3BN9D

Crystal structure of mt-sp1 in complex with fab inhibitor e2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
211
Chain Sequence
QVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARPYLTYPQRRGPQNVSPFDNWGQGTMVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Membrane-type serine protease 1
total genus 35
structure length 211
sequence length 229
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D01
1CE1H 2IG2H 3TFKC 5IFAH 3VFPA 1PQZA 2WQRA 4PYGA 1NGPH 4MXQC 4WFFD 3NFSH 1C8PA 2LV4A 5B22A 1IQDB 2FYYB 4HW6A 1RZFL 1JPSH 4GKOA 2Y6SC 5IK3A 3WFZA 3O6FC 4LHUA 1CK0L 5C0JB 2L0DA 1J5OL 2WLYA 2J1KA 4I9WD 4OKDA 2AK1H 1EAPA 2E7CA 4IRJD 4WHTA 4BJLA 3RWJA 1QFWI 3RGVA 1EEYB 2D3VA 2AJYH 3EDFA 1MUJA 5IVXE 1GAFL 3FQNB 1L9NA 3UTPE 1RZKC 1MI5D 2PNDA 4JG1H 3QNZB 5T1LA 2F19L 2W9LA 5IM7A 4JHWH 5J6GA 3OJDB 1W0VB 1DN2A 3MZGB 3KLDA 3SDAC 1T1XA 3JUZA 3UJTL 5CJQH 4D0BB 1CDCA 4WW2C 5CCKL 1UB5A 2COQA 3GMQB 4G80B 1LK3L 3KLHC 1CL7I 5DLMH 3T8XA 1XF5A 1A9BB 2CK0L 2RFXB 5IGXL 5F1KC 4Z7NF 4BSVB 4JHAL 4Y4FA 1HKLL 4JFOB 5HYQA 4JPIB 4WFGE 3BI9X 5IUSA 4FFZL 1VACA 2X1OA 1U3HC 4WWKD 4P57B 4C54A 4MWFB 3MRMA 3CLEH 3W82A 1AR1D 3HG1A 1HXYB 4IRSC 1G6RA 5C0CB 4FQ1H 4N68A 4XPAL 3HLAA 5I76B 3MQIA 1G7JB 1J0KA 1MCNA 3MBXL 1DBKH 2ADIA 4LDEB 1J1OL 4GRMA 1NAMB 3QXAA 4I0CC 4F7PA 4JO4L 1CXKA 4G6JH 1LP9A 5F9AC 1D6EB 4CVXB 3QPQD 4JDVA 4JN2B 1BFVH 2HRPL 1SJVA 3BE1L 3I3EA 3J8F7 4YXKH 3VFGL 3KYNB 4M4PA 1S9YA 4RMQA 4QRRB 3LPWA 4XVJL 2V7NB 3BKMH 3LZFH 1CWVA 3GM8A 4HEPG 1MPAH 3BQUB 2X4UB 2ICCA 3BYYA 5K9KA 2DYPD 4Q9RL 3DVNA 4W4OC 2FX7L 1O0VA 3T0DA 4X6DE 2EDLA 1LO4H 5FHBH 4QRUA 3DX7A 4HAFA 4O02L 5ERWA 1QLRB 2XZZA 4WJ5B 5ID1A 4ESKA 4LKXA 1KFAH 1JRHI 5EPMB 2FEEL 1A1NA 4IDJL 1CLOL 3HAEA 1OSZB 3RZCB 1ZT7A 3IAQA 5KANI 4Y5VC 3VXMD 5DJ8B 4UDUB 3HUJE 1MJUL 3ZT6A 2V2XA 5F71A 4BYHA 5I8KH 3VWJC 3L5HA 3TESA 4HLJA 1S7TB 5JDSA 1VDGA 4W6XB 4JKPL 1KIUA 4PFEA 1KELH 1RULL 3MODL 3W0WD 4RZCA 2ADJB 3T04D 5I1DB 5L7XH 4P4KC 1P7HL 1I8IB 2PR4H 2ZCKL 2GTZA 2IQAA 1QYGH 1BQLL 5HD8D 1AY1L 4P2OA 3AU1A 3B3IA 3KJ4C 1TVBA 2PKDA 5CUSH 1G7LA 5ETUA 4WI2A 1FBIH 4PJIE 4KK9C 1NGXA 3T4AB 4HT1L 5CZXC 1ZT1A 1QRNA 1KCSH 4IS6A 5CBAA 1MFNA 3MV7E 3D48R 1GOGA 4FXGA 4NQVA 4JKWA 5E5MA 4ZAKB 3SE3A 1A7RH 1CYGA 3TIEA 1ZVSB 3QUKA 3CDGA 5F3HB 1EXUB 1MCOH 4Z7VF 5I1GL 3ULVE 2Z4QB 4IRJC 4M6NH 4Z7WA 1UZ8B 2UV3A 4YHMH 2HLFD 5D71H 4KI5E 3VG0L 3NN8B 2FX9H 4P0DA 1H3TA 4M3JA 2VN7A 4UT9L 5SV4A 4Z78B 4BH8B 2BSTA 1MHCB 3IS1X 5IOPB 2HP4A 1FGNH 1G7IB 4JPKL 4PTTB 4Y8DC 2PN5A 3TIDB 1W0WB 5IJKC 3NIGE 3BJ91 1TVBB 5F1NB 2ZOLA 5L88L 3GFUA 2J2ZA 3DIFB 3VI4E 2BRRH 3BGFC 3IVKB 3EJYC 3TO4B 3GBNL 5AG9A 2VZ3A 5HYJE 3QRFM 3DX6A 1ZT4A 5INDB 4O9HH 2JK5A 4BH8A 4BK4A 5JDSB 5HDLA 4UINH 3WHE0 4MNGB 4ALAL 4MNGE 1VKXA 1A6UH 3MLYH 5IKCB 4NPYB 4PV9A 4MHHG 2J6EH 4S1RL 3CX5J 1SJEA 1RVFH 1S7QA 2J5LB 4HH8A 2H9GB 4M03A 3SDAB 3AM8A 5IFAL 5CIPB 1ETZA 1E4XI 1P9MA 2Y1VA 4W81A 2KUTA 2PO6A 3V7MA 1T6VN 4GG6A 2A77L 3O3UN 5F7LB 2VQTA 1ZLVK 1JV5A 3S36X 5CSGA 5EBWB 5HGDA 2E6JA 2DQCH 1CR9L 4NWUH 4LKXB 1M05A 1U8NA 5IFHL 1I8IA 1DFBL 2IANE 3FRUB 5HHXL 1F02I 4MJIB 4U1GC 4LGSB 3QEQA 4R9HA 1BF8A 4FN0A 4JQIH 4M7LH 3UAJC 3GIZL 2E3VA 3CSYA 3P11H 2YA0A 4L4TA 1P2CA 4UDUA 3ZHDA 1IBGL 1PW3A 5HSFA 3WD5L 3TGXA 3GBNH 1RUKH 3HRZB 2UYLA 1G9MC 2C1PA 2MQCA 3SCMC 3ABZA 1UCBH 2AGJH 4JM2F 3SQOL 1EJOH 4YHYB 3IJSB 5BVJA 1CD1A 4OLUL 2NX5D 1UH4A 4HIHB 1RFDL 2JCCF 2W9EL 3SE8H 1GH7A 2AV1A 2EDWA 1TQCB 5KZCD 4U6YA 3OZ9L 3ZKSD 3LDBB 3I6GB 1JGDB 1T03H 4M1CD 1LK3H 3Q2CA 5HHOB 3T09A 3B2VH 2DQHL 4GKSB 1NGYA 4OGZA 3TZVC 3W11D 4X80H 1N6QL 3TN0B 2DQJH 4N8CH 3CFJB 4ETQB 1DVFB 4NBXB 5EN2A 5F9JB 5HPMA 1VEOA 2V2TB 1KBGL 4HDIB 4UU9A 4XVTL 4BFIA 2VZSA 5MEND 4EIGB 3DBXA 4QF1B 5E8OA 3VFVA 1M7DA 4LP5A 2P4AB 3T3MF 4WWKA 3JTTA 1AGBB 4F37K 1BOYA 4L9LB 1MVUA 4R6UA 3DX6B 2PTTA 4OF8A 1Z9LA 4KVCL 1HILA 2XA8H 4M7LL 2OJEA 3E0GA 4GG6E 2HFGL 2I26N 4EOWH 1QSVA 3O2WL 1GGBL 1QEWB 2AK4E 2KZ1B 4NKDA 4OF0A 1PYWB 3DTXA 4RFOH 1H0DB 2VWEE 3O2VL 5KVEH 1YEJL 5LJYH 3KPLA 1JI1A 3T2QA 3HE7A 1EEYA 3ZKXB 5GGQL 4ONHA 25C8L 2F58H 3VRLF 4IM8A 35C8H 1G9MH 3QDGE 5T3XE 2I07A 3GIVA 3CZJA 3VXNA 2NXZB 2OR8A 2PXYD 2JJUA 4POUB 5C6WH 5IK3B 4TN9A 1VSCA 2F8XC 4XNMA 4LLQA 4LPCA 3TT3L 5ADPL 1XGUB 5DR5H 2A6JA 1NH6A 4WDIA 3QEHA 3IKKA 1MUJB 5ADOL 3G9AB 5F7MC 1LQSR 1BOGA 4QRPE 1AKJB 1HWGB 1HE7A 5DFVC 1NEUA 3FQXA 1FZMB 1H5BB 3CX5K 1AGDA 3RVVC 4EN3C 4I3GA 4KUCF 4GQ9L 5KW9H 1FYTE 1I1YA 4LMQE 3B6SB 4GKZA 5CWSB 3BQUC 1J0IA 1R24A 3ORJA 4OLVH 4ZFGL 4CW1A 3PQYA 2GJ6E 1AXSB 1I3VA 3BXNA 4NQED 4P23B 3A6BL 3FMGH 3O3AB 5JORB 2VLJA 2CLZB 4EUPG 2OL3A 4HGWA 5FF6B 5D7KE 4LL9A 1ZGLB 4RGNB 2XZCH 2BSRB 1NKOA 5DD0H 1NLBL 4H8WC 3DGGB 1YEKL 2BY1A 2H26B 2GCYA 4PRAB 1QLFB 3SBWA 1KLGB 1CFVL 3TYGL 3MRGA 3WFCH 1G9NC 1BM3H 1KTDB 1RUPL 3Q3GA 4KVNH 4PRPE 1OLLA 4UTBH 5GRZA 3N1MC 3UXFA 2D7TH 1G9ML 3RDTC 4JREC 1LP9B 4LASL 4LEOA 1CFTB 3P77B 2AV7A 4QRUB 1N5YH 2VC2L 2BC4B 1CF8H 1EEUA 1EJOL 5E9DA 3T2NH 3DXAD 3VXQB 5GHWH 4QRTB 4DW2H 3OKLB 2OQJA 1ZHBA 2V7NA 4UINL 5D1XD 3QWQB 1RHHB 4RFOL 4D8PA 1QSFD 3HI1A 5J9PA 4UQ3B 4KROD 1OAUH 3QO1A 4R0LA 2EDQA 3DX8B 3VXRE 5ICXA 1A6PA 3QUZB 5EIVA 1CG9A 2Y9RT 4JFOA 5HYJB 1QEWA 5MI0B 1FNSH 4KMQA 4NJAH 1A6ZA 2VITB 3QXAB 1LDSA 4BQ6A 1FE8L 3QWRA 2CUHA 2OTPA 1VFAB 4G6ML 4WO4B 5I8OH 3BUYB 2IWGA 1E27A 1JFQH 5FUCE 5FFLA 1HEZB 1AXTL 1BLNB 1LEGB 1M6OA 5GRJL 1JZ6A 2DQFA 3MRFB 2CGRH 4XCFH 4POZD 2YSSA 4Z0XB 2Q20A 2Q3ZA 3LVEA 3Q0HA 1QBBA 2C3WA 1CFTA 3P77A 1T5XA 4MJ5A 3KYMA 1J12A 5SWQA 3SCMA 2C7UB 2F74A 4N8PA 3IFLH 1URLA 4F37F 2EIZB 5BOPA 3GSRA 1RURH 3EFDH 4YE4L 2CLVB 3GHEL 5TQ2H 3DGGA 3OKLA 5E2VL 5D9SB 4WUUE 4L4VD 1OCWL 1HKFA 1CGUA 3CMOL 1KJ2H 3IRPX 1OAQL 4Z95H 4PUBL 5KSAD 5BO1H 3O3AA 4PRPA 2OSLB 2ZPKH 4LSPL 4XAWH 4P3DB 1IGIH 4BELD 4LVHB 1YY8B 3HZYB 4NCC2 5I1AB 1FL5A 3P11L 4GBXB 5D1QD 5FYJU 4LCWB 1JL8A 3AFLA 4G8GD 5A3IC 3FQTA 1A7NH 3OKYA 3PDDA 3VWKD 1JNLH 1FVCA 4NQCB 4DUXA 4KROB 4A6YH 1XAUA 2PYEE 2XTJC 3MRLA 1YYML 4IHOB 3SPVA 3ARBB 4MCZB 2R1WB 1F90H 1BQSA 1A6AB 4BH7B 3JWOC 5ITFA 1E4WH 5HDQH 1OB1A 5C09D 5EZOH 2NYYD 5IR1B 2ARJB 3G6DH 5JMRA 4NNXB 1A5FH 1JIBA 1QO3A 2YA2A 2APFA 5GJSH 1Z6JT 3JWDH 2X70B 5FO8B 5K9JH 1ITCA 4N9OB 3VXMB 4PLJD 4LCYA 4N8VB 4ODHH 4F7EA 1HOCB 4MNHB 4JG0L 3FFDA 2R0KH 3MCKB 1CVRA 4I4WA 3RWIB 5GGQH 4OTXL 2Z9TA 3FZUD 2P24A 1MLCB 3MXVL 5FM4A 2RCSH 3LD8B 5IW6A 3U7WL 1FNEA 5TDOB 5HJ3B 2ZCHL 5FKAB 4E41A 4X6FB 3ULSA 1KTRL 3EZ8A 1OQOA 4HUUB 1HCFX 2R4RL 2IG2L 2CDEB 4YFLI 4PJ8B 1QA9B 3QNYA 1GHFL 2PETA 1KPUA 2OMBA 5C07E 3VXME 5E6ID 3W11C 1NFDF 3D85A 1FFPB 3FB5B 1MRFL 2N7AA 3OR7A 4Z7QE 2VERN 1R3IH 3WNMA 3CDGB 5F3HA 1IC5L 3ULUF 5GZOC 3EOAA 4OLZH 1OCWH 2LTQC 3KLAB 1MCLA 2WBJB 3QPQC 2AEIT 4QRPD 5EH1A 3BO8A 4EKXA 1KJ2L 3AVEA 2P44B 2X4SB 3T65B 2ARJA 3TH4T 1BQHG 4BZYA 5JW4N 1W72A 1VFOA 1B0GB 2DM3A 3EYUL 5D5MF 3P9LA 5JHDA 1NBVH 2OJEB 3DVGA 4D9RE 4F2MB 3KPRD 1NSNL 2EDOA 2RHEA 3QCVH 5C3TA 5J1SC 2NX5A 1K3ZA 3H2WA 2F54D 4OGXL 2GW5A 4YHNA 5IT2H 5F7FA 3FQTB 1KCVH 3U4BH 1ADQH 5D7JB 1EERB 4LCWA 5T3ZH 3X13A 1G0YR 1SQ2N 4TULL 1FVEA 2R0LL 4Y4KA 2GITA 2P8MA 2ZUXA 4FQJH 4XHJD 4Y5YA 2CD0A 1HCVA 4HFUH 4G6MH 1G0XA 3VDBA 3BAEL 1TMCB 2VXUH 4AZ8A 1JV5B 4KKAC 4MLSA 3VGHA 4MMZC 3NACL 3PQYE 4QKXB 1A7QL 4JO3L 1RHFA 4JQVC 2Q76B 3BH8A 1CFSB 2P48B 4ZMAT 4X9IA 4Z0BL 3MRIA 5F89B 4ORZC 5JA8B 1EO8H 4FQ2H 4O02H 3N1PC 2DS4A 4MVBC 4ODUA 4PJIF 4JFPA 4UV7L 2FO4B 4DVBB 5B8CA 3MOAL 4G42A 1ZANL 5JLZA 4HUMB 3TJHD 1N5YL 3VFGH 1HHIA 1BM3L 2ICES 1NAMA 3GM0A 2WBJD 3ARXA 4LK4A 3SDYL 2R15A 1FZJA 3MRDB 3ZL4L 3CVIL 2QADB 4WHYH 4C59B 1J86A 5I71C 1ZT4B 3BO8B 3EO0B 4NOFA 1IT9L 4QRRA 2P5ED 1JP5A 2HJFA 3BH9A 4ODVL 4QXTA 4XHQA 4K7PY 3VFRB 2XIDA 4S10A 4GAJL 3BN9D 1BPVA 1TVHB 1DBKL 3NIFE 4P99A 3VRJA 4ZQKB 4AENB 2EC9T 1FVEB 4Y4KB 1CCZA 3CDFA 4HQQL 1WBZB 3O9WB 3LKOB 1MCFA 4MAUH 4XCYA 5DJ2A 2F5BL 1QFUL 3CAFA 4NM4H 4CKVX 5CLTA 4L3EA 5EBMB 1N5AA 3SDXA 3GHEH 4F8QA 4GW5A 1MF2H 5INDA 4NKOA 2Q8BL 3RNQA 5I0ZA 3HR5B 4JO2L 1QBLH 1OAQH 1R3LB 1FNFA 3F6LA 5GIRB 3ZTNL 1UWEH 1F8TH 3P4MB 3UPAA 2M1KA 3RFZC 2FJHB 1YPZE 3AC0A 3C5ZC 3HZVB 5I6XC 4ZYKB 2OZ4L 3VG9C 5D96C 3BT2L 1HQ4A 1G7HB 5F6HJ 2L4OA 4N8VA 4WTZG 1M7XA 15C8H 2DIAA 4HUNB 1LDPL 2J5LC 4CU7A 1U6AH 3SKJL 3F7VB 3Q1SH 3MA9H 3QZWA 4M5ZL 4LLWA 3FO0H 3KDMA 1WAAF 4JO1L 3HC0A 5CILL 2G2RA 3AS3A 1MAJA 2R69H 3DVIA 3TIDA 3VXTB 3AUVA 1RI8A 3DURA 4P23A 1NEZA 2DM2A 4JKKA 1ZLVH 1B6UA 1V05A 3DV6B 4ZAKA 4YHLH 4D94A 3MFFB 43CAB 3H7LA 4M61B 5JXAH 4JM2B 5BS0E 3L6FA 1ZKAA 1LEKB 3TJEL 2YRLA 1QOKA 1SEBA 1MJ7H 3MLRL 2FR4B 2X9YA 5AG8A 4OFKA 5IMOB 1Q0YL 2NNAB 3GMMA 4KHXL 5CJOL 2B5IB 2HH0L 1KYOJ 5DRWA 4HKJB 3KPMA 3O6FD 2NY0B 1TVHA 3RAJH 4NWTH 3QWOB 3GJFK 1GJIA 4O4YL 1MCPH 2X9XA 1F3DJ 1W0YT 3EBAA 1EMTH 5F9WC 3KYKH 3OPZL 4HMDA 1KCRL 2WWMD 2WAHA 1CL7L 4TUKH 4F7TB 1GCFA 2E7MA 2DYPA 2VZ1A 3QEQE 2A6DB 4KUZL 3SE9L 1WTGT 2JCCE 2X4OB 3K4AA 3WSQL 2W0KA 5I66A 3TLRA 5ISZD 4OZHA 1LD9B 3PP4L 5JXED 4PJEB 5F1IA 3RGVD 2Z35A 2ITCB 1IFHL 4L29A 1YEEH 4X4MA 1OVZA 1B90A 3LKPA 4JFYA 3CNKA 4RA3A 1H15B 1N26A 1R5IB 3CJJA 4P2CG 5I1AA 4Y16B 3EOTL 1J8HD 1MVUB 4IIQA 4YBLB 1K6QH 3RVTC 5TH2B 1HXYA 3SGKA 3HUJB 2VAJA 4LRNH 4QHNA 4F8TA 3W0WE 5GZND 5KVDH 1GIGH 4YPGB 2AJVL 3UCRA 2VUYA 1IC1A 4IJ3C 5KOVC 1ORSA 1YMMA 4FQPA 3TPUB 1LP9E 4OIIL 2XWJB 5B39G 3STBA 4XWOC 4Z8FL 1SMOA 3NMEA 3MRHA 5J56B 1BQUA 1U8OB 2YC1B 4PLKC 4UB0H 3VWKC 3BP4A 5IM7B 3FL7A 1KN4H 2H8PB 5D2NA 1FLRL 3G6JB 2VXQL 3WBDA 2VISA 2ADIB 4PLOB 3QISA 4C4KO 1DQTA 4U0QB 4ZUWA 3NGBC 3HRZA 4PGJA 1MCJA 3TVMA 2NQCA 4R4BA 1UG9A 3C6SA 4XP1L 3GIZH 5JZ7D 3O8XB 4GAGH 5DFVD 5F7NC 3NCEB 3X3FH 5JW3H 1U3HB 3AREB 4LU5H 2RR3A 3MSPA 1JNHB 3AAZA 4PP2A 1HSBB 4QRQA 5C0RL 4TSCH 2VE6A 1XZ0A 4PY7B 4Z0BH 4ZTPH 1NFKA 1CN4A 2O5XH 1EV2E 4H5SB 4OZIE 3ZKNC 1FNGB 3SO5A 4CW1B 1D5ZA 1QQDB 3GSUA 4PREB 3RWDA 3BHBA 2EZ0D 4OZHF 2ESVB 3QCTH 1CD9B 5EU6E 2HTKD 1H15A 2AVGA 3BZDA 5IESL 5ELIA 4X8JB 1YDPA 5D7JC 3JV5A 3G6JF 5HGBA 3VG9B 4WI7A 3KYAA 5I66B 1FCGA 4UI2A 4FQCL 2X05A 2APWA 3SDDC 3MLVH 4OI7A 1DJSA 1I7UA 1MJJA 4XPTL 1ZHLB 4WUUB 4K94C 4UNTA 1H8NA 4DKAA 2X44D 1TZHA 2R56L 1ZGLA 3MGOB 1UM6L 4YHPB 1X4XA 1DQML 3IS0X 1XF3A 5GS1C 2AJ3B 1NMCC 2Q7NA 1KB9K 1MVFA 5JHLH 2BVOB 1LEIB 3CPLB 1NBQA 4NQCA 3VH8B 5JR1L 2NNAA 2R23A 5C0EA 2JJTC 5EWIH 4JDZA 1W0WA 3GB7B 2D03L 5CS7A 5KSUB 3QUMB 5KBNC 1OTTC 4G8EA 1HXMA 4XT1C 1UM5L 4JB9H 3ZLQC 3MJ8A 2WQ8A 4M93C 2JJWA 4C56B 4MCYB 2MNUA 4WI4A 3GBML 3GO1H 4YXHH 5CJXC 5DJCA 5IBLD 3GSVB 2W60A 3DXAB 1U93A 1T5WB 3TO4D 5HI4C 3CD4A 1N64H 3TH2T 4KWUA 4L8CA 1HNFA 4CDGC 4LSUL 2ADFL 4N9GA 4PJGE 2IFFH 1EXUA 4PJBF 4TVPD 2R4RH 4ZAKC 5CEZL 2FWOA 4S1SL 2M2DA 2CGRL 3ES6B 5L7XL 1FDLH 1BP3B 3HE6A 3MO1B 2F74B 1PY9A 5C9JB 3TCXA 1A3LH 3REVB 3TFKD 3S6CA 2YMXH 4NIKB 4H88H 1FFOB 2AQ1A 4MNQA 4NRXB 3V5HB 5I74B 1N7ML 5C1MB 2WK2A 1KJ2B 3RRQA 4KI1A 5C08D 4OGAD 2DTML 3L9RA 2RQ8A 4OD3H 4XVSL 2WIMA 2IPTH 5GGUB 3MYJA 3UTOA 5FGCB 1MY7A 4YH6A 3B2UC 3RVXD 2QHLA 3QUYA 2EH7L 4UDTA 1MWAA 4PYHA 3HTLX 4XCFL 5IVNA 5MP6L 1YJDC 2UY7A 4KAQL 4MB3A 4QRRD 2XNAB 4G8FB 5ICZB 1XGTA 1U8IB 2Y06L 3FQWA 3LHPL 5CMAB 3HMXH 3GKWL 2E7LC 4F3FB 3VFRA 4M8QB 4MA7L 1R0AH 1OAZH 1HSAA 4ZS7H 5JO5A 3U0TA 2ERJB 5C70A 1FAIL 4EXKA 3PABB 3NCCB 5BJTB 3NABL 3GSNB 1JPGA 4H26A 3O4LD 4HIHA 4N5ED 5DVMA 3VFTB 2DKSA 4JN1H 3L1OL 3UO1H 4XI5D 2QBWA 4JFFE 4I18A 5FYJD 5I73B 4ZFFA 4YX2H 5BO1L 3VMPA 3WS3B 1MHHB 3E2HB 5FO7B 5D7JD 3QQ3A 3HC4L 2WUCH 3WFEH 1UWXH 4Q0XH 4LLDB 4P5MB 4APQC 2BNQB 3WS6C 5IEKA 1OAKH 4XPHL 1SVZA 4DGYL 3VFNA 3IDNB 4JM2D 4JFQB 4PTUB 2HJLA 3VXRD 4FQLL 5CEZE 5DVOA 2ED8A 3FRPA 4U1GB 3WIFB 5K9OB 1INDL 4LLVA 2NTFA 5KW9L 3BVNB 3UC0H 5DLML 2QHRH 4PJXB 2AXGA 2OMNA 1KLUA 4MDIB 1S3KH 3S34L 1CFNA 4DTGL 1Q94A 2D7MA 3EOTH 4PG2C 1DL7H 5B3NA 4X4XB 2FL5A 4QNPF 5I75B 1BWWA 4BSVA 2HN7B 1J0YA 4QHUB 5HHVL 1T0MA 1DQLH 2WBJA 1KIRB 1NFDE 2FEDD 3QI9A 1MI5E 1WCBB 4DGIH 3QXWA 3MLUH 3P4MA 4P5TC 4XNMB 1ONQA 1WCQA 4WW2A 1WC7B 2BSSB 4ZTPL 1BVLA 5KVFH 4RCAA 1Q0XL 5E6IA 2VC2H 4YXKL 1T0MB 1T0PB 2HWZL 1S7SA 2IFFL 4KK5C 4F58L 3IVKA 3DPBA 3RWCA 3HE7B 8FABA 1FRGH 2V9TA 4OJFL 5DJXA 3L3KB 2RJMA 3OKEA 4UILH 4ENEC 4HWBH 5C0GB 2EXWD 1YNKH 3GMLB 5FOBA 4PJXA 5DZOA 5SWZA 4G6FD 1PG7H 2R2EA 2DQDH 4B7IA 2BJMH 5D6DA 3QIWC 4Y19D 2Z8VC 2DQHH 3MNWA 1IKFH 4X7SL 1H9VA 2FLBT 1JHTB 3JTSB 3VFNB 2EYRB 2PCPA 4OBRA 4YHKL 1MLCA 4PRNB 1QSEB 1Q9LA 3BDYL 1FFNB 5GPRA 2DD8H 5D2NE 1DBBL 5C3LD 2EIEA 1PDKA 4JFHE 1MCDA 5GZNC 2FHFA 2IMMA 2OM5A 3RVUD 5HHOA 4NQVB 4OFYD 5IB5A 1WLHA 4K2UH 5D4QA 3RBGA 1A14L 1WEJL 3BPNB 4ERSH 2DQJL 4N8CL 4Y19A 4PTUA 3PABA 4NC1E 2EXYC 4L3EE 5DRZA 3MJ9L 3BFOA 1NEZG 4HK0A 3BKCL 1D5XB 1OL0A 4X7TA 3SO3C 3WFHB 3SDCC 3QQ3B 4ELMF 1LO0H 4N5EC 1FYTA 3BIAX 4OLWH 2YPVH 5FYKU 1AO7A 2MKWA 4PY8J 1WBYA 2H6PA 1LE5A 1N0XH 3NCFB 1RZJH 4YQXH 5EA0H 4MXVE 1WTLA 2A6KA 3UDWC 3G5ZB 4NFCA 5C6TH 1ZEAH 1DUYA 5DD3H 1NCUA 1FN4B 2A9ML 5GSVA 4Z7OE 3OAYK 2ZSVA 1BAFH 2NX5B 2OL3L 2X09A 5K59F 4LCWE 3ECBB 1NMBL 4EOWL 4HQQH 1ZGLM 1I85C 3ZSTA 1DSFH 4NP4H 3LQAL 4GAYA 2G75A 2R0WL 5TQ0H 3C60B 1FPTL 4XH2A 4LPVA 5SX4I 2NY4B 3ZE1E 3MRFA 5DURD 4PJDE 4F7MB 4Y19B 1A7QH 1QACA 3HI1B 4JFDE 4LEXH 1UM4H 4HMCA 2F8VA 4PJ5B 3CVIH 1EX0A 5ACZB 5D96B 4RQQB 1CXIA 1U8HB 5BQ7B 1H8OA 1G7QB 4XBEL 1PBYA 1I1FB 1Z0NA 4G3YL 2H9GA 5GS3A 4NO5A 4XB8A 1SJEB 1NDMB 1VEMA 1FFNA 3GMNB 5IHZB 2HKFL 4PLNC 3FONB 1J8HB 5ID0B 1NGQH 3BDBA 2OI9C 1PD6A 4JGUA 5GGVY 2V7HA 2YSSB 2OXHA 2W60B 5KS9F 1EFXA 3MV8B 3Q1SL 5C08A 2Z91A 2DMKA 2YPKB 4EVNA 5CGMA 2C26A 3MXWL 3GSXB 5T1DH 2AQ3A 4X98A 2EEDA 3L3HA 3WFCL 2UY6A 1QG3A 4LIQL 1FZKB 2NLJA 1VFAA 5IV2B 4Q9BA 3GSNL 3S5LA 4HC1H 3OKEB 1KEML 1DANU 3I6KA 1F8TL 4I48A 3IFNH 3ZT7A 1KTLA 1YNTB 2FJGA 4YDKH 1E6OL 1BOGB 3MROA 5EO9B 5H37H 2RBLA 4ERSL 1M7IB 1IZKA 3DXAA 1MCEA 4S2SA 4KK9D 4FFWC 5IW3A 2PYEA 3QO0B 1YNKL 1KIQA 1BJMA 2CLRB 3N1FC 1NPUA 1IARB 1YNLL 1LNUA 4LIQE 5EU3B 3S36H 4N90D 1OP9A 2VR9A 4A2LA 2VZVA 1HI6B 3ZE2F 4WGVB 3UTSA 3V4VH 5ITFB 3GUTA 4J3WA 5FA4B 5IJKA 3LKRA 3BZEA 3ULUD 5HI5C 4U05A 4MSWA 1T04B 1T4KA 1Q0XH 4PRDB 2X70A 3EYOA 5JPNB 4Z5RB 1KXTB 4IDLA 1ZT1B 2VWEC 4PR5B 1MCWW 4LSVL 1UXSA 2BMKA 3T4YA 4NNYB 3FJTA 3INUL 3EYFB 2YA1A 3WE6B 3MFFA 1A6AA 5IJVA 2DQUL 5FYLE 3EGSA 4X5WA 3NTCH 3STZB 5C9KA 4R26L 3MC0A 4YDLC 4B5EA 5TPWL 4IDJH 3SJVE 1JPTH 1DL7L 3U7WH 1XCQA 2ZSWA 3P0GB 3QG6B 2PYED 4FFVC 3LDBC 4TVPL 1UXSB 2FX7H 3L3GB 2R69L 5ISZB 5BZWB 4C4KT 4LLDA 1J18A 5HPOA 3ARBC 2ZUQC 5TFSL 1RIUL 3T3PF 3QHTC 5ID1B 3X12A 4M1DH 2NY5L 3W2DH 2V2TA 4X4ME 4I48B 4OUUA 5D93C 4JPVH 4U0RC 5IHZA 3IB4A 3QUXA 2KPNA 4NRYA 4XZUB 1M4KA 2J4WH 4PJGB 2XG5A 1UXWB 4X80L 3BW9A 2I07B 3GIVB 5BW7A 3IFPA 1T2QH 5DHVA 4IMLA 2IMNA 4ELMB 5AAWA 4YHML 4M8QA 4R4BB 2ZCKH 5D71L 3VG0H 4S11A 1L9MA 1UH3A 2NY2D 1G1CA 1C5DB 4GUPB 5I1GH 4NQEA 4MDJB 5ANMA 5DRXB 2WANA 3IJYB 2FGWH 4NZRL 2BVUA 1MAKA 2MFNA 4CVZB 1UJTA 1YYLL 3BP4B 3VFMB 4HWEH 4JCLA 4Y4HA 3FTGA 1T1ZA 4P3WA 3OGCA 3BZFA 1FBIL 1G7JA 5JPMA 1D6VL 1PG7X 1FC1A 3DO3A 4X9FA 4LNRB 2XWJA 4X5XA 2DBJA 2DN7A 2IGFL 4QYOB 3LS5L 5HDOA 1INEL 1WFTA 5ESVA 1T22A 3OB8A 3BKYH 3V6ZA 4YAQA 4KU1A 1YN7B 1I1RA 4Z7NE 5EO1A 1X5YA 1UZ6F 1F58H 3S35L 5C0FA 3EDKA 4I18C 2DQGH 2O61B 5C2BL 5FM5O 1FIEA 5TH2A 2X4QB 5D2LB 4U1IA 2J8HA 5EZJB 5T1MA 3EOBB 4IMLB 1A3LL 1JVKA 3RHWF 1XGQA 1FH5H 1A4JA 3RGVC 4HHAB 5J6HA 4GG6B 3OKMA 1B0RA 4XXCA 1A5FL 1FVDB 1YEHL 5EUKA 3P9MA 2BVQB 3ARZA 3O6KL 4KMTL 3SOBH 1I3UA 7FABL 1ZE3C 2HFEA 4JZJB 1XF1A 4LEOB 2OP4L 5KJRL 4GLRH 3BP5A 1XF4A 4LLMA 5L88H 3VWKB 4BUHA 4Z7WF 1AE6L 1AR2A 1XGTB 4BSWB 1I7TB 2E8ZA 1CICA 1JE6A 3BSZH 2GCYB 3L3GA 2EYSA 1A6UL 3CCHA 3F7RA 2OK0H 1F6LL 2BVEA 4K55A 4N1EA 4IRJB 2DLEA 2H32H 1JWSA 3DYOA 4XPHH 5DD1H 3VH8G 3RPKA 3TWCL 3QEQB 3INUH 3LAFA 5GS0L 3FRUA 1YEGH 1BIIA 5F7DB 4L9DA 2HG5A 3H3KA 3O4LB 2Q86B 4EI5D 2VRAA 4PJ7B 3D0VA 4WI8A 5C0GA 4JFFA 1KJ2A 1U41A 3ILPB 3HB3D 3MRJA 3FO2B 3X3FL 1KTKE 4X4YA 3GSWB 1I8LC 5KSBB 1RJLA 2ATKB 5CGYC 1OP5H 3VD3A 5M7QA 5FCUH 1ZHLA 3MX0A 4PJCE 1DUZA 1MFAH 4PJ7F 1BZ9B 3SKOB 1D9KD 5DWUL 1Z5LB 1ZLWK 3BPCB 5DK3A 1H3UA 3HUJF 4GH7B 2WP3T 3PWLB 1J05A 1S7QB 1H0DA 5DJZA 3TVMC 1FV1B 5DO2D 3G5VA 4CADA 4JRXD 1JI2A 1MH5B 4M02A 3SDAD 4F15C 1Q9LB 1R3LA 1T5WA 2D03H 5CEYA 5E70A 4EEEA 3RGHA 4XBPB 5F8QC 1X5HA 1LO2H 3UTZB 3V5DB 3V0WL 4OLXL 5DUML 1WIOA 4JE4B 4XNZB 2BSSA 3HNTL 4MYWB 4Z6AT 1OPGL 2FIRT 4M6OL 4YXLH 4YDLB 3BSZL 1K85A 4N0CC 3ZE0F 3NZHL 3KS0J 4AT6A 3ZHKA 5BS0D 1C1EH 3PUCA 2H2SD 1WV7T 1P4BL 5GS1B 1L4IA 5E99H 5ICYA 5CJ8A 5FYJL 2ZPKL 3HR5A 4L4TE 5GS0H 2PTTB 1J7VR 1KOAA 1YEDB 2OXGA 3MLVL 4MZ3A 2PO6D 4HS6A 1CDYA 4MLIA 2HVJA 1EFXB 1RUML 3MV8A 1I1CA 4PV8A 1UADC 5C7XL 2I24N 1HQ4B 1NAML 2VSDA 4BH7A 1ZV5A 1A7NL 3QT2A 5C8JB 3VCLB 5DT1L 3IJSA 3CFJA 4PBXA 4ETQA 1A9EB 3B8SA 3NIGF 1MHHA 3P0VL 3W9DB 1JGVH 1ACZA 3OHXB 3LPFA 3MV8D 4MQ7B 4TVPH 5C0AE 2VXQH 4AIOA 2KZWA 3J7HA 2VDNL 1CT8B 2HN7A 4HKBB 5DJ8A 1EH9A 3FQUA 1JPST 4M3KB 5IF0A 1WBZA 3O9WA 5KVEL 1VGEL 1LILA 4Y2DB 3N0PB 4K94L 2R8SH 5D1ZC 5EPMA 2JLLA 2QR0A 3O4LA 3DSFL 4PGDB 2FH8A 2RB8A 1DEDA 2CKBH 5IBLC 2FZ3B 4MQXC 3FRPG 4H1LG 4KKBC 4J12A 3EHBD 4ZOEA 4ZFZB 3MFGB 5F96H 4Q97A 1D5IL 1F45A 5E8DL 3B43A 1MFDL 5LGHL 2EYSB 1UYWH 5JO5B 3TP4A 3NCYP 4OAWA 4QOKE 5FKPA 1BBJA 2NY3D 3RTQA 1LD9A 3SKUD 3SQOH 3HMWL 1QBML 5GGUA 3VFUA 5E00A 1GGCH 4LCIL 2VLRE 2J8UF 2Z8WC 3C5JB 3QIUB 5F7WC 3M17B 4LAQH 1HHJA 4CVXA 4I18B 3OSKA 3MRKB 2FATL 2IQ9L 4HPOL 4KTDL 4P9HH 3T2PA 4TNWK 3S4SG 3L3JB 1LDPH 1VCAA 5IB2B 4JQIL 1J9CT 2VR5A 1OTSD 1HSAB 5F3BA 1Y18B 2Y23A 5J1TC 4XC3H 3QFDA 5EOCL 5KSBF 1R3HB 1S7RB 3F7YB 5FA3B 2P8LB 2QR0B 3TPUA 2PW1A 3SQBA 5LWYL 3PV6A 5D7SH 2N4IA 4XCEB 5DFWH 1H8SA 4O4YH 1LWRA 2D31B 2KBGA 4PD4J 5FECA 3CH1A 2SEBB 3ESUF 3KPRA 1ZEAL 5HHQA 3VXOB 4PJFB 3ZDXF 1QFWL 1A6VL 2BSTB 1NCNA 4MQ7A 1I1AC 1YEDA 2LU3A 4WHDA 4RGOL 4UTBL 2F5BH 2LABA 5SWZB 3SE9H 1DSFL 3RWFA 1WQVT 2YUWA 2ZG1A 5F9OL 4P46B 3RKDC 4EDWH 2BC4A 2ITCA 4L29B 5F1NA 3TA3D 3QDJD 4R7NB 3MBEB 2JIXD 5IROC 5J11C 4N0RA 5DJYA 3ARDD 1AGFB 4XMLL 2BVPB 3UBXG 3KPSA 5GGTH 3BIBX 1SJHB 4LP4A 4OM0H 1P4BH 3RNKB 4RAHA 4NN5B 4KJYA 3RU8L 3HAEG 3IU4H 1ZWIA 4HKZA 4WFFE 3SKJH 1TPXC 3E6HB 4MJID 3UMTA 4MA8L 2R1WA 1U58A 1K8IB 5F93C 3MYZA 3STZA 2QSQA 3BPOC 4M48H 4FQQB 1EO8L 4FQ2L 5CZVH 5HYSA 2XZQH 5EFIB 4Z8FH 2GSGB 1QRKA 4PB9L 2VDKL 1JTTA 1VFBA 3D18B 2HLAB 2R0LH 5LWYH 3SGDI 1N6QH 3IF1B 5CWSA 1YMHA 3O81A 5ITBL 5C0JA 3HZMA 1OTSC 1I9RL 3TEUA 3FMGL 1EEZA 4OLWL 2R23B 1NJ9B 4ZTOH 1ED3A 2GFBA 4AENA 2OBGA 3U36A 3UYRH 3GKZA 1I75A 5HGGS 1FG2B 3ZKQD 1JHLL 5LG1A 4JPKH 4HAGA 1KYOK 2Z92B 1FZJB 3MRDA 5K59E 1WEJH 4C57C 3BESR 1BFOB 3H42H 3IXTA 3V6OC 3BKJH 5E08L 4AH2A 4H1LA 1JGUH 3D85D 1V3JA 3S97C 1MFDH 4ZNEA 1G9EA 1FPTH 1T7ZA 1BQHA 3FQRB 2CK2A 4P3DA 1MI5A 3S4SB 3KPLB 4P4KD 3U9UA 2FO1A 5EU4A 5LXGH 3GNMH 1I9IH 2QQLH 1IGFL 1PZUB 4OZIB 5IMMB 4HK3N 3WIIH 3C08H 1BWMA 2IPKB 1YUHB 4HX1A 3EKCA 4DQOL 3HI6L 1JZ5A 3OKDA 5E8NA 1Z2KA 2A9MH 5DC0A 2YUXA 5D1QC 3RNQB 1UQSB 3SHSA 3C6LC 2X4QA 5D2LA 3ELAT 5SX5H 1IC4L 2O61A 1NGWA 1R3KA 3MLPA 5INCB 4CN6A 1MQKH 4GW4B 5DURB 3SDXF 2D0HA 2XA3A 1SYSA 5F9JA 5HPMB 4GO6B 3FT4A 1KSRA 1LO0L 1V3MA 1DEEA 4NQEB 4B53A 2G9HB 1FO0B 1PY4A 4M7LT 5DEFA 4A2MA 4G6KH 3ZKMD 3BRDA 3R1GH 4X4ZA 2VXSH 1MWAB 1RU9L 1BJ8A 4QHKJ 3A6OA 3DV4B 5E94B 5K9JL 4Y5XC 3JWOH 1SEQL 5F7KC 2DKMA 5HHME 1G6RB 3QZWG 2KQNA 3VFWB 1D9KB 4AEEA 4KRPD 5TE4L 1MFEH 1IAOA 5E99L 3KYMB 4PJ9C 2ICWB 4JO4H 2NW2B 4YO0B 3EYVA 2H2PC 3TBSB 1NDMA 1MI5B 3UYPA 1LO4L 5FHBL 3LRSB 1FAIH 4PJAA 3S3SA 5E2TH 4KJQD 3OKKA 3OF6D 2V2WA 4XVJH 2HYMA 5E94A 3QDMB 1A7RL 4HPYH 1J11A 2QSVA 4PRAA 4HS8H 2DQCL 5D1XB 1BFVL 1QSFA 2HRPH 5GRUH 3UTQA 4UAOC 1D5MA 2DQGL 4LCIH 2B5IC 3QAZC 4PGZA 1XIWD 2FDBP 3AMKA 4JY5H 3WIHH 3U7YH 4QT5A 3FT4B 5GJTL 1CFQB 5KSAA 2VLJB 3IETB 1ADQL 5HYJD 4OD2B 3PHQB 4JJ5B 3D1MC 4F7TA 4IIQB 2WBWB 4U1SA 4QOKB 2OLDA 1IGYA 5IVZA 5E8EA 3QH3B 3ZYOA 1J10A 5H35B 2OTWB 1UM6H 4PJEA 3NFNA 1NBVL 3D0LB 3VE0A 5ENWB 5J57B 3QWOA 5T5FH 5TGBB 2EDBA 2CLZA 3BD4A 2WLZA 1BQHB 2P1YA 3DVGB 3QEHB 1NBZB 2V5YA 1ORQA 1KCKA 3TC9A 5DA0B 5DJAB 1C7SA 4G7VH 2VAAB 4AEHH 2H26A 2P5EA 2YRPA 3C2AL 3U82B 1EHLL 1R3IL 5E03A 4OCRH 2BSRA 4UOW0 4UNVA 4KZEL 2AKRB 1FORL 1UJ3A 4MHHI 4LCCA 4WTXA 2VLLA 3V4PH 4YBQD 2CDFA 1L7IL 2XY2A 3RY6A 2IPTL 2WW8A 4DAGL 1TFHA 5LGJB 1KNOB 5DJ0B 2VXUL 3MRNB 2P5WA 3X3GH 4NO2B 2DLTA 1ZGLP 4JRYE 2XKSA 3ULUH 3GUTB 4RFEA 3KPOA 3EOYG 4ZODA 5KTEH 5AYUH 4UTAL 4LF3B 3RWCB 4PJHE 5L8KB 1U8PB 1CQKA 1F90L 2XTLA 4X6FA 3ULSB 4QOKA 1NC2B 5H2BB 5MEPB 4G9FB 4OGXH 1T04A 4M7JL 3NFSL 4W6WB 5I2IB 1FFRA 4N0UE 1K4CA 3WN5A 3TV3L 3OB0H 1KJVB 4HCRL 4HXBL 2AP2A 2VJXA 4D9LH 5B3JE 1Z9SA 2W9DL 4NKOB 4P3CL 5F70A 4KKBD 3BH9B 4QXTB 4GW5B 4HSQA 1I85A 5HYIA 2R2BA 1INEH 1H3XA 4ZOBA 1A2YB 1FIGL 4C58B 4HBQA 2IADB 3QA3A 3H3PH 3ARGB 4O2CA 4X4XA 1ONQB 3PWPE 1I9IL 2QQLL 4BQCA 2NY1B 2H8PA 1BX2A 1JGEB 3HZVA 2NW2A 2IH3A 4YO0A 2Y06H 3RA7H 3PQYD 1LMKA 5LBSH 3WFEL 1YYLH 5HGAB 4GSDL 2EDTA 1HEZA 4I3RH 5HHMD 1KC5L 4PG9B 1G7PA 1T2JA 3I6GA 1UWGL 3H3BC 3BP6A 1TCMA 4EN3A 3CSYB 3QQ9C 2J4WL 4NQXB 5HGHB 2GSIB 4MD5A 1A4KB 3QO1B 4R0LB 3QDJB 4BFEA 4D9QD 1U8KA 4P2OC 4PGDA 4YR6B 4Y88A 4JRYA 5GS0C 1U8HA 3LEYL 2Q6WA 4JZJA 2OK0L 4X6CF 1KV3A 3S9DB 2YN5A 4NOBA 3ZSSA 2BDNH 1T83C 1Q8MA 3LCYA 4EN3B 2GAZB 3MJ6A 4D2NA 3FN3A 3QCUL 4G6JL 4Y4KC 1A4JB 3BEVA 3HPJA 5EZJA 1YEFL 3SOBL 1XMWA 3K81A 4F3FA 1YPZA 5CZXD 4MA1C 1X5FA 3SGDH 1JFQL 1DBML 3LKNA 3OPZH 1LO3L 1T21A 3BPNC 1ZLWH 5LXGL 3ARPA 1Q9WA 3QI9D 1D5XA 5AAMA 3PGFH 4XBEH 5LCVL 5JZ7C 2F54B 1I8KB 4G6KL 4NYLB 1GZQA 1JRHH 2HH0H 4OQ1A 2BNRB 1K8DB 3QG7H 4OF6A 3FN9A 1T3FB 3KG5A 3SE4A 3VGAB 2X1PA 4KI5F 1U8KB 2ZOKA 3IYLW 3PQYB 1KB5L 1DR9A 4CDHA 1FFPA 3L5XH 4EI6B 3LS5H 3OXSB 2HFGH 5LQBL 2VR4A 2VLRA 1BZ7B 4HKXB 4MJ4A 2FX8H 4U1JB 2VDPH 3CMOH 4DZ8B 4U3HA 1WUNT 4GT7A 3HS0B 5J89A 3F62A 3QUYB 4E41B 3S3PA 4UZGA 2WBKA 1NC2A 4BSJA 1IE5A 3GSOB 5CP3A 1WC7A 5BMFH 4JFDA 1WFUA 1W0VA 3VI4F 3SJVB 1KPUB 5E6IC 3MV9D 2NY6B 4L8CB 5DJ6A 3A0OA 3WN5B 4IOSD 1NUNB 4MJIE 4LLQB 4PRPD 4W68A 8FABB 4HWZA 3BKCH 2AK4A 3CXHJ 3T0EC 3BRGC 1KIRA 3LH2H 2EE3A 5CJQL 2YD3A 1AJ7H 3HE6B 5H8DA 1CXEA 3RPIA 3P4LA 1NGPL 5I1IH 3VA6A 1BFTA 3CFBA 4NNXA 1G0DA 3TNMA 3AY4A 4OCLC 4V2CB 2A73B 1MEXH 3MRJB 5FUOH 4NQDB 3FT3B 4F9LA 1KEGL 4LBEB 4PJ9B 4OZFA 4MNHA 2EO9A 4XXCC 1KB5B 5SV3A 2BHZA 4TSBL 4HIJB 3O9WD 1ZVSA 3QUKB 4YDJB 4FTVB 1YPZF 4FTVE 1NCAL 1JWSB 1PEZA 4WV1A 2HFFB 1DE4A 3WJJC 1IAIM 4DFHA 3L5XL 4M48L 4OKVB 2NY5C 1BHGA 1IGCL 3NN8A 3NTCL 1WZ1H 3CMGA 4HLZH 1U8MA 3I6LD 2NR6D 1A1OA 2FD6H 3E2HC 4J4PC 3CPLA 3ARUA 4FFVD 4ZFOL 4LASH 2P8LA 3QQNA 4L8SB 3TZVA 3IGAB 5LCVH 2O5XL 5DI8A 3PWNB 2WP3O 4W4OA 1NCDH 5KSVB 4I8DA 4P2OD 4QHUA 1O7VA 1JPGB 4H26B 5EB9A 2VDNH 3DLQR 5GS0D 3MLYL 4HUWB 4U3CA 2OZ4H 3KPPA 5DQDL 1F00I 2CLVA 3MRKA 2VNCA 2OL3H 1CFNB 1BVKA 1WT5A 3GJEA 1EPFA 4KI5C 3DMMB 3MV9B 4KVNL 4JFPB 3MJGX 3QCUH 5JNYB 4BZ1L 5T3XL 1JTPA 3BEWB 3X17A 1C08B 5HHPB 4P2RD 4MJ5B 4EUPA 4NQXA 4U1LB 2E7LA 4FFYH 4RMSA 4P5KA 5C7XH 1EVTC 3STLB 4KRMB 1PVHA 1E6OH 4LLUA 4DK6A 4LLAA 4WGWB 2R1XA 4HG4K 2GI7A 4JVWA 4LRIC 1WZMA 4FHBD 1FP5A 3QFJA 3X11A 1MFCH 4NZTH 2BHUA 4RSVA 2MTPA 2OSLA 3OZ9H 4KKCD 5EBWA 3O6FB 3C87A 3ZDXE 1F5WA 1CFQA 1DEEB 5J8OA 3B2VL 1IAOB 1X6LA 3W81A 1REIA 4F7CB 3SE3C 3WSQH 4EXPX 1RZ7H 4QRRE 2XACC 4AL8H 1OGTB 5TQ0L 4PRIE 2YC1A 3O8XA 5DJDA 2P7TA 3DV4A 2WWMC 4ODXA 3EDJA 3OV6A 4PJAB 4U0RB 1UXWA 4MA1B 1NCDL 3QDGB 4X6DB 5J6GB 2EEAA 3AROA 2HT3D 3G6JA 2VXTL 5EOTB 4G9DA 4Q6IC 3S8WA 1EGJL 3O2DA 1RIHH 4U2YA 3L3DA 4ZSOE 3QIWB 5DQJB 1OAXL 4WHTB 3RWEA 3MJ8B 2R29L 4PJXF 3EHBC 3PJSB 3EOAB 5I0DA 3MLZH 1JK8A 2AW2A 4Y4HB 5DXWA 3CXHK 4PGBB 1C16A 3RX8A 1ZXQA 3VDAA 1MJUH 3WV0A 3MCLL 1XCQB 1HH6A 1KBGH 4XVTH 2AJXL 4FA8A 3FFCB 5I2IA 5T1KA 1CVSC 4DK3A 5DF0A 5JW4Q 2H3NB 3S5LG 1P53A 1NCBH 1XGPA 2YD8A 3SGJC 4OT1H 4HUWA 4RGNE 5F88B 2E9JA 3BP7B 3OJDA 1TVDA 4KV5F 4NGHH 2HLAA 5IHUH 3ZT5A 3ARFA 2DTMH 5IB3B 2AAVA 3ARSA 5T33L 1J0JA 4M6ML 4ZNCD 4LDLB 4NDMB 3Q6GL 5KG9B 4TTDC 1U58B 3H42L 1FGVL 2BRRL 1IEHA 2FSEA 4UV4H 3T0EA 2OS7A 1LEKA 2Z93A 1TTFA 5DO2C 4ZG1A 1KB9J 1CLCA 2WWKT 2C3GA 3ARFD 5MHSD 2WINA 4S1SH 3FQXB 4I77L 2LU4A 4GKNA 3IKCA 3D0VB 1MAMH 4ODTH 1KACB 4S2SB 1AGFA 1D6VH 2HT3C 3LKQA 1SM3L 1HQRB 4EDXB 3C60C 3G6DL 4KZEH 1J8KA 2VXVL 3G6JE 4JPWL 2QTEA 1TPXB 4DKDC 2B20A 1JNNH 3S5LB 1TQBB 3U2SB 3B9KB 2EZ0C 3OL2A 3MRRA 2FEEI 2R0KL 3S37H 3Q6FA 5T5FL 1CE6B 3DO7B 5I71B 4V1DE 3GMOA 3G5XB 1X44A 4R8WL 2LAGB 3V52H 5D2NB 4OUOA 2UWEF 5BRZE 4QT5B 4G9DB 1PG7W 4L5FL 3SKNB 1DQJB 3ET9F 5EOQL 4NFBA 3IXAA 2B8OT 1HI6A 5IG7A 3DECA 3W2DL 7FABH 3LHPH 1AY1H 1IAII 1BZQK 1U2CA 4OLZL 3FOMB 1G7QA 5TE4H 1KGCE 5T3ZD 3TVMB 1MIEL 3TA3A 4RAUA 1JCKA 3IJHB 5IQ9B 3HS0A 4XPGL 3WHXB 3K80A 5D7LB 4ZPVA 4JLRB 5D7LE 4PY7A 4Y2OA 5ETUB 3Q5TA 1T1WA 1Q94B 2VL4A 4X99A 1I3GH 3SEPA 4XVSH 4G9FD 2ZUSA 1FSKC 4LARL 3MRPA 3C5ZD 5C2BH 1E4XL 2DL2A 3IDGA 3QUZD 1NDGB 1DDHA 3MLSL 2MSPA 2XN9B 4KAQH 2E9WA 4Q9CA 1OAUL 2IPKA 1H3VA 1A02N 4YZFE 1AHWB 5HXMA 5JQHC 1KFAL 3CH1B 3BGFB 4IMKA 4L4VE 2YEZB 3L3OA 4X5LA 1L0YA 5MEOB 4FQLH 4Z76A 2OP4H 4JANA 3DX8A 3QDGA 2ZOKB 4IEFB 2I9TA 2RFXA 4QTIL 2C1PB 3OG6B 4U6VL 1IILE 1Z3GH 1CD8A 3VFUB 4J7RA 4K7PH 4Y2DA 4YBHA 5EZLA 2E5EA 5AUMB 4XNXL 1S78C 3S35H 3V0VA 3UX9B 1YZZA 3GJFB 4G43A 5HHOE 4KK8C 3QFJD 3VRIA 2IBBA 1F13A 3S88H 3VXUA 3MV7B 1AIFA 1CGSL 4XNYL 1IEBA 4FRWA 2I9TB 1JNNL 1Y6KR 2CXGA 3LIZH 3KPMB 4TUOB 3GZKA 4ZO7A 5E4EB 1CZ8H 1Q72H 5CSZB 5E00B 4LOUC 2GSIA 1WJ3A 2G5RA 5EG6C 3RTQB 3MBXH 2H1PL 1X3DA 5A43C 3TZVD 3WUWA 3O8XC 2EYRA 2PCPB 3P30L 4CUCA 1WWCA 4HH9A 4FFZH 4MA7H 5D1ZB 4JY6B 3B9AA 5AD0A 1B0WA 2JB6A 2OL3B 2QKIA 2XQYG 1S9WA 3ULUL 1Q9KB 2M26A 2IH1A 5GJTH 2ENYA 5DK2A 5DMGC 2G2RB 4LBEA 4KI5D 1KLFA 5IB4A 4NPYA 1U8MB 1ZMYA 2F19H 2A73A 4OFVA 3D39D 4QXUH 3IAPA 4X7CC 3ARWA 4TUJB 2DMCA 4Q9RH 1PZ5A 4GRLA 2FLRT 1XF5B 3TN0D 3EYQD 3TA3B 3F7QA 1SY6L 2P5WE 1X4ZA 5EBGA 4B41A 2H41A 4GQPH 1F2QA 2CRYA 4D0DA 3H9YA 2RCSL 1KG0A 3NZ8B 5B3JF 4FQXD 4GRWE 3WO4C 1QZ1A 4GQ9H 3SKNA 1GGYA 1F4YL 4K8RL 1F4XH 1QNZL 3BKYL 3D3VA 5HY9A 3O0RL 5GHWL 1WFOA 3MNWB 1U92B 4B7LA 4CMHC 43CAA 4MCYA 4WV1B 3M1BA 3KLAA 3PL6B 4FTVA 5FYKD 4MXQD 3BN3B 1RIHL 5F6HI 4UOW1 1AP2B 1AO7D 2SEBA 5BZDA 3GRWA 3P4OB 5LBSL 2JCCA 4GMTL 1FYTD 2VDQL 1U8JA 5HYEA 3D6GA 3ETBF 2BVOA 3LB6D 4ZUTB 1LEIA 4H0GA 1I1AB 2DJUA 4NC1C 1R6VA 4X9HA 1KN4L 1MHPH 4PJ8D 4R0LC 1QBAA 3M1BB 3Q6GH 2A83A 4RMWA 5C09E 1FL3B 5DK0B 1ZS8B 2JJTA 3RUGA 5EBMA 4MB5A 5F9WB 3O6MH 3UTTE 3VA2C 2F54A 4M5YH 4QF1A 2X89A 5BV7C 2P24B 5DC9B 3BPLC 4ODTL 5J12C 4NGHL 2AJVH 3HG1D 2MKLC 1MOEA 3AREC 4HIIB 2DLFL 5FO9A 3TV3H 5CP3H 5DMGD 5C86A 3NA9H 3QRGH 2XTJD 4P9HL 1R5WB 4Y5VB 3IDIB 4FXGB 2GKIA 2GY7B 2BFVH 2NW3B 1DUZB 4BK5A 4DCQB 4C83A 3ROLA 4M6MH 3T1FB 3V5KA 4F7CA 2K7PA 4JM4L 4MAYA 2ESVA 1K6QL 3IRZA 3VGDA 2CMRH 5ACMA 3HMWH 3ILPA 2NY4C 3RZCA 2X41A 3I2CL 4HZLA 2NYYC 2H32B 3KYNA 2R4SH 4KKNA 4LHUG 1I9JH 2Q86A 2EC9U 1Q9OA 5F7EL 4R4FH 3AS2A 4KXZH 4ODUB 3QFJE 1VB9A 4QRSA 2X7LA 1W72L 5MEOA 3VFSB 3DSFH 3GHBL 5K9QI 1OAYH 3DROB 2CDGA 4NN6B 1FN4A 5GSVB 5TJWK 4BZ1H 5EUOA 3WUWB 4BQ8A 2Y7QB 5KS9B 3TBYB 2BCKA 2AEQH 3C6SB 2APVA 1F6AA 1DVFD 2Y72A 5J0BA 5EC2A 3W9DA 1QSED 5GGTL 5HGAA 2NY7H 2ZUYA 2D7NA 5E1AA 5C0BA 4OSUL 1RU9H 3QXDB 5L2KE 5L2KB 1QRNE 2V5RA 2APBA 5HGHA 4UT6H 4U7MA 3CC5B 4WEBL 5D6CA 3WKNA 2UVFA 5T5NG 4OB5L 2X4UA 4HS6B 1DQQA 1RVFL 5DMKA 2FB4H 5C0AA 4ZUVB 1OQXA 3UTSE 1MIEH 1WITA 5DGQA 1I3RA 4YR6A 4PJAE 1OGTA 3O2VH 2ED7A 4G6AD 2YKLL 5C71A 4XZUA 4EI5A 2HA1A 4JM4H 1NMBH 1QSFE 5JIHA 3QHZL 4XNQA 3LKSA 4UQ3A 1FLTX 3BYTA 5J9PB 3G5XA 5DHYA 4OD1L 3T8XB 2MCPL 1NGWB 3PWPD 5CIPH 3V5DA 2ZCLL 4LNRA 2Y07H 2JELL 4N5UA 5ITBH 4PJDF 4NZRH 2YPVL 2DLFH 1MCCA 4PJBB 3U2SA 3MCG1 3QNZA 3UJJL 4HZAA 4CVZA 1WF5A 1U8JB 4HV8B 3CFCH 3MUGA 2JCCB 4IOIA 4O2FB 4J4PA 4MVBD 1T2QL 4PJEE 2YUZA 3QEGH 4L4VA 5DD6A 5A2JH 2GJJA 4LCCB 1OT2A 1PLGH 3T0WA 1EFQA 2D2OA 4D9LL 3FHQA 3U0WH 4YWGL 5D7KD 1I9RH 2CJUH 5E9DB 2PTUA 4XMPL 4LKCA 5T1LB 1IQDA 2FYYA 4KGLA 3WO4B 4XBGB 1INQA 4Z7WB 1TJGL 4J3SA 1UCBL 4TOYL 3OX8B 4CMMB 1WCBA 3QULA 1CGSH 4XNYH 4URTB 4IRZL 4DGVH 3MLTB 4J6RL 3GGWB 1J1XL 5L8LB 1S8DB 2FHCA 5IB3A 1ED3B 1A1OB 3S88L 4UAOB 1P7QA 3I50H 3LS4L 2BP3A 2OTWA 3CK0L 4G8IB 3ULVL 4K3EL 4P9HC 2P5WD 5I1KL 1VGKB 4AIXA 3QUMA 4PGCB 2YXFA 3RDTA 1MCRA 4XGZB 3EJZC 3HE7C 3JWDC 3MUHL 4PRIA 4ZS7L 5HVFB 2ZWLT 5C92A 4U1SB 4HJ0D 2Q8AH 3AXLB 3VWKA 3SBWC 3E6FA 3F7PC 2HG5B 2BOBB 3MA7A 5D1QA 4OF7A 5I1IL 4GBXC 2Z31A 3HNSH 3LPGA 1JMXA 5JXAL 4WVRA 3VE0B 1I9JL 3ZHLA 1CD0A 1NCAH 4MX7B 4APQD 2O5ZL 5BRZA 1MHEA 1JF5A 1F4AA 3LV3A 5LKNA 1E4KC 3ULVD 4ISVB 2BDNL 1FZMA 1G6VK 1H5BA 2I5YH 3P3YA 2P5EE 5DD1L 5DUPH 1CGWA 4JM2C 4KTDH 4S1DC 3UJIL 5EFIA 4H20H 3SGKC 3QRGL 4IRSB 4NJ9L 1IGML 3MV7D 1JNLL 2DM7A 1LP9F 4KQ4L 4M9OA 4WIQA 3X14B 4H88L 1XGRA 2HKHL 3GMNA 4Z0XA 1U36A 4CNIB 1XGUA 3EO9H 4WW1A 1DQDL 1D5MB 1VESA 4NBYB 4BKLB 3E8UH 3LQMA 1HILB 4PRHD 2Q1EA 1WBXA 4WUUD 4P59H 4FABH 3L3IA 2JJSA 1BD2B 1YQVL 3DRQA 5I1LB 3GSQB 1S9XB 1KCVL 1JZ8A 4ONHB 4JDVB 2YBRA 1M1SA 4NC0B 4L3AA 3MPCA 1RK1A 4Z7UE 5EBLB 1X4YA 3I6KB 2NPLX 4DVRL 4FQIH 3HNTH 1MRCL 2ZUWA 4QWWC 4WTZA 4KRPB 1RZGA 1HKLH 2W0PA 3CFEB 4HUXB 3H0TA 4S0TD 1S7WB 2ERJC 5HYSG 3GSXA 5A2KH 1WZKA 4GFTB 1BEYH 2NX5E 5IGXH 4UOJA 4K9EC 3WIHA 3DOSA 1GZPA 1E4XH 4OZIA 4P5KB 2DBLL 4ONOA 2E8YA 1C5BL 4KZDH 2IADA 4OB5H 4DEPC 3WHXA 3PNWA 3WXWL 5C0IA 5E2WL 3SDCA 2FB4L 2A6DA 3VXSB 5D7LD 2HT4D 4JFHD 4S1QH 3UBXA 4APQB 1RZKH 1RAMA 4P2RA 2XWTB 4TTDD 2DWDB 3RY5A 1RUMH 1QD0A 5MERB 1NCTA 1JYWA 4E5XA 1HH9A 3R4DA 1FO0A 1N2RA 4N8VG 1FG9C 5IMMA 5FF6A 3DXAE 1C1EL 2AK1L 3X3GL 1YJDL 3PGCB 1HHGA 1V8HA 4X6BA 3ARFC 4IRSA 3EGSB 3Q5YA 3BIKA 1DN0A 4OQTA 5DRNB 1JGVL 2EE2A 3ARED 5B38G 1E28A 1YY9D 2MQ0A 2VLKA 1BIHA 1QLFA 4HXAL 5C07D 1IKNA 3ARVA 4WFGD 5EO0B 4PR5A 5H94B 4I2XA 4UIMA 5IFJB 1VA9A 4XRCB 1S5IH 3T0AA 2EDNA 3H7BA 5MENA 1KPRB 2CIKA 2NTSP 3ME0A 1OAKL 3AM8C 1FO0L 1OTTD 5JW5B 4YDJA 5T3ZL 2FZ3A 4G8GB 1A9EA 1M71B 1FIGH 3VFPB 4X5WB 4X6DF 3WFHA 1CDBA 3IKCB 3CFKB 1MCSA 4LCCC 4HZLB 4QHMA 3NZHH 1Q1JL 3B5TA 5DWUH 4KDVA 4NNYA 2KL6A 1GPOH 3CLEL 2BY2A 2J8UA 2PW2B 4HKBA 5FHAL 2A83B 2WZPD 1P7QB 1EDQA 1IGFH 4UUJB 4KPHL 2X89D 5A3ID 3FO1A 3L3KA 1K2DA 3U7AA 1NC4A 4AEFA 3TNMB 1PKQE 2JJVA 4M7ZB 2IFGA 5IHUL 2ZP0T 3UPCA 3EW3B 5DQ9B 2ID5A 4RWYL 5TQ2L 5A16A 5GGSB 3W39A 2AK4B 1ZHNA 2HJKA 1GC1H 1XH3A 4PJ7E 4CAGA 4HS8L 4BFIB 4JRXE 3KPRB 4P4KA 1X5AA 4AT6B 1K2DB 1PAMA 3MACL 3IDMA 4X7FC 3PG2A 2XOTA 5BZDB 3MNZA 3F58L 3F6IA 4XPFH 1MFEL 4M43H 5EIIB 1NGQL 2CDFB 4Q2ZB 5CGYD 1JGDA 2E27H 5JW3L 1FGVH 3QDAA 4U4BA 2I60H 3DJ9A 4KJPD 3QAZB 5D6CB 1CFBA 4O51B 1BZ7A 5B21A 2EC8A 5DJAA 4LIQH 5J1AA 5E7FA 4ZXBC 3KVQA 4NNPH 4L8DA 5F44A 1EVUA 2GJ6B 3MV11 2H2SC 3RVUC 2B1AH 4N0YL 1NGZA 4ODXB 4J3XA 3REWA 2NZ9C 2AXJA 1QFWH 4NT6A 3W5NA 5ACZA 2E6PA 1TXKA 5E0QA 3GMPB 2DKUA 5IQ7L 4G7VL 2A6KB 4YEEA 1BAFL 4WNQA 4FQ1L 5CSBA 4L5FH 2XICA 4WY7L 1QLEH 2NMSA 5DUBA 1DVFA 4HKXA 5EN2B 1WFNA 2ZZUT 5EORL 3I50L 1MRCH 1YYMH 4PGEA 2A1WL 4LLMB 1S5HA 4WJ5A 2IH1B 4ZFFB 4X6BB 1BIIB 2DQTL 4M8VA 1J1PL 3HUJA 3FQWB 3QFJB 2WUBH 5EC2B 1QHOA 5KVDL 3VXUB 4NO0B 5I15H 3OKDB 5E8NB 1HZHL 1MLBB 3MNVA 4FABL 2Y36H 5EUOB 2WUCL 2VABB 4YHLL 3Q48A 4HIXL 1JHLH 4XP5L 1I4FA 4LPXA 3OMZA 5JHLL 2PUQT 4QO1A 2XV6B 4V2BA 3S4SA 3SGJA 3C8KB 4PLKD 1NLBH 3G04A 4R90H 2V5MA 4OZFG 2JIXB 7CGTA 3A67L 1D6EA 2BFVL 2OTUA 4LPYA 3PIQA 1OLZA 3LN5B 2LQRA 3RBSA 3UJIH 1BD2E 2LVEA 3QA3B 1C12B 4P9ML 5I8CB 4NJAL 2X4PB 3QUXC 2QLVB 5D7IE 1V7ML 1QRND 1IJ9A 4UV4L 1B6DA 3MBEC 3MOQA 4HHAA 4AM0A 4JFZH 2UZIL 1GOFA 3NCMA 2VL5B 4GRWF 1CDIA 4BA8A 1AD0A 3D39A 1RFDH 3SE8L 1QSEE 4JQVA 2VLJE 3QUYD 3IDMB 3BOVA 1UKTA 4OBSA 1UA6H 3KPNB 3UROR 3RI5K 5C0CD 2NY5H 4AG4H 1TZIB 2YS4A 5CJXA 1UC6A 2KDGA 1R3KB 3MR9A 3MXWH 5E4EC 4WU5B 1LE9B 3A6CH 2CIIA 4Z78A 5D6DC 2VZTA 4ZO8A 5T3XH 1D5BA 2C3VB 2DB8A 1MQKL 5F72S 3FB8A 5FB8A 1MH5A 1UZ8A 2HWZH 5JA9A 3JUYA 3NZ8A 2WV3A 4KMLB 1QNZH 1IQWL 1BECA 4LLYA 4BZ2H 2X4NB 2ZUVA 3T65A 3DRTA 4XPBL 3PWVA 3QQ4B 2JK5B 1A2YA 2XWBB 5CBAB 3HI6H 2I27N 5BZWA 4XPFL 4TQEH 1U92A 1Y6NR 4LQFH 2XKUA 4DGIL 5FGBC 4P23C 3NA4A 3PF2A 3KPQA 4U1HB 3T3ME 4OIIH 5DZNA 2DIJA 4OGYL 3H9HA 5BRZB 4MX7A 3WFDH 3QEGL 4CU8A 4L3CB 1UCTA 1X5KA 3VXPA 2GYSA 2MQ3A 2OR7A 4K23H 1NBZA 5DJZB 2XRAH 2WNGA 4D0DB 3BAEH 25C8H 2F58L 3V0AC 1QKZH 1CE6A 5CJBA 5HJ3A 1TETH 1JUFA 3IDXH 2D7OA 5DTFA 4PJ5E 3PGDA 2DWEA 3UJJH 3O3BB 1II4E 5D7IA 3WCYA 3RDTB 3D5OF 8CGTA 2B4CH 4Z5RA 3V7AE 3D87B 1SM3H 3WNPA 5JXEC 1KT2B 2XFXA 3BHBB 3LEYH 5T5NF 3K2UH 2Z8SA 5FYKH 3PV6B 4OLEA 3OXRA 1OD9A 4M1DL 5IROA 5JOFB 5HVGB 4HWNA 3VD9A 2XN9E 3OKNB 4QRQB 1FAKT 4X8JA 3MA9L 4AIZA 1GZQB 3QH3A 2EDKA 3ROOB 1C12A 4PS4L 1AGEA 3GMRA 3TBVB 3KPQB 4U1HA 3BT2H 2GK0A 4PB9H 4NHUA 5F7YC 4OI8A 4UNUA 3BQUD 3HKFA 4G42B 3TBTA 5ADOH 3KGRA 2XA8L 3DYPA 5L9DH 3BDXA 4KTYA 2X1XR 1YN7A 3CU1A 4HF5L 1FNAA 1CR9H 4NWUL 2X9WA 1GZPB 2VDQH 1YDPB 3I75B 4X0KB 3VGBA 5H35A 2Y6SD 5TE6L 4PJAF 2YK1H 3BQUA 1S7VB 1CTNA 3VFWA 4HWUA 3QDMA 5DVKA 3K46A 1XGQB 4I1NB 5F6IB 1YA5A 2CIIB 3BZFB 2CUMA 1K3IA 3PXJA 3RAJL 3CIQA 3L1OH 3DVFA 3UO1L 4J3VA 3W0WB 1UM4L 3IETA 3C5ZB 4U1NA 4JN2A 4YC2B 5CEZD 5SWSE 1IT9H 5DEFB 2HFEB 3BGAA 2O5YH 5FECB 5B39B 4R4FL 1RK1B 2XXMB 4L1HA 2B1AL 4N0YH 4PB0L 1FQ9C 3SO3B 5C9JA 3KJ6H 3MGTA 1MCWM 4F15B 4N0FB 2BNRE 1UB5B 1UA6L 1KXVC 1Y18A 3MRQB 3HLAB 3NCBB 5D2NC 4LSQL 4PJ5A 3V4UL 4R90L 4YJZL 3QIWA 5DMIH 5DQJA 3ARQA 4F7MA 3SCMB 4ONGL 4TRPH 2UVEA 4YFEA 2R0ZL 5I1EL 1DQJA 3KPRE 4Q6YA 3TBSA 2D9QB 4JO1H 1GXEA 1AH1A 4RISH 4R3SA 4HUVA 1OPGH 1HHJB 5BV7L 5C0BE 4K3JL 1V7MH 5AZ2H 1C7TA 4NO5B 1UB6A 2IPUK 4JFZL 3ZE2E 5I76A 1Y0LA 4I0PD 1E0OB 2BZDA 5L0QC 3ULUC 5JPMB 3ILQC 3GHBH 4B0MM 1KJ3L 3EYUH 1GC1C 1P2CB 2GY5A 4ONFH 1QFOA 2XKNB 3RHWK 1BJ1H 3GK8H 4U6XB 3NFPA 4KJPC 5B39A 3U9UB 1CGVA 1KN2H 3OJVC 3CFIC 3EO1B 3THMH 1XEDA 4HCRH 3MA7B 4HXBH 3U36B 1OF2B 1NBYA 3QPXL 1QFHA 1T1YB 3AS0A 1N4XH 3P9WB 5I15L 4E42B 5IMLB 1A6WL 1WICA 3O4OB 4PUBH 2ZG2A 3TBVA 1KULA 3VXSE 1IAKA 4DUWA 4XP6L 3NIDE 4I4WB 2Y5TA 3NAAL 5IP4A 4YDIL 4L1DA 1TZGH 4NO2A 4OZHB 1T2XA 4XP4L 4CVWA 4BZ2L 5J11B 1F3RB 3ZKXC 5SWSA 3LKRB 4MQTB 3OX8A 4MD4B 4WHYG 3WIHL 5IIEA 5JMOC 3VXPB 1QO3B 3FB6A 3UTTB 5I16B 5J1AB 2Y25A 1KUMA 5E2VH 4P5TD 1S7XB 3KPPB 4OCSH 3V4PL 1TIUA 5IEHA 1OP3K 3G9VA 3FO2A 1FCCA 3D3VE 3VWJD 1UH2A 1D5ZB 3QO0A 5HHNB 1T7VA 4Q2ZA 1JN6A 1AXTH 5I8KL 1HIMH 4LQ1A 3V6FA 2ORBH 5FGBA 1IL1A 1AXSA 1ZA3B 3DIFA 1ND0B 4QTHA 3DX9A 5I19L 3BZEB 5MENB 3UP1A 3WE6A 2MPAL 5HD8C 1ITBB 1INQB 3U4AA 1YEIL 5FOJA 3P4OA 1C16B 1NCCL 3ARDA 4TSCL 1NFIA 4AYFA 5C0NC 1XF2B 3RX5A 2NY1C 3D69A 3PWUB 4KDTC 1HHHB 1S7UB 5J3HC 1QR1A 1U8QB 3NCJH 2HVKA 3UTSD 4LU5L 2Y5EA 5TPWH 5CJ5A 3LQZB 3GDBA 3D3VB 5HY9B 4XVUC 2DQEL 3F12B 5D7SL 1T0NA 4K3HA 3K8LA 2R1YB 4HGMA 3B5HA 1K9TA 4UQ2B 3OKKB 3TO2B 4K07A 1MY5A 3LRGA 1R5VA 2DTSA 5IB2A 3VXSA 3WKML 1AQKH 4BFGA 1BREA 1J1OH 4Q7DA 1KN2L 4M6AA 3O2DL 1MPAL 4Z9KB 2VLJD 4Y2DC 4YPGA 5DD0L 4XPAH 2FATH 4HPOH 5FXCH 3LY6A 5ESVB 5JLZB 5F97E 4A6YL 2G60L 2IAMC 1M71A 3KXFE 3BE1H 2NZIA 1FZKA 2FX8L 4WI9A 3HMXA 2QKIB 4LVNB 3MRHB 4L9LA 1CLYH 3N50A 5HDBE 3OGCB 5AZ2L 3HN3A 4MJ6B 3V6BR 2OZ4A 3BZ4A 2BNRD 1K4DB 2W0FA 4ZAKD 4M62L 4AEIH 3DROA 3L5IA 2PXYC 4Z7WE 2PR4L 3IFNL 3M07A 4P23D 3LSOB 3MLXL 2IALB 2ICWJ 5CFHA 1KELL 1RULH 3QSKB 3SDDB 3GSQA 3SN6N 4YHYC 4ODHL 3BVNA 1IGMH 3O4LE 1ZHBB 3LEXA 1ZAGA 3TM6A 1TQCC 4LLUB 4E0RA 1KIPA 3OGOE 3TNNA 2YXMA 1N6VA 2X4PA 3DI2B 1L7TH 4G5ZL 5ALCL 3JV6B 1LO3H 4NT6B 5I19H 3TH3T 4U1IB 5T1MB 4WFEE 4DTGH 2X7LB 4YHIA 4A6YB 4XHJC 1YJDH 3TZVB 3SDDA 3KYKL 4FQHA 3G04B 3R06B 1HHKA 2XG4A 3V52L 4X7TB 4J8RA 5TE7L 2H32A 4PJCF 1AKJD 5E9DE 4L4TB 4DEPB 4LSVH 4P4RB 1C5BH 4KZDL 5FYKE 3OKNA 1IGCH 4Z7VE 35C8L 3HAEH 5FUZL 2FCBA 1VHPA 5EUOE 4KRNA 4LGRB 5DD5L 3O45A 5B8CC 3IGAA 2FECL 5E24E 4OM1H 5D5MB 3V2AR 1FNLA 3FN0L 3FZUC 3QI9C 4L3CA 4EDWL 1T83A 2DBLH 2AXFA 2P45B 4Y4FB 1Z9OA 2FR4A 1RSFA 4LLWB 4Z77A 5IHBA 2VDLL 1GRWA 4YDVA 4AMKH 1CGTA 3MO1A 1U3ZA 4MJ6A 4OLYL 3P4NB 4RAUB 5H37G 3QJFB 1AGDB 2XWBA 1RZJL 5EA0L 1KF9B 3CVHL 5TDOA 1T7WA 4XX1G 3DRTB 5C07A 1RK0B 1A64A 3U6RB 1RMFL 1NEZB 2JTDA 4FFWD 5I74C 4PJGA 4QHLB 4NQSA 3IU3A 3SDDD 3QIUD 3D39E 4GRWH 3P73A 4PJ8A 3GK8L 5CZVL 4RISL 1QSEA 1N8ZA 1GOHA 4J23A 1HINH 5GGRA 2X1QA 1IKFL 1MJ8H 3B5GA 5I1HH 4TPRL 1OGAD 3CVHA 1EZVY 2XZQL 1ZA6A 4OCMC 4JRXA 5IW6B 4XBPA 2MCG1 4V1DB 4L8SC 3T4AA 4QXGH 3E8UL 2UZXB 4O2FA 2FL5B 3EFFA 3OG4B 5AWNH 4FG6D 4NKDB 4UBDC 5I30H 5IW1A 2A9NL 3MCKA 2GIYA 2W92A 3P73B 4XC1L 4C55A 5EU5A 4HIEB 4RX4D 1HOCA 1PKOA 2GTZB 3FB8B 5FB8B 1XH3B 4K3EH 4RDQG 2DQIL 3LQZA 4E41E 1NKRA 2NTFB 3R8BB 5GGTA 2F9BT 3PL6A 4YEFA 2E9IA 1YEJH 1MCBA 3CVHB 5C0RH 1UEMA 1IC4H 4EN3D 2IAMD 4C56A 4LSSH 3V8OA 3I3BA 3MJ7A 4NKQB 5I17B 5BS0B 5I8CA 1FYHB 3KLSA 4HWBA 5HHOD 2V9QA 3BD5A 3MLUL 4KQ3L 4G8IA 5CHNB 2VH5H 2ORBL 3EYOB 1V3LA 3G5YB 3K74B 4JKMA 4EI6A 3NPSC 1OAXH 2GUOB 1T6WA 3VMNA 5ADPH 1WAAE 2EKSB 2K1MA 3M8OH 4N1HB 4Y16C 1RV6X 1GGUA 2JB6B 4PJFE 5CJOH 3VFTA 2VDRH 5KN5A 3U9PL 3V6OE 4LSDA 3O6LL 5IR1A 3DI3B 4JEGB 4JAMA 4E42A 1PGRB 4H8WH 4KUCD 1FNGA 4U2ZA 2PYEB 3P0VH 4WCYH 3KLHD 1UJ3C 4NNPL 5SWQB 2NY2C 2W07A 5KSAB 4XNUL 1MNUL 1PLGL 3OKOB 4LVNC 3NH7H 2HJLB 4UT6L 3RVXC 5I75C 1T22B 4KKLD 4ZXBB 3AREA 4HH9B 1MEXL 2CJUL 4UDTB 3GSNA 5I9QC 2ITDB 3T77B 1AR1C 2R2CA 1IGYB 5IVZB 1I7RA 2A0LC 3U7YL 1JF1A 1A21A 2K3TA 4M43L 3CZFA 4ZUSA 3BN9C 1IFHH 3QBTB 2B2XL 2VMFA 3P9LB 2E9BA 4YGVB 5TDPB 5IT2L 2GITB 2P8MB 5HYQB 3PP4H 1CDGA 3NFPB 3R8QA 3U1SH 3ALPA 4GUPA 4KHTL 2YBRB 2ZUQB 5BJTA 4P9MH 5FUCC 1HDMA 4P5TB 3O3DA 2ZCLH 1ZHKA 2O5YL 3H3PL 4GG6F 4HFUL 4LPUA 4C56E 2EE9A 1L6XA 2DOCA 3WKMH 3MGTB 1X5IA 1X9QA 5C0IB 5IB1A 5I1CH 3O6ML 3ZZ1A 5FO9B 1LK2B 1CIUA 1TCRA 4WW1B 3U9PH 2NY0D 1QLEL 1YEEL 3QUZA 3DUSB 1SYSB 2YKLH 2J88H 1SYVA 1F3JB 3I85A 2XI9A 3JTSA 3VXRA 4FP8L 3VD4A 1T7YA 5GRVL 1FNEB 1YC8A 2I5YL 1B4RA 1JF1B 1E27B 2VH5L 2AABL 1R0AL 1VADA 5DEGB 2VKWA 4LGPB 2ITDA 1K5NB 1A3QA 3QUXB 3ZMRA 4JDZB 3HI5L 2O5ZH 1G6RL 1WBYB 1LE5B 5CGTA 5AYUL 4UTAH 1C08A 5HHPA 3O9WC 3MRNA 4KGJA 5I30L 5BRZD 3KR3L 3MGAA 3W39B 2YPLE 1SBSH 5DS8B 3WDJA 4NO3B 3OWEA 4HK0B 1FGNL 1YEFH 3F58H 2R1YA 1EIBA 5IEHB 1FORH 1L7TL 3ARDB 3UAJD 4QHMB 1L7IH 3QUMH 5D72L 3QDGD 5T3XD 4M6OH 1CLOH 4YXLL 5IB5B 3PXHA 4KDWA 3CXDH 3RX7A 4KQ3H 5TGBA 3WNKA 2VUOA 4O2EA 2CR6A 1IQWH 5IBTH 3AXLA 4OCYL 3UC0L 1QBLL 2A6IA 2F8OA 4UIMB 5IFJA 3MGOA 1S3KL 3KHOA 4RIRA 3HZKA 4LKCB 5F7HA 1NFIB 1A7PL 3WO3B 3IF1A 2V5SA 1JHKH 2VLKB 2VLKE 5GGRY 4AMKL 3VWJA 4AIZB 2EXWC 3QWRD 1BJ1J 3VH8A 4OGYH 2BHYA 4LAQL 3A6CL 3MLTA 1FL6B 3O41A 5IBUB 2Q87A 2FRGP 3BGMA 5CUSL 3V6FB 4GSDH 3G6AA 3TJHC 4IHOA 1N4XL 32C2B 2X4RA 3MOBL 3SGEH 4HULB 4OZFB 1TLKA 5MENE 4WCYL 2B1HL 5GGVH 1J88A 2A1WH 4JY6A 5I1HL 5MERA 3H9HB 1NAKL 5ECJE 3BPOB 3QZWB 3N9GL 2QHRL 5J13C 5KVMC 2P8PA 2VB5A 1GVIA 3SDXE 3BWAB 3FB6B 4BSWA 3H6JA 3L95A 3CFDA 3WJJA 1U3HD 4WWKC 2BERA 4TUOA 4YK4B 3K8KA 3VD5A 1PEWA 1LGVA 1RMFH 2X4NA 4U31A 3ZDYE 4RNRB 4K8RC 2R8SL 3DURB 1IC5H 2FJHA 2P42B 1BD2D 5EOTA 5KVGH 3NCYS 3KJ4B 4F9LC 3RKDD 1RJYB 2X5PA 4NUGH 3C09B 4H0IA 3S35X 3FO9B 1X5LA 1PSKH 4Y4FC 2ESVD 4J2XA 2J8OA 2VDPL 4TYUA 1V7NL 1XFPA 2Z0BA 4NZUL 1P7KB 2QADD 1JJUA 4YDVB 4NQCD 5EO9A 3VGEA 5HHQB 2QSTA 4OFYA 1P6FA 4TSBH 2Y4SA 2UZIH 5HI4D 3PP3K 2DICA 2J7LA 1IAIH 3MUZ1 3C60A 4XH2B 4G8GE 3ARBD 1XT5A 1DBAL 4U1NB 5FDYA 3PWPA 3D25A 1RIVL 4GS7C 1FH5L 3D9AH 5INCA 4Q9QL 4N90E 3O45B 4NFDA 4XP1H 1JRHL 3OAZH 3S96A 3JVGA 1SY6A 2UZYB 3W9EA 5I73C 1FDLL 4X83A 4NYLA 1YN6B 3F5WA 5EOCH 5C2UB 2GTWA 1DLHA 4ZSOA 2BNQA 3DARA 1CLYL 2ADFH 4I0KA 5E6ZA 5C0AD 2XXCB 1BEYL 4DVBA 3IFOA 5CSZA 3DETD 5CEZH 2X4OA 4ZQKA 3VMOA 3LKNB 2D7PA 4OGAC 4XNXH 1ZTXL 4OCXL 3F7YA 1YPZB 2YD5A 4YHIB 5HGDB 4KPHH 1JWMB 5EZOL 4Y16A 5M94B 1EO7A 4MAYB 3O2DH 3QYCA 4QRTA 3V79C 1ERNA 1TJIH 2Q76A 1RZKL 5F8RC 4POYA 1OGAA 3KPSD 2W91A 1GGIL 2C3HA 5CP7A 3QDMD 3QXDA 3U46B 3U4EA 2R2HA 4DWHA 2VQ1B 4H0HB 1NAKH 4JPVL 3QDJA 4LSRL 4J1UB 2UYLB 4YHOL 5EOCJ 1OM3H 1I4FB 5ISZA 3QEUA 2YD9A 3L6FB 3WXVL 3QIBC 1A22B 1DBAH 4PJHB 3BH8B 1WIUA 2AI0L 1XR9B 4HWEL 5EZIL 2WIIB 4NQCE 1NL0L 1AO7B 4QRSB 3KYOB 4LDOB 2R2EB 1FYTB 4OZ4B 5D1XC 1L6ZA 4CMHB 3DMMA 4PJHF 1EBAA 3HC0B 1I1AD 5FYLD 1ZWIB 4ZO6A 3IDJA 1NMAL 3JWDL 5IF0B 5F9DC 4O51A 5GZOD 4FQCH 4PBVC 4G5ZH 3T1FA 2CQVA 1IVLA 3V5KB 4K3DL 1JPTL 5KN5B 4OD3L 4JM2A 2A6IB 3KWWB 5D8JL 2BVPA 3O4OC 1EA9C 5EC1A 4OM0L 3WUWG 3EJYD 2A0LD 4Q9QH 1C5CH 5TFSH 4ZYKA 1AO7E 1VFMA 3ULUE 3KS0H 4LVOC 5CHNA 4F9PA 4JGMA 4Q6IA 2VLMD 3QXVA 3VJ6A 1NCCH 1A3RH 3NAAH 4YGAB 4RGMC 2XN9D 5JR1H 4ODWA 1DE4B 2F53B 4FZ8H 1Z0MA 5HYFA 2RGSA 5KANG 3KWWA 3O2WH 1YECH 4XWOD 3VFVB 1OM3L 1YNLH 2W65A 3S36L 5D5ME 4LLYB 2VSCA 5CD5D 5JQ6L 5IVOA 2ATPA 3RZWA 1CF8L 3V4VL 1GC1L 5L2JB 3PWJA 3GEWB 1EK3A 3GNML 3WS6A 1KNOA 5JIKA 4MQSB 3WDIA 3EYSH 1E4KA 3D39B 4HC1L 2C4XA 1WGOA 3MRCB 4WWKB 4YK4C 4JZOA 3ZDZF 2XQYK 3VXRB 4PJFA