3BN9D

Crystal structure of mt-sp1 in complex with fab inhibitor e2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
211
Chain Sequence
QVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARPYLTYPQRRGPQNVSPFDNWGQGTMVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-type serine protease 1
publication title Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 211
sequence length 229
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D01
4HKBA 1H15B 5TFSL 3KJ6L 3QHFL 3I84A 5HSFA 5T5FH 5I1EH 3P11H 2HLFD 5IR1A 3DMMB 4LRNH 1AXTH 3SDAD 1I7UA 3VRJB 1CFSB 1JPTH 5EBGA 4S1DD 5MEOB 1ZTXH 1CDYA 2MPAL 3MV7D 3W0WD 5LGJA 1PG7L 4QOKD 2ILLA 4RAVB 5ACLA 3B43A 1B88A 1C08A 2P24A 4JKMA 3O41A 1A0QH 4YHIB 1S9YA 3GBML 1K3ZA 2VXUL 4NC1C 3JUZA 3QEHA 1E4KC 4DJMA 2EYRA 3IJHB 1DSFH 5E5MB 3STZA 3ZTJG 4KDTA 3RY5A 1IGCL 1EAPB 1JGLH 4A6YH 1S9WB 2F58L 5CZVL 4NFCA 4NZRL 5B38G 3MRCB 2CUHA 3P40A 4OM0L 1P4BH 2XZCH 4ZS6C 3ZL4L 1I3GL 4EI5B 4GXVL 4R0LC 3QJFA 2VLME 3D0VA 5C7XL 5FGCB 2XY2A 2OTWB 1VFMA 4Z7QE 3PUCA 5EWIH 4O9HH 5E6YA 2BNRD 5IBUG 4GOSA 1T5XA 3O45A 4FNLL 5C0JA 4NZDA 3RFZC 3QI9A 1I85A 4JHWH 5SWSD 2BJMH 4DN4L 2VDLL 4M43L 5BV7L 1DBAH 2JTDA 3TCXA 2HVJB 4JRXE 3VWJC 4HX1B 1ZHBB 5BCAA 1JPSL 4K7PH 1NGQL 4XB8A 3H7LA 5DFWH 3WD5L 3TNMB 4MD4A 4XRCB 1FL6B 4R97C 2JJVA 1FNLA 4PB9H 3RDTA 2X4NB 2Z31A 4YHZH 1NFIB 2ZPKH 3FB5B 2MNUA 4DVRH 2AK1H 4LVNC 1Y6NR 4LCIH 3TESA 3O3DB 4F7CB 1H3WM 3FMGL 4KVNL 5HVGB 4JRXA 1UM6L 3L5HA 3G6DH 5I9QB 2ZG2A 2Q6WB 2ICCA 3GIZH 5JOPD 3DPBA 3D9AL 1XZ0A 3OKMB 3WN5C 3KR3L 2WANA 4TUJA 4HUNB 4GSDH 5FYKL 3ULVE 3LEVH 3FRPG 1VHPA 1JN6A 2FH6A 2YUXA 2D4FA 3QB7C 4FQ2L 1VGKB 5GGVH 3VXMD 2VLJD 1NEZB 4UMGA 2WIIA 5EC2B 1PX3A 3V52L 4D9LH 2VAJA 3GSXB 1G7IB 43C9B 4LASH 5HHQB 2WBWB 3MACL 3TV3L 5EPMB 3ARFD 3PWLA 1K4CA 3L3GB 3TO4D 2R0WH 5TGBA 3IDGB 4HIHB 5DS8B 2XICA 1DCLA 4HKJB 1W0WA 2W9DH 3GM0A 5IMOA 4DGVL 3NVQA 5IHBA 1YUHA 4FABL 5BZWA 5GQBA 3UXFA 3P4NA 5DK2B 3FQNA 4R26H 2DAVA 2R8SH 5D7JC 4OZHB 5CJ8A 1JNNH 1EEZA 4CW1B 1DVFC 2R56H 5MHSE 4F8TA 4XMPL 4O2CA 2VZVA 4PJGA 3CC5A 2CMRL 4JN1H 4BZ1L 2FIKB 4P5TD 5HYEA 2BCKB 4RWYH 1ZANL 3VD5A 1KJ2H 5JQ6L 4JO2H 1E4XI 3OPZL 5FB8B 3MLSL 1KLFA 5A1AA 4LHJB 2DTML 3RGVB 1BQUA 1KLUB 2RBLA 5I17B 4L8SA 1T7VA 5F9JB 5GZND 3LMJL 5FFLA 1TCRB 1I4FB 3ECBB 4NT6A 1PZ5A 3ALWA 1X5YA 1VADB 5DEZA 3QNYA 1QFWL 3GHBH 3VGHA 4XP5H 2ESVE 1H8SA 3U30B 1J0YA 3NOIA 1RZIB 2GITA 4MJID 3BP4A 3FO0H 2FO4B 1CT8B 4NUJA 3TBWA 4S0TD 3UYPA 1U8HB 3UTSB 3V0WH 1ZT4A 3UC0H 3IFLL 1S7SB 4JQVC 3SDCB 1M7IB 4PJAB 1O0VA 3JWDL 4DWHA 1ZVSA 3OAYK 3IAGC 2YPKA 2DLHA 1R5IA 4L3CA 1FFPA 5HDOA 2ESVA 4Y16A 3SDXF 3QFJD 5EO1A 3VI3F 2UUDK 4JFZH 4NN6C 4G6AC 4NC1E 4OZGB 3FCTA 1MIEH 1CGSL 4QGYA 4YNYB 4G3YL 3CK0L 1LO2H 4K3DL 3CSYA 3FTGB 2MKLC 2XI9A 2O61A 1HILB 2PXYD 3MODH 4Q0XL 1ITCA 3MLVL 2EICA 5CKAA 1YNKH 5F9AC 5JIPA 3JV4B 5H37H 3S36L 1RMFL 4ALAH 5E6IA 5KVGH 4J3TA 4XVUC 4ZFFA 1X5AA 1KV3A 3ZYOA 3SE4C 1E4KA 3GEWB 4XNYH 3O3BA 5C0ND 4OQTL 5LGHL 4POUB 4HT1H 2DMKA 2QHLA 1W0VA 3BKCL 4R7NA 4FQCH 4RIRB 4JY6B 5KG9A 3W9EA 3BJLA 1JV5A 2Y7QB 4HGWB 3QCUL 1G6RB 1HDMB 2ID5A 5F7MC 5EOTA 3BZ4A 3P73A 4ZTOL 4R97B 4K3HA 2XWTA 1YEKH 3B9AA 1BZ7B 2NXYC 1AGBA 3ALXA 2YC1B 1F3JA 1R3IL 5CEYA 3Q1SL 4YAQB 1B2WH 2H2SD 4HEPG 5B38B 2I27N 2IPUG 3NFPB 1UZ6E 1A64A 1A14L 2CRMA 3MNWB 1JYWA 3RJDA 5JUEL 5ICYA 1S9VA 1AGDA 3BOVA 3U1SL 1UQSA 4MX7A 4JKPL 5FF6B 4OLUL 3EBAA 4QRTA 4HQQH 4KXZI 3MRGA 3G04A 5IBUB 2FRGP 2EE6A 5AD0A 2VABA 2GW5A 1MCHA 1R3HB 1OSZA 2W9EL 3VXRD 5ENWB 5FCSH 1JFQL 3SDXA 1HH9B 3SCMC 4R90H 3WO4C 3DOSA 1KB5H 4UIKH 5LWYL 5DUPH 3P0GB 4NPYA 1GZQA 2E9BA 1S5HA 3JBG7 4NRXB 4NQED 1MLCB 3MJ8A 3R06B 1U8OA 4G6ML 4HXAL 1MWAH 4JGUA 1FPTH 2FWOB 2VC2H 1G7PB 4BJLA 1EFXB 3WN5A 4MNQB 4KZEH 5CEXA 1RUPL 5HYJB 5FKAB 3NCJH 1NCWH 2V6HA 4WFHD 5F1NA 1HYRC 4KK6D 1U8NB 5D2LF 3WLBB 2OP4H 5BXFB 5F7HA 3FO9B 1S3KH 3X17A 1RJLA 4P4KC 5MENE 4MXQC 1CI5A 2BOCA 3QAZC 1QPPA 1XGYH 4KTEH 1T3FB 4DGYH 3LKRA 3LSOB 5EORH 5EUKB 2GT9A 1HXMA 3CFEB 3SO3B 1NCDH 1W72H 1FYTA 2D0FA 4X8JB 1KTDB 2DQDL 2LQRA 3D39B 1WLHA 1YEFL 3RKDD 4WCYH 3BIKA 1P5VA 4FA8A 5DWUH 2MCPH 3K7UA 4MAYD 5MENA 3NZHL 3F7RA 5H35A 4OZIF 3OGCA 3PIQB 5E99H 3HPLA 4MJ4A 3FT4A 1T66D 4L4VB 5JHDE 1I7ZA 3GIVB 5GRWA 1DVFA 1S7VB 1LD9A 5I66A 5JA8B 1TNNA 3SJVB 4NRYB 1A02N 3FAXA 4OLXL 4LAQL 4G8FA 3LKSA 1LO3H 2UV3A 3SGDI 4PGDB 4OF5A 1PX4A 2X4RA 4ERSL 5H2BA 4PLJC 3BD5A 3QWOA 3OHXA 1R5VB 1BJMA 5F1IB 4DN3H 2GSGB 2YMXH 2Y25A 3QEQD 5GZOC 4YHKH 3WXVH 5K59E 4Q9RL 4U6YB 4MVBC 5C71A 1TETH 2KZWA 2HH0L 4OB5H 1F4YH 1D9KD 2HAZA 3FB8A 3C6LB 1ZLWK 1HWGB 5B3JE 1OTSD 1HSBB 1FO0H 3LB6D 5GS3A 3B9KB 4X5LA 2ATPB 2IFGA 2DJ4A 2R2HB 3FAWA 3SPVB 3L3OA 4GAGL 4D3CH 1OAYL 1CL7L 3TT1L 3RVUD 4J2XA 4JO1L 1R6VA 3FHAA 1WEJH 5D2LA 5DF0A 4APQD 1LO4L 2KUTA 5DD3L 5JZ7D 3F7PC 3QUXB 1T7XA 3TYFA 2R1XA 2RIKA 2V5YA 4D0CA 2OZ4H 3V6ZA 2NX5D 4OAWB 1CXKA 1IM9D 1Z6JT 3DO3A 3N06B 4P9HC 4WY7L 4FFWC 4OZIE 2R4SL 3A0OA 1EJOL 1MFBH 4N0FB 3PP4L 5EU5A 4PGCB 1V7ML 1H3XA 2DM7A 1KEGL 3FQXA 3ISWA 3G5VA 3WL9B 4MXVE 4HKXB 3IXTB 3ZHKA 1I1AC 5FO9B 1UFUA 4QO1A 4OCLC 4I0PB 4I2XB 4S1SH 3MRPB 4XMLL 4ZUVB 3C5ZC 5SV3A 4MCYA 4Y2DD 1CG9B 1JF5A 1E27A 5H37G 3U0TA 1KENL 5CUSH 2HT3C 4OZIA 4QHLA 3HNSH 2FSEA 1MAMH 1FG9C 2JJSC 4KQ4L 1P69B 5M94B 3KLHC 2VXVH 3LIZH 4X83A 5LG1A 4AQOA 1J1PL 3SE4A 2NXYB 5CINH 4QYOB 2OJEA 2V7HB 4HCRH 3VXQA 4BSVA 1M6OB 3HNTH 5DUMH 4ODVH 4XBGB 5HY9B 3NCYP 1L6XA 3RZWA 1RVFL 4EEEA 4Q9QH 5FHBH 5HI5C 2G75A 4DOHB 5I0ZA 4PRDB 2NYYD 1EGJA 2H45A 3JSSA 3G6JF 3IVKA 5JPNA 2C9AA 5D7IB 1RZ8B 2OS7A 2HTLC 2ZNWA 3U0WH 4R3SA 1RZGA 3NH7L 1A7BA 3V7MA 5DGQA 2W92A 4XHJD 3V5HA 3QXUA 4G42A 4WEBL 5CD3B 1NC4B 2HKHH 4PRPD 5C0RL 1L0YA 4WWKD 1IAMA 4LLVA 4QRSA 4YLQT 1CR9H 3L5XL 1OM3H 2OL3H 4GRWE 4LARH 4XPFH 1A3LH 2IANB 2EH7H 3TA3C 2A9MH 4JHZA 1IEBA 1B4RA 4KMTH 4JDVA 3D1MC 4XT1C 5DJXB 3VA6A 1WBYA 1JYXA 1X9QA 1AXSA 4LEXL 2JELL 3OAUL 4F33B 3DXAB 3LEXB 1NMAH 3SCMA 1IKFL 3DXAE 3F7QA 1N64H 5GISL 3SE9L 3U46B 3KXFD 4ZQKB 4FQJL 4M8VA 2BOBA 3QQ4B 3UTQA 3HE7C 2PETA 2G5BA 3WJLA 5MI0C 4IMKA 3FOLB 3GJFA 5CWSB 3PHOA 5FM5M 2X2YA 3W2DL 2CGRL 2CKBB 4JDTL 5F7FA 4HS6B 4LNVA 5KBNC 2APXA 1ZSDA 1Q9LB 2AJ3A 3U36B 5GS0L 4Y5XA 4KKCD 2C1PB 3N9GH 4LVHC 3G6JE 5D1XB 1TQBC 4F8QA 3CFDB 4JFED 3VG9B 4KFZC 1I1YB 3F58L 5E8PA 3RWCB 3TPUA 1Y18A 1IGML 1FV1B 1QQDA 2JB6B 5E5UB 2YWYA 4DW2L 1AC6A 4LCYA 3QSKB 3WLWC 5FYLH 1TITA 2VSCA 4HK0A 4QXUH 4I1NB 3MLUH 3CU7A 3MRHA 4MA7L 5TQ0H 2VITA 1ZGLP 3BZEA 3ZYZA 2VLRB 4LKXB 3G6JA 4CMHC 3CUPB 3VG0H 2E9JA 3GJEB 1A4JB 3UJIL 1RD6A 2FX8L 3MA7A 3MJ9H 1UXWB 5IF0B 3W0WB 1KT2A 4NRZA 3WFHB 2UYLA 5I1LB 3HAEH 4O00A 5JPMB 3MGTA 1BVLA 1MVUA 1OSPL 1EVUA 1H5BB 5FHAH 1C16A 2VDNH 1YN6B 1Q1JH 5GGRB 4BSWA 4WHCA 5IFJB 3VW3L 3EJJX 4LPXA 1SYSB 2FEDC 4UNTA 3C08H 4NNXB 5AG9A 1TXKA 5DJ2A 5EZLB 2IMNA 4PRNB 3LN4B 3KLAB 2DLEA 4G8GD 5B21A 4CN1A 3V9FA 4YE4L 1C7SA 1UKSA 3MRMB 5ISZB 2AEPL 5T3XL 3FRUB 3PL6A 5MEPA 3OJ2C 5IFHL 2YZ1A 3ARWA 5CKGA 2E9WA 3GMPB 3R0NA 2DL2A 4UQ2B 2R69L 5DJCA 3ZKXB 2M2DA 4EKXA 2G2RA 1NCTA 1U93B 3L9RB 1I3VA 3DETD 5LCVL 3KPRE 3KPNB 4KRNA 1KJ2B 2B0SL 1YEDB 2NY2D 1KPUA 1QR1A 4LCUA 2F53E 5E1AA 1FCCA 4Z0XB 4WFFE 2IQAA 1CBVL 4I4WA 3WIIH 1Y6KR 3H42H 3SE3A 3BT2L 1GC1C 4TQEL 2OK0H 5IW6B 3L3JB 2ICES 3DGCR 3BPNB 4MXWH 1EO8H 3WIFB 2YPLD 5GXBB 3I75B 2X70A 3SKOA 5E2WL 2Z8VC 2HT2D 3QJHA 4NSKA 4QHMA 5EC1A 3HG1E 4LHUG 4M7ZC 3VFGL 2D03L 2Y5TB 2YN3A 4RZCA 4L8CB 1OQXA 1Q0YH 4UAOC 1OB1B 1JNLL 5FDWA 4I0KA 5DRWA 1XIWA 2F53A 1TVDA 3PWPE 5FK9A 4XNMA 1BIIB 1FVDB 4F15B 1FLRH 2BRRL 2VXQH 5ERWA 1I1AA 1U8KA 4PGBB 1UWGH 4CN4A 3Q2CA 4M7JH 4ETQB 3B9EA 1MHCB 3C5ZA 2FX7L 3QCVH 1OT1A 1U8QA 4R9HA 4YHPB 4F7EB 1OCWL 1ZVYA 5H8DA 2X1PA 4YHML 3MRNB 2OX5A 4YIQA 4F3FB 3CPLA 3DLQR 3X14B 2R1WA 3PWPA 4QT5B 1U2CA 1WZ1H 1MIMH 4L8DA 2H1PL 5DQ9B 3BPCA 3ILPA 1JF1A 2VERN 4LFHG 4ZOEA 1T83C 3ARZA 4GRMB 5DJDA 3C09B 3UJTL 3CDGA 3CH1B 2G5RA 1Q9OB 1S9KC 2E7HA 4U1GC 1BVKA 1RZKL 2X44D 5AWNH 4LBEA 4XB7A 1HKLH 4KTYA 1BD2A 3EIFA 4E41D 2AAVA 2DS4A 4LLUB 1C5BL 1AJ7H 1G9NL 4MYWB 5GIRB 1IAOA 2EDBA 32C2A 3UBXA 3TJEL 3QBTB 1BQLL 1MJUL 1M71A 3JWOH 3OF6A 2ZOKB 1HQ4A 3AS3A 4LSUL 4WUKL 1EIBA 1HSAB 5E2UL 1N3NA 1YEGL 2YA2A 2WUCL 4XNZB 4JM2B 4IJ3B 3TA3A 5FKPA 5HD8D 4U0RC 4WW2C 4IDLA 5I1KH 3MRQB 4LSPH 4X80L 1WF5A 4Y1AA 5ESAA 3SQBA 4NFBA 1AE6L 4EUPA 1H3PL 1KTRL 2IALB 4OV6F 2D31A 1MUJA 2Q1EA 1E4WH 1NBYB 2R29L 4R4BB 4MB4A 3B5GA 3CXHK 5DRNB 5CS7A 1K8IB 2OR9H 1R0AH 1FL3A 3BUYA 4PRHE 5GGSY 1UEMA 4F58L 4YK4C 1J8HD 1I3RA 3PG2A 1I8LC 4G9FD 3PWNA 4UV4H 2NY5L 1SJHB 4M62L 5A2KH 4MJIB 4OCRH 1N7ML 2CPCA 5ITFA 4PG2A 1KB5B 1QTYT 5B22A 4L29B 3QDME 5FUZH 1INEL 3QH3A 2IAMD 2A1WH 1IL1B 4ODUA 3HC3L 3FFCE 4G9DA 1T2QL 1CICD 5F97E 4P57B 5HHPB 1XCTB 4PRHA 4Q9CA 5CBAB 1I1FB 3RWDA 2JLLA 5DD6B 1TVBA 1C5DA 1FZMB 5J13C 4XBPB 2V9QA 2EECA 3WFCH 1KB9J 1FRGL 1PEWA 3L7FB 1FORH 4C4KO 3MXVL 5DMGC 1SBSH 2HRPH 3OR6B 4R8WL 3QDMA 1LE9A 5DFVD 3V0VA 4S11A 4L8BA 2PXYB 1VERA 2VZ1A 3MA9L 4NN7C 4JFHE 4BUGA 4Y2OA 3ZO0A 3T2NL 4HS3A 1K6QH 3U4BH 4NQUA 1ZLUK 4QRPD 3HZYB 3UDWA 4EBQH 1SY6L 1W72B 5ECJE 4ELKA 1X4XA 2J4WH 4G8IA 3DX7B 3HS0B 3VFWA 3QA3B 1NC2A 5DHXB 2AGJL 4PJCF 4JGMA 2QTEA 3SGKC 1PJ9A 1TNMA 35C8H 2CXKA 5C0BD 1BOYA 4WFGE 1CFQB 2XWJB 3ALPA 5JOFA 1N59A 1IEAB 5I1AB 3VFPB 3VFUB 1RIVH 1YYLH 5F3HA 2EZ0C 5FYJD 1ADQL 1DEEA 3O6FB 1FE8L 2IEPA 4K7FB 5E24E 4S1RH 3O6KL 4IMLA 2B4CC 4FXGA 1PG7W 3DVNB 5TJWK 4UINH 3KWWB 4OT1L 5I71C 3JVGC 3NABL 4WI7A 1MNUL 3KPTA 3PGCB 4QHKJ 4XCCH 3UYRH 3VCLA 1FJ1B 1UXSB 3LV3A 4U1HB 3RVTC 3GUTA 2I9TB 5IBLD 2FHBA 5KOMC 2W0FB 4WW2F 1J86A 4NWTH 1XGPB 2GAZB 3WE6B 1XR8B 3MZGB 2FD6H 3BKML 4Y4KD 1J05B 5CMAB 2C7UB 3MLXH 4CVUA 4LLAA 1FO0B 1K4DB 2NZ9C 3B5TA 4PLNC 4NQCD 5KAQG 2AEIT 5D7KD 3OR7A 4AH2B 1BGXH 5JIIA 1MFAH 4LSRL 4BELD 4PRAA 4WO4B 3U0PA 2CIIA 4TVPL 5GRYA 3TVMB 4KGLA 1WICA 4PJCE 1NSNL 1PGRB 3T2QA 5F70A 4WHDA 3SKUD 4M6OL 2DYPB 4P3DA 1Z9MA 4LHUB 4B41A 1P7KB 1UVQB 4JRWA 5DJZB 2K7QA 4WHTB 3MYJB 5CEZE 2A6IB 4XTRD 5J89A 4MZ2A 3WFDH 3P30H 1NANH 4KMQA 1CGWA 4ODTL 5T3ZL 4F9LC 1PLGH 4M4PA 1C1EL 1N6UA 2ICEB 3C5SA 5C08D 4XPHL 5K9JL 4JCMA 1T83A 4DUXA 1MRDL 4K9EH 5FUCC 7FABH 3EAKA 3HI1A 5EIIB 4HSQA 1P7QD 1GIGL 3EYQD 4Y4FD 1EH9A 4OIAA 3WIHH 1CCZA 4P2RD 4WJ5B 4U0RB 3EYOA 4JFYB 4ZYKA 3GSVA 2VDOL 4U6HA 4NKIH 4HPYL 3RAJL 2A73B 3I2CL 4JO4L 3LOWA 2LABA 2NW2B 2X4OA 3EYUH 3QG6B 4IRJD 2DD8H 3GFUA 2VOTA 4GBXB 1ZGLA 4L4TE 4PJEF 3OB0K 4MAUH 2OQJA 4HKZB 1N5AB 2AJVL 4NZJA 3QRFM 4WTXA 5ALCL 1P5UA 1TTUA 3KPPA 3G6AB 2Q7YB 4M8QA 4ODXA 1F6FB 2ZNXA 4P46D 3QP3A 3ARBC 1JK8B 1ZLSL 2DLFH 1QP1A 4H88L 4LGSB 1UB6A 5HPMA 3GHEH 4LL9A 4IHOB 4GAFB 5ICXA 1IRAY 4KHTH 3NPSC 2Z9TA 3IFOB 4JZNA 4QLRA 2EXYD 1N6QL 5E00B 2C5DC 2OL3B 2A74B 3IKCB 4G6JH 2DQTL 3RIFK 5I8CB 1QSVA 3S37H 2COQA 1TFHA 3W39B 5F9OH 3WFEH 3IU3A 5GSVA 3N85L 3OMZA 3IDJB 1P4LA 1R3LA 5J13B 1PSKH 4LKCA 3SDDC 4ORGB 5DVMA 2ZSVB 5F7DA 5EZOH 2EDWA 4UZGA 4UOW0 1EBPA 1H8OA 1FDLL 5GSRB 4QNPE 4P2QD 1BBDL 3MYZA 3OXRA 5FDYA 5IV2A 4G6KH 4EVNB 2YPVL 1JI1A 3BHBA 1CFSA 3W11D 1UG9A 2ARJA 5EU6B 4BZ2L 3TBSA 1EEQA 3QIBA 4DUVA 4NN7B 2ZUQC 2V5RA 3WS6A 4APQB 1TMCB 1IAKA 2FBJL 3Q6FA 4PJBF 4PJEE 3CSBA 1G9MC 1KG0B 5IB1B 5TFSH 4YHIA 3KJ6H 5FYKD 1OAKL 2JK5B 3QHFH 4P2YA 1ZHNB 1YEJH 4YZFE 2MQ3A 3QG7L 1KNOB 2P5WB 3BW9A 4HXBL 1DBML 5T1KA 3KPQB 3IRPX 5CZXD 2Q7NA 3ZTNL 4P9ML 1X5GA 3CFBB 5CCKL 2IH3B 3LQMA 2WP3T 3G5XB 2GTWA 2MPAH 5AZ2L 3EO9L 1JP5A 4U4BA 3KYOA 1PG7H 2FHCA 4PJEA 5K9QI 3P9LA 3KLSA 2X4TB 4X4MA 5INCA 5DD5L 3HB3C 4LPCA 3GBMH 3FOMA 2VXUH 5IVXF 1T2JA 3MROA 4JZJC 3EGSA 5ID1B 4F9PA 3SGKA 1IGCH 1MY7A 3MLWL 3U7AA 4MD5A 2F58H 5LXGL 4G43B 5CZVH 2VDKL 4NZRH 3HAEB 3WEXA 3ZL4H 4GXVH 3BYYA 4ZFGL 3QNZA 2RHEA 5C7XH 1IC5H 3O4OB 3ULVL 5C9JA 5KANI 1T6WA 2HT4C 5FV2A 1Z9LA 4XRCA 3QDGA 5J1AA 1XFPA 4DCQA 4P23D 4KRMB 1QZ1A 3WYRA 5KSVA 4FNLH 4PJBE 3ARRA 1GGYA 2D7PA 4DN4H 5DEGA 2XNAB 2VDLH 3BWAB 3O3DA 4M43H 5C0EB 5BV7H 4WWKB 4JLRA 2FNBA 4NNYB 1GGIL 1D6VL 5ABDE 1JPSH 4O4YL 1NGQH 1U91B 5CJBA 1L9NA 1OAUL 3DVGA 4YPGA 3WD5H 4ZFOB 5HGDB 1GGBL 4I18C 4PY7A 4CADB 3FN0L 3HRZB 3UTPD 5EN2A 4AEHL 5JW4Q 2YOCA 5EC2A 1UGNA 4HIIB 4HMDA 4JY4A 5INDA 5HVHC 4KVNH 2X4SB 2P8LA 1UM6H 3LAFA 3DRQA 5HHQA 4OLVL 1F2QA 2C26A 5FUCE 4LLWA 5EPMA 3D9AH 4XP6L 3KR3H 1YC7A 4U49A 4HC1A 3HUJE 4YC2C 1VEOA 5DJ0A 4NQDD 4HJ0C 1U8PA 4ELMF 5A2JH 4ZOBA 3CJJA 1NH6A 3F7YA 3RNQB 5I30H 3V52H 5IVXA 3VDAA 1X5JA 4OF8A 4O2EB 4O2FB 5T5NF 1KIQB 3MACH 3C6SA 5KSAC 2A77L 3U2SB 3TO2A 2BVOA 2PF6A 2BNQB 2VQTA 3WV0A 5BQ7B 5BO1L 4BK5A 3NFNB 4CL7A 4MB3A 2VDMH 3BAEL 5M95B 1A5FL 2PO6D 1CFNB 3D85D 3TLRA 1B0GB 2FIKA 3VXUD 1E4XL 3DUSA 1QSZA 4DGVH 2BCKA 1BZ9B 4FABH 1FVEA 3NPSB 2K9UA 3M17A 1EA9C 3VJ6B 1PYWB 1IEHA 1ED3A 3VFMB 4AM0B 1D5XA 1KLUA 4FFYL 5IVZB 4WTZG 5I17A 3TZVB 4HDIA 2WNGA 1GGCL 1EJ6A 2XN9E 5IJVA 1NLDL 4RBPH 4U1IB 4XMPH 4W81A 4K71C 1MCPL 3SDDB 3HC0B 1I4FA 2CMRH 1A7QL 3ARBA 1B6UA 4BZ1H 4Z0BH 2IH1B 1L9MA 1FL5A 3VWKC 1ZANH 4FXKB 4C83A 5IHZB 5JQ6H 1V3JA 5J1TC 5D70L 3MLSH 2DTMH 1Q72L 5I8KL 3UTSA 3W9DB 2XN9A 4ELME 5E7FA 3UZEA 3HZMA 3IDUA 3LMJH 3ULSA 4GXUN 4WUUE 4U6XB 1WISA 1QFWM 3K4ZA 1TZIB 5A3IC 4M1CD 4IRSA 3RWJA 1C5CL 1QFWH 5ALBL 2NY2B 4OZGA 1W8OA 4YEFA 1MJ7L 3REWA 4YNYA 2P4AB 3ARXA 1WCBA 4RFNC 2A2QT 3BP7A 2H6PB 2MMXA 4ELMA 3MLYL 1S7RB 3L7EA 3IFLH 1MCSA 2H32H 3D2UB 3BN3B 3TC9A 3MRLB 4WUUA 5IJKC 1IKNC 3DYMA 3UX9B 2I24N 3L6FA 3QIUA 6FABH 1M7DB 4YO0B 4LSSL 3RU8L 4PJDF 1ZT1B 1CGSH 5BS0D 4G3YH 3CK0H 1B90A 4K3DH 3TIEB 5E9DA 1UH4A 2CD0A 4Q0XH 4Z7VB 3F8UB 1DUZA 3MLVH 3O3AA 4PR5A 4MDJA 3TBVA 3OBAA 3SGEH 4MNGE 3F6LA 2JCCF 3OL2A 1RMFH 1XMWA 4U3XA 1J0ZA 4HMEA 5BJTA 5DJ8A 1G6RA 1DBJL 4PJIB 3SKMB 3LKQB 2EDOA 5FM4A 5C2UB 3E8UL 3F62A 3FO1B 2YXFA 3N1PC 4JZJA 2PUQT 2DKUA 4PV9B 4OQTH 5LGHH 2YC1A 3CZFA 1EUUA 1JGDA 3HI6H 5EIVA 4JFQA 5TDNA 1AR2A 4C55A 4I3SL 3BKCH 1U36A 2EH8L 2RFXA 3EOAB 3KPSE 4V1DD 4XC3L 3ZSSA 4WU5B 3MNWA 1BFOA 4PGZA 4XNUL 3QCUH 1LEGA 2EDYA 3IS0X 4J4PD 4ZTOH 2R1YB 4QXTA 4X5XA 3K2UL 3CFCL 1QOKA 5EOCJ 2AXFB 3RZCD 4X98A 4Z7WF 4KY1H 4DVBB 3AU1A 3E1F1 3X3FL 2EKSB 3I50L 2HJFA 1YEEH 3DO7B 3DUHA 4GAJL 1XCQA 3M1BA 4N8PA 5ENWA 3Q1SH 1M1SA 3EO0B 3KPSA 4Y5YC 3DURA 3TH2T 2BMKA 5SX4I 1IM3B 5J12B 5B4MC 4NRXA 4PJDE 3QDHA 5JUEH 1C7TA 1TPXB 5F7LB 1HWHB 1A1MB 3U1SH 1K8DB 4JKPH 2ZOLA 4OLUH 2CLRA 4HHAA 4PTTB 4I18A 1AO7E 4J7RA 2JCCE 1JPGB 3K0WA 4LK4A 5DMJB 2W9EH 4NDMB 1I1RA 2CIKB 3MOQA 3EYSL 3WLBA 4XVSH 4J3WA 3TWCL 5L9DH 1YN7A 3FO9A 1KXTB 1MFNA 1HZHL 5IQ7L 1BM3L 3WNPA 4HG4J 5KSAB 3O2DL 4L9DA 3LVEA 4G6MH 4HXAH 1X5LA 3O8XD 2X9YA 1T7WA 2X7LB 4FQ1L 5C07B 2VRAA 2P45B 5C0CD 4QTIH 4KK9D 3ZSTA 3D39A 4X6EB 1WZMA 3SDAC 3RUGF 3WKNA 1RPQA 3NCMA 5F72S 2CJUL 4JG1H 4NP4L 1GHFL 1JJUA 2DQIL 3S4SG 4ONGL 3RIFF 3QDJE 5CLWA 1T1WA 3X11B 1KN2L 3KYNA 3GSOB 1CICB 4Z7WE 4IOSD 1G7MA 3MRJB 2EDKA 1DANT 1N2RB 2FJFB 2VISB 4L4VA 3GIVA 3H9SB 1DLFL 2XG5A 1JTOA 5IB3A 4NRYA 3GNML 2EDFA 1A6VL 2DQDH 3O9WD 4WIQA 1T4KB 2APBA 3OAZH 3DHMA 3NZHH 5CSZA 4HWEL 3GMNB 3EFDL 2H8PA 2KL6A 4L3EB 4Z7WA 3BPOC 2X89D 3BPLB 5IW3A 3BGMA 4KDWA 2DQFA 2NW3A 4OZFA 1FN4A 2J8OA 3DYPA 3V6FB 3O0RL 3AAZA 3PJSA 4LCWE 4GQ9L 4OLXH 4YBLC 4LAQH 3DBXB 3C6LA 1V5JA 3MRKA 4EDXA 2DQUH 1HSBA 2VDQL 2R2HA 1WAAF 3CNKA 3VWKA 5C0BB 3SPVA 1Z5LA 4ERSH 3LEYL 2AK4A 3P2TA 1YMME 5D6DC 1ONQB 3IGAA 3S7GA 5JW3L 3TNNA 3RUGE 4EN3C 2VR4A 4PJ9D 5I1DB 3DV4A 2Y36L 4Q9RH 3WHXA 1EGJL 2HH0H 4FTVD 3PP3K 4IOIB 1TTGA 4LCWA 4X6FB 5AAWA 1FNSL 1RUML 3LKPB 4W6WB 4RAUB 3V5DB 2Y72A 3KS0J 1A7RL 2BFVL 2J3SA 3RWEB 3WSQL 4YGAB 4TSBL 1SEQH 1QVOB 4OGYL 4X6BA 1OPGL 4GAGH 5D7LD 5TE7L 1YMMA 3DI3B 3HZKB 1T2XA 3HMWH 1OAYH 3TT1H 1S7QA 3D3VA 2EEBA 4LNRA 3CDFA 4JO1H 3BEVB 4NZUL 4ZFZB 2F54E 3MRPA 5IT2L 2C4FT 2Y6SD 3QIWD 4DKFL 5DD3H 3JV0A 3KYKL 1ZHLB 3IAQA 5IJKA 2YRPA 3W5MA 1YY8B 4WY7H 1A1NB 1EJOH 43CAB 3BP5A 1NGYB 5GS0D 3PP4H 2I25N 1V7MH 1KEGH 2VLKB 4HV8B 4QYOA 5IMMA 1OGAB 3GSWB 3VH8A 2JJUA 3ZT6A 3O4LD 4H20L 3ZKMC 1HHIB 1AKJD 2F54A 3QWQB 3FQTB 4FRWA 1UJ3C 1MI5D 2ZSWB 3TCLA 3BQUD 4O9HL 1KENH 3ARFC 4BZYA 5F88B 4GRLD 5D1ZD 4YXLL 3TO4C 4X6DF 5IIEA 2DLGA 2NY1D 3DRTB 1XF3A 5BW7C 4JREC 3DV6A 5JORB 1J1PH 1NBVL 2VXTH 4PRIB 3X13B 2O26U 1ORSB 1RZ8A 2JJTC 3PV6A 4MA1B 2VB5A 1Y6MR 4KGJA 4A6YA 5AUMB 4P5KA 4IIQC 2AV7B 3RX5A 1WAAA 3QUMH 1UKTA 1P7QB 1RVFH 3VD7A 2BY3A 3BWUC 5EU3B 3UO1L 1QSED 1FNFA 3UPRA 1QHOA 2CKBL 1N5YH 1AQDB 3TN0C 5GS1C 3OXSA 4P5TC 4LCIL 1QRND 2KDGA 5DJXA 3K46A 1RAMA 5FECB 3NH7H 4Y4HD 3VU2A 5IROC 5KVEH 3QPQD 4K55A 2YHGA 4WEBH 5T3XD 1L6ZA 1NDGA 3IFPA 3QCTL 5C0RH 3U46A 5C09D 4ZQKA 3L5XH 3UCRA 3H3PL 5I76A 4JFPA 3CZJA 5GZNC 2LV4A 3MUY1 2I60H 3QQ3B 3FOLA 1MCCA 3H2WA 5HHOB 4OLZL 3F12A 4PP1D 5FO8B 4BKLB 1GAFH 4XCEB 2YBRA 5HHOE 1HH6B 3QFDA 4PJ5D 1Q9LA 4LEXH 2JELH 3OAUH 3AC0A 3JZ7A 1HHKA 3D25B 2R0ZH 4RQQA 5BV7B 1B0RB 3QPXL 1IKFH 3MRRB 5KJRL 3QQ9C 4B0MM 5GISH 2X9XA 4XI5D 5I19L 1UYWL 4FQJH 2C4FU 3L3HA 5J9PA 3MV7E 1U6AL 5I6XB 4GUPB 4U7MA 4PJHB 2YD6A 5DR5L 1QNZH 5IBTH 1ND0A 2J8UB 3GSRB 1DQML 4JDTH 4F7MA 4H0HB 4HIJA 4P2QB 5GS0H 2QR0B 2ICWI 4X6DA 3SDAA 4XAKD 4LIQE 4R26L 4OI8A 3I3DA 4QXWA 1YPZB 1VFOA 5MEQB 1REIA 3MV7A 1OAXL 3W0WA 3PWUB 2R56L 4XPAL 4QOKA 5I1LA 5IMKB 3P4LA 5JPMA 1IGMH 3VGEA 4P9HL 5D8JL 2OMNA 4JRYD 4DW2H 3GKZA 1KPVB 5DEFB 5B8CB 1QLRA 4J23A 4ZUTA 3EYFA 2DN7A 4J8RB 4FQHA 5J6GA 2PYED 1MCKA 2BNRE 1SYSA 5ESQA 4MA7H 2HVKB 2APWA 4NNXA 1PEZA 2W65B 3MBEC 4MD0B 5TDOB 2P5ED 3S4SB 3NA9L 3LN4A 2Z4QB 5EFIA 1S5IL 3QUYD 4OCWL 4URTB 1CD1B 2CDGB 4RAHA 1ZKAA 2NLJA 3VXSD 4NO3A 2Z0BA 2R4RL 1OSPH 1BMGA 1RZFL 4UIMA 3GHBL 5H94B 4XP5L 3K1DA 3KPLA 2BNRA 1H9VA 4Z6AT 4OLEA 4Z8FL 1U93A 3L9RA 3MFFA 4ODSL 4LLMB 4DGIL 5DDHB 2ICWA 5KSUA 1U92B 4MQTB 1BVZA 5SWSA 4POYA 2O5XL 2H2SC 2W0KA 4M6AA 4O58H 1QKZL 4YE4H 3L3KB 1INQA 3P4OA 4U1MA 2AEPH 5IW6A 3QZWA 3PGDB 5DQDL 2VZOA 3MV8D 2GTZA 5IFHH 5EG6C 2P1YA 2R69H 4E5XA 5JOPE 5HYSG 3LQZB 3KYMA 1LGVA 4HWZB 1KLGB 5DT1L 5LCVH 1I8IA 5DZNA 4UBDD 2B0SH 5DQJB 3S96B 4D94A 5IP4A 2FEEI 3REVB 4FQXD 4KKNA 3KPOB 4KZDL 3WUWA 4KK8C 3VXME 5JMRA 1CBVH 1FVDA 1YNKL 3BT2H 4TQEH 1JZ6A 1U8JB 4ETQA 1MHCA 4H1LH 1EZVY 3VDCA 5JW4N 1U3YA 1MREL 3KG5A 5E2WH 4GO6B 4F7EA 4L4JA 3VFGH 2D03H 3CVHB 4NIKB 1MCBA 1RJYB 4HUXB 1DN0A 4QT5A 1J12A 5F7NC 4NM8H 1KULA 1JIBA 5DLML 3VXMA 1FZJB 2VLJA 5HYFA 1JWUA 4LU5L 4FQCL 2BRRH 4ZOCA 5D9SB 4AEIL 2ADIA 1GJIA 2H32B 5F3BB 4KVCL 1WWWX 2HFEB 1UJ3A 1AGEA 2FX7H 4G80A 1ETZB 1F6AB 3PHQA 5DA0B 5D1QB 5HI3D 3G9AB 3ARFA 4Q7DA 3GMRB 1KIPB 4PBVC 1YC8A 1OCWH 4Y19B 2WWMD 3TO4A 2V2WA 3MUGA 3P0VL 4OFKA 4WNQA 5DJ6A 3IKKA 2WW8A 4PGEA 4LLUA 4PJ7B 4NQDB 3RKDC 3QXDA 3ES6B 2X4QB 3VI4F 4QHNB 3R8QA 3EOBB 1F2XK 3T0EB 1ES0B 4MAYC 4PJ7E 4CMMA 3C2AH 4IIQA 3UJTH 4ZPTA 3BISA 2WIMA 4I5BB 1T66C 4BQ8A 4OFVA 5F6HI 3CLEL 5JLZA 4QRRD 4PJ8B 2ZUXA 1IGTA 4ENED 3RWIA 2PO6B 1C5BH 4XC1L 4DEPC 5HYQB 4R96B 15C8L 3DIFA 4P5TA 1VFBA 4KRPD 1DDHA 4X9GA 5E95B 3TJEH 3HR6A 1MJUH 5IROA 1I9IL 5JW5B 1MRFL 1T7ZA 2BY0A 4ZS7H 2NY3B 3I6LE 5JXAL 4AT6A 4BQ9A 5C2BH 5DRNA 3P3YA 4WUKH 5D6CB 3EOTL 1UWXH 5E2UH 1YEGH 3Q3GA 2WUCH 4K8RC 4OI9A 4QY8A 4KZEL 1S8DB 5HJ3B 2D7TL 1OTSC 3LB6C 4X80H 4GKZB 1BBJB 2IGFL 3QFJE 2BVYA 1HHHB 1S3KL 1AE6H 3MV01 5HHMB 4MJIA 1H3PH 2EE9A 4HH9A 4LDEB 4L29A 1RFDL 5HHME 2R29H 4Z18A 1IL1A 3V7AG 1A1OB 1UB5B 3QO1B 4ZSOB 4MCZA 4P57A 1XCTA 2PW1A 5JZ7C 5T1LB 1MWAA 3ROOA 3NZ8B 3V5KA 3DYOA 1P84J 4F58H 5DO2C 3I6GB 1E28B 1BREA 5DD6A 1F3DH 2FL5A 4WCYL 4JN2B 5DWUL 3LQAC 3QFJA 4U7SA 4DAGL 1RY7B 4M62H 1QFPA 3DSFL 1N7MH 5JA9A 3RNKA 3AREB 5FO7B 1X5KA 1D3CA 2PXYA 2J5LC 3HC3H 3I6KA 5DI8B 5I73C 1EUTA 5IK3A 2EDTA 4JFDD 4N1CA 2A6KA 3HZYA 2LU4A 3JTSA 3STBA 3ARGD 2DBLL 5LAXB 3QA3A 4MHHG 5I1GL 2VIRA 4X4XB 4Z9KB 3KHQA 5T3ZD 3MXVH 4UU9A 4R8WH 2V5MA 2C3XA 1U3HB 4LQFL 4NQXA 3BESR 5BRZB 1AGFA 3VXTB 1IC4L 1CGUA 3MA9H 5BRZE 2XWJA 3PQYE 4JDZA 4YHKL 2HKFL 3HE6B 3T2NH 1JZ2A 4OB5L 3T65A 4XXDA 4PBWD 1DFBL 5GHWL 3H9HA 2NYYC 2WINB 4P2OD 3R8BB 4KROD 2YD3A 4RFOL 3PABB 1CGYA 4JJ5A 2KZ1B 5T1DL 1CQKA 4GG6B 1CXHA 2QADB 1S7UB 4JFOB 3WFBL 2CDEB 3DVNA 1AGCA 3KDMA 4LPYA 3VXRE 3KWWA 5ID0B 4WU7B 2R2EA 4BFBD 3TH3T 3TBYB 2HLAA 4N0UA 4QHKI 2GCYB 1FCGA 5HDLA 1VKXB 1V3KA 5HGAB 3QR2A 3UAJD 2I9TA 3WO3B 4TSCH 3G5YA 4NJAL 5CEZL 1ADQH 3SKNB 2GAZA 2CKNA 5E4EB 1AD0B 3KHOA 1FE8H 5IEHB 2FIRT 4OFDA 2C7UA 4KK5C 3DMMD 1UM5L 3O6KH 2I26N 4ZUSA 1CLCA 2HG5B 3VXRA 2X1QA 4XWOC 4E42B 4OT1H 4Z7OF 3VFOA 1MNUH 2ZP0T 4JHBA 4E0RB 1W8NA 3L5WA 2XYCA 3I3EA 5CUSL 4JANB 4LOUD 3CMOH 3Q0HA 4NQEA 2FBOJ 1JCKA 1OGTB 4UDTA 1IILE 4PJFB 2VXVL 5E8EB 1P4IH 4YPJA 2FJHB 4ZO6A 4WHTA 4Z78A 2CO7B 4M93B 4LSRH 1O5DT 4HCRL 4JFFB 4AG4L 2Z91A 4NYLB 4UT6H 3K2MC 1A6PA 3HNTL 3V0AC 2Q76A 4KKCC 1SJEA 1PQZB 4OCYL 5FCUL 4TVPH 1XF1A 4LGPB 4BFIB 2ICEA 3CFIC 3DX9B 4EI5D 1D6EA 3ETBF 3TBTB 5I1CL 4AL8L 3HLAA 5I74C 4M6OH 1EHNA 1NUDA 3GMLB 1LNUB 5JO5A 2AV1A 3E6HA 1AHWC 2XWBB 4WJ5A 3JV5A 3D18B 4YXHL 4YDLB 1QSFB 3O2VL 2MHAB 3HR5B 5JXED 1Z3GH 4MAYA 1C1EH 3AXLB 1UM4L 4XPHH 1CR9L 5K9JH 1OM3L 1GSMA 1MRDH 2DBJA 3BN9C 3F5WB 3PWJB 4X7TB 4XPFL 4NKMA 5HVFB 1VPOH 4PJXB 1GIGH 4AY0A 3OJDA 3QEQE 3QO0B 4CVXA 4Z7OE 4J6RL 3IETB 3MR9A 4F7PB 1IBGH 2RCSH 2Q7YA 2WZPD 4WI5A 3MRIB 1QEWB 4PLKC 4YGVA 5IW1B 3H3KA 1KC5L 4X9BA 2VDOH 3VE0B 4NZTL 4HPYH 4UUJB 2AJXH 3ESUF 3HZVB 3I2CH 4JO4H 1NMAL 2IPTH 2E7BA 3NGBC 1WBXA 1N64L 2C3HA 3NA4A 3LCYA 2F15A 3NFSL 3QUMB 3B2VL 5GGUB 3RPKA 2AJVH 2OL3A 4LAJH 3RTQB 2DQEL 3QEQA 5I8CA 1F3RB 3ULVD 2R2BB 4GAYB 5ALCH 3S5LB 5ETUB 3O3UN 1D9KA 5DHVA 2C3WA 3MOAL 5CD5D 2NX5E 3AM8C 5F89B 3DETC 1U58A 4ZXBC 3KS0H 1K5NA 1ZLSH 4H88H 3N9GL 4FQQB 4MA3B 5F6IC 4QWWD 1OD9A 3ZDZF 4PS4L 4FOMA 1NUNB 4ZODA 1KIUA 3MX0A 1FFNA 4BQCA 2AJZB 1FC2D 1N6QH 2DWDB 2DQTH 2MSPA 4APQA 1XGQA 1MRCL 4XZUB 2WWKO 2J88L 3N85H 2NX5A 2J7LA 4C57C 2HT2C 1IM9A 2HYMA 4QXUL 2NTFA 1KG0A 3MLUL 3MREB 3QUZC 5IB1A 2B4CL 4R4ND 2DIBA 4FZ8L 1ZHNA 1FDLH 2DI8A 3VG0L 1BBDH 1HNFA 2ZUYA 3Q5YA 3MJ9L 1MCLA 5CP7B 5F8RC 4BZ2H 5GGRY 4IOFD 4Y2DA 3G5XA 4MSWB 4G8EA 5F8QC 2QQQA 3ELAT 1HQRA 3K8MA 1A22B 1ZLVH 3SQOH 2X4TA 1JVKA 1OAKH 3C08L 1MQKL 2OMBA 4RNRA 1XGTA 3GSUA 4MHHI 3IF1A 4RMQA 3QG7H 3EDFA 5DMYA 4HXBH 1Q8MA 1HI6B 4ZNEE 5EOQL 3RGVD 3ZTNH 5CCKH 4G43A 1U9KA 4WHYG 3ARDD 2IBZX 1CFTA 3HAEA 1BX2B 3H9ZA 4PRPE 5IEKB 3ZDZE 4GS7C 2F74A 3LN5A 4ZO9A 1BQHA 4HC1L 3CFKB 1OF2B 2YUWA 4W4NA 1MLBB 3UTTB 4M9OA 4ZNEA 3WIIL 5DMKB 4GW4A 4U3CA 1D7FA 2CRYA 3MLWH 3ULUC 4MXWL 1SM3H 2DM3A 1T0MB 4Z95L 1LP9F 2WQRA 2VDKH 3SDCD 1MCWW 3FT3A 3IJSB 2BSTB 3C60C 4ZOAA 4PRPA 4R4FL 4WWKA 1NGWA 3KXFE 4ZFGH 2HTKC 3V95A 4POZC 2YUVA 5JDSA 1QSEB 4B50A 4PP2B 4NNPL 3KPMA 1R24A 4NN5B 4F37K 4AENB 2IPKA 3T0BA 4AJ0A 5ANMB 1JTPA 3DX6B 5DK3A 2HJKA 3QWRD 1JHTA 3VXNB 5ANME 1CDGA 3UTOA 2VXQL 1VFAB 2G60L 1T6VN 2C1OA 3EUUA 3KXFA 4DZ8A 4ZAKB 2BVQA 1GGIH 1D6VH 5I74B 3W5NA 1YMHB 4ZD3L 2E3VA 4JFEE 4O4YH 5F9WB 2DWEA 2ZUUA 1MJJA 1A7PL 3C5JA 1GGBH 2BSRA 3FN0H 4PJ5B 3CLFL 2PTUA 5KSBB 1GOFA 1NL0L 4AEHH 4P4RB 1T21B 3ESVF 5F93C 3A6CL 2R0KH 5C6PB 3VWJD 3RQ3A 4R2GB 4OLVH 3W82A 3LKOB 1T04B 4JFEA 1NQBA 3MZTA 4ONFL 4UDUA 4BH8A 3MGOA 4G6FB 2GJ6B 3S36X 4W70A 1LP9E 5BQ7A 4V2BA 5CHNB 3RL2A 1AHWA 2GJ6E 2J2ZA 1CXEA 1KIRA 1WBZB 1JPFB 4TNVK 2IBGA 4D9RD 3VFNB 1CFNA 3U6RB 1B0GA 3NGBB 1UC6A 5AYQA 2JE8A 4G8GE 4YBHA 2XTJB 4RBPK 2HJLB 3VFMA 1QA9A 4D8PA 4J3SA 1NMCB 2BC4B 4JCLA 4EIGB 2A77H 2FZ3B 2VZTA 4OD1L 1G9ML 2W60B 3H7BA 3FJTA 4U1IA 5I1KL 5BO1H 4LSPL 1CS6A 3MJ7B 4XMKL 4ZXBB 5HI4D 3FO2A 3KNBA 5TH2A 1AD9A 4FXLA 1E4XH 5F6IB 1LMKA 1YJDC 4U1LB 1IAII 4G8GA 4OV5A 5C3LD 4HZLA 1MCOL 3UJJL 5BMFL 1RI8A 4FFYH 1QFOA 3MV9E 5IM7B 1GGCH 1JL8A 1NLDH 4J1UA 4JPIA 4WI6A 4CNIA 1EFXD 1G7QB 2C3VB 2AI0L 4HJGB 4LCCC 4MNQD 5J57B 3WDJA 1MCPH 5HYJD 2BNUB 4DFHA 3RVWD 4J3OC 3MC0A 3AM8A 2P8MB 1HHGB 4LSQL 4N68A 1XF2A 4M48H 2CLVA 5HGBB 2H3NB 2LAAA 3DHJA 5L2KB 4P5MA 1UWEL 2D2OA 5DUBB 1JWSB 5D70H 2CUMA 4RGNB 1ZA6B 5D7JD 1A6TA 2WSKA 5I8KH 3GMMB 1ZEAL 1ZS8B 1S7RA 2AEWA 1Q9KA 1VACB 1YQVH 2YPLA 3QQNA 4M3KB 4O51B 4YHNB 1YNTA 3M8OL 4B7LA 5FUOL 5HHNA 1XF5B 2DIJA 2GFBB 2HA1A 5EBWA 5C6WH 1VDGA 3IXAB 4Y4KC 4LF3A 2XRAL 3RJQB 3TH4T 2HRPL 4NO0B 1C5CH 4PG9B 2VH5H 3K80A 4H0IA 5ALBH 1M7DA 3BH9B 1FFOB 4OFIA 1KTLA 1CE1H 2P7TB 1MJ7H 2PYFA 5C0DA 3TIEA 5C0IA 5JHDD 3B6SA 2E7MA 3R0MA 4Z7VA 3MLYH 1RIUL 4L9LB 1M05A 3EHBC 1TZGL 5FA4B 5D5MF 4GS7B 1DQJB 3SJVD 1NAMB 2J4WL 4ZUUB 1MCWM 1WSST 1YNLL 5J6HB 3MRDA 4E41E 5A2FA 1C8PA 1KELL 2YA0A 1DN2A 5IB2B 4LSSH 3RU8H 2ADJA 1GGUA 1DLHB 4G5ZL 1A6WL 1VENA 2KQNA 4PV9A 5KN5B 1BOGB 1OARL 2VLLB 3SBWA 1EFQA 3L95B 3EO1B 3ULUE 5DHYA 2GJJA 4X9HA 4WU5A 4KU1A 3EYQC 4Y4FC 5CP3A 3BVNA 1Y0LA 2FJGB 1DBJH 1TZHA 1ORQA 4E41A 1A9BA 1P2CB 3B9KD 3T2OA 4S2SA 4MMZC 1I85C 2NY6B 1T1YB 1TLKA 3E8UH 1ZV5A 4ODWA 2J6EL 3FT2B 2AXFA 3FQWA 3WNKA 4NUGH 3U7WL 5HHVL 2JB5L 3MCKB 4C56E 5ACZB 5DZLA 5DVOA 4I3SH 2DKMA 4HWUA 2OTUB 1JF6A 2EH8H 4LMQI 3ZKND 1CD0A 2E6JA 3MMEB 2WBJB 5JMOC 4XC3H 3QUXD 4PRBA 3GMQA 1KFAL 3NCCB 4XNUH 4Y5VC 4LDLB 4QRRB 3RDTC 3RX8A 1K8DA 2Z31C 4H25B 1MFAL 4N1EA 3K2UH 2VWEC 2D4DA 4G9FE 5D5ME 5AAMA 1WC7B 3X3FH 1XH3B 1GOGA 3I50H 1BLNB 1NCCL 5J3HC 1CGTA 4GAJH 1KUMA 4I0PD 1N4XH 3GKWL 1RK1A 1KJMB 2EXYC 4X6CB 1FIGL 3OKEA 3MNVB 4OFYD 1JMZA 3MJGX 4LMQE 1MF2L 4UQ3B 1WWAX 3BZFA 1LEIA 4N5UA 1J8HA 3AB0B 1RUAH 4M6ML 4G9FA 5D5MA 5C0AB 3P30L 4RMVA 4KMLB 2NXYD 5IOPA 2ADGB 5C0AE 2XG4A 5ADPL 4IS6A 1D5ZB 3W11C 4CVZA 3TWCH 8FABB 2IAMA 1FZOB 1FSKC 2GKIA 2V7NA 1HZHH 2HN7A 1LE5B 5IQ7H 1T22B 3OX8B 4XCFL 1CICA 1U8MA 3O2DH 3LD8C 3U7YL 1LK2A 3MRJA 2YK1L 3LPWA 4JO3L 2DLTA 5JR1L 2VISA 4XCYA 4YFDB 4OUUA 3FFDA 3T4YB 1HIML 1GXEA 4Z77B 4U1JB 1E6OL 2LFGA 3EYUL 1I8MA 3BH8B 2AJUL 4MWFA 2D9CA 4MAUL 5CZXC 1SHMA 3B8SA 1GHFH 3HMXA 1WK0A 1T0PB 2X4UB 1A3RL 1NC4D 2DQIH 3WS3B 4ONGH 5SV4A 2EXWD 3BKYL 2IAND 3T1FA 5CGYD 3VD4A 5K9KA 4QRPA 1SYVB 1M4KA 3RVXD 4Z5RB 3OKKB 4LCCB 1PZUB 2OR8A 4B5EA 1QO3B 1DLFH 5FYJE 1XGUB 1I9EA 3SGDH 4HULB 3GNMH 3RRQA 3GHEL 4XCNB 1GZPB 3DXAD 4MJ6B 4UTAL 4JAMA 3IDYB 4P4KD 2VMFA 5C0BA 1AI1L 4JJHA 4HWEH 2WMPA 4G6JL 3QUKB 1ULVA 4YDIL 5IB4B 5F9OL 1KPRA 3WFEL 4HKBB 4K07A 1GCFA 5GS2D 5SX5H 4XP9L 5ADOL 3ZYJA 1OT2A 3GI9L 4IOIA 4M1GH 1YEHH 3EFFA 2FR4A 4P23C 5JDJA 4RAUA 3V5DA 1I7UB 3GB7A 4LP4A 2UY7A 2W07A 5D7KE 1PVHA 3LEYH 5D1XD 1KJ3L 2O93L 2WP3O 3HZKA 5LGJB 2E9IA 5DD1L 4L5FH 4MA8L 1NKRA 1C08B 1HCFX 4WFEE 2P24B 4D0BA 3O41B 1S9YB 5JNYA 2Y36H 4Y16C 1EGJH 3JWNC 5I75C 2EYRB 3AMKA 3OV6A 1FNSH 1YY8A 1RUMH 1F8TH 1YEJL 4Y4KA 1NGXA 4NQCA 4U7KA 4YXKL 1A7RH 2BFVH 2IC2A 3WSQH 1MH5A 4TSBH 2VLRD 4OGYH 1LILA 4RRPA 1OPGH 5TE7H 1NFKA 1G7HB 1O7VA 4QHUB 2XV6B 3QJFB 3D0VB 4JFXA 5TQ2L 3BSZL 4MZ3A 4NZUH 2QSCL 4W68A 5C08E 5GZOD 5I18L 1WIPA 5E6IC 5ITBH 1Q94B 4MVBD 1FNGA 5IT2H 4M3JA 3JWDC 1KCVL 4DKFH 2DL9A 4F37F 1I75A 3KYKH 1DL7L 5E0QA 2QBWA 3C9NA 5HPOA 4XPTL 1T5XB 3B3IA 3O45B 5C0JB 1OTTC 4OBSA 4DFIA 4R6UA 3DRTA 3QI9B 4P2RE 3OJVC 4RMWA 3WJJC 1KBGH 1JNHB 1ORSA 5HGGS 3NMEA 5ISZD 1AXIB 4H20H 4GRWH 5C08A 5HDBE 1IC5L 1NGPL 4ODHH 1U8IA 4MD4B 1QUNA 1O7SA 1P7QA 3GJFH 4X5WB 2EDDA 4Y4FA 2XZQH 4TPRL 1X5IA 5EU3A 3KPRD 4YXLH 4OD2A 3MXWL 4P2RA 5IHUL 4XGZB 1T1XA 5BVPL 2X1OA 1NBVH 2ITCA 2VWEE 4X7EC 4H5SA 1WFTA 4IRJA 4JRXB 3EDJA 5MP6L 3MCLL 4TUKL 1JYVA 4JEGB 4OCXL 4OF0A 4PJGF 4AIZA 4C58B 2D7MA 1NCNA 2B5IC 2HT3D 1UH2A 3HG1D 1T0NA 4TUJB 5L0QC 5MERB 4Y5VA 5GS2H 1J88A 3UO1H 3KLHD 4LVEA 3VRIA 4OKVA 4TNVF 1JN6B 2CKBH 4P46A 3C8KA 4CJ0A 1H0DA 2YRZA 2HP4A 3BYTA 5FO8A 4Y0GA 5IESL 4LIQL 2WIIB 1ODAA 3IDMA 4XCEA 3B9DA 1T7YA 1HH6A 5LBSL 5KW9L 3OKOA 2FO1A 2KQMA 1B0RA 1ROWA 2DI9A 3QCTH 4HWBL 1S7TA 1K4CB 4WW1A 1RU9L 2LVEA 2P49B 3H3PH 5D96B 5TGBB 4AQ1B 4N0RA 4LLDB 3LZFL 4CU7A 2CDFA 4J12A 4ZNCD 1W0WB 4OLZH 3SY0B 5IMOB 3GSRA 2QQLH 5BZWB 5I30L 4TUOA 3NTCL 4P2QA 3FQNB 5D2NC 2H9GA 3IU4L 3QPXH 1CU4L 5KJRH 4XNQA 1YPZA 3BZDA 4U3HA 4D0DA 1EEZB 5I19H 1UYWH 1JUFA 3PWUA 5C6TH 1U6AH 3CC5B 5IGXL 2VDML 1S7XA 4NQSA 2GK2A 3B2UC 5DR5H 1KYOK 4PJGE 1HE7A 3S3JA 1DQMH 3P77A 2A0LD 4QKXB 3D69A 4OF6A 2HVKA 3MSPA 2DRUA 4M61A 4TVSa 1QBLH 4L8SB 1BQSA 4KJYA 3UZQA 5KZCB 3HE7D 3CU1A 1NGZA 1OAXH 3D5OF 2CDGA 4QCIA 5A2LH 2XIDA 4XPAH 4JM2D 3VD3A 1PZ5B 4HBCH 4P9HH 5D8JH 5IQ9A 3QNYB 1MFCL 1WQVT 5EA0H 4Z0BL 5BZDA 3H9YA 5D93C 3BP4B 4NUJB 3TBWB 4TN9A 5DDHA 2CXGA 2BZDA 1U92A 4X9IA 3RWHB 4PGJA 3NA9H 1ZT4B 3B8YA 1AY1L 3ZE2F 1S5IH 5C0GA 4X4YA 4OCWH 1F45A 3ARDB 1ZVSB 3CXHJ 5HXMA 2W0LA 2YPKB 2ZCLL 2NNAA 1R5IB 2FDBP 1L7IL 1V3MA 1FFPB 4HUUA 4L3CB 5EU4A 2R4RH 2ESVB 1KJVA 3WLWD 4PD4K 5EO1B 1RZFH 3CVHL 4OM1L 1OP5H 1UADC 4IDJL 3FCTB 4Z8FH 4P23A 3A6BL 2FEEL 4ODSH 3RZCC 4HFWA 1A6AA 1W2KT 4DGIH 2CK0H 3FFCD 2O61B 3CX5J 3UTPE 3MRBA 3REVA 4Q9BA 4UILL 2O5XH 4WI4A 1QKZH 2X05A 1UKQA 3IFNH 3ZDXF 5E6IB 5DQDH 4EXKA 3V6BR 4ZFFB 4R7DA 2NR6C 2Q3ZA 4OZ4A 3EZJB 3ILQD 3OKDA 1G7LA 6FABL 2FEDD 1BFVH 2AXGA 2IFFL 3O3BB 3PWVA 4OBRA 5DT1H 1X4ZA 3BE1L 3KGRA 1W0VB 2QSQA 4LLQA 4R7NB 1DQQB 4JFHD 1CTNA 4RMSA 4KZDH 4WGVB 5KG9B 3AY4C 3W9EB 4R0LB 5F3BA 3FB6A 2H26A 5EOTB 4DQOL 3BZ4B 3P73B 3S6CA 3O8XC 2DMCA 1MREH 2XWTB 2ERJC 5A40E 3ZE2E 4JR9L 1H3GA 4NQVB 1F3JB 4TRPL 4YDKH 4WFGD 3RVVD 4EUPH 5CEYB 4NQDA 5DVKA 3HI6L 1YDPA 2EDRA 3EOBA 3WJJA 5DLMH 3VXUE 1OL0A 4LU5H 1KGCE 4NO5A 3VWJB 4AEIH 5DRZA 5ICYB 5E8DL 5GGQL 4KVCH 1TQCC 4MX7B 4QRTB 1OP9A 3NAAH 3MRGB 3G04B 3O6FD 4HGMA 5AD0B 2VABB 4UOW1 4N5ED 3P0VH 3ZDXE 4KY1L 2V2XA 4M03A 3O9WC 4LVNB 1YEEL 4JG0L 3SDXB 2PO6A 2JIXD 3D85A 3VXUA 5FOJA 4OQTA 3MLTB 1RZJC 4LRIC 3SDXE 3EJZD 4NPYB 1GZQB 1ZHKA 3VI3E 1S5HB 5F1KC 1MCDA 3MJ8B 5JW5A 2EYTB 1UWXK 2I07A 3HNVH 4GW5A 2PNDA 3WN5B 2B2XL 5CEXB 2AS5M 3CLEH 5K9OA 5I2IA 4GG6F 1EEUA 5D71L 5F1NB 1D5IH 3LKNA 4WO4D 4XC1H 3WNLA 5HGHA 15C8H 4XVSL 1RJLB 4GKZA 3MNZB 5L9DL 2BVPA 3TVMD 2BOCB 5GRVL 2MOVA 2HFFA 3O3EA 5E8NB 1X6NA 5E94A 1I9IH 2R15A 1MRFH 5D2NE 4WGWB 3LKRB 1TJGL 5JXAH 3WJLC 1VB9A 1UB5A 3T0WA 4IMKC 2GT9B 5DRXA 4M00A 1HXMB 5EZIL 2DYPD 4X99B 4LHUD 3EOTH 5CEZD 3NZ8A 1CDBA 3RY6C 4QTIL 1E28A 1FYTE 2D7TH 5K93A 4Y5XC 3INUL 5GGSA 1KCSL 4JG1L 5MENB 3G5ZA 2P8PA 2IGFH 2ZUWA 1IQDA 5H35B 2VR5A 4O5LL 3OGCB 3MQIA 5D2NA 3HPLB 5D7JB 1RFDH 3S35X 1MCFA 1I7ZB 1DVFB 1BWWA 1LD9B 2Y6SC 4OJFL 1EMTL 2X9WA 5IB5A 1CVSC 4N9GA 4EZMA 1Z9SA 5AZEH 2IG2L 2X4RB 2XOTA 5L7XL 4L4TD 4DAGH 3DSFH 4X7SL 4LFHD 1B3JA 4X4XA 3QWOB 4GBXD 3OHXB 4OCMC 5BS0A 3DSNA 2X4PA 2LU7A 1GC1H 4TULL 5JHDB 2CO6B 5TF1L 5EH1A 4JZOB 1SQ2N 3LS5H 4V1DE 4HW6A 5TF0A 4OLYL 1SMOA 4J3UA 5D1ZC 4YR6A 2V2TA 2IADA 2NY1C 3QNXB 4MQ7A 2DQUL 1VEPA 4LPVA 3PABA 4QRQA 1ZLWH 2DBLH 4XVTL 5I1GH 4GG6A 5M7QA 3QISA 1DE4A 4HFUL 4LQFH 5D2LB 1CL7I 3PL6C 1IC4H 3C8HA 3KVQA 3RWGA 5D2LE 3TYFB 2R1XB 4FFZL 4D0CB 3V8CA 1F11A 3IT8D 4KI5C 3V6ZB 4V1DA 1MHHB 1EEYA 2HKFH 5DJYB 2X1XR 1DFBH 4CAGA 5GHWH 3GSNL 3RP1A 1UJTA 4LSTL 4J4PA 4NN6B 5EU5B 4RFOH 1SEQL 5GRJH 3FQXB 3G5VB 4KKBC 5T1DH 1G0XA 3F6IA 3RZCA 5SWQA 3HMWL 4RGMC 3SE3C 3WFBH 2BRQA 4Y4HC 2G9HB 2QLVB 4MCYB 5EU6D 3QPQC 4UT9H 5GPRA 4HUVA 1MCJA 4HG4K 1E27B 3U0TB 1UZ8A 1CK0L 1DR9A 4OZIB 4QHLB 4E0RA 4F7TA 3B5HA 5I1JH 2A6JA 4HLJA 2ERJB 5CSGA 4NJAH 5CEZH 1OP3H 1RJZA 3K81A 4KQ3H 1XIWC 4PP1C 2OJEB 2HRLA 2BX5A 1UM5H 2FJHA 2P5WD 3UBXG 1EHXA 1X5FA 3VXQB 2R9HC 3BXNA 3U4EB 1V05A 4BQ6A 3BI9X 1HN1A 3BFOA 3AY4A 4NKOA 3DX9A 1XGRB 3ARPA 4XI5C 5FM8A 3C8DA 2G75B 3TBTA 4PTUA 2EZ0D 1GYAA 5FYLD 4K8RL 3O8XA 5F7YC 3GMLA 5JPNB 2VAAB 1DQDL 1JRHI 3CSGA 1EHLL 4YJZL 2BK8A 2VXTL 2XWBA 1FG2A 4R3SB 3V4UL 5C0CA 4EUPG 1A21A 3VFRA 3D18A 2BSSB 5I8EA 4PLOB 3V5HB 4AG4H 4G42B 2QQKH 3GM8A 4HWNA 3K1KC 4OCYH 5FCUH 3TM6A 4LP5A 4LLVB 4EI6A 2WUBL 1D5MB 5E03A 3QUML 1MHEA 3VMNA 2DTSA 3S3PA 3CVIL 4U1SA 5I1CH 4WEUD 4AL8H 2L4OA 3S8WA 5E1HB 4PJXA 5BVJA 1N5YL 1OW0C 1PKQA 4JDVB 1U8LB 1WBYB 4HIEA 3LQAL 1AXSB 3P4MA 3D0LA 1QEWA 2CH8A 5IW1A 3DJ9A 2J12B 3VE0A 3O9WA 4UUJA 5KVEL 2KH2B 3SCMB 4YXHH 2OI9C 4KJWC 3O2VH 3WO4B 1J0HA 4LRIA 4GRWB 1NCBL 2BOBB 1UM4H 3EZ8A 3UTQB 5DZOA 3E6FA 1NUGA 2G5BB 3OB8A 1RZKC 5GGUA 5LVEA 1T20A 3GJFB 2X89A 3PHOB 2F5BL 2I60L 3RBGA 2KKQA 3S5LA 4J6RH 3KJ4C 1GAFL 1LK3H 1ZSDB 2ZWLT 3OKLA 4FTVE 1I7TA 1G9NC 1KC5H 4Y5XB 4NZTH 3RIAK 1FVCA 2R0ZL 2GQHA 2MTPA 4P4KB 4FQQA 4KI5F 4MA3A 3QAZB 2GUOA 3NFSH 1DUYA 5E8PB 4MB5A 3B2VH 3TPUB 2NMSA 1Y18B 1QQDB 4LCYB 2DQEH 4PJ9A 1QNZL 5IBTL 4HK0B 4FTVA 1CD9B 3MRHB 3MOAH 2VITB 3I9GL 3RY6A 4LGRB 1U95B 1MCRA 2DF3A 3G6JB 4PG2C 4UBDC 4GLRI 3OZ9L 2NY4C 1NCUA 5IKCA 4FQXC 4GW1A 5D7LA 4PS4H 3ARUA 4OGAD 1KT2B 3FZUD 4NRZB 5ELIA 2UYLB 2QHRL 5CIPA 3T8XA 2Z8WC 3MGTB 1BVLB 1ZLVK 5EO0A 4N8VA 1MI5E 2BNQD 3QIWA 4BSWB 1UACL 2XPGA 1MRCH 3FB7B 4LDOB 4DKEH 2J88H 1CF8H 4HUWA 1DBBL 3TFKD 2GSIA 4Z7UF 2PCPB 2NY5C 2DQGL 2GYSA 5DJ2B 2ICWJ 3S88L 2B4CH 2Z92A 4NO2A 3SDYL 2I9LA 4FZ8H 3LPGA 3IDIA 4AEFA 3GRWL 1RURL 3O4LA 3VFSB 5GJSL 2XACC 1AKJA 5DJCB 1ZT7B 3TZVD 1MI5A 3IYLW 3UDWC 5B39A 2G2RB 1A4KA 1BX2A 3BQUA 4KI5E 5HI3C 1K2DB 4HLZH 4WEMB 2EC9T 5GGTL 4GRLA 2FX9L 5D1ZA 3SDDD 1NLBH 3QEUB 2IBBA 3WKMH 1KEML 2XA8L 1NFDF 4F2MA 1QR1B 2OYPA 4LCUB 1MQKH 5E1AB 4DK6A 2GJZA 4HAFA 3LDBC 1P1ZA 2IQAB 4I4WB 2W91A 4O58L 3BGAA 2VDRH 4CRPA 4OLWL 1NCAL 2YWZA 5EOQH 2X09A 1N0XL 4RFEA 2X70B 3QXAA 1YY9C 3SKOB 5DURB 1ZMYA 4Q2ZA 4QHMB 3QJHB 1J9CT 5EC1B 5C09E 3LS4H 4RZCB 3PGFL 3KPRB 2UWEF 1QSEA 4HC1H 1E6JL 1XIWB 3GK8L 3SKJL 1HHJB 1QD0A 2F53B 2LU3A 4YEEA 2X6MA 4ENEC 2B39A 5FK9B 4XNMB 1QRNA 4KRPC 5ERWB 1I1AB 1U8KB 3VXNA 4FG6C 1VFAA 4Y4HA 3C5ZB 1RUQL 4Z95H 4NOBA 1U8QB 4J3VA 3D2UD 4R4FH 5C09A 3HG1B 1DQTA 1UCTA 3QRGL 3HB3D 3UTZA 1A2YA 3CPLB 1C12A 1BFSA 4NNPH 2WLZA 3PWPB 1T03L 2NXZC 1I8KA 2UY6A 4L8DB 3BPCB 4NM8L 3ILPB 3UBXI 1JF1B 2YUZA 1IGIL 1GH7A 1VEMA 4PJ5A 4Z7UA 5DJDB 4NWUL 2FATL 3L5IA 1MJ8H 4NQTA 3QHTC 5L8KB 2PW2A 4XAKE 1CXIA 1T21A 1DEDA 2G60H 3N0PB 4LBEB 4ZG1A 4ZUWB 4H1LA 1HOCA 5FOBA 3T77B 3AS2A 1RHFA 4ZD3H 3AS0A 3M07A 1BD2E 4BH7A 1GL4B 2W9LA 5C0FA 1A7PH 1IAOB 32C2B 2XQYK 3GO1L 4XH2A 3UBXB 1GGTA 2EDJA 1A47A 2VL5A 5F9DC 5AEAA 4WV1C 1EXUA 2PYEE 3CLFH 3C2AL 4YHOL 5IMLA 2BERA 3O6LL 1NL0H 4RDQF 2UWEE 5E2VL 1HQ4B 4KUCD 1NFDA 1X3DA 3C87A 4Q6IC 2R39A 4RA3A 3A6CH 2P5EE 2AJYL 1FNEA 4FHBD 4LPWA 3FQUA 2HJLA 2ZUTA 3RWFB 4EDWL 2GK0B 2E6PA 1MQ8A 1IZKA 3TA3B 4ONFH 2EC9U 3Q6GL 4JRYA 1OW0A 1XR9A 5ESAB 4X0KA 3ARGC 3SHSA 4EUPB 2MCG1 2PYEA 4Y1AE 4WI3A 1MUJB 1NBQA 3CFJB 4AYFA 5F7KC 2UWEA 4N90D 1IAIL 1WIUA 3DX8A 2APTA 4ZS7L 2P5EA 2PTTA 4N1HB 5C2BL 3BP6A 3QUYA 1FL3B 3BUYB 3HE7B 4ISVB 4U31A 5F6HJ 5MI0B 3JXAA 2FGWL 3HFML 1I3RB 4W6YB 2VXSL 2YRLA 4OD1H 3VXSA 3PWNB 4QF1A 3UROR 5IM7A 3GMOA 1G9MH 3N1FC 1AO7D 2ATKA 3AROA 4KROC 1ZA3A 4XMKH 4YFLF 3NN8A 5ITFB 1HHGA 4LVHB 3QH3B 1CZ8H 2NY4B 3NACL 4HMCA 4ODUB 5HGBA 5TE4L 4H26B 1TQBB 5J0BA 5F44A 1B9ZA 4PRHB 1MCOH 3UJJH 5BMFH 4QRUA 1ZA6A 5KSAD 3RWDB 2OLDA 3BEWA 4ZO7A 1A7NH 3UAJC 3MV8A 2F19H 1TVHA 1TVBB 4HF5H 1NAML 1C5DB 4YHNA 5BOZG 3GBLA 1XF5A 2AI0H 5C07D 4P99A 5B3NA 3DMMC 3QDMB 4LSQH 1LE9B 1FFRA 4PG9A 4CMHB 3QDJD 3V0VB 3FFCB 5DYOA 4M7LT 1MCQA 3QIBC 4X9FA 3ULUL 4O02L 1UWEH 4HH8A 4FQXA 4YFLI 4KJPD 3WS6C 2YD7A 4KI1A 2HMID 1OWWA 2APVA 1ZEAH 2KPNA 4LOUC 3WXWL 1IGJA 4ELKB 2OSLA 3R1GH 3M8OH 3H9SD 4G8IB 5FUOH 1F90H 3VFWB 3EYVA 2ENSA 2YXMA 1NC2B 4ONHA 3S3SA 5E2JA 2EIZB 3RKPA 3JV6A 2XRAH 3TIDB 5EZJA 4LSVL 5E08L 4UNVA 4YQXL 4TNWK 5DK0A 1FZKA 1A6UL 1ZWIA 5JOFB 4L3ED 1N59B 2VQ1A 5EUOF 1WITA 1BOGA 1OTUD 2I5YL 5KS9F 1F4XL 1NBZA 5JOEA 2Q86A 1QACA 3EO1A 1RIUH 5F3HB 5K9QG 1TZGH 2AP2A 1DEEB 3UZVB 4HLZG 2X10A 4IMLB 1YNLH 1XF4A 2AQ2A 1A6ZA 4YDVB 5EOCL 4FXGB 4F9PC 1X7QB 3RI5K 2M26A 5D7SL 1KELH 1MFDL 5J56B 2APFA 1CE6A 5A16A 4KAQL 4G5ZH 1A6WH 5JXEC 2VE6A 3VCLB 3UPAA 3LV3B 3GUTB 5IFAH 4AIXA 1CWVA 1OARH 5E8OA 2R23A 1QYGL 2RJMA 2NPLX 1LEKB 3NIDF 4WI9A 2EO1A 4TSCL 3GGWA 5KANG 1N8ZA 2BP3A 4M7ZB 4QRRA 1SY6A 3OR7B 5CBEB 4UAOB 4PRAB 4GKNA 3VXOA 2A6DA 2CIIB 1JGEA 4PV8A 2JIXB 1CQYA 2J6EH 1WC7A 3HMXL 3U7WH 5HHVH 2JB5H 1XH3A 1BLNA 2OBGA 4DZBA 2DOCA 4XNXL 2FYYA 5SX4H 3CMOL 5I9QC 4YHYC 5GJTL 4CU6A 1KJMA 5TE6L 3DUUA 2AKRA 3WMSA 4P3DB 1KFAH 1P4IL 1U42A 3GI8H 1EO7A 4UQ3A 5EUOE 1A3QA 1AC0A 1R3KB 5J11C 1RULL 1XEDA 3ARYA 3VFVA 2XKNB 2XZAL 4UT6L 1YQ2A 2VLKD 1I9JH 1OGAD 4CJ1A 4FQIL 4PJCB 1IGFL 1AR1D 2Z93A 1YJDL 1NCCH 1T1ZA 1LDPL 3GKWH 1V7NL 3HI1B 3LPFA 4U1GB 1FZOA 3VXPB 1FIGH 4OZFH 3F65A 3TT3L 1NJ9B 5EBMA 5EUOA 1MF2H 5FYJL 4S0SD 3EYOB 5KS9A 2VUYA 4ZYKB 4QXGL 4JFDE 4WI8A 3NIDE 3RIAF 4K94C 4M6MH 2X4OB 3T4YA 4PRID 4R4NC 4C54A 1P6FA 2AEQL 2CRZA 2JJWA 3WBDA 1Z3GL 2A83A 1ZGLB 4WV1A 1UH3A 2Y23A 5SWZE 5ADPH 2OQJB 2YSSA 2QKIA 3VFTA 5T3ZE 4MNHB 3DGGA 3MV11 4Q6IA 4F57L 2X4UA 4IOFC 5TPWL 5B4MD 1EHAA 1VPOL 4XCFH 3OKNB 2Z35B 3KPPB 3LH2H 1JHLL 4M8QB 4ODXB 3JTTA 3U7YH 1IBGL 2RCSL 2YK1H 4JO3H 5JR1H 4JFDA 4WW2B 4Z5RA 1OLZA 3L3IB 4D9QD 1A7OL 1HIMH 2AJXL 3ARGA 5HPMB 2IPTL 1E6OH 4L4TB 4Y8AA 5ICXB 5HYIA 5SWZA 1Z9OA 2AJUH 4Z7QF 3VD9A 3U9UB 4JZNB 2YD2A 4GKSB 4LLYB 1A3RH 2XT1B 3LRSB 3BKYH 3HCVA 3IU3B 5GSVB 5SX5K 4W4OA 4J3XA 1INDL 1P4LB 4AK1A 3IDNB 4YK4B 1R3LB 2YEZB 4K7PX 4LKCB 2VSDA 5T5NG 5HHOD 5F7DB 4P2OA 4WDIA 2N7BA 3OXRB 3U30C 5IV2B 1UT9A 3BHBB 4ACPA 4UTAH 2ARJB 3TBSB 2WK2A 3QIBB 1OWRM 4UNUA 5DSCB 4RX4D 1AI1H 1B4JL 3SDCC 1IAKB 2CLZA 2DMBA 3Q6FB 2D0HA 4YDIH 1J5OL 2P43B 3MUJA 2DLIA 4L3AA 4JKWA 1H15A 4I77L 4XP9H 5ADOH 4IRSC 1ERNA 3GI9H 4NHCH 1X44A 2QQNL 3BW9B 5T1KB 3DMMA 1CLOH 3VRJA 4NCC2 1MCEA 3WDIA 1H3TA 1E0OB 3GSQB 2GTWB 1G7HA 1KJ3H 4QHUA 1YEIL 5MEOA 3KYOB 5DD1H 3ULVF 4HK3N 3DVIA 3MLRL 4MA8H 4PJEB 3P9LB 3V4PL 5INCB 4RAVA 1AIFB 3SQOL 1Q94A 3BDYL 3I02B 2P48B 5FGCE 1FIEA 3FOMB 3QIUC 4X4ME 5I1IL 3MROB 5L88L 3EGSB 3DWTA 2J1KA 3IJHA 4YBQC 5E5MA 4JY5L 4YXKH 1EAPA 4MD5B 4N0YL 5GRUL 1S9WA 1JNHA 3WEXB 2YZ8A 3MRCA 3QNZB 3GJFK 5TQ2H 4EI5A 4EN3D 1EO5A 3OJMB 3BSZH 5CJXC 3RGHA 2QSCH 3WNNA 5I18H 5C9JB 2OTWA 3EOYG 1KCVH 3QDGB 5J1AB 4X5WA 4DCQB 1DL7H 1LDSA 4XPTH 3QDGE 5KSVB 4AIOA 4XGZA 2YD4A 2IPUK 5DEGB 5I71B 4OZHF 1SM3L 5JXEA 3TYGL 4JLRB 4YHYB 2CR3A 1PD6A 2HVJA 2NY0C 4HX1A 4ESKA 1ZHBA 1NGPH 2XKUA 3DVGB 4YPGB 3TEUA 3VA2C 4CBPA 3TNMA 4TPRH 5MERA 4PY7B 5J11B 1ZVHA 1FL6A 4PJBB 3MXWH 5EN2B 5IHUH 2X4NA 3DROB 4JKKA 5BVPH 1NFIA 3FB5A 4HGKC 5HI4C 2Y4SA 5LJYH 4F7CA 1WTGT 4JY4B 5INDB 2GHWB 2P8LB 3ZKMD 1WJ3A 5MP6H 3MCLH 4TUKH 2EC8A 3DRQB 1FH5H 1CDCA 4LLWB 4OCXH 2Q6WA 2EDEA 4H8WC 2N1KA 1AFVL 3HC4L 3OKMA 4NGHH 4OGXL 5DJ0B 2PTVA 4LLDA 3RVWC 1U8PB 4ORZC 5JHLL 5IESH 2EYSB 3F7YB 3SY0A 4LIQH 5EO9B 4M5ZL 3U9PL 5IVXB 1VGKA 4OD3H 3IJYB 2FLBT 1NEZA 5LBSH 5KW9H 2R0KL 3MUHL 4PJAF 5IVXE 3GSXA 1G7IA 3C6SB 43C9A 3TO2B 2BVOB 4KKAC 1H3VA 3MBXL 4FP8H 4HWBH 2P42B 4OZFG 4HK3J 1RU9H 3HUJB 4OZHE 5D1QD 3N1MC 3THML 4OZGF 3L3GA 4XX1G 4Y19D 3SO3C 3MRFB 3LZFH 3IDGA 3TN0D 4HIHA 4K3EL 3SEPA 5DS8A 3DUSB 1NUFA 4HKJA 3T0ED 1KACB 1J7VR 1FVEB 3M17B 3NTCH 1MCIA 1ED3B 5AYUL 1D5XB 3PDDA 5DK2A 3IU4H 1CU4H 1QPXA 4HDIB 2E5EA 5IJVB 3PXHA 3H0TB 3VRLF 2WAHA 4OZHA 3RY4A 3OSKA 4CW1A 3P9MB 4PUBL 4PJ8D 3U82B 5IGXH 1CFVL 3ARBB 4KJQD 2CK2A 1FL5B 4C83B 3UMTA 1EX0A 4JVPA 3E2HC 3MOBL 3I6LD 4S1QL 5FB8A 3QQ9D 3RWHA 3RGVA 2NY3D 1WT5A 2XN9B 5DC9B 4PY8I 4FS0A 3HZMB 1OAQL 3UTSE 3ULSB 2ZJSL 4M1DL 3ARDA 2PR4H 1P9MA 5F9JA 4U6VH 3NIFF 1R5WB 4PJAE 1OP5K 1TCRA 4IRSB 1KTKE 3RWJB 3C6LC 3ECBA 1MFCH 1QLFB 3TJHC 1UZ6F 1VADA 4M48L 3B9KC 4UT7H 4TNWF 1RZIA 3REWB 1WCBB 5HHMD 4OZGE 3VH8G 1QBML 1RQ5A 2FO4A 3BP7B 1CT8A 2ED8A 4ELMB 1KCKA 3L7EB 1U8HA 1AY1H 2ZUQB 3VGGA 1YQVL 3ZKNC 4WUUB 1S7SA 3SDCA 1G84A 3K74B 3QUXC 5T1LD 1M7IA 4PJAA 1IJ9A 2ZCLH 3L6FB 1L7IH 3QIUB 2XTLA 4NJ9L 3RI5F 3VRLE 2VH5L 3CVHH 2D7NA 4OM1H 4IDJH 3A6BH 1IMHC 4OIIH 1CE1L 5E9DB 3MBED 3QWRA 4M7KL 3ARED 5TDPB 3FTGA 1DQQA 1DUZB 3O3AB 1RK0B 4I0PC 4UILH 5E9DE 1HILA 4PR5B 2Y06L 3LRGA 2VDPL 5IUSA 4NCDA 4MDJB 3TBVB 4R0LA 3Q5OA 3JV4A 4HZAA 5BJTB 5DJ8B 4ZDHB 1HKFA 3B83A 1F4WH 1F97A 2IFFH 4JZJB 3KLDA 4IRZL 4NQVA 3CZFB 1JGDB 3NIFE 4JFQB 5TDNB 2BHZA 3BE1H 1PY4A 1U3HD 5BRZD 3PQYD 5F7WC 4D9RE 2RFXB 3UYOD 4BK4A 2N56A 4MNGB 1BFOB 2HWZL 4RIRA 2MJWA 3LY6A 2NY0B 3HE6D 4JY6A 3VWJA 4JB9L 2Y7QA 4HGWA 5CJXA 1LEGB 5F96L 4DQOH 4QXTB 1HDMA 4X5XB 1RSFA 2QV2A 4X98B 4JR9H 5E70A 3AU1B 2HJFB 4NUGL 3KAAA 2QADD 3HI5L 1BZ7A 4TRPH 7CGTA 4YFEA 1XCQB 3M1BB 3U79A 4KK8D 3KPSB 4HBQA 1F6LL 4YAQA 3DURB 3MLTA 4RCAA 5B38A 2BMKB 1F42A 3NFPA 3STLB 2EXWC 1J11A 5E8DH 5GGQH 2EYTA 1U41A 2SEBB 1AP2B 2ZOLB 2CLRB 5CGYC 5DC4B 4HHAB 3RVXC 1UEYA 5FF6A 4I18B 1HCVA 4DTGL 1DTUA 4MNQE 5HYJE 1R3HA 4JG0H 1FNHA 5K59F 4QTHB 1YN7B 1N4XL 1LO5B 1HH9A 3MNZA 3PDOB 5HVHB 4NKQB 4PJDB 5FGBC 4KV5F 5F71A 4KKLC 1HINL 1G1YA 5E8NA 5B3JF 3U83A 1MLCA 3R06A 2DQHL 1FFQA 5CLTA 2O5ZL 2FWOA 4NKDB 2Q20A 3T04D 2B2XH 4X99A 1AO7B 1G7PA 1RUAL 1OLLA 2JCCB 1EFXA 3CCHB 4YC2B 4MNQA 3RL1B 1CTOA 1FGNH 5D71H 5HYJA 5FKAA 4JFFD 3D39E 1U8NA 3NPZB 5D72L 5BXFA 1T1WB 3CH8A 3KYNB 5D1XC 3TPKA 1S7WB 1G7MB 4OUOA 5D7JA 1T3FA 1TJGH 3VG9C 4KPHL 2PN5A 3LSOA 5I1HL 5EZIH 5IB3B 4MXVF 5EUKA 4L4VE 2F8XC 3CFEA 2V17H 3FRPA 4Y7MA 4YDJB 3SJVE 1XAUA 2ORBL 2HLFC 1KTDA 4X8JA 4UTBL 4JHAL 4C59B 1QSFD 3INUH 1KCSH 3E2HB 3QDJB 5CSZB 1BWMA 5LQBL