4HH8A

Crystal structure of bovine butyrophilin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
211
structure length
211
Chain Sequence
APFDVIGPPEPILAVVGEDAELPCRLSPNVSAKGMELRWFREKVSPAVFLSREGQEQEGEEMAEYRGRVSLVEDHIAEGSVAVRIQEVKASDDGEYRCFFRQDENYEEAIVHLKVAALGSDPHISMKVQESGEIQLECTSVGWYPEPQVQWQTHRGEEFPSMSESRNPDEEGLFTVRASVIIRDSSMKNVSCAIRNLLLGQEKEVEVSIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 1 member A1
publication title The extracellular region of bovine butyrophilin exhibits high structural similarity to human myelin oligodendrocyte glycoprotein
rcsb
source organism Bos taurus
molecule tags Protein binding
total genus 40
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2012-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4hh8A02
4XGZA 4I77L 2G75B 3O2VL 4NKQB 2AERT 4KMQA 1DDHA 3GBLA 3F5WB 5C9JA 4N5ED 4RFOH 3GMOB 2YPLE 4E9LA 4PJ9A 3PHQB 4I4WA 1B0RB 1BQUA 2PW1A 5HI3C 3OL2A 2YUXA 3FO2B 5CD5C 4C55A 3EDDA 5CJQH 1HYSD 1FAIL 2MKLC 1CE1L 2UVFA 3SEPA 3ZKMD 5T5FL 1KN4H 1FDLH 1A6PA 4N0CD 5DJZB 1T2JA 3REVA 2FX8L 1J1PL 1QQDB 1TJIL 1VGEH 4KJQD 1T4KB 3JXAA 5F96L 5D71L 3GKWH 2CXKA 4XP9H 2P47B 4K23H 1IM3A 4RGMB 1FN4A 3JV4B 4DGIH 1MJ8L 1G7MA 1GGBL 3B5TA 3I50H 1L6ZA 4UMGA 3LDBB 5FA3B 5D9SB 3NGBC 4LMQI 1WCBB 5INDB 2XNAA 1PY9A 1A4KB 3BKMH 3IDXL 5AYUH 2VLRD 3EOBB 2NY4B 4E5XA 3HNTL 3HC4L 4YUEH 4YC2B 3L3HB 2LFGA 3GO1H 2NW3A 1TCRA 4M48H 1AKJA 5CJ5A 3QDJB 3K4ZA 2BSTA 4AL8L 3ULSB 2HT2C 5GZND 4JG0L 3L5XL 4IS6A 4PJFF 4IJ3B 4AH2A 4PJGF 4Y19D 3Q6FA 1IL1A 1U8NA 4ZOCA 3K3QA 4FQXA 3SDYH 3OPZL 5A1AA 5J1AA 3OKEB 1PEWA 2VLMD 3QZWB 1NCBL 4WHTB 5I1AB 4HMEA 2LTQC 2VXVL 1QNZL 1J9CT 3VU2A 1HI6A 4H8WH 5L7XH 2L7JA 2HJLA 4U0RB 1QFUL 2OK0H 2YBRA 3EJJX 1BOGA 3BEWA 5IG7A 4ZFZB 1SMOA 3HR6A 2CK0L 4L1HA 3FFDB 1WJ3A 3BZ4B 1U8MB 3DROB 3N0PB 5HHNA 4EXKA 2ZOLB 4PJ8D 5DURB 3CXHJ 1RK0A 3H9SB 5AD0A 4JQVA 3SOBL 5C07D 1MFEH 3MCG1 3P77B 3O6FA 4PLKC 3I84A 3IFOA 5F3HB 1CXKA 3CLFL 1AD0B 3NCYP 5IB3A 1M71B 3HE7C 2HWZL 2WIIB 3BYTA 1U6AH 2GSGB 1XR8B 4LPCA 3HI1B 2QQLH 1IILE 3FN0L 1KPVB 4LSVH 3P30H 4MA3B 3NCFB 3PHOB 1EHXA 3DSFH 4MB3A 1YNKL 2FEEL 3QI9D 1NC4A 3VXUE 1X5GA 4I3SL 4HS3B 5DA4A 2FBJH 4KRLB 3GMPB 5FYKD 3C2SA 3GMQA 4R4ND 5EBLA 5BO1H 5CUSH 2EE6A 1FL5B 1WEJL 3NTCL 5DRZA 1A7QL 2H32A 1C1EL 4V2BA 1T03H 3I3EA 3VFRB 4JFHD 5IV2B 1MRFH 4UT7H 5MEOB 1UXWB 3RWJB 4OAWB 3ZKXB 2YPLD 4AG4L 3B9KD 1X5KA 4P9MH 4HH8A 5HYIA 5KN5B 1LK3H 2XQBL 2DLEA 2IPKB 1R0AL 3AAZB 3MLSL 5ICXB 3TESA 1U8IA 1CF8H 3OKLB 2P49B 5EIIB 2DIJA 5CD3A 1MOEA 2Q8AH 4JPIA 5D93B 4K55A 3ARBC 4JPVH 4Z7UE 3QWOA 3PUCA 3GSVA 3SDDA 3RVVC 3OGCA 1KENL 4X99B 1I9RL 2WP3O 4LLDA 4QTHB 1OTSD 3EKCA 4ODXA 5GGQH 1ZHBA 3T3PF 2W38A 3I9GH 4E41D 4F37K 5HY9A 1G6VK 3DURB 1P5UA 2IADB 2HLAA 3X14A 3RWHA 4JY5L 4JQXC 3SDXA 5IVXE 1WK0A 4WU7B 1M4KA 4PJ5B 2BXZA 3KLDA 4M1GH 1TNNA 1IEBB 1V8HA 3VXOB 3BX7C 5HHXL 1YY9D 4HK3J 4RA0C 2C4FT 4FQPA 5CBEA 2V7NA 1LVEA 2Q8BL 2YC1A 1IFHL 4OZGF 5I0ZA 1I1AC 1P6FA 5FGBC 3JWNC 3IS1X 3MODH 4ACPA 4JREC 5C3TA 5AAWA 3DRTB 4NHUA 4FABL 4MQ7B 3BEVB 4DUWA 3RI5K 4Z8FL 1SEQL 1MRDL 4HT1H 3H7BB 2R1WB 1D5BA 4S1DD 3C9NB 3KPQA 2X05A 1HNGA 1ES0A 1URLA 2JCCE 1L7IH 4G6FD 3L3OA 4L3CB 1OP9A 3DX9B 1AR1D 4KV5F 3O2WH 1IKFH 4NZRH 5GRJL 2ICWJ 5EUKB 2V9RA 2HFFB 1PBYA 2PO6A 4P3CH 3LKNA 2W92A 3DGGB 3FOMA 4OFYD 2DLFH 1CICC 3QUXD 4U6TA 4N1CA 1JZ8A 4R0LB 4N8PA 3VXSE 2V2XA 2OJZL 1E0OB 1AE6H 4HWEL 2GFBA 4U1IA 2GY7B 4F2MA 3CGTA 2F5AL 5DZLA 3SE9H 2Q7YA 1LEIA 1M7IB 3GNMH 4W70A 5ACLA 2CUHA 1AHWC 1QYGH 4LOUC 5JZ7C 2FR4A 1HILB 4ONHB 5JUEL 3GBNH 4BJLA 4BH7B 4HIIA 4NZDA 1UB6A 4NPYB 5ID1B 1JGDA 2A73A 5FYJE 4LAQL 4D8PB 1Z9MA 1OPGH 1ZVHA 4WNQB 5HYJE 1BP3B 2QADB 4ZUTB 1A2YA 4I0KA 3KLAB 5JXAL 3RWGB 3MRNA 1LO0L 1SJHB 4NP4H 5C0GB 3D5OF 1FVDB 2B0SH 3ARUA 3LQMA 4X7EC 4KJWC 1KCLA 3RX5A 4C4KO 3FFCE 1DJSA 4OZIA 5DHXB 4YHMH 1AO7A 4Y4FC 1CD9B 4EN3A 3ZSTA 4MA1B 2EDFA 1TXKA 2DQIH 4M7KH 4GRLC 1Z5LB 5HDQL 3FB8A 1ZA6A 2MQ0A 1QTYT 5E03A 3K8KA 5D2LF 3HFMH 1A6VL 4OF6A 3BKYH 3HLAA 1CT8B 4ZAKA 3HE6B 2ILLA 4WEBH 1B4RA 3FQTA 2I9LB 4HXAL 1U92A 4HXBL 4OKVB 3SKMB 1AGCB 3MCLL 1GZQA 4KC3B 4KQ3L 1DFBH 4NSKA 5EOCJ 3PWNB 3HN3A 5DHVH 4TTDD 1EEQA 3C09C 5IQ7H 1BHGA 4NRXA 4PRBB 5FIEA 1RUAH 4LEXL 5IM7A 1BREA 3BZEA 5BS0B 5B38A 1WAAE 5E8OA 2V5SA 3BIBX 2N7AA 3KYMB 2FEEI 4RMQA 4C56A 2FIKA 5EZIH 4PRIA 4L4VD 3WIFA 4NGHL 4NQCA 5D6CA 5TDNB 1I8MB 4QTIL 3NIGF 3O9WC 4FS0A 3T65B 1MHPL 2IPUK 3JTSB 4QRUA 2JJSA 3MUJA 2JK5B 4JANA 3U9PH 4DAGH 1HHGB 1AP2B 2JKXA 2AKRB 3RWIA 4APQC 4U1NA 3F65A 2OLDA 3RBGA 1KB5L 5DUMH 3DRQA 3WNNA 1S3KL 3BP5A 2XA8L 3D18B 4PRNB 1QFHA 1IZJA 5HD8D 2F58H 5EBWB 2X09A 3IFNL 4MS8C 5JW3H 4GMTH 1YEJH 4G7VL 5FF6A 2C1OA 3RGVC 3SN6N 5FOJA 3LZFH 3EDEA 2M2DA 5ACZA 1ZXQA 4EDXB 2YD8A 5CAYB 3O3AB 3N85L 1MCDA 1MF2H 5ALBL 5CBAA 5D7SL 4WW1B 3NFPA 2VLJA 2OTWB 3H9YA 5HVHC 2KH2B 2VC2H 3VXSD 1L6XA 5E95B 5KSBA 4XP5L 1TJHL 2JELH 4H1LG 1ORQB 1GYAA 1H15B 5C2UB 1JHTA 3WN5C 3PWPD 2O5ZH 5A2FA 2VAJA 1ZK9A 4TVPH 5DD3H 3WD5L 4N9OB 3D69A 3ARGA 4HBCH 2KKQA 5E2WH 5HHPA 3WIIH 2FJHB 4JG1L 4J12A 4PJ7B 4F15B 5EU6E 5FYJD 3RPIB 4IDJH 1B90A 4OSUH 1NGZA 1ND0B 3LHPH 1QSFA 1WZMA 5HYJD 3O2DH 5HYSB 2GYSA 4X4XA 4H20L 5FUZH 4J8RB 3VW3L 3V0WL 3MA9H 3CU7A 4PJBB 2YA1A 1EAPA 2W60A 1UG9A 2MCG1 2B4CC 4RGND 1ZLVH 5D8JH 3QDME 2X1XR 5DJ2A 1DLFL 3ULUC 5A2IH 3RRQA 3W2DH 4XCEA 4YHIA 3HE7A 2R0LL 4I0PC 5C70A 2WBWB 5TDPB 1NMCB 1IVLA 3FQRA 5EUOA 1KLUA 1XGQA 5DEFA 5IBLC 3NAAL 5I71C 5DD1L 1NBVL 4X4MA 5CP7B 5MEQB 4WRLA 1MEXH 3ABZA 3U0WL 3DXAE 1GGCL 4IRSD 4OLVH 2FSEA 3R0NA 4U6YA 1WC7A 2YRPA 1A6WL 3RTQD 5FCUH 2EEDA 4XCNB 5J0BA 4XBGA 3OF6A 2IQ9H 3KS0H 3VWKB 5TQ2H 2B5IC 2A77H 4G6JH 4MQTB 4EI5D 5IROC 2CGRH 1WIUA 1A22B 1IAIL 3HZYA 4ELKB 3WUWG 1OF2B 1QLEL 3HG1A 4KRMB 1KB5A 4WCYH 2HFEB 3QFDB 4PJCE 2R69H 3NZHL 2DI7A 4HK3N 3S3JA 3KPRB 2JJUA 4NO0D 1EMTL 3WHE0 3ULVE 2DQHL 1VGKA 5MERA 1MUJB 1ZS8A 2D3VA 5EN2A 4G8FB 1HOCA 2ZSWA 5F9OL 4I18C 1T6VN 1SJEA 2VIRA 2X4SB 3D9AH 3MRKB 4AEFA 4C59B 4S1RL 4OF3A 1R3LB 2FWOB 3ARXA 2MCPH 1ORSB 2VWEC 2H9GA 3G6DH 3VFGH 2VDQH 1K8DA 3ARBA 2FCBA 4OM0H 4DJMA 4DVRL 3Q2CA 3MRIA 2ATPA 2HAZA 1RZGB 1YMME 3QT2A 3B4NA 4R26H 4WDIA 1U8QA 3ZDZE 3UBXB 1AI1H 5IJKA 4PTUA 4Z95L 4U4BA 2RR3A 3QPQC 4K3JL 2HG5B 3O45B 5INCB 5GGRY 3UJIL 2VERN 4JCLA 1L7TL 4JQXA 5L9DL 4PJ5E 3MLTB 3FQWA 3ARDD 3CFDB 3OZ9L 4XPAH 4N0RA 5D1QC 2A9MH 4JKWA 3RNQA 2H8PA 4R6UA 3BKCH 1D9KC 1DE4A 4ODHH 4Y4KC 2NXYB 3O3BA 1HQ4A 1I1AA 2I07B 2F54D 5FGBA 4ZDHA 5BRZE 2XKNA 3VFNA 1JZ5A 1JCKA 4Z5RA 1BVLB 3BH8B 1IEAA 3V4UL 3H7LA 5C8JA 4BH8A 1QG3A 3B2VL 1MCJA 1ZA3A 4HPYL 3RWDB 2BVOA 1K5NB 2ZOKB 3MRQB 3VG9C 1LEKA 1N3NB 5TQ0H 5F1IA 5EU4B 3MLZH 1T83A 4ZO6A 4K9EC 1KB9J 4LP5A 5FB8A 2I24N 1XF4B 1H3TA 1MFDH 3QIBC 2R0WL 4NRZA 4HUVA 3DGCR 5E08H 5IR1A 5JA9A 1CFBA 2CIIA 2XZAH 2P5WE 3WDIA 4OZFG 3RBSA 5EU6D 4PY7A 3TH4T 4YDVA 5CSZB 5T3ZL 4OV5B 2OBGA 3O8XC 3QNZA 4DGVH 2R29H 1EJOL 3BGFB 1IM9A 5D7IB 3U1SH 3MBEC 3NCJH 2NY7L 1DVFD 3H0TB 4GG6A 1BZQK 1QSVA 1JGUH 1YN6B 4TSBH 5EBMA 3BN9C 2P8MA 3QDMD 1J1OH 4OLXL 3D25A 3ZTNH 1UVQA 2IQAB 1SEBB 4G6AC 2Q6WA 3UC0H 5IHBA 1F97A 3JTTB 2RQ8A 3IDJB 3DVNB 1UT9A 4P59L 3S35L 1H3XA 3QNYA 4YDKL 5D7JB 2IJ0C 1NEZB 2BDNH 4YXHH 3PNWA 2UZYB 2HMID 3HZKB 2FD6H 2MHAA 2P7TB 3CNKA 3DXAD 3K4AA 3D85B 1KTKE 4MDJA 2Z93B 3WS6C 4R7DB 2XQYG 4XMPL 4ZTOH 4JFQA 5E7BA 4AT6A 3E6FB 3P9WB 4GSDL 4PG9A 2ICES 1OCWH 3CU1A 1YPZB 5C6PB 5BQ7A 2X4UA 4YO0B 5LGHL 2ENYA 4OIAA 4G8GD 4UOW0 1EDQA 3VXQA 3ARVA 2DLTA 1DTUA 2B8OT 3FRPG 4N9GA 4Y4FA 4PB9L 4QRRA 5JR1H 1KTLB 5L2KD 4LL9A 4DOHB 5LAXA 5GRZA 3FOLA 4ZPTA 1AJ7L 4CN1A 4GRLA 5GS0D 4P4KC 3ULVD 3C60B 1UWGH 1OLLA 5E2UH 3HCVB 4ZUVB 2BNQB 1ZHLB 2IH1B 5BMFH 4AEEA 5JHDE 4WI5A 3G5XB 5CKAA 1NL0H 2QQNL 2EDNA 3QUYC 4GOSA 4OD1L 3DUUB 5EU5B 3WXVL 5D7KD 4Z7VA 3KGRA 1KBGH 2W91A 4QEGA 4YDJA 5DUPL 4EUPG 3U6RB 1YMMD 4FQCH 5DI8B 4Q7DA 3MLVL 5IFAL 4H25A 3G08B 1NBZA 2NW2B 3ULUL 5BS0E 3RY5A 4JFXB 5FYLH 4HHAA 3PHSA 3H42H 3NPSC 3JV5A 5FHBH 3V8CA 3DNKA 4XI5C 4LLAA 5D5MA 5EZLA 2XWJA 2B2XL 1U2CA 2EE9A 3O9WA 3TIEB 5IMMB 3U9UA 4L9DA 5F21B 5EFIA 3O11B 5DRWA 1XGYH 2QSTA 3RVXD 3V6ZA 2HKHL 4I0CC 2G2RA 2H6PB 2CDEB 4U31A 2Y07H 1BFVL 3HUJE 2C3HA 1GOFA 2ADJB 4APQA 5BRZD 5J13B 1H3GA 4PFEA 4QYOA 1G7LB 1RZJC 4OGYH 5EZJA 3QYCA 4P2QB 2E9IA 3VGFA 4TPRL 5KSAD 2Z0BA 5I0DA 5CZVH 3RDTC 3W5MA 3WLWC 1U8HB 4ZFGL 4L29B 3GSNL 2D9CA 5HVGB 1P7QD 3GIVA 4JLRA 3PGCB 4PGDB 2DICA 3MUY1 4ENED 4PJIB 1FZMB 4LSPH 4XVJL 3ZE1F 2CD0A 1LK2A 2WBJC 3CVHB 3IKCB 1KEMH 4YFEA 3AMKA 2XG5A 5DGQA 4JPWL 4FA8A 3QIWD 5D1XD 5FAAA 3UZQA 3MRFA 2ED7A 4YHYB 4NN5C 3VE0A 1A14H 3ZDXE 5C0EA 5CMAA 1A4JB 4PRDB 4U1JA 3KYAA 3NCMA 4KTEL 5DQ9B 3WN5A 3S8WA 4JDTL 1XR9A 5TE4L 5CEYB 2P8LA 3MROB 4P2OC 2BJMH 5JPMA 1JZ7A 2J8UB 1J8HA 4ZODA 2Z8SA 4KTDL 5ANMA 5DQDL 5LGJB 5C0RH 2W0FA 5IBUG 1D5MB 3VXMB 1U8OA 3C6SB 3V5KA 4XB8A 3KHQA 4XC1H 4Z6AT 3QIUB 2JB6A 5HHOB 4U7KA 5I1CL 3MTRA 3G5ZA 4QT5B 5EU7C 5B3JF 2BOBB 2YSSA 1QOKA 4IRJA 4KXZH 4BFIA 4AENA 1FNGA 4KMTH 5BOPA 2D7NA 2BVQA 1VSCA 5A16A 1UKSA 1TZHB 2D7MA 5F9WC 1U8JB 4I0PA 5TH2A 4AMKH 1CVSC 4K9EL 4NNYB 3P11L 4XZUB 3OXRA 1J8KA 1TETH 4N0UB 5IB4A 2P8PA 3SGDI 1KACB 1NLBL 4D9LH 3UTTA 5EIQA 2J6EL 2VDLL 3PDGA 5BZWA 1EO7A 2APBA 1GPOL 2BNUA 1Q9OB 4HKXB 3L5WB 1F4HA 4U1HA 2V2TA 4WUUA 1KIQB 5LQBH 2EC9T 3CVHH 4YHPA 3L7EB 3U0TB 4OD2A 4XNQA 1R5IA 3MRPB 4JRYD 1R3JA 3LS5L 4LLYB 2W65A 4PR5A 3S34H 3O3UN 4CUCA 2O61A 2YMXH 3UO1H 1C08B 1EAJA 2X89D 5HGDB 2X1PA 4FQ1H 4QCIB 3GSNA 1U3HB 1S7RB 3PL6C 1FL6A 3T4AB 1VFOA 2WANA 4PJAF 3WNMA 4PYHA 4ODWB 5C0DB 1KJ2L 3LEVH 1RVFL 5C9KA 2DDQL 2WWMC 4FQLH 5DO2C 2N7BA 3BPLB 5C2BH 4MDIB 3AGVA 4DKEL 1ZWIA 1YUHB 2QQQA 1JNNL 1O0VA 2CMRL 5EA0H 3O4LA 4JGUA 3VD3A 4PY8I 4WWID 3RAJH 3FT3B 5I8OL 2R15A 5HGHA 3I75A 4K07A 4OZ4A 4DZBB 5F93C 3UYRL 2P45B 2ZSVB 1R5WA 1YECH 4ZOBA 3BDYL 4CU6A 3O6KH 5ISZE 3KDMB 4OLUH 1XGUB 4U1SB 4YFLI 3LH2L 4X6DA 4N5EC 3GK8L 1KJ3H 1MFAL 4K7PH 4JHBA 3BP4A 4FTVE 2IGFH 2GJZA 2P24B 5D1QA 4LVHC 4LIQE 3IDNB 3BPNB 5DEZA 5K9KA 4M5ZH 3VXNA 3GHBL 1D9KA 1ZLUK 4Y4KA 3TA3D 1MCRA 5TPWH 4JRXB 4X6CF 1BEYL 4B50A 4Q2ZB 4OCNC 1HYSC 2VL4A 1BQLH 3ZKMC 2QQKH 1KGCE 1GGIH 1F3RB 5KJRH 3MXVH 4N0CC 1X4YA 1IGIH 2IFGA 2WP3T 2B7DT 3OKMA 4CW1B 4WGWB 5KVMC 1TVHA 3C08L 4KRNA 1XF2A 3REWB 3FT2B 4Y4HB 1BZ7A 4H26B 1SM3L 3GDBA 3LKQB 4WO4D 3TBWB 1EA9C 2XV6B 4QHNB 2J6EA 4XGZB 1T2XA 5D7IE 2ERJC 3IJYA 5C9JB 3VCLA 1OP3H 4JPKH 5E24E 2ARJA 5FYLE 2PW1B 5GZNC 1CG9B 1RZJL 5KAQF 1LDPL 3VRJA 1NCAH 4FMKA 2VXSH 2EDWA 5DZNA 4YBLC 2MSPA 1FYHB 2YUZA 2DQFB 3UP1A 3REVB 2LU4A 4LCCB 1KJ2A 4G9FE 4DWHA 4LSTL 2DQDL 4X4YB 5E6IB 3MLYL 4OCXH 1VPOL 3QXVA 4YHKH 3WS6A 5JQ6L 2RFXA 4NQDD 1WFNA 1G7MB 5J3HD 3M8OL 2ARJQ 4DW2L 1EEYB 4L5FH 3C2AL 4HIEA 4PJ8C 3O6MH 5ALCH 2GQHA 3W82A 1PQZA 4V1DA 5JXED 4J4PA 4NQEA 4PS4L 3DVIA 3OR6B 4ORGA 4K3EL 4E5XB 1BBDH 3PP3H 4DQOH 1BIHA 4DOHE 4N90D 2FX7H 2NW3B 5BZDA 5D7LD 3MRBB 2XXMB 5E1AA 1PKQB 1AKJB 5IKCB 4P4KA 4OCWH 2BNQE 6FABH 4KDTA 5A3IC 2IAMA 3QUMH 5IW1A 1HHIA 3AY4C 4P2RA 5A43C 3QUYA 4FNLH 1OAYL 1IL1B 5F7YC 2DI9A 3QI9C 4FQXB 2YEZA 2J4WL 5D2NA 5I1JL 3IT8D 3S88L 1QACA 3ES6B 5DRXB 4R4NC 5F7WC 3RA7L 4H88L 1HI6B 1WTGT 4JO3H 4RAHA 1N2RB 1SYSA 2HJLB 3KXFD 4P49A 2YBRB 4NZTL 4C4KT 3FQNA 3BEWB 5IG7B 4XP1L 3QHFL 4PJDA 4JHZA 5ISZD 2AV7A 1XF3A 2OSLA 5LXGL 1VFUA 5E00B 1M7XA 4GAGL 2PYEE 1IGTA 3B9KC 1JJUA 3UTZA 4N8VG 3L1OL 1A8JH 1LO3H 1AIFA 1I9JL 5DHYA 3O6FB 3FO1A 5E9DD 3IFOB 3G6JA 4E42A 4HUWB 2WV3A 3BQUD 4BKLA 1UC6A 1WWBX 2Y5EA 3ARFD 2VITA 5C08A 4D0DA 2YUVA 1NC2B 2J12B 2HFGH 1U3ZA 4ZO7A 4MMXC 2O5XL 1MCQA 3GJFB 5ETUB 3BKJL 4MNGA 2X4QB 3MV8A 3MXWH 1NC4B 1OTSC 3RDTA 3T0WA 4ZSOA 4LNVA 3EYUL 2ZUQB 3VDAA 5IMLB 3QULA 3GMQB 2HFTA 2O5YH 5DRZB 1F45A 1KCUH 1P4LA 1NSNL 2H32B 2WBJA 4Y1AE 2X4PA 1NBYA 5HDLA 3SKOA 4TULL 4BZ2H 1QZ1A 2GK0A 3I6GA 3VA6A 1YY9C 3LKSA 5C0CB 1U8KB 4MAYD 3PP3K 2A74A 4OLWH 3AREB 3QCUL 3MYZA 5IEHA 5D1ZA 4FP8H 3UJJL 1OAKH 4XCCL 3GSUA 4JZNA 5JW4R 1CLOH 3LEYH 3W0WA 4LSRH 1NJ9B 2X2YA 3SCMB 3MRMB 1U8IB 5JORB 1NCCL 4P2OA 4JY6A 5GS2D 4EI6A 4W6WB 1NUGA 3GSVB 3SDDB 3VXME 3TO4D 1V7NL 1F6AA 2Y7QB 4G9FD 5C09D 5JW4M 5I6XC 3OKOA 4JJ5A 4LLDB 5HHOE 3AU1A 4M3KB 4I77H 3S4SB 2DJUA 5F6HI 1L0QA 3O2VH 4L9LA 4ODXB 3I3BA 2Z31A 2AS5M 3GMMA 4NHCL 4TUKH 5DFWH 1ZEAL 4I5BA 2HLAB 1MHEA 3QUXC 4GKSA 3QHZL 2R4RH 3NA9L 1RQ5A 3IDMA 1CDYA 3T77B 4KROD 5HHQB 2UVEA 1ONQA 3PWLA 3HPJA 1QRNA 4Z7WA 3MLUL 43C9A 5KVFH 1CE1H 3GJFH 3MV7D 5T5FH 1V7MH 3PDDA 4LPVA 2EDRA 1MCPL 3EOAA 4WGVB 1IBGH 3IJHB 3PWJA 3V8OA 3FB5A 3VWJD 4NHUB 5I75B 3LEXA 3LRSA 5C1MB 1VB9A 4ERSL 4DGYL 1NFDA 4LCYA 1D5BB 3LMJL 4QRSA 1T22A 4KAQL 4Y5XC 4O5LL 1ES0B 5CJOH 2BHUA 1B0WA 2Z4QA 2FATH 2UV3A 3FB6A 4OD3H 3KYKL 4KK6D 3QEGL 5DYOA 4IOIA 1ROWA 2DQJL 2OJEB 1KLGA 1JIBA 5DMKB 1N64L 5GGSB 4Y16B 1QBML 1IC4L 1OWRM 3PL6A 2LE9A 3FOMB 2FB4L 4G7YH 4M62L 4CL7A 2AJ3A 2BNRB 1ZVYA 4QGYA 1LEGA 3LN5A 5JLZA 2VXTH 2YPKB 4K94L 4F2MB 1MH5A 1NGQH 2QHRL 3SY0A 3GIZL 2Q7YB 2BRQA 5I1GH 1LEIB 2I60L 1I3GH 4IIQC 2FR4B 3LRHA 1TVDA 4LMQE 4HIIB 4M6ML 4QXUH 1E4WL 1T1WA 3TCLA 1JGDB 2A73B 1MY7A 1XEDA 4O02H 5MENA 3OR7B 1L0YA 2ICWB 1LP9A 1A2YB 2I5YL 4TTDC 3VFUB 2UUDH 4DN4L 5E6YA 2CK0H 1Z0NA 3MRNB 4WWKA 4L8CA 2JJWA 2DQUH 3CFEA 3JV6A 5TE6L 2MFNA 1A6TB 2ZJSL 4UB0H 4D0BA 4Y1AD 4Q6IB 4OKDA 3LS4L 2F5BH 4KPHH 4G42A 1AO7B 2UYLA 2A0LD 1DBBH 2H1PL 5EZOH 5FYKL 2NY0B 2Z35A 2HTKD 3GJFK 1WFUA 4GXUN 4JFFE 4JQIL 4M00A 3WCYA 2X7LA 4P46B 3DHJA 4U3XA 4S2SA 1JF6A 5I73C 4M6NL 4UIMB 3HLAB 3N1MC 3CXHK 3FQTB 5DA0B 4PJFB 2NXZB 3V52H 5FUCC 3BHBA 1GZQB 4XP4L 2R2EA 4XNUL 4S1SL 3KLSA 2VLRA 4PJEA 3KPMA 1IAOA 2AJVL 4RZCA 4YR6A 1BIIA 4LEOA 4MWFA 3PXJA 3TNMB 1JYVA 5IFJB 2CKNA 1S5IL 3MNVA 1AY1L 3WKML 2CDFA 4NRXB 2OZ4A 3RZCD 4M6OH 5IM7B 1MCLA 4YXKL 4GQ9H 3HNVL 4MJ2A 3RX7A 1K85A 4UAOC 1Z9SA 3U7WL 5CGMA 2FIKB 3K2UH 4PRIB 4HWNA 3WIFB 5EO1A 2YHGA 4NQCB 4XP6L 1NDMA 4FFZL 1CGVA 1NCTA 2RBLA 4QRUB 4ZO8A 1QPPA 1C5CL 2VDRL 3CFIC 4JANB 3S5LG 1BM3L 2YPVH 2AEQH 4GW5B 3IAPA 3BGAA 4KKLD 1CK0L 4JHWL 4FN0A 2AABH 5IMOA 1DEEA 5AUMB 1U93A 3FAWA 1PFCA 1I8LA 3TNNA 4RFEA 4D94A 1CFVH 5JQHC 3BP5B 5IVXF 3JBG7 1RI8A 3NGBB 5ICYA 3CPLA 4PJ8A 4W6YB 2E27H 4GG8A 2UUDK 1FYTA 4HCRH 4PGBA 5C07A 1FG9C 4RGNC 2C1OB 3HZMB 2FGZA 4X98A 1GGUA 2MTPA 4ONFL 5HBBA 1CU4L 5DR5H 5AG9A 1XAUA 5ACZB 4JR9H 5DUBB 4KHTL 1A7PL 1YYLH 5H94A 5GRUL 5CBAB 1KCVH 3MV9A 3NFPB 2VLJB 1MFBH 1RJLB 3AY4A 4PUBH 2Q20A 4BSJA 2JCCF 5KSBB 4IRSC 4JO1L 4OZHA 3RTQC 2Q76A 3BGMA 3UPCA 1A9EA 3EYSL 1ZANH 2LTQB 2AP2A 4JDZB 1PVHA 4M7JL 2HP4A 1TQCC 3D69B 1NLDH 4EI5C 4D9RE 2MWCA 1QLRA 4Z78A 2GAZA 5HPMA 3I3DA 2DYPD 3FTGB 5GPRA 1NGZB 4WW2A 2GTWA 1QSFB 3LB6D 5T3XE 4J3SA 1OTTD 2VTFA 1H5BC 5HGAA 2R0ZL 4RDQF 2VZOA 2GCYA 1FZOA 2ZUYA 3B9KA 3VRIA 1U95A 2W60B 3TM6A 3U48A 5HTSA 3GBMH 3IU4H 1T1ZA 5DJ2B 1HIML 2E9BA 2F5AH 4XCEB 4YHIB 3HE7B 4U7MA 5EOCH 5TJWK 1A64A 25C8L 3U4EB 4NKIL 5JUEH 2AJZA 1KLUB 1XGQB 4PGZA 5DEFB 2GK2A 1JPST 1FP5A 5FOBA 4JFFD 1BF8A 1WC7B 3K1KC 4E41A 4OZGB 4XC3L 5EC2A 4QKXB 4A2LA 1FFQA 5B3NA 4GLRI 3E3QC 5HI4D 5JXAH 4QNPF 5E7FA 1DQLH 1CFTA 4Q9CA 1JWMA 1NAMB 1X5HA 4HIHA 3ZL4H 1KB5B 1F58L 1Q0YL 1SVZA 4LKXA 1F02I 3MLRL 2RB8A 5HYFA 1N0XH 3OKDA 3SGKA 2A9NH 1N59A 1Q1JL 3TN0A 2B1HH 2MMXA 3MFGB 1PJ9A 5MERB 1BFOA 1E28A 4XPFL 5EN2B 1CGSH 1HOCB 1IAMA 2ZSWB 3N1FC 3PQYD 4LFHG 1SJEB 1EHAA 1MCOH 4I3RL 2VIRB 4JN2A 5MEPB 4ZXBA 2OTPA 4L8BA 4LCIH 4KZDL 1N7MH 1A6VH 3ARQA 3ARBB 1K8DB 4HXAH 4U6HA 2J5LC 5ECJE 3B8YA 4R96A 3HAEH 3MCLH 2VKWA 1MWAL 1U8QB 4WDIB 1WAAF 2HT4D 4KQ3H 3F12B 4EOWL 1A02N 3ZYIA 1VEPA 4LFHD 5FK9A 3R1GL 1Q9LA 3SDXE 3QUXA 1MNUH 3IVKB 2UWEA 1LO5A 3MUHL 2PKDA 3S36X 1DVFC 3CDFA 3TJHD 3TO2B 1OQOA 4PJHA 3NFSH 4FZ8L 5C0IB 1TVBA 2VOTA 5T1LD 1T1XB 1HQ4B 5J8OA 1FVEB 1MCBA 1MHPH 2AEIT 1I1AB 4Y5YA 3TCXA 4RMWA 2XKNB 3BW9B 4JREB 4Z5RB 5C8JB 4BH8B 1NAKH 2LV4A 2HMIC 1NAMH 3G6AA 4MJ6B 2BVOB 4JO2L 4Y5XA 1KB5H 35C8L 3CFJA 5F1IB 4U6VL 3W9EA 1P84K 5FB8B 2D0FA 4HUVB 5IR1B 4D9RD 2CIIB 4Y8DC 3T04D 4PY7B 1DCLA 2G9HA 2RHEA 3EYVA 1XMWA 5ITBL 3TF7C 1CD0A 3WHE1 5T3XD 1YQVL 4M43H 3AC0A 1CICB 3MOBH 1IM9B 4XH2B 4NNXA 3DETD 4FXKA 1SJXA 2YKLH 1RZFL 5GS0C 4LDLB 3ULVC 4GG6B 5EWIL 1J0ZA 1I1CA 4D3CH 4XBPA 5EBMB 3MLXH 1AHWB 2D7OA 1S8DA 1UVQB 1DUZA 2V5MA 1VDGA 3VGDA 3X3GL 3QNYB 2VZVA 2Y36L 1F00I 3CCHA 3ARYA 1AXTL 4JO4H 5IIEA 4UV7H 3RWEA 2GJJA 3QHTC 1Q0XH 4ODTL 1JTTA 4JY4B 4YX2H 4LHUG 4OQTH 3BT2H 4LPXA 3N9GH 1AGFA 5IW6A 3DTXB 5LBSL 5CWSB 3CXDL 1MWAA 3V0WH 4LU5H 4TSAL 4L4VA 5BQ7B 2YN5A 3SJVD 4OZIE 3DO7A 1AO7E 3VXQB 1HZHH 4Y4FB 3RVXC 1DLFH 4G80B 1XGPB 2V2WA 5LAXB 3FOLB 1JK8B 4ZPTB 5KOVC 4GRLB 2CO6B 1RIHL 3VFTA 5I18L 2X9YA 1PKOA 4LHUD 4XX1E 3W81A 1JNLH 5CIPA 4YHNA 2BC4A 3EDKA 4PV8A 1QRKA 4NBXB 1A6WH 3LKRA 4WHDA 5TDOA 4NQUA 4NYLA 4PJCF 2R1YA 2C7UA 5DJDB 2AJYH 2ITDA 3WFEH 1SY6H 3OJMB 4QRTA 1IAIH 3KPTA 1W8NA 1OY3B 1YEKH 4ENEC 1AGDB 1AH1A 1TITA 4H25B 3C8HA 1S9XA 3C09B 1N5AA 2Y25A 3T2OA 3RVWD 4XCYA 5F7EL 5D2LA 5A2JH 2PTUA 3FT4A 3D0LB 3QIWC 4C56E 5D1XC 1OAZL 5SWZE 5D5MB 4NQCE 3VXSA 4W4NA 3GEWB 2C1PB 3O9WB 4OUUA 3U9UB 4J1UA 2Q86A 3DIFA 4YIQA 5EFIB 5DRWB 3V6ZB 5K9OA 3AXLB 1DSFL 3H9SD 3PWPA 3ZDZF 3KJ4C 3QQ3A 2BVPB 2NLJA 1RURL 4APQB 4QYOB 2XN9A 3ECBB 3T4YA 4WI2A 4MJIB 1R3IH 4OCYL 2DQEL 4P99A 1OGAD 1YEFH 2OM5A 4XPGH 4R7NB 4UT9H 4L8DA 3G9AB 3I02A 1SBBA 1OT2A 3TV3H 2XZQL 2EDJA 4H1LA 5C0AD 2IFFH 5FUOH 3WNKA 5F9DC 1D5IH 4HQQL 4ETQA 3RGVB 1GVIA 3L9RB 1MJJA 4FFYL 4UOW1 1KTDA 1J0KA 1Q94A 2PO6D 5DJAB 1P7KA 3BXNA 2BHYA 4CGTA 3IETA 1FH5L 1WZ1H 2X5PA 5HVHB 3MRFB 4OF0A 4NWTL 5J57B 4HWZA 2DD8H 4IRSA 3STLB 1HNFA 1X5AA 3VE0B 4MA8H 3RTQA 5IK3B 3WN5B 4FFVD 4U2ZA 5JOFA 1DZBA 4EI5A 5JPMB 1JTOA 2R0WH 9CGTA 2V6HA 5I30L 1QSFE 2W0FB 3P4MB 1E6JH 2AXJA 4UINH 1CGYA 1WF5A 1U8OB 3V5KB 3W39A 4NO0A 3RJQB 4NCC1 4BQ8A 4IM8A 1TJGL 1UA6L 1HHJB 3TP4A 1W0VB 4QOKB 4NFDA 2YSSB 1K4DB 4PLJD 4P3DB 1AGEA 1F8TL 4BFIB 4AENB 1FNGB 5DWUH 1MRCH 4KJYB 1OARH 1FFPA 3BUYA 3U2SA 5A16B 4KKCD 1KB9K 3NH7L 4O9HL 2JE8A 4HIXL 5EUOE 4I0PB 4EN3D 1K6QH 4X4ME 5BVPL 4M03A 1KOAA 1A1MA 1D6EA 3D0VB 4R3SB 2W9DL 5I71B 5D70H 5E5UB 3A6OA 1F4WL 3OXRB 5IB4B 4KTYA 3V9FA 1DQQB 1WZLA 5T1DH 2P8PB 4F8TA 4UTAH 1A9BB 3ORJA 2ZUVA 3H3KA 4MJ5A 4ZAKD 4RIRA 5BZWB 1P4IL 2BNUB 2B5IB 5BCAA 1KG0A 2ZCKH 1GOGA 4U1HB 4O2EB 4XVTL 1OSPH 4WUUB 4F7PA 3KWWB 4YHPB 3HG1E 1FZKA 1XH3A 2HRPL 2VL5A 2X1QA 4NO2A 4OD2B 1R5IB 1UH3A 3ARDA 5GS0L 4GSDH 4PR5B 1Y0LA 2CO7B 5GGVH 2Z92B 1BVKA 4NUJA 3MRHB 3M17A 3U36A 3T2QA 3TA3C 5EOQL 4R9HA 4TN9A 1D3CA 3LSOA 1DBAH 2F54A 4F57L 4JKPH 1Q8MA 4I18B 1FL6B 4Q9RL 4K3HA 4C56D 3DMMA 3VFPA 2YD3A 4L8SA 5SWZD 3SE8L 1EK3A 3CVIH 3GB7B 1H3UA 3V6FA 4Q74A 2KQMA 4R4FL 2M1KA 1ZWIB 2SEBA 1HCFX 1N4XH 1S7SB 4CVUA 2OP4L 3O4LB 4WO4C 1FLTX 1CXIA 3HS0A 2HRLA 5KZCD 3VMPA 4HWUA 3VJ6A 4JM2A 5DFVD 1FNFA 4BK4A 2FHCA 4OZ4B 1N6QH 2B4CH 4QRQA 1S9WA 3BD3A 3BUTA 3F7RA 2E6QA 1A7NL 3FRUB 4X6DB 2BZDA 2R8SL 2QADD 3BP4B 4PJXA 5IESL 1DLHB 5ADPH 1TZGL 2FBOJ 2GJZB 3LPFA 4MLIA 1ZHNB 5D1QB 1VFBB 3CUPA 3HUJF 1IAKA 2WZPD 4X6FA 5K9KB 3VXNB 1BAFL 1D9KB 2B2XH 3OXSA 3QDMA 4Y4KB 2XOTA 2V9QA 1U3JA 5KOMC 2ED9A 1AGBA 4OCLC 2VH5H 2VE6A 5CGYD 1DUYB 2YOCA 4OZFA 1S5HA 1I1RA 2OTUB 4JN1H 1YMHB 2AI0L 1ZT7A 3UX9B 3MRRA 4HX1B 5IHUL 2FEDD 4NCC2 4HZLA 3OKMB 2A6JB 4HIJA 1ZT1A 4HUNB 4X6BA 5ILTL 3VG9B 1G7JA 4ETYA 1MI5B 3CMOL 5E8EA 5L0QC 3QIBB 1GIGH 5EORH 5J1TC 4LF3B 1EGJL 4I3GA 4NFBA 4HDIA 3K8MA 1RV6X 3HE6D 4HGKC 4X5XA 2E7LC 3G5YA 4Z76A 4G8GA 1J7VR 1Q72H 4RISL 3O8XB 4OIIH 1J05A 1EEZA 1NGYB 1IGML 5L2KA 3IJYB 8FABA 4XPTH 4KQ4L 1Z3GL 1NFIB 5K9QG 3MBEB 3ZDXF 4GG6E 4TVPD 3SGEI 4PGJA 1C8PA 3UDWC 1UWEH 1QSED 2ARJB 1A1OA 4KVNH 3EAKA 3VRJB 2WNGA 4P9HC 5JIPA 4KTEH 2OL3L 2FZ3A 1E4XL 3HTLX 4YJZL 2X70B 5M95B 2FGWL 5TE4H 1KJ2B 1P53A 1BQHB 5KTEH 4EEEA 3DV4B 2AJXL 2APFA 5ADOL 3IRPX 3BIAX 3VFVA 2RFXB 2XT1B 4GMSH 4CVXA 5E94A 5DT1H 5AZEH 2XY2A 2VXQL 4MD5B 3GFUA 4NWUL 3T09A 1DN2A 3MNWB 3HG1D 2ZCLH 4HKZA 4PD4J 2HVJA 3B2UD 1NEUA 4V1DB 1B4JH 4QRRE 2E7CA 2EYTA 4YHLH 4WUKH 3G04A 1XGRA 2DMCA 1J5OH 3EFFA 4EUPA 5BZDB 4AEHH 1Q9KB 2HYMA 4GKOA 4P4KB 5IMKB 2PETA 3BQUC 1C7SA 1LO4H 3OKYA 1T0MA 1FIGL 3ARFC 5IW1B 3P11H 5B39A 3VGAC 2X41A 4ODSL 2J8HA 4GAFB 4P2RB 5KSAA 5EBGA 4HKBA 3QUYB 1NLBH 2CLZA 4U3HA 4Z7VE 2YEZB 1GPOH 3V4PH 5I9QC 3JWDH 3GMRA 4Z7NE 1P7QA 2XY1A 4X8XA 1CL7L 5IHLB 1UQSB 2ADIA 4KKAD 1MELA 1CR9H 1JPFA 1SYSB 5FO9B 1O5DT 3EGSA 3FQNB 1OP5H 5ABDE 1JRHL 2OR9H 3K1DA 4GRMA 4XAKE 1EGJA 4ZOEA 3NPSB 3QIWA 4ZPVA 5ITFB 5D1XA 1XF3B 1HKLL 4MAYC 1QKZL 4UNTA 3GSWB 4JJHA 1ACYL 5T3ZE 4XNYH 1E6OL 2LAGB 1IGTB 3UTZB 1KUMA 4M7LT 2EZ0C 5E8DL 5DHYB 2DDQH 5D4QA 3QQ4A 1CLZH 4BKLB 2PUQT 4DKEH 2RAMA 3OAYH 2VITB 5C08B 4D0DB 4HFUL 4O4YL 1QEWB 3Q5YA 3WIHL 5IB2A 3LQZA 3TO4C 1J11A 5F7HA 4WY7L 4MNGB 2OL3A 5I15L 5JTWA 2JB5L 3MV8B 3RDTB 5I17B 4X8JA 2EDTA 3AS2A 3IXTA 1OB1A 5F70A 4C83B 3WNPA 3QULB 2VLLA 3LH2H 4LPTA 5DK0B 3GK8H 3HMWH 2X1OA 3CFKB 3NN8B 3H3PH 1YEHH 4NT6A 2NTSP 3RQ3A 2WBJB 1HEZB 4DN3L 2X4PB 1NBYB 3QXDB 1NANH 5B4MD 4KROC 3SKOB 2GK0B 4XPHH 2VABA 1AQKL 1VADA 4BQCA 1I3RA 5I1IL 1BBJA 4MNQD 3MMEA 5C7XH 4NN5B 1FNSH 2H26A 4F7TA 1AXIB 3HC0A 3UBXG 3CZFA 3VWJC 3GSUB 4JZNB 2R9HD 3UJTL 1ITBB 5D72L 4UQ2A 4K7PY 5KVDH 5I76B 2Q3AA 2DKMA 3T8XA 5B8CA 4I48B 3CH1B 3QH3B 4P2OB 1J8HE 4BSWB 3CFBA 1MJ7H 4EI6B 5ANME 5GGRA 5D7IF 1SM3H 3MGAA 4JRYA 3QJFA 2EYRA 3PIQA 3HNSH 1F6AB 4CADB 3TBSA 3BZFA 4P57B 1HDMA 1BD2B 3OKOB 4KK6C 4XAWL 2X89A 4NZUH 3GI9H 4HV8A 4YXLL 3FJTA 3FO0H 5HGBA 1OP5K 2EEBA 2WUBH 3O6LL 3UTSB 3HPLA 3RNKA 1J10A 1LO2L 3ULUE 2D4FA 3HR5A 4YNYA 4O51A 1OLZA 5F9WB 3IDMB 1V05A 4FQIH 4QRRD 1ONQB 5IB1A 5KANI 1LDPH 1GAFL 3CX5J 2GITA 3C5JA 3HPJB 1YJDC 1WZKA 3V4VL 4HKJB 5TE7H 1IGCL 3EOAB 1RZKC 3UTTE 3PWJB 5HI5D 2NXYD 4G9DA 4X6CB 3OAYK 3QDHA 2VDML 4F7MB 1YPZF 4ZNEA 4NFCA 4OTXL 3ESVF 2X4TB 4HPOH 4WUUE 1P5VA 5J7CC 1NFDB 4LBEA 1T22B 1WBYA 3WJLC 4K3GA 3WIHA 3OAZH 2Z4QB 4FQJH 3QCTL 4Y88A 4RWYH 5DYOB 4IOIB 5HDOA 4TOYL 2C4FU 2NY1D 3MBXL 4PS4H 1B2WH 5H35B 3EYQD 3MUGA 1WFOA 1DBMH 5DJ8A 1U36A 2B1AH 3PL6B 4Y2OA 2GSIB 2A0LC 5ELIA 5MP6L 4BK5A 5DJXA 4LSQH 2AJ3B 1NCDH 2NX5E 3MA7B 5T3ZD 1EERB 1T2QL 3F7YB 3LN5B 1KJMB 2VWEE 4Z0BH 1MH5B 5SX4H 3OV6A 3SY0B 3IXAA 1NGWA 2IBZY 4O00A 5HYQB 1XGTB 3O4LE 2BVYA 1G7IA 1G9NC 4WO4A 1ZOXA 3P0YL 4M8QA 3KHOA 5HJ3A 1T1WB 2YN3A 2FIRT 5E99H 3QUZC 5K59E 1E27A 1LP9B 1LE9B 4X6DE 5IWLA 4WFHE 4MVBD 3T0EA 3RWFB 4YFDB 3RZCC 4BQBA 3BH9A 4LVHB 1INDL 4EVNA 4KRPD 3CFEB 3JV6B 5FECA 3RU8L 2J88H 3S36L 4LK4A 2V17L 1CL7I 4G42B 4PRPD 3INUH 1YNLH 3QAZC 3ME0A 1JMXA 4U3CA 1UJ3A 1FO0L 1AR2A 3TT1H 1CDIA 3P2TA 1JRHI 3V79C 1T0PB 5IJVB 4PJIF 5HHME 2X7LB 3AS0A 1DN0A 1A7RH 4S2SB 1ZGLP 1KCKA 4FQ2H 4NQDA 5F71A 5K93A 1QPXA 1PLGL 1RFDH 4XWGH 1J8HD 4YQXL 5BOZG 4S1QL 4AM0A 2C5DC 2E7LA 3PV6B 5KVGH 3GUTA 2D0GA 3IDYC 5JXEA 3OAZK 3KPMB 4YWGH 3I2CL 5LJYH 4RZCB 2EDYA 2D03L 4YR6B 2ERJB 4LEOB 1FCCA 4MWFB 3TWCH 5D7LA 3U82B 4QXGL 1A6ZB 3L5IA 1ETZA 3UDWA 4JDVA 2FRGP 3WHXB 2X4NA 3DI2B 4KY1H 4CN6A 4TSCH 3X17A 5DD6B 4Y19B 1F2QA 4YBLB 4LLUB 5GGTH 3C8DA 2D31B 1UCBL 5DMIL 4V2CB 4XMKL 1PYWA 1P1ZA 3EOTL 1ED3B 3KXFA 3UTTD 4ZTPL 3L3KA 1DEEB 5IMOB 1DBKH 2YD9A 3TNNB 1BVZA 3P4OA 2EH7H 4RFEB 3GJEB 3DI3B 3L95A 4EBQH 3GSOA 1OTTC 3VDCA 1QBLL 2V7HA 1YEGH 1HHHA 4OBSA 3CFCH 4PJ8B 4GG8B 4V1DE 3HC3L 4NQEE 3DPBA 1JGEA 3CDYA 2R2HB 4ODUA 2DWDA 5C07B 4MAUH 4NJ9H 4X7TA 1UZ8A 2NNAB 4X98B 4LLMA 5E9DA 3F7QA 5C6TL 1G7PA 1W0WA 2XZCL 2VDKL 3BQUA 3EHBD 3MLUH 3LN9A 1JMZA 2HJFA 1EBAA 4Q9BA 3ARFA 1F4XH 2OQJA 4P2RE 3TFKD 1JF5A 2YA2A 1RHHB 4K3DL 1MCWW 2NX5D 1R3HB 4P48A 5IF0A 4YAQA 5FYKU 3QI9B 5D2NE 5HVWA 1RIUH 2Q76B 3BGMB 4D9QE 1FO0A 4ZS7L 1A9EB 1T7XA 3NACH 5J6HB 3QEHA 3EYOA 5HI4C 4KAQH 2NCMA 1IZKA 4Z78B 1P4BL 2XYCA 3BMVA 5CSGA 1GRWA 4PJDE 3LN4A 3EO9L 2NY5L 2GTWB 2WUCH 1C12A 3HRZA 4MAYA 2XG4A 5HGAB 1YJDL 1N64H 4K71C 1MHCA 5ESAA 3QXAA 5ESVA 4GKNA 2DL2A 2A6IA 2GCYB 2YPLB 1FZOB 4PJ9C 3B9KB 1JNHA 3VRIB 1U95B 5F3BA 5T1KA 4J3VA 2XRAL 4WENB 1T66D 3MLWL 3ZE2E 4CKVX 1T1ZB 1JFQL 3HZVB 3G6JE 1C5BL 2DJSA 3GRWL 1HN1A 15C8H 1BJ8A 2QHRH 3KPOA 3P0VL 5C08E 1I1YA 1LD9B 2G60L 3L3IA 3K8LA 4Y5VA 3EOYG 3TO4A 1UM6H 4MNGE 1G0DA 2FO4A 5C09A 1M05A 4J6RL 3TH3T 5FOBB 3MV8E 1DBJL 3DX8B 3TT3L 4ZSOE 1W72H 4F80A 2R2BA 2HT4C 4K8RD 1UACL 4E41B 2R23A 5EC2B 4QHLA 1PAMA 1FFNA 4X7SL 2K7PA 5IGXH 3X13A 4RAUB 4Q0XH 1ZHKB 4BZYA 4G3YL 2ZWLT 3RHWF 3TJHC 3S97C 4YHZL 4OFPA 4LKXB 1KFAH 3SKNA 5JHLH 1XFPA 1BFSA 1I4FA 2DKUA 3MV7A 1N59B 3LS4H 3V5HA 1KT2B 4IRZL 3MX0A 2D0HA 5F97E 1BFOB 1E28B 5GS1C 1HXYB 1BMGA 3VWJA 3W0WE 4YHOH 5IFHL 3PGFL 1NGPL 4JN2B 4HF5H 2VXUL 4JHAL 4ZUSA 4JFEE 1RAMA 3QG7H 4LSUL 4A6YB 3PDOB 4G6FB 5T33H 1CD8A 2HJKA 4R96B 5I6XB 2ICCA 4XP4H 1TPXC 1GHFH 2I9TA 4LPUA 2AJVH 3O3DB 3R4DA 5EU7E 1WV7T 1I9IH 2GJ6D 1Q9LB 2XZZA 5GRVL 5J9PA 3QUXB 2ZG1A 1W8OA 2P48B 3DETC 3HNVH 4YLQT 3VGHA 1BGXL 2QTEA 3K2MC 4Z7WE 1QRNE 1O7SA 1XZ0A 4GRWE 1TVBB 5C0FB 4CVWA 1U8LA 3UPRA 4M7ZC 1RZIB 2EDKA 1U91B 3C5ZD 3HI5H 1F3JA 1PG7L 2AJUH 1BM3H 3LIZH 4NBZB 4LPYA 1A3LH 2C3GA 4JKLA 1MSPA 1NFDE 3GRWA 4RNRA 3LCYA 4X7DC 1ACZA 4KWUA 5FA4B 3G6AB 3WFDH 1JHKL 1NMBH 4Y5XB 3WO3B 1YY8A 4U1MA 1KPRB 4D9QD 4OGXL 1A3RH 2Z9TA 4DK6A 5JDSA 5F6IC 3JVGC 5E5MB 1IC5L 1PX4A 3O0RL 1EHLL 2AEPH 1HQRA 3OHXA 1EV2E 2G9HB 4HK0A 3EZJB 1FZJA 4ONFH 1CU4H 4XMLL 1X5ZA 3O41A 4KHTH 5EU3A 4HH9A 4NNXB 1IC1A 1T89A 4XVSL 3BMWA 3U4BH 1UWXH 5GRYA 4A6YH 4QRPA 1OAUL 4ZUUA 4IIQB 4P4RB 1S8DB 2ZUSA 2QJDA 3CC5A 3TZVD 3DHMA 5MENE 1HWHB 4R4BA 4XBEL 4M7JH 4Z7UB 3CCHB 2ZNWA 1MPAL 4QXWA 5IIEB 1FE8L 3KPNA 4KK5D 4PRAA 3RWEB 4WV1A 3KVQA 3ZHLA 1MLCB 3SQBA 1NCNA 2VDNL 3GI8L 1MCIA 1QR1B 3RZCA 3RVWC 3VD4A 3QCVL 4R97C 4HC1H 1AGFB 3FZUD 5IW6B 3A6BH 1MWAB 2R4SL 3GGWA 4L4VB 4DCQA 3A6CL 4JKMA 2CR6A 4NQSA 3DO7B 3PABA 4G6KH 4MX7B 5DTFA 1HINH 1CBVH 3PP4H 3KPSD 3SO3C 3FO9B 2V5YA 3HMXH 4FZEL 5D1ZD 1YEEH 4NKIH 1MCHA 3VFTB 5CEXB 1EXUA 4ZYKB 4MCZA 3SE3C 5CSBA 4G5ZH 4KHXL 5I73B 4OCSL 2P5ED 3W0WD 1HYRC 4UILL 5DJ0A 1HK6A 4AY0A 2DM2A 4P5TD 2EDBA 5CIPB 4YHNB 2BC4B 4OFVA 3MJ6A 4JFED 4NKDB 5TDOB 4PV9A 3UTQA 4GAYB 5IW3A 4XC3H 1D5XB 3WFHA 2VLRE 2R1YB 2C7UB 4PJEE 2ITDB 2JCCB 4M93C 4MGXA 4RFNC 1N5YL 1RUKL 4PPTA 1OGTA 1N6UA 3S5LA 2DJ4A 1F58H 5FM4A 4U1KA 3VH8G 3IFLL 2PO6C 1VEOA 3O4OC 5GISH 4XCYB 1RUQH 5SWQA 2PXYA 4ZUWA 4PBXA 3FMGH 4UAOB 4WEMB 3V0VB 1AFVH 4RFOL 1N6VA 3ZDYF 3M1BB 3VXSB 4U6XA 4XPFH 2ATKA 1HXMA 3GHEL 1FFOB 4J1UB 5E70A 3DIFB 4YIQB 1QRND 5K9OB 4FFVC 3PWPB 3SDAD 3E6HA 3PV7A 5CJQL 1QHOA 3CDCA 1G9EA 2IANA 1KN4L 1MQKH 1IGJA 4P23D 5JMRA 2AXFB 2DYPA 3SDXF 1IJ9A 3GKZA 5DK2B 4DVBA 3ZTJH 3QDGA 1VGEL 1VKXA 1MWAH 4AIXA 5HYJB 2QR0B 1NC2D 3GKWL 4XP9L 2EKSA 5K9JH 4K23L 1FYTE 4NDMB 1JF1A 1EIBA 3BWAB 4YPGA 4PBVC 2F53D 5C07E 5DQJA 3B9AA 4RGNB 2FJFA 3WS3A 1YZZA 4PLJC 5IQ9A 1MJJB 3CSPA 1KTDB 2BY1A 5AYUL 4NQTA 1Q94B 4YE4H 1G6RL 4KKCC 3BXNB 4Z77B 1MIEH 4YUEL 2WLZA 4F3FA 3IETB 3MV9E 4EN3C 1I7RA 5CIPH 4M48L 3OB0H 5DJ6A 1VHPA 1CGXA 5C0CD 4IRSB 4OZHE 4F7CB 5FYKE 3RTQB 5MHSD 3S4SG 2A83A 4ZAKC 2AXGB 1I7TB 5CILH 1UKTA 1MVUA 3OG6B 5IVZA 5JOFB 1TQCB 35C8H 4EI5B 5T3XL 3SDYL 5MEND 1MREH 5GGUA 4JFHE 3BWUC 3V2AR 3AMLA 1H0DB 1BECA 1XCTA 1DP0A 3KYOB 1TIUA 5L7XL 4HS6B 2LU7A 1H5BB 2OK0L 1J0HA 4F33A 3X11A 3QA3A 4XXCA 4NO0B 1QFWH 1FL3B 2ED8A 4WWKD 1VACB 2BVUA 5ITBH 1X5FA 1ADQH 5KW9H 1BZ9A 4W4OA 4TUOB 3PQYA 2EDEA 3G5VB 1CLYH 4GW4B 1AGEB 1VA9A 3IYLW 2BXYA 1L4IA 1FFPB 1ZSDA 3BUYB 1RSFA 5FYJH 4Q9QH 1MFEL 2JJSC 5BXFA 3HI6H 2E9WA 1A1MB 1D6EB 2BERA 3QO0A 4HEME 2AK4D 2XPGA 2Y36H 4NNPH 1U6AL 4E41E 1I8KA 5DFVC 2QQLL 4X6EB 3B43A 4RIRB 3P30L 4NZJA 5F72S 5F7UA 3UZVB 1KG0B 5J56B 1SMAA 3DSFL 3MGOA 4OZIF 3BJLA 5JDJA 4F7PB 2JIXA 1FZKB 1XH3B 4PTTB 2FBJL 5BV7H 3T0AA 2QV2A 4WFED 2X40A 5CZXD 5BO1L 3STZA 5CUSL 4BSVA 3QEUA 3IS0X 3M17B 3U36B 5EOTA 2CR3A 5T1LA 1T03L 1R24A 4NC0B 1MRFL 1F6LL 5CGYC 5DC4B 4UT7L 5GS1A 1VCAA 3MCKA 3S96B 3NZ8A 2DMKA 2CUIA 4F7EA 2FEDC 4GKZA 1RIHH 3UPAA 2L0DA 3OB0K 2ESVD 1JGVL 2VLKA 3LOWA 4YGAB 1G6RA 5I18H 4P9ML 4NUGH 1YYML 1LK3L 2BNRD 2FLBT 4UZGA 3V6FB 2EC9U 4UU9B 1XF5A 3RIFF 2SEBB 4O58H 1FC2D 2J5LB 2CJUH 2DWEB 2LAAA 3OB8A 1L9NA 3ARGC 4GBXD 1CF8L 2Z91A 4KK8D 3HS0B 3WV0A 2DLHA 1WUNT 1DR9A 2JJVA 2Q8AL 3FONB 4JPVL 4QHKI 3D6GA 5EU6B 5J11C 1T04A 4MSWA 4QRQB 2Q1EA 1S9WB 3TJEH 3T08A 1I75A 2G75A 2UWEE 2H2PD 4K7PX 5GGQL 4NM8L 5C0ND 3I9GL 1FYTD 3TLRA 5F7EH 4PJHE 1DVFB 3GMOA 1IAKB 1G9MH 3D2UD 2BCKA 4O2CB 4AQOA 3QDMB 3PHQA 3A67L 5FHAH 4M1GL 2MQ3A 4OZFB 1UB5A 3F58H 3MV9D 3QWRD 4IHOA 1CQYA 2AGJH 2EXYD 4RSVA 4HZLB 3DYMA 5GIRA 3DXAB 1ZT1B 3MODL 2NY0D 1A0QL 4LLVB 1G7JB 3EYFB 5L88H 1T4KA 4ZFFB 1JWUB 2HTLD 3J8F7 4HT1L 3JVGA 3JV4A 1IGFH 4OF5A 1NCWH 4HDIB 1L7IL 4GAJL 5IHZA 3SJVA 3G5YB 1G84A 3ARTA 3O2WL 1IKFL 1BLNA 1DQTA 5INDA 5KSBF 3T0XA 1J05B 4NZRL 1A4KA 4PJCB 3L3DB 1KF9B 3DECA 4YH6A 4LKCA 4MXWH 4P3CL 5IVNA 4GXUM 4NKMB 4LHUA 3QDJA 4NKOA 1AE6L 3ULSA 5DLML 5TF1L 5CD5D 3SE9L 2WW8A 2FZ3B 3GNML 1QYGL 2E8ZA 1G0XA 4N8CH 3GBNL 2CKBB 3SQOH 4OB5H 1YMMB 4KKAC 5IJKC 1CFSB 5HGGS 3LKPA 5AZ2H 3CIQA 3ETBF 4M7LL 3WDJA 4F15C 1HSBA 2IBZX 4OI9A 4QHUA 4L4VE 4XNMA 4JM4H 3BZ4A 3QFJE 1U8MA 4HKZB 3DROA 2HVJB 3MNZA 1RUMH 1JYWA 4UIKL 4CNIB 2ZOLA 2EYTB 2D9QB 1MFCL 1T21A 2B0SL 3H9SA 5E1HB 3TN0D 4EUPB 1U8PB 1FNAA 4HIXH 4LQFH 3VXPA 1M6OB 3P77A 4YHML 5BRZB 5F3HA 3SE3A 1T0MB 4XCFL 4NBYB 5HDBE 1F4WH 5B39B 2DQIL 2WIIA 4H5SA 1OGAA 4M7KL 4ZXBD 2GSGA 2PNDA 3HI1A 5FUCE 2IH3A 1FQ9C 4PLNC 1T83C 3HAEG 4MA3A 2W9LA 3HFML 2AAVA 3BKYL 3R8QA 4XVTH 5C0AA 1P7QB 4YPJA 4WEBL 4HS3A 3P4NA 1KN2H 4JFZH 3KR3L 4YDLC 5I66B 5GS0H 4RX4D 3ULVH 2P5WB 1UEYA 5KSVA 4J23A 1DFBL 3WUZA 5D2LE 5B4MC 1BFTA 4RGOH 1FNEB 4MCYA 4GRMB 4Z7QE 4ZPVB 4P5MB 2DQCH 3QIWB 5D1XB 1L0XA 3X12B 2IMNA 5IV2A 1YN7A 5IQ7L 1RZ8A 1UXWA 3OJDB 1RUAL 3SKJH 3PWPE 2CKBH 1JZ2A 4MJ4A 2R9HC 3KJ4B 5DK3A 5EZIL 4YK4C 3RY6C 3WE6A 3QQ4B 2IPKA 3C6LD 2XN9E 2MQCA 4WFFE 4R4FH 3DUHA 5GGVY 5ICXA 1HH9B 1RMFH 5IB2B 3U9PL 1V5JA 4DAGL 4PB0H 5EIIA 3I6KB 2A1WH 3UAJD 4NOBA 2J2ZA 2OL3B 4GXVL 4X99A 4AIZB 4X8JB 1J1XL 5GSRA 1X9QA 1KC5H 1OB1B 4RGNE 1M1SA 1Z9LA 3DO3A 2DL9A 5IESH 5I19H 3BYYA 2F58L 2IADA 4KVCH 3UCRA 5JW3L 5E2TH 4GMTL 1YEJL 4HS8H 2CRZA 3LZFL 3FCTA 4WU7A 2DM3A 1EVUA 43CAB 1TZIA 3VXOA 4QWWD 3U7YH 2MPAH 3BE1H 2DQTH 1MF2L 4QO1A 5HI5C 3HC0B 1T1YA 1F90H 1CDUA 2VC2L 3T1FA 5JHDB 3LY6A 3T8XB 5LCVH 4MQ7A 2JELL 4KI1A 5HHVL 4IMKC 5GGRB 2O5ZL 1FSKC 5DS8A 2R1WA 3RUGA 4BA8A 4TVPL 4JRYB 5DD3L 3C9NA 2EYRB 3PIQB 3VD7A 4GG6F 1CWVA 2XFXB 5E2WL 3TBSB 1HDMB 2YWYA 3WIIL 5AG8A 5CEZD 3DX9A 3JWOH 2IG2H 2NY1C 4HV8B 5E8PA 4OSUL 4MA7L 3HHRB 3LHPL 2PR4H 3ARZA 2O26U 3O2DL 5F88A 2D7QA 2Z8WC 2HFFA 3HPLB 3RNKB 5FUZL 4P3WA 2JTDA 5SWZA 2HLFC 4JAMB 3DGGA 3PJSB 1VERA 3QFJD 4YNYB 4O51B 3BD4A 5DHVA 5D8JL 4HAFA 4R0LA 5IB1B 2GITB 3C5JB 1J0YA 1JI1A 5ENWA 3SBWC 3HUJB 3W2DL 1E4XH 1NQBA 1M7IA 3J7HA 4B5EA 2CH8A 2FGWH 4HMDA 4ONHA 2D7TH 3D3VD 1A21A 5BW7A 4BH7A 4N68A 3E3QE 1FORH 2AJXH 5ADOH 1MEXL 5JW4Q 3BISA 4OLVL 4D8PA 3V7AE 4HJ0C 4HWBH 1DANT 4LBEB 4JFPA 3MV01 4W81A 1WBYB 4MVBC 4WNQA 3H2WA 2IQ9L 2VXQH 3KLAA 5TQ2L 1ZLSH 3NABH 4G6JL 4KRPC 2CGRL 4ELMA 4OJFH 4DK3A 5H2BB 2A6KB 1SJHA 3TA3B 1H8SA 3BP7A 2F54E 5C0GA 5FO7A 1FVDA 3TH2T 1EZVX 1NUDA 1OW0C 4MYWB 1RPQA 1YNTB 2R69L 4FMFA 2MKWA 3DBXB 4KZEH 5DJXB 4Z7VF 1I7UB 2NPLX 1H8NA 1CICD 4AYFA 3QEQD 4Z7NF 3R0MA 3D87B 2VISB 3CJJA 2V5TA 1CI5A 1Z5LA 3D9AL 1FJ1A 2DBLH 4WO4B 3MRCA 2MCPL 3B3IA 2P1YA 2XN9D 3G6DL 4WFFD 3VFGL 2VDQL 4OM0L 2YK1H 1UXSB 3HE6A 5D5MF 3BSZH 1MCFA 3MYJA 4OKVA 3SKMA 1AGCA 4R26L 2KL6A 5E56A 1T3FB 1JPTH 4PJXE 5FGCE 2CLRB 4KUZH 1P2CA 2F8OA 1QSEA 3MACH 4EVNB 4HUXA 2K9UA 4IRJC 1ACYH 3H6JA 5GJTH 4PRBA 5FECB 3NIDE 3U7AA 2OXGA 4LARH 2A9ML 1IKNC 3O2DA 2RCSH 3BJ91 3EFDH 3BKCL 2QSQA 4ODHL 2BSED 4M5YH 1I8MA 3W9DB 5K33A 4LCWE 1OL0A 3D39D 1CGWA 5DDHA 2JK5A 2OX5A 2KQNA 4M61B 5DRNA 3SDCD 1CFQA 1HSAB 5J6GB 5L0QB 1IMHC 3TBVB 5I15H 1X44A 3BD5A 5TQ0L 3MLZL 5J06A 5TGBB 4G8GE 4AM0B 4AEIL 4Y89A 4PG2A 4PRNA 2FYYA 1MHHA 1MFDL 4NQXA 5L2KE 1FBIH 4OF8A 2XZAL 5D7LB 5FO8B 3WXWH 3W5NA 3EHBC 2H3NA 4DGVL 2R29L 5I1IH 2VN4A 4MD4A 3U1SL 4YDIH 1EH9A 3O3AA 3TFKC 1NFKA 1Z2KA 3WEXA 5JOPD 3IDIB 5D7KE 3V0AC 1JGUL 2AK1H 4TSBL 2NY2D 4MB5A 1J1OL 5GSVB 2QL1A 3ZTNL 3QB7C 4MXVE 3OKKA 3UC0L 1PYWB 1P1ZB 1OTUD 3KXFB 4ESKA 4YXHL 1PSKH 3P4OB 3KPLA 3ULUF 1PZ5B 2FJHA 4PJ7A 5ISZB 3L95B 3GMNA 2FD6L 4MJID 1NKOA 3GSOB 4X83A 2V7HB 1IQDA 1KLFA 4ZTOL 1KELH 5F1KC 4FTVB 1JGEB 2EECA 3R8BB 4ODUB 2DWDB 4J8RA 4EIZC 5AWNH 1Z0MA 3TBYA 3VFMA 1ZLVK 3NVQA 3VFWB 1T66C 4PJBA 1UZ8B 1OCWL 5DMGD 4ZG1A 5DD5H 1G7PB 2ZP0T 2IC2A 3BQUB 3OX8A 3OQ3B 1J12A 3V4VH 4LNRB 2HJFB 3TVMD 3DMMD 3ARFB 5JR1L 2OQJB 3VGAB 4QGTA 1C5DB 1UWGL 1HCVA 2AV1A 4YAQB 1A6AA 5CP7A 5MEQA 4K8RC 3GSRB 3DX7B 5BMFL 1FO0B 4XNZC 5I9QB 2NMSA 1LE5A 4W6XB 1NL0L 1RU9H 4OLZH 2UZIH 5K9QI 3PE9A 3ZKNC 4HJGB 1I3VA 4JM2D 3VWKA 4H0IA 1KBGL 3CX5K 3Q6GH 4ELKA 1OF2A 2HH0H 4FQCL 3HRZB 4MAYB 1MHCB 2HFEA 3QXAB 5JW4N 3RL2A 1ZTXL 4GKNB 3F62A 4P9HH 4MNQA 4ZFOL 3KPRA 5JO5B 5MP6H 3H42L 5F3BB 3QXTA 1I8IB 1T2QH 3RY6A 4G8FA 3MJ9H 3AUVA 3KPOB 5K59F 1NMAH 2N56A 2OMNA 3RKDD 1XGYL 1I1YB 4LASL 4KUCD 4X6DF 3C5SA 3P0YH 1XIWD 2Y07L 2FWOA 3TO4B 1ORSA 4G9FB 5C09B 4LCWD 2Y6SD 2Y23A 3AFLA 1RZGA 4CJ1A 1ZKAA 4LIQH 7CGTA 3C8KA 4LGPB 4PGEB 1ZGLB 4OLYH 1INDH 4J4PC 4JVPA 3RL1A 4KROB 3SKNB 3LQAC 3MLTA 5I8CB 3DJ9A 4LSPL 5EIVA 2DTMH 3CFDA 1I4FB 3MV7B 2V17H 4PP1D 4XWOD 1CTNA 3V5HB 3BPNC 4UT6H 4KDTC 1OWWA 3C5ZC 1KNOA 1UM5L 2IAMC 3KG5A 3VWJB 3BPCA 3BO8B 32C2B 1QO3A 2F74B 2I26N 4ZUSB 1BVLA 1OAXH 3BH8A 4XT1C 3B8SA 1A14L 3THMH 4IMKA 5D2NC 4Q6YA 4JRYE 3RWDA 4TQEH 1DL7L 1K5NA 1PLGH 2X10A 2ZOKA 1N3NA 5TFSH 5EU4A 1G7QB 2BJML 3HKFA 3SPVB 1XF4A 4X80H 1JNJA 1IEHA 2EE3A 4PYGA 2WINB 4X5WA 3QPQD 1JVKA 5J9PB 2CLVA 4OV5A 3MFFB 2APTA 3N50A 5GS2H 3WSQH 2PYEB 3ZYOA 3TC9A 1XZ0B 3VFOA 4DUVA 4NO5B 3H0TA 4KMTL 3UPRB 2NY3D 1PW3A 3SBWA 1A1NB 4ZFOA 1F3JB 3TZVC 4UTBL 1T5XB 1OAQH 4PY8J 3S37H 1SEBA 4ZNEE 4GW1B 1G7HB 2ZCHH 2EYSA 1M7DB 1IC7H 2CRMA 3EOTH 3JTTA 4XRCB 1TETL 1UKQA 3MQIA 4KK5C 5BJTA 3QBTB 3GMLB 3HZKA 2EIBA 3L3JB 3D85A 1R3KB 2Z93A 5JDSB 4R7DA 3FZUC 5LQBL 4FQHB 3CVHL 3E6FA 2QBWA 2I27N 4Y1AB 5B21A 1UENA 3OHXB 1OW0A 4HK0B 3S34L 1JPSH 1FZJB 3UBXI 5JPNB 4KU1A 4PRPA 4YO0A 3UO1L 5SX5H 4KGLA 2VDKH 3O41B 4FQ1L 3QJHA 3MREB 2DQGL 2BFVH 4YGVB 5D1ZC 4ALAH 1BQHG 4WJ5A 1KJVA 3PWVB 4MQSB 3BFOA 3MBED 1EJ6A 4ZUUB 2BRRH 2BY2A 3AM8C 4P5TC 2I25N 4WEUD 1REIA 1ZHLA 4PJDF 5CP3A 3CC5B 3CMGA 5C2BL 2BOCB 3Q1SH 5E8NB 3QUZB 4R4BB 1IT9H 5C0BD 5EA0L 3MJ8A 4PRHD 3VDBA 2DM4A 3HA0A 3H9HB 3KPNB 4J3OC 3KJ6H 3T0EE 1MCNA 3RAJL 3DUSA 4L9LC 7FABH 1J0IA 2Z31C 3ZE2F 3RZCB 1YECL 3G6JF 3O6KL 4OLUL 2BMKB 3FQXA 2NW2A 3CLEH 3L7FA 1QFWM 5ESQA 1KJ3L 4JFXA 3GGWB 4K7PL 4LRNH 4MHHG 3WLBB 2IGFL 1RZKH 1KPUB 4NQSB 2XRAH 1IKNA 2O93L 4LVNC 4M5ZL 4WFGE 5DTFB 3QAZB 3BOVA 4K8RL 5TPWL 3SDAC 3OSKA 1I9EA 2KBGA 3O11A 2DIAA 4L3AA 1BQLL 2QQKL 3MOAH 2H6PA 2CDEA 1GGIL 4P23C 2LABA 2FL5A 3QPXH 5E4EB 4QF1A 4X7FC 4LDOB 4NQDE 2WMPA 1IGIL 5DJ0B 2ADJA 1YDPA 3UTPE 4P2QA 3RWCB 3WFHB 1CIDA 1HHKA 3IDYB 4D0CB 2ARWA 4G43A 4N90E 1U8HA 5KG9B 1T80A 4LQ1A 4XTRC 5D7LE 4G3YH 8CGTA 4M1DH 3PGCA 1UM4L 3DX6A 1FZMA 5F7NC 2G5BA 5IT2H 4OBRA 3CVHA 3IKCA 1D6VH 1G9NH 5SX5K 1BX2B 1Q9WB 2NX5A 4JPKL 4NJAH 4U6XB 3T3MF 2C3XA 1CLCA 3ZT6A 2CQVA 5FV2A 1NGPH 2VXUH 5TF0A 1NCAL 4GFTB 1PZUB 2VXSL 3B83A 3P9LA 2ADFH 3KXFE 4GJTB 1IGJB 4MNHB 5C86A 3IJSB 4TNVK 3CAFA 5CEYA 4G8EA 1N8ZA 2HKFH 4N5UA 2R1XA 2OMBA 2J8UA 4OCXL 3LQAL 5LGJA 4NRYB 4Z7WF 4WWKC 4GRWF 2PN5A 4YPGB 1PG7W 1J0JA 1FPTH 4L5FL 5EPMA 3AS3A 5M94B 5E9DE 4QT5A 1MFNA 5I8KL 3O6ML 5FKAA 2VDPL 3F6IA 5ALCL 2BP3A 1HKFA 3VXRD 4KK9D 2BOBA 4WI9A 5C0JB 1NFDF 1RUPH 5HVFB 4F3FB 2FX7L 4ZMAT 5KBNC 1ULVA 4KJQC 4E0RA 3TYGH 2ADGA 4OCWL 5DJ6B 1LDSA 4JFFB 1A5FH 3QUML 1DQDL 2CSPA 4DFIA 4EDWL 2A83B 2VYRE 5IOPB 1JGLH 1FGVH 1NGXA 2YRZA 4FNLL 4YBQD 4QXTA 4R90H 4HKXA 1MAMH 2QLVB 5GGUB 2DAVA 4KXZI 1KIQA 2VUYA 5CZXC 1XCTB 3L7EA 1IC5H 5I1HH 3ARRA 1DDHB 4JO3L 5CJ8A 3MRPA 5I1KH 3T0ED 4F33B 1YQ2A 4K71B 2JF1A 2GHWB 4PJ9B 3VG0H 4I4WB 1BD2D 3I85A 1C08A 1BZ9B 4XMLH 1JYXA 4TRPH 3PQYB 4I1NB 4QCIA 1U3HA 2W9EL 1S7RA 4L3ED 4JB9L 3UTSD 4XPBH 4I2XA 4HLJA 5SWSD 1LP9F 1LO3L 2EH8H 4P2CG 4WFGD 5BXFB 2G5RA 3QO0B 5C09E 1JYNA 4B53A 4GBXC 4K94C 3S35X 4MDIA 3N06B 1IM3B 1FN4B 2X42A 1I8KB 1RK1A 1I8LC 2A6DA 3JUZA 5F6HJ 2HFGL 3B9DA 1KIRA 2GJ6A 1SBSH 4ISVA 3AB0C 1KIPA 3MGTA 3UTPD 3R06A 3MXWL 3U79A 2XNAB 2ZSVA 3MSPA 1MAJA 2H2PC 1G0YR 3KDMA 2FH6A 2ZKHL 1ODAA 4JFDD 1Q38A 5JMOC 3STZB 2O5YL 3MO1A 5A2KH 3FB7A 4RQQA 1WLHA 1KCUL 3MV7E 1TCRB 4IMLA 5T1LB 3IDNA 1R24B 2LU3A 5E2VL 2BSTB 3C5ZA 2KDGA 4BZ2L 3FN3A 3I6LD 2Z8VC 5GS1B 4JRXA 5KAQG 1BPVA 4IS6B 4Q2ZA 4N0YH 1H3PH 1SYVA 4OLWL 3VXTA 4AH2B 4LCUA 2EXYC 4GKZB 3WFBH 3Q6FB 4PJEF 1U8NB 2EDQA 1G6RB 4FP8L 2VSCA 1OAKL 5J1AB 1F4AA 4CW1A 1CLOL 3LEYL 4LSRL 2E5EA 4JKKA 3WBDA 2Z91B 2VAAA 2R0KL 4OCRH 1NDGA 3QUMA 1TPXB 4UV4L 3REWA 1KCRH 1BOGB 4Y4HA 5MI0C 5DSCA 1T04B 2ORBH 3Q0HA 4WW2C 1FC1A 4MSWB 2Y06H 4TTGA 5HHNB 3X3FH 1ZVSA 2XA3A 3QRGH 4KGJA 3IFLH 2GTZA 2VB5A 3FHAA 4DZ8A 1LNUA 1A7OL 1RK0B 5AD0B 1OP3K 4TUKL 2EE2A 2AJSH 3ZZ1A 2BCKB 3WFZA 3CX2A 3ZHKA 3UEZA 5L6YH 4M7ZB 2J7LA 1EO8H 2R4RL 3GHEH 5LWYH 5IB3B 1CG9A 5EH1A 3TZVA 2ZNXA 1UB5B 2IF7A 3MRDA 1CDGA 4CDGC 1Z6JT 5KVFL 4IHOB 2XKSA 1V7ML 5F7DA 2E6PA 5GIRB 2DQFA 1IBGL 1SVCP 3UTOA 4LCCA 4H0HB 5E6IA 4X4YA 5CLWA 4OT1H 5EBLB 3NCBB 5F6IB 1QBBA 3E0GA 5CGTA 5CJOL 1I7ZA 5IHZB 1EEYA 3SJVB 2FATL 1WVZA 1A47A 3E8UH 1BLNB 2ZPKH 4OD3L 3KPSA 3RHWK 3SGKC 4OZHF 3TN0C 2QKIA 1G6RH 3OR6A 5LGKA 1HH6A 4LKCB 4L4TE 2QHLA 4F9PA 3CK0H 5IVOA 5T1KD 4QRPE 3MRBA 3IDGA 4G7YL 2IBGA 2GUOA 3EJYD 1PKQA 3GM8A 4LHUB 2P5EA 5IKCA 3MR9A 3AM8A 1FG2A 4NKOB 4P5TA 4ZXBC 4ONOA 2VXTL 4JFEA 4S1DC 4WW2F 5CD3B 4CMHC 1NGQL 4JPIB 1AQDA 4YZFE 5I1GL 3QWOB 3LRGA 2C3VA 4HGWA 1I3GL 3OGCB 1AR1C 2GT9A 2NY6D 2LQRA 3H8NA 3QUKA 4JFYA 5JIIA 5KS9A 4HJJL 5T3XH 2PCPA 2VQ1A 4QXUL 1B3JA 5F8QC 1GH7A 3ES6A 1ZHBB 4O02L 5DRXA 2K3TA 1F11A 4R2GD 5HY9B 3LKPB 1N2RA 4R97B 3X14B 3KNBA 1AC0A 3RWHB 1HSBB 1RHFA 4QHUB 3SDXB 1CDJA 4XNMB 5D96C 3MNZB 4BFBD 2DQUL 3ARPA 4Y2DD 5CBEB 5E00A 1FAIH 1T21B 2V7NB 3SO3B 5DF0A 1S7WA 2YC1B 3SDAA 1RJYA 4UB0L 4ORZC 4BFEA 4Y5YC 3VXPB 2F5BL 4KPHL 3C6LC 4P23A 2FX8H 3VH8A 3WNLA 2WAHA 1J1PH 1TJIH 1CXEA 1PEZA 1DBBL 1CFNA 5EZOL 4HUWA 5F96H 4J3TA 5D71H 4H5SB 5A3ID 1OGAB 2H32H 1NC2A 1MJ8H 2IH3B 3UAJC 3KPQB 1GGBH 4QHMA 3L3OB 1CVRA 1WWCA 2OZ4L 3GJFA 4M93B 4RFNB 5DJYA 5ETUA 2F53A 4DEPC 4NQVA 5C0AB 2QSCL 2X4QA 2NQCA 1LHZA 3IDXH 3P4NB 1T7VA 3V52L 4CBPA 2P44B 1S7VA 1U3YA 4F58L 5IMLA 3HNTH 3HC4H 2PO6B 5KSVB 3LKNB 3O4OB 4LDEB 4MCYB 3ZKQD 4AL8H 1VENA 1YN7B 2V2XB 2IBBA 1RZ8B 4QWWC 2GFBB 3KYNA 4JG0H 3L5XH 3BVNA 4U1IB 4M6OL 1U8KA 5C0CA 3ZYJA 5CCKL 4GQ9L 4HG4J 1BJMA 3AREA 3PXHA 2C3WA 1JGVH 3K2UL 2IANE 3WE6B 1X3DA 1UB6B 2YRLA 3OPZH 1YYMH 4BFGA 1NCBH 3P0GB 2VXVH 1QNZH 1NJ9A 1YEIL 3SCMA 3MRMA 3QDGE 2YPVL 5JORA 2AEQL 1QFUH 2UWEF 2EC8A 4YEEA 5JNYA 2AABL 2A2QT 4PJHF 4LGSB 1EFXD 3EZ8A 4B0MM 2Q87A 2Y7QA 3JV0A 5GSRB 3EUUA 1CFVL 3S4SA 3OAUL 4NM8H 2E27L 3Q5OA 4MB4A 4LLWA 3SOBH 4HCRL 1TNMA 1FIEA 4OZIB 5FGSA 3A67H 3CLFH 4BUHA 3FCTB 3Q3GA 4EN3B 3WKNA 3T77A 5DR5L 2HWZH 1FNHA 3KAAA 4RMVA 5HHQA 1TZIB 4JR9L 2EKJA 3UYOD 4JZJC 1YYLL 2AK4A 1ZA6B 3FB8B 3FN0H 4L4TD 3TIDA 3BIKA 4HMCA 4QRPD 2CPCA 2D7PA 1T1YB 1KCVL 3WJJC 4ZAKB 1MFBL 1YNKH 4PUBL 2F19L 4EZMA 3IJHA 3T1FB 4I3SH 1U92B 1A0QH 5HD8C 2FDBP 1WEJH 1ZANL 3NTCH 1X7QA 4NSKB 5DS8B 3RUGB 4EJ1C 1A7QH 1TLKA 1C1EH 1NLDL 4GAJH 1FV1A 3IAQA 5E6ZA 3S9DB 5E8PB 3BZEB 5B38B 2OJEA 5E8OB 3PQYE 5F88B 1X5LA 2IEPA 3SGJA 5DMKA 4AG4H 4C56B 5GGSA 4Y16A 5SWZB 4Z7UF 5D6CB 5E5RB 2Y4SA 2ESVA 3M45A 2XQBH 3HRPA 3ZYZA 2IPTL 4NN6C 1XCQA 5DHVB 1R0AH 2BNRA 3MLSH 3GBML 3IU4L 1BOYA 5DLMH 2YPKA 5FCSH 1S9KC 4GBXA 4JZOA 1D5ZA 5ENWB 5TF1H 3RWIB 5EOCL 1N0LA 5KZCB 1KENH 4U1NB 5L8KB 1I9RH 4ODBD 3DRQB 4HUMB 3U0PA 3DVFA 4JFPB 3OR7A 2ICWA 5J89A 2E8YA 3DOSA 4M1CD 2EIEA 1CDHA 4M7LH 3VFUA 4JY5H 5FF6B 4PIRF 3VXUD 3D2UA 1DQLL 4ELMB 1UYWL 3BP7B 4UIKH 5CS7A 3ZL4L 5HHXH 4WTXA 5HDBF 5FO7B 1MFCH 2Q8BH 4POZD 2PXYD 1I1FA 1A6TA 1IFHH 2XICA 4GT7A 4QNPE 1N0XL 2XTJE 3QWRA 4Q6IA 2A9NL 2VLKE 2B1HL 4HCRA 1XF1A 4LHQB 1S78D 4FABH 4XCFH 1CGSL 3SDCC 3ZKSD 4Z8FH 1JHTB 1SEQH 1MRDH 1MCOL 3MOQA 5KVEL 1TCMA 1FJ1B 2IAND 3ARGB 4DKAA 1KXVC 4P46A 4LCIL 5HHPB 3MRCB 4UIMA 1N7ML 3B3IB 3ZTJG 1YEDA 4Z7QF 2ITCA 5J11B 3QDGD 5GRJH 3MYJB 1V3MA 4PJFA 5C3LD 3KR3H 4PJGA 3QNXA 4X4XB 3BPOC 1CXHA 2WK2A 3TGXA 1R5VA 1P2CB 3VFSA 1EAPB 3TNMA 4JVUA 5IFJA 1QSEB 4HUXB 2OJZH 4HWEH 1QA9A 1MNUL 3BN3B 1P84J 3NFSL 4HD9A 3D48R 3FQRB 5EUOB 2NY2C 3K80A 1BQSA 3LKOA 4LAQH 2FSEB 4U6YB 5DDHB 1OTUC 4GW5A 5DRNB 1CFQB 4XBGB 3BDBA 1NAKL 1JWSA 3BRFA 1U2HA 1NAML 3MRJA 5AUMA 4GXVH 4UDTA 1H9VA 1LO0H 3HZYB 5T1MA 1J1XH 2AW2A 3HG1B 3SJVE 3ARDC 4ODVL 2FYYB 2VJXA 1MHHB 4NQXB 5BVJA 4MD0A 2J3SA 4L4JA 4RDQG 5DMGC 2ICWI 1JZ6A 1VGKB 1ZS8B 3HZMA 4OLEA 2H3NB 2DN7A 2ID5A 2HVKA 3TVMC 3DMMC 3QDJE 3RPKA 3FKUS 4M43L 4L8SC 3MOBL 2APXA 4MD4B 5DUBA 2CXGA 5HDQH 2YKLL 3WEXB 4U33A 4D3CL 3GSQA 2H9GB 5CEZL 1RJLA 3MLXL 3MRIB 2ATPB 4HXBH 3KLHD 3OKKB 4S0SD 4IBLT 5HHVH 4PTUB 3RIFK 4JM2C 4RX4A 4JDZA 2HT3D 1MJUL 1WISA 1F3DJ 3OJVC 4JO4L 5GJSL 3KPLB 2WQ8A 4UV7L