4HH8A

Crystal structure of bovine butyrophilin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
211
structure length
211
Chain Sequence
APFDVIGPPEPILAVVGEDAELPCRLSPNVSAKGMELRWFREKVSPAVFLSREGQEQEGEEMAEYRGRVSLVEDHIAEGSVAVRIQEVKASDDGEYRCFFRQDENYEEAIVHLKVAALGSDPHISMKVQESGEIQLECTSVGWYPEPQVQWQTHRGEEFPSMSESRNPDEEGLFTVRASVIIRDSSMKNVSCAIRNLLLGQEKEVEVSIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 1 member A1
publication title The extracellular region of bovine butyrophilin exhibits high structural similarity to human myelin oligodendrocyte glycoprotein
rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 40
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh8A02
3AC0A 1JE6A 4P5KB 1PX4A 4AT6B 2DBLL 1GAFH 5T1LB 1LO5B 2BY2A 4IRSB 3MBXL 3MJ8A 1D5IL 4G7YL 4AM0B 3IJSA 4XVUD 3JWNC 1UWEH 1HHGB 5DS8B 1EMTL 1JPGA 2GT9A 3IU3A 2LQRA 1BBJB 1F11A 1CVSC 3IB4A 3RGVB 5CFHA 5B4MC 2Y06L 5EC2A 2GK0A 4YBLB 5CGYD 1EHLH 1KGCD 4ODXB 2UY6A 5EU6E 5EIQA 2J3SA 1TTGA 4KUZH 2OXGA 1U58A 1HH9B 1EO5A 1KIPB 2DQHH 2Q3AA 4KROD 4OCXH 2VXSL 2B5IB 3E6HB 4L8SB 3L1OL 5F6HJ 2AXJA 1VA9A 4YLQT 4IRZH 3X13B 5FKPA 5DVLA 5T1MB 1I8IA 3B9EA 1UM4H 4F57H 1GSMA 2C4FT 4X9FA 4TUKL 1HE7A 2HG5A 2FBJL 1KB5H 1CXEA 3K4DA 1C08A 2G5BA 1PLGL 4OZ4B 2O93L 1CD1A 1A6PA 3MPCA 5AYUH 2CLZA 3G6DL 3QQ3A 2ITCA 2Z31D 4OQTL 1XF3A 2C7UB 3QUKB 4MA1B 2BERA 4Y8AA 5IVZA 1I3GL 5KG9A 1A14H 1YNTA 3OR6B 4WO4B 2A6IA 1PG7W 3O6LH 4XCYA 5EA0L 5GGRY 5ILTH 1VFMA 1QRND 1YEJH 4Z0XA 1LO4H 3P4OA 2F5BL 4JM4L 4PTTB 4HJ0D 4LARL 3T0XA 5CEZH 5INDB 1FRGL 2G75A 3SGJC 3THML 4AYFA 2VLMD 4N0RA 1FAIL 1J0YA 5JR1L 2D31A 2A9NL 3MREA 2YC1A 4AK1A 4IHOB 4JJHA 2V2WA 4NQDA 1HH6A 2WK2A 3VI3F 4D3CL 5AG8A 2IQAA 1H5BA 3OKNB 3V5KB 2KZ1B 4HXAH 4LCYA 4U05A 3K74B 1ZHBB 1A4JA 1YEDB 5F7LB 5LGJA 5ITFA 1FYTE 1R5WA 4FG6D 1A6TA 5DD6A 3RX5A 3LV3A 5ESAB 2BSTB 3P11H 3T4AB 1KEMH 2D03L 3KS0H 1JMXA 1YY8B 1YNKL 3TIDB 4PG9B 3MA7A 2IAMC 5MP6H 9CGTA 2XQBL 3HAEH 1ACYL 4WW2A 3H2WA 1C1EL 5E94A 5GZND 4GKZB 1N59A 3LD8C 3TA3C 4QGTA 4GW1A 2VZOA 5DQDL 3A6OA 4GMTL 4NJ9H 3UBXI 1D5IH 1IC5H 4G7YH 5I17A 1DE4A 4HH8A 2BX5A 3JSSA 3QDGD 4Z7OE 3BN9C 3G6JF 2AS5M 1IM3B 3DURB 4AIZA 1EVUA 5DHVA 1P7QD 3P9WB 3RU8L 3GO1H 1IGIL 2FATL 2Z8RA 4GW5B 5DJAA 3RWGA 2PKDA 1PGRB 3MRNB 2XRAH 4NDMA 4PFEA 1KXQE 2ZCHH 3VXRA 2HLAB 3MCLL 1AQDA 3TBYB 3T2PA 1KTLA 1FG9C 1MFAL 3GMMB 2FLRT 4IOIB 2Y23A 2D4DA 1ZT7A 2VDNH 3BFOA 3EW3B 3KXFB 5T3XL 4AEEA 3CFBB 3L3OA 4XNQB 2DRUA 4JGMA 3L1OH 4MD0B 4PREA 5CCKL 4PGCB 3MNZB 1S7WB 3GJFK 4X6CF 4E0RA 1FC2D 3KPRD 5J0BA 1FV1B 2IJ0C 4IJ3C 2NXYB 4TUKH 2HFTA 3S98A 1OLLA 1RUKH 1DQML 2FBJH 2X4OA 2B1HL 2XYCA 5C07D 4NOFA 5FO9B 4UT7L 2EDBA 1T2QL 3MRLB 1BFVL 4IMKA 2EZ0D 4PJAF 3G6DH 1RU9L 4N0UA 4HBCL 3QULA 3BW9A 2KDGA 1AGDB 4F9LC 2JELL 3WFEL 4OQTH 3WD5H 2BY0A 4PP2A 3B8YA 2O5YL 2HTLD 2VAJA 1IJ9A 4Y1AA 3VFSB 5LKNA 1UB5B 5J6GA 1I3GH 3QAZB 2XV6B 4DFHA 5E5MB 3VXNA 4GUPA 5IEKB 2F5BH 5IOPB 5CJBA 1KTKE 4NO5B 1M1SA 3MUHL 4HIXL 4F15B 1M05A 1FAIH 1SYSA 2I24N 5JR1H 4R7NB 3QHZL 4R0LA 5GS0D 2A9NH 1QUNA 3L3JB 2P7TB 5FUZH 5DLML 3TH4T 1DFBL 2IBZY 1UEMA 4G8IA 3MNVA 4PJ5B 1NBYA 4YPGB 3DVGA 4ZTPL 3LKPA 4KZEH 4PJDF 5FOJA 4KHXL 1TVBB 4MXVE 1HN1A 1NC2D 4W4OC 3NIDE 2FX7L 4WU7A 3FONA 1X5AA 1MCOH 1GHFL 3HS0A 3HC4H 1RVFL 4MQTB 4ZS7H 3ULUL 1ERNA 1U8OA 5D5ME 15C8H 3L5IA 4RWHA 3FQWA 3OKMA 5GQBA 1U92A 3VXTA 2D03H 3QNYB 5DJCA 1BVKA 5IMLB 3S37X 5F6IB 4OZGA 3OZ9L 2PYEA 5D96C 4H8WC 3U36A 4MJIE 5MENA 3ECBB 3C60A 3O4OB 3KLAB 4XRCB 2FECL 4U1MB 3VRLE 1EIBA 2XQBH 2D0FA 1J9CT 1J05B 3TCLA 1ACYH 2WM0A 3C2SA 2W9LA 2KQNA 4BSVA 1TZIA 3LEXB 4P2QA 4ZG1A 4GMTH 1U8KA 2X2YA 1X5KA 1U0QA 4FHBD 1AGCA 3TZVA 3PWPD 1J5OL 1FO0A 1XZ0A 5CD5C 2FGZA 4G42A 2ENYA 1AFVL 4KVNH 3O4LB 5DEGB 4X4YA 2G2RA 4Z7UF 3M17A 3RP1A 1IGIH 1A1MA 1HXYA 3OHXA 2QSVA 5D71L 3U46A 4KY1H 4YDIL 3BQUC 5FUCE 3MCLH 3PWVA 2EE6A 5CSZA 1X5FA 5MEOA 5ACZA 4OUUA 4DZBA 5F9OL 4JRYA 4NFBA 4NO3A 2CQVA 4OCYH 1RIVH 4DKFL 3MZTA 5T3XH 4U1LA 4B7IA 2R15A 2W92A 4L4VE 5CCKH 5ETUA 4UAOB 2V2TA 5IVNA 5JW4N 1N8ZA 1KLFA 4H1LG 5KSAC 3MUZ1 4NQEA 4TVPD 3JWOH 2R2HA 4R7DB 1UH2A 1I8MA 4MDIB 4U6VL 4W81A 4X4ME 3EYUH 5C92A 1T2QH 3MV7A 4JKPL 1J8HB 1EUTA 3RDTD 5E2TL 3TC9A 1RU9H 2X42A 1ORSA 2OR9L 4HBCH 2BOBB 4LSSL 5DVMA 5EOQH 4ZUTA 2JELH 4F7TA 3WFEH 4ZUWA 3ULVL 5EC1B 1GRWA 1GGCL 3IXTA 3FHQA 5I1IH 3KLDA 3KAAA 2EYSB 1A1NA 4NC1E 4HLZH 2P42B 3BZFA 3WHE1 4XNMB 3KPTA 4NFCA 4YAQA 4ZXBD 4X7EC 3UCRA 4HIXH 3C09C 5EOCL 4NT6A 2VLLA 4GRWF 4OI7A 2APFA 3P9MB 2OJZH 3IDYC 4UT9H 3W0WD 2XY2A 3QHZH 3U7YL 1GH7A 2M1KA 4NN7B 1CFVH 1MOEA 5DLMH 5J7CC 3IDJA 1UWXH 5BXFB 1DFBH 3QFJB 5GRZA 4DKAA 1DEDA 4AG4L 1BLNB 5GRVL 4KHXH 4WVRA 4APQD 4JY5H 2FX7H 2OBGA 1QBLL 3QJHA 5I8CA 1GHFH 3PL6D 5E1HB 1RVFH 4E9LA 4MQXD 1T04B 2I9TB 1TETH 1OSZA 4PRNB 1AO7E 2LFGA 3ZKSD 3KPNB 5MERA 1DN2A 1AD0B 5JXAL 1FSKB 1CK0H 4QHLA 1M7DA 4ZS6C 4BZ1L 3DTXA 4K23L 3BZ4B 4BQ8A 2QADC 4Y4FC 5LGHL 1I7TB 2PXYD 2H8PB 3QG7H 2AK4B 2VR9A 3CPLA 2XXCB 1LO0L 2WINA 1LO3H 2UVFA 2ATPB 3PQYD 4N0FA 1J5OH 3BGMA 5F7KC 2H2SD 3HC0B 4MGXA 3K8LA 3QQNA 2FECI 3NFPA 2GJJA 4MAUH 2D0GA 1KCVH 3VH8G 25C8L 5F7DA 5K9JL 4XP4L 3SGEH 1K8IB 2I60L 4LLMB 1FO0L 3OPZL 4X6DE 1WEJL 1BFSA 4U1SB 5IKCA 5CMAA 5F9OH 5EIIA 1FYTA 4DKFH 1BVLA 4R3SB 3RTQD 5I1AA 2YD3A 1HHKA 4BSWA 1S8DB 3L3KA 3Q5OA 3LVEA 4F9PA 2R56H 3CIQA 3KYOB 3J8F7 3L3GB 3H3BC 3QIBA 4U6VH 5AAWA 3BPLC 1IGTB 5CEYA 4GBXC 1ZHKB 5MEPA 1PKQB 4KK5D 1GYAA 4M4PA 5HHMD 2OR9H 1VACA 1JTOA 4LSSH 1MCIA 4S1DC 5E7FA 3ULVH 1GGCH 1X5JA 3FRUB 3V4UL 2R1YA 3DBXA 3DGGB 3MLTA 1MCKA 3FFCB 4YIQB 2X4PB 3UJIH 4OI8A 5DD1H 3VFWB 3T1FA 5KTEL 4PJFB 2VLKB 3HG1E 4JEGB 4WHTB 5EOCH 2IADA 3MBEB 3OKKA 1B9ZA 5L6YL 1BQLL 2A6KB 4HJJL 1I3UA 5C2UB 4KKLD 4Y4KA 3U7YH 1MVUA 1ZVHA 4C57C 4JLRB 2FX9L 1JP5A 3FMGL 2X7LA 4RGND 4JJ5A 5DZNA 4GXUM 5BMFL 1WTGT 3QUYA 1KJVB 4LGRB 1HYSC 4AG4H 4RFOL 2JCCA 4YBQD 4G43A 2DLIA 2YWZA 2FCBA 5L2KE 1QBLH 5JPMA 3P9LA 1ZLUH 4MNQD 2IQ9L 4D0DA 1J8KA 3CUPA 3VWJD 5GS2D 5D1QD 5DUPH 5DF0A 1DLHA 2N7BA 3FAWA 3TBVB 3HI6L 1MCEA 4JVUA 2M8XA 1J1PH 1NUGA 2XFXB 2H3NB 2QEJA 3FQNA 4XWOD 4BZ1H 4ODBD 1OGTB 1TMCB 4K23H 3EYVB 1IQWL 4A6YA 2PN5A 3HI1A 1DVFC 5EBMA 5LGHH 4RIRB 5C0JB 3IDXL 4UU9B 2EC8A 5DC9B 3UAJD 1YMMA 4ORZC 1S9KC 2Z4QB 5MI0C 5TE4L 4NKMA 1TTFA 5DC4B 1QLRA 3WNOA 1UXWA 5IVXE 3PDGA 2D9QB 5AZ2L 4LGSB 5F6HI 4XPTH 4P2RE 2E7HA 1KPRB 4F8QA 1CT8A 25C8H 5K9JH 3EJYC 4XP4H 4L9DA 4CVXB 2O61A 1OGAB 4RNRA 3CSYB 2I60H 1RK0B 1FO0H 2P48B 3NACL 3OPZH 4LCIH 3VXME 5EZIH 3LS5L 4E41A 3RFZC 3MR9A 2XTJC 1BD2E 2F53B 3ARED 3D39E 3HC3L 1PQZB 4GKNA 1S7TB 2KBGA 1RZ8B 4AQOA 1II4E 4PUBL 4U7SA 4IOFC 1URLA 3IRZA 2EDJA 4D0CA 1FL6A 4YBHA 4FFZL 2H2PC 4NO0B 2RB8A 4BKLA 5GGQL 3FB8A 3GSXA 4TNWK 4F7MA 2OK0L 1AXIB 3JWOC 1CDBA 5EZLB 4WJ5A 3WNPA 2C1OA 5IQ9A 2AV7B 2VLJE 3V5DB 1WBXB 5JZ7D 1RJYB 1F4AA 2FEDD 5EUOB 1T89C 1RUPL 4QRTA 2VQ1B 3D25A 5IB4A 5KTEH 2NY7L 5L6YH 4YHYC 1BQLH 2VDQL 4HJJH 5FA3A 3ZDXF 1B3JA 5IJVB 3L3DB 4OF0A 1CFBA 5K93A 2FX9H 3FMGH 3BJ91 5E6IA 3QWQB 1B6UA 3T3PE 2AJSL 4K3JL 2VQUA 1R5VA 5GGRA 3PGCB 4RFOH 4L4VA 3V7AE 5FYKL 4AZ8A 5L8JB 3WL9A 1NDMB 3V6ZB 4RCAA 2CDGA 1VFBB 3GIZL 4D0BA 2NW2A 4NQCB 1QEWA 3ESVF 3I3BA 4BH7A 4X4MA 2AXHA 1P2CA 4M6OH 2BVOB 3TO2A 3GJFA 3P73B 5JPNA 2Z92B 3V2AR 1BEYH 2R39A 4UTAL 5DHYA 2JIXB 1U8QA 2X70B 3HE6B 1SEBA 3HI6H 1I8KA 2BCKA 3BEWA 5FKAA 1MUJB 5FCUL 1KXTB 4LPXA 4OFVA 4WCYL 4X0KB 3C08L 1LE5A 5DMGC 1JGUH 1IQWH 2X4TB 1H5BC 4BH8A 1AGEA 2H32A 3IDXH 4JZJC 1VFAB 2CRIA 5IWLA 5EBLB 1EUUA 3BPNC 1I7UB 4JN1L 4RRPA 4ZOEA 3FT3A 5TE4H 1GPOH 4A6YL 1AD9A 2KH2B 1T66D 3LN4B 1T3FB 5F21B 5AZ2H 1F58L 2EDEA 3UTSE 5ABDE 4V1DB 1OD9A 1LO2L 5CAYB 5SWQB 3V4VL 5JTWA 3FJTA 4J8RA 3NACH 2BXZA 2X89D 3LS5H 3ZYIA 3ISWA 1YUHB 4CVZB 3NFSH 1MH5A 1T2XA 2UWEB 3T65B 2VXTL 1TNNA 3HZKA 4Z7WF 3D69A 5HGAA 2VDRL 3OKOB 5JHDD 2VAAA 1LEGA 2CPCA 3LN5A 2A74B 3NPSC 4EI5B 2R69L 1AO7A 1T0MA 3Q1SL 4PUBH 1GZPB 1FORH 3O3UN 1OP3H 3TV3L 1TQCC 1NFDF 3UEZA 4XPGL 1A7QL 3C8KA 2PYFB 3GIVB 3I2CL 5D8JL 1MIEH 5GGQH 4DGIL 5DJDB 2NY2C 4CL7A 2VITA 1EEZA 2VL5A 1DBJH 1ZA6A 2OK0H 3FOMA 1JIBA 3D3VD 4DJMA 1XF2A 4HFUL 1JPTL 3UTTE 1F45A 5DMKA 2ZNWA 5FHBL 4JFYB 7CGTA 1HHJB 3GMPA 4OF6A 3RWIB 3G04B 4OM0L 1I85A 2NY7H 4MHHI 2WIMA 4WNQB 5DWUL 2VDQH 4X6DA 5JDJA 4PYGA 2DM7A 1IARB 1IKFH 3FB7A 4M1GL 1YQVL 1FZMA 2OI9C 4K3JH 5EU3A 5JO5B 2NLJB 5FYKH 2WBJD 4JHZA 3GIZH 4LHUA 4HS8L 1NAMA 2M26A 4ZSOE 5GIRA 5HVHB 2NNAB 4UBDD 5E9DE 1R3KA 2OXHA 4C83B 4UTAH 2VNCA 4N8PA 3UDWC 5D7KD 1BREA 4TUJB 3VXSE 5FCUH 3UYRL 3EDEA 4G9DB 3ES6A 4PR5A 2CUIA 4AIXA 2BNRA 5KVMC 1CFQA 2BRRL 2RAMA 1FFOB 5GSRA 1U58B 4KJWD 4P4KD 5A40E 3WO4B 4JN1H 1YEKL 1LP9F 4NCC1 2E5EA 1QSVA 1DUZB 4S1SL 5BJTB 2C3VB 2VR5A 4LSTL 5CJ5A 4D9QD 3ET9F 5C7XL 5FDWB 3T1WA 2DLGA 4X5XB 5CZVH 1J10A 1ZLSL 3MV8D 1LO2H 4DVBA 4HDIA 4LU5L 1KCRL 2P5WA 5D7LA 4OGYL 2Y36H 4N90D 5T1KB 5A2IH 3SDYH 5HYQB 2CLZB 5GGTL 2VXTH 2Q86B 2FX8L 3T4YA 5E6ZA 2HRPL 2YZ1A 1XF3B 3O6FB 3MUGA 3PV6A 1OF2B 1D5XA 1WFTA 1JVKA 5KG9B 1IQDB 1YNTB 3TZVC 3EGSB 4N5EC 5DA0B 1XCQA 1NSNL 2DYPD 2R69H 3LRSA 1CQKA 1NCCH 3IDMB 2RFXA 2A6IB 3Q1SH 4QO1A 4Z0XB 2PO6D 3P4OB 4NPYB 3X3GH 1G7MA 5DJ0A 3QDJD 2F5AL 4XPGH 2G75B 4PJ8B 3BWAA 1QFPA 3I2CH 5C6TL 3FOLA 5EPMB 4Y2OA 2R23A 4DGIH 3DMMC 1KULA 2D31B 1D9KA 3PWJA 1S78D 2CO7B 5HHXL 1WAAE 5IFHL 4NQDB 3IKCA 1Z0NA 5IB5B 3BZEB 1G9MH 3DUUA 3FTGB 4HFUH 5IVXA 1JPTH 3HAEG 1MHCB 4QKXB 5FHBH 5J12B 4P2RA 3OXSB 5FM5M 4LCYB 3X11A 4MDJA 3ZT6A 5K9KA 2XN9D 2MOVA 3NFNA 4YHNB 3EDKA 3WYRA 5LGJB 3QEQE 5DWUH 3VXMA 5JUEH 1P6FA 4JO3L 3LV3B 3T2QA 2OTPA 4BELD 2QHRH 3RWJA 3T2NL 4QGYA 3WHE0 4M1GH 2EXYC 1YQVH 3D39A 4XTRC 1OTSD 2YD7A 4PJCB 1BFOA 5E1AB 1RZFL 3MA7B 2R9HC 4RWYH 4J3TA 4JFQA 1A8JH 2ADIA 1NANI 4OBRA 4NHUA 1BF2A 3TO4B 2H41A 2UYLB 5F44A 4HS8H 3MLXH 5E94B 1CICD 1OAZL 4XHJD 4ZTOH 2YUWA 1PY4A 1T2JA 1XH3B 4GAJL 2ZUYA 2DLHA 3AAZB 4GLRH 1DL7H 1PAMA 1NAML 2AERT 3UYRH 4AIZB 1QSZA 3HB3D 4NC2B 4PRPE 5ID1A 1WIPA 3GJFH 4POZD 5K9QI 3QIUD 4KTDH 4PJGB 1G6RA 3TBTB 1EERB 3DV6A 1MRCH 5EOTB 2VWEC 4AEIL 5I66A 4NDMB 1UVQB 3SGDI 3VXRB 2PR4H 4RAHA 5KS9F 1GGBL 5HHNA 1YEKH 3IXAA 4Q58C 1QSED 1ZT7B 1K3ZA 3D48R 4GLRI 3TN0A 3L3OB 4S1SH 4LSTH 1KJ3L 2H32H 1ZK9A 2OL3A 5J6HB 3BYYA 4PJ9D 5CGYC 1S5HB 4TVPH 5HYJE 3WJJA 5HHQA 4I9WE 1ZLSH 4DN3L 4F7EA 1KLGA 3Q5TA 3V0VB 1KCRH 4YHML 4PJDE 4OB5L 5ACLA 5GGTH 4ZQKB 5B39G 2MQ0A 1N4XH 2HRPH 1I3RA 5FO8A 3ARFD 4PP2B 4W6YB 1P5UA 4L3EB 1IGFL 4QRUB 4XNXL 2BNQB 2J4WL 5CKGA 1NSNH 1MFBH 1ZEAH 2OZ4A 2Y6SD 4EUPA 3SDCD 3GMRB 1UJ3A 2YD6A 4LDLB 2Z31C 5C6TH 1QO3A 3HUJB 4HK3J 2ADJA 3DHMA 2OQJA 2WWKT 3GSUA 1DQQA 1WBYB 3QDMA 4R0LB 1Z9OA 2CUHA 2DTSA 1GVIA 5F9JB 4FQ2L 4GAYA 1JNLL 5E8OA 5HHXH 5IFHH 3A67H 3UTPD 4MS8C 4HJ0C 3MNVB 1MHEA 1FLRH 3LEVL 4JRXA 1MIML 1S9YA 3DVGB 4HS6B 3H9SD 4WFGE 4PB9L 3UTSA 1CFSB 4WU7B 3FONB 1U9KA 2E8YA 5DVOA 2B20A 1K4DB 1U8OB 4GKSA 1E0OB 4YDJA 1KFAL 1X5XA 3I75A 4JO3H 5I1GL 4U1KB 5IHBA 2W59A 2EDTA 1U92B 4L4TD 3TNMA 4XAKD 1G0DA 3NCYS 5SWSB 3GI9L 2DS4A 2PYEB 3OGOE 5D4QA 5EU7C 3QUXA 5MENB 3O6KH 4NYLA 5F96H 4KC3B 1SHMA 4FG6C 4OLYL 4P23B 3S4SG 4HIHB 5ALCL 5HI5D 3RVVD 1KIQA 2BVTA 5GJTH 1GGUA 1KT2B 3LZFL 5H2BB 3GEWB 5DRXA 2IH3B 1OAZH 3QFDB 3WV0A 3IJYA 3CVHB 4U6TA 5C1MB 1XF4A 4GAJH 2P8MA 3VXUD 1EAPA 4URTB 3G5XB 4M00A 1NAMH 3WKNA 4P9MH 4PRBA 5LGKA 1WVZA 2IF7A 4HUKB 3MRQB 4P46D 4WWKA 5GZNC 1FNGA 4RFEA 3U6RB 3FB5A 3OHXB 4LLQB 2J8UB 3UTTA 1IL1A 1YY9D 2C3XA 3IRPX 5DVKA 3E6FA 3DX9B 4HEPG 4XC3L 3O3AA 3CXHJ 2B39A 4OUUB 4DZBB 4H25A 4UQ3A 3R06B 4PJHF 1G6RL 5F7MC 1C16B 3MJ9A 4GRWE 3D2UA 1T7YA 5ETUB 3QPQC 2V2TB 5IMKA 3K2UH 4HLZG 2D7PA 3O3EB 4TRPL 4PJXF 3DXAA 5I19H 2FR4B 4TULL 5FYLL 2OL3L 2FGWL 4UILH 4X80L 1YN6A 4WU5A 4ZSOA 4F7TB 4ZUWB 5LBSH 1XIWD 5E9DA 1KACB 5E4EB 2J4WH 4H1LB 1RK1B 4NQTA 3VXSA 1FL5A 3IFOB 3PDDA 1J0IA 3JTSB 1PX3A 1H3PL 4WWID 3H7BA 2EYRA 4HWEH 2ORBL 3G9VA 1T83A 4M6NL 5EU6B 2HTLC 3HMXA 2OZ4L 4WI8A 3BDYH 3EJZC 3U0PA 2R8SL 4CUCA 1FZKB 3O11A 1FH5L 5B22A 1FNEB 4HEME 4HH9B 3LEVH 1IAMA 5FYJE 3F7VB 1MIMH 3KPOB 4G8FB 4DEPB 1EDQA 1NBVH 4Q0XH 4NZJA 4PB9H 2DLTA 1JI2A 5I8CB 1HNFA 1G7PA 2B4CL 2VIRA 2EYTA 1O0VA 5EB9A 4F37K 5I1GH 3MMEB 4ODWA 3SCMD 4LAJH 5FFLA 1DJSA 1G9MC 1XMWA 4HUUA 5MERB 1S9WB 1XR8A 1F6LL 3TGXA 2VLME 1NCUA 3T0EE 2BVUA 4HT1H 3HKFA 4NKDA 4QHLB 2DQTL 4LIQE 4RGOH 4Y4HA 3DTXB 43CAA 4J3SA 5F1IB 1WT5C 1T1WA 3VFUA 5LG1A 5GRJL 2DWDB 1PYWA 1VKXA 4XMPH 1PJ9A 4WFHD 1FG2A 4M8QA 4XXCA 1ZLVK 4HCRA 3OV6A 3BSZL 1G7LA 5E6IC 3SDDA 1WAAA 3PHOB 5JW4M 5JDSA 1T7VA 5C09D 4G3YL 4EVNA 3F58L 1JNJA 2NYYC 4LRNL 1RZ7H 3ZDZE 3RL1A 1TFHA 4XC3H 4M03A 3PWUA 4XT1C 1I9IL 1MCPH 4RMTA 5IKCB 4XWGL 5IEHA 3IFNL 4XB7A 1FYTB 1G6RH 2DN7A 5FCSH 5I1AB 4R4BA 1HHKB 1F4XL 2GJ6D 3VG9C 2EDWA 1P4BH 3WNLA 3FFDA 3GNMH 1JRHH 4ETYA 3VH8B 3FKUS 3WIFA 4NWUH 4N8VG 4OCMC 4DAGL 3MJ9L 4TRPH 3U82B 3OBAA 3RZCD 1ND0A 3IAQA 1S7XA 4P5TD 5GRUH 1M7IB 4TULH 2P46B 5FYLH 2OL3H 5EN2A 3QDGE 2FGWH 5K33A 4MLIA 4X80H 1QLEH 5ISZA 1VACB 2V17L 3B9KB 1MLBA 2XICA 1HHIA 4G5ZL 2CK2A 5IWLC 3ULSA 4HGKC 4NNYB 3HZMA 3W9DB 4U1NA 4KJYB 2BVPB 5B38A 2AW2A 3QI9B 2N56A 3O45A 3RDTC 4PJIE 2VQTA 4XAWH 2EH7L 3NA4A 1FL3B 2GW5A 4M6NH 4JPWL 2OZ4H 4EUPH 1TITA 4YGVA 5TF0A 1CF8H 5DK0B 3KPRE 1E6OH 4JKKA 1FH5H 1MVUB 4JO2L 1K9TA 3BYTA 1VPOH 2X7LB 3LKOA 4XNUL 1P9MA 5L8LB 5DD3L 3QUYB 3WS6A 3HMXL 4ZXBC 1DQTA 1HWGB 1NDGA 1N3NB 2A77L 4OAWA 5HYJA 1A6ZA 4Y16D 4QT5A 4BYHA 3OKDA 5F97E 3EOTL 3QWOB 4DW2H 1BQHA 5EO1B 4APQC 1MNUL 4S1QH 4ISVB 2CGRL 4ODSL 1KPUA 3VG0L 3PL6C 2CMRL 1NL0L 2AQ2A 4MQXC 1QQDB 5LCVH 5SWZB 4PGEB 2LVCA 1LILA 4A6YB 5D7JD 5EBMB 4NZUH 5D1ZD 1QA9A 3ESUF 4LVOC 3BE1L 3QEUA 4G80B 4OZIE 1KLUA 3N0PB 2VLRE 4QRPD 4DK6A 2WMPA 1I7ZA 3ROOA 2UZIH 2P5ED 3MRPB 2HFEA 4C54A 1IC4L 5JORA 4CVWA 4JPIA 3TLRA 3U0TB 1KCSH 3MRJA 3W39A 2PXYC 3KPQB 4G8EA 2XKSA 4M43L 4EXPX 4LRNH 3GBNL 3TYFB 3ARSA 4NBYB 4UDTA 2AK1L 3WJLC 3J7HA 4HCRL 1E27B 1KCUH 1NJ9B 2OSLA 4RFNC 4G8GD 3HE7D 5D5MB 4C56A 2QR0A 3RWDA 1YC7A 2COQA 3OSKA 5FA4B 1I7RA 3LQMA 4GRLD 4GG8B 3ZDXE 3VFPA 1MI5A 3GMOA 1TPXC 5E8NA 4MJIB 4RX4A 5F9AC 1JNNH 4KRPC 4CN6A 4DKEL 1ES0A 3PWPE 3VGBA 1T6WA 3I6LE 3MV11 1CZ8L 1HHHB 2V17H 5FECA 3G08A 1BX2B 3V6OC 1XGYH 4QHMB 1EBAA 4X7FC 5E2JA 4U6XA 4F7MB 2YD8A 4GXVL 4WJ5B 5DZOA 5F9WC 1F3DJ 2ESVB 4KJQC 4FTVE 1VERA 2EXWC 3N06B 2HJFB 5E6YA 4ZFFA 1RHHB 1OP5H 3KR3L 4KK5C 4NQUA 2MTPA 4MJ5A 2MQ3A 1U36A 3SY0A 5J4MA 1G9NC 2IPKB 3MRIA 5C0AB 4JPWH 1BZ7A 3HNVL 4R97C 5DJ2B 1X5YA 3HPLA 4YQXH 1AXSA 2JJWA 4KPHL 5DD3H 1QFWL 3CFCL 3RGHA 1IGYB 3HMXH 3MOQA 4M1DL 4FNLL 4XPFL 3WL9B 4OF8A 4WI2A 3MLRL 2GTWA 1BM3L 2D9CA 2AEQL 4PJ7B 2D2OA 4ODUB 2NW2B 3MRDA 3D0LB 3BVNA 5TQ2L 2AKRA 5C0EA 1KB9K 4NRZB 1G7HB 4UUJB 1MNUH 4Z7WE 5I8EA 3RRQA 1I8KB 5FKAB 4MAYD 1D9KC 1HSAA 2CGRH 1T20A 4KK8D 2PW1B 1ZSDB 3IDGB 1T80A 3ELAT 5T5NF 2CMRH 3LPFA 4HHAA 4RMVA 1LE5B 1NCBL 3BXNA 1XFPA 4IJ3B 4UINH 1K5NB 1FDLL 1NEZA 4I5BB 3VWJC 4XI5D 1YNLL 5D1QC 4YR6A 3BE1H 4XVSL 1YMHA 2GTZA 1QBML 4UNTA 3TVMA 3ZE1E 1NFDE 4HIIA 4MA8L 4YXKL 3VXOA 5CIPB 4MCZB 2A6DB 1QHOA 3QXDA 4MD5B 1AD9B 3LS4L 4J12A 4XWOC 4HGWA 1TNMA 3CC5B 3C5ZB 4MJ6A 1LWRA 1ZHNA 2Q6WA 4OD2B 3K4AA 5BRZA 4L8DA 3PXJA 1A1OB 2EIEA 2GITB 3GBNH 3ARDA 4XZUA 2H6PA 4FQHB 1RUAL 2AK1H 2X4RB 4IOSD 1MH5B 4HCRH 4Y5XA 5E8EB 4MVBC 3CFKB 3D69B 3CZJA 3O9WD 4N8CH 5E00B 1C5BH 1LEGB 4LCUA 2V5TA 5TQ0L 2IANB 5DGQA 3SO3C 1V3KA 4Z7VF 4F58L 3GSOB 3MYJA 3T0EA 1B90A 1L0QA 5BZDA 3N1QC 3AREC 4DKEH 4HIEA 4MMZC 3PNWA 3FQUA 3L7EB 1ZKAA 3CFDA 5IK3B 3D18B 3QJFB 4TSAL 1CZ8H 1HQ4B 1KBGL 4JDVB 4U1JB 1EEZB 2PTTA 2O5XH 2VL5B 1YJDH 5D2LE 1JK8A 1BGXL 1MJ7L 4LCWE 1U8NB 1XF2B 2ZJSL 2B1AL 4LF3A 2BC4A 3KR3H 4G6FB 3L7FA 3G6AA 4YHPA 5EBGA 3PGFL 4PLNC 4YZFF 3NGBB 5IF0B 3LRGA 3ZL4L 7FABL 3JUYA 1NBZA 4Z95H 4X6DB 1VFUA 4MSWB 2J7LA 3V6OE 3P4NA 1I3VA 3SDXE 4MD4A 2XA8L 2ZSWB 2VC2L 1QFWM 4KPHH 5JZ7C 1FZMB 1LP9E 3CFCH 1S7RB 2FEDC 3M8OH 5LAXB 1VGKB 4M1DH 4FNLH 4XPFH 4PLJD 1N0XL 3MLRH 3DUSA 4LSUL 4FQXA 4DVRL 2AEQH 1RJZA 5GRYA 5I76A 4M7ZC 5JIHA 1EH9A 2NX5A 4RQQB 4KDVA 4ZOBA 3O2DA 5IFJB 5TQ2H 2R0ZL 2GFBB 3U9UA 3DRTB 4AH2B 4L29A 3X12A 4D9LL 2N1KA 2R4RH 3GSWA 1CL7I 4Y5YA 1QFWI 1XF1A 5BV7H 4PRHA 4CADB 1M6OB 2MMXA 5DDHB 5TGBA 4OZFH 4PR5B 1HKLH 4WI4A 2P24B 3QA3B 1NGXB 4HPOL 2ATKB 5JLZA 3SDAA 3Q6FA 1YNLH 1XF5B 4PJIA 4NJAL 4RGNE 2F54E 2V5MA 5GSRB 4FQLH 3BDBA 5J1AA 3T8XB 2V5YA 1QBMH 2YPLA 3HG1B 4MA8H 4YXKH 1QFUL 4KVCL 1OM3L 3QHTC 4MXQD 4FN0A 1U3HD 3UTOA 5HDQL 1X5IA 1NC4A 1QBBA 4OLZL 4MNQE 4H88L 4JFDE 5IV2B 1NGZA 3EZ8A 3MNWB 3KGRA 4U0RB 5DQJA 4DVBB 3ARBA 5DI8B 5JXED 4MQSB 5L2KB 1RUAH 1IFHH 3WN5A 4WO4D 1LEIA 3U0WH 1G84A 2JJSC 1T66C 1SBSL 2BHYA 5F3BB 5FYJL 4X8XA 3IDYB 3WLWC 1A3QA 1S9VB 1NLBH 2JJUA 4U49A 3MUGB 3GJEB 3GMQA 5EO0A 3GRWA 5TQ0H 4JY6A 4F37F 1H3VA 4K8RD 3RZWA 4IDJL 4OV5B 2ZCLL 3MRMB 5EUKA 4PP1D 5A43C 1DTUA 1C12B 4F58H 2IFFL 4S1RL 1AGBA 4WWKC 2WLYA 1AC6A 3BWAB 2DIAA 2ADGB 4TSAH 5DTFB 2VZ3A 4Y2DA 4L3CA 5IGXH 4OZIA 4BQCA 4KI5D 5INCB 2VLRA 2YN5A 5GGVY 2VDKL 4ZD3H 1ZTXL 3IKCB 2QQKL 3BH8A 3DUUB 2B1AH 4N9GB 5DT1L 4YK4C 1FFNA 4P2RB 4F7PA 3PGFH 4KGLA 4P2OA 3BI9X 3NFNB 3ZL4H 3ZTJH 1HDMB 4ZPVA 2C26A 2X4UB 3ARGD 3VXMB 1WITA 1NUNB 5HDLA 3MV9D 2CKBA 2YS4A 1BD2B 1FNHA 4Z5RB 5IESH 2XA8H 2PF6A 3ROLB 4BUGA 1PDKA 4PV9B 1TCMA 4LSUH 1KTDB 4JB9L 3D85B 4JFQB 4DVRH 4NHUB 1AJ7L 5I2IA 1DBML 2LAAA 2J8OA 4TSBH 3RAJH 4YWGL 3HCVA 2EC9T 2YBRA 3GKWL 3K8KA 4I0PB 4YDKL 4EN3D 3JV0A 2VDOL 4D9LH 1T22A 1U91A 4U1GC 4Q2ZA 1KB9J 3O8XA 3QUZD 3O2DL 4FZ8L 1QLFA 5I6XC 2AXFB 1FGVH 4M48L 4ZUVB 5ID1B 1ED3B 4RA0C 2LTQC 2XKUA 4MA3B 4LVNC 4XPAH 4FTVA 3DV6B 2VLJB 5F1NB 3VFOA 1V3JA 3OF6A 4UBDC 5C0CD 4N0CC 5KSBF 4Z78A 4GBXB 2NTFB 2P49B 4QOKA 1J1OL 5HHNB 3T0VA 3GSRB 3IXAB 1QFUH 4BFBD 1MWAA 1OT2A 1OM3H 1UB6A 2NCMA 3TN0B 4JO4L 3ARXA 5HDQH 1QHPA 1Y18A 5IBUB 1UJTA 4NKIL 1CIDA 2VH5L 4OLZH 1AQKL 3WFCL 4G7VL 4OZHF 3L3HA 5IHUH 5KANG 3IDUA 1CDYA 2WQ8A 2HJLA 2Y07L 1KLGB 2R2BB 4P4KC 4JREC 2FSEB 1FVEA 4XPBL 5HHOB 3FRPG 4NN5C 1J0KA 5J57B 4JM2A 1I3RB 3WEXB 2FJFA 2EDQA 1T0NA 1U2HA 4J3XA 3E3QC 3PP3K 4X4XA 5JW3L 2ZCLH 1JWSA 1YPZA 4Z7WA 4XXCC 2IFFH 2OTUA 2NY6B 2F9BT 1UJ3B 1A4KB 1HWHB 4PJ5D 1G7QA 1IM9D 2E9WA 3GRWL 4U6HA 3STLA 3BGFC 2OQJB 5B39B 1V7ML 4FQ1L 4JFEB 4TNVF 2KQMA 1U2CA 3E2HB 3Q6GH 2VDKH 4L9LA 4YHOL 4LKXB 2WUBH 1ORQA 2QQKH 1W72H 4LLDA 3SGKC 2XPGB 2DMBA 2HJKA 5DT1H 3QXWA 1OARL 3MJ7A 3PGDB 5E2UL 2AEIT 4GKOA 1N6QL 5I73C 1BHGA 1ZGLA 1DVFB 1PKOA 5JHDE 1JFQL 1S78C 1YJDC 1LD9A 3VGAC 2AJVL 4NSKA 5TE6L 5I15L 4UNVA 5BVJA 5SX5H 4G9FA 4OIAA 4O5LL 4PJHE 3QUXB 4NYLB 3NCCB 3AXLB 4H5SB 4KU1A 5BS0B 2CKBL 4NCDA 3BP4A 1AJ7H 5FYKU 1T1YB 4ALAL 2DQEL 5C08D 2GCYB 1VADB 2VDML 4YWGH 3IETA 3GKWH 1BAFL 5I1EH 3RWFA 1IE5A 5DRXB 1NUDA 3IJYB 1OTSC 4EOWL 3PWNA 4X6EA 4XPHH 3REVB 2P8MB 1EAPB 5DR5L 2MKLC 1E4XH 4Y7MA 4PRBB 5D2LA 4LCWA 5DFWH 1WZ1L 3AMKA 2ICWB 1FNGB 3QT2A 4RFEB 1CICC 1NMBL 3FB5B 3WS6C 1F13A 4JY4B 3S4SB 1VEMA 1IL1B 5ERWA 4XHJC 3RUGF 2XWTA 4WV1B 4MWFA 4WEMB 32C2A 3S88L 3O4LE 1CXHA 5BV7C 1KEGH 1D6VL 1E6JL 3LHPL 1Q9KA 2W0FA 4JO4H 2XTLA 5CHNB 3QIUC 3SDXA 3RNKB 5K59F 2AABL 4NKIH 2BVQB 1BVZA 1YDPA 2XWJA 4LOUC 4G7VH 4JAMA 3WFCH 1MWAL 1TVDA 2IAMD 5IW1B 1BECA 2Y07H 4IRJA 4ZPTB 3TJEL 4ZO9A 2QJDA 3T3MF 3RQ3A 1EFXA 4MCYA 2DQFA 3CVIL 3TA3D 2CDFA 4ZSOB 4KQ3L 1TJIH 4P2CG 4XX1G 5DUBB 2FZ3A 1OT1A 1QVOB 1GIGL 5E9DB 2DWEB 3VRIB 1J8HE 4W6XB 3VXSB 1OAQL 4LLVB 1YN7B 1ZE3C 4J4PA 3H7BB 4UIMB 4AT6A 5CEXB 1A02N 3ARFC 3VDAA 5T1LA 3SE3A 4IRSA 4FQ1H 4I8DA 1ADQA 2F54A 1E4KC 1HHGA 3I50L 5DS8A 3O11B 4P3CL 2X41A 3MV8E 1RURL 4YHOH 3U4BL 2Y6SC 3ILPB 3SDCC 4IIQC 3RGVA 3L5JA 1A6AA 5LWYH 2FNBA 3FO9B 1OARH 1JGDB 3MXVH 5E2UH 4ODXA 3V4PH 1BZ9B 1G7PB 4JFDA 3KLHD 2EYTB 1HH9A 1QSFD 1KIPA 3QFJE 1AHWC 4JZJB 4LGPB 4NGHH 3E6HA 3IGAB 3FN0L 3X13A 2ED9A 1JHTA 3WDIA 5IR1B 2AK4D 4LP5A 5T1MA 5F7NC 3QIWA 5TDPB 4NQXB 4O5LH 5HHPB 4EZMA 4KK9D 1ZLVH 1U8MB 2YUXA 2NY0C 4NKDB 1OAUL 4U6YB 2FJGB 3H9ZA 3SE4A 1ONQB 1UCTA 2DQEH 2G9HB 2PUQT 3R4DA 4XXDB 2DQIL 1PYWB 2DTMH 2W60A 1BAFH 4QXGL 3C6LA 3ARWA 3EFDL 4PG2A 3JV6A 3WUWB 1FVCA 2C7UA 3QUKA 3HFMH 1V7NH 2HH0H 4XCEB 5FV2A 5DR5H 3OR6A 1FG2B 1RIHL 2E9BA 4WI6A 2XN9E 3AB0B 4WW1B 5HI5C 3FQRB 1WZ1H 4PTTA 3SDDB 1I8LA 5INDA 5JDSB 1UA6L 2BHUA 1NMBH 3KYMB 1DBAL 2DM2A 3G6JB 1TQCB 1HQRB 3QUML 2IBGA 3TWCL 3DYOA 2OMBA 3RL1B 3VWKB 2X1OA 2NY3B 5C0GB 2HMID 3MXWL 3S88H 3QEQB 3H8NA 3LHPH 1BQSA 4I3RL 1TENA 3OKNA 3FFDB 4HQQL 4JQXC 3DVNB 3WNKA 2Q7YB 6FABH 3V5KA 4KI5F 1WICA 2I07B 1ZHBA 4P9HL 1MWAH 1YEDA 3WIFB 1BWWA 1FPTH 2UVEA 1DR9A 1W2KT 1B4RA 3FFCD 5DURD 4YHIB 2BSTA 3BP6B 4X6CB 3ZE0F 4RA3A 2WAHA 3F7YB 1TJGL 2R2CA 5CUSL 3GMLB 5IHZA 2NPLX 4ZOAA 1MLBB 1OTTD 1HHIB 3P30L 3HTLX 2K7QA 2ICEB 1YY8A 3TIDA 3ULSB 4JN2B 4PG9A 1HNGA 3WFZA 4HKZB 5CP7B 2HKHH 3B3IB 1INDL 4K7PX 5FHAL 4PJAB 2OI9B 5D9SB 1OAQH 4N8VB 1AGFA 4PRPB 4DZ8B 2QSQA 4GKZA 3TM6A 3VMNA 1A7NL 4XP1L 4S11A 3DO3A 2W9DL 5EG6C 2YD2A 1XIWC 3CFIC 1ZGLP 2VN4A 4YGVB 5I1CH 1IM3A 2J1KA 3DURA 4Y5XC 1RURH 4AMKL 3S35H 1JNHA 4L8CB 5FAAA 2AJZB 1ADQL 4NKOB 4GW5A 3VMOA 5KSAD 3OR7B 2Y4SA 2AJYH 1N2RA 1UQSB 2HLAA 5F7UA 5HYJB 3TBYA 5HVGB 5E99L 3GMMA 5ICZB 1KJ2B 4M61B 1AE6H 1CIUA 1I9RH 4IOIA 4XNZC 3RIFK 1JV5B 1VFOA 3KXFA 4PJDB 4QT5B 3CFBA 4XNQA 2XKNA 3OKDB 4PGCA 3FN0H 5AWNH 3MNZA 1S7WA 5D72L 1ZGLM 2J12B 4HGMA 3EUUA 5CKAA 4LSPL 3STZB 1FV1A 4J3OC 4TN9A 1CLZL 1M7XA 5FO9A 4QRRE 3MRLA 2CLVB 4XMKH 5IIEB 4E5XB 2DQIH 2ZUQC 1QA9B 4CMHC 3RI5K 1AGDA 4QXGH 1UEYA 3DVFA 5CJ8A 1YEEH 3WDHA 1KG0B 2ZG2A 3VFSA 3H9SE 1UB5A 1JGVL 3ZKXB 2J88H 4XP6L 1RIHH 2EDHA 1B2WL 4JPIB 4JPVL 3UTZB 2YK1L 5IEKA 5C6WH 2C4XA 1IC1A 5IOPA 4XCCL 1UA6H 4Y19B 4HW6A 1L7TL 4NO5A 4QWWD 3O6ML 1NGPL 4XAKE 5E8PB 3QUMH 4JFFE 3S37L 1X9QA 4B41A 3TWCH 4R7NA 1MY7A 2VZTA 5FM8A 2BDNL 3L3JA 2OSLB 2P7TA 3MXWH 1Q38A 1YYLL 3GHEL 4TQEH 2ZPKL 4I3RH 4D8PB 4CN4A 4YPGA 1IAKA 1OGAE 4HQQH 1BJ1H 1ROWA 2ZUUA 1TVBA 1ZVYA 3GMOB 3MGTB 1F6AA 3QWRA 5D1XA 5E8NB 3ZT5A 4P9HH 2F53E 5FM5O 4TOYL 4ZS6D 1HCVA 4YUEH 2RHEA 2E8ZA 3VXUE 4HD9A 2QADD 4Y4FD 3QNYA 3GBLA 4N1CA 5IMLA 4XC1L 1TJGH 3SDAC 3EBAA 5CUSH 1RMFL 3G08B 3PXHA 4OF3A 1MCQA 4PIRF 2Q87A 3N1PC 1X6LA 2OCFD 3KLAA 4XRCA 5LQBL 4U1MA 1INDH 1CGYA 2VMFA 5FHAH 5DMYA 1NH6A 2EO9A 3ARUA 3MODH 4P5TC 5ADOL 1J05A 3DUHA 3RJQB 4ZFFB 4JE4B 3C8DA 3O3BB 3HRZA 1EXUB 2W9DH 1TJHH 3ARBC 2HLFD 1BZ7B 2WANA 4PJEF 4ZO6A 1U95B 2I9LB 3MA9H 2FO4B 2H1PH 1UXSA 4NQCD 5DEFB 1MEXL 4GOSA 4XGZA 3FQTB 3SJVE 4B50A 3O4LA 5DEGA 5EUOE 1MAMH 5JOPD 2XZCH 3ILQC 4GRWB 3I3EA 4KRNA 1O7SA 2VKWA 1ADQH 2JIXD 5KOVC 3HE6D 3U7WH 2GTWB 3LKSB 5E99H 2X6MA 2YEZA 1I1RA 1S7VA 3WMSA 5D6CA 3MUJA 4MMXC 1Z3GL 4Y2DC 3SEPA 2DDQL 3Q0HA 4LSPH 1HSAB 1SEQH 1F6FB 4R7DA 3OAYK 1MRFL 4MDIA 3UX9B 1RI8A 1OAXL 1CE1L 1NKOA 1J8HA 4TUOB 4XP9L 1NEZB 1X4YA 1IGCL 2GSIB 2XZQL 2BOBA 3OB0K 1D6EB 1R3LB 4KROB 2GTZB 4P2OC 4R8WL 3RWHB 3RY6A 2VKXA 2W1NA 3PHQB 3QXDB 1MHPL 5I1HH 4H26B 3BHBB 1B2WH 3BPOB 1NGYA 3OQ3B 1YECH 2YK1H 5D7JC 4XNMA 5IB1B 1HYSD 5D1ZC 3DO7B 4XCCH 2X1QA 3KPSD 3KVQA 4L8DB 3V0WL 1L7TH 1NGPH 5J89A 3F8UB 3S37H 4G6KL 3B5HA 2RCSL 2Z31B 4JFZL 4QHUB 3BISA 4QXTB 1YYLH 3CD4A 4V1DE 2CIKA 3GHEH 3QFJA 1I1AA 2ZPKH 2ZKHL 4LDEB 1BLNA 5EFIB 4K8RH 4M6MH 1QRNB 3G5ZA 4G6ML 1BWMA 3ZHKA 5BZDB 4Z0BL 1A0QH 3O0RL 3LY6A 1T04A 2I9TA 2BFVH 4P0DA 4WFHE 2X05A 2BY1A 2XQYK 4XC1H 1V3MA 4RBPK 3WXVH 4PRNA 1RMFH 4K3DL 4PRIE 3S7GA 3MACL 1U8HA 4RZCB 5C09E 3KPNA 2YRPA 1KJMB 2QKIB 2BZDA 1AD0A 3S34L 1V3LA 4EQ2A 5GGSB 1I7TA 4MNHB 4YHPB 3MLUL 2H8PA 2OTWA 2NR6D 4HS3B 4F3FB 2GJ6E 1NBZB 1ACZA 4LNRA 3ZTNL 2ATPA 5BW7A 5IROC 3E0GA 3V9FA 4MD4B 1MEXH 4HWBH 3HC0A 1MAKA 1B0GB 1Y6KR 5DJ6B 3M1BA 1KC5L 2YPVH 4OZFG 4M5ZL 4LLMA 3JUZA 4JHWH 1Q9OB 2X10A 4DGVL 1U8PB 2EE9A 4IOFD 1FNSL 1OWRM 1N7ML 2C1PA 4U1SA 1A5FL 3MGOB 4NQVB 2CDEB 4R3SA 4O9HH 5T3XD 3QDGB 4L29B 1S8DA 1JZ4A 5IMMB 1LK2B 1Q0XH 1Z3GH 1LVEA 1P7QB 4Y5YB 1SJHB 3L3GA 4GSDH 1YEFL 3VMPA 3DNKA 3PP4L 4JPKL 1A9EB 2WIIB 1HIML 4L9LC 1MRFH 5DFTA 4AENB 5GGVL 1OAXH 1CE1H 1IGTA 3WNMA 1ZHKA 4L4JA 5FB8A 4GMSL 2D0HA 1DQLH 2AJUL 5KVGH 1CGUA 2QQNL 1Z5LB 4MAYC 4M1CC 4KK8C 3EDDA 4WI3A 3DGGA 5F71A 3IU4L 1MHPH 5CINH 3KPRB 5TPWL 4YIQA 5ALBL 5KVFL 2X4PA 4Q9RH 3LMJL 3QR2A 1NC4B 4O2FB 5C07B 4N68A 3OGCB 1IZKA 3C87A 4PJFA 2VLKA 4FQQB 4WHTA 4GFTB 5DQJB 5E2VL 2O5ZL 3MBEA 3EHBD 3RWCB 2A6KA 4G6KH 2ZUTA 3WN5B 2RCSH 2LU7A 3FN3A 1CWVA 1CFNB 1VSCA 4JLRA 2EDNA 3RPIA 2ZKHH 4LEOB 4NP4L 1KJVA 5DRWB 5CD3B 5EO0B 1UM6L 5C9KA 4LVHB 5KZCD 5I9QB 4NZDA 4IBLT 3RX8A 4QRPE 2AJ3B 4NQDD 4Z0BH 3ULUD 4LASL 2EDDA 3ZTJG 4QRRA 4FS0A 1I9JH 3O9WC 4M7KL 5HJ3B 3I6GB 2LAGB 2BJML 2ZOLA 2VERN 3QCTL 1AXTL 4HMCA 4L3CB 4D9RD 3TBVA 5F7WC 4P9HC 3S34H 2XFXA 2H3NA 1NC2B 1RJLB 2FD6L 1OGTA 5EH1A 4RIRA 2DM3A 4G8GE 5C0JA 5IJKA 5GS1B 4UU9A 3LPGA 1TDQA 3TT3L 4X7SH 2Z4QA 4ZPVB 1JGEB 4JFFA 5CLWA 3DPBA 1F00I 2CKBB 3K80A 5KSBE 4M62H 1CBVL 1NCWH 1KPRA 5IBLC 3P2TA 5JMRA 1KC5H 1EZVX 1UCBL 5AYQA 2H45A 1OGAA 1QOKA 3CSYA 5DUMH 1RK0A 1EHNA 3IAGC 1H3UA 2L4OA 3NTCL 2F53A 1N7MH 4M93C 1GC1C 1CDIA 4J4PC 4L1HA 5C6PB 1PQZA 5T5NG 1XGUB 3PWPB 1S7TA 4CMMB 2NY2D 3VXRD 3O8XB 4X9GA 3DYPA 4POYA 3VG9B 1YEFH 5DFVC 1T4KA 2D7TL 2X4NB 1HIMH 3RGVC 4HFWB 5GGVH 2O26U 3SKNA 1P84K 3TFKC 3VFOB 4NO0A 4GMSH 5A2KH 3V6FB 4Z78B 2NY4B 3PV7A 2YA2A 3ULVD 1F90H 3PJSB 4UOJA 4M4RA 1UB6B 3IU4H 2MJWA 4L8SC 5TPWH 2F58L 5KVFH 1Y18B 3LMJH 3V5DA 1K6QL 1WBXA 3QXUA 3SJVA 1RJYA 4WFFD 5BVPL 5EUOA 5D2NE 3GUTB 4LPWA 2VQ1A 4Y1AD 3RDTB 1B4JL 2O5ZH 4FXGB 1MJJB 3V52H 3JWDL 3QZWG 3SE4C 1EPFA 3RA7L 3MFFA 1TCRB 3IS0X 2FJFB 3PGCA 4PJBF 1T0NB 3QXAB 4MA1C 3KYKL 3CK0H 5DK2B 3V6ZA 5JXEC 5CP3A 4Z7WB 4LLUA 4JG0L 1VFBA 4WO4C 1OAYH 3RHWK 5C0BE 1WSST 4LASH 5D7IE 5I30L 1G7QB 1VEPA 3QH3B 5H37H 2BVOA 1A47A 2R1WB 4M7KH 3P73A 3STLB 2Z92A 2BJMH 4XCNB 3QCTH 2BNQE 1AXTH 2X70A 5E2WL 4K8RC 5DRZB 1LEKB 3MOBL 2R0KL 1MUJA 1NFDB 1P1ZA 3BJLA 1NMCB 2EDFA 4X0KA 4ONFL 2DQCL 2FD6H 4IEFB 3QB7C 2D7OA 2PYED 3PL6B 4X9IA 1MQKL 1VFAA 5MEND 2FHCA 3C60D 5EBLA 1ZGLB 4KI5C 1H0DB 1I7UA 4K9EL 3BGAA 5FV1L 3L5WB 4LAQH 3FB6A 5D70H 1E28B 3LN4A 1T3FA 5DRNA 3W81A 2IPTL 1CBVH 3QO1B 5BVJB 4QRSA 1NBQA 4V1DA 3O3DB 4MZ3A 4P2QD 2EIBA 3TZVD 3MLSL 4W70A 5K59E 2AJXL 3RVUC 3ARGC 3SO5A 1YUHA 1RUML 2UWEA 3T65A 3IETB 2ZCKL 1BIIA 5CBEB 1BF8A 1A64A 3NN8B 3PQYB 3OKOA 1U8IB 5IFAL 5D93B 1RZJH 3T3ME 1GGIL 2A74A 4PRIA 4EI5A 5CJXA 4JDTL 1OB1B 1GXEA 1GZPA 1FVDB 2D7TH 4LCWB 4JRYD 1RFDL 1WIOA 4ELMF 2H9GB 1CU4L 3D9AH 1NCAH 2PYFA 3GIVA 4EN3C 4KRLB 5J13B 2XWTB 4NQED 4JGUA 4L8BB 4MWFB 4LEXL 2J6EH 4YHZL 4OGXL 2Z9TA 3RTQB 32C2B 3KWWB 1N5YH 4NUGL 2OP4H 3MV7D 2ED7A 2W0FB 3DHJA 1EEYB 3WXWH 3SDXB 2J8UE 2EXYD 5BVPH 1N6UA 4U1HA 4JFYA 4O2EB 5F9WB 1JHKL 1HHJA 2XWJB 3S5LA 1LP9B 4M8VA 3RWIA 3G04A 2FH8A 2VXUL 2EE2A 4M5YL 1B4JH 4WNQA 2IPUG 5HHMB 4QTHB 4ZNCD 2R29L 4Q97A 4WUUE 3RA7H 3U9PL 5GHWH 1V05A 4J23A 4PY7B 5EU4A 1N64L 2NLJA 3CCHB 3KYKH 2DD8H 2DI8A 2F8VA 2E9JA 3QAZC 5C0DB 4JG0H 4YE4L 4WHYG 3WIHH 2X9XA 5I30H 5DC0A 2NNAA 5HDBF 4F15C 4XHQA 3MUY1 4C83A 3RX7A 4XNYL 4WTZG 2Y7QB 4RGNB 2F54B 3WUZA 2DJSA 5B3JF 4TUJA 4DN4L 3HZYB 2C3HA 5C0ND 4M7LL 4G9DA 1OLZA 1A6AB 2CRMA 2YD9A 4OLUL 3S3SA 3FHAA 2CIIB 1V8HA 4I4WB 4MNGE 4MNQB 1FFOA 1MQKH 2ICCA 5SX4I 4JFXB 4JFDB 1A9BB 3VWJB 3BIKB 1UM5L 4NNXB 4LSDA 4XBPB 1DUZA 2E7CA 1J12A 2HRLA 1SBBA 5HVFB 3TYGL 5BJTA 2C3VA 3MRFB 2IPTH 5JQ6L 5FDWA 1JHTB 4X5XA 3QIWB 5H94A 5GJSH 2CXGA 3NAAL 4YC2C 2W07A 3KYNB 4NIKB 4YFEA 3W9EB 1IAOB 5T1KA 5HYQA 4OSUH 4BQBA 2ZUXA 2W60B 4KK6C 3FAXA 4YDLC 2ZCKH 2BNUB 2Q86A 2V9QA 4XBEH 3C6LB 2RGSA 2JTDA 2YXFA 3JV6B 3QISA 1FVCB 3L5HA 3O6FA 2DKSA 2OJEB 2ENSA 1OF2A 3U4AA 5I18H 3VW3L 4PD4K 1IQDA 3EGSA 3B4NA 4JDTH 3IDMA 3QNZB 2Q8AH 3WFDL 5HPOA 1FYTD 4MS8D 4NPYA 5EIVA 4IM8A 4PJ8A 1DBBH 3MV9E 2FB4L 1P84J 3FO1B 5EPMA 3HPJB 1FQ9C 4ZUUA 3AREB 3I85A 3UC0H 1QR4A 3OAUL 4OD3L 4YHZH 5HI3C 4OGXH 3CH8A 3QIBD 3ULUF 4NUGH 1U6AL 3V5HA 4I3SH 1K8DB 5IB5A 3BZEA 3FTGA 3QCVL 4ONGL 1SYVB 1MHCA 4UAOC 5ADPL 5KS9B 3OXSA 1N5AA 3ZYJA 4YHNA 1D5ZB 1Z9SA 4JG1L 1L6ZA 1RD6A 2IALB 1JF1A 3IVKA 3IKKA 3PDOA 4LQFL 4ODVL 1GZQB 2R29H 3SKMB 4H0HB 5IHZB 3KPLB 4PJCA 4MJ2A 5E1AA 2R4SL 2D4FA 2EKSB 1Q9WB 5EO9B 5FYKD 4NCC2 5C0CE 2G5RA 4WW2F 1V5JA 4Y4KD 5LJYH 3SKUD 4FQIL 2ID5A 4YE4H 1AGFB 3TO4A 4JCLA 1K85A 2UYLA 3CDFA 4WGVB 3CXDL 3QUYD 3LKNB 2UUDK 2DBLH 3GI8L 3VD3A 4K3GA 5CJOL 1L0YA 3MBXH 4ODTL 1XH3A 4Q6YA 4XNYH 2NTSP 3AAZA 4LFHD 1EMTH 4NN7C 2YKLL 4M7LH 4ORGB 1CR9L 4LCCB 4PJGA 2D7NA 1JNHB 2Y06H 1CDGA 3QPQD 4OLUH 3TBTA 3MLVL 2DJUA 5EOTA 1T0PB 1N2RB 3BRFA 1UVQA 3DSNA 3MFGB 2GUOA 1UM5H 1ZHLB 2VXSH 3VFTB 3TYGH 4LKCA 1KENL 2XKNB 1FZOB 2ZUSA 1NFKA 5J6HA 2J5LB 5J3HC 5IMOB 1S5HA 1YMMD 4ONHB 3ULVF 3NAAH 5F7FA 3V0VA 3KLHC 1OD7A 1PLGH 3STBA 4UDUA 4ZQKA 3RKPA 5C0BA 5D7IA 3GB7A 4O02L 5B8CA 2ZP0T 4L3EA 3VW3H 4YJZL 5HD8D 3EJZD 3HRPA 4QRUA 4E41D 2BNQA 4KK9C 1W0WB 3KJ6L 5SWZE 3R0MA 3BUYB 5I75B 3MYZA 3HLAB 4DOHE 5EA0H 3WFDH 3GMRA 5ID0B 4JM4H 4LARH 1FRGH 3B2VL 1NCDL 4WRLA 3THMH 1NPUA 2FB4H 3NZHL 3HUJA 4PLKC 1MAJA 1RZJC 1WBYA 1JZ5A 5F9JA 5JHDB 3EAKA 4OLWL 1U6AH 4D3CH 1FFQA 4PJEE 4HS6A 4ONGH 5DVNA 1IAKB 5C08E 1F6AB 5I8KL 5D1XB 1CFSA 1A6UL 1JZ7A 4PJHB 4YK4B 1OCWL 4JG1H 3HR5B 1K4DA 2V2XB 2HMIC 2EIZB 1DQJA 2DF3A 5E95B 4U1KA 3RVWD 4HC1A 4LQFH 4OZGF 1JGLL 3UJJL 3BD4A 1BOGB 1KTRL 4X8JB 5SWSA 3F6LA 4HSQA 4PJXB 4U4BA 1YNKH 3L3IB 4MQ7A 4NO2B 2W9EL 3U2SA 2W91A 3U7AA 3AM8C 5CWSB 1A7RL 1RQ5A 5EU5A 4P23A 4FQIH 4OI9A 4HIHA 1UYWL 5E6ID 1C1EH 3CXDH 3HRZB 1QFOA 4AY0A 1ZVSB 1KT2A 2NYYD 3GI8H 4L4VD 1OTTC 2IH3A 5DQDH 5H2BA 3QFDA 3CVHA 5CJOH 4C58B 5C8JB 3BEVA 3TPUB 2ESVE 3G5XA 4KV5F 1UXSB 5JIIA 4XGZB 1F4HA 2XA3A 2A38A 3MRQA 4PRDA 3RU8H 2WBJB 3HI5L 3U6RA 2FATH 4LLQA 2J8UA 3MLVH 2F19L 5FXCH 5C0AE 3OAYH 4PGBB 2LTQB 3DX9A 4LVNB 2D3VA 3MO1B 1GCFA 1MFAH 2YEZB 4ETQB 1S7VB 3R06A 1C16A 5D6CB 3UO1L 4X7DC 4WUUA 2Z93B 4HK0A 4PJ7E 3O3EA 3F62A 4GAGL 1DP0A 1DQMH 4UQ2A 4UV7L 2HTKC 4YNYB 2APBA 2B1HH 3ZO0A 4KH2A 4UT7H 4OGAC 2FR4A 4E42A 1BFVH 1AIFB 5IT2L 3GSVB 4DCQA 3V8CA 4JREB 3C6SB 2YPKB 2YSSA 4NN5B 4R9HA 2O5YH 1A3RL 2Z8WC 4PD4J 3KJ6H 4F80A 4H1LA 1SMAA 1RK1A 5M95B 3WS3B 1CXIA 2AQ3A 5IQ7L 1NGYB 3IFOA 1J1XL 3MV8B 2XZZA 1WJ3A 1F2QA 2P8PB 1NCDH 1X3DA 3JTSA 4LLAA 4OFDA 3U1SL 1D7FA 5EU6A 1AO7D 3FCTA 1YZZA 3RIAK 4NNPL 1FZKA 4BJLA 1FNEA 3D0VB 3JBG7 4OLWH 4HH9A 1CGSL 2CIKB 4RBPH 1I1AB 2JK5B 2DYPB 3F7VA 3KPOA 4G8FA 4ZTPH 3EYOB 3QG6B 4QWWC 5I8KH 3G5ZB 2PO6B 1A6UH 3SPVB 2BMKB 2Q20A 5A2FA 4X9BA 4PV8B 3ULUH 4U1IB 3LSOB 5HPMB 5DJZA 5I73B 3MMEA 4OLEA 3UJJH 3V8OA 3NPZB 4QRQA 4LSRL 3KJ4B 3EO9L 1UT9A 4MA7L 2IANE 3VGAB 3OZ9H 5I1JL 4OF7A 1WK0A 1U8HB 2JJTA 3QBTB 1S9WA 1X5GA 1PSKL 2W9EH 3RKDD 3IDNB 4HC1L 1T5XB 4D2NA 4QCIA 5F1IA 3L95B 2CLRB 2XN9B 4A2LA 2DWDA 5IP4A 4NKQB 4OF5A 2OTWB 3FQXB 2X4SB 3LB6D 4LNRB 1FE8L 3VRJB 2VB5A 4LHUD 4FMFA 1KCKA 1AFVH 3G5YA 3PHOA 3CVHL 4UB0L 4HMEA 3M1BB 4HZLB 5C0RL 5T3ZL 2F19H 3NCJL 5D71H 5KVDL 4H0GA 2HLFC 4YDIH 1CICB 5DZLA 2I5YL 5DHVH 3U30B 1A7OL 2B0SL 1CTNA 2FWOB 2C1PB 4KRPD 1ZA3B 3BP7B 2BNRD 1X4XA 1XR9A 3FN9A 4KMLB 2BSED 3UO1H 4MYWB 1YEIL 3HE6C 4ERSL 1EEUA 3VH8A 3I3DA 3QIUB 4V2CB 1NQBA 4OZFB 5CS7A 4GAGH 5KVEL 2I27N 3N9GL 3CLEL 4KJQD 1M7IA 2EXWD 4JKPH 1ZS8B 2ARJB 2HN7B 3ARQA 5E2TH 3MLPA 2VISA 5FB8B 2VOTA 4HAFA 3B9KA 4GJTB 4NNYA 2L7JA 2P5WD 1A3RH 5D7LD 3W9DA 4Z7OF 1LDPL 4K55A 4PJ9B 4ZUSA 5GXBB 1Q72L 4KJYA 1YA5A 2BVPA 5IQ7H 3QI9A 2D7QA 4EQ3A 4NZRL 4FXLA 2UY7A 3KHOA 3BKJL 1R3IL 4LPTA 4J2XA 1Q94B 2IG2L 1FL3A 3U1SH 3GGWB 2DI7A 1NUFA 1JBJA 2QV2A 2X9YA 4LSVL 1EK3A 4YFLI 5DK0A 3ARFB 1LMKA 4GG6F 2JCCF 3RPIB 3KDMB 3ARZA 3B6SB 3DX6B 4IIQB 5HYSG 4EKXA 1D9KD 1N3NA 4PGJA 2QQLL 4R2GD 3LQZB 1R3HB 4XBGB 5CBAA 3H3KA 4K7PY 4QRRB 5HYEA 3REWB 1ZMYA 1PVHA 4P2RD 3EO9H 3MCG1 4MA7H 1F02I 1RJCA 2ZOLB 4O2CB 3QWOA 5I1JH 3MRBB 4EBQL 1RPQA 5EO1A 5CEZE 4ISVA 5GGUB 3VXMD 5JXAH 3Q5YA 4DUWA 4HC1H 3H9SB 2NY5L 5K9OB 1BD2D 1QQDA 5SWZA 2K7PA 4BZYA 4KKNA 4PGEA 1MFEL 4FXKB 4NUJB 2MPAL 3D39D 3N85L 4G80A 1CI5A 4PS4L 1LO0H 1G7IB 1H3GA 3DV4B 3MRPA 2LU3A 1JCKA 4GQ9L 4JFFB 3TIEB 5ITBL 4FA8A 3K46A 3L6FA 2XOTA 4MVBD 4HG4K 4KKCD 1F2XK 3QO0B 5DYOA 3U0TA 1JPFB 3EDJA 3WFHB 4Y5VC 1S9XA 3KPQA 3CVHH 5C0RH 5T3ZH 4O00A 3NIDF 1A6VL 2NR6C 3K81A 4EXKA 3QP3A 1H8NA 5KVDH 2HVKB 1WEJH 3TYFA 1ETZB 3NH7L 3CSGA 1A7OH 2B0SH 1E27A 1NJ9A 4Z8FL 5D5MA 1BPVA 5DSCB 5F89B 2VDPL 3QPXL 3KNBB 3BESR 3VXUB 5FA4A 4GG8A 1OY3B 4I2XE 1YEIH 4FOMA 4P46B 4ERSH 4WI7A 2VRAA 4MJIA 1T4KB 2DB8A 3E1F1 4FFYL 5DQ9A 1J86A 3TN0D 3IF1B 1CGTA 3SKNB 5FYLD 1JHLL 1HHHA 3BKCL 4Y88A 3TH2T 1BX2A 4ZODA 3HNSL 4YHKL 3G9AB 4QHMA 3V4UH 3WO4C 5EZOL 2ESVA 2ZUVA 2HJFA 1RHHA 2QBWA 4M9PA 3SJVB 3V95A 1ZWIB 2FIKB 1RY7B 3TNNB 4I77L 3BKJH 1NCNA 1R3IH 2IPKA 5H37G 2IG2H 3QDAA 5C0AA 3UYOD 3DX7A 3QDHA 3VFVB 4KRMB 2ARWA 4ZAKB 5DJ2A 1XIWB 4ZFGL 3MFFB 5BMFH 1OAKL 5JA9A 1MREL 1IGYA 3O6FC 5EULV 3QDMD 3EHBC 2QQLH 4LLUB 5E7BA 1J7VR 5HHOE 1R24A 3F7QA 4PJ7A 3SE8L 4F2MA 4ODUA 1KOAA 4L5FL 2NMSA 3BX7C 4JRXD 3D0LA 2IQ9H 2HFGL 4PJ8C 1XGPB 3QZWB 1C5DB 1H3TA 3UTSD 4Z7VB 4EBQH 4NRZA 3PE9A 4R90L 1G7HA 5ICXB 4UUJA 3UPCA 1IEAB 5GSVB 3R8QA 3KPSE 1P1ZB 2A0LD 2PW1A 1ZSDA 1UWXK 3IDGA 1NCTA 3ULUC 4OKVB 5TH2B 1HXMA 1K5NA 4I5BA 4I0KA 5J12C 4JFEE 3QUXD 3V7MA 4PS4H 3T0WA 3RBSA 1U3JA 3SCMB 5T33L 5CIPA 4MCZA 2A6DA 4GQ9H 4F9LA 4MD5A 3FB6B 1FJ1A 5DRNB 4MX7B 3CC5A 1BOYA 4P4RB 4QRSB 3WLWD 2BP3A 3C5ZA 1A2YA 4S0SD 2OMNA 4OD2A 1A7PL 1A1OA 3TJHD 1A6VH 2NZ9D 2GITA 4FQHA 1TZHB 1AH1A 2SEBA 2X4RA 3NH7H 1MCCA 5E8EA 4WWKD 4WW2C 3CFKA 1BIIB 3W5NA 4OJFL 3HC3H 1DSFL 2VDPH 1S7QB 3UTTD 5E00A 1LK3L 5BS0E 2DKMA 2IANA 4PRIB 1T1ZB 5C09B 4X6BB 3VFGL 3GSOA 4UTBL 1BIHA 4W4OA 2YA0A 1OTUD 3D2UD 2XTJE 4Z7NF 3L7EA 1JHLH 4FFZH 5IK3A 3D18A 3WFBL 3QJFA 1HQ4A 1FGNL 3RY4A 4QY8B 1L9MA 4JDVA 2J2ZA 4U1JA 3HNSH 4QTIL 3MX0A 3DXAD 2GJ6B 1U8NA 5I71B 1AY1L 5EZOH 1FZJB 1VDGA 2ARJQ 1OQXA 1JWMB 4LPUA 1HK6A 4B0MM 4U1HB 3RY5A 3W11C 3S5LB 1RUPH 3RZCB 4K94L 1KIRA 2JLLA 4I77H 5IF0A 4Y89A 5E9DD 5T3XE 4X6DF 4CDGC 5AUMB 1FCCA 3ULVC 1PZ5B 2EKJA 5HYIA 4MSWA 2GIYA 3VXSD 4IMKC 2ZSWA 3QNXB 4ZFGH 3BP5B 8FABB 1CQYA 1QBAA 1OAKH 2AJSH 3P0YL 1S7RA 5LAXA 3RNQB 3MQIA 2V6HA 4HUNB 5EU4B 1VGKA 35C8L 4EDXB 2DQDL 2PCPB 2A6JB 2EH8L 4RQQA 2FHFA 5IFJA 3BQUA 2GFBA 2HFGH 4I48B 1RIUL 4LDOB 3TBWB 5J9PB 3DRTA 4AH2A 4N0CD 2VZVA 1AKJA 5FK9B 5I1KL 4JFOB 4R0LC 1E4JA 3OAZK 1G1YA 4CADA 1M6OA 4WCYH 3C08H 5DDHA 5J11B 3S3PA 4HUVB 2P24A 3QA3A 1NGXA 2ATKA 2R0LL 2V7NB 3NVQA 1XF5A 3T8XA 1FC1A 4R4ND 4Y16B 3HZVB 5C71A 3HG1A 1ZLUK 5T33H 1WCBB 4Y4HD 3MJGX 2R0WL 3P4MB 4A6YH 5EDXA 4P99A 1TQBC 4HG4J 1F58H 5H94B 5E4IA 1A7PH 1MHHA 5IV2A 3MNWA 2Z8SA 3VI3E 3C60C 3V4VH 1QR1A 5D7JB 5DI8A 4ZFZA 5L2KA 3ZLQC 5JNYB 4D9RE 1O7VA 1R3JA 2VXQL 5JOFB 2B2XL 1W0YT 2QSCL 4QRPB 4CRPA 3SDDD 2OM5A 3D87B 5F3BA 4OJFH 3LCYA 3W82A 1JWUB 2P5EB 1YEGL 1DSFH 2VDRH 3W5MA 1S9VA 1BZQK 1LK3H 1Z9LA 3GJEA 3M45A 4OV5A 5ANMB 3MRMA 3QQ4B 2IEPA 1C12A 4TTGA 4UTBH 3TV3H 4HIJA 3NZ8A 1CFTA 2XG4A 5TF1L 2OX5A 2Z35B 3S36X 1A7QH 3ALPA 1EGJA 5J8OA 2ICWJ 1G0YR 3WFBH 5D8JH 2ADGA 5DTFA 1FGNH 3UBXG 5EBWA 4G8GB 4ZUUB 4YXHL 3HE7B 2BOCB 5JW4R 2AEWA 3VCLB 2E9IA 2MHAB 4QTIH 5INCA 1VB9A 3IDIB 3NMEA 3EIFA 4GRLB 1MELA 5IVXF 2HAZA 3GHBL 3V5HB 2DLEA 4N9GA 5ISZD 5KSBB 5DJXB 3G6JE 1N5AB 4K94H 1NANH 3VFNB 1CE6B 4OM0H 3SKOB 5E08L 4PB0L 4H8WL 1HDMA 2X4UA 4UMGA 1JF1B 3IVKB 3LPWA 3PDOB 3O41B 4RAUA 1BD2A 1F3RB 4Z5RA 3OKLB 4OZHB 4JZOB 3ROLA 3P0YH 4HX1B 1M4KA 2XT1B 3HAEA 4JKWA 4PV9A 4I2XA 5E4EC 1CLYL 1KTDA 3ARVA 3D85A 2Y1VA 4X6CE 3MRHB 2VN7A 3ULVE 4YDVB 1UWGL 4I0PA 4U31A 3D6GA 4LHJB 4U3HA 3SGDH 4N0UE 1Q0YL 4IDLA 4PJAE 4WFFE 2GJZA 3VE0A 5HYJD 4Z18A 4J1UA 2E7MA 3TBSB 2OLDA 4Y1AE 2AXFA 5I16B 4ZUVA 3OKYA 1ED3A 2RIKA 4KDWA 4P5MB 1IKNA 1UWEL 4MA3A 3AY4A 4DUXA 2VLJA 5F1NA 2VABA 1YC8A 2BRRH 4LOUD 3SQBA 4GBXA 5D2NB 2NTFA 1EZVY 3NIGF 2GUOB 1L9NA 4W68A 3GSRA 4LPYA 3MRCB 5C0NC 3ZKND 4LKCB 3OWEA 4MAYB 5C7XH 3T3PF 4ZFOB 4H0IA 4OCXL 3FO2B 5CIPH 3QSKB 4ZO7A 5HYFA 4IRZL 5A16B 4LU5H 2R2BA 4R4FL 5GGSY 4OGYH 4UDUB 2FSEA 1UM4L 4F57L 5HHOA 1JN6B 1G7JB 2B2XH 2QSCH 1Z0MA 5C0BB 2FX8H 4V2BA 5D7IB 3GB7B 3WEXA 5L0QB 5B8CB 2ADFL 1P69B 5AYUL 4WFGD 4JFPB 4U0QB 4GH7B 3Q2CA 4OZGE 3IFLL 4EDWL 2NY1D 3VXQB 1CLOL 4OCSL 4HULB 1A4KA 5TF1H 4C56D 1A14L 2F5AH 4PRAB 1MI5D 1YEJL 1JZ8A 5CEZL 4TPRL 5B39A 4JFEA 1VHPA 3O81A 4P2QE 1Q1JL 3AUVA 4RX4D 1B0RB 1U3YA 4OT1L 1EGJL 4LKXA 1MSPA 4OKDA 1CG9A 4Y19E 5HDOA 2XPGA 2Y5TB 5I1LB 4I0CC 4KV5E 3PGDA 2P47B 5FUOL 4F9PC 2M2DA 1SJVA 4Z7UE 2NY0D 1DVFA 1Z2KA 1DQJB 3QIBC 1CD9B 4HXAL 4A2MA 2YD1A 4HKJB 2F74B 3T2NH 3ETBF 4AL8L 5E70A 4X99B 4JRYE 4LBEB 4K7FA 4I18B 3B9KC 4XP5L 1DCLA 4MQ7B 1RZFH 3AXLA 4H5SA 5DJYA 5BS0A 3U2SB 4L1DA 4PBVC 5EU5B 1T1YA 2GCYA 3QI9C 1VADA 5F8QC 1CVRA 5JW5B 4CNIB 3MV7E 3BIAX 4W4NA 4M93B 4LNVA 1N26A 3BEVB 3REVA 3VA2C 3MLZL 4M3JA 4Y4KC 4POUB 4NJ9L 4PRDB 1CTOA 1IC5L 2ICWA 2QSTA 3QUYC 4JY4A 3S4SA 3SOBL 4TNWF 1MRDL 3EJJX 4AEIH 4WV1A 3GO1L 3F6IA 1GGBH 2XRAL 1EHAA 2ZCHL 5CHNA 1KJ3H 3GSNB 1JZ6A 3S3JA 3RNKA 3D5OF 4WUUB 2VDNL 1ZT4B 2BVQA 4Q9CA 4HK0B 3TVMD 1XGTA 5F88A 4TYUA 4DN3H 5IW1A 4UQ2B 2VWEE 4ZPTA 2ZWLT 4R4FH 1T89A 4YHMH 4Q74A 1WISA 2CUMA 4E42B 3LDBB 4OB5H 2EE3A 1RUKL 1LE9A 3S35X 4DCQB 5BRZD 2XQYG 4Q9BA 5DUBA 3PIQB 5FYJD 2YSSB 2ADFH 1U3HB 3CJJA 1QVOA 3ARDD 3EOAB 1IGFH 2DWEA 3IFLH 4XNXH 3VRIA 4DTGL 1KGCE 2LABA 5CLTA 4EDWH 1MJUL 3WD5L 4WUKL 1CLOH 5HTSA 3AMLA 4OCSH 2VUYA 4LLVA 1YN7A 4WDIB 4UIMA 1I1CA 4N0YL 5CEXA 1ULVA 2V9TA 4F8TA 4TPRH 4MNGB 3FCTB 4XMLL 1JYXA 5HD8C 2NXZB 1Q1JH 3T0ED 4FQ2H 1JNLH 4OT1H 2ERJB 1AI1L 1EGJH 3ILPA 3UPRB 2JJVA 1B88A 4F7CB 3A6BL 3FO9A 4OFYA 1GGYA 2GEEA 5FUZL 4ZOCA 1JGDA 4M6AA 5FUOH 1KF9B 1HZHL 2FH6A 1BZ9A 3P77A 4KZEL 5GISL 4JANA 5IM7A 5DJZB 4IS6B 4JZJA 1KFAH 3JXAA 2E6JA 4QRQB 1MCOL 4HXBL 3HC4L 3IGAA 4ZS7L 4AL8H 5LVEA 1QRNE 3GI9H 3OKEB 5IR1A 1JI1A 15C8L 5JIKA 4XP5H 5TDPA 4NQXA 5HHPA 5BOPA 4K94C 1U8MA 4KQ4L 3EFFB 4U6YA 1CN4A 4JZNB 2FJGA 4QCIB 4OLYH 2YD5A 3RVWC 1ONQA 2G9HA 5ALCH 3WE6B 4XXDA 4CJ0A 3HMWL 1AP2B 3ARGB 1F42A 2E7BA 3LZFH 3WUWA 3MV9B 2X1PA 4S0TD 4FQXD 3KHQA 1IMHC 4XCEA 3MLZH 5EU7E 5FUCC 2NX5D 1EA9C 1WAAF 3G5YB 4RDQF 4WW1A 5DGRA 3FQRA 5GRWA 1R0AL 1LDSA 1RUQL 4Q6IB 4EI6B 3KYMA 3V0AC 3CAFA 3SOBH 4KVNL 3CU7A 2GYSA 1MQ8A 1MRDH 2ICES 1IT9L 3G6JA 1HQRA 2YOCA 3VWKA 4PRHD 5C0GA 5IB2B 4EN3B 3EO1B 2CK0L 3QEQA 3A0OA 1WZKA 5FYKE 4KY1L 1XR9B 4K7PL 2ZOKB 3SDAD 3QUZB 1ZV5A 3DVNA 2Q7YA 3ALWA 1P4LB 3GSQB 4OCYL 1RIVL 4GG6E 2YPLD 2I07A 5IBTL 2JCCE 5FDYA 2KZWA 5IB3B 1JPSL 3WHXB 4RGMB 5C0CB 4EJ1C 2GSGB 4YHIA 4KTYA 3BP6A 3ZSSA 4X6CA 3JWOL 2VISB 1NC4D 3F7YA 4NC1C 5FO7A 3GMLA 4BK5A 3EYUL 5FEBA 4OCRL 5JIPA 3X3FL 2ICEA 3ARBD 4JN2A 4F33B 3DX8B 4HKZA 5CP7A 3B3IA 5EOQL 2MCPL 2W38A 2QQQA 1OP9A 4DTGH 5FOBA 4ZUSB 4PJAA 1MJUH 4YXLL 5D9SA 4WUKH 4N8VA 4YEFA 2HA1A 4PRPA 2DL2A 5I1IL 3ILQD 4DZ8A 5F93C 3C5ZC 2XG5A 4Y0GA 1H3PH 4KMTL 3BD3A 4N0YH 3F7RA 2ORBH 5ICYA 3Q3GB 1TTUA 4HLJA 4JVPA 4XMLH 2R8SH 1A6WL 1YMME 2D7MA 2AXGB 1RZIB 4WEBL 1AI1H 2EDKA 3OJDB 4X4ZA 3T08A 5C07E 4HKBB 2OJZL 3UDWA 4UT9L 4L8CA 3A6BH 1HOCB 2BSRA 4BFEA 1CFVL 4Y2DD 2AJZA 4NKOA 1KIUA 4JQVA 4RMWA 3CGTA 3OR7A 1HZHH 3MRGA 1UQSA 2VLRD 1PG7X 2B4CH 1IM9B 1N6VA 5CBAB 5ICZA 5GISH 1KJ2A 4M61A 1WC7B 3ABZA 1JV5A 3QYCA 4JY5L 1KELL 2MWCA 4E41E 2QLVB 4G6AD 4PJDA 3QEHB 3VXPB 3ZMRA 3DYMA 4HXBH 1NLDL 4P2OD 5LXGL 2QHLA 4KKAD 1TETL 3STZA 5I1DA 4KQ4H 4Z77B 1UENA 3BH9B 4BK4A 2DQTH 5HYSB 2XXMB 2CLVA 2X4QA 4DOHB 1QKZL 4YC2B 5F7HA 4FFVD 4E5XA 5IIEA 5GRXG 1CXKA 3EO0B 5GRJH 1CK0L 3HMWH 2ILLA 4C4KO 1K4CB 1DUYB 3NGBC 2ZSVB 1I85C 1KG0A 5IVOA 4YDLB 3KPPA 1E4WL 3QG7L 3RKDC 4C4KT 3L6FB 5KAQF 5DYOB 1I75A 1P7HL 3UTZA 1R0AH 1LO3L 3VGDA 1S9XB 3BSZH 1RUQH 4OIBA 3B2UD 3I6LD 3ZSTA 4Y19A 4G3YH 4PJEB 3F58H 1ODAA 5C08B 5E8PA 5EZJB 1R5IB 1IT9H 4MAUL 3O8XD 3CFJB 3LB6C 1KCVL 1I9IH 2CK0H 4Z7UA 5I0DA 4XWGH 3IFNH 3DMMA 1EJ6A 1B6DA 2Y72A 4D8PA 4FTVD 4K7PH 1F4XH 1PZUB 3OF6D 4Q9QL 4X6FB 1BQUA 3MGTA 4YX2L 2NY4D 2VJXA 4QOKD 5GZOC 5IBTH 4DAGH 4WIQA 1WBZB 3MJ9H 3IFPB 5DQ9B 1JPSH 1H9VA 3ZT7A 2R56L 1A3LL 2ICWI 4OM1L 4LPVA 1OVZA 3BMVA 4G5ZH 4OCRH 3X3FH 4XCFL 3DROA 3KG5A 2MCPH 1WWWX 2J8HA 1I1FA 5MEQA 4YXLH 3E8UL 3DJ9A 5HGHA 1J0JA 4NWTL 4JM2D 2IAMB 3O3BA 4NBZB 3ZKMD 3I02A 2A83B 1EXUA 4KMTH 2EH7H 4JFHD 3UXFA 3MOAL 3UJIL 4U0RC 5DD1L 3TPKA 1OWWA 3DX7B 3LD8B 3TA3B 1U95A 4NRYB 1A6WH 2I9LA 2FO4A 5DEFA 4JO2H 4WEBH 4TVPE 3T77B 5FGCE 3FQTA 4XNUH 3TEUA 1CL7L 5BOZG 2PETA 3H0TB 4NFDA 2A77H 5I74C 4M7LT 1R24B 4KGJA 3LKSA 4F2MB 5FM4A 4KFZC 1DBKL 1KELH 4CU6A 2Q76A 1X5LA 1DEEB 2HT4D 3CFEB 1NLDH 3EOTH 2X44D 1IZJA 1N0LA 1KJ2L 5LXGH 4CBPA 1HEZB 4ODSH 4M1CD 4R2GC 5DUPL 3DVIA 3VG0H 3OX8B 1NL0H 1I1YB 1DN0B 1HXMB 1QKZH 3AROA 3P40A 4TUOA 3W0WE 1J1PL 2GSIA 3L5XL 4G9FD 1QSFB 1LQSR 1GOFA 1CD8A 1D6EA 1R3LA 3RWHA 4I13B 2EIDA 5KN5A 4N5UA 4Z7NE 3PHQA 1E4WH 1IC4H 3C5SB 4H26A 3BHBA 1FJ1B 3AU1B 3RL2B 5ECJE 1OHQA 1A2YB 3QQ9C 5IB1A 3DO7A 1HSBB 2CKNA 4M43H 3ORJA 4U2YA 1MCWM 4XPTL 4IMLA 1X6NA 3AS1A 4MHHG 2EC9U 2SEBB 1X5ZA 4LCWD 2Z31A 4QHUA 5ESVB 4KKCC 4LCIL 4QXTA 4I0PC 5EZIL 4HPYL 2C3WA 4Q9QH 5EFIA 1QRNA 4YX2H 3HR6A 4DGYL 1IGJB 1TXKA 3KLSA 1PW3A 3PQYE 1F8TL 1IKNC 1A3LH 3AY4C 4KDTA 3QXTA 2FIRT 3SGEI 1DDHA 1H8OA 4OM1H 4MLSA 5KOMC 3JTTB