3BN9D

Crystal structure of mt-sp1 in complex with fab inhibitor e2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
211
Chain Sequence
b'QVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARPYLTYPQRRGPQNVSPFDNWGQGTMVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-type serine protease 1
publication title Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 211
sequence length 229
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D01
5DMJB 3BP4B 3BGFB 1HXMA 5KW9H 1I3GH 5GGQL 1C5DB 2AABL 4HZLA 5EG6C 2YR3A 1IILE 1UB5A 2V2WB 3NCYP 3ZE0F 5FGBA 5TDNB 5F70A 4IRJA 3U4EA 5D6CA 3MXWL 1CIDA 1OTSC 2V9TA 1JF6A 3E2HB 4PTTB 1XCTA 4ZMAT 5ADPL 3LRSB 3UPAA 5FYJL 1RZ7H 1FGNL 1UADC 35C8L 3NAAH 3OL2A 2QHRH 5DS8B 1FO0H 5EU5B 2OJZL 5GSRA 5TDPA 4LSPH 2MTPA 2UZXB 5I15H 1JNHB 1FNEA 3RVXD 3L7FA 3GMQB 1AO7E 4G8GE 1FZOA 5FHAH 4UAOB 4UU9B 3QRGL 3Q5YA 3ZKXB 5BRZB 4U05A 1R5WB 1LWRA 2FJGA 4S1RH 3RFZC 4FFVD 5I0DA 5ID0A 4F9PC 3P9LB 1AGCB 2QQLL 4OCWL 5FUOH 1WF5A 3MLZL 2WK2A 4LL9A 4M6NL 3GSNA 1U8IB 3SDAA 4PJ7F 1F4HA 4O5LH 1F02I 3TBYA 2YPKA 1AKJB 1KEML 1ZOXA 4XX1G 1NCWL 2AKRA 2XA3A 4Z77B 4N0RA 1G7PA 4JLRA 4U6XB 4A2MA 4G42A 2DIAA 4FRWA 3G04B 4P9HC 4Z8FL 4EI6B 5TF0A 1CT8B 5SWSD 3FQRB 3D2UA 4WO4C 3RL1B 1ORQB 4XP6H 4ZO9A 3MC0A 1MF2H 4LF3B 5FGCE 2PYEB 3C2AL 3V0WH 3L95A 2ARJQ 1TJHL 5IB4A 1SY6A 3KPRD 1IARB 4CVZB 1N8ZA 4PJEA 5K33A 4JJ5A 5KN5B 4MJ6A 3WXWH 2X7LA 3RY6A 4XP1L 2GIYA 4K3JH 1MVUA 4HIHA 4YGAB 3S88H 2HP4A 2BJML 5IWLA 4JRXE 4Q9CA 3MLRH 4ZFGH 4WENB 5DRWB 3IYLW 5IK3B 3RIFF 5E2VH 1JYWA 4LSVL 3V4PL 4NNYB 3RVWC 5IF0B 4GXVH 2UZIH 4N8CL 5FUCC 3SOBL 4N1CA 2UV3A 3D25A 3FOLB 1H3GA 4PYGA 2X70A 1N64H 3QFJE 1RZ8B 3QWOA 4JKPH 4JZOB 1MWAA 5H37H 3L3KB 4C83A 3IRPX 2X4PB 2XKSA 1S7SA 4WFHD 3S96B 5DI8B 2Q76B 3L5HA 3P9MB 4Y16A 1O7SA 3NIFE 2E9BA 2IANA 3GJFA 1QA9B 4YIQA 1UQSB 3OR7B 3UTQA 1TVBB 1TZGH 3C8KB 2LE9A 3F7YA 4YDVB 4PJ9B 5I6XB 1XF2A 1GCFA 3SN6N 2D0GA 3OKDB 4HW6A 1GIGL 1QRKA 5EU4A 4AG4H 4ISVA 4OAWB 4F15B 1OP3H 5DMIL 1X5YA 4I3RL 1YEKL 1BPVA 4LIQL 3OJVC 3NOIA 1U91B 4BSVA 1ED3B 1NCNA 3DVGA 4Q2ZA 1QEWA 4K8RD 4NFCA 5BO1H 2CQVA 1BQHB 5DYOA 4OBSA 4PIRF 1C08A 4J1UA 4ZTOH 2VLRE 4X4XA 1DQDH 1O0VA 4HSQA 3E6FB 3RI5K 4FFWD 1W0WB 3RWDA 1Q8MA 2Q8BL 3VXSA 1KCVL 5CKGA 4LLQA 2WP3O 3BO8B 2BNUB 3V5DB 1V3JA 3I9GL 2R0KH 1U58A 3CMOL 3AREB 3EO1A 3ZYZA 3D6GA 5EC1A 1JWSB 2D31A 5EWIL 3O6KH 2PW1B 3D0LA 4YHIB 1FFOB 3ULUE 1LO4L 1AXSB 1BX2B 5KVMC 4ZUUB 3L5WA 1EHNA 4X6CF 4XGZB 3RKDD 4GRLD 4JGMA 2VXTH 2SEBA 1MCFA 3P4NB 1IM3B 1NGXB 4PGZA 3LDBC 4P23C 4Q9BA 4PD4J 4UINL 3RY5A 3TVMA 1NBYB 5HY9A 4NWUH 6FABL 4DUXA 2V2TB 3S34H 5L8KB 3P73B 5EBLA 1LO2H 1JWUB 3WJLA 1R5IA 3PWJA 4DVRH 5CBAA 1NCBH 1QSED 4F8QA 3BRGC 3T65A 2ZOLB 4NKMA 4MQTB 5I71B 3VWJC 1X5AA 4HWNA 1KIQA 4JY4A 3CFDA 1EUTA 2JLLA 3FRPG 5AZ2L 2X44D 3N0PB 2GTZB 3MR9B 5EPMB 3PWUB 1FORH 3OG6B 1M6OA 4ODTH 2FO4B 5C92A 1UACL 1FL5A 4Y5XC 5CCKH 4WU5B 3BPLC 5B38G 5B3NA 4KKLC 1P53A 4N5EC 3BUYA 2MQ0A 1U6AL 3EJZD 5TE4H 3TN0B 2VDQL 1DFBL 1VGKA 4PGBA 3QEQD 2VZSA 5C0EB 1DQTA 3UTZB 4EVNA 4YHLH 5D4QA 3EYUH 4P5TA 5DWUH 1BD2D 3QIBA 2HMID 2YPLD 3U36B 5K9KA 5J13C 4CL7A 5MERB 2UYLA 2DWEB 4WUUB 5D9SB 3VXME 1DQJB 4OCSH 2BY2A 4JFEA 2JJVA 1QHOA 2GHWB 2VITA 5FM5M 3VGAC 1ZGLB 4XWGH 1BFTA 3B3IA 3PJSB 1AC0A 1PY9A 5D8JL 2XN9B 2VLME 1MCWW 3VD9A 1HXMB 2VDOH 2NY3C 3DBXB 3VE0A 3FMGL 4HZLB 1UB5B 3T0EB 1A7QL 2EIEA 3U4EB 4IRJB 5D6CB 2H32A 2VLKA 4HJ0C 1NFDA 3D69A 4XP5L 2DD8L 1A4KA 1MCSA 1MRDL 3CSGA 4ODVH 1YEGH 5E6ZA 1ZMYA 3TYFA 3QXAB 3CFBA 1U93A 4DFHA 2D9QB 5GSRB 1CGYA 1PQZB 1MJJA 4K94H 1T1ZA 1PYWA 3IDXL 5TDPB 3IDMB 1FNEB 3P0YL 4XCCL 1FZOB 2W9EH 3VGDA 3ZTNH 5MP6H 2WUBH 1DSFH 3GMNA 3CU7A 2FJGB 4KXZH 5D2NA 5JW4M 4CNIA 1JYNA 1WT5C 1CL7L 1QFOA 3PWVA 4GAYB 5ID0B 4KMLB 4HXAH 5IHLB 2YC1B 4HJJL 2VQ1A 2BY0A 2ESVD 4GO6B 3LEYL 1MFEH 2Y5TA 4I9WE 3TBVA 3MPCA 4UT6H 4FFZL 3GSNB 3SDAB 2E3VA 2DM4A 3TBYB 3WXVH 2YPKB 4JDTL 2VSDA 2P5EE 1ZGLP 3H9SE 4HUVA 4NM8L 1G7PB 3PWPA 4JLRB 4G42B 4PLNC 2OYPA 4M02A 2W0LA 1LHZA 4KHTH 2A9NL 2R2EA 3D2UB 4M6OL 4O58H 3L95B 1CR9H 4HUKB 4NQDB 2VB5A 4OZHF 4YFEA 4R7NA 5CEXA 5IB4B 4JM4L 4BZYA 3E3QC 1BBJA 3BZEA 1N8ZB 3DETC 4PJBE 4RWHA 4PJEB 2ZPKL 3FO9A 1GAFL 3QIUA 4JJ5B 1JGLH 4MJ6B 2X7LB 4NO3A 4MXVF 4W6YB 2KZWA 3EJJX 4G8EA 2Q3AA 4HIHB 2ZWLT 1WICA 1A0QH 3VU2A 5C0FA 1UG9A 3MLWL 3HB3C 4R26H 1PX3A 1C1EH 4YEFA 4DJMA 5ITFA 1L7IH 1X5HA 5I1KH 3BIBX 2ZJSH 3J7HA 2PN5A 3OXRB 1JIBA 4OTXL 3T09A 1GGBH 5JZ7C 1BGXH 3D25B 3OKKA 4R9HA 5JNYA 3VRIA 5GRUL 2X70B 1MWAB 2XA8L 2W0FA 4C83B 1E4XH 1S7SB 4FXLA 4PGDA 3V5HA 4I4WA 2KPNA 3AS0A 3T0XA 5C6WH 4Z7UB 4XBEL 1A6WH 4KKCC 3GJFB 4I0PB 2DQEL 2VQTA 4JFHD 3LKRA 3UTQB 1OHQA 3LKQA 3F7YB 3C6LD 1QVOA 4MHHI 3VW3L 4HGWA 2R2HA 1UKSA 2YUXA 3AMKA 5EU4B 2E5EA 3M1BA 2XRAL 3F5WA 5TF1L 2D7OA 4K94C 5D1XA 3Q1SH 4LHUA 5EC2B 1SJHB 1RIVL 4ZXBD 4PJ8D 4HH9A 4LLUA 3BQUD 5F7EH 4BSVB 3GZKA 4Q2ZB 1QEWB 1JI2A 5FYLH 4HWBL 3FO1A 1AHWA 5DYOB 3H3PH 5FB8A 4J1UB 1BLNB 4J6RL 3VFMA 4DOHB 5T1MA 3QUML 4X4XB 3RWDB 3VXSB 3ZKSD 4LLQB 3MRKB 5LCVH 1TTFA 3RKPA 5J12C 1S8DA 2D03L 1LNUB 5HYIA 3FQNA 5INCA 4F33B 1DQLL 3ARBD 4CBPA 1UT9A 5EC1B 1BM3H 5A16A 2FL5B 2D31B 1QSVA 4PJGE 3D0LB 3P4OA 4OI8A 1HYSD 5F89A 4LSUH 2A0LC 4LKXA 4NN5B 1I9JH 2DIBA 4EN3A 4KKBC 1UJ3A 1U95A 3TVMB 2H3NA 3QUXA 1ZLVH 5HYJA 5HY9B 5KVEH 2H45A 4Z7VB 4H5SA 5DEGB 2ARJA 2DYPD 5FA4A 4UIKL 5FFLA 4HCRA 4NKOB 3QIWA 1YY9C 1MIEH 1R5IB 3PWJB 5CBAB 2AJSL 5HVGB 2FDBP 1NAKL 3A6CH 2R69L 3T65B 4OD1L 1RUAL 1IGFL 4NKMB 4MNHA 4OIAA 5AUMA 2D4DA 2E7LA 1KIQB 4JY4B 4J23A 5F7NC 3RRQA 5C0CA 4K7FA 2BHYA 4LRIC 2APXA 3SO3C 3JUZA 3ULVD 4FP8H 4WWKD 4XCFL 1M6OB 5GGQH 2WM0A 4O02L 3BIKA 2AABH 1FL5B 1WISA 4OFKA 3BUYB 4HJGA 1GGTA 5C0BB 4ZNEA 4R4ND 4Q0XL 3MXWH 4MXQD 3BEWA 2CDGA 4BSWA 2EDOA 4JRYD 4CKVX 1VGKB 3MLUL 1BIHA 5FYJH 4ELMA 1FN4B 4XC3L 1FGNH 2YUZA 4KRPC 5IIEA 4EVNB 35C8H 3O45B 4FQXD 5KSBA 2EICA 4YH6A 4P5TB 1F5WA 4ZFZB 3MRNA 5JOPE 4MVBC 5HI4D 5K9KB 3RIAK 2BFVL 2UYLB 3Q0HA 5J6HA 1F8TH 4N9GB 4I18A 4M7LT 4JFEB 4OGYH 3CLEL 3HC4H 3NABL 4ZD3L 4HKBA 2HJLA 3KPSA 3B3IB 3MMEA 4JN1L 2CKBL 4HPOL 2AXFA 4RMQA 4LVOB 3U7AA 1RY7B 2HKHH 3ET9F 1IM9B 5AWNL 4RGOH 3VE0B 1MCPH 1Y6MR 2QQLH 3MLZH 3L3HA 4GS7C 4XBPA 4X9HA 3VRLE 1DP0A 2ZUXA 2H32B 4M6NH 4YZFF 2VLKB 1NFDB 1V7ML 3D69B 3RQ3A 3BP7B 5EO0A 1KEMH 1A4KB 5GRYA 5FA3A 4QRTA 3MUGB 4ZO8A 1NCWH 2Z8WC 1JTTA 3TYFB 3CFBB 5H35A 3RGVC 1U93B 4Z8FH 1MJJB 1T1ZB 5IW6A 1N5AA 1ZSDA 5IHUL 3QWRD 3X3GL 1KB5A 3QWQB 3C2AH 4RGMB 5TPWH 4TVPE 5I17B 4KXZI 3GMNB 3D5OF 1B4RA 5D2NB 4L4VD 4CNIB 4RIRB 5GS1C 1QFWL 3PWVB 1HWGB 4XP1H 5GSVA 2ED7A 2BJMH 4JFFA 1JN6A 2VQ1B 2DLFL 5JORA 2ERJC 2Y5TB 2ZUTA 3QNYA 1I4FA 4D9RD 5A1AA 3V4PH 2XWBA 1X3DA 3NCMA 4N8CH 3SOBH 4HUVB 3PL6C 3RWJA 3PWPB 3KS0J 2Z0BA 4YFLI 4KTYA 4B7LA 3B9EA 3PDOA 2VKWA 5JOEA 3HZYA 1IGJA 4Y2OA 5TJWK 1JHLH 2R2EB 4D0CA 4ZPVA 3Q48A 3BSZL 2VDLH 1YDPA 1N6VA 4IRSC 3MNWA 5JQ6L 4NGHL 3BZEB 3C08L 4YQXL 3INUL 1RHFA 3FO9B 3MRMA 3QIUB 4NNPL 5I1IL 4KK6C 1GIGH 4NO3B 5B8CA 1RUKL 3LN9A 2VABA 2OZ4A 5JHDA 5JMRA 3H3KA 1ZVSA 2WBJC 2AK4E 3V6OC 3WCYA 3U79A 2AJ3B 5IFHL 3OJDB 4I3RH 1YEKH 2OI9B 5JA9A 5ITFB 4LIQH 1YYML 4M9OA 4HG4J 3SDXA 1LP9E 3ARPA 4YBLC 2J12B 3OKKB 5F96L 1H8SA 3TT3H 5EU7E 1TQCC 3WLWC 1QKZL 4IMLA 3ZHKA 4PR5A 1E4XI 1MCHA 2W0FB 2DQFA 5DUBA 1FDLL 3V5HB 4I4WB 2Q8BH 1KCVH 4Y4HD 1NCTA 4N8VG 5C09D 3W39A 4IJ3B 3LKRB 1IAKA 1XR8B 3F58L 1QVOB 5E8OB 3CMOH 5FYJU 3VMPA 4HGWB 2R2HB 2ZCLL 1QLRA 3ULVL 1F6FB 2Z4QA 3M1BB 3F5WB 3LHPL 2QLVB 3QAZC 5D1XB 5J4MA 3UJTL 5IMMB 3DTXA 2A6IA 2FYYA 1G7LA 2O5XH 4LHUB 4RFNB 3DROB 3HA0A 5DJDA 1J05A 4HH9B 4LLUB 4D0BA 1U8HA 1ITCA 3BP6A 2APTA 5B39G 4LRNH 3VFSA 2XV6B 1VGEL 1A4JB 6FABH 4X99B 3CH1A 5CGYC 1AHWB 5FB8B 3HNTL 4PTUA 3VFMB 3O8XC 4HBCL 5T1MB 2EC9T 3GSQB 1LVEA 5D96B 3BGMA 4G8IA 4TPRL 4CVWA 3HE6C 2H41A 4X0KA 5DJXA 3NVQA 1S8DB 4F7MA 3X14B 5INCB 3FB7A 3HR5A 3EZ8A 5AZ2H 3OHXA 1KJ3L 4LLAA 5A16B 5FECB 4QHUA 4PGJA 3NIFF 3AB0C 1IAMA 4RMUA 5F7HA 3P4OB 3UBXG 5F89B 2VLJD 1UACH 1XAUA 3CC5A 4LKXB 2YD5A 4Q97A 4YC2C 1U6AH 1ZGLM 1MREL 4EN3B 3G5YB 1UJ3B 4L8SC 4PJ5D 2H3NB 2VDQH 1DFBH 2NXYC 2GSGB 4AMKL 3VG9C 5HYJB 4Z7OF 1AP2A 3O9WA 2CRMA 4QY8A 4H5SB 2ARJB 3RPIA 4GG6A 5IW3A 3T4YA 5FA4B 1X5FA 3ARQA 5HDBF 3QIWB 4WU7B 5C0RL 4GAFB 1DBMH 2OJEA 4Y1AD 4PJCE 4P46C 5AUMB 2NNAA 1M4KA 1V3KA 5D8JH 4X4MA 2B2XL 5LXGL 5C0CB 3CSYA 2YUWA 3QUZC 5I19L 3BISA 5IBTH 4KZDL 3BIKB 3FMGH 4GSDL 3I6LE 1E4KA 3RX8A 2PXYA 3HUJE 4B5EA 2NR6D 2MMXA 5T3XE 4HJGB 1G7HB 2CDGB 3BEWB 3RZCB 4BSWB 5E2WH 3O41A 3K8KA 4G9FB 1Y6KR 1F2XK 4XP5H 4ELMB 2DD8H 1ZTXH 2XTJC 5IIEB 3ESUF 5CD5D 4QYOA 3AU1B 2ADIA 3ZL4H 5KSBB 1RUPL 3MRNB 2OK0L 1PVHA 3KNBA 4OKDA 3WN5C 5E6IC 1X7QA 1INEH 5J6HB 2P5WB 3LCYA 5DC9B 3P0YH 2NY0C 5F1SA 3V4VH 3MMEB 1NANH 5HXMA 4E41E 2AXFB 3RWEA 2CO7B 3VGBA 1K4DA 1JL8A 4LCCA 2ADJA 4MNGB 3L3HB 3LEYH 4XBPB 5J1AA 2JK5A 4FFZH 1HHIA 3QNXA 1KJ2L 1GOGA 2KQNA 3N1MC 4JDTH 4M7LH 5FA3B 4QRTB 4LCWD 4Q9RL 2VR9A 5EIVA 3BOVA 1NBVH 4NM8H 4ZODA 5H35B 4KK5D 4J3TA 5IW6B 1AI1H 3B2VL 3JTSA 1N5AB 2V5YA 2YXMA 3BE1L 1B88A 1QD0A 4ETQA 2J88L 3MOAL 2HRPH 1JHKL 3OPZL 3D3VA 4JM4H 4NRYB 2R2BA 4G6ML 5CIPB 2X05A 1GAFH 1RUML 1TVHB 1WTLA 5GRJH 1KCKA 3PGCA 3BZ4B 1MHCA 4JFFB 1JN6B 1FZKA 3EYSL 3F8UB 3OKNA 3MLWH 4Z7QE 1EIBA 1I4FB 1JRHL 1MHPL 1SYVA 4OTXH 5K93A 3HRPA 5A3IC 4EOWH 3FO2A 3SDYH 3O6FD 3RWJB 2YWYA 3LKNA 3PDOB 1OGAD 4YXLH 2XA8H 2HT2C 3HZYB 1IGJB 1WIPA 1SMAA 3W0WD 2VZTA 4D0CB 4ZPVB 2ZUWA 4FQJH 1EK3A 4K3HA 1XGTA 4XBEH 1YDPB 4WW2F 3ZKQD 2JJUA 4BZ2H 3MNWB 3SJVE 1ACZA 4GMSL 3VW3H 3MRMB 2F74A 4HUXA 3VWKD 1YNLL 5B8CB 1A1NB 2DQCH 4H0GA 1M05A 2VABB 2XRAH 5TF1H 5C2BL 1M1SA 4K7PY 4WHCA 3OAZK 5JHDB 1YEJL 2E7MA 9CGTA 1GZPA 4JQVA 1S9VA 4MMZC 5C07E 3D85D 2EH8H 2RJMA 1RIVH 3FO0H 3V9FA 4XVUD 5DHVH 3HE7A 3GM8A 3SDXB 3MJ9A 1T21A 2NXZD 3DRTA 5HHMB 1OWRM 4HWBH 3EYQD 4RISL 1P4LA 4Y19E 1OTTD 2BSED 2E6QA 4IMLB 2ILLA 5AYQA 5BV7B 4PR5B 1D9KA 4X80L 1UM5L 1VADB 3QUMH 1PG7H 3A6BH 3JV4B 4NSKA 3MGTB 1YA5A 1GOHA 3BEVA 5ELIA 3LD8C 4QXGH 1UXSA 4TTDC 4P2QD 3W39B 4F37F 5IMOA 1IAKB 2D03H 3T2QA 3LB6D 1DQLH 3IAGC 3MV9D 2W9DL 1AE6H 4X8JB 4FXKA 1XR9A 1JGEA 1QLRB 1OAYH 2Z4QB 1A6VL 1RJZB 2QJDA 3DTXB 4MQ7A 1MFCH 2ADFL 1G7LB 3HNSL 1JPSL 4YEEA 3BN3B 3C60B 4MA1B 5EZLA 4NJ9L 5DJDB 1J05B 3E0GA 3HS0A 4D0BB 1U8HB 4S1SL 4OCYL 1FO0B 3N85L 5AEAA 2AEPH 3A67L 2PR4L 1MLBA 1FFQA 3CH1B 4RGNC 4X7TB 5BRZD 1H5BA 4PTUB 1BVLA 2IPKA 4QKXB 1Q9KA 5IMLA 5KAQF 1Z5LA 3W9DA 2IAMA 4UIKH 2CRIA 3BGMB 4YHML 4G8IB 3OJMB 3VFTA 2Z93A 2R1YA 4X0KB 4OD1H 1RUAH 1IGFH 1H0DA 1WSST 5DJXB 4YDLB 4F7MB 4CJ1A 3FB7B 3HR5B 3KPOA 4JVPA 3OHXB 1F13A 1NDMA 2MKLC 2B5IC 4BH8B 3C8HA 4KHXL 4L3CA 4XHJC 2EO1A 5ADOL 1OF2B 4WDIA 3CC5B 1D5ZA 2Y4SA 3FT3A 5IFJB 4DK3A 1CFNB 3LKPA 4QHMA 1XF1A 1TITA 3IFLL 1KELL 4Q0XH 3MACH 4OFPA 2M2DA 4WI2A 3S5LG 4ODSL 1NMCC 4AT6A 4MA8L 4XC3H 4Y5VC 1REIA 2W59A 1AP2B 1VESA 5ESAA 3O9WB 4Y8DC 5IHBA 2P24A 3REWA 3RPIB 25C8L 4GG6B 2ICWA 3TA3C 2VLLA 1PKQE 1DDHA 1JJUA 5FV1L 1SJVA 2NLJA 5ISZE 4FZ8L 3DURA 1GHFL 4OZIA 3ARDC 4OZGA 1F3JA 4ZD3H 2LTQB 5F21B 2NNAB 1D6VL 1FBIL 4Z78B 3WDIA 5GQBA 3EZJB 3MLXH 5F3HA 5HPMB 2R8SL 1CICC 1HILA 2GJJA 3ESVF 3J8F7 1A6PA 3LIZH 2YSSB 5AWNH 5D1QC 2HMIC 4UNUA 1Y0LA 5TFSL 2BVYA 2PXYB 3ARGC 3TO4D 5A43C 1R0AL 4PJGF 3RUGE 1I7TA 1OQXA 1GPOL 2HTKD 3P9WB 1R6VA 1V7MH 5DUML 4Y5XB 5FO9A 1VACA 4D8PA 1KTRL 3SE4A 3EO0B 4QYOB 4MJIA 2ADIB 1TMCB 4P4KD 4NQSA 3KNBB 1LK3L 3C5JA 4JAMA 5C86A 4B7IA 3CLFL 1QNZH 4DKEL 5D7JA 1GGCL 3X3GH 3BDBA 1D5XA 2Z92A 5MHSD 4OF7A 1NANI 1AY1H 3V8OA 4X6BA 4NN6C 2UWEB 4C56D 1FQ9C 1DBAL 2FCBA 5E7BA 5CJQL 5DJZA 2XOTA 3O4LA 1K4DB 1RK0A 4QXUL 2A2QT 4ENEC 4HKZB 2YBRA 4K3DL 2DLFH 5J1AB 2JK5B 3OAUH 1HHIB 1NUFA 3QNXB 4ZTPL 4LLWA 4WHDA 2HA1A 3ZKND 3VA2C 2DM7A 3QQ4A 2BNRD 5CEZE 1IGCH 4HKJA 2AK1H 3ARED 3GIZL 4YHNB 3JTSB 3WFDL 2D7MA 5CZVL 1AGDA 1FHGA 3X13B 4CW1A 4PPTA 5AAWA 4ETQB 1AXTH 5ESVA 1KLGA 1TZIA 3BSZH 5FYKH 4BZ1L 4UNTA 1RJCA 3DI2B 3D3VB 2R2BB 5F97E 5I73B 4NGHH 3C08H 1A7BA 3INUH 4YQXH 3QXTA 1J8HE 4NNPH 4Y2DA 2HLAA 5GGTA 5I1IH 1T0PB 1S3KL 1RUKH 3PQYD 3PGCB 1I3RA 1MHCB 2PO6A 3GM0A 2VL4A 1FZKB 3TWCL 5IFHH 2NY4B 3OKNB 3QUYC 4RDQF 4OF8A 3RNQA 3QEUA 1YYMH 4XPGL 1MCEA 3MCLL 4KGJA 1N5YL 2CR3A 4NN7B 5EFIA 4EDWL 5LGKA 3FO2B 5D1ZC 5F96H 1G7JA 4POZC 1QKZH 2H2PD 2MCPL 4O51A 3IGAA 4OQTL 4APQA 1X4YA 3ZDZE 1TQBB 4BK5A 4OGAD 5GS2D 3RJDA 2OLDA 3M17B 1MCRA 1XGTB 2DF3A 1QBML 3H7BA 3UJIL 3HNVH 3GMOA 3MLYL 2NY2D 3H9HA 3F58H 2R4SH 2WIIA 4HUXB 2F74B 3ULVH 2PTTA 1FYTD 4XTRD 1M05B 1QSFE 3LHPH 4I5BA 4KK9C 5DD3L 1GZPB 4DOHE 1S9VB 2Y5EA 3QR2A 2MPAH 4HUWA 4M1GL 3DUSA 2FEEL 1ZLWH 2EDLA 2FLBT 4HLZG 5HI5D 1FVCA 3HE7B 4AQOA 3PHOA 1T21B 3SDDD 1IAOA 4WHYG 3DRTB 5E5RB 3VXUA 1J9CT 3C6LC 5E5UB 3QCVL 3HNTH 4KK8D 5FOJA 5T1KD 2W60B 5GRXG 1D9KB 1BEYL 4HBCH 4NSKB 3ARVA 4TPRH 3T2NL 3NIDE 4CU8A 3BMWA 3WEXA 2DQHL 4ZXBC 3H0TB 3MUHL 3UTPD 3MV7E 5IMOB 5EORL 1WUNT 2HG5A 2V5TA 4Y88A 3JWDC 2DQIL 4GAGH 4FXKB 3SE8L 1LK2A 1NCDL 4URTB 3FRUA 1U3JA 1AO7D 1I7ZA 4Z7VE 1YNTB 1KG0A 4RMRA 1NKOA 4MQ7B 5MI0C 4XMLH 3HHRB 1RSFA 4MAUL 5EZLB 5F88B 4JREB 3FFCE 3HS0B 4P2OB 4AEFA 3QEGH 5ALCL 4AMKH 3LRGA 3ARBC 1J0ZA 2YWZA 5EBMA 1CCZA 1H5BB 2IPKB 2IAMB 1CFTB 1KNOA 4ODXA 3S37X 4XB8A 3U0TA 4DUWA 1OCWL 2V9QA 2HYMA 1AIFB 3VFTB 1T80A 5HVHB 2R1YB 1QG3A 5C0BE 4YAQA 2PETA 1JGUH 3C2SA 3C87A 2QTEA 1NC2D 3RTQA 2FB4L 2B2XH 5LXGH 3QPQC 4OZFA 1WZMA 5HGDA 4IDJL 5I19H 4L3CB 5JDSA 2AS5M 4WDIB 3DLQR 1D5ZB 3FT3B 4JY6A 2EEBA 1ZLUK 2BHZA 4WWID 5JXED 3BVNB 3MRQB 4Y4KA 5MENA 1A3QA 4WW2C 3U6RA 2YK1H 1MCBA 5FYKU 3EBAA 3JUYA 4N0UE 2Y9RT 2A6KB 3UO1L 4G6FB 4JRXD 3MOQA 2ZUYA 3MODL 4HBQA 5DRZA 2P24B 5I66A 2ZSVB 3REWB 4FQ1H 4FXGA 1RUPH 3FKUS 4OSUL 2OK0H 2ICWB 3ULVC 3KJ4B 4WWKC 2VLLB 5HYSA 2NLJB 3FAXA 1HXYA 3DURB 4OZIB 4OZGB 1F3JB 3ROLA 2BRRL 3I50L 1RURL 2XZCL 3QFJD 4O4YH 3RWGA 4XZUB 5B4MC 2ZUQB 5F3HB 1HHGA 1HILB 3PGDB 2GY5A 3TZVC 4Q6IA 1TPXC 1YC7A 3EFDL 1X6LA 5GS0D 1Y0LB 4Z0BH 1LE9B 1M7XA 1I7TB 1ACYL 3P2TA 4BFBD 3JSSA 1N6QL 4AIXA 3MJ6A 3WKML 5C6PB 4X7DC 1KJ2H 2NY6B 3R4DA 3HC3H 2NY1D 4D8PB 2F8OA 4FQQB 4Y16D 4BSJA 4MJIB 4J12A 1CGSH 2IAND 5F7MC 3NCBB 2IQ9H 4GRWF 5E95B 4NQSB 3C5JB 4BQ8A 1AQDA 1DQQB 3B2VH 3CAFA 1EERB 4GBXD 4KRPB 2CO6B 3NH7L 3BE1H 1D5XB 1EGJL 3S3JA 2AV7B 2J88H 3MOAH 4X6BB 4MQXC 1M7DA 2LFGA 1JHKH 3OPZH 2ZUUA 1QRNE 2VLRD 5HHNA 4EI5D 4G6MH 4OIIL 2WBKA 4MAYC 4Z7WA 3HAEG 1GC1H 3STZA 2X9XA 4PJCF 4GLRH 5DJZB 5E4EB 3O4LB 3ZYOA 2Q87A 1RK0B 2FO1A 2WUCL 3DARA 2YBRB 3EYSH 2PKDA 7FABL 1MHPH 4LLWB 3QFDA 3ULUD 1BQHG 2OL3H 3QQ4B 1TTUA 4A6YA 2F5BL 4PLKD 1QBLL 1G9MH 2JELL 4HKJB 1I7RA 1S5IL 4ZDHA 4EJ1C 3ECBA 3RY4A 5A40E 1F4XH 1TJGL 4JN2A 2GJ6E 4CW1B 1KLGB 1TZIB 1UKTA 1JTOA 2FLRT 3B83A 3IS0X 4HMCA 4WI6A 4RWYL 1JYVA 4L4TA 4GMSH 5ALBH 1B90A 1HWHB 1BQSA 1YNLH 4Y2DB 2HLAB 1MQKL 3OTTA 5L7XL 1L7TL 5C2BH 4YHZL 3KDMB 1K5NB 3HLAA 4JEGB 5L2KE 3MCG1 3RNQB 3QEUB 1T20A 5EFIB 2VZ3A 2X89D 3NFPA 3WFHA 5SWSA 3V7AG 1KPUA 4ODHL 1G7JB 3IDYB 2IWGA 1K85A 4O51B 3IGAB 4APQB 4X80H 1T89C 1UM5H 3MRHA 1ES0B 5E2JA 3DSNA 3SDCB 4HS3B 2EXWC 3SGEH 1DZBA 3H7BB 4KTEL 3GMOB 5F9WC 5DD0L 2WIIB 3DVNB 2W9DH 4NM4H 3GSNL 5DK0A 4CN6A 1SJEB 1A6VH 4I5BB 5D2LA 1G1YA 4OCXH 1KFAL 4ZOEA 1CD1A 1G0DA 2A74A 2ADFH 3QIBD 1F4WH 3HNSH 4HUWB 1JPSH 2ENYA 1Q72H 4NJ9H 4S1SH 4K2UL 4OCYH 2HVJA 4B41A 3L9RA 5ICYB 2G9HA 3N85H 4Z7QF 1IAOB 4LPUA 3A67H 4KI5E 3IVKA 2PR4H 3VXUB 1AGEB 3BZFA 1LO3H 1GC1C 3ARFA 5GGVY 1SY6L 2AEQL 1S5HB 1XGUA 1IC4L 2H2SD 2BVQA 4YHMH 2DQJH 2I24N 1I1FA 3VFRA 4U1GC 3DV6B 4I2XA 3WEXB 5IJVA 1CWVA 4POUB 5MEOA 1T83C 3T3ME 1FNGB 5I30L 3FZUC 3U1SL 4L3AA 5IR1A 3FRUB 4NQCE 1I7ZB 3BD4A 1FGVH 3TT1L 2DIJA 4KHXH 1KG0B 1G9MC 5EBWA 5GS0L 4FQPA 4QLRA 1G0XA 4G6AC 1MWAL 4P4RA 1IC1A 4TNWF 4PJDE 4DCQA 1U8PB 2FX8H 4FMFA 4LFHG 5JTWA 3BPNB 5LGJA 5IBLC 3H3BC 5HGHA 4JFOA 5EBMB 4YX2L 2VAAA 1URLA 4KH2A 4W6WB 3ZTJG 2O5ZH 5F7UA 2XG5A 1KNOB 2HJKB 4LMQI 3U0TB 5J6GA 2P5ED 4CVUA 1GHFH 3B9KD 1WZLA 3H9SD 3C09B 5IVXB 3KPQA 4YAQB 3X12A 2JCCA 1D6VH 2XXMB 1HOCA 5ABDE 4U6VH 1FBIH 2APBA 4KFZC 3SKOA 3RTQB 2Y36L 4I1NB 4GRLA 4OZFB 5HGDB 1ZHNA 1UA6H 5E2TL 3MNVA 5JDSB 3AY4A 3EDFA 3EHBD 4JKWA 4JY6B 1CU4L 2EDRA 4H1LA 1R0AH 3NZ8A 4KRLB 4Y4KB 5MENB 5E5MA 2P5WE 3AB0B 3GSRA 4U1LA 1GPOH 3QO0A 1XF3B 5ILTL 1RMFL 3CFCL 1QFUH 1XF4A 2HRLA 4I13B 4IOFC 1PD6A 3ULUL 4YDJA 4HH8A 2EEAA 3MRPA 3WE6A 1OP5H 5DRZB 5I66B 4FXGB 4XWOD 1A6ZA 4X7SL 1L6ZA 3CLFH 3IDUA 5HYSB 5CSZA 1HXYB 4U1MA 2NR6C 1GGCH 4MNGE 3ROLB 2FH8A 4F8TA 1LEIA 1E4WL 3RWGB 1Q38A 5D7IE 4AY0A 2P49B 3VI4F 5F6IB 3IFNL 1DBAH 5ACZB 4GRMB 1HHGB 2ZOKA 4HLZH 1KTKE 3R0NA 4Q6IB 1AGFA 1NUGA 2E8YA 1ZV5A 3OKMA 3HI6L 4QXUH 1EHAA 4WHYH 5AAMA 4U0RB 2B20A 3QEQA 3QNZA 3VFWA 3CVHA 3JV0A 1T1WA 5DD6A 4ZTPH 1BD2A 1KJMA 1B0RA 2YPLA 3ROOB 5DEFB 3GI8L 1CQYA 4GRWH 2WANA 3C5ZA 5DRXA 3KYKH 2O93L 3JVGC 3QDGA 1AQDB 3GIZH 1ZA6A 3WFDH 4PGCA 1BAFL 2H9GB 3VFVA 3FQXA 3GDBA 4OLXL 5DJ6A 1ZANH 5E7FA 1M7DB 2LQRA 1R3JA 3EDKA 1T1XA 5HHNB 2JB5H 3QDGE 4TN9A 4GLRI 3STZB 1F2QA 1S3KH 3QYCA 4PBVC 4KK5C 5DMGD 3BKMH 2IFFL 2HKFL 4GH7B 1DLHB 1IKNA 4MWFA 1MVFA 4AEHL 4DAGL 2DBJA 3SBWC 4M93C 3O0RL 4XPGH 4MJ5A 3QULA 3MCLH 5LGHL 2LABA 3QFDB 3RUGF 2R29L 5I8KL 1WAAE 1DBBH 4FFYL 1XCQB 4A6YB 2MJWA 5CD3B 1P6AB 1QFPA 2O5YL 3LKOA 4RCAA 4OQTH 4ZDHB 3ECBB 3K2UL 4TNVF 1CXEA 4M8QA 1ZLSL 4MD0A 3JWOL 1T2XA 4JN2B 3OAYK 3KR3H 2YPVL 3BDXA 3T0AA 2ZCHL 1QBMH 1EJ6A 3UJIH 2EXYC 4TVSa 1OW0A 4L4TB 1HH6A 3MJ8A 2ESVA 3QUXD 2XIDA 1MRFH 5DD3H 1TZHA 3O2WL 5KSAA 4M1GH 1CDBA 5T1LD 3QXUA 1Z9SA 3N06B 5KS9E 3EKCA 5FUCE 1EUUA 3WJJC 2Y25A 1T20B 5F7WC 3KWWB 3V6ZA 3NFPB 3WFHB 2BNQE 2FECL 3MRFA 5SWSB 4I3SL 1NFKA 5EBGA 3PP3H 3QCVH 3KYAA 1BEYH 4F7EA 1IEBA 3O4OC 2WQRA 3MRHB 1SBSL 3MBED 3T2NH 3KPRB 3SGEI 2A73A 2CKBA 2VC2L 5EUOA 4UTBH 1HHKA 3VFPB 2DQHH 3LAFA 3SE3C 4UV4L 2VYRE 4XVUC 2D7TL 2QADD 5EORH 5JLZB 1J1OH 4ZOBA 4LGPB 2O61B 2YZ1A 2A83A 2DQIH 3KPTA 3MRBB 5DK0B 1U8QB 2UZYB 2W65A 3IXAA 4X83A 4PRDA 4L9DA 2WW8A 4OCNC 3LVEA 2HN7A 1JBJA 3VXRA 4XNMA 5D2LB 1Q0XL 1CD1B 3PXHA 2A74B 3BGFC 1E0OB 2VL5A 1DBJL 4M62L 1L9NA 3T8XB 4JGJA 1U2HA 4RBPH 4CMMB 3L9RB 1KB9J 2DMBA 2G9HB 4LGRB 5ALCH 3IVKB 3BZFB 3KHOA 2V2XA 4MB3A 4MD5B 3ARFB 3KPSD 2ICES 2NZ9D 3IKCB 4Z7UF 5CMAA 3E2HC 2VNCA 5CINH 1XGUB 2BVQB 1JYXA 4QHKI 3HAEH 3S3SA 4DTGL 5CGTA 2IG2L 4P23A 5IJVB 2BCKA 3QUKA 4KJQD 4X6DE 3ZDZF 3LRHA 5MEOB 4NQVA 1YN6A 3EJYC 1NLBL 1CGWA 4JM2A 2FB4H 4UAOC 5IR1B 4YPGA 4XPFL 3ZKXC 1MY5A 2P48B 4IDJH 1PW3A 3B4NA 3QG6B 4TVPD 2C7UA 4YGVA 4JZJA 4PJHE 4P3DA 3P77A 2P7TA 2HT4D 4CU6A 5HGBA 1J87A 1QACA 4P4RB 5MEQA 4R7DA 4R0LB 4DCQB 2YKLL 3U83A 3DI3B 5LGJB 1TJIL 5HGHB 3LS4L 4OSUH 3CFEA 1T4KB 3OKEA 5J11B 4XBGB 1L9MA 5D7KE 3CPLA 4JFFD 4XH2A 3X12B 2JCCB 3I50H 4UDTA 2Z8VC 1RURH 2XZCH 1HOCB 1F3RB 3SKOB 4OV5A 3NIDF 3MRGB 4GRLB 1ZHNB 5JMOC 2FATL 5CHNB 3MNVB 4R96B 3EFDH 4IDLA 3RPKA 1OSPL 2VUOA 4LAQH 1G7QA 3QCUH 4Z7VF 3GSRB 4U1LB 4JFZL 4MSWA 2IBZX 3WKMH 3K4AA 4JQXA 5FOBA 2DYPA 4ZS6D 1JF5A 4YDJB 2AK4D 3MRPB 4G6JL 2UWEE 3WE6B 2CIKB 2CXGA 4ZAKD 1QSEB 3MNZA 3VG0L 2Y06L 1PKOA 4L8CA 4PG2A 5GS2H 5IKCA 4KUZL 1R3HA 5D70L 2JJWA 1EGJH 2WLYA 4M48L 5T1DL 4PV8B 3OR6B 5HDOA 2HTKC 1LEIB 2YZ8A 4XPTL 2IALA 1KT2B 2RIKA 2ZOKB 3IAQA 3L3DB 5KANG 1AGFB 2VMFA 4U3CA 4FNLL 5HHMD 3OKMB 4K23L 4PJ9C 5I6XC 4JRYA 5LWYL 4YHOL 3QEQB 2CLVA 3L5JA 3QNZB 4J7RA 2E27L 4JPVL 43C9A 3T2PA 4XC1L 4C59B 3VFWB 2J5LC 1T1WB 4FQXA 5DD6B 3IU4L 1S7TA 1BD2B 4NO5A 1KJMB 1B0RB 3QUMB 5J3HC 2YPLB 4JDZA 4M5ZL 4M43L 3MRRA 3C5ZB 3NCYS 5DRXB 2F5BH 2JELH 4OCRL 1S5IH 3OQ3B 2X4QA 2GITA 4OD2B 3SGDI 3ZKMC 3OKYA 3VFVB 3FQXB 1TJGH 4ZYKA 1ORSA 5DJ6B 5K9QI 4QXWA 1KEGL 1HKLL 4PRNA 2OR9L 4V2BA 1R3JB 1T1XB 1IZJA 4RWYH 4EKXA 5DJYA 4N0YH 5LBSL 5DJ8A 2FIRT 4HWEL 4KRNA 3HMWL 1L7TH 4YHZH 3AREC 1RQ5A 3NN8B 3QQ9C 1C12A 4NRZA 5C0DA 4PBXA 3ZTJH 4MJ5B 4PD4K 5EIIA 3QULB 4KJPD 4BFIA 12E8L 5CZXC 5JW3H 5IEHB 1WFNA 4CMHC 1EXUA 5I9QB 4ESKA 4MD0B 4EQ3A 5L9DL 3S6CA 2GYSA 3WIFB 4L4VA 4XVSL 2DJ4A 4KMTH 4KTEH 5LQBH 4LPYA 1ZT4A 5DD0H 5D5MA 4RAVA 1G6RA 2ESVB 3GSNH 4HGKC 5I71C 4RMVA 1TTGA 4OF3A 2JB6B 3VJ6A 1KXQE 1Q9OA 4KDTC 4YBQC 4TVPL 2PNDA 4HX1A 4AK1A 5KSAB 4PB0L 4OGAC 3DHJA 2XQYK 1FVDA 2Z31D 4KKNA 2AXJA 3N1GC 4K2UH 3GMRA 3V6ZB 1P5UA 3CDCA 4L8BA 1KB5L 3MRFB 4K3EL 3I6LD 4RZCA 5E0QA 2B0SL 5T3XD 3TN0C 3MUY1 3GBLA 1SY6H 2AEQH 1UXWA 2QQKL 4F7EB 4XTRC 1YUHB 5HJ3A 4R4BA 2A73B 2CKBB 5EUOB 1HHKB 1IFHL 2NTFA 1KXTB 3AUVA 3THML 3GBMH 4L4JA 3IU3A 4U6YA 1BF2A 2A83B 1Z3GH 3SDDC 1FE8L 3U1SH 3IXAB 3UTTE 4PRDB 2B39A 2HN7B 3TT1H 2GQHA 4OT1H 5GS0H 3U30B 4FTVA 1UM4L 3MROA 4QRQA 3KXFE 5C0AE 1FLRL 4DN3L 3RHWF 5E08L 1IGYA 1Z2KA 2VL5B 5EDXA 2BVTA 2DBLH 1MWAH 3HI1A 4E41D 4FQIL 4PJ7A 1NGZB 4GW5A 3UZEA 2DM2A 1A6TA 1HNFA 3T0EC 3L3JA 5DMKA 5DURD 3QPXL 1YEDB 5FGBC 1TCMA 4IRJC 4PJAB 5TQ0L 3F7VA 4EIGB 1EHLL 2V2XB 1NAML 3GJFH 4JQIL 4U6HA 5D6DA 2OXHA 5CMAB 4Y4HA 4Z76A 1P5VA 5BVPH 1SEBA 1U3YA 2GI7A 1A47A 1WFOA 1PZ5B 3C6LB 5LAXA 3GHEL 3OKLA 2DL2A 2OZ4L 1S9KC 3GFUA 3QUKB 3WHE1 3DXAA 4LVNB 2QQNH 5DFVD 1A6AB 4ZNCD 5I1CL 5B39B 1YN6B 2LU3A 4LPWA 2YOCA 5JHLL 2BSRB 4LSTL 4YPGB 3VI3E 5C08E 1HH9A 4HF5H 4PJ8B 5E2TH 4YXKH 1DANT 3BQUB 3QJHA 1D5MB 3DXAE 3OB0H 4YGVB 4JZJB 3H2WA 4M3JA 4P3DB 4XCYB 3P77B 5BV7L 2P7TB 3O3AB 5HGBB 1U92A 5MEQB 2GK0B 4ZSOB 2DLGA 1CLYL 2CR6A 4R7DB 5FEBA 1YEIL 5ILTH 1RMFH 3GJEA 4S0SD 3ULUH 3SDAC 5LKNA 3CDGB 1HCVA 1KLUB 3UBXB 4X7SH 3OKEB 2VDRL 3DECA 1J1XL 1ZT7A 3HG1A 2VXUL 1GGYA 3ARBB 4PJXA 3R06A 5DSCA 2F53E 1OPGL 5HGAA 3TPKA 4XH2B 1CVRA 2BK8A 4UDTB 4J2XA 4W81A 4OV5B 1E28A 1T2JA 1YPZE 5DA0B 2VDKL 4YO0B 3W11D 4B0MM 2VXVL 4FG6D 4GOSA 1CTNA 1YMHA 4G3YL 5SX5K 1T6WA 3G6JB 3HI6H 1J0HA 3T3MF 1UZ8A 5CUSL 4JKKA 3OZ9H 1G7QB 4LPXA 3SJVD 2ICCA 1G84A 4UBDD 4OD3H 1U3ZA 1EHXA 3RY6C 3WYRA 1F4AA 3FB6B 4MSWB 3AFLA 4QRPE 5IWLC 3ZO0A 1JZ8A 5KVFL 2DYPB 3GI9L 1MH5A 1CDUA 3C6SA 1IQWL 1RVFL 2A77L 1L0YA 4QXTA 2IH1A 4JKMA 4NKIL 5C07D 3O3BA 3ARTA 3MNZB 3PF2A 4PJDF 1WEJH 4OKVB 3SY0A 1MAMH 5IHZA 2PYFA 5I8OL 3TH2T 4L8CB 5IKCB 1R3HB 4OLXH 1BF8A 3TP4A 4NUJB 5FYLE 3KJ6L 4JFDA 4F9LA 5IQ7L 5JR1L 5CLTA 2CUHA 1T3FB 1FFPA 4Y16C 1FJ1A 3BD3A 5I1EL 1MRCH 4I0PC 3H9ZA 4Z7NF 1WFUA 4X6CA 5DQJA 2IFFH 4OQ1A 4JRYB 2HKFH 3WNOA 4AEHH 2CLVB 2IMMA 1LO0H 1C16A 4N0CD 4Z95H 4FQXB 5CZKA 4NO5B 4R3SA 1U3HD 2R29H 5I8KH 3EIFA 4FFYH 3MRRB 1KLFA 4XX1E 2O5YH 5HDLA 2X4QB 2GITB 3K2UH 1UWXK 4HWZA 4ZYKB 4WGWB 2YPVH 2ZCHH 4XXCA 1ZXQA 4QOKE 4PRNB 4XMPL 1RJLA 5FM4A 1KYOJ 4H88L 4ONGL 2H32H 5DJYB 1T66D 3K4ZA 2LAGB 1QPXA 2EDFA 2Y23A 4WUKH 4NRZB 1NGQL 3O2WH 5C0DB 5D71H 3MZGB 3I3BA 5EIIB 1D5IL 4IRSA 4BFIB 4NN5C 5HHXH 1UFUA 3ALPA 4WTWA 3TVMC 3QZWA 3BKYL 4E5XA 1QYGH 4JHZA 3V6OA 2WBJA 3CFJA 1EXUB 1X44A 4PRIE 2YD6A 4CAGA 1SBSH 3QQ3A 1WBXA 5DXWA 1KCSL 1QHPA 2E7CA 3ARZA 3FL7A 4L4VB 5FYJE 1YEEL 3WO4B 1JUFB 2AP2A 1AR1C 2KQMA 4UV4H 4EXKA 2XNAA 2D7TH 3FB5A 3WJLC 4LEXL 5I1JL 3VFGL 1ZT4B 5D5MB 3LEVL 4KPHL 3V6OE 4RAVB 1GXEA 5ISZD 5DJCA 3SCMD 3VJ6B 1S9WB 4XCNA 1G7IA 1Q9OB 3ME0A 4E42A 1V3LA 4HX1B 4HDIB 5KSUA 2PW2B 1DBJH 4LQ1A 1FVDB 5DJ0A 5BZWA 3O6FA 4JHWL 3ILQC 2C3WA 3RVTD 4FQ2L 1KV3A 4L8BB 3AGVA 2FD6L 3MRLA 3W0WA 4RZCB 4D3CH 4XAKE 1FRGL 3SKJH 3WHE0 3NPSB 1UXWB 1CI5A 1WAAF 1JZ7A 3QCTL 5FCSH 3SE9L 4R4BB 2HLFD 4WIQA 1HQ4A 4KKAD 4P5TC 2Y7QA 3QIBC 3NPZB 3VWKA 2IG2H 4KUCF 4IRZL 3BHBA 3MJ7A 2CK0L 1WFTA 2NTFB 4X7FC 3WFZA 3CU1A 5I76A 4U6YB 2BSSA 5F9JB 4XNZB 3D85A 5I75B 5CJBA 3SDXF 3FB8A 2W0PA 4MJID 2Q3ZA 4HC1A 1KJ2B 1FV1A 5HBBA 4LVOC 3VGGA 1F58L 1IGYB 2VERN 3HI1B 5CEYA 1S7UA 4XI5D 5I8EA 5D7JD 1BZ7A 2IADA 1A6TB 2RHEA 4LCYA 5DMKB 3R8QA 3O11B 3U4AA 2A6JB 5JPNA 1C5BL 3UYPA 1CF8L 3F7VB 4U6HB 1HZHH 4ZUSA 4RA3A 4V1DE 4Y4HB 3TV3L 3UZVB 3GB7A 1X9QA 1UJTA 1AD9A 4S2SA 3FQUA 3EDDA 3OKLB 4JVUA 5C9JA 4J4PD 4OZHA 4MS8D 1CFQA 1I1AD 4WJ5A 3TC9A 4GQ9H 5CEZD 3VFUA 1JHTA 4KAQH 3LZFL 4OV6F 5SV4A 5T5FL 5FKPA 4O2EB 1XF5A 5EOCL 4M1CD 4RGMC 1YYLL 1HH9B 2EH7L 5D7LA 3MJ9L 2IPTH 3QJHB 4OJFL 3OBAA 4XP9L 1KCRL 2YRZA 5D2NC 1OSPH 1O5DT 1NFIB 2ORBL 3UPCA 4JFYA 3STBA 3L5IA 3WIIH 4U4BA 2IBGA 3U0PA 1MSPA 4G5ZL 4MXVE 3UEZA 5EN2A 5E8EB 3TBWB 1WVZA 3GJEB 5L6YL 1IT9L 4PLJC 3RDTD 2X1PA 2XQBL 3VG0H 2ID5A 4LIQE 2FBOJ 3Q6GL 3P4LA 4PJXB 1ZT7B 4OGXL 3TBSB 3KLSA 1NH6A 1A7OH 2PO6D 3R06B 4QTHA 5DSCB 3O2DA 1L0XA 1VB9A 1EO5A 1U8JB 2WV3A 3S5LB 4XPTH 2EZ0D 4X9BA 2VLJB 1E28B 5GHWH 5F9OH 3HZKB 3U82B 3GKWH 4X6DF 3SKUD 1YMHB 3L3IB 4Y5YA 2IGFL 4FNLH 3TFKD 5LVEA 3WN5A 4K23H 4PJ5B 2AJUH 1UZ8B 4YHOH 1A5FH 3QIUC 2J4WL 2E27H 4JPVH 4XC1H 1N26A 1DL7L 4HG4K 1IEAA 1OT1A 4HCRH 1G0YR 2Q7NA 1ADQA 2WMPA 4PJHF 4HEME 5CSGA 1MH5B 3C6SB 1QSFD 2R9HD 3VGHA 2OI9C 2IH1B 4M43H 5FKAA 2ZG2A 1FZMA 5HD8C 3O3BB 1J86A 3S35H 3AXLA 3SY0B 3MZTA 5IHZB 4YDKH 2PYFB 4OCRH 2QQQA 4Y1AB 3KYNB 5AZEL 1GGIL 1CDHA 3QHFH 1F6AA 4OB5L 3TJHD 1HKLH 2OR9H 3MOBL 5I2IA 5JW4R 1ZHLB 1FFPB 1S9YA 2AERT 3MLTB 1FJ1B 5CILL 3TO4A 3MSPA 3TIEA 2QR0B 5JOFA 1U8KA 4DZBA 4IJ3C 3HMWH 5DQJB 3VXUD 1MI5A 3MV7D 2K1MA 4I77H 1R3KB 4PUBL 1C16B 4AJ0A 3LPFA 4PYHA 1IBGL 1YZZA 1SYSA 5D1XC 2MHAB 4R3SB 4P4KA 1EH9A 4RFNC 3PUCA 3U4BL 1YMME 4K55A 3R1GL 1JPFA 4S1DD 5IW1A 3JXAA 4L9LB 1MEXH 3FFCD 5SWZA 4F37K 2UWEF 3BRDA 4F7TB 3ARYA 4TUJA 5L9DH 1AHWC 2YMXH 4BFGA 2L7JA 4P5MA 2EIZA 4XVSH 1I1RA 4C56A 2B4CH 3EOBA 5D96C 4ETYA 2KKQA 1RJLB 4UT9H 1KBGL 5ICZA 2HTLC 3B9DA 4EDXB 5KZCD 4U7MA 1J1PL 2E9IA 5MEPA 1K6QH 4JO2L 3K74B 2BVOB 1FPTL 4I3GA 5DRNA 2A1WL 3RVVC 3PGFH 5HTSA 3MLSL 2CMRH 5BS0E 4QGYA 2DWDA 3TYGL 1GJIA 1N3NA 2BNRA 1TETL 1BVZA 1EPFA 2CDEA 2FECI 5HI3D 1U0QA 5L8LB 1KB5H 4K3EH 1YEFL 2Q8AL 4GKZB 4EN3C 1UJ3C 4M93B 5DZOA 4E5XB 3F12B 3QUXC 4NQEE 2X42A 2QQKH 4L5FL 1YC8A 3CFJB 4X9IA 3HPLB 3QQ3B 1WBXB 4GXUM 3VRJB 4NHUA 2J1KA 5JUEL 5E00A 3OF6A 1IFHH 2XNAB 3FB5B 3QIWC 3THMH 5CEZL 3PQYA 4OZ4A 4WI9A 3ZSSA 1FE8H 4KVCL 1V7NL 2XACC 4JB9L 1EDQA 5DJCB 1FP5A 5C6TL 5JXAL 4XCNB 1G7IB 4NUGL 2E7LC 1UC6A 4AH2A 2RCSL 4ZUVA 4E42B 1UM4H 3V52H 4DN3H 5ITBL 1FLRH 2VDML 4L3EE 5KSUB 5K9JL 5A2LH 1NC4A 1QFWM 5BZWB 3O6FB 5EO1B 1N0LA 1KN2H 1DANU 2HFEA 1P9MA 2Y72A 1OVZA 3QPXH 2DM3A 3MRLB 4RRPA 4X5WA 3W0WB 5TQ0H 1EHLH 1MUJA 3RZCC 3P0VH 2JF1A 3EDEA 4NZJA 5F3BA 1FYHB 1KACB 5GGTL 3WFCL 5DO2D 4UTAL 3GHEH 2Y7QB 4FS0A 2OZ4H 3VWKB 2RFXA 3BHBB 3MJ7B 3G5XA 2JE8A 2D7PA 5I1CH 1B6DA 4NO0A 5JHLH 5I76B 2BSSB 3LEXB 5HYEA 5IEKA 4LSTH 3D85B 4NP4H 3M8OL 5KVGL 3FTGB 3UROR 1DEEB 3FB8B 4UILL 1FV1B 4ZOAA 1QRND 5BV7H 2NXZB 4HK3N 5CEYB 3RVUC 4RGNE 2BSTA 2CPCA 5I8EB 2B4CC 1YEIH 1RI8A 1SHMA 2CLZA 4KJQC 5GRWA 5T1KA 3QI9A 4WI8A 1DVFA 2WWKT 1EAPB 1XGYL 1IQDA 2M26A 2YD2A 4P57A 2R4RL 1CBVH 2J8OA 1SM3L 4P2QB 1WWBX 1AD9B 4S2SB 3FQUB 1J1XH 3U2SA 2VXUH 3GBNL 3MV9B 5FK9B 4OZHB 5C9JB 3H9YA 1BJ8A 1CFQB 1OPGH 3GSUA 4WJ5B 5J06A 1AO7A 1JHTB 3QO1A 4G8GA 4Y5VA 1I8LA 4XNUH 3B43A 4UUJA 4C54A 4K7PX 2GJ6D 4JO3H 4K9EL 1G7MA 4G3YH 1RZFL 4WCYL 1QSEE 3TJEL 5IROA 1SEQL 2X09A 4HAFA 3H8NA 3BXNA 3UJJL 3PV6A 4JFYB 4XVTH 3PHQA 5FUZL 4AYFA 3U0PB 5EN2B 2DQDL 5KVFH 3GI9H 1RVFH 2A77H 3EOYG 1NCAL 4NKIH 3MQIA 4L4TD 5D1QA 3BW9B 4PY8J 5FHBL 5F7DA 2V7HB 4LVHB 1NC2A 3BX7C 4LDOB 4LLDA 1L4IA 1JNNL 4QTHB 4HULB 2G5RA 4LSQL 1MLCA 1J0IA 2ITDB 5IQ7H 1DTUA 1FVEA 3BMVA 3KVQA 4P2CG 4FZEH 1IAIL 5BXFB 5I1EH 5JXEA 4Y5YB 5BW7A 1B2WH 3HC0A 4YFLF 1NCUA 3VI3F 3P11L 5B8CC 3DX9A 4JRXA 5ANME 1IEAB 4PP1D 3LQZB 4QCIA 5I8CB 5F44A 3WIHH 1Y18A 1P7KA 5FKAB 1FZMB 1RK1A 4YPJA 1O7VA 4MCZB 3B9VA 1GL4B 3HRZA 1ITBB 3QFJA 4H25B 4HS8L 1F4YH 1N59A 4KI5D 3S35X 1RZGA 1F6AB 5BV7C 1HHJA 4ERSL 4XRCB 3QDME 3GMLA 5I2IB 4H88H 4OLWL 4G8FA 4ONGH 4JG0L 4PB9L 3TO4B 2E9JA 3IAPA 5JOFB 1U8KB 4DZBB 1IE5A 1KOAA 1MI5B 1YPZF 2E8ZA 3O3EA 5GGRA 3ARFD 3MXVL 1NGQH 2A6DA 2FWOA 5BJTA 2YUVA 3JWNC 2JTDA 4NQCD 1SYSB 5E9DE 2XZAH 5T3ZL 4P4KB 4XNXL 5C1MB 3HAEB 3C60C 4MA1C 5F9AC 1JPFB 4GBXA 3NIGE 2J5LB 3QDJE 3RL2B 3BKYH 1EA9C 2FR4A 4KROB 4TOYH 1U8NB 3GMMA 4TUJB 2VLRA 4EI5A 1KCSH 4Z7OE 1MCLA 2EIZB 1YEEH 4C56B 4AIOA 5EA0L 4JHAH 3EOBB 4OIBA 5JO5A 3JTTA 1BIIA 1OGTA 4MA7L 5C0ND 3PNWA 5DDHA 5ICZB 1T7YA 2IBZY 5HDBE 3VFGH 5I1JH 1MPAL 5MEPB 4ONHA 4TUKL 4TSAL 2I9TA 3MRJA 1MCJA 4YDLC 1E27A 1S7QA 4QRSA 4DFIA 3NFSL 4C58B 3S36H 2DWDB 3BPCA 1K8DA 5H8DA 5DUPL 4JHWH 1A1MA 4LOUD 1N3NB 2BNRB 2J6EA 2CDEB 1VEMA 4FQ2H 4PJFE 1EMTL 1E6JH 1INDH 1XFPA 5JW4Q 1FRGH 4YE4L 1GVIA 3MLPA 4MGXA 3GO1L 5DA4A 1ZEAL 3QCTH 1K9TA 3SE9H 1NUNB 3O9WC 3EOTL 3IRZA 3GK8L 3ZT5A 2ZSWA 3L7EA 4IRZH 2R0ZH 2CK0H 1UM6L 5E00B 5J57B 3PQYB 4OZ4B 4CMHB 3GSOB 1W8OA 3B2UC 5F9DC 5J1SC 2XXCB 4OZFG 4U1KA 1KN4L 2FBJL 2LTQC 5DTFB 2WINB 4PJAE 1QLEL 2XWJA 1ERNA 2BDNL 4ZUVB 2WZPD 4A6YL 2X89A 2Z9TA 1F58H 4KGLA 4QTIL 4JFHE 3A6OA 2XYCA 1DQMH 1VPOH 2HFEB 4HAGA 2DAVA 1FAIL 1E4KC 2PXYC 3KLHC 1UKQA 1IEHA 3BPOB 5EZIH 3SPVA 2APVA 4D9LL 4X5WB 4X5LA 1OTSD 1PLGL 1MUJB 3QXDB 4RAUA 3TV3H 5F3BB 5HYSG 2CK2A 2ADGA 2NY2B 4DZ8A 5GXBB 1FG2A 3QB7C 3VXMA 2RFXB 3G5XB 3N1QC 1FYTB 4HFUL 5SX4H 4GKSB 5IEKB 2FSEA 2EH7H 5EOQH 3MJ9H 4K7PL 4W4OC 2F19H 5JPMA 2RB8A 4MDJA 4XP9H 1KCRH 3L5XH 4Y4FA 3C5ZD 5FYKE 4M8VA 1HHHA 1CDIA 4HQQL 4PRPE 3SDDB 2ORBH 3AM8A 3QDGD 5FM5O 2FJFA 2BSTB 4DK6A 3IJSA 2CLZB 3P30L 5T1KB 3QI9B 3HN3A 4FABL 1F3DJ 1IQDB 2EIDA 3BKJH 4LHJB 2BERA 4KJWD 2XQBH 4P57B 1K3ZA 2GTWA 3QDHA 3G6JE 4OGXH 3U2SB 4F58L 4WO4D 1XCTB 5I18H 5DF0A 4JO1L 1AO7B 1QOKA 3QO1B 2FEDC 4HK0A 1JZ3A 4UUJB 2EDDA 1G7MB 2JJSA 2IGFH 5I73C 1AGBA 4FHBD 4AEEA 2AJVL 3L7FB 1BFVL 2HVKA 1KENL 3PV6B 4LSSL 3PHQB 2IH3A 1I1YA 3W2DL 5J0BA 4LQFL 1IRAY 4DEPB 3GHBH 2NY4C 3ULVE 1A7RH 2DDQH 4R8WL 1A22B 1FIEA 4WV1A 3MRDA 3T1FA 2P5EA 2N1KA 4NN7C 3B9KA 5GJTL 1WBYA 3H9SA 2OR7A 5IVXF 5FAAA 5F7DB 5AZEH 1GGIH 1NC2B 2BNQD 4LLDB 4OB5H 1S7XA 3MRCA 1TQBC 1FVEB 5KSAD 5HHPA 5FGCB 2BHUA 4K8RL 3NA9L 2AKRB 4Q7DA 4F3FA 3HPJA 3SQBA 3GSVA 1R5VA 5CILH 1CZ8L 4PJBA 3HZMA 3HC0B 1JPTH 5B22A 1CDYA 1RFDL 3DX9B 4JRXB 5KJRH 1IBGH 4JQVC 4QCIB 5F7YC 2I9LA 4MAYA 1Y18B 2E7HA 4QT5A 4AQ1B 1A9BA 4XNQA 3V4UH 4P2RE 1RK1B 3HE7C 4M00A 1A6UH 3FFDA 2FX9L 1MVUB 43CAA 2DLTA 3HRZB 1MCCA 1TCRA 5F1IA 5EU6A 3QFJB 1N59B 4M61A 3RWHA 1BJ1H 3VXRD 1RZGB 4U2YA 4QRRE 1HHJB 1CLZL 1D9KC 4R4FL 1WWAX 1OAXL 1JVKA 1FCGA 3GMLB 3EO9L 5ERWA 3CXDH 1BJMA 2G60L 4G8FB 4JO2H 4NKDA 1T04A 5EU6E 4G80A 3QWOB 1JK8A 1FPTH 1BREA 3UXFA 4LU5H 3G5VA 4LMQE 3FJTA 4JCMA 5EO9A 2A1WH 4G6KL 3MLSH 3O3EB 5GGRB 5CP7A 1JMXA 2H1PL 1NLDL 2A6DB 5BJTB 5K9OA 2NY1B 4Y16B 3HMXL 1P4BH 2EDYA 2IANB 4HT1L 4YIQB 1TETH 4WFGE 3V8CA 2AQ2A 4PJIE 1XF2B 3FOMA 3OV6A 2Y6SC 1TNNA 4P23D 2Q8AH 3UTSE 4JREC 4GBXB 1QR1A 5HHVH 1T7VA 4P2OC 1CK0L 4ISVB 4O9HL 3OJ2C 5BVJA 1T66C 4JM2D 2FR4B 4L5FH 4P2YA 5HPOA 2VLRB 4EI5B 1T7XA 1H5BC 2CKNA 2IAMC 5JO5B 5JUEH 4KQ4L 3DVGB 3PNWB 2W1NA 2IC2A 4OGZA 4ONHB 3O6LH 3CVHL 4U1HA 5HVHC 1MJ7H 2NX5E 1T1YA 1C08B 5D7KD 3VWJD 2I9TB 5C6TH 1CE6A 1E27B 5JXAH 4NUGH 1EJOL 4QRSB 4TNWK 1FH5L 1PG7W 1PEWA 2ITCA 3BESR 4PJGA 4EUPA 2YXFA 5GJSL 4FA8A 1CDJA 3HI5L 5K9JH 3BPCB 1K8DB 1VSCA 4Z5RA 4P3CL 4KKLD 4N5ED 1U58B 3EO1B 1RIUL 3WSQL 3TH4T 3QP3A 2LVCA 3GNML 4RNRA 5D93B 2FGWL 1B4JL 3L5WB 5KG9A 3IB4A 5GGTH 2SEBB 4CUCA 4P9HL 1NUDA 3L7EB 5C3LD 3KJ4C 5DGRA 2I25N 1T03H 2QSTA 4DW2L 3RVTC 4B53A 1U8OA 3T0DA 4Q58C 4BA8A 2DOCA 5EBLB 3ZMRA 5T1LA 4G7VL 5KVGH 2XWJB 4JPKL 4XPHL 4KY1H 5FXCH 3QJFA 4H1LG 1CDGA 2DQGH 2ZUQC 5IB1A 2F54E 2NY3D 2Y1VA 5C09E 1NGPL 2CUMA 1JF1A 1GGUA 3WFEH 3CFDB 3VXNA 5IB5A 5E6YA 3SPVB 1NGWA 4P0DA 2OL3A 3MBEA 3GUTA 4K71B 3T04D 3I6KA 4RAUB 3VXOA 2NY6C 1UWGL 3WFEL 2ADGB 1SM3H 2OTUA 1T0MA 3SE4C 3PHSA 5KW9L 5IT2L 3GBNH 1FG2B 1I3GL 4P5KA 2CUIA 4U3XA 3VXMB 1XT5A 1ULVA 2X4SA 4PGBB 4B50A 5ADPH 4ACPA 3CX2A 5SX4I 5D7JC 3RU8L 3CJJA 1A9EA 2FSEB 3QIBB 2OBGA 4K9EH 2OJZH 1RZFH 1B0GA 4WCYH 4MDJB 1II4E 4LP5A 3FQWA 1OB1A 1SEQH 3QA3A 1HHHB 2QHRL 2H26A 3UJJH 3WHXA 1Q9LA 5J9PA 2VITB 2FJFB 3QRGH 5E4EC 2F9BT 5FUZH 3IJSB 4CVXA 5I15L 4KJYA 4HKXA 1NCAH 2GK2A 3WNLA 2VLJE 3DGGA 1GZQA 1MJUL 1ZWIA 3I02A 5FHBH 2GTWB 4HUUA 4OCWH 4S1RL 4RSVA 4NCDA 4MX7A 4U7SA 4PJ5E 2D0FA 4WI7A 1JNNH 4NBXB 3BN9C 4LSQH 1RZJL 4WTXA 4HK0B 1IAIH 5HYFA 1SJXA 1CG9A 4WW1A 3DETD 1PYWB 1AGBB 5DVKA 1PZUB 3MYZA 4K3GA 4Y2DC 3P11H 1XIWA 4EIZC 4M7JL 3IDGA 2IH3B 1I1YB 4LSRL 1TJHH 2JIXA 1NMBL 2J2ZA 3HB3D 3ILPA 2EYSA 5EH1A 4J8RA 4JZNA 3C8DA 1NKRA 4BQCA 4WV1B 4I0CC 5JZ7D 2P5EB 3B9KB 1WBYB 3H9SB 2D4FA 2VH5L 2XPGA 2J8UE 3HR6A 4OZFH 4HS8H 4X7EC 3IDYC 4LHQB 3TBVB 2F58L 3IXTA 3KPPA 4J3VA 4UMGA 1JP5A 2AI0L 4K3JL 4ERSH 3S88L 4LSVH 4APQC 5HHOE 3F6LA 1S7XB 2G2RA 3MRCB 1KULA 4OCLC 5HHPB 2HFGL 3QSKB 2YS4A 4G9DA 4F3FB 3SDCC 4OLWH 4PB9H 3GSVB 4MZ3A 4KKCD 1T5XA 5H94A 3OG4B 4PJBB 2X4NA 3JVGA 2XKUA 3HZMB 3UAJD 1MCKA 4GXVL 4QEGA 2ICWI 3KPLA 2I26N 1N64L 4JKPL 2C3XA 1CD9B 2AK4A 4DKAA 1X5IA 4R7NB 4ZAKA 3UTTD 5CEXB 1NAMA 2ATKA 2D0HA 1S78C 1BBJB 5T3ZH 4CDGC 4LLYA 3P0GB 2I9LB 3ULSA 1VFUA 1LP9A 4QT5B 1A9BB 3KXFD 1EFXA 4XNQB 5C0AD 1XGQA 4GMTL 4G8EB 43CAB 4K9EC 2VWEC 1Z9MA 1TCRB 5DMIH 5C0FB 1RAMA 4ODUA 5TH2A 2OSLA 1T6VN 3LSOA 3RWHB 4M61B 4WTZG 2O26U 3TGXA 4AG4L 5BOZG 2PUQT 2ZNXA 4YHPA 4FTVD 4LCWE 4PGEA 3X3FL 3QBTB 4MA7H 1HYRC 2FHCA 5ERWB 1EEUA 1MPAH 4MNQE 1OLLA 5JNYB 3VRIB 4TUKH 4NKDB 4TSAH 4H8WL 1I8IA 5EO9B 3BYTA 1U36A 4PGDB 1S7RA 3OMZA 2ZKHL 3S9DB 3ZE2F 5DUPH 3UC0L 1PY4A 2A0LD 3I9GH 5C08D 3LKQB 1OAZL 3B6SA 3FOMB 3NZHL 4LNVA 3IFOA 2DI9A 3DXAD 5EWIH 4IHOA 1D5BA 1QR1B 2Q20A 1LO4H 3V5KA 3GO1H 1ZEAH 4F7PA 3BPNC 1WZ1L 1F45A 3EOTH 3GK8H 1MIML 4UINH 1NEUA 1YY9D 1UM6H 3VXQA 1OGAE 3FO1B 4U1HB 4JR9L 4F2MA 3OAZH 1T1YB 3C09C 1W72A 3LY6A 1KN4H 2FBJH 3D39E 1CE6B 2F53D 4IEFB 4YHKL 2BDNH 4NWUL 3CUPA 4A6YH 3RTQC 1IJ9A 5CJ8A 3SE3A 1INQA 2WIMA 1FAIH 3FQNB 5BZDA 3HG1D 3BH8A 4DVRL 4GW4A 4GKOA 3MV8E 1NCBL 3O2VL 4D9LH 5F8RC 4Y4KC 5DVOA 3T77A 3ARSA 4RNRB 4NT6A 1MOEA 2VIRA 5KG9B 4QRPD 2VUYA 3NIGF 2AQ3A 1U95B 3KHQA 3M07A 4ODTL 1C5DA 4GRWE 3QUXB 5CCKL 1JI1A 3Q3GA 1BWWA 2NZIA 5I1LA 1U8OB 5TQ2L 4PJCA 2AQ1A 4PRHE 4MHHG 4WI4A 5T1LB 4PTTA 2Z31A 3LRSA 5FYLD 3SKNA 4NNXA 2GJZA 5F6IC 1JTPA 1P7QD 4J3OC 4Q6IC 4MNHB 5EU5A 1JF1B 3HUJA 3BZDA 3MV9E 3P30H 4OCSL 4U0RC 3VXNB 1NGWB 3SKMA 2K3TA 4K7FB 3MBEB 4JFDD 4UU9A 5EUOF 3PXJA 1RULL 3I6KB 4IMKA 2GW5A 1F3DH 4PJFF 3VXOB 1MFAL 3X17A 2OTUB 1G6RL 1T0MB 2QADB 1A7QH 2IBBA 1MHEA 3T0WA 1MFNA 3RGVD 1FL6A 4M7ZB 3VXPA 3K0WA 4RA0C 4F58H 2X4SB 5BRZE 4JO1H 3ES6A 4BQ9A 1MRDH 3QRFM 3L3OA 1Z9OA 1A9EB 4EXPX 4NJAL 1JMZA 4E41A 1B0GB 3IDXH 4QOKD 5EUKA 3FQWB 1OB1B 5F71A 3QA3B 3TPUA 1YEGL 4I18B 2AJVH 2H26B 4U6XA 4XCCH 3WHXB 1Q9LB 4PJAF 2BMKA 5J9PB 1WBZA 4N0FA 3G04A 4HKBB 2HJLB 2BVPA 3KPSB 4CVXB 2X1QA 4X4YA 4CN4A 4HKXB 2LV4A 4R8WH 5GGVL 2CDFA 4XVJL 3ZTNL 1CL7H 3DGGB 4NOBA 5MP6L 1GZQB 2CJUL 4JFXA 3TM6A 1TDQA 4HUUB 4HJJH 4MX7B 4PY8I 5KN5A 3RVXC 4HUMB 1CLOL 2K7PA 5L2JA 4HXAL 2PYEE 5EO0B 3TF7C 4K8RH 1MFEL 1IAII 2QSCL 4TQEL 4PRID 4UT6L 4IRSD 4FFVC 5F1KC 2A9ML 4NNYA 5FYJD 5IF0A 2A9NH 4Q6YA 4KK6D 4QO1A 1ZSDB 3SQOL 1OAQL 4M6OH 1KB5B 2OS7A 3IDGB 3TCXA 2WBJD 5E03A 3UYRL 2JIXB 2X4PA 4KHTL 3ILPB 2EYSB 4L1DA 5DI8A 4JZNB 2ZPKH 1QQDA 3TIDA 4DGVL 5GSVB 1B9ZA 2XPGB 3ZLQC 3C8KA 5EZJA 1ETZA 1TXKA 3R0MA 5T5NG 1CTOA 1CE1L 3WLWD 3U7YL 5JORB 1FSKB 3QNYB 3KPPB 5ACMA 2EIBA 2G2RB 2XWBB 4PP1C 3KLAA 1OAXH 1UGNA 3G6JF 4H1LH 3EO9H 4G9DB 1NBQA 1OD9A 5GRUH 5I1KL 1T5XB 3SJVA 1TLKA 4MYWB 4G6KH 3WV0A 2H1PH 3NGBB 1NLDH 5CJOL 3KPLB 2AK4B 4ZAKB 1NAMB 5C07A 2DQEH 1HCFX 4NHCL 4BQBA 1W0WA 1X5GA 1KB9K 4LLYB 3G6AA 1LP9B 5E70A 4P9ML 1EFXB 4OFYA 1XGQB 4O9HH 4K07A 5E99L 1ZVSB 4OCMC 5CGYD 3ULVF 3OXSA 4Y19A 5GRVL 4ODUB 2FH6A 2OSLB 3ARFC 1YEHL 3O8XD 4IIQA 4LARL 4JY5L 4YHIA 2Q7YA 2C9AA 4ZUUA 2C4FT 4KQ4H 2C5DC 3HE6D 4V1DD 1IM3A 3CVHH 4J6RH 1Z0NA 1I8IB 4M5YL 1EJOH 4YDIL 3S8WA 2DQFB 1S7RB 1FH5H 5DUBB 5FYLL 3DYPA 2PTVA 5GJSH 4KV5F 3U46A 1U3HA 3EYOA 4BQ6A 3QT2A 3DJ9A 4P3CH 5DVLA 3X11A 3B6SB 4GUPA 4K8RC 3IFOB 3WSQH 1DN0A 1D5BB 3ALXA 2V5MA 1FIGL 3GNMH 3V7AE 4PV9A 2FGWH 4R0LC 4UT7L 5IB2A 1B4JH 4F7PB 1EZVX 2A6IB 2DKUA 1BM3L 1I85A 2FYYB 4FFWC 5D7LD 5ACLA 1W0YT 1P84K 2BC4A 3BP6B 3SGJA 3VFSB 5J11C 2YRLA 4ODWA 3VXQB 2JJTA 1OWWA 1KSRA 3ZYJA 4F2MB 4QHKJ 2BY1A 4R97C 4G7VH 1A7PL 3CSPA 4IBLT 1DUZA 3FN0L 1QUNA 3CUPB 4EEEA 2AJSH 3RKDC 3UTZA 3QUZD 3DHMA 1NAKH 2K9UA 4GRLC 1CDCA 2R69H 4OI9A 3VI4E 1OM3L 1NGPH 1XGPA 4LDLB 3AY4C 1INQB 4WUUA 5BZDB 5D9SA 4QHUB 1FYTE 3D18A 3V0VA 4G43A 4XCFH 1ZGLA 4NT6B 4PJIF 2XTJD 4O02H 3V79C 2VIRB 2XN9A 2X4RA 1P2CA 2DKMA 2BY3A 4WUUE 5D5MF 5IT2H 4FP8L 1PKQA 3DBXA 4W70A 3RJQB 1WWWX 5E6ID 5ISZA 3BFOA 4CADA 4XPBL 3SCMA 1UH3A 3MLUH 5F6HI 3T0EA 3RU8H 3Q3GB 3NBNA 2NY0D 5I1LB 4QY8B 2D9CA 4HMDA 1OTUD 4PJCB 1EX0A 2XN9E 3T4YB 2Z31B 2IEPA 2BFVH 1BVKA 1X6NA 3SKNB 4NNXB 2GJZB 3AS2A 3UTPE 3T0EE 3VDAA 3QXAA 3K46A 3CLEH 3NABH 2OJEB 3GRWA 1PQZA 3EJZC 3HUJB 4JN1H 3RUGA 3IDMA 2CKBH 1F8TL 4HPOH 5IVZA 1F6LL 5C0IA 4OGYL 3SKMB 3CSYB 3HC4L 1ZE3C 5E1AA 1MJUH 5CP3A 3QHZL 4TSBL 1MHEB 3C5ZC 2HKHL 1FL6B 1YMMD 4GAYA 3VXPB 1MI5D 3O41B 4RGOL 1MCPL 2YC1A 3ES6B 1RZJH 4YR6A 1N0XL 3L3OB 1H3XA 5IBUB 3FT2A 1VFOA 1W0VA 1ZLUH 2CIIA 4E41B 2Q6WA 4KJWC 2EDTA 1X7QB 1J12A 5EUKB 3IJHA 3TPUB 3AS1A 5DURB 5IHUH 4RFOL 4I8DA 4LGSB 5FO7A 2BMKB 3STLA 5SWZD 1WBZB 4KROD 4M7JH 4N0FB 4LSRH 2BVPB 2EE3A 4X4YB 1WZKA 2BZDA 1NMBH 3T0VA 1IKNC 3DMMA 1KPRA 1CL7I 3RWEB 2CDFB 2EDNA 4BYHA 5TPWL 1ND0A 5BS0D 1QFWH 4NQDA 1P4IL 2RGSA 5A3ID 4J4PA 1YQVL 4JFXB 5DT1L 2VH5H 1I1AA 3WUWA 1Q94A 4LCCB 2ADJB 2W9LA 2F58H 2HT2D 5L2JB 2AI0H 3G5ZA 4HC1L 3BAEL 4NQDE 5I9QC 2HFGH 4NQED 4OFIA 5IP4A 1DEDA 3MBXL 4PJEE 1JZ5A 3OXRA 1J8HA 1OW0C 4OUOA 1IC5L 2UUDK 3L3GA 4ODBD 3OX8A 3W5NA 3RDTA 5CJ5A 1JHLL 5JQ6H 4H26A 3ARXA 4KQ3L 5KSAC 3DPBA 4M4PA 4PJXF 3WDJA 1QQDB 3OF6D 4Z7UA 3TIDB 2VDLL 3QZWG 4GMTH 4L3ED 4J3SA 4I0PA 1H15A 4LNRA 5EZJB 1ETZB 3U0WL 4OLVL 2VZVA 4X6EA 1SYVB 3X3FH 4Z7UE 4LDEB 3KLAB 2IANE 3UYOD 5EC2A 1NC4D 1SJHA 2OMBA 4TTDD 3LKNB 3SJVB 1JPST 4H8WH 3NACL 1FDLH 2ZNWA 3TT3L 2AGJL 2ZKHH 1VEPA 5TDOA 3WNPA 1QSFA 5T33L 1BLNA 1IZKA 2EC9U 3UC0H 5C07B 3U30C 1CFVL 1OAZH 4TULL 3G6AB 1RZJC 1CFBA 4XXDA 3VMNA 3NZHH 3O2DL 3MRKA 1IVLA 2Z91A 2ZCLH 3BT2L 4NO0D 4TRPL 2MNUA 4ORGA 1HDMA 1LNUA 2X10A 1BOYA 4RGND 4F33A 3OXSB 3UJTH 4Y19B 3ORJA 1I9IL 1WZ1H 2FL5A 5TE7L 3HZVA 4IIQB 3VXSE 4D2NA 1MIMH 2Q7YB 3F7RA 1K4CA 1X4ZA 2J8UF 5DR5L 1I1CA 1VGEH 2O5XL 3BI9X 3MV7A 1P4LB 4JR9H 1ADQL 4LVNC 3QI9D 4LRNL 1DVFD 2ZCKL 4YHKH 4JM2C 3S98A 3QQNA 3BEVB 4UQ3A 4Z7VA 1K2DA 5DEGA 4XHJD 1U3HB 3U46B 3EYOB 4PJ8C 1PG7X 1UXSB 1DUYA 2AJYL 1KF9B 1H8OA 3BQUC 4U6TA 2L0DA 4NKOA 2FNBA 3X11B 1A21A 3FONA 4JZJC 3I6GA 3FFCA 3DX7A 3B8YA 1KJ3H 3O2VH 4GUPB 4JCLA 5IUSA 1DN0B 1XR9B 3LKSA 1JGEB 4PREA 1VKXA 4RX4A 3H7LA 4PV9B 1AD0A 4G8GD 5IB2B 4OM1L 4S11A 3EAKA 5JA8B 5DHYA 1NCCL 1MREH 3TA3D 2BC4B 4FQLL 2DTML 1HIML 4O2CA 3SGKC 4ODWB 3MFFA 1MLBB 3ARDD 2W38A 5C0BA 5IB3A 5TQ2H 5IM7A 3CMGA 1CGTA 3UDWA 1LDPL 1BVLB 1NGYA 1Q9KB 5IMLB 1HYSC 4P99A 1Z5LB 2VOTA 1RIHL 5CBEA 3W9DB 1DUZB 1FN4A 5JQHC 1CICD 5C0RH 3O45A 2Z93B 1CD8A 5D1QD 4ZFZA 2V5SA 1H0DB 1HSBA 1XGPB 3CXHK 3ARGD 3ELAT 4S0TD 3EFFA 3KPOB 4N9GA 1KUMA 1NDMB 3D18B 4N0UA 1DBML 3V0VB 2XZZA 1RZKL 4G43B 1KC5L 1RULH 1JNJA 4H8WC 4JQXC 4KZDH 4GSDH 5I1AA 1MFAH 1G6RH 2X4RB 4N9OB 2DTSA 3LKPB 1HE7A 1P2CB 2GEEA 4KI1A 4QHMB 1AFVL 2CRZA 2PTUA 1PKQB 1C7TA 3T3PE 1IM9A 1OLZA 1UZ6E 5IBTL 4JFEE 3AC0A 5ISZB 4CADB 3SCMB 2DMKA 5A2FA 4WFFE 4AT6B 4PG2C 4PP2A 2C4XA 5ESAB 5SV3A 1LD9A 4NJAH 3BJ91 5E2WL 3TNNA 4NOFA 1OAKL 3BP7A 1DDHB 1FC2D 1ZTXL 1BVKB 3MUGA 3QDMD 2ZG3A 2P44B 3ZL4L 1PJ9A 1FNAA 3MUZ1 2EDWA 4R4NC 4YNYA 4MXQC 1EFQA 1JCKA 4ENED 4ELKA 2F8XC 3RUGB 1INEL 2VLKE 1NFDE 5IVZB 2E7BA 3D1MC 4FQCL 5C0IB 5GGVH 4XVJH 3V4VL 4FQXC 2X5PA 5I17A 2CJUH 5E1AB 3N50A 5HI4C 5E9DD 4FOMA 4RIRA 2ED9A 4OBRA 1CLOH 4TTGA 5IG7A 4DWHA 3LN4A 4YK4B 5D7SL 5FO9B 1VACB 3QDJD 5C70A 4YR6B 4Q9RH 1KYOK 3G9VA 2QSCH 3BJLA 4TQEH 5D2NE 1HNGA 4MD4A 3FT2B 1QRNA 1W0VB 4JAMB 3JV6A 2CIIB 2APFA 2Q6WB 2A9MH 4PRAA 4M7LL 2P8MA 4PY7A 5D7JB 3IJHB 3K81A 1S7VA 1NBVL 3TCLA 3SQOH 2VDNL 1OAQH 3CDYA 5L88L 5FO7B 2Z92B 3STLB 2FHBA 1BZQK 5CGMA 4R2GB 3UYRH 1AI1L 2OM5A 3PDDA 3QUYD 2XQYG 3DMMB 1OSZA 1KPRB 3N1PC 1QFWI 1OP3K 1RUMH 1ND0B 2HRPL 4DGVH 2QHLA 3PWPE 3GIVA 5D1ZD 1I1AB 3WUWB 1Q94B 5KOVC 2RAMA 4DVBA 4POZD 1CE1H 3U7YH 2MCG1 4JRWA 1MCOL 5GRJL 3G5ZB 1JRHH 3MFGB 3BYYA 4U1SA 2GJ6A 2AJ3A 3VXTA 3OJDA 3WO4C 4U0QB 5DK2A 2C4FU 2GFBA 1J8HB 4JO4L 4AENA 2UY6A 4EOWL 1AGDB 3SDYL 3L3GB 2IQAA 2KBGA 3UBXI 5CJOH 5L0QB 1EEYA 5ESVB 4YXLL 4KK9D 3OX8B 4ONFL 4XMKL 5CJXC 3RDTB 1J88A 4NHCH 4ZFOL 5L2KA 4H26B 4FQJL 4YJZL 1GOFA 1BECA 4P9MH 2L7UA 3ZSTA 2LU7A 3ABZA 4BZ2L 1I3RB 2PO6B 5E99H 1XR8A 1H15B 4LNRB 1YEJH 5E8OA 4ZS7L 3UAJC 1A3RL 4OM0L 2P46B 1YEHH 2DQCL 4LARH 4JY5H 3NPSC 4OLUL 4X6EB 3WD5L 5IMMA 1LMKA 2EH8L 4FMKA 3KYMA 1FAKT 3DROA 3FO0L 4RISH 2K7QA 3FN9A 4M5YH 4YDIH 1A4JA 4X99A 2B1AL 1MAJA 5TDOB 2BP3A 1QSFB 4XNZC 1JV5A 8CGTA 2GAZA 4MJ4A 4QHLA 1VA9A 5I75C 3VH8A 3GSQA 1PG7L 1G9NL 3A6BL 2BX5A 3H9HB 3ZDXF 5DD5L 3RWCA 4RRPG 4XXDB 3VXMD 4QXGL 5FYKD 2Z91B 1M71A 3LV3A 1FIGH 2PTTB 4MJ2A