H88H 4HWBH 3FQWA 2AP2A 1TPXC 1H15A 5GRVK 3QG7H 1BX2A 3RWHA 1RJZB 1GPOH 4EOWL 3OG4B 5HGBA 3UZVB 5HYSG 5IM7B 5DUPL 5FCSH 3ZE2E 3OSKA 5HY9A 3FFCE 1YNLH 4M6MH 1GVIA 2R4RH 4MS8D 3OKDA 5F9JB 4QRSB 5HDBE 2ICWB 3K4ZA 4ERSL 2CDFB 4QRRB 2QEJA 1OARH 3I6GA 5FXCH 2OI9B 2W60B 4NQTA 4XNUL 1CFSB 1BJMA 3B8YA 3KYAA 4P0DA 5BMFL 5DJDB 3BQUD 1EUUA 5I75B 1S5IH 5J56B 2O5ZL 4UINH 2C3VB 4CU8A 2IC2A 1DN0A 2AS5M 2GI7A 5BZDA 5AWNH 4X0KA 4OFKA 5J13C 5DRZB 5FB8B 4QRPB 1TQCB 1E28A 3TT3H 2LVEA 3IDXH 2OX5A 2ARJA 3FCTB 5IB2B 1U6AL 1DVFB 1WSST 1CWVA 4XNMA 4XPBL 3HE6A 3WN5A 2P1YA 5JPMA 4LLYB 1BM3L 1NMCC 5BQ7B 5IQ7H 3BMVA 2EIZA 4HH9A 5IMKA 3BE1L 4G6ML 3QUML 4XNYH 5ITFB 3SN6N 4CVXA 5C0JB 1EHLL 4TOYH 3DJ9A 4JE4B 5EC1B 2CRZA 3REWA 1SMOA 2WIIA 1AC0A 1YNKH 3V6OA 2JK5A 3BZDA 4AG4L 2GJZB 4URTB 1T4KB 2F9BT 4OT1H 3VD9A 2ADJB 3WJLA 2APVA 5FA4A 3WE6A 2O61A 3BGFB 5EZIH 5E1AB 2CKBB 4F15B 3OKOA 3L5IA 1BZ9B 4HKXA 4HWNA 2JCCA 2LV4A 3QPQD 2FEEI 2LFGA 1GZPA 3GRWA 2BSTB 2R4SL 3KPOA 5BV7H 3SDCC 4K8RD 3JVGC 3D39D 5TPWL 1VFOA 4LEXH 4RGOL 4NHCH 4Y5VB 2ZG2A 1BF8A 1RFDL 2RHEA 3JV5A 1OCWH 1BJ1H 1F58H 1FPTH 1BBJB 4PPTA 1FIEA 5J1AB 1A6UH 1BFOB 5D5ME 2CIIA 1JNLH 1Z9MA 4L4TA 4Z7VA 3KLHD 4NRXB 4YBQD 1N4XH 3DIFB 5T1LA 4EI5D 5C2UB 1FNEB 2CDGB 3CLFL 3TN0A 5A2JH 2AGJL 2NTSP 5D6CB 4Z8FH 1CZ8H 4ZFZB 1W72L 3HZKA 4R26H 1JK8A 3U82B 5L2KB 4Y2DA 3PXHA 5GGVL 4XRCA 3O4OC 1TVHB 2XOTA 1XF2A 1II4E 5HD8C 43CAA 5F9WC 4UTBH 3FO0H 1VSCA 2E6JA 3G6JF 5J6HB 4XPTH 4FZ8H 4UOW0 5KANI 3QH3B 3S35H 2ZOKA 3RFZC 1S7XA 4JFEA 3CZFA 5HHPB 3CSYA 2DQCL 4POZC 4UQ3A 1S7SB 2VERN 4JGJA 3ULVL 1ZHLA 2HG5A 4ORGA 3N1PC 1YMMA 1J8HE 3O4LA 3C08L 3QPXH 2IBZY 5IVZB 3VWKC 4HUWA 1JF5A 4HGWA 2VXUL 2FD6L 4GRWF 5HI5C 4J3VA 3EO0A 1CD9B 4OTXL 3O3UN 4OLUL 4HUUB 5IBTL 3T1WA 1HSAB 2D7TH 3PIQA 1QRND 3S37X 1UKTA 5CEZD 2V2TB 1LP9F 3HZYA 4FNLL 1A6TA 4NJ9H 5C09B 5IBLD 5ID1B 2XQYK 1FJ1A 4X99B 4Y19D 4U7MA 1HN1A 2DJUA 5CD5D 3L1OH 5C3TA 4A6YB 4GBXC 3L6FB 4WVRA 2VITB 1NCCL 1CDIA 4XVUD 1HYRC 3QIUC 4YBLC 5IV2B 1C12A 2ADGB 1BJ8A 2OK0L 1MCDA 1DE4A 3LDBB 1KLFA 1EJ6A 1ACZA 4KRPD 1WZLA 1JPFA 3ARDD 3VCLA 4OFYD 4S1SH 4PGCA 3ARXA 5JW4N 3RQ3A 2VLLA 4RAUA 1UADC 2IG2L 4X8JB 1HH9A 5DRWB 5EB9A 1L6ZA 2B1HL 4YHNA 5D7LB 2APTA 3BIKA 5BV7C 4OCYH 1TTFA 3VXSA 1KB5L 2YD9A 4P23C 1MAML 1MFAL 1CD0A 2D0HA 3IU3A 5INCA 1CCZA 1KN2L 1A5FL 1RPQA 2VR4A 3OPZL 5DD1L 4KKCC 2FR4A 3MCKA 3T8XB 1QLRB 2R2CA 1E4XI 5KS9B 1B0GB 3PHQA 2VDLL 3VA2C 4MJ5A 2R2BB 1I75A 3OX8A 1YEIH 3MNWB 2HTLD 4LLVA 2I07A 5F7YC 2KDGA 1CG9A 2P4AB 4N9GA 3ZKNC 4DZBA 4Z5RB 2OJZL 1TZIB 3KWWA 1HZHH 1TJGH 5BZWA 3FQUB 3P9LB 5D2LE 5HHQA 4F8QA 2GJ6D 4L8SA 4PJEF 3TO4D 3U7YH 6CGTA 3MNVA 3ARBA 5D2NE 2KPNA 5D8JH 5TE4L 1J87A 1P4LA 2ZNWA 4X8XA 2X5PA 1GOFA 4NQDA 3GK8H 4LAJH 4D0BA 5IR1B 3QWRA 4YEEA 4P57A 1BVKA 3FRPG 5DMGC 3H0TB 1A7NL 3CH1B 3EZJB 4IJ3B 4K3HA 5BRZB 3AS1A 1M05B 1WCBA 3WYRA 2ZKHH 1RURL 3MV7E 1WC7A 2HKFL 1NCAH 4R9HA 4LVNC 1HHHA 3OKNB 2R8SL 2BVPB 4X7SH 3LKPB 1VACB 2OM5A 4K94H 3VMOA 5C7XH 5E8OA 3MZGB 2C4FT 1KGCE 5SX5K 3SCMD 4CAGA 3U1SH 4DFIA 2HJKA 2JIXB 2VLKE 4K3DH 2HTKD 4G6JH 4FMFA 4LCIH 3KJ6H 2EDXA 2DLTA 4JKWA 4MWFA 3MX0A 3BSZH 1KELH 4WNQB 5FIEA 1U9KA 3S7GA 2BZDA 4OM0H 5T3XH 4M6OH 5KOMC 1G6RH 4E0RA 1GL4B 2FHBA 2LVCA 1R3LB 4JB9H 4ZOBA 4XC3H 3SKJH 1IGMH 5SWSD 3LMJH 2GTZB 2OMNA 5F1KC 3G5ZA 4JZNB 2FECI 5IHUH 5EWIH 3KPRA 1NL0L 5HHVL 2CRMA 1YEKH 1ZTXL 4U1GB 4QXUL 4FQXB 1OAKL 3UTTB 1NQBA 3HRZB 3LKRA 3SHSA 5TFSH 3W39B 5E08L 3N9GL 5JHLH 2GK0A 3QDJA 3LRGA 3GBNH 4NO5A 1TZHB 4ODVH 1HIML 4QHNA 5J8OA 2X4QB 3CSBA 2BX5A 1T5WA 3UTSA 3DXAD 2ATKB 3ABZA 4YHMH 4PJ5D 3WFEL 3OB0H 2E9WA 1QFWL 3NIDE 3MOAL 4ZOAA 5DLMH 3TWCH 4MD5A 4GSDH 3WHXB 3VE0A 3SKMA 4ODSH 1PSKL 4KKAD 3EGSB 3RWDB 1F8TH 3BH9B 4YJZL 1F4AA 1EMTL 1RAMA 2DWDA 4Z7WE 5F7EH 2N7AA 4OZHE 4PRHA 1RU9H 3KJ4B 3MJ6A 1HQRA 3PP4H 3DPBA 5F3HB 3T0VA 4ETQB 2V2XA 1KIPA 3IFOB 3WXVL 3BI9X 3GMNB 4NZDA 4R7NB 4AEIH 2YSSB 1MFCH 5B8CC 5I1AA 4W4OC 5IHZB 4OIIL 1UWXK 1HHIB 5KJRH 4JJ5A 3QA3A 4KRLB 2D9CA 1TTGA 2NY5L 1K4DB 4CJ0A 1MEXL 4JPVH 4KDTA 1ITBB 3EOAA 3I75A 5JLZA 4UTAL 2PR4L 2QADC 1FL3B 1AGFA 4P3CL 5GRZA 2CDEA 5JMRA 4GXVH 1W0VB 3TV3H 4LGPB 5C71A 4LPXA 4S1QH 2VQTA 1U8IA 4JM2C 2DD8H 4O2EB 4XB7A 4HXBL 4KPHL 3QXAB 1RD6A 1FVDB 3MJ8B 4U1JB 2DTSA 5E2UH 5DWUL 1IQDB 2EE9A 4K94C 4M3JA 1JPSL 1U8OA 2OL3H 4RNRA 5FHBH 3MGAA 4GBXA 1SYVB 5B4MC 3QIUA 2XZQH 4ZXBC 3BPCB 1M7DA 2DKUA 1YEFL 4K23L 1OGAB 3EFFA 3D87B 4MJIB 4NRZA 1X4XA 5EZLB 3J7HA 3PDOA 2NXYD 1L6XA 3O3AB 3TBSB 3SPVA 1OP5K 4L8BB 5IKCA 5K9KA 5D1QD 5F44A 2ICEA 3ILPA 5EG6C 5KSBB 1F11B 4K8RH 2FEDC 1KENL 4JJHA 4QF1A 4M1DH 2APBA 5E8EA 1IGIH 3UBXB 5L7XL 4KXZI 4ZSOE 4LSUL 3ULUE 4R7DB 4CW1B 1Q9LB 1LEKA 2NR6C 1AP2A 3O3DA 4JZJC 4HCRL 4BZ2H 4NN7C 3LZFH 3VXQA 1I8IB 3LKSA 1CL7L 3OKLB 3BPNC 1NKOA 1SEBB 5JA9A 3KPTA 4KGLA 1D5XA 2VQ1B 4XPFL 2NY0C 5K9OB 5TQ2H 3PWPE 1WCQA 4R96B 1G7MB 4FTVA 2WNGA 5KVFL 5CBAA 2LE9A 4ELKB 5HJ3B 1IAOB 3V6FB 2QQKH 5D7SL 5C08E 3JWOH 2VISB 5JW3L 1YN7B 1I1RA 1H0DA 4MS8C 2XPGA 4P2QA 4GAJL 4XWGL 3TCXA 4JKKA 4PRPE 3H9SB 3HS0B 5HBBA 1CK0L 5F7HA 2CMRH 3C9NA 1ZGLA 3TJHD 3FO2A 5TGBB 1UCTA 1JWMA 2ZPKL 2X6MA 4RFEB 3UJTH 5C0GB 5KSVA 3BKCL 4NZRH 2DM7A 1I9RL 3BQUC 2ZCHL 4ODXB 3F7RA 1H8OA 2DIBA 1XIWB 3VXMB 1YPZE 1CBVL 3FN0L 3RNQA 2WM0A 4PJGE 4W6YB 4F7EA 1EDQA 5EU6D 3GJFH 1DDHA 2EIDA 3CDGA 4P2RE 1J7VR 4KUCD 4PJ7A 4Y2OA 2UWEE 4HF5L 5J6GA 3QJFB 5JW4Q 1QSEE 2VLMD 4IRSD 2GYSA 3RWFB 3QDMD 1CFQA 1VGKA 2LAGB 5I1IL 1MHEA 3FQWB 4G9DA 4PG9B 1LO3H 2PYEA 1IEAB 4D3CL 2CGRL 2VXTL 4JFPA 2F8VA 2FJGB 3H2WA 2D31A 4YQXH 1BZ7B 3MLVH 4JY4A 3VA6A 4YHIB 3BW9B 3CSPA 1DTUA 2KKQA 4FXGA 4MA7H 2MSPA 5TJWK 2FBJH 3LQMA 1IEBB 4XCCL 3U7WL 1J05A 5E1HB 3S8WA 3MRDA 3QIBA 5GS1C 2EDWA 1ZHKA 1LO2H 3MV9D 2I60L 2DLIA 4LKCA 5BS0A 2G60H 3MXWL 3QPQC 2BNQD 5EBMB 2IQAB 4K8RC 1ZA3A 1OLZA 3L3GB 1TJHH 2V9QA 5DQJA 3TT1H 3QUKA 3MRMA 5CCKL 1BREA 3U46A 3PHOB 3QJHB 1O0VA 1NAMH 4IMLA 5IWLA 2P8LA 4GAGH 4QXGL 4XWOD 2AKRA 1OF2B 1I9JL 3DWTA 4OCRH 1MCBA 1YY9D 4RWHA 2HN7A 2VSCA 3KLHC 3UEZA 4WEBL 5I1JH 2B20A 3RWIA 4EI5C 1UH2A 4POYA 1LEGA 5DD5L 1ZLSL 3WD5L 5L88L 4OI8A 3BHBB 4HWZB 4UB0H 2FJHA 2IAMB 4MCYA 3NCCB 5I1HH 1AIFB 3A67L 5DI8A 3WUWA 5DYOB 2X9WA 3RTQB 3QZWA 1A6WH 4ZUWA 3ETBF 1HILB 5FA4B 3H3BC 3FAXA 3T2OA 4K71B 4JRWA 3LQAL 5TF1H 2BSED 3OKOB 1MFEL 3U4EB 3MYZA 5CLTA 1OVZA 4KY1H 1KJ3H 1CVRA 2AABH 3KDMA 5CSZB 2F74A 1RZIA 3NN8B 1U93B 15C8L 4GXUN 1XZ0B 3DX7A 3QFJB 4TVPE 2QLVB 4OLZH 1Q9OB 4G8GD 5KSBF 1RZJH 1IM9D 1ZK9A 3VJ6B 3P9MB 4N0FA 5GRVL 3I50H 3BDBA 1MRFL 4WUUE 4L4TB 2P5EE 3DTXA 1GGIH 2JJTA 2B0SL 2BRRH 1QBML 5T1LB 1KYOJ 3QCVL 1EIBA 4AT6A 2O5XL 3QDGD 4O4YL 2HVJB 3W9DA 2EECA 1DP0A 5IBLC 4JFFB 2AVGA 3KPPA 3MMEB 2J8UE 5CD5C 4L9LC 1J5OL 4XBEL 1W0WA 2V7HA 2HFTA 3K81A 1FGNL 3PJSA 4C83A 1JZ7A 3DROA 4OV5B 2O5YH 4PJAB 4WI7A 1UEYA 1FL6B 3DX8B 4G6AD 4KRPC 1MFBL 4N8VB 5BW7C 4QTHB 1RZ7H 2ZNXA 3IU4H 3ARDC 2R9HD 3MBXL 4Q6IB 3CVIL 3Q3GB 4XBPB 1CFBA 1YEHH 1A3LH 4LNRA 1JNNL 1X5GA 1QQDA 3X3FL 2Y7QB 4NQCB 1HSBA 4C56D 4EI6A 1J1OL 1G7JB 3SE9H 3TCLB 3P0VL 1ZHLB 1F6AA 1IL1B 3MGTA 4PJCB 2QHRL 3ULUL 4PR5A 4HUWB 1LO4L 1Q9WB 1T1ZA 2FGWL 2KBGA 5FUCE 2GITA 2F5BL 4BH7B 3S34H 3Q6FA 1LO0H 4U1NB 4Y4FB 3STBA 2VLRE 2BHYA 5HHMD 2XWJA 1VPOL 3O6FA 3HR5A 1FYTE 4AZ8A 4C55A 2HTLC 1ZVYA 1QFPA 4MB4A 2DBLL 5EU3B 1NUDA 1IGTA 1N5AB 3NAAL 4ONGH 3Q1SH 2XN9B 2IEPA 1XGQB 3ZLQC 1CTNA 1RMFH 2DWEB 5AYUH 3HCVB 3VG9B 3VRJB 2YPLD 1HINL 5JHDD 5MERA 3RVXD 2PUQT 3GNMH 2B4CL 4U3XA 2EYTA 4GOSA 4HKZA 4OF8A 1WGOA 4WHTB 2FB4L 2CK2A 3BQUA 3ESUF 4M7JL 5EZJA 4WDIB 3QNYB 5EZOL 4KTEL 2BHZA 5C0RH 2AJSL 1CR9H 3RWCA 1P7QD 3LB6C 3IS0X 1T1XB 3QI9A 1T1YA 2ZCLL 2VIRA 2DJ4A 3LKNA 3WV0A 4W6WB 4KHXL 3JV4A 1D5ZA 1HHGA 3BP4A 3QXTA 3RY5A 5DTFB 2XZAH 3SJVD 1TPXB 2D7OA 5SV3A 4NQXB 4XP9L 2C3XA 4YX2H 1D5MA 3MCKB 4ZUVA 4WFEE 4V1DE 3O6KL 5ESAB 3VFTB 4Y1AB 4KQ3H 1UT9A 4MJ5B 3SCMC 1RZJC 4LLVB 4I3RL 1MJ7H 2HTKC 4X6DA 2XTJD 4XCNB 1C5DA 5HGAB 1JYNA 4OGYH 4UUJB 3BXNA 4P5KA 2F53A 5JR1H 1OSPH 1KTLB 3GBML 4YHPB 1UJ3A 3HMXH 5GS1A 1F4XH 3AXLA 5E2WH 1QFWI 3VRIA 1OAXH 5SWZB 2GAZA 3FT2A 3N50A 3O81A 3P0YL 4AYFA 3VFPA 3WO4B 4JZOB 1EEYA 2J2ZA 3KYMA 3QO1A 5H2BA 2BSSB 5I1GH 3ECBA 5DK3A 1TCRA 1G9NH 3TVMD 3T0WA 2X4NB 2F8XC 1BVLA 1AGEB 1MLCB 1U8PA 2BK8A 2HP4A 5J13B 4JFDB 4H5SB 5EU4A 3CFKB 4AL8H 5CUSH 1H3PL 1RIUL 5DC0A 3G9AB 4OM1L 4YHZH 5C0AA 2CH8A 2W92A 1BHGA 4XX1G 2OMBA 4PRIB 4ZTPH 1NMCB 2EKJA 4L3ED 3QQ4B 4EXKA 4KKAC 1EO5A 1JYXA 1OGTA 1KG0A 2EDTA 1DN2A 4UNUA 2GIYA 1YNTB 1GGYA 4MWFB 5GRUH 3RL2A 3BPOC 5J12C 2OTPA 1D3CA 5T1DL 3DURA 4KK6D 3UJIH 1AGCA 4OCNC 1AQKH 5DHXB 3RVUD 4OQ1A 3TBTA 2JE8A 2ARJQ 3I84A 4JO2L 1HQ4A 3D2UA 3RHWK 2P24A 3SDCB 3RAJL 2BFVH 4MA8L 5I76A 3OKEB 4D0DA 1R3JA 3HAEA 4EDWL 3GHBH 2PYFB 2DI9A 5KW9L 3HG1E 4NRYA 3MRJB 1XCQA 5IW6B 5IQ9A 5KSUB 4U05A 1LD9A 1LILA 5HHXH 1GGCL 2XT1B 2J12B 4K3EH 1KT2B 1EEZA 4Z7UE 1QP1A 1DSFH 3OXRA 2Q6WB 3RWGB 2J7LA 3UTSB 4JHBA 2EXYD 1A0QH 3P4NA 3VFWB 5D93C 2AJZA 1S7UB 1KCUL 2HJLB 4NQVA 5AEAA 5HYJA 4Y8AA 1L7IL 4TVPL 4XP1L 5SWQA 3MRQB 4NZJA 4EEEA 3O4OB 4JRYE 3HE7C 1VHPA 5DK0B 1MFNA 3S96A 1JZ4A 3G5XA 5T1KA 3NGBC 1PLGL 5B3JF 1HHJA 3C60D 1CICD 5F9WB 1DQQA 3GMRB 1QNZL 1CL7I 3B2VL 4KUZH 2NXYC 1H3XA 2AJYH 1E4JA 3MCLL 5T3ZD 1QLFB 1YC7A 3CJJA 5IBUB 3HC4H 2EH7L 2CLRA 2R0ZL 9CGTA 1YYMH 4XMKH 1UWGH 3F58L 3HPJB 3N85L 2EYRA 4AEHL 5HGHA 1UENA 2W0PA 4RIRA 4MA3B 3VWKB 2J6EA 4JM4H 1K4CA 3GMOB 1IBGH 4NNPH 1AGFB 1NPUA 1G9NC 2DQHH 5CBEA 1U8JB 4ZNEE 5JUEL 1UH4A 3BFOA 3LS4H 3WSQL 1U8IB 3U83A 2BCKA 4IRZH 3T77B 2V5YA 5CEXB 1F3DJ 4OZIE 5DURD 4HT1H 3T3ME 1G7LA 3O2DH 2XWBB 4GMSL 5ACMA 2YXFA 1A7QL 4GKNB 2GJ6A 3TO4A 1FFOA 3VXNA 1X6NA 2VN7A 4YBLB 1CGWA 1NBZB 1NC4B 5HDQH 4KJPD 4MSWB 3GSRA 3MREA 5JOEA 5T5NG 1NGWA 3ZT7A 5D5MA 2XTLA 1AO7B 2H8PA 1JHLH 1WZ1L 5C07A 1WUNT 3VFOB 1JGLH 3SPVB 4NO0B 5F88A 1CE1H 4EBQL 3HUJB 4GRMA 3MRKA 5DHVA 1T04B 1U92B 2BP3A 3X11A 1R3IH 1J1XL 1U8LB 2JJWA 3BT2L 3GBLA 3TJHC 3MRNA 4EXPX 1WFNA 5BV7B 4PV9A 2NTFA 2DQGH 3REVB 4H0GA 4P23B 5GIRA 3PXJA 3WNOA 1RUKH 4ZFOB 1KIRB 5GJSH 1ZLWK 3O6ML 4NP4H 5T5FL 5I1LA 2XZCL 3MNZA 3T4YA 1N3NA 5HGDA 1SBBA 3GSVB 5I71C 3CXDL 1EUTA 5GSVA 1A1NA 2GCYA 3DLQR 3OMZA 3H7BB 4KJQD 3KPNB 5DD0H 5F1SA 2VZOA 4IRSC 2IFFH 1U2CA 3TBWB 4X6EB 5I66B 3HRPA 4CMMA 3OB0K 4QXWA 4JFQB 1ZANH 4KAQL 5SWSA 1J8HA 1CGXA 3KLAB 5KAQG 3P4LA 1JVKA 1AFVH 1JN6B 1SM3H 4XC1H 1IT9L 2W0FA 4U6VL 1HE7A 2NX5E 1N8ZB 3T0AA 5FGCE 1RK1A 4D9RE 2FH8A 4F3FB 1X4YA 2W0LA 4R6UA 4OLVH 5K9JH 3GDBA 3LKQB 2VC2L 4YNYA 4LVNB 2PN5A 1NC2B 5C70A 1GGUA 3C6SA 4X6BB 5H35A 2VLJD 4RBPK 3BAEL 5JXAL 4LU5H 5DJXB 1MAJA 3RWEB 4PGEA 4LSQL 1E4XH 2DYPB 3O3EB 5E6ZA 3W5NA 1MIEH 1MCEA 2BNRE 3K46A 3RA7L 3BMWA 3NVQA 4KI5E 1JV5A 2ADIB 4U2YA 3ZMRA 1FN4B 3EYFA 1ZHBA 4XWOC 3LEXB 1ZGLP 5B39A 1PGRB 1YY9C 4BM7A 1ZKAA 1EHXA 1MHEB 2DIAA 3I9GL 3MUZ1 3WXWL 3LPGA 4N9OB 2HVKB 3RY6A 3ZT5A 4N8CH 3ULVD 4HK0A 2B2XH 5ANMA 1WJ3A 4JQXC 5DUMH 3MRFA 3MJGX 4ZAKD 5CHNA 3KPLA 3S97C 1T22B 1BD2E 5LGHH 5DJ6B 5HHOD 3MODH 4AIXA 4FXGB 2YN3A 4PJBA 3P73B 4LSPL 3O9WD 2A73B 2A74B 1FO0A 1U91A 3QQ3B 5AAWA 4I5BB 4KMTH 1A7RL 3QRGH 5E2TH 3JSSA 4B7IA 2Z35B 4R4FH 2DQDH 3DX6B 2XNAB 3UC0L 4G3YH 3GB7B 1NSNL 1S7TA 1UKSA 5JOPE 4OAWB 2APXA 3C5JA 2FZ3B 2EDBA 3MRMB 5BO1H 1K3IA 3ELAT 4K2UL 3TESA 3JV0A 1TETH 5CP3A 1X5FA 4IMLB 2AXJA 2NW3B 2P8LB 3B9KA 4NO3A 4PRAB 2R69H 1HH6B 5LWYH 2FIKA 4JR9L 3DVNA 5CJOL 5MEQB 3DMMD 1RUPL 3KPSD 3S35X 4K07A 5DD3H 4LGSB 1ZLUK 5EO1A 3W0WB 3VMNA 3PWJB 3EW3B 5B8CB 4OSUH 1OAQL 4S1DD 1PY4A 3V0WL 4MCYB 1MFDH 3RX5A 1FVEB 5D1QA 4OCSL 3WUWB 2AK4E 3AY4C 4L4VA 2XA8H 4UAOC 3P4OB 4NT6B 1BOGB 2IH1A 4PP2A 2QADB 1JGDB 2R1XB 4PJHA 2P43B 2Q8BL 4LCWA 4G6AC 5IFJA 2ESVE 2K7PA 3V7MA 2NLJA 3Q5YA 4FQLL 3SGKC 5DK2A 2R9HC 3ARFD 3O0RH 1DFBH 5ECJE 1Q94A 3LHPH 5C0DB 2NXZD 4JM2B 4O2FA 5MENB 2PW1A 4NWUH 1JTPA 4I4WA 2VDRL 2P5WB 3S36H 3T65B 3S88L 3HUJF 4LBEB 1SEQH 1QEWB 4KZEL 3FFCD 2FLRT 4R3SB 3WIFB 3SY0A 2DLEA 1GHFH 1KPRA 4KVNL 1FNGA 1IC7H 1IGJB 5CINL 4ZXBB 2PNDA 1I8LC 3QEQA 1PKQB 1WWCA 2VXSL 3IRZA 1GAFH 1Y18A 3IDIA 1A6VL 2GFBB 3DRQA 3WLBB 3X13A 4M48H 4F7MA 1G6RB 2RFXA 5HPMB 5DEGA 3OF6A 4XTRD 4ZDHB 1L0QA 3RVXC 1NBYB 2AK1H 2RB8A 1F2QA 2EIEA 2ILLA 4M43L 4JFOB 3RDTC 1OB1B 1OP3K 2BJMH 4UQ2B 1AKJB 4L29A 5D71H 4AM0B 4QRRE 4GKOA 4JZJB 2G9HA 4NN7B 4F58L 5BXFB 3OAYH 3MJ9L 3VXUA 4NKDA 1H9VA 5LGJA 4V2CB 3BPNB 4EI6B 3D3VE 4Z77A 4R8WH 1U58A 5EFIA 2ZUXA 2HKHH 2NY0B 3WLWD 4WWKD 1NANI 1EZVX 1T21B 1NEZG 3LEVH 5DR5L 2P8MA 4NKMB 1U8NA 5D1XD 3V6ZA 5MEPB 3HB3C 1EO8L 3I2CH 4H20H 3KG5A 5H8DA 2Y36L 3T2NH 4CVZA 3GJEB 1FH5L 1QLEH 2XTJC 1R5IB 1YMHB 4OKVB 4OZGA 3MLRH 3NIGF 5E8DL 5LCVL 1MHHA 2H26A 1X5HA 3TBVB 2GT9B 2PTTA 1S9XB 4MX7B 3WFHA 5IW1A 2EYTB 4NQUA 1RV6X 4Q0XL 1IM3A 3D69B 1P1ZA 5MI0C 1FZOA 1YUHB 3QZWG 2SEBA 4KXZH 4EOWH 2K3TA 2QL1A 3FZUD 4P9ML 5C1MB 4XH2A 5DUPH 5JW4R 3BQUB 3Q48A 1NH6A 1N0LA 1P6AB 4NNYA 4AJ0A 3CFDB 3RHWF 2Z4QA 4IRJC 5IEKB 1A22B 1M71B 2AJ3B 4LRNL 5C0BB 3TVMC 3X17A 4KKLD 1ADQA 5CGMA 4ERSH 3FB7A 1ITCA 3QG6A 5FFLA 3RX8A 1E6OL 4PD4J 3MBED 4G8IB 4XNUH 5DVLA 4JDZB 3GMLB 5FUOL 4MAYA 5BMFH 3FOMA 4DZ8B 1P2CB 4GW5B 2Z31D 3EOBA 1IFHL 1CLYL 1T89C 1UQSB 5IIEA 3BEVA 2O5ZH 4P2OD 4P5TD 3SGJA 2OL3B 4JPWL 3ZZ1A 4ONHA 4JDVA 2CLVB 1U6AH 3ROLA 3WFDL 5AZ2L 5ADPL 1GGBL 4XPBH 5EORL 1EFXD 2EDFA 5F7FA 4KK6C 1F02I 1FHGA 5GS1B 4JRXD 3VRIB 3RVUC 5L2KE 5FA3A 2F5AL 1BM3H 2ITCA 3PWPA 2H9GA 2R29L 2WBKA 2YBRA 3BE1H 1OPGL 4G6MH 3QUMH 2EC8A 5DZOA 1RJCA 4QY8B 4B7LA 5I1DA 1EHLH 3D39B 4F33A 5TDOA 3K8KA 2E6PA 4AG4H 5C08A 3L95A 1OAYL 4UU9B 1U8PB 1ZS8B 3U7AA 4NNXB 4G8GA 4PRPA 3FL7A 4BSWB 3MA7A 1IM9A 2BOBB 4XZUA 4RRPA 3HR6A 1OTSD 1FZKB 3IJHA 3MLSL 2EXYC 2R4SH 4KWUA 3SEPA 4QHLA 5DO2D 5TPWH 1VGEL 4F57L 3G08A 5A40E 5EN2A 1I3GL 1OD9A 4EI5B 1S9YA 4RGOH 1I8KB 3O45A 1X7QB 2DQEL 2A1WL 4JM2F 1WFOA 2FO4A 1RUQL 1RFDH 1YPZA 1OGTB 3CFCL 3LN4A 4N90E 4P2RA 1AGDB 4EDXA 2VL5B 1QA9B 4TNVK 3ROOA 1YQVH 1WAAA 3CXHK 3QEHA 2CIKB 3C60C 4GS7C 1CICC 3UTOA 2CD0A 4LCUA 3TBTB 2EDEA 3CLFH 2QBWA 5F3BA 2AGJH 5I8CB 3PGCB 3WIIL 3FRUB 3N1GC 1BEYL 3QAZC 1W72H 5IFAL 4P5MA 5IG7A 2DLFL 4FQ1L 5GGVH 3NFNB 4YZFE 3EO1A 4MQ7A 3ES6B 2ED8A 4TSAL 1MCWM 3TBYA 1WT5C 4PJFA 5IF0A 3NIFE 3KAAA 2UZXB 1UM5L 2B39A 1EEZB 4ELME 4QCIA 3GJFB 4D9LL 5CIPA 5D7LE 4NOFA 4J3XA 1NJ9A 4WU7B 2DQCH 4FFWD 3L5XL 1KJ2A 1QRNB 1C08A 2OJEA 5KS9E 1F5WA 1JUFA 5FYKU 3ULVH 4MZ2A 3ZKXB 4Y19B 5B22A 3C08H 5JHDA 4L9LB 4ELMF 2VXUH 5DDHB 2FD6H 3RPIB 1GGTA 4HG4J 3UTZB 1Q9KA 4OTXH 3TA3A 4HJ0D 3U4AA 4KJPC 4OLUH 4QHKJ 5IBTH 4X6CA 3FHQA 4ZPVA 2UUDH 4KRPB 5I9QC 3DX9B 1FIGL 4JO1L 4HMDA 3ARDB 4H25B 5FGBC 4FNLH 2V2WA 2Z8RA 3PDGA 3FB6A 3MUGB 2AV1B 3IDNA 3AS3A 2GKIA 1JJUA 1KGCD 2A0LD 3CK0L 3OGCA 1NCCH 1CLZL 2VLKD 1NGYB 2E6QA 5B21A 2OK0H 4U1IB 1FL5A 4WCYL 1QBAA 1KUMA 1PQZA 3GSNA 4NKOB 3QUXD 5C0IB 3HLAA 4J1UB 3U0PB 1SYSA 3MRRA 2FGZA 3HC0A 3X12B 1NAMB 4H26B 1MWAL 5HTSA 2X1XR 2AEWA 3KS0H 5TDPB 5DMKB 5EH1A 5IB3A 3UZEA 2IG2H 3PDDA 3V4PL 2A6JB 5FO7B 3GUTB 2B1HH 3L3KA 4KJQC 4NC1E 4CRPA 1KB5H 1UWEL 4XVJL 4WFGE 1MAMH 1MFAH 2ZOLA 4AK1A 5CD3B 4S0TD 5GRJL 5DD1H 1KN2H 1A5FH 3DO7A 2Z92B 3OPZH 4GG6A 1PEWA 4BZ1L 3KR3L 4FMKA 2VDLH 4WHCA 4OZ4A 4Y16A 4B5EA 4J7RA 4LLDA 3IDJA 3U6RB 4PLNC 4PGDA 4U1LB 4OLYL 2OJZH 1AR1D 3BP6A 4PRBA 3I6LD 3TVMA 5IP4A 4GRMB 3WBDA 1VFMA 4L8CA 1MI5E 1MRDL 2DLHA 4DK6A 1INQA 4NQEE 1H3VA 3UTTE 4HC1A 3BUYB 4HWEL 1SBSL 4HZLB 5CJ5A 2XKNB 3WO3B 5TE4H 1MJ8L 5F9OL 4GKSA 4LSVL 1HEZA 3SE4C 4UV4L 5D4QA 3L7EB 2OTUB 4DN4L 1GRWA 2X4TA 4GAYA 4Q9QL 3OJVC 3SCMB 1A7NH 1RURH 2X7LB 3S37L 2A77L 2HKFH 2ZUYA 1K8DA 3RRQA 3LKOA 2R8SH 5FECB 4X5WA 3U0TB 1F45A 4J3SA 4XNXL 2YA0A 4MCZA 5F72S 4E41E 2WWKT 1NBVL 4DJMA 3QISA 3ULVC 4PRNB 2VABA 2P7TA 2W65B 3EKCA 6FABL 1U95B 1Z9SA 4U6YB 4ZAKC 5ITBL 3OHXB 3OB8A 1T7ZA 2ZG3A 3QP3A 3P77B 2A83B 4WUKL 3O9WC 5A1AA 3QUZC 3OXSB 1OWWA 1UEMA 1J9CT 2H32A 3CNKA 4ZO8A 1J12A 1OAZL 4LDEB 1NL0H 5HHVH 3DXAB 3QIWD 4IOSD 1ZTXH 3ZKMD 5E9DE 4PJ5B 3M07A 4QXUH 3L3JA 1LE5A 1OAKH 4N0UE 3EHBD 2YPKA 3GSWB 3X3GL 5E08H 3N9GH 3OR6A 1FP5A 2RBLA 3HI1B 3DV4B 4P2CG 5EIIA 1MJUL 3EDDA 3VFSB 1HIMH 3GI8L 1YEJL 2LTQC 2J4WL 3EYFB 4RQQA 4KDWA 4K7FA 3SKNB 3BPOB 3PWLA 5J12B 3THML 3DUUA 3DMMC 4LHUD 4HHAA 3WFEH 4E9LA 2QSCL 2EDRA 3MOAH 4WHYH 1JHTB 4UT7L 5ANMB 1PSKH 2Y5EA 1NFIA 2X2YA 5L6YL 3ULUD 4U3HA 2LABA 1EMTH 5EPMB 4XCFL 4OZFA 4UZGA 1PZ5B 4F37F 4Y89A 5HDOA 3I3DA 1CDGA 5J0BA 3ZKQD 1IVLA 4NJAL 1MCQA 3WXVH 3BZFA 2OBGA 1XF5B 3FT4A 4XT1C 2JIXD 1QACA 5CEYB 4OIIH 4HS8L 3ARFC 3X14A 3WKML 5D93B 4HS3A 1XR8A 2NXZC 1PVHA 3D85A 5DJ2B 3GSUA 4HW6A 4NKQB 4DUXA 2NY5H 4M5ZL 3C5JB 3NMEA 1MEXH 1NUGA 3QEGL 1MCOL 4UTAH 3MFFA 3WS6C 3BWAB 1NMAL 1J18A 2PR4H 3K2MC 3VXOB 4P3CH 4MXVF 1A1OB 1FVCA 1XF1A 2ZSWA 3HE7B 2FIKB 2GUOB 3JXAA 1ZT7B 3AREA 5TE7L 3NGBB 3RVTD 5DJYA 1I8MA 3D25B 2R2HB 3OWEA 5E00B 3BDXA 4HXBH 4KPHH 2BXYA 5C9KA 2K1MA 5JO5A 2NXYB 3WFCL 1FNHA 1G7QB 4DVBA 5HXMA 1T83A 5DWUH 4HD9A 4E5XB 2FSEA 2WAHA 1REIA 5CSBA 4I13B 4NZTL 1JPSH 1WK0A 4XTRC 1A9EB 2MPAL 3VFGL 2VAJA 3F7PC 1U2HA 1C5BL 3GSQA 4J23A 3MRPA 3P30H 4P59L 1QSED 3QEUA 1YEFH 4K23H 4RDQF 3OJDB 3VWJB 1A6AA 3GGWB 2F54A 5IROC 3BRFA 3C5ZA 1D9KA 5F1NB 1NMBL 2Q86B 3TNMB 1XR9B 3U4BL 2O26U 3IF1B 5EDXA 3BESR 2PW1B 4IEFB 1KENH 5TE6L 2X4SA 5L7XH 3U9UB 5FAAA 4X9HA 2BNUB 4WWKC 4X4YA 1S8DB 4LSUH 4K3JL 3RJQB 4PJDA 1L0YA 3AGVA 5D1XC 4TQEL 4BQ8A 3KPMB 1X44A 3D0VA 4HCRH 5B39G 4Z7UA 1P84K 1JBJA 1CL7H 3KHOA 5DMYA 3HPLA 3BVNA 3PQYA 1MHPL 2ORBL 4GUPA 1QSFA 1BLNB 1TVBB 1I3VA 1UM4L 3AAZB 2OLDA 3AROA 4XPFH 4F7PB 5DEGB 4R0LC 2NYYD 3JV6A 3F6LA 4MQTB 1K5NB 5KVFH 3DUSB 1A6ZB 5L2JB 3GEWB 4JQVA 5ISZD 1R0AL 3FZUC 5D7SH 3KPQB 4M6NL 1NGXA 5JW3H 2DRUA 5GGUA 3EAKA 3W9EA 5DSCA 4GAJH 3NACL 4IDLA 5E5MA 3FO1A 4XWGH 5EU6B 4CADA 1W2KT 5I71B 1CK0H 4BFIB 3QNXA 5LGJB 3MJ7B 4FFYL 1CDHA 5FYLE 1P84J 4KI1A 3MBEC 4IRSB 4M61A 1KCVL 3QDMB 3IVKB 2ZPKH 3Q5TA 3L3HB 1MUJA 4MNGB 3BKCH 3NCJL 4PREB 4TUOA 1J10A 3TPUA 1I9RH 2ZCHH 1U8NB 5LGKA 3V6ZB 2Z31C 2NY5C 2KQNA 1ZA6A 4HX1A 3FN0H 1CBVH 1DEDA 3QSKB 5EC2B 4P2OC 4P5TC 5F7DA 4WWID 4F80A 4ZFGL 3IS1X 4HF5H 1YECL 4ZNEA 1S7QA 5EO0A 1EK3A 4XCYB 3RIAK 1HOCA 3BJLA 1H5BC 1R6VA 4OZGB 5D9SB 1M4KA 3LSOA 2OTWB 5F89B 5I1IH 5KVMC 1I3RA 4ZYKA 5FYJE 3QXUA 3GO1L 4D3CH 5EU7C 4UNVA 2CGRH 2VXTH 2HT2D 3MV9B 3NOIA 1OW0A 3UTQB 5ACLA 1HKFA 2XKSA 4L3CA 2IFGA 2HLAB 2BNQB 4QO1A 4MJ4A 3BZEB 4FFVD 3SDDA 4OV6F 1AY1H 4ZUTA 3V4UL 1FGVL 5CKAA 3QR2A 1IGCL 1VEOA 1NDGA 2JCCE 2WBWB 3U7WH 4XCCH 5D7IA 4XBGB 3FB7B 1I7UA 4DGIL 4DVRL 1TVDA 2X89D 2VUOA 3NZHL 2IMMA 2I60H 3MXWH 1JYWA 5A3ID 1OTSC 3OR7A 4LCCA 3PP3H 1IGYB 4FQPA 5DO2C 3H9SD 5GGTL 4JN1H 1KULA 1KB5A 3AU1A 4HDIA 1KLUA 5CCKH 4PB0L 3TIDA 4Q74A 3HHRB 4L4TE 4ONOA 4Z7VE 3EO9L 5FK9B 1XGTB 4G7VL 3DBXB 4GMTL 4MA1C 4QXGH 4ONHB 4Z6AT 2H3NA 4HKJB 1T6WA 1I9JH 1XCTB 3ROLB 2GSIA 5AUMA 2C5DC 2YZ8A 5ID0A 4JFFE 2BSRB 4LGRB 4WEBH 4OIBA 3CD4A 1EBAA 2YUVA 4DOHB 5DD5H 1ZLSH 3TYFA 2XYCA 1M6OA 3WD5H 5L88H 3P3YA 5IVXB 2HAZA 2ZCKL 4PJAE 1JCKA 2EDJA 5J1SC 4CVWA 5I16B 2AEPL 2VLRD 3L95B 3F12A 1RK0B 1XEDA 3ZTJG 3R1GL 3NH7L 4G8GB 1DCLA 1VFAB 4JFEE 3ZTJH 3LQAH 1MFEH 3MA7B 1KPVB 1IM9B 2A2QT 2MHAB 4BKLB 2DJSA 3KHQA 1MNUL 3EYVA 4XX1E 3OAYK 3CH8A 1YMME 2H6PA 1BQLH 1FLTX 2R39A 3O4LE 1DR9A 4PJCE 4FFWC 15C8H 3IJYB 5F93C 3O45B 3QDGB 2UY7A 2ICWI 5F7LB 3ZYIA 3OL2A 4YR6B 2ZP0T 3LIZL 3QWOB 1E4WL 2BVUA 3MA9L 2BNRA 4OFIA 4KRNA 5B38G