3BN9D

Crystal structure of mt-sp1 in complex with fab inhibitor e2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
211
Chain Sequence
QVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARPYLTYPQRRGPQNVSPFDNWGQGTMVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-type serine protease 1
publication title Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 35
structure length 211
sequence length 229
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D01
1M7IA 3F7VA 3IETA 4X6CE 1GGBL 3CFEA 4F57L 5EU6E 4EEEA 1K8DB 2C5DC 4PJXF 5E2VH 1JWUA 3SDXA 5CGYC 4JB9H 5B4MD 3MRKB 4KHXH 5FYJU 5I1EH 5HHQA 3I50H 1UXSA 5CLWA 4LAJH 2H41A 1IEHA 2O26U 3CXHK 2B5IB 4IRZL 5FGBA 1U8PA 3HPLA 2DKSA 4P2QA 4ZTPH 5I66B 5I8CA 1RIUL 4PGCB 5IW1A 4LOUC 1IL1A 4RQQA 4DW2H 3K80A 1KBGH 1EA9C 1PZ5B 3QRFM 4GRWF 3NACH 5HYSG 3MV9A 5C7XH 1CYGA 3GJFH 2CKBH 3O41A 5H2BA 2X09A 4YIQB 4XCCH 1T83C 3QAZB 1BLNB 4GG8B 4R90H 5FA4A 5LVEA 3G9VA 3NIDF 5E9DD 3B9KA 3QXUA 2J6EH 4K23L 1FIGH 4C57C 3RI5K 4G6KL 1CFNB 3UTTE 1KJ2H 2EDXA 2PTTB 3QXAB 2NZIA 5JMRA 1ACYH 2DMCA 4L4JA 3SCMD 1UEYA 5DGQA 3L7EA 1KCRH 4OFIA 4PLKD 4NWUH 3RBSA 4UQ2A 1HDMB 4E5XB 3BH8A 5T1LA 4JQXC 3VGAC 3BQUB 5E2WL 3T3PE 2EKJA 3KAAA 1CD0A 4WEUD 2DQEH 4R0LB 1UZ6F 1OGTA 5ISZD 1NANH 3GSNA 3V0VA 1F11A 2IG2H 3AXLA 3K7UA 3MUZ1 5L0QC 2CJUL 3RWFB 4ETQA 3KJ4C 4N5EC 1WZMA 5D6DC 5KVGH 3FN0H 5FXCH 2VC2H 3DRTA 5E70A 4KUZL 1E27A 1BFOB 1FZMB 1MWAH 1NKOA 4HIXL 4K3DH 2O93L 3PHOA 4F8QA 3P0VH 1WZLA 5I76A 4IRSB 3I6GB 3ARDD 5I8OL 4JVUA 2GJ6A 3HR5A 4XI5C 4MJ2A 1Q94B 4JQIH 4U1GB 4L5FH 3FQWA 1MCRA 4PLJD 5IFHH 4CKVX 1B0RB 4P23C 3RUGA 4HMEA 1HHGA 3TO4C 4FTVA 4TSBL 1U8QB 4YO0B 5CD3A 1PG7L 5SWSE 3THML 2ESVA 1MPAL 1KTLA 1N59A 3RWEB 2JB6B 4AQOA 1C12B 3LKRA 4K55A 1KYOJ 5EZLB 1H8OA 2FDBP 4Y5YC 2QSVA 5MEPB 5HVHB 4I48A 4NO5B 4XBPA 1WBYB 2WAHA 3GSXB 5C0AA 4W68A 1AXIB 2DD8H 2FGWL 1B3JA 4P4RA 4Z6AT 4PP2A 1KENH 3IU3B 4DGYH 2Q8BH 1FORL 2CPCA 4UAOC 3ZT5A 3HTLX 4TOYL 3G6JE 3ZHDA 1Z5LB 1QEWA 4RFEA 3MLZH 1XF2A 4F8TA 4K94C 1MIML 4WCYL 3U9UA 4XP4H 3VA6A 3UTSE 4PJ5E 5DRZA 5T3ZL 2Z93A 5IHUH 5D6CB 2OJEA 5INCB 2NW3A 1D5IL 4NQDD 4Y0GA 4AK1A 1N4XL 2AGJH 4LMQI 2VLLA 5I2IB 5ADPL 1P7QD 1P2CB 3MLXH 1DVFD 3QUXA 1U3YA 1A9BA 1XGPB 4ENED 3L7FA 5KVFH 2NY7L 1YMMD 5LBSH 3ZE0F 1JF5A 5ETUB 1LO2H 3GSNH 1JF1A 3FN3A 1D9KD 5D5MA 4PJCF 1JNLH 1VFAB 2QQNH 8CGTA 1YN7A 3V4PL 2AXFB 5TQ2L 4I18A 1J8HD 4P2CG 3BAEL 4QNPE 4PJFF 5T33L 4KV5E 3RAJH 5BS0A 2Z35A 5CBEA 3P4NA 2Y7QB 1HOCB 2VLJB 2NYYD 4ODHH 4YEFA 3B4NA 2GSGB 4RDQG 5EWIL 1BVKB 1A8JH 3LRSA 1WBZB 2WBKA 1CK0H 3U79A 4HJGA 1N26A 3DXAE 1I3GH 2IAMD 4ELME 5L8LB 4RNRB 1VGKA 4OZIB 4RIRB 5DO2D 4JFOB 3KYNB 4XVSH 3RDTC 4NN5B 4MLSA 5ICZB 4JZJC 1JMXA 3O6ML 3SDAA 5DT1L 3QSKB 4EKXA 1A4KB 4O4YH 3P9LA 2X9YA 1YUHB 3CAFA 4KK6C 3RY4A 1FL6A 1SJVA 1GZPA 2V5TA 2DIAA 3UPCA 1A6PA 5L88H 5HDBE 1KIRA 4ZUUA 4O2FB 32C2B 2KL6A 2DRUA 2ITCB 1C5BH 2P5WB 5JPNA 3SPVB 1T83A 3HAEB 4TPRL 5I18L 3PG2A 3QB7C 4NDMB 3LQAC 1GGIH 2YPLA 3MRBA 2KBGA 3B8SA 4Y4FD 1MCWW 2B39A 2A2QT 1G9ML 1ZT4A 4QTIH 2PETA 1CQKA 1OAXH 3GMLA 3IDXL 1VA9A 5MEOA 4PJ7B 5ID0A 4JQXA 5IF0B 1G6VK 2GTWB 4UV4L 2DTML 4NRYB 1DLFH 2ENSA 1MAML 1A1OA 1RK1B 5C1MB 3L3HB 4QTHA 2YD7A 3WDIA 1JF6A 2VDML 1MFDH 3QEUB 1RVFL 5HDOA 4GMSL 2EXYC 1TQBC 1JZ3A 4X7SH 1NC2B 4PBVC 2RGSA 4JY6A 4FFZH 4LP5A 1BD2E 2FBJL 3NCYS 3ARQA 4U1NB 3SDCC 3NOIA 3TH3T 2NNAA 2VAAA 4X6FB 4WWKA 1JIBA 4UIMA 5TJWK 5D1XB 1EXUA 2IFGA 2VXUH 2NY6B 5D8JH 2WBJC 4O5LH 2OR9L 3RWGA 3L3JB 1N7MH 5F1NA 2MCPL 2LU3A 1CICA 1DSFL 3MODH 4QCIB 1Y6MR 2AS5M 1FFPA 3UJIL 4WHTB 4JRYD 3T3MF 3TO4A 5GGTA 1GJIA 1MLBA 2Q3AA 5DQ9B 4XNYL 4EBQH 4LSTH 4P5TB 4JO4H 3UZQA 1NCCL 4M4RA 1OF2A 4PB9H 4MJIE 1YEJL 1QRNA 5GJSH 3SDXF 4QGYA 1JTPA 3N85L 5SWZE 4S2SB 1W72L 2AJUH 4XWGL 3MV8E 2LV4A 1SMAA 2DJUA 5I1IL 3FO1B 1IGFL 2QSQA 3T8XA 2PW1A 4LBEA 3RGVB 1CFTA 5M95B 2IBBA 3EW3B 3QXWA 4TULL 1RZKH 4KK9D 1F45A 4U1SA 5F1IB 4P4KD 3D39A 5F9JB 4JZOA 4HV8A 3U9PL 1G1CA 1J0ZA 1I9IH 2DYPD 2P5EE 4HLZH 3U7WH 2BVUA 1FDLH 2DBJA 4JFDE 3NIGF 4UQ3A 3VRIA 4O00A 4JB9L 3BDXA 4KHXL 1A3LH 5I1EL 4MHHG 1RURH 3I50L 3QO0B 4F9LC 4I3SH 2X44D 4EXKA 1IARB 5IMKB 1ZHKB 3P2TA 1QLRA 5FK9A 2PF6A 3G6AA 3DSFH 3HMWH 4ZTPL 5IB3B 2PO6B 1A6AA 2ICWJ 5A2FA 4Y5XA 3FOMB 2FO1A 4JAMB 3JTTA 3HC3H 4MX7B 5JNYA 2YZ8A 4P2QD 4DW2L 4HAGA 1JPFA 1KBGL 5IP4A 3NACL 5C7XL 1F3JA 2CKBL 3T08A 2D2OA 5FECA 1OP5H 4F7CB 4RAUB 3MV9D 4MQ7A 1HYSD 2Q76A 3VWJB 1FVEA 5BW7A 2J6EL 3OGOE 4ZO9A 2UWEE 4BQ9A 4MSWA 2DICA 3KPTA 1KJ2L 3MBEC 1MREL 4J4PA 3VE0B 1ACYL 4KDTC 3STLB 3PHQA 2APVA 3B9KD 1FGNH 3GHEL 1EAPA 5C0JB 1U8NB 5D7JB 4XCFH 1T21A 1HZHH 2IGFH 1KCRL 4NO2B 4NWUL 4L8BA 5GGTH 4JREB 1UQSB 3MLWH 5JIKA 1JFQL 3B9EA 2DQEL 3IJYA 5T1LD 5JW3H 1B0GB 2VDOH 2F19H 3JWOC 1BOGA 2D31A 2NR6C 3QWOB 4BK4A 3RUGF 1P7KB 2XA8H 2IG2L 4GAYA 4EUPB 2NY5C 5HYQA 5KVGL 1H3WM 1J88A 1U92B 3FN0L 3I9GH 4JFQB 3U83A 5CINH 2ZOLB 3BGMB 4UDTB 4WENB 3HUJA 2CLRA 3UJJH 1MWAL 4K3DL 1QHPA 4Q6IA 3VFNB 4R2GB 1LEGB 2Y06H 4KJPD 3P0VL 4M6AA 5A16A 3TA3C 1JHLH 5HPOA 4BH7A 3QIUA 3K4ZA 4IS6A 1ZWIA 4PG2C 5DK0B 5DRXA 5F21B 3GB7B 4ZMAT 3BIKB 4L5FL 4W6XB 1DLHB 4NZRL 2GJ6D 1P4LA 5IFHL 3BH9B 1HH6A 2ARJQ 1U3HA 1U93A 4U1KB 3UDWC 4NZUL 3SBWA 5C0IB 1UZ8A 2EDDA 3ZL4H 5KSAC 4ODSH 2HLFC 4M6MH 1T22A 2YSSA 3O2DA 4JGJA 3RKDC 3O9WB 3RVXC 3DV4B 1GC1L 5DUBA 2P7TB 3S4SB 3F62A 2IEPA 4RA0C 4FZ8H 1UKQA 5E94A 3T2PA 2FJHB 4OLUH 2DD8L 3CFJB 1G7HB 3R0MA 5IHBA 4DGYL 2Q8BL 2WBJA 4DN4H 1P1ZB 5C0AD 1C5CH 4KROC 5D5MF 2I27N 2R8SH 3TJEH 2HJFA 4N9GA 3IXAA 2DDQL 3MLZL 1OP3H 2DQCH 3HI5H 5I30H 5E4IA 4XP4L 1EGJA 3FO0L 2O61B 1U9KA 4XCYB 3DO7B 3CFKB 1KFAH 1RUAH 3D0VA 1DQMH 3QI9B 2QTEA 3KG5A 2EDBA 3FZUC 4IOFC 4HH8A 3DPBA 3ELAT 3V52H 2BMKB 4OLVH 3MLXL 4N8CH 5DJ6B 5C8JA 4J12A 2W9EL 5KVFL 3HI1B 1DZBA 1U8HA 3TH2T 4WHYG 3GSNL 3P11L 3QUXD 1NUFA 2LTQC 1XZ0A 2QQNL 2WZPD 2Z8SA 3CVHB 4PRIB 4X6BB 3W0WE 1YECH 2B1HH 4Q7DA 2I9LB 5CBAA 1X7QB 5I1GH 4YR6B 3WFZA 3VXTB 4NFDA 4BFIB 5D96C 1MI5B 4LVHC 1VCAA 5ENWB 1QVOA 3VJ6B 5IR1B 5C09E 4H5SB 1II4E 4ODHL 1L6ZA 1TLKA 1NUNB 3MRKA 5BXFB 1KOAA 1BWMA 5BS0D 3S96B 1TCRA 4B41A 3HHRB 3ZT6A 3F7RA 4GRMB 1CK0L 5C92A 1I3GL 5I66A 4OT1H 2V9QA 4UBDC 3DTXB 1QA9B 4XVSL 3BEWA 4EOWH 4EQ2A 4TYUA 5IIEB 2F53A 3SDYH 3C6LC 5K93A 4D9QE 1JVKA 1H3GA 3IAPA 1I9RH 1T04B 1VACB 2FECL 3O2DH 1HHHA 4JO3H 3TBWB 5HVWA 3MLUH 4PGDB 4GO6B 3SDAD 4WHCA 4YIQA 1RV6X 3MRIA 4XX1E 5L88L 1BLNA 5EDXA 4GG8A 1BJ1H 4M93C 5EBWB 2C3VA 3LN5B 1JRHI 3K2MC 4HKXB 3T4AB 2ZG3A 1CFNA 4Z0BH 3VXRB 2PTTA 3QXAA 3WHXB 1C5BL 5TDOB 3RL1B 5E03A 3UTPD 1QSFE 4BZ1H 4B53A 4YE4L 1GGIL 5CIPB 5F3HA 1TFHA 2BVTA 5HGGS 3X14B 5TH2B 1EGJH 3RX5A 4E5XA 1QSEE 3GIVB 2YPLD 3BQUA 3O3UN 1PG7X 1A6WH 1D7FA 1HXYB 4XCNB 4R0LA 4Z95H 3O6KH 4Y4KB 5ILTH 2C3HA 1MCQA 1DLFL 1BFSA 3LDBB 1QR4A 3RWFA 2VDPH 3CFDB 3QDHA 1MFDL 1SBSH 1QLEH 2UVFA 1FZMA 1P6FA 4PGEA 4X7SL 1EFXA 3TZVB 1KTDB 4HT1H 4FFZL 4L3EE 4IRSA 3NA9H 3I6GA 3NCFB 1DBAH 1DQTA 5DHXB 2IANB 2QBWA 4DUWA 5F8QC 3U0PB 1KIPB 3RIFF 4ODXB 4U3HA 5EBMA 1W0YT 1A5FH 5GGSB 3OF6A 3TYFA 5B8CB 4JR9H 2VXUL 5D8JL 4AENA 5EUOE 4Z7OF 4O5LL 3QDGE 5AYUH 4WWKD 1WZ1H 3BP5B 1B0RA 3U2SB 3D25B 4JN1H 1N7ML 4RRPG 3HI6H 1MIEL 2Q20A 3UBXB 2XG5A 2CRZA 1NAMB 4YO0A 3MODL 4ZSOB 3DARA 5IBUB 4MXVF 3S34H 2JB6A 4ZFOB 1C12A 5JTWA 4WV1B 1RZJH 3IT8D 4MNHB 1CICD 5C07B 1J1OL 1X5LA 5MEPA 3P9WB 1L0YA 4QT5B 4S1SL 3O3AA 3JBG7 2NY4B 4JO4L 4NO5A 3M17B 4PB9L 1YEGH 3C8KB 3CMOH 5GJSL 4P57A 2ATKB 3C2SA 3IU3A 3QP3A 1KNOA 2AJUL 2W0KA 2SEBB 1QRND 4NQEE 2F5AH 2O5XH 4QY8B 1JZ6A 1BF2A 1Z5LA 4OZHB 3O8XA 3TGXA 4C59B 1J7VR 3FTGA 1S9KC 5INCA 2MWCA 3PIQA 2VZ1A 3PXHA 2VQTA 3H0TB 3WYRA 1I9IL 2FBOJ 4PJHE 3U7WL 2E8YA 2YS4A 1FDLL 4H1LG 5EIVA 1B6UA 4FZEH 4HULB 1U8MB 1A0QH 1LO0H 1UWXH 4PUBL 1XGPA 2W91A 4K8RD 4DGVH 1A3LL 1RURL 4I3SL 1GZQA 3DJ9A 3OB8A 4HJ0C 4MVBD 1X6NA 1VFAA 4XXCA 4PD4K 5LGJB 3BPOB 1S8DA 2ADJA 3HMWL 1NBYA 2YRZA 2XOTA 1Q0XH 4D94A 2DLFH 2QHRH 3FB7A 4QRUA 1D5MA 3HC3L 2XTJE 1OAKH 4HWZB 2EXWD 2Y7QA 4NOBA 1HOCA 4M03A 4FABH 4WNQB 3GMNB 2VLJA 4H25B 5FDWA 1WIPA 1T7VA 1BVKA 1WBZA 4PJ8B 3BMWA 3R06A 3ECBB 3INUH 4KMQA 4EQ3A 2OI9C 1EJ6A 2NXZC 4RNRA 1MH5B 4OZIA 1I1AD 1HI6B 5GZOD 3O4LA 4RIRA 4JFOA 3KYNA 1NGZB 5KSBE 1EJOH 4FFWC 4NM4H 3DRQA 3GSRB 1LEKA 3IFPB 3HUJF 4C56B 1FLTX 4FNLH 1EBAA 1FGNL 3V6ZA 4PP1C 4XCFL 3ZT7A 1HZHL 1JI1A 2IGFL 2YKLL 4J4PD 3S37H 1QPPA 5FB8B 3H3KA 3SN6N 1NMAH 2X6MA 5GGTL 4KVCH 3MLWL 2H26B 4XZUB 3RY6A 1A47A 4UAOB 1FGVH 4O2FA 3BPLC 5JW3L 2VDOL 1G9EA 2F19L 1HNGA 2P5WA 3SPVA 4RSVA 3HAEA 3W2DH 1AO7B 5HI3C 2XA8L 4L1DA 1KEML 1KIQA 4R3SB 3I9GL 5H94B 5AUMB 4U31A 4YHKH 4NT6A 5DMGD 5FYLE 5JHLH 5CD5C 4IEFB 2Y06L 5GGRB 4YDIH 3A67H 3K4AA 5KJRH 2MPAH 4X9HA 2R9HD 4OLXH 3FFCE 1JHLL 3MOQA 1C8PA 5IF0A 3ARGC 2GTWA 4EJ1C 4NRYA 5FFLA 1MFBH 3LEYH 4GAGH 4PJBB 4IOSD 2QADD 1PGRB 2DI8A 3L3HA 3QIUD 3QIWB 1RJCA 4NN6B 5HHMD 2FR4B 3PL6B 4Q0XH 3QEUA 4WDIA 3DSNA 5GS3A 4TSCH 1NLBH 1FNSH 5I1CH 4DEPC 1NC2A 4OCNC 5KOMC 3FT3A 5H37H 1MCEA 5HTSA 1HH9A 4L4TD 1U3HD 4OIIH 3VXNB 6FABH 3H9SB 4N0FB 4ODSL 4U1NA 5E1AA 3D3VE 5K9KB 4M6ML 4X6FA 1FC2D 2RBLA 2EC9U 3CDYA 4D8PA 5D1XA 1P69B 5GS0C 5I71B 1KPUB 3GMRB 1UFUA 4PJIE 5EPMA 4XX1G 4OLUL 2YRPA 2VQUA 3U46B 3QDJB 4L4VE 3QCUH 3PWLA 3X13B 3GO1H 3LKNA 2WUCH 4DN4L 3U7YH 4M5ZH 1C5CL 4JZJB 3TYGH 1SJEB 3C2AH 3ZKND 4QCIA 2R8SL 3TJEL 2DQCL 3QEQA 5I30L 3DX9B 2GUOA 5EU6B 1G0YR 1Y6KR 4L8SA 1OAYH 5FGCE 4IMKC 1KFAL 1RUAL 1DQML 3ARFC 4K7FB 4K3JH 4MWFA 4JM2C 2NTSP 1NFDA 4YDJA 4E41E 4N9OB 5DVOA 1VADB 3W9DB 3V52L 1RULH 3PWPB 5AG8A 4H1LA 2FSEB 1NC4B 1V8HA 1CLOH 5ECJE 3U6RA 7CGTA 2UZIH 4OCLC 4Z7WE 1JYNA 4PRHB 5CJ8A 1XH3B 2Z8RA 3HAEH 3WLWC 5AZEH 3DVGB 1A1MB 2B1HL 5F9JA 1J0IA 5I1GL 1FNGB 1FCGA 1QP1A 1LE9B 5E4EB 2OTUA 1RJZB 4TNWK 4TSAL 4MQXC 4P2OD 5ICXB 3LIZL 4KY1H 4OZFG 4HC1A 1NEZG 1BQHG 1TPXB 3QO0A 3L5WB 1ZHKA 1JL8A 4X4MA 3GDBA 4IRJC 5EO1B 1DBBH 4H8WH 2FCBA 4ZG1A 2GYSA 2DS4A 4OT1L 3JZ7A 2Z0BA 2PO6A 4OLEA 5HGHB 3FOMA 4GXVH 4JAMA 5CJOH 4OD3L 1HQ4B 2YMXL 4MX7A 4JKPH 5DEGB 3SDYL 1QD0A 5K59E 1U8OA 1MJ7H 4YLQT 2LE9A 3HG1E 1I9RL 4HFWA 4LSQH 2BVQA 3O2DL 4JO3L 3MLUL 1ZTXH 2XKNB 1JV5A 2WP3O 1IZKA 3P4OA 4RAHA 3NPZB 5GQBA 3BP7B 4MNQE 3VWJA 5CILH 5D9SB 1MF2L 3WJJA 1RQ5A 3SO3B 4J3WA 4Z0BL 3MJ9A 4QHKJ 1PSKL 2FH8A 1ZAGA 2OTWA 3ARWA 3VE0A 3STLA 4BZ1L 1GCFA 1VKXB 1KB9J 1U8NA 3QXVA 5D7JA 5LKNA 4P99A 3BZ4B 4NO2A 3VD5A 3B2UC 2XTJC 1OM3H 3EYSH 4G8GE 1UQSA 1XMWA 3P73A 4L3AA 2ITDA 3UPRA 4G6MH 3NBNA 3WDJA 3AB0B 4R9HA 3O6KL 1DQJB 1PW3A 4QHLB 1B0GA 4NHCH 3PWNB 5ILTL 2Y07H 3BQUD 2KKQA 1V5JA 3QWOA 4H1LH 2Z9TA 4EUPA 2VDPL 5D71H 5TDNB 1U92A 4QEGA 1MFAH 1SBSL 2ZOLA 3BGMA 4HPOL 4UDTA 1FG2B 1QLEL 5GS1B 5FO7B 3VFNA 1LEGA 2E9JA 3WN5C 2N56A 3O6LH 2OP4H 4A2LA 3NA9L 1DBAL 1ED3B 4BK5A 4PTTB 3VXSB 1OPGH 1EFXD 4R4FH 3VG0H 1BIHA 4Y19A 5DK0A 5T3XH 2FJGA 2WLZA 2YD5A 2YOCA 4IRSD 1N6QH 5IB1B 3KXFE 3BIKA 1UWEH 4JR9L 1DLHA 5M94B 3LKQA 4HC1H 3BH9A 3GK8H 4JFPB 1G0XA 1WZ1L 5I8EA 5C2UB 2Y4SA 4NNPH 4JN1L 5I19H 4U1KA 3OF6D 4PJ5B 2ICEB 3QQ3A 4JQVA 1RUPH 4RMQA 3D69B 5C0IA 1HCVA 4X7CC 3WSQH 4CUCA 3S34L 4OF5A 1RZJL 2PKDA 3O9WA 2QR0B 4PYGA 3G5XB 3DV4A 2P7TA 4UTBH 5DJCB 3S4SA 3WKMH 1M05B 4OCYL 1YEGL 1DR9A 3CMOL 2FJHA 4OSUH 3CFJA 1G7HA 4OBRA 3UZEA 4LCWE 1A21A 4N1EA 4JO1L 5DK2B 1U42A 1P1ZA 1HSAB 3SKUD 5IK3B 2O5XL 4PR5B 5CS7A 2BRRH 3SY0B 1JPST 4HG4J 3IGAB 2BSED 1AR1C 3MJ9H 4DWHA 1S7XB 2O61A 3V5HA 3QI9A 3O8XD 1WSST 4AYFA 5F7DA 3MV01 3JVGC 4NPYB 2R0KH 1I3RB 4LK4A 1PEWA 2NLJA 4U2YA 3MFFB 2BMKA 1OTUC 4PGBB 5FCSH 1OAZH 4FZEL 2FLBT 3EOTH 4OZFA 3QHTC 4DGVL 2BVPB 4JY5H 4CGTA 1NEZA 3IDIB 5IFAH 4FHBD 4OZIF 1JYVA 4NQUA 4G6FB 3S97C 5DJZB 3I3EA 1DUZB 4Z78B 2JE8A 4N0UB 1EO8H 1LK3H 5F89B 3NCBB 4EUPH 3ES6B 3ZDXF 4XNXH 3CVHA 4PRIA 4OKVB 3TV3H 3K3QA 5TPWH 4QRQB 2GAZA 5C0RH 2I9LA 1KN4H 1X7QA 2BXZA 1Q0XL 2DWEB 4YR6A 2DLFL 2QHRL 4Y2DB 1EDQA 2ZUQC 3KNBB 1JPTH 4UDUB 4YHYB 3VJ6A 4KKBC 4FABL 3OPZL 3RRQA 3N9GH 3ULVH 5AEAA 4UT6H 3QQ9C 5BXFA 1FFQA 4K9EC 4KK8C 1S7RA 3S96A 4XHQA 2X1QA 4YHMH 3KLDA 4GRMA 2VLJD 3INUL 4YDVB 4AL8H 2NZ9D 1GOFA 3QDME 4E9LA 2HTKD 2BVOB 4XP1H 3DTXA 1N5AB 5KSAB 1QA9A 2QQLH 3RWJB 3IDYC 1EJOL 4GQPH 5E7BA 4NM4L 4Z0XB 2X89A 5IIEA 4XBGB 1P84K 2DM7A 4FNLL 4XTRD 3BX7C 5DURB 4UINL 1KXVC 1T04A 2FL5B 4G9DA 1VACA 1LO3H 3MV7B 4QXWA 2WLYA 3S37L 4Y4HC 4KVCL 2CXKA 2FX8L 3JV6B 3OR6A 4WO4B 1NCAH 2MFNA 5J1SC 5EBWA 3H2WA 3LN5A 1FGVL 3SJVE 5IROC 2FECI 3VXRA 1EK3A 1MY5A 5TDOA 3RL1A 1RHFA 3W2DL 4M6NH 3PGDB 5ACMA 4WTXA 2HYMA 1RJLA 5JW4M 4HWEH 3X14A 2P5WD 2GY7B 3TCLB 5TH2A 4YHKL 1P6AB 3LPWA 4JVPA 2JCCA 5JHLL 1GRWA 3GIVA 1XCTB 3MPCA 4YDIL 3A67L 4C83A 5KJRL 2VUYA 2MPAL 4UT7H 4B50A 4OLXL 1HINH 4PJDF 2IMNA 3V6OA 5JOEA 5KG9B 2VZSA 4F33A 2DKUA 4JJ5B 3BRFA 4FQPA 3VXQB 1MFBL 3LEYL 4GAGL 3VFVB 4OZFH 1S7TA 1YYMH 3CFDA 2LTQB 3KYKH 1OSZB 4Q0XL 3MRQB 5F8RC 2H1PH 1NLBL 2B2XH 1FNSL 4JRXE 5I1CL 3MA9H 5EC1A 1OB1A 2GJJA 3TZVA 4WUKH 5ACZB 3CVHH 2C1PB 4LVHB 3KPNB 2X05A 1NBVH 4MJIB 1ES0B 6FABL 3SQBA 1FH5H 2IANA 4JDTH 3DHMA 4U05A 2EYSA 1NC2D 3U0PA 1KIPA 1NFDF 4ODXA 4KTDH 4HHAB 4CVZB 5GHWH 1J0YA 3UTZB 4LHUB 2DN7A 3HLAB 4WY7H 4IIQC 4P48A 4FFYH 1DP0A 1C08A 1ETZB 3OZ9H 3Q48A 5D1XD 3U2SA 5E6IB 4QRRA 5I6XB 5A2KH 3QCUL 3QNZA 2NY6D 4RGMC 3GO1L 2WUCL 3U7YL 3UBXA 2N4IA 4M5ZL 4Q9QL 3TYGL 1NAMA 3C2AL 2IALB 4ZSOA 1AGDA 3TT3H 1F8TH 3SHSA 3C6LB 3VG9C 4ZFOA 2VKXA 4N90D 2ZNXA 4WV1A 4MNHA 3TFKC 5C07A 1F4YH 2P8LB 4LMQE 4PJAA 4K3JL 2AQ3A 5D2NA 1JGDA 3QEQD 4J3XA 4FP8H 4WWID 3MLRH 35C8H 5HHPA 3GUTB 5HJ3B 2HT2D 3DIFB 3MBXL 4FQ2H 1F97A 4GRLC 4P5TD 1RULL 3PDOA 3PWVB 1AXTL 2SEBA 1SM3H 1YY9C 3L6FA 1NL0H 1JGVH 4QY8A 3L3KB 4OZHA 3CZFB 1TZHB 1JE6A 3WDHA 3E2HC 2BX5A 3AS2A 1ORQB 3ORJA 1TZGH 3EFFB 2W0PA 5IESH 5AZEL 4X98B 1T2QH 1EUTA 1JZ7A 4CVXB 1BFVH 1A6VL 3H0TA 2G75B 4NRXB 1FBIH 4EI6A 4O9HH 4NCC1 4KK5D 4YPJA 1U8MA 4IDLA 3JVGA 4GT7A 4KY1L 4FQXA 2DQFA 2HVKA 3PJSB 2C4FU 4OLZH 3PGCB 3A6OA 5T3XD 1QHOA 2UWEB 3W5MA 1A3QA 3MRMB 5I1AA 4NKMA 3M8OH 1CXIA 1A4JB 3VFPB 5LGJA 2YA2A 4P3DB 3WIHA 2Q8AH 1DBBL 4H8WL 1CGTA 3SE8L 3QUYC 4I1NB 3TN0B 4GXVL 4V2BA 5CJOL 3TVMC 4HGMA 2BJML 5F93C 1Z3GH 4HWZA 4FQHB 4WI2A 5T1MB 5EB9A 3BPNC 2PO6D 4N8VB 3EAKA 4WNQA 5HY9B 1MJ7L 4JPWH 5MERA 1RY7B 4LSQL 5IKCB 3WMSA 1N0LA 1ZTXL 4PJ8A 1S3KL 3ECBA 4HIEB 1N5YH 3BKMH 1MH5A 2Q86A 4HUUA 5CILL 1HI6A 4FG6C 3QUZC 2W65B 5FYJE 3MRFB 1MCLA 2VOTA 4J8RB 5FF6B 3SE9H 3MO1B 2JIXB 3V6FB 3IFPA 4KKNA 3VWJD 1NAMH 1AI1H 4D0DB 5FB8A 3ULVF 1OM3L 2OBGA 4HXBH 2DLGA 1YPZE 3VXME 4JG1H 3EYSL 1KGCE 3CLFH 2H26A 5D7JD 1X5FA 2I9TB 5CZKA 4G6ML 4XZUA 5D2LE 4ZXBB 1VENA 5IJKA 2BOCB 2Y07L 4F7EB 3EJZD 5HYJE 3IDMB 2J8UE 1AO7A 2XN9E 3R4DA 3V7AE 2DQJH 4LLUB 2BDNH 5SX4H 3DV6B 2R29H 2E6JA 4F58H 1MFAL 4KZEH 5H94A 3KWWB 5AUMA 1WICA 1AIFB 4FFVC 3MLYH 5GGRA 3ULSB 4TTGA 2AEIT 3O6LL 2OP4L 4HCRA 3ARYA 1LDPH 5CSBA 1N6UA 4WRLA 3OB0K 3W11C 3FQRB 1OPGL 3VG0L 4R4FL 5T3XL 2EH8H 2R2CA 4PJBA 1UWEL 3ULVD 1LP9E 2XICA 3QIWA 4HC1L 2BNUB 2FR4A 2Q6WB 3PL6A 3VCLB 2HT3D 3GK8L 4HS6B 4NNPL 5I19L 1RUPL 4XVUD 1FL3B 2DBLH 1T0NB 3WIHH 3ZKSD 5HI5C 4XNUH 4LFHG 3VXNA 3H9SA 4N0FA 4GJTB 5C08E 3CXDL 3DOSA 5JDSB 4KKAD 1KACB 4N1HB 3EYFA 3BE1H 4UTBL 3WKML 5J8OA 3CDCA 3GMRA 5L2KA 1QQDB 2OI9B 3OHXA 3QPQC 3O9WD 1HKFA 2NXZB 1FHGA 2QSCH 3OAYH 3LSOA 3B6SB 4JPIB 3U46A 3WFEH 3QDJA 5EBLB 5F7MC 3KLSA 3E3QE 3X13A 2RCSH 1U91A 4IIQA 1SJEA 3W0WB 5MENE 3HNTH 8FABA 1L0QA 4POZD 1EIBA 3DX9A 3QRGH 3QUKB 4G6AC 1ITBB 3W39B 4OUUB 4U6VH 1G1YA 5C09B 4M61A 2HVJB 1SJHA 2A9NH 1R3HA 4ZDHB 5MP6H 1UCTA 2R0KL 1VADA 3FO9B 3QI9D 3W9DA 5B21A 3PWPA 2YUXA 5EIIB 4HQQL 1OAZL 2FSEA 3WJLC 2UYLA 4AT6A 2YR3A 3EOTL 1MRDH 2XQYK 2B20A 4JY5L 2OZ4A 1S78D 4GRLA 5IFAL 3GMOB 2YRLA 3AMKA 4PRHA 4CMHC 1EO8L 3BUYB 2VR9A 5HYEA 3ZE1F 1DQQA 4CDHA 3TV3L 4D9RD 4X5XA 3DVGA 5TPWL 4PLNC 3L5IA 1KN4L 3VWKB 1T20A 1XGUB 5CEZH 1F00I 1OAUH 1JPTL 3O6FB 1XF4A 4PRID 1RJZA 4OFKA 4HCRH 3D0LB 3VXUE 3N9GL 4HUNB 1S7QA 1RZFL 3ULVL 1ZGLB 4LKCB 3PP3K 3BUTA 4UT6L 4W81A 1MI5D 1ADQA 4KI1A 5I1LB 1M71B 4M43H 1R5WB 4YHML 4AL8L 2EIZB 1QO3B 1FN4B 3TPKA 4K7PH 1PKQA 4HWNA 4XP1L 5JXEA 3HB3C 2QQLL 1JGEB 2JCCF 4P0DA 4KXZI 4IBLT 5KVDL 4G7YH 1LO3L 5C0NC 1CLZH 2X89D 1N8ZB 4Y1AB 4Y88A 5CJBA 1X5ZA 2XKNA 5EH1A 1EHXA 1IILE 5DZLA 1BM3H 4Y89A 2YBRB 3O3DB 3EFDH 3TNNB 4YJZL 4GOSA 1I1YA 4TUKL 5D9SA 1CDCA 2EYTB 4WFED 1QACA 3V9FA 2V2WB 3V8OA 4M6NL 5CKGA 1UH2A 2VXSH 2NY0D 4NKDB 1R3LB 4KJWD 4P9HC 3VXRD 3BZ4A 1RK0B 5E00B 5JOFB 3QIBC 3T4YA 4PRDB 3N1QC 1CL7H 3J7HA 4JFEE 4HDIB 3WNPA 4UT7L 1UC6A 2ADGB 1HINL 5EUOB 4DJMA 5D4QA 3QDGB 4BSWB 4QHLA 1DQJA 4FXLA 3MTRA 4LSVH 3NFPB 1N0XH 5BZDB 2APWA 4EVNB 4O58H 4Z8FH 5CWSA 3TIDB 4KJYB 1YYML 5TDNA 4Y4KD 3LZFH 1TJGH 3KYKL 2OZ4H 1WT5C 2H1PL 3OJDB 2B2XL 5GS1A 1IGYB 3MA9L 5FO7A 4AG4H 5DQDH 2H6PA 4WUKL 5DUMH 3CVHL 4HUMB 1KIUA 5DD5L 1F3DJ 1NBVL 3PWUB 4PJAF 3U0TB 4KKLD 1ED3A 2EIDA 1FH5L 3HRZB 4JDTL 4PTTA 3VGGA 3VXSA 4MHHI 5M7QA 3TZVD 2W9DL 4KTDL 3WFBH 4TUJA 5EN2B 5GHWL 2DF3A 5LXGH 2IAND 4WY7L 4OGAD 1FRGH 4FFYL 4JFPA 3T0EB 2ENYA 1ADQH 3WNOA 3OZ9L 4OZHF 4XP5H 3I75B 5C2BH 2JJVA 1CFBA 2AJXH 1OLZA 5FV2A 2EDHA 2FIKB 4I4WB 5IGXH 3TT3L 1F8TL 3BZFB 3PNWB 2VTFA 3VH8B 3F7QA 2QR0A 3DBXB 1F4YL 3T0WA 4WGVB 3T2NH 2AQ2A 3MA7B 4XC1H 2EDEA 1I7UB 1X4ZA 4JFHD 2LAAA 1AGCB 5JORB 4FP8L 3I6LD 1UJTA 3DGGB 35C8L 3MLRL 5C07D 5LGKA 1EEUA 4L8CB 4FQ2L 5I16B 4G9FE 2NY4D 4QYOA 1XGYH 2A73B 2X4SB 4I0KA 3WE6A 5IK3A 1NL0L 4PR5A 1JNJA 1WFUA 4OLWL 4XH2B 3V7AG 3IGAA 4FOMA 5DMKA 4MA1C 5CJQL 3VFSB 2XTJB 3T0VA 2F54A 3IDUA 3IS1X 4QRPA 1TZGL 5IESL 2VB5A 1UM5H 1T2QL 2YD2A 2CK2A 5D72H 3HR6A 1BFVL 4YHZH 5F9AC 3T77B 1I7TB 3RVTC 1I3RA 1FBIL 4WI3A 4V2CB 4PGBA 1LVEA 1R3KA 1KXQE 4I2XB 1I8IB 3S6CA 4RWYH 4Y16C 4EDXA 5GXBB 1ZEAH 4X7TB 4OLZL 2VABB 2D4FA 3IDIA 3S37X 2XKSA 5DD3H 5KSBB 2CUMA 5HI4C 1RZGB 1HCFX 5DJZA 1DUZA 3GJFK 4Z78A 4N0UA 4Q2ZB 3F7PC 5F89A 4FQXD 4LIQH 3ES6A 4L3CB 2Q87A 2Q8AL 4OKVA 1A1NA 2A77H 4LARH 3S9DB 4QRQA 1D5XB 1OTTD 3LKPB 4PFEA 3L5HA 4Y2DA 3KNBA 3TPUB 4UDUA 1KSRA 2E7LC 1Z3GL 5HHOE 2VE6A 3ZLQC 3JUZA 1X5HA 1R5IB 3SE4C 4JPWL 4KI5E 1MCWM 3WHE0 5HXMA 3O0RH 3OGCB 5FA3B 1MVUB 5E5UB 4KRPC 2MMXA 4YDVA 1CD1A 4CU7A 3MSPA 5LCVL 2IPKB 1Y0LB 3GZKA 3TO2B 2BVOA 4RZCA 4PJ8D 3CU7A 3RWJA 3IFOA 4Z0XA 1BZ9B 4M48H 3QG7L 3SE9L 5F1OB 5EO0A 2LQRA 1NAML 1T1XA 1JN6B 4G8IB 1VGEH 2FL5A 5JW4Q 3MV7A 4ZFOL 4N0YH 4XXDB 5D7LE 1B88A 3V0WH 3GBNH 4JG1L 4CMMA 4MB5A 4WO4A 2BNRE 2R2HB 4PJBF 1A2YB 3ARBC 3DVNA 1NUDA 4GAJH 3AREB 1YDPB 4QOKE 1S7VB 3HNSH 4X4XB 2DQHL 3W9EA 2DQJL 3PGDA 2BDNL 3SGEH 5IVXB 2R29L 4F58L 4V1DA 3UTQB 4KZEL 1KB5B 1DBJH 1OSPH 3TCLA 5I17B 1AO7D 5BQ7B 4DKEL 4XBEH 3Q5TA 4JFFB 3MLYL 4GXUM 1LDPL 3RU8L 1TCMA 5CEZD 1MHPH 5E8NB 2BOBA 3VXQA 2NQCA 3WL9A 2EH8L 2OL3B 3B5HA 1KF9B 1ROWA 3NIFF 3VFVA 4XWOC 1OSZA 3MRQA 5FGSA 2AJ3B 4M1CD 2AW2A 4NNYB 3O11B 4OLYH 1EHLH 3C60B 5FGCB 3CH1B 3QIWD 2DBLL 3WIHL 4MXWH 1TITA 3PL6D 5ACZA 3KPNA 4XNUL 3HMXA 1WT5A 1ES0A 4EN3B 3KPOB 2I26N 3KPRB 3WUWG 3F58H 1IQWL 4HHAA 5B3JE 4RFOH 1CTOA 5F9WC 3UTZA 1T7ZA 3BE1L 3H9SD 4LHUA 2W1NA 3ZE2F 5EZIH 4I0CC 1ETZA 3BHBA 3G04B 2QSCL 5GRJH 3WFEL 5E6IA 4IHOB 1T03H 1HSBB 5TGBB 4M7JH 5DJ0A 2XY2A 3RBGA 5B38G 1T1YA 2IALA 3MLPA 5E9DE 4PJXE 3HNTL 3QDJD 4Q97A 3KVQA 3NGBC 9CGTA 3MOBH 3B9DA 1KCVH 3VXOB 2P8LA 3MNVB 3PV7A 4HH9B 1K4DB 3EJYD 2YA0A 1I9JH 4U6VL 4YHPB 5H8DA 4MJ6B 4D3CH 5MP6L 5T3ZE 4NBYB 3GUTA 1CG9B 5HJ3A 2EIBA 5J06A 4WW2C 4HWBA 4L9LB 4FQCH 1LEIB 4MGXA 3PWVA 4QHNA 1MRDL 2ZUVA 3L3KA 4NZJA 4Z7VA 5ISZE 1TZHA 3PWPD 3RWCB 4GRWE 1NC4D 1VFBA 2ZG2A 1ORQA 3LKOA 1OTSD 5E2UH 4WFFD 1GAFH 3EFFA 5E08H 4X99B 4D2NA 1LQSR 4X98A 4ZAKC 4CVXA 3OXRA 3HG1B 3WS3B 4PRHD 5FYKH 2G75A 5CEZL 1N3NB 4NRXA 3NIDE 1OAUL 1FQ9C 4ZUVB 4HCRL 3AUVA 2Y6SD 4P46B 3PJSA 2JLLA 4M43L 3X11A 4GAFB 2ARJB 1A4JA 4Y16A 3VFPA 2CH8A 2WWKO 5F6HI 4HZLB 4FQJH 3WHE1 3MRNB 4K7PL 2NY1B 5JA8B 4X7FC 4YAQA 3MGAA 4RA3A 1WCBB 1UZ6E 4O02H 4G8GB 5EU4A 1LILA 1WISA 1YNKH 1IC5H 1WCQA 3OR7B 1A7BA 3AY4A 4N8VA 3QH3B 3HMXH 1C1EH 1TVHB 5ADOH 5JXED 5HY9A 2ZCKH 1KLUB 3FB8B 4G7YL 1G6RB 2YD9A 1FSKC 4X0KB 5IKCA 1XF5B 5HGAA 5D1QC 1BM3L 1XFPA 4HIEA 1E4WH 4YK4B 1I9EA 1U8IB 3EFDL 3MUY1 5HGDB 2W65A 1IEBB 3VFUB 2BCKB 4LLDB 4J8RA 4WTWA 3BT2H 3MO1A 2JIXA 4LPCA 3C87A 1RU9H 2P45B 5TE7H 3SGJC 3MUGB 2EDYA 1CL7L 4NQDE 1X5YA 2I9TA 4KI5C 3QUMB 4RFNB 1CN4A 1FZJB 2JJWA 4ZXBA 3ZYZA 4JZNB 2NMSA 4G7VL 4JHWH 2BOCA 5B39G 4HWBH 3RNQA 4F7EA 4LSVL 3IDMA 4X7DC 1IGMH 1N0XL 4Z8FL 5DMYA 4O58L 5HD8C 5ITBL 1AKJB 5KVEH 5JZ7D 3DV6A 1YMME 3LZFL 1TJGL 5C3LD 2OZ4L 4PJ9B 3KS0H 4WJ5B 4CRPA 1JWSA 4M3JA 4AG4L 5DQDL 3ULSA 5DUML 5DEFB 1J8HE 2XRAH 3S35H 3FQRA 2R56H 2JJSC 1OP9A 4ZOBA 3DETC 3DX6A 3WUWA 3VRLF 2DI9A 3WFBL 2VISB 4P3WA 4BYHA 2ZWLT 4ZO6A 3VFRB 4WUUB 3VXSD 5F70A 1FRGL 2Q6WA 3VCLA 3TP4A 1ADQL 2M2DA 1MHHB 4HS6A 1O7SA 4XP5L 5C2BL 2AJXL 4HF5H 4UU9B 3RVWD 4LKXB 3TVMB 1T0NA 1AGBA 4NNXB 5IGXL 4ERSH 3QFJE 5EC2B 1BP3B 4IDJL 2FLRT 5JDSA 3ZE0E 3T2NL 4XC1L 4WI9A 5GRVL 1ZT1A 4WI8A 3LS4H 4PJCE 2ZOKA 4PS4H 3V4UL 4JPIA 4H20L 2ZJSH 3QUZB 5EBLA 5BV7B 5TE4H 3R1GH 5DVLA 5TF1H 5B4MC 3VD4A 1UJ3C 4L29B 3T09A 4PJFE 3NABH 5FEBA 2FJFA 3EO0B 2VLKB 3SKOB 4Z7QF 3QUKA 1BJMA 1A9EB 1HNFA 3W39A 4OUUA 3MRDB 4LCCB 1CXHA 3NZ8A 1UM5L 4H0GA 4HK0B 1BZ7A 1FP5A 5D72L 3D48R 4J7RA 3RX7A 3CNKA 4N68A 2ICWI 2BFVH 4G3YH 5DI8B 4O2EB 2IBGA 3QDMB 2ED9A 4GBXB 4RWYL 3BGAA 3KLHD 1A22B 1EO5A 1QBBA 4EI5B 4WW2A 3UMTA 5DD3L 3GMOA 4HBCH 2BY3A 4JY4B 3BUYA 4LIQL 1IBGH 1OP5K 2A77L 4LARL 1T5XA 3VWKA 4G6FD 1XGUA 2WNGA 4R96A 1T1WB 3SCMC 1CLCA 3O6FA 3DX8B 4NUJB 4OFYA 5F6IC 5F7KC 2EEAA 2YXMA 3PDDA 4PLKC 3FONB 1YNLH 3D0LA 5CJXA 1ZA6B 3BVNB 4Y2DD 4LKCA 3SJVB 3WLBB 4B7LA 5I1LA 1M71A 3O0RL 4MS8D 1QBMH 1R5WA 1QO3A 3QPXH 1AHWB 4GW1A 5F71A 4OM0H 4LSUH 5IBLD 2G5RA 3BW9A 2ID5A 1G7QB 4M48L 3BGFC 1JGEA 3B83A 3SGKC 4LASH 3V6BR 2IH1B 4U1LB 1DQLH 1VGEL 2H9GB 4JRYE 3LEVL 4N0YL 1N8ZA 4Y1AA 2IPTH 3V0WL 3GBNL 4TNWF 5J1AB 2J2ZA 2YBRA 3O3DA 5DURD 3MRPA 4BA8A 1U8KB 3MV7D 1AQKH 2EYTA 4X9GA 4GAJL 4WO4D 5B39A 2V2WA 3HNSL 1DANT 4PLJC 4KRLB 1R3LA 4AEIL 3LB6D 1RK0A 5KANG 2K1MA 1DBJL 1L7TL 1OSPL 4TUOB 2AJVL 4XBEL 4YHLH 4ONGH 1C16B 5FHAH 4UZGA 4KJQD 3VFOB 5DD6A 5FYKD 3D87B 3ARRA 4P5MB 2FEEL 1I4FB 4JLRB 5BZDA 4EVNA 3DYOA 2XQYG 3TIDA 3T3ME 3BP4B 1AGFB 5I75C 1J05B 3BRGC 1N2RB 3KPQB 3ILPB 1IGYA 1F4WH 4OLYL 3SDXE 3TNMA 1EHLL 2A83B 4X8JB 4MXWL 1MOEA 4JANB 3VFGH 1MAJA 3JSSA 3PWUA 3U0TA 2VZ3A 1SJXA 2CMRL 3HRZA 2QJDA 4BQ6A 5I15H 4TQEH 5LAXB 1OP3K 3F58L 3ULUH 5D1ZB 3MRGA 2DLTA 4P2QE 4RFOL 4U1HA 5JPMB 4YFEA 1AQDB 4WW1B 5EZIL 5ICYB 3UPAA 2PXYA 4PRAB 2R39A 2XZQL 3T0EA 1DVFC 4Z7VF 4NWTH 4ENEC 1T03L 3IDGA 4LHUD 4M7JL 4TNVF 3MV9E 2FIKA 4I4WA 5KS9A 1LE5B 3NIGE 5E6ID 1D9KC 3MOBL 3PNWA 4OGXH 4XP9H 2Y9RT 3VH8A 1KCVL 1ZE3C 4ZFZB 3ET9F 2NPLX 3CK0H 3PABB 3Q5YA 2ZSVB 3EOBA 4LLMA 3FT2B 4NP4H 2R0LH 5LQBH 1TZIB 1NCTA 1HHIB 5I16A 4AIXA 2NYYC 4FQCL 3N0PB 2A73A 2W0FB 1UYWH 3IU4H 1J10A 1BBDH 2IAMC 3VFSA 5F9OH 5CSZA 1YA5A 2AV1A 3DROB 5E2UL 5DO2C 1UENA 5HDQH 1VESA 3BI9X 2VQ1B 3T77A 4JM4H 5FYKL 5E8OA 5EOTB 1MCNA 4KFZC 2XPGB 2NX5B 5SWQA 5IQ7H 4ODWB 4UOJA 1X9QA 4DOHE 4I2XA 1I8IA 2XACC 1H3TA 4X7TA 1S9YA 3T1FB 2VABA 1D6EB 4L8DB 1RZGA 3WEXB 4D9LH 2AXGB 4GKNB 4GQ9H 5JUEH 4UT9H 4I13B 4L3CA 3ARXA 2GJ6E 1D5XA 2V9TA 3RWDB 3LKPA 3HNVH 3UCRA 3Q6FB 1ND0B 1LK2B 43CAB 5J89A 1YPZB 3MJ7B 4O02L 3ZHLA 1YNKL 1IC5L 4OCXL 4Y4FC 1D6VH 2DWDB 2V5MA 3HMXL 1C1EL 4W70A 5D93C 3RA7H 3TN0D 3RUGE 2ZCKL 5ADOL 1A7OH 4UUJB 2HWZH 4FTVE 4NOFA 1MEXH 2YUZA 4UILH 2J5LB 1MVUA 2J8UB 2AXHA 2ESVE 1E4WL 1O7VA 1JI2A 1UM6H 2IPKA 1MLCB 3H6JA 4U49A 4ZYKA 3MYJB 3DYPA 2FWOB 2OSLB 5E2TH 1L0XA 3DURB 1FNLA 4LEXL 3BT2L 1BZ9A 2WWKT 5J6HA 5C0AE 2D4DA 3RVVD 3N50A 4DQOH 4H88H 1JN6A 5E5MB 1RU9L 1AGEB 2FATH 4G8IA 5TE7L 1KXTB 1IEAB 1F3DH 2JIXD 3S5LG 4DVRH 4UIKH 4XXDA 5I1JH 4JKKA 4NC1E 1P9MC 2QEJA 2E27H 4PV8A 1F42A 1LP9B 5JIPA 1FV1B 3NFSH 2R2HA 3NCEB 5DC0A 1A2YA 5ERWB 4PG9B 4HWBL 2X1OA 3ARDA 3ZKXC 1S7VA 4XC3H 5CMAA 1IGML 1MQKH 4MA1B 1UB5B 1T89A 4ZXBD 5CZVH 3PV6B 4Q9BA 4RISH 5IVXA 2X4PB 1UWGH 5C08B 3HA0A 4LEOB 5I17A 1YC8A 4P3CL 3NTCH 4JEGB 3UYPA 5BQ7A 2GCYB 4QHUB 4JFFA 1TNMA 1INDL 1PKOA 1A6ZB 2XRAL 3S35L 3RJQB 5E8NA 2GIYA 4QKXB 5D5ME 4GKSB 1RUMH 3UJTL 1S5HB 3OX8B 4F9PA 3IXTB 2OL3A 2BP3A 5FUZH 2R4RH 3CZJA 4QXGH 3X12B 1PAMA 5C9JB 2VR4A 4LCIH 5JQHC 2R23B 5BS0E 2AJ3A 3IAGC 4DVBB 4NNYA 2AJYH 4APQB 3U4BH 3C60A 4Z77A 4HF5L 5K9QG 3CH1A 2P8MA 1WWWX 4YDKH 1JZ8A 1Q1JH 5CJ5A 4ERSL 3U4AA 2IWGA 4EN3A 3KPOA 4KK9C 3LD8B 3KPRA 4P4KC 3D1MC 5AD0B 4NQTA 1UM4H 5LG1A 5IMOB 3BP6B 3LS4L 4KRPB 1H5BA 4YHIB 4GS7C 4PS4L 3G04A 3DMMB 3RKPA 4HKJA 2ZJSL 3BXNB 4WW2F 5KSUB 1HSBA 5TE4L 5TGBA 3R1GL 2VSDA 5TF1L 1KCUL 4G43B 3HE7B 3NPSB 2VN4A 3NABL 4Z7NF 3TEUA 4Y8AA 1UWXK 4E42B 4F80A 1RJYB 1JNNH 4DZBB 3WBDA 3W0WD 4HH9A 3WFHB 4YHPA 3EOAB 3VI3F 2F9BT 3CPLB 3LQMA 4MJ6A 1ZANH 4K7PX 4ZUTB 3FHQA 5FGBC 1IGTB 2IH3A 1CG9A 1GIGH 2P8PA 3ARBB 2YPLE 2BFVL 1C5DB 4L9LA 3OL2A 1EEZB 4G3YL 3CDFA 1HKLH 2BY2A 1BREA 4QXUH 4YUEH 4YXKL 1KLGB 3GJEB 3FQXB 3CDGA 2B4CC 3C8DA 3RWCA 4HBCL 1HYSC 1SYSB 5F97E 2C3WA 4QLRA 4J2XA 4DKDC 4X99A 2NW2A 1UH4A 3H7LA 4HS8H 3WS3A 4IJ3B 2R2EB 4KPHH 1N3NA 4X6EB 3B9KC 3TJHD 3H9HB 5E0QA 1AC6A 2COQA 5DHYB 4N5UA 1IGCH 4HIIB 4M8VA 1CFVH 1M1SA 1YNLL 4WHDA 4LHJB 3VWKD 4P46A 5E1HB 4A6YA 5I9QC 1YMHB 3BO8B 3ULUD 3O6FD 4OFYD 3FO2B 3P0GB 2OL3H 2ARJA 4FXGB 3GMMA 3FT4B 5I74C 4U6HB 2FHFA 3BZDA 1MCSA 2NY2B 1NMCB 3QPXL 4HZLA 1EPFA 3NCMA 1I8LA 4OM0L 3MRNA 4LSUL 3Q5OA 5GPRA 5CLTA 3WXWH 5CEYB 3QNXB 1WCBA 1CXKA 1FNEB 4ZO7A 3CFCH 3OR7A 4WEBH 1TVHA 3FB8A 1KLUA 2VUOA 1M4KA 5F9WB 4M62L 1DQLL 2BY1A 4KJPC 3RTQB 1TQCB 1XF5A 1MHEB 3GNML 3HZKA 3VFMB 1J0HA 4I0PB 3QG6A 5C6WH 4JRWA 1J1PH 1U8IA 1NDGB 1XEDA 4M8QB 4AQ1B 4Y1AD 5HGDA 1AQKL 3VFUA 1IEBA 4LLDA 3NGBB 1MAKA 2PCPB 4OIAA 1QRNE 4UV7H 3EDEA 4GMTH 5KZCB 4PJEF 3W5NA 4XMPH 4BSVA 3LH2H 4MQTB 4YDLC 4XHJD 1CXFA 4LPWA 1TJIH 3BESR 3MUGA 2ZKHH 5DJXB 4HUXB 5DUPL 4ONGL 4YHLL 3JWDH 1MCFA 4NJAH 3HE6A 3QFDB 4CDGC 4NGHH 2CLVB 1ZHNB 5JXAH 2WV3A 3QHZH 4ODTH 4MXVE 1MFEH 3D39E 1JYXA 4CN1A 2AABH 3FB5B 3QDGD 1G7IB 1OOAA 5KS9F 4PJ9A 3HC0B 3B3IB 1F4WL 2WK2A 2IQAB 1IKNA 4NQVB 4X6DF 5DEFA 4KC3B 5ID1B 4S0TD 2IADB 4MNGB 3DUUB 2X4NB 4NC1C 3ROLA 5I15L 2PYEB 5CZXD 4YEEA 3QEGL 4PRPB 3VFRA 1BIIB 3GSOB 4WUUA 3QJFA 3MMEA 2OYPA 2ZUTA 4A6YH 2JKXA 1MCKA 4OBSA 3X3FH 2AV7B 2XWBB 1MHHA 4JCMA 4NWTL 5DXWA 2BVYA 4GXUN 2XYCA 4UU9A 4LKXA 3FQTB 1IGIH 2PXYD 1TVDA 1CI5A 3T0ED 4U0QB 5IUSA 1BAFH 3QUXC 4Y5VB 5EC2A 5C0BB 1FYTA 3EKCA 4OGXL 4XP9L 5JQ6H 1CS6A 2DJ4A 3DGCR 4LLWA 5JMOC 3SDDA 4YC2B 2R0LL 2XG4A 1ORSB 3B5TA 1G6RH 3B9AA 1BPVA 4I18C 5F1KC 4NN7C 2YN5A 1WZKA 3HCVB 1JNHB 2F15A 2CKNA 1EHNA 4PGZA 3EO0A 1UYWL 2VLKA 3IU4L 1HIML 1CFSB 1BBDL 4K71B 2MHAB 4BQ8A 1A9EA 5F9OL 4DK3A 4JFXA 1S9WB 4LCCA 1DFBH 1KG0B 1KC5H 2XZAL 3DX7B 1KT2A 4HK0A 1TJHH 3K8KA 5C86A 5HDQL 4JM4L 4M7ZB 3KLAB 1U8JB 1XCQB 1BVLB 4IMLA 1R5VA 2J8HA 2E9BA 3GSWB 3MJ8B 3OBAA 3QDMA 3HUJE 3SDAC 3ARVA 4EI5A 5L8KB 2C26A 2HMID 4R4BA 4D9LL 4YBLB 4GQ9L 5JUEL 1U8LB 4UT9L 1MFCH 2H32B 3J8F7 1JYWA 1B2WH 1J5OH 2FX7H 3HNVL 3MFGB 2FYYB 1T1WA 4M9OA 2R1WB 2Z4QB 4NUJA 1RHHB 5TF0A 1MELA 1HHJB 3FONA 4QHKI 1D6VL 2BNRB 5IWLA 3RA7L 3BVNA 2LU4A 1GXEA 1RZKC 3SJVA 5TDPB 2HWZL 4A2MA 1MEXL 2G2RB 4UILL 2EE6A 2CRMA 4HBQA 3Q6GH 1AHWA 3FFDB 3VW3H 1UM6L 1CD9B 2AXJA 1CBVH 5IVXF 4HIHB 5E2TL 4QRSB 1XAUA 4OTXH 4XPFL 3L3OA 5HVFB 4JG0H 2A6KB 1EFQA 4RGNE 1L9MA 4NKOB 4DQOL 4H88L 2FD6H 2FATL 2IH1A 3D2UB 2H9GA 3WFCL 4NC2B 1TTFA 2H3NB 4UIKL 2DOCA 1CQYA 3IVKB 5J9PB 2F58H 4F7PB 5J1AA 2EICA 2E27L 5IMMA 2M26A 2EDKA 1FO0B 1U8KA 3NFSL 1UJ3B 4RAVB 4O2CB 1XR8B 4ZOEA 2YEZB 4HLZG 2FIRT 5BV7H 3M1BB 1WV7T 1M7DB 2R1YA 3MGTB 4XC3L 5DHVA 1MQKL 1CZ8H 4WWKC 4Q9RH 3GM8A 4OCMC 5CZVL 2DLIA 2GK0B 3PP4H 1FAIH 3IKCB 1UWGL 3ARED 2DQIH 1LHZA 2EDFA 1YEFH 4TUOA 2VLME 1MSPA 3QWQB 4R4ND 1C16A 2F8XC 3H8NA 1CICC 1DDHB 3CMGA 4P5MA 5J56B 4G8FA 5J12C 4JFFD 4JLRA 1JUFB 5FUZL 4OUOA 1Q9WA 2R4RL 4QXGL 3NFNB 3WS6A 1AGFA 5SV3A 4X5WB 1J05A 4LCIL 4LSPH 3CC5B 4F3FA 3V79C 1LNUA 2F8VA 1N2RA 2CDFB 2AJYL 3KPQA 3U4BL 3VD7A 2A83A 4X8JA 4XNQB 3OSKA 5DF0A 5J57B 2Z31B 4YDKL 3SCMB 1KEGH 4JANA 5AWNH 3OKDA 2W60A 1S9XB 2B4CH 5F3BA 5CCKH 1YZZA 3C60D 5LAXA 5D1ZA 2DI7A 3QQ4B 1UM4L 4WW1A 4EN3D 3GSUB 2OXHA 4D0CB 3UYRL 3KPRD 5ISZB 2FEDD 4PRAA 2F53E 4KK8D 3ZTNL 1RIVH 5TQ0H 1NBQA 4Q74A 3GHBH 1ZOXA 4ODUB 3BGFB 3REVB 3WFDL 4MVBC 1I85A 3C5SB 3TBTA 4W4NA 1V7NH 2RFXB 4ZFZA 1UA6H 1JNNL 1HHKB 2YHGA 3PABA 4KGLA 5IM7B 1H0DB 3FT2A 1FVCB 5BRZE 4QWWD 3LKSB 1ZANL 1TZIA 2EXWC 1GIGL 3E0GA 4Y5XC 3G5VB 1R6VA 2GITA 2W0FA 2XFXA 3C5ZA 4M7LL 4QXUL 4YUEL 2XZZA 4UNVA 3RL2A 4N0CD 3U30B 2WQRA 5DHVH 5GZOC 2HG5B 2WANA 3H3PH 1YN6A 4YFLF 4HS8L 2VQ1A 4LRNH 4KPHL 2AEPH 5EOTA 5BW7C 5A3ID 4EXPX 2XPGA 3BEVB 2NX5A 3CVIH 5BOZG 1FL5B 4ODWA 1IGCL 4J4PC 2E7CA 1CFVL 4WI4A 2XQBH 1FVDA 4J3OC 4X8XA 5HPMB 3T1FA 3OQ3B 1MCIA 1Q9LB 5BJTB 1D6EA 4L8DA 2OL3L 2VSCA 3JV5A 2AXGA 2KZWA 4P46D 3FAWA 4BJLA 1R3JB 2AJSH 2R69H 4LVEA 3RWDA 4G8EB 3IRPX 2XNAB 5F44A 3IDNB 1LK2A 3NCCB 43CAA 4DAGH 3MJ7A 3RPIB 3CFCL 4NKIH 4MD5A 4NO3B 4NQDB 5DDHB 4MAYA 2A38A 2NY1D 2DWDA 1WJ3A 1DL7H 1LO5B 3P9MA 5DMGC 5E56A 2EEDA 3HPJA 3TBSA 1S5IH 2R9HC 1CIUA 4OJFH 4QXTA 4FQQA 4Q6IC 1J1PL 1SEBB 1INQB 4ZO8A 1YMMB 1MLCA 4BUGA 2JELH 3MYJA 4F2MB 1W0VA 2FWOA 2OSLA 3DURA 2QADC 3QIUC 4YWGH 4JDVB 2MKWA 4UV7L 3OKEB 4GMTL 5E5MA 4NUGH 4XMPL 1AGEA 1J8HB 4P5KB 1B4RA 3LH2L 2UUDH 1ZT7B 5IVZB 1TJIL 1FNAA 4R7NB 1U3HC 1YJDH 3LRGA 5J13C 3JWDL 4NJAL 4M1DH 1ZHLB 1NGPL 5I73B 1J1XH 1FV1A 4NGHL 3SBWC 3F8UB 1F58H 5ERWA 5JXAL 1EV2E 4PG9A 3QHZL 1J11A 4AEHL 3HE6D 4ODTL 1MFEL 1IM3B 1NSNL 4CADB 1UB5A 4HGKC 5FGRA 3PV6A 2AABL 4NZTH 4R97C 3QFJB 4HXAH 5DC9B 3P77A 2CO7B 4LEOA 4RGNC 3ZKNC 2GCYA 4OCRH 3F12B 5IVNA 3FMGH 4PJ9D 1A6ZA 3QHFL 3K2UH 3GGWB 3FN9A 4GKSA 1S5HA 5IFJA 3L1OL 4PJFB 4Z76A 3CCHB 3U82B 1G9NH 4A6YL 1OVZA 5FYJH 1W72B 5SX5H 2H8PB 3X3FL 1S7WB 3IFLH 3QZWB 4DVBA 4KZDH 4APQA 4WUUD 2D9CA 2VMFA 1IGIL 2P4AB 1MCOH 4U6XA 4HKBB 5E2JA 1SQ2N 2ZPKL 3EYVB 2OQJA 5CHNB 4M6OH 4OZIE 4PJGB 5EFIB 3RNKB 3RQ3A 2XXCB 3O4LE 3MXWH 2HFEB 1UVQB 3BP6A 1FYTD 3ZDXE 4W6YB 1I8KA 1WC7B 5L7XH 3BISA 4P2OC 3DMMA 5CEXA 3BXNA 4PTUB 3SDDD 2AKRB 4G43A 3HE7A 4NCC2 4OZGA 5ANMB 4ONFH 4NHUA 5HHNB 3G5YA 1YEDB 3ZYOA 1RJYA 1T0PB 3K1KC 1UGNA 3KPMB 5DTFB 4DZBA 4NQCB 2VLKD 5E2VL 4LRIC 3WFHA 2OMNA 1DFBL 1CDHA 3EOAA 1KC5L 4TVPH 4Z7UB 1JZ4A 1TJHL 4MCZB 2B5IC 5K9OB 2P5WE 5HSFA 1IGTA 3GSQA 3A6BH 1S7SB 1SEQH 2C3GA 3CSPA 1RZJC 5GGVH 4WI6A 3GJFB 3L95B 2CKBB 3FQNB 2BSRA 1KLGA 3GJEA 2ZSWB 3FQXA 4JFZH 1CU4H 3EO9H 3K0WA 1ZKAA 3WO4B 4J3UA 3QDMD 4GBXD 1TVBA 2APBA 3AAZB 1MFCL 4EI5D 1KJ2B 1JCKA 1B2WL 1J5OL 2FX7L 2R2EA 4X6EA 1I1AA 2LVEA 3I6KB 5FOBB 5DHYA 3NH7H 4YZFF 4XCCL 4HIIA 2YD3A 3GSVB 1NKRA 4XB7A 4R90L 4NO0B 1NJ9B 2J3SA 2NY3B 1FIGL 4QHMB 2EECA 3FO2A 3LPGA 3E6HB 4JN2B 1PBYA 1NPUA 3Q6GL 2JK5B 3FT4A 1RFDH 3KPLA 1V3KA 3SJVD 2GW5A 1R24B 5MHSD 3VW3L 3BQUC 4MMXC 25C8H 2IC2A 1CBVL 5FUOH 5CEYA 3QNXA 3EDKA 4OTXL 4PJDE 4R0LC 1FNEA 2CRIA 4JG0L 3SKNA 1Q38A 5GGUB 2AK4A 1IC7H 2FD6L 1FAKT 5DS8B 3HZYB 2VLRA 1MWAB 3RTQA 4N90E 2D7QA 1MHEA 5DD0H 4I0PA 2HFFB 1M7IB 3QEQE 1NDGA 4HJJH 3MX0A 1GOHA 4LF3A 4M8QA 2P24B 2O5YH 3REWA 4QRTB 1E4KA 2VC2L 4IRSC 5KSVB 5BV7L 5DRNA 5JW4R 3SDXB 2GI7A 1LWRA 2A1WH 1CZ8L 2Z91B 1NFDE 2VZOA 3PP4L 1FAIL 3CX2A 4U1GC 4LDOB 4K8RH 1INEH 3NAAH 2DQIL 3V5DA 2MJWA 1YEFL 4U0RC 4P2QB 1WFOA 5DJXA 4JQIL 1WIOA 1FNFA 3QFDA 2P48B 5C0CE 3ZYIA 4F37F 2J4WH 4CN4A 4RQQB 4J23A 2DL9A 1FZKA 4L4TA 4LGPB 4C55A 1PY9A 4KWUA 2EO9A 5GRWA 4ORGB 4LL9A 2X4OB 5HVHC 1HE7A 2X2YA 5IB5B 3AGVA 5H2BB 1G7IA 4LSPL 5T3XE 2XZCH 2D0GA 3HC0A 3B3IA 4GLRI 3TLRA 1X5IA 5MEQA 3OAYK 3SKMA 1W8OA 2ICCA 2HLAA 4NQVA 1KEGL 4LVOB 5ID1A 2B4CL 2IADA 4MNGA 3DUUA 2F74B 2WWMD 3KHQA 2X4NA 4X4ME 5CCKL 3S88H 3LV3B 2PYEA 3GIZH 3O8XC 1KENL 3KYMB 3L7EB 4PRPA 1BIIA 3GSOA 3QXDB 4LLYB 2HTLD 3S3JA 5T1LB 5D1ZD 2AV7A 2XWBA 1RIVL 2BNQE 3GHBL 5IHUL 3RZCB 4GW5A 4EIZC 2YD1A 1OGTB 1ZHBA 2AGJL 2CQVA 3GSNB 4Y5VA 3V0VB 1BHGA 1IAOA 1FLRH 3CUPA 2ED8A 5C0BA 3AXLB 1TTGA 2VDRH 1V7NL 1UA6L 3U36B 5L9DH 4XNMB 2EC9T 3DRTB 2VN7A 3DECA 4FXKB 5DFTA 5DFVD 1XIWA 4XXCC 3D18B 4LDLB 4PY8I 5ALBH 1K4CB 5LBSL 5I76B 1LO2L 2EDRA 1JNHA 2VXTH 4GKZA 5F88A 1JNLL 1QFHA 4GG6B 3HR5B 2IPUG 4P2OA 3KPSA 1CFSA 2W38A 4XMLH 2NZ9C 2MHAA 1A7RH 2X42A 3RAJL 4URTB 2HTKC 1K8DA 2J12B 3C5ZD 1KG0A 3H3PL 3RUGB 5ESAB 2AEPL 1KJMB 4FTVB 2JJTA 1XCQA 4LRIA 4XTRC 4B5EA 3CVIL 2ESVB 1N59B 4NRZB 4NN5C 5T1KB 3GSWA 5GZND 2XQBL 3O3BB 5H37G 2P46B 3LKRB 3ZHKA 1QFWH 2NX5D 3ARZA 4PGCA 4I48B 5EUKB 3ULVE 1U8LA 2BHUA 5FYJD 1PZ5A 2H32A 4Y19E 2R69L 2J88H 4O4YL 3RY6C 2FYYA 4W4OC 4X83A 2R1WA 4DAGL 2Z4QA 1ZLSH 3AS1A 3STZB 1DL7L 5J3HD 2Z93B 4LQ1A 5TDPA 1S5IL 4OF8A 1S9VB 4OJFL 2ADFH 4MAYD 3RP1A 1T66D 2VL5B 3ZTJH 2VLLB 3FFDA 2MOVA 3AC0A 2JELL 1AJ7H 2DM3A 1FPTH 4QRSA 4ELKB 1U2HA 1A9BB 1HDMA 4YWGL 1FFNB 3OKNB 4QTIL 4WGWB 1OAXL 4NKOA 4KUCF 4NUGL 1I1CA 1CT8B 1JF1B 1TETH 1BQUA 3D2UA 4H8WC 5D5MB 2H3NA 1YN7B 5GGSY 4ZQKB 4J1UB 3HAEG 1YJDL 2ERJB 4CJ0A 4TVPD 3HKFA 5DJDB 4F7PA 4NN7B 1FO0A 1J1XL 1GGBH 4F57H 4O2CA 1XR8A 1F58L 2YEZA 3P4NB 4U6YB 4AH2B 2BHZA 1BFOA 3S3SA 2C1OB 1M7DA 3MGTA 5HYSB 2GK0A 3N1PC 5D1XC 4NZTL 3IKCA 2JF1A 2NY6C 2Y25A 4HXAL 4XT1C 4OCRL 3OTTA 1Q94A 2D7PA 3FMGL 1OGAB 4D9RE 5DYOB 4HPYH 5C08D 1XGTB 1DDHA 3K2UL 4KUCD 4Z18A 3RVTD 4PRIE 1JUFA 3AM8A 1JRHH 1M7XA 3KJ6H 3P9LB 1U8QA 2HT2C 4L8SC 3NFNA 4LPXA 1FL6B 1G9NL 1GZPB 4P5TC 4X5WA 5GRVK 4OZGF 1PD6A 1Z9LA 1CVSC 2YA1A 1KPRB 3RWEA 5FM8A 1UADC 3IFLL 4KZDL 2CDFA 5EZLA 1KIRB 2BY0A 3P3YA 4XNQA 2EDLA 2Z31A 4EBQL 4LSTL 1T2JA 3ZDZE 1WBYA 2H32H 4G6KH 2R1XB 1S9XA 3GSXA 1MCOL 5JPNB 4APQD 5AG9A 4ZODA 3GFUA 2C3XA 4M6OL 2F5BH 3MRBB 3ZO0A 3MXWL 1U3ZA 1RUKH 3GSUA 4D0CA 3ZE1E 4KK5C 2R0ZH 4OFPA 4DCQB 3GMLB 3RX8A 3RY5A 2R0WH 5E2WH 5MEOB 1X4YA 1P4IH 4C54A 2ZUYA 5ID0B 1EAJA 4ODUA 5D6CA 3GRWA 5DA0B 1RZKL 4ONFL 3MRCB 3REVA 4LVNC 3VGAB 1KJVB 2EIEA 4WFEE 3DMMD 3H9ZA 4O51B 4OZ4B 2WBWB 3HC4H 1K3IA 5I2IA 3FRUB 3C5SA 5A1AA 1MJJB 4I5BB 3HE7D 4QTHB 1P2CA 5GJTH 2IBZY 1H0DA 2OLDA 3QEHB 1FVCA 4KUZH 4TVPL 3VXRE 3LKSA 1UB6B 1DN0B 5L0QB 3A6BL 5T5NF 3KJ4B 1SEQL 4JY6B 5ETUA 1KB9K 2N7AA 2PO6C 2GTZB 4KAQH 5GGVL 1FO0H 3DSFL 2JCCE 2AXFA 5IB2B 5KANI 1EXUB 1CU4L 3EO9L 4P49A 4C4KT 2GJZB 3V6OE 3BJLA 4FMFA 2EC8A 1W8NA 3VWJC 2GSGA 1CICB 2CO6B 3WJJC 3BEVA 1VFUA 1L7IH 3H3BC 4P23B 1FFPB 3PQYE 3TO4B 5HPMA 5IHZB 1H9VA 1Q9LA 5BJTA 5D7JC 1G7PB 5IT2H 5ICZA 2P42B 3MXVH 1PLGH 4Y5YB 4JREC 1RFDL 1R3JA 2CRYA 2EO1A 3EJZC 1A4KA 4U1JB 25C8L 1YUHA 5FUOL 3RVUD 2ICES 2GEEA 3AFLA 3MLSH 5GGRY 1Y18B 2NY2D 1J18A 3RPIA 4IM8A 5DDHA 4OCWH 1IC7L 1MIMH 1OD9A 4QRRE 3T8XB 2PW1B 4XNZC 4ODBD 4W4OA 3U4EB 32C2A 4ONHB 2ITCA 2AK4D 3D39B 4ZSOE 4CN6A 4RMSA 4JZOB 5DD0L 4NDMA 2VLRD 3C9NB 4JFHE 4KRMB 1SEBA 4HJJL 1J87A 3RTQD 3I6LE 1INQA 3C6SB 4K7PY 2O5YL 5C07E 3K8LA 3I2CH 5CINL 4F2MA 3ULVC 4PJAE 1CD8A 3UJJL 4UQ3B 4I0PD 3VRIB 5D2NE 4OF6A 3GRWH 5IHLB 2HT3C 4PJ7A 4P5KA 4XVUC 4K8RL 1INEL 1ZT7A 3B2VH 1QLRB 1WQVT 5IVZA 3BWAB 5BZWB 3V4PH 5KZCD 1F6AB 4HG4K 4OZHE 3TF7C 4EUPG 4JQVC 1RK1A 2P44B 2DQGH 2VRAA 3JTTB 2J4WL 4KKAC 3L5JA 1DE4B 5D7IB 3GM0A 1JPFB 1OW0A 4OGYH 1WTLA 4CADA 3BYYA 3O9WC 3ARSA 4NCDA 2EE3A 3ZL4L 2D7MA 5HHXH 4MZ2A 1JGUH 4MQ7B 5ITFB 1FVEB 4POZC 4KKCD 2IJ0C 1WITA 4CL7A 1I3VA 2D0FA 4FZ8L 3L3JA 3GGWA 3PHQB 3S88L 4MDIB 3BN9D 4KDWA 3GIZL 1JWMB 5FUCE 1EAPB 5FM4A 1T21B 3RDTB 4PJFA 5JHDE 3CCHA 3OKMB 3QI9C 1UKSA 1MY7A 2PYED 3HI5L 4HFUH 4BQCA 1CE6B 4X6CB 2H2SD 4WHTA 4PRPD 3HZMB 1T6WA 5DQ9A 1S78C 4P5TA 3S4SG 1BOGB 4HKBA 4F15C 2D31B 2VERN 5I18H 1FLRL 4CW1B 2VDRL 3EYVA 5HYQB 2XWTB 5L9DL 4S2SA 4OLVL 4PJGA 5EFIA 4B0MM 4XAKD 1ONQB 2HFEA 1UVQA 4N8CL 5C0BD 2GQHA 1G9MH 5ALBL 3FO1A 1WC7A 1NGWB 1U58B 1IMHC 4XRCB 4MA8H 3RGVA 3EOYG 2AKRA 5K9JH 4FRWA 2EDQA 4JGMA 1XIWD 5ANMA 5LGHH 4I3GA 2X1WL 5F1IA 1YECL 1ZWIB 5DRXB 2DTMH 1YEDA 2EDNA 4XMLL 2FGZA 2QQQA 3KPMA 4NQCA 3GBMH 1HH6B 3KPSD 1ZMYA 4Z7UA 5J13B 4RMUA 3V5KB 1F90H 3PGFH 1PQZB 1AO7E 3P0YH 2Z8WC 1UZ8B 3UTTB 3F7YB 2FBJH 5IMKA 1TQBB 5CEZE 1A7NH 3QXTA 5JOPD 1QFWL 5IB3A 3FQNA 3QULB 3QBTB 3SDCB 4EOWL 1ZVSB 4MJ5B 1XGRB 4RGNB 5E94B 3WO3B 1L6XA 2VDKH 1HK6A 2J88L 2WBJB 4PJBE 3I6KA 2NY0C 4KH2A 4KJWC 5FOBA 3RHWF 1ZLSL 3V8CA 4N9GB 4F7CA 1CLYH 3GSVA 4RAUA 3QR2A 3UROR 4NO0A 4QHMA 3BWUC 1UCBH 2C4FT 4JN2A 3E6HA 2ADFL 2BNRD 5K9QI 2JK5A 3H9SE 3AVEA 1YEKH 4YNYB 5C0JA 1R24A 1I3UA 4EZMA 1AJ7L 2VZUA 1EGJL 3V6OC 1DQDH 4M3KB 5C8JB 4Y4KC 3T0BA 5L2KE 4XPTH 5GGUA 3PWJB 1A6WL 3QDJE 4ZOCA 5DS8A 3HZYA 3NIFE 3FQUB 3DHJA 1TETL 3LDBC 4Z95L 1XZ0B 1O5DT 3DUSB 3FAXA 4KKLC 4TNVK 1WAAA 1P7KA 2HFFA 3QCTH 3D2UD 3TZVC 5SWSB 1F13A 1OD7A 2P24A 4QRTA 4JFQA 4LNRB 4NSKB 3Q0HA 1QVOB 5KSVA 1NANI 4OGAC 2Z91A 4HT1L 1TCRB 3TWCH 1NBZB 5B8CC 4P2RE 2NTFB 3PWPE 1T2XA 3ZE2E 3GMQB 1QYGH 2AERT 3L3DB 3NVQA 1A5FL 4WFFE 3GB7A 4HPYL 1X5KA 3FL7A 2EKSB 3G6JB 3BEWB 4JKWA 1GGUA 4PRHE 5AYUL 2F53B 2VZTA 3UTSB 5IQ9B 1JRHL 1Z2KA 3HI6L 3KJ6L 4WV1C 3VGEA 4ORGA 2X4OA 1HHHB 5IB5A 2VR5A 2NY4C 5DVKA 5D2NC 5HBBA 1CXEA 3MRIB 3OKKB 3K81A 2HP4A 2C3VB 5BRZB 3MJ6A 3EYQD 1MREH 2F74A 5CP7B 3FRPA 2K7PA 3LV3A 4KTEH 4CBPA 2Z31D 3B8YA 3GHEH 1IFHH 5F3HB 2F5BL 2YD4A 1PKQE 3KYMA 5DJ2B 3UBXG 1ULVA 3MBEB 4TTDD 2V7HB 2F5AL 1NEUA 2A0LC 3ALPA 3QXDA 5T3ZD 4LLYA 1RUKL 5IBUG 2R0ZL 2R0WL 1TTUA 1P4IL 1JTOA 1JFQH 4XCYA 5F7LB 3CFKA 3DO7A 3RZCA 1GHFH 1WWCA 5E95B 3Q3GB 2Q3ZA 4S0SD 4HIJB 2VO5A 3HC4L 4FQXC 1A14H 1X5JA 3N1GC 1KELH 4YGAB 2RQ8A 1J12A 3U36A 1OTTC 1GSMA 4XNMA 5GJTL 3TCXA 1A0QL 1LO0L 2L0DA 3DXAB 4ELMB 4FXKA 5DJ6A 3D18A 4PGEB 3HI1A 3BPOC 2ILLA 2ATPB 1EFXB 1K4CA 5FUCC 2I07B 5TFSH 3QT2A 4KAQL 5EOCJ 3OWEA 2Y1VA 1FO0L 4GG6A 4X6BA 5EBMB 3GEWB 5I1HH 3TA3B 3TYFB 1ZLWH 3VXTA 4BFIA 4NZRH 4AENB 1MI5A 5CGTA 5ENWA 5IR1A 1OAKL 4U0RB 4PJ8C 4H5SA 2MQ0A 4NZUH 1UH3A 5ESAA 3ZKMD 5GSRB 1KJMA 1PX3A 6CGTA 1GGCH 2M8XA 4LIQE 4ZD3H 2OCFD 1L7IL 2FO4B 4NRZA 5T1KA 1Q9OB 3O3BA 3IB4A 1GC1H 1E0OB 4LDEB 2K9UA 3O3AB 5IT2L 1KJ3H 3L5XH 3QWRA 4I9WD 5EUKA 3MXVL 1PLGL 3QNYB 4P57B 3VXSE 1OT2A 2PYFB 1WUNT 1KNOB 2KH2B 4PJ7F 2KQMA 5DWUH 3TBWA 3MLSL 1NMAL 4PGDA 3ALWA 5IJKC 4LCYB 4WFGD 2DDQH 3O8XB 4OCWL 3STZA 1WLHA 2DM4A 4WU7B 4HUWB 2I24N 2A9MH 3FO0H 4KROB 4HKXA 3T4AA 1CDJA 2V2XB 3FTGB 5DRWB 2CDEB 1MCBA 1OCWH 4PV9B 1S9VA 1ZLVH 3WHXA 1DEDA 3PIQB 1T5WB 2VL5A 3UO1H 1BD2B 5CIPA 3I2CL 3ZMRA 4OCSH 1E4JA 4OFVA 4NYLB 3VI4F 4ELKA 3NA4A 1FFNA 3VU2A 3OKNA 4LPUA 3UX9B 2W9EH 3GRWL 4M1CC 4FA8A 1R3IH 3VRLE 1GZQB 1JK8B 1HXYA 4XCNA 3P11H 1CT8A 1C7TA 3B2VL 3QIWC 4NN6C 4Y4KA 5KAQG 3G08B 1QOKA 3PL6C 5L8JB 1S8DB 2ADJB 4ZQKA 1NBYB 4J1UA 3JUYA 1BX2B 5DJDA 5FV1L 4MA3B 2DQGL 3FB7B 4X4ZA 4QRUB 1D5MB 2F54E 2N7BA 4U6YA 3C8HA 3ZDYF 4QRPE 4TSCL 4AH2A 4RMTA 4OGYL 2C1OA 1CDGA 2VDQH 5HYSA 1KTDA 5FDWB 5D96B 2BERA 5I71C 4OIIL 3R06B 2B7DT 5HHXL 2FHBA 1JGUL 1WWAX 4ZPVB 5SWZB 5GGSA 3MV8B 1OGAA 3O4LB 5DYOA 5B8CA 3QFJD 4PJGF 1XGTA 3DRQB 1LEKB 2K7QA 4N0UE 3BP5A 3EJYC 3D25A 3PHSA 3E1F1 4WI7A 3V6ZB 3QA3B 4WFHE 4Z7QE 3LEXB 2CIKB 2E6QA 4HX1B 5F6HJ 2P5EB 1KPRA 3KS0J 4HFUL 5CGMA 4JPKH 1NMBH 1OAYL 2ORBH 4JFDB 1XF1A 4QT5A 2R1XA 2UZXB 1PDKA 2XA3A 3M17A 3C8KA 1NFKA 4Z7UF 4MZ3A 1IAKB 4M93B 1OTSC 2ATKA 4YE4H 1KIQB 5JA9A 3CXHJ 1SMOA 3EUUA 1RSFA 1CLOL 4NT6B 1WFNA 2UZIL 4KDVA 3EHBD 4DCQA 2A6DB 5BMFH 2Y6SC 4MA8L 5FHBH 3BJ91 5D7KD 5K9JL 2NCMA 5T5FH 1XT5A 1AR2A 5E4EC 3MV7E 5LGHL 3MRCA 5CIPH 5A2LH 1KJVA 3KYAA 1CDBA 1EEYB 4O51A 4OZ4A 5E8EB 3FRUA 4UB0H 3RGVD 4AIZB 1MJJA 4I5BA 1Q9KB 5DZNA 4LCUB 1TPXC 1CIDA 3CJJA 3GBML 3QEHA 4WDIB 1VB9A 1UB6A 1DN0A 1NFIB 1F90L 3PGFL 3P0YL 4P59H 5D6DA 4NQCD 3FT3B 5JXEC 1HH9B 3MLVH 2GTZA 4V1DE 5ESVB 1WBXB 5E1AB 5FYKE 1A7NL 1BEYH 3MGOB 1DBKH 2DLEA 5IB2A 4D8PB 2X70B 2QLVB 4PJDB 2GJZA 4JKPL 5EPMB 4LLVB 4DGIH 3ZZ1A 4DN3H 2VDKL 2BZDA 2CDGB 3GMNA 5F7YC 3PWLB 4H25A 3ZSTA 3LKNB 1MIEH 3SO3C 3VGFA 4P23A 1CLYL 3QEQB 1WAAF 2XWJB 2GUOB 5IHZA 1J1OH 4ZPTB 4L8SB 3HFMH 1UCBL 2EZ0D 4S1SH 1NGZA 1G7PA 1QSVA 4MWFB 4LHQB 4N8PA 3GSRA 4NO0D 2YD8A 2NXYC 1NFDB 4Y5YA 5INDB 1YEKL 4YDJB 4C56A 2HKHH 2NY3D 5JW5B 4F7MB 5DJYB 4U1JA 3CH8A 2ZUSA 4H1LB 3LY6A 3AB0C 1HILB 1DQDL 5JZ7C 3U6RB 1Y18A 4FQLH 4XPTL 4HMDA 1CGYA 5C0CB 4XP6H 3C09C 4IOIB 3U4EA 1AD9B 4NHCL 4H0HB 4ONHA 1VFOA 1UEMA 5GS1C 2XIDA 5AZ2H 5EO9B 3C9NA 3NCJH 4JJHA 4LNVA 1T4KB 3QCTL 5D71L 1KPVB 3C6SA 4R3SA 4XCEB 5IEHB 1I8MB 2OTUB 4LVNB 1JHKH 4OKDA 4PUBH 1FG9C 4M7KH 3TWCL 2HAZA 3RVWC 4R2GD 1QYGL 1X3DA 3BWAA 5BZWA 4ZNEA 4FN0A 1F6AA 1JJUA 4Z7VE 1N6QL 1RPQA 1T3FB 4MD4B 4N1CA 5J1TC 1DE4A 5D7IA 1HYRC 3I84A 1YEHH 2BNQB 4BQBA 4U7SA 4JDZB 1U8OB 4RX4A 4HFWB 2BVQB 3EDDA 3WSQL 1KCKA 4S1DD 2VNCA 1JV5B 3P4OB 5EU5B 5K9KA 5T1DH 4KGJA 3UTOA 5ITFA 1KPUA 5FIEA 2ICWB 2OTWB 4U3CA 2WQ8A 4OSUL 1MCPH 4KTEL 4MDIA 1JWMA 2DIJA 1IFHL 2LVCA 2WMPA 3RDTA 2YKLH 2ZP0T 4JZJA 2GKIA 3OKMA 1IAIH 2BRRL 3ILQD 4GG6F 1W0WB 3P73B 1CE6A 4X6CA 3MJ9L 2ITDB 2B0SH