3BN9D

Crystal structure of mt-sp1 in complex with fab inhibitor e2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
211
Chain Sequence
QVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARPYLTYPQRRGPQNVSPFDNWGQGTMVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Membrane-type serine protease 1
total genus 35
structure length 211
sequence length 229
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D01
2ZWLT 3NPSB 1YDPA 3S35X 5E8PB 1LP9E 4GKSB 5HGDA 3F6IA 3IDNB 3BP6A 3UX9B 1Z3GL 3QIBA 4P4KD 2XACC 3MUGA 4RIRB 2HJLA 4AIOA 2VDMH 3SHSA 1CDGA 2NW3A 3QHZL 3LIZH 4EUPH 5B8CB 2GT9A 1B0GA 4NCC1 1N2RB 5FKAA 5E8NB 5E03A 4E41E 5DEGB 1MWAH 4ZDHB 5CZXD 1NCCH 1JPST 3N1QC 3WKML 4ACPA 1HHHA 3BKMH 1SY6A 3L7EA 3LKRB 2CRYA 3EYQC 3PXJA 4NQCB 3TBVB 2ZZUT 2WLZA 2W59A 3ES6B 5HHNA 4QHUA 4YFLF 4KMQA 3W81A 1C1EH 4FQXB 3ULUF 3RWIB 1Z9OA 3QPXL 2AABL 2BVOB 4XHJC 5IHLB 4G80B 3DRTB 3LY6A 4JFFE 5TH2B 3NTCL 1JZ2A 5CJQL 2AV1A 3RAJL 1IKNC 1HILB 3ZDXE 1H8NA 4JM2C 1F97A 5F89A 2GK0B 4QOKA 2XPGB 5TJWK 1A4KB 2YSSB 1YN7A 2OJZL 3MRPB 4G6AD 1PLGL 1FL5A 2JJTA 5FA4A 1NGQH 3PGCA 5ISZA 5D1XA 1RZIA 3V4PH 4V2CB 3VGAB 5FYJH 4KY1L 4RDQG 4LLVB 1QFWM 1C5CH 4X5WA 2BY3A 1Q9KA 4N8VB 4LBEB 5CIPB 3BDXA 4MJ6A 2DM7A 4NRYA 3V0VA 4U1LB 4M5YH 2EDWA 5EA0H 2J1KA 4UINL 1Q9OA 5L8JB 1I9JL 4QRSA 3T0EA 3DJ9A 2LTQB 2FJFB 4K3EH 4X9GA 1F2QA 3PE9A 1ADQL 1Q1JL 1BFOB 3ZTJG 2GJ6E 2W65B 3T1FA 5T1LA 1DLHB 4JDVB 5EORH 15C8L 5ERWA 4KK5C 4P59L 3FRPG 3MLSL 4Z7VF 3BP4A 3QA3A 4P4RB 5I8KL 4IMKC 2OL3A 3SKNB 3T2PA 5GRWA 2VXUL 4HG4K 2R1XA 5FECA 1TQCC 1F90L 2BP3A 5D7LB 5E1AB 1KPRA 2SEBB 4K3DL 3BH9A 4G3YL 1I8MB 3OKOB 3FB6B 1ULVA 4G43A 1NAMB 4PJ9D 4YXLH 1G9NL 4J3VA 4W70A 1U8LA 5JIKA 5B39B 3E6FA 4WW1B 5KS9A 4G8FB 4KI5D 3WFCL 3LS4H 4PRDA 4NOBA 4PJHA 4DN4H 2CKNA 3DV4A 3ECBA 4R97B 2R0KL 2A9MH 1YJDC 2ZUTA 2W0FA 3P9WB 1IGCH 3JWDL 2OQJA 3L9RB 5BMFL 1TQBC 1U42A 3V0WH 1I1AC 4JFHD 5IB2B 3GSQA 4Y0GA 2CO7B 2GSIB 4ZAKC 3TLRA 5EBWA 3MRFA 3TH4T 4M7ZC 3QCVH 4CN6A 2JB5L 2GY5A 1IMHC 8FABB 3U1SL 3N1GC 1U93B 5A16A 4X6BB 1A7RL 4B53A 2NY0C 3HNTL 3UP1A 4OGYL 2A2QT 4G9DA 3JVGC 1QBLL 1CFSB 3GJFH 4XC1H 3V52H 5LVEA 5J13B 4J12A 3LZFL 2Z31A 3VFMB 3QEHA 4PJ7F 2HWZH 4WW2F 3DBXA 3PWLA 4FTVB 5GGTL 4KTEH 2X70A 1T7XA 3PHOA 5E0QA 1KTKE 3MLTA 1X7QA 2WW8A 5F21B 3RWCA 5I71C 2LU7A 4R90H 2NLJB 5J3HC 1NGYB 1AR2A 3O2VH 3SDCB 3JV5A 5DJCA 1JGDA 4G8GE 4XPFL 5D2NB 1WAAA 5EBLA 2IFFH 4ZTPL 1D5MB 1H3UA 3M1BA 2OMNA 4WENB 1A6VL 4I18C 5DRXA 3MRIB 2DM2A 4GXVH 1FVDB 5EUOB 2QADC 5FCUL 5C0IA 3UYRL 1IGFL 2AEQL 5L2KA 2BNQB 4E0RB 4ZXBA 4QLRA 4NQDD 3C5ZD 4XGZB 3EYSL 5C0AA 3OTTA 4O5LH 4NQDE 5DK0B 1JHTB 3RBGA 5FEBA 1HSAA 4ZD3H 4G9FD 5F93C 2W9LA 1TTUA 5FO7B 1PBYA 2HT3D 4U2ZA 1XF4A 2AXFA 2APTA 4HMEA 2Y1VA 3VFWB 2WBKA 5FUZH 1WFUA 4QXGL 4P3DB 1Z2KA 5CD5D 2FB4H 3QP3A 3BMVA 4PJDE 3OXSB 3K4DA 4CW1A 5IWLC 4AENB 1Z5LB 1K6QH 3BP4B 1A7QL 4NQDA 5BJTB 1DVFB 2EO9A 3HAEH 4XH2A 4OQTL 1MREL 4JREB 3G6DL 2RB8A 5D6CB 4BZYA 5E5MA 1W72A 1QZ1A 3HAEA 5DD5H 1U36A 5LQBL 1SJEA 2X4SA 1T83A 1T2QH 5HVHC 2E9JA 2FJFA 4TSAH 4NO2B 4K9EC 2BOBA 4OZIA 4MSWA 1L6ZA 5C08E 3P2TA 1IC4L 4Q9RH 1UCBH 5TQ0L 4CVWA 1L9MA 3B2UC 4QY8B 4GKZB 5I73C 1S7UA 5CLTA 1W0WB 4CMHB 4JN2B 3PG2A 4GG8A 4PJXB 5FB8B 2VDPL 2XG4A 3TJHD 4Q0XH 4NIKB 5J8OA 3RY6A 3HG1E 4MX7B 4YGAB 1NGPH 3SDDA 2HVKA 4JO2H 2XWBB 1KEGL 1DFBH 4EI6B 5KSAD 4MCZA 2ZOKA 1KPUB 5HYJB 4PV8B 5AEAA 2VDRH 2CUHA 1UWXH 1OB1A 1WZ1H 3MV7E 3VXTA 3MYZA 3H9SD 4FMKA 1JPTH 4KUCF 3CDCA 3DX8B 1LD9A 1YYLL 2ZOLA 2P42B 1EAJA 3LRSB 3EIFA 4JY5L 3SQOL 4CL7A 4JFZL 4X5LA 2VDQL 4PJ9C 1OPGL 3RVVC 1QLEH 1TZIA 2QLVB 1P4BH 1RIUH 6CGTA 4FQLH 3BWAB 2M1KA 5JW4N 4U3CA 3I9GL 3LV3B 1G0YR 2XQYK 2C3VA 3CVHH 4DVRL 3OSKA 4OT1H 2DOCA 5F9DC 5IMLB 4AIZB 4XHQA 5B8CA 3CVHA 3IU3B 3H7BB 3QO1B 5AYUL 1SVCP 2Z93A 2ESVA 5E2VH 5I66A 4Y2DB 4PJIF 1KBGL 1A5FL 2X1XR 5GISL 5FYJE 3NA9L 3CCHA 2ED9A 4J8RA 4U1SB 2VXTH 1FJ1B 3D2UA 1ACZA 4GW1A 4KRNA 3W0WE 1HKFA 4AEHL 3OPZH 3TFKD 4JCLA 1LEGB 4S1RL 1DE4A 4H25A 3OHXA 4AM0A 3IF1B 4ZNEA 4JY6B 3DBXB 3PWLB 5CKGA 1MHCA 3LKOB 3MGAA 5E56A 1U3JA 4PRHE 5LQBH 5L88L 5I1GL 2VLJB 3NCEB 3A6OA 1F58H 4U3XA 4KRPC 4PLJC 4J2XA 1N8ZA 1WCQA 4JO4H 3DSNA 4J1UA 3M45A 4XB7A 2PETA 3DMMB 3DYPA 5KAQF 2A38A 3WDHA 4JFQA 3RUGA 1MLCA 1JWUB 3D9AH 3HI1A 1YECH 3SDCD 4FMFA 4O2FA 4PJFB 3G5VA 4XPGL 4JRXB 5DMIL 5HHMB 4TQEH 2PCPA 1D5IL 5HHOA 1QQDA 4DUVA 3GSWB 2QQNL 1LDPH 2AGJL 5DD3H 1VCAA 4X7FC 1OARL 1UC6A 4MX7A 5FCUH 4Z7OF 1KXTB 1VEMA 1BZ9A 1KLGB 1ZOXA 4NO5B 1QA9A 1UXWA 4WW1A 5KS9B 1GJIA 1KYOK 2CH8A 4QTIL 3GHEL 5DT1L 3PWVA 3FB6A 1WT5C 5CJ8A 1ZVYA 3Q6GH 2Y7QB 2FGWL 5IFJA 2ITDB 3P73B 4MXWL 4TPRH 2VQ1A 1WWWX 2ARWA 2WMPA 3BP5A 3HFMH 5DGRA 4NHCH 1F3DJ 4Y1AB 4M7JH 2EIZB 5JHLL 3TYFB 2CLRB 1I75A 5DC4B 4ZFOB 3BQUC 2WQRA 1FHGA 3QXUA 5SWQA 2BZDA 3SJVE 1CD1A 3VFNA 4BUHA 4EJ1C 4YDJB 4JQVC 5IFAL 3B43A 4OCXH 3OGOE 3GJEA 3H42H 2VABA 2BFVH 3FAWA 3L1OH 3V0VB 3FRUA 4M1DH 3D3VE 4NGHH 5GGRY 3PIQA 2XQBH 4ONFL 4PS4L 1EHNA 4L8CA 3DARA 5FDWA 3QUMB 1TQBB 4QF1A 4KKAD 1CXFA 1DBBH 1KB5H 5DJ0B 1LILA 5C07B 3VXMA 4WFGD 2DTSA 5C0JB 5HI4C 4U7SA 1T1XB 1HNGA 4I0PB 1XGRA 1F4WL 3WO3B 2CXKA 3G6AB 5T33L 1HE7A 1KB5A 4OF6A 3R1GH 1J87A 2YD8A 1V3LA 3AB0B 3A6CL 4L4TB 1DBML 4R9HA 1R3LB 3WFCH 2CGRH 1JZ4A 4XPTH 4MCYB 3E2HC 3BX7C 3S3SA 4UV7H 1TPXC 4Y5YB 4R0LA 4LSVL 4ODUB 5MENB 4YIQA 1MRDH 4D0CA 1VSCA 1I8LC 3QDMB 4BUGA 5GZOD 1QO3A 1DQDH 3MACL 43C9B 2OM5A 1NCAL 2NTFA 3WUZA 4YO0A 5DUPL 3VJ6A 5I1LA 3WFDH 1IC5H 3V4VH 5T1LD 4DCQA 3EO9H 1Q1JH 2YPVH 2YUWA 2CLZA 3G5XA 3UDWA 3GMOA 3OKNA 1QBBA 1DQTA 3D39E 3NGBC 3SKJL 3T8XA 1Y6KR 1QP1A 1G6VK 3T4YB 3TH2T 1IAKB 4ZUVA 3CAFA 3FFCA 2VC2L 1CLYL 5BVPH 4I18B 4KKBC 2V17L 1CL7I 1DBMH 4JFFD 4NPYB 2XN9B 1IL1A 5K9KB 1KT2A 4GAYB 1CXHA 2P47B 1U3HD 1G7JB 4LVNC 2NPLX 1P7QB 3H7BA 2IMNA 3CPLA 1UVQB 3WNOA 4K8RD 4G6ML 3WNMA 3S3PA 3DO3A 3D85A 5B38A 2MKLC 3DV4B 3ECBB 4P2OC 2D4FA 1AR1D 4RQQB 5GS0H 1KXVC 3C6LD 5HHOB 4KH2A 3U1SH 3TO4C 1JF6A 3HLAB 5C0DB 1UQSB 3F6LA 5ANMB 1YQVL 1EMTL 2X1WL 2D0FA 3JV0A 4NO0D 1HKLL 1WV7T 1GAFL 2EEDA 2IBZY 2NX5B 3MRCA 2IMMA 1JNLL 2W38A 5HDLA 2WINA 2W9DH 4FQ2H 1E27A 2DJ4A 1O7SA 1H5BB 3DECA 3OB0H 3ME0A 1FDLL 3HCVA 2Y07L 3CFDA 5IKCB 4G8IA 3B2UD 1G7HA 4QRPA 3THMH 2UZXB 1D6EB 3BDBA 4JKPH 4OKVB 1KIRB 4L29A 4XPFH 1F4AA 3SY0A 4KK8C 5F7DA 2A73B 4GW1B 1NJ9A 2Q8AH 5HPMA 3ZT5A 5GGTH 5CHNB 1YEEH 4NJAL 4Y16D 1HQRA 3T1WA 5DD6A 5INDB 5FKPB 5KTEL 3T8XB 3MX0A 5FIEA 1YN6A 4NKOB 7FABH 5DEFA 3OX8B 1RMFL 2I5YH 3EYVB 2C3VB 3AY4C 1NCNA 5DUML 1TLKA 4MQTB 1NMBH 3VJ6B 3L5IA 1XGPB 1MY7A 5CGMA 2E3VA 1N59B 1JWSA 2GK0A 2R2EA 1AFVL 4PY7B 2HLAB 4XBGA 3P0GB 4XT1C 4M1CD 1W72L 3RIFF 4R96A 4YWGH 1NEZG 2A9NH 4HW6A 4LKXB 1XAUA 1I1AD 1B0RA 3UZQA 4MDIA 1YMMA 4MCYA 3JUYA 4WDIB 3PDOA 2DDQL 2X6MA 1NGZA 2MPAL 1FO0A 2AK1L 3D39B 4LCYA 2HH0H 4NM8L 4RAVB 2AXJA 3RNKA 2R0LL 1BJ1H 4G8EA 4OD3H 1HSAB 1SEBB 4TVPH 4XPAH 1KPUA 2XQYG 5HYJA 2J8HA 4OCRH 4MD5A 3SKUD 3SDDB 5DEGA 3QFDB 3ULVC 4OLYL 5CSZB 5B21A 3BE1H 5FDWB 1G9ML 4R26L 2X4QB 1AGBB 3RQ3A 4LVOC 4F8QA 1LO4H 4LPTA 1NBYA 1T0PB 2J8UF 4L9LB 1FVDA 5EUOA 4BZ1H 4HIJB 2FLRT 4E9LA 4IIQA 2CLVA 3WHE1 5CHNA 4DEPB 5ILTL 1K8DB 5DUBB 35C8H 3VG9C 5D8JL 1T80A 4GKSA 4MMXC 4Y89A 3SY0B 2G5RA 2HFEA 4L8BB 1A02N 5EOTA 4XNYH 3PHOB 1G9EA 3U30C 1EUTA 1GRWA 1FIEA 1GGCH 1I1YB 2CDGA 4XRCB 4FXKB 3GRWH 4NKDB 4KRPB 5DRZB 4OCRL 4N68A 5L7XL 4Z6AT 3FB5B 4UQ2B 1PQZA 4FQ1H 4ODXA 2DD8L 1H8SA 5CINH 2OZ4L 3QHFH 5IVXF 4Q6YA 3E8UH 2DMBA 2BFVL 1AY1L 1IQDA 2VZTA 5F44A 4MNQB 3WYRA 5EZIH 4Z7UA 3BZEA 3ZHLA 4IHOB 1CYGA 1FL6B 1GSMA 1RMFH 1M05A 3T0EC 5EBWB 1BQHG 1INQA 3TA3D 3BPOC 2NW2A 4NO0B 4APQB 5A2KH 4U1NB 3NCYP 5DRWA 4KI5C 1ITBB 4JFDD 3MPCA 5IB4B 4GG6F 4WJ5A 2E27L 2EXWD 3GRWL 1P1ZA 1BFVH 4YHIA 4Z7QE 4Y19D 5JQ6H 1KTLA 1JPFB 1JRHH 2CMRL 4XPBL 2BMKB 1KT2B 5EBLB 3IJHA 3ARRA 1M05B 3LMJL 3QXVA 4M5ZH 4PREB 5F9WC 4UV7L 1LO2L 1GIGL 2K1MA 1FG9C 3G5VB 4HKXB 1KIPA 1QR1A 4MNQA 5MERB 1JWUA 3O11B 4RNRA 1AQDA 1BLNB 2NY3D 2YD7A 1MWAL 4U3HA 2D7TH 3VFMA 2F54B 1I7ZB 2MCPL 1XGYH 3QH3A 1CZ8H 5GSRA 3U4EB 3QHFL 5DFVD 3IDXH 4LDOB 1FAIL 4AZ8A 1BX2B 5I6XC 3VD7A 5CEZH 4HK3N 1IZJA 1DE4B 1GAFH 1O5DT 4L4VA 2ICWA 3PABB 3QRFM 4J3XA 1Q9OB 2IQAA 1J8HA 1FNSH 1EHAA 2AVGA 3QIBC 5MEND 4PLKC 1LDSA 5EPMA 3LEXB 3MLRL 5L9DL 5EU7C 1U92A 2P45B 2ATPB 4LRNH 1OP9A 1SJVA 1TIUA 5CSZA 4I0PC 5GGUA 1MUJB 1I7UA 3NZ8A 4MMZC 1Y0LB 4QRPD 2JKXA 4Y7MA 2LVEA 2XPGA 4UU9A 2NCMA 4UT7L 4EXKA 1U8LB 3TT1H 4TTDD 1XEDA 3E2HB 4W4NA 3ARFA 2ZG1A 3BIBX 5F9JA 2IEPA 2G60L 1ZANH 5J9PA 4MDIB 4EQ2A 3DX6B 4HZLA 2NX5D 4GXUN 3VXSA 1I1CA 1ITCA 2HH0L 1U8QA 3GSNL 1INEL 2R2EB 4DN3L 2CJUH 5I1CL 2HRPL 2QSTA 4X83A 2I07B 4MNGB 2HA1A 3NABH 3BN3B 4JCMA 1FV1B 2C1PB 2YXMA 1YEIH 4P2OA 1CXIA 4HCRA 3SE9H 4NKOA 3VFGL 1YEKL 2EYSA 4ZAKD 1W0YT 2GT9B 1IZKA 2BDNL 5GPRA 1KTRL 3RPKA 4PJXA 3TP4A 1LO3H 3C8KB 2IH1B 4IEFB 4OFYD 4C56B 3BHBB 1BD2A 4GH7B 5E08H 3SDXA 1PD6A 1EK3A 1WISA 3V4UL 1SJEB 3P0VL 1NGXA 1A14L 2WAHA 4PGCB 5T3XH 5DHYA 5D1XB 5D1XD 3U7YL 5JPMB 1VPOH 3GSWA 4A2MA 3V6OC 3FOMB 3B9KD 2VDKH 1CICB 1P7QD 4PJGA 3MRQA 5EBMA 2R23B 1Z0NA 5EC2A 5BZWA 3GB7B 4PRHD 5HDOA 4OUUA 5EC1B 4AEHH 5D7SH 4JFQB 4M6MH 2Y5TB 5D7IA 5SWZD 1CF8L 3OAZH 5IM7A 4FFYH 1DLFL 5IJVA 5GISH 1OSPH 3NPZB 4J1UB 3NBNA 3LKRA 1WAAE 3QG7L 1AGDA 5F7MC 1OAYL 3MLXH 5C6TH 3W0WD 3IT8D 3UBXI 4L4VE 4HK0B 2LV4A 4IDLA 2VOTA 1F4YL 4X7SL 1A14H 1A2YB 3TA3B 2OK0H 5F9OH 2VZUA 4MJ5A 3PQYE 4KU1A 3S37L 4AM0B 4NZRH 3MCLH 1R3JB 4TSCH 4MA7H 2VLLA 2ADIB 5CZVL 4P2QA 1R5IA 1K4CB 2ADFL 2BY2A 1WAAF 1A3LL 2FBJL 3ZDXF 1FVCA 3MOAL 2CDEA 5HYSG 1ZA6B 2DMKA 4IOSD 1C12A 1TVBA 2ESVB 1IM9A 2G9HA 3MZTA 4S10A 1QFPA 3L5WA 4N90D 2D7OA 4TQEL 2F53D 3ZTJH 4NN6B 1FO0H 2XKNB 2OTWA 1I4FA 3BPLC 4XPGH 3CSYA 4FFZL 1RUKL 2IANA 2P5EE 2I9TB 2DQGH 1T1WB 2NYYD 2OK0L 2O61A 1RUPH 1I3VA 4MJID 1A7PH 5F97E 4IRZL 1ORSB 3W39A 2DJSA 3VD4A 3MBXH 2Y5TA 1NSNH 1VFAB 5FYKH 3L7FB 5E2WL 3BEWB 3K8LA 4K55A 1KIPB 3FZUD 4QRRE 4AIXA 3RWJA 3PUCA 1LWRA 4Z7WF 1QFUL 1UJ3A 2IALB 3MRRA 5HHPB 1OB1B 2YPLD 4ODHH 3VGGA 3MJ9A 4I9WD 2YUZA 2GSIA 1O7VA 1J0HA 3NFSL 4ORZC 3NIGE 5EO1A 3QPQD 4PJ5E 2AAVA 1HINL 3WKMH 5JHLH 2HAZA 5DJXB 2ICEB 3HUJB 5F8QC 3MJ7B 1AHWA 1N5AA 4MVBC 5I15H 2WBJA 4P2RB 4NQTA 3GGWA 4AYFA 3C9NA 2AQ1A 1N7MH 5C08B 4OSUL 2FEEL 1NC4A 5ITFA 4GXUM 2DM3A 2RFXB 1A6AA 4K71C 1CCZA 1QSEE 4UAOC 4BSVB 4TVPL 3A6BH 1X5AA 3DETD 1IQDB 4F9PC 4RGNB 4ONGL 1KN4L 5DD1H 4OZGB 3F58H 5C0RH 5D6CA 2PF6A 3IDXL 1IT9L 2H32B 4O2EB 3H6JA 4H8WH 1UM4L 4XBPB 1KCUL 3U2SB 2DL9A 5IK3B 1HI6B 1AXTH 3BP7A 4K3HA 3DETC 3ZL4H 4WO4A 4O4YH 3BZFA 1G0DA 1T20B 1ZK9A 5C0AD 5FGCB 4PLJD 2X7LA 3V6FA 5EOTB 1OD7A 3I6KA 3ZDZF 4MQSB 3S36L 2ZPKH 3SOBH 3O0RH 1V3KA 4BSVA 1QFWI 5FUCC 5I1HL 1V8HA 4R90L 3HE7A 1XR9B 5FM5M 3HNSH 3IDJB 5DK2A 1II4E 3REVB 4ALAL 2A6IA 3NCYS 3JTSA 4NZTH 4XVJL 3TO2B 1RULH 4RBPH 5L88H 2X4QA 1ZTXL 4JO2L 1IGIL 1U92B 3ZZ1A 2XIDA 1ZXQA 2OI9B 4TSAL 5HTSA 1K4DA 3X3GH 3MR9A 1BWWA 4P2OD 2Y07H 2E27H 3IKCB 1J8HB 1FYHB 3DHMA 3N1MC 3OPZL 2VISA 1TJIL 1F3JA 3DIFA 3O2DA 4MDJB 5DJCB 3EAKA 1HHKA 5EU4A 4LLAA 1UADC 1B0RB 1MLCB 3MV9B 5EH1A 1YY8A 3B8YA 4M5YL 4KJPC 3VRLE 2YBRA 4PD4J 2P5WB 5LAXA 3VMOA 3PWNB 3D9AL 4Q97A 4D9QD 5D96B 5JW4R 3O6LL 2EEAA 5C7XL 1RZFL 4DVRH 5FUZL 4KK6D 4QRUA 1RK0B 4FQ1L 3EYVA 1RURL 3CSGA 3PWJA 5DJ8B 3K0WA 5K9OB 5FYJU 2LU4A 5KSAA 5F70A 1KC5H 3GZKA 4U1GB 4PV9B 4FNLH 3PV7A 2FYYA 4S0SD 1OTTD 3WD5H 5D7JA 4ELMA 3FAXA 3FHAA 1JGLH 1BMGA 3B3IB 2E9BA 2XA3A 4NQCE 1CXEA 3HR5A 4HWZA 3S97C 1P4IL 4JPWH 4PJ5D 1SHMA 3KPRD 1F90H 1FCGA 1YNKL 1QPPA 4WUUA 1R3JA 5CJXA 5JNYB 1D6EA 1QUNA 2CKBH 3BKML 1ZAGA 2X9XA 3W0WB 3QRGL 3C5JA 2AEIT 3PL6B 2VLRD 3KPLA 4NO0A 4EIGB 1JYXA 4PJHB 3KHOA 3T08A 5D70L 3GI8H 2EC9U 4UOW1 3DX7B 1RHHB 1FZJB 3C2AL 2WANA 2BNRE 3VDAA 3B9KB 5LCVH 4KI5F 1M1SA 5I1AA 4PTTA 4QHKI 3D2UD 3HZYB 25C8L 3SGJA 1SYVB 4BSWA 1IGML 2VH5L 3WNKA 4YK4B 3EGSA 1JGUH 4MXQD 1CE1L 3BD3A 1AIFB 4LSRH 1AI1L 1Q94A 3BIKA 4PRIA 5DUMH 3ROOA 2CIKB 1TMCB 4YHPA 5IHUL 4C58B 1LO5A 2HVKB 5ETUA 2F53A 3EDFA 3VXPA 4TSBH 4ZXBC 3CGTA 3O3DA 3FFCD 4PGCA 2OXHA 3PDDA 1DUZB 1JCKA 5EU6E 4P5TB 1C5DA 1W8NA 2B39A 3CMGA 3IFPA 3SDXB 2VWEC 4HS8L 3ULUL 3FONA 1CTOA 3AC0A 1U6AH 3RI5K 3CUPB 3L3OB 3PWUB 4U6VL 5ALBH 1HXMA 5JORB 4G9FB 5TDNA 4WHTA 3SDAB 3VD3A 3JWOC 4HXAH 1V7NH 2QQLL 1AD0A 3CFKA 3FO1A 2CLZB 1AC0A 3BGMB 3CLFL 5FGSA 2BVTA 2R2HB 1RZIB 2C1PA 3WS3A 4JKMA 5D2LF 4WIQA 1NMAL 4OLWH 5F7KC 1BGXH 3O3BB 1U8QB 4MD0A 3C8HA 2OJEA 3MXWH 1KJ2L 4C56E 4G80A 5IBTH 3HRZA 4I3SL 2C5DC 4TPRL 4GQ9L 4A2LA 1PKQB 2NX5E 4DW2H 1H15A 5F7EL 3RTQC 2MKWA 2O93L 3REWB 3IDIB 3AM8A 4OGXH 1N59A 4MA3A 1MQKL 1XGRB 4R7DB 3ZKQD 3RJQB 1M7DB 1YEJH 1FIGL 3QIBD 4P4KA 3TA3C 3HG1D 4EVNA 2DB8A 2VE6A 4XWGL 3DVIA 2X4OB 3ARYA 3U0TA 1JUFB 1N6VA 1IC7H 4OGYH 3QISA 3F7QA 4PRBB 5AD0A 5K9JL 1LDPL 2AGJH 2NNAB 5IBUG 1AY1H 2G75B 3G9VA 4XP6H 2VH5H 3IXTB 3KPRB 3DLQR 1RK1A 3PABA 4GW4A 2X40A 1T6WA 2VZOA 3Q48A 3BJ91 1RUML 5DFVC 5E8PA 4YDJA 3UDWC 3TFKC 3WKNA 3FB8B 2C3HA 2X70B 3HR6A 2B8OT 3VXPB 5DDHA 4J3OC 5I18H 1ZGLA 3O2VL 1ADQA 5H8DA 4BQCA 4XBEH 1KULA 4G7YL 3VFPA 3T09A 1DN0A 1I8LA 4JKPL 5J06A 2JJVA 4CRPA 4DGVL 4ZUSA 1S7RB 4NQSA 4R0LC 2V9QA 5HHQB 4JFPA 5DFTA 3ZYZA 3WXVH 3NA4A 3T0EE 5DI8B 4HF5L 2NYYC 5KN5A 3P73A 4I2XA 5GS0D 1Q0YH 2JLLA 4YXKH 3I2CH 3RKPA 3W9DB 2KH2B 4NBYB 4HKXA 5M94B 3HC3L 3DGGB 1VGEL 2FD6L 5C0DA 2NY6C 4MZ3A 3IU4L 3HE6A 5FM8A 1KPVA 3NFPA 3WV0A 5DZNA 1N64L 3DGGA 3GSQB 1HCFX 1OTUC 5CP7A 2ZCHH 1X5FA 2X89A 4EN3C 4D0DA 1X5YA 4MZ2A 5I8EA 4L5FH 3OMZA 3ZHDA 4RWYH 4YBQC 1ZHNA 3LH2H 3HC4L 3KXFA 1CLZL 4MNQD 3U79A 4DTGH 1KJMA 2DQTH 3JTTA 3KPMA 4N0FA 1PEZA 3DV6B 4WU7B 4PP2A 2VYRE 4M62H 1FP5A 2GSGA 2LTQC 3CDFA 4LLWB 4PGJA 3NN8A 5H2BB 3ZE2E 1MFEL 3VFTA 3E1F1 3IDYB 3OKOA 3NFNB 2R39A 3CXDL 4ZPVB 3W9DA 3RPIB 1D7FA 2R9HD 1D5BB 1G9MC 2H3NB 4BM7A 3EYUH 3IU4H 5EUOE 1YPZE 4AMKL 4KKAC 4PRNB 4DGIH 1EGJH 5DJ8A 1GHFH 3DUSA 3UJJH 2DQHH 1DUYB 2YA0A 2VZVA 3G04B 1VFBB 3DURA 4TVPE 1G7QB 2GW5A 1FN4A 1TQCB 3C6LA 3GI9H 1RV6X 5MENA 3VE0A 1OWWA 1DL7L 1BFOA 3WFDL 3MV9A 1IGMH 2Q8AL 4ZUTB 4L8DA 2B5IB 5TE7H 4Q0XL 2VMFA 4DKDC 5MI0C 2VISB 3QFJD 3CCHB 5BXFA 3LPGA 5CD5C 2DLFL 1L7TL 3W2DH 5DQDL 3WJJC 3K2UH 4R97C 3GMRB 2VLME 4IOIB 3LVEA 1QTYT 2OI9C 5T3ZH 4U0QB 3LQZB 5HBBA 3O3BA 4RGOH 5GS3A 2EDHA 2IWGA 2EIEA 2AQ2A 2XZQH 4M7ZB 1A64A 5B39G 1SVZA 2XRAL 1G84A 4R4FH 3UYOD 2R8SH 1FE8L 1KN4H 3K1KC 5E08L 2XT1B 5DURB 3AXLB 1RJYB 5TDPB 1EO8L 3CSPA 3MA9L 4G9FA 3EJYC 5CJ5A 3B9EA 1GGCL 3H7LA 1T20A 3MXVL 3KPQB 3RWEB 1UWXK 2OTUA 5DLMH 1JPGA 1BECA 2RBLA 4M00A 5E70A 3ALPA 3SCMD 4ZDHA 2AJZB 2HP4A 3RY4A 5EU5A 4OZ4B 1JZ6A 1ZHBA 4HAGA 4MNGE 5C2UB 2F53B 2WLYA 1WC7B 2CKBA 5FF6B 2IF7A 5EZJB 4FXGA 1CFQA 1S3KL 3PWVB 4WNQB 2G60H 1FFNB 4S2SA 1QFUH 3QIWC 3D48R 3RWDA 2QQLH 1NC2A 3LMJH 3D3VD 4YPGB 1WWCA 4OD2B 3V4VL 5MHSE 2HLFC 4ZUUA 3PL6C 4NRXB 1KJ3H 3QUZB 3O9WC 5IESH 3ARDC 5GRJL 1FNLA 3EBAA 2WUBH 4TVPD 3MRKB 5I0ZA 4XMLH 1QLEL 1RZ7L 5F96H 1QFHA 5E8OA 1WEJH 3D0LB 2FIKA 2NY7H 4NNXA 3QXAA 4HGWB 1KCVL 1EHLL 1QOKA 4Y4HA 3VD9A 1A6TB 1DSFH 4JAMA 4WGWB 4NKIL 2AJXH 1SYVA 4BSWB 5ACLA 1MCFA 4WUUB 1JZ8A 3AMLA 5GZNC 3KPSA 5MP6H 2VDQH 1FFPA 2FL5B 2DRUA 1UQSA 4UQ3B 3ALXA 4NN5B 3MLYH 1AO7E 3B3IA 1RUAH 4BK4A 1GZPA 3MOBL 1DVFC 1S7SB 1RVFH 4Z7UF 2FATL 4R7NB 4JFFB 3O9WA 1A9EA 1EZVY 1XF2A 1PFCA 5JOPE 1J5OL 4HS3B 1MJUH 1Q72L 1YEHL 3CFIC 3L3GB 4JY6A 4PGZA 5D1QA 2A74B 5HHQA 2PO6C 4PR5A 1BVZA 5CMAB 4WUUD 1INDH 3HC4H 2ZUYA 1UZ6E 3J8F7 3FCTA 1S9XB 4HQQH 1ZA6A 5IBLC 5I1KL 2PW1B 4Y2OA 2BK8A 3D25A 2ZCLH 4CMHC 2YBRB 4OLXL 3UTSD 4QHKJ 2IADB 2Z31D 4MYWB 4PJIA 4J23A 4P2QB 3MREB 2ZG3A 4ZFFA 4X4XB 4JG0L 3OAZK 1XF3A 5M7QA 2HRLA 1BAFH 4AIZA 2EH8L 3QI9B 3N85H 4KI5E 2C9AA 5HHMD 4YEEA 3IKKA 2FX9L 3LEVH 4QT5A 1K4DB 3NFSH 2H45A 4KZDH 1C08A 1CL7H 3U0TB 4D0CB 5CP3H 5GS1C 2VE6B 3LRSA 4FQJL 5CUSH 2AK1H 4NM8H 4LSRL 3CNKA 5IW1A 2IH3A 2FB4L 1XGUA 3T77B 1UH4A 3QEUB 5DYOB 5TGBA 3AREA 3V6ZA 3S88H 2Z8SA 5D7LD 1H15B 2BVUA 4OCMC 4KK6C 4O9HL 4DGYL 5FHBH 2RIKA 3ZL4L 2FH8A 3OKKA 3MLVL 3V6FB 2P5WE 2XWTB 1K2DB 5LWYL 1CG9B 4Y2DC 1JV5B 1A6VH 4LIQH 1OAXL 1G6RA 3VXME 3UTTA 1U58B 3LDBB 5EN2A 1C5BH 3GM0A 2ED7A 1WBYB 3B6SB 4MSWB 5D8JH 1QBAA 4R6UA 1A0QL 2VDPH 4KROB 3HNSL 4NQCD 3QPQC 5EOQL 1FH5H 1IAOB 5E1AA 3QNXB 4JANA 4X6DF 4DQOL 3BD4A 2ZNWA 2E7MA 3TYFA 2A6JA 1MSPA 5L2KD 3C08H 1C5DB 1T03H 4L3ED 4M8QA 1BGXL 3BH8A 5E2TH 4I48B 4Y1AA 1BQHB 1AP2A 2X44D 3DVGA 2HMID 2XTJC 1FZOA 4KVNL 4ETYA 3S4SA 2VQTA 4OF3A 5EZLB 3MO1A 2VAAA 2XI9A 4ZOEA 4HJJH 3MMEB 1JF5A 3ULSA 3HRPA 3O4LD 2CRIA 2DF3A 5TGBB 5AYUH 1EXUA 4HBCH 4KK9C 1YNTB 2GKIA 3HMXH 3AM8C 5C08A 3RWJB 4NRYB 5IB3A 1E4XI 3IJYB 1U8NA 2PYFB 4FQXC 3JV6A 5C0BD 1ND0B 5TQ2H 3WNNA 3U7YH 2C3WA 1VFOA 3BN9D 1N7ML 2ICCA 2ATPA 4LPXA 3KYOA 4QYOB 2CDFA 5TPWH 2VB5A 2RJMA 3T2OA 5E94A 5FOBB 2M8XA 3M1BB 2CUIA 3RHWK 3OKLB 3IDYC 4YAQB 4NDMA 3Q3GA 2B4CC 3RU8L 3W0WA 4DN4L 4PFEA 3O4LA 3FO9A 3AS1A 3AY4A 1KCVH 4UMGA 2Q87A 4EDWL 4FQCH 3UAJC 4QHMA 2ZNXA 4CADB 3L3DB 4HKZA 3CFEB 5T3XD 1D5XB 2YD5A 3BIAX 1MCSA 5DVMA 2P7TB 2W0PA 3U4AA 1TITA 3QO0A 2YK1L 1WJ3A 3CSBA 2Z31B 3DPBA 1PGRB 3KPNA 1F4YH 1S9XA 4X7SH 3WXVL 3UPRB 1I7ZA 2G2RB 2HWZL 5FV1L 3MV7B 4YC2C 3KPSD 4GSDH 1CGYA 3RGVD 2IPUK 4UILL 1T0MB 2JCCA 1HIMH 1BVKA 4PBVC 1TVBB 1T7VA 3JWNC 1QBLH 3ZYOA 1UZ8B 2AXGA 2BC4B 1NFDB 1NDMB 5IHBA 1E4KC 1WFTA 4YFDB 5T1KB 4IIQC 3PWNA 1X44A 4PREA 5ITBL 1B6UA 5IB5B 5DMJB 4FHBD 1IFHL 2QQNH 2DQFA 1BZ7A 4YHLH 1IEBA 4ZTOL 5J7CC 2LAGB 3A6BL 1CGWA 4JFDE 4JKKA 5C2BL 3RVVD 2W0FB 3P0YL 4P5KA 1Z6JT 4OB5H 3D0LA 3MBED 1OSZB 2ESVE 3OV6A 4PRDB 3TWCH 3GMLB 1QSFB 2ID5A 3H9SA 5D5MB 3RAJH 2HT3C 4F15B 1MFDL 4P23D 1AKJB 2DQUL 4YR6B 2X9WA 1NAMA 2R15A 4XWOC 4BH7A 4CDHA 2AJVH 5GS2H 2HTKD 5J1AA 3TYGH 5D7IF 2XN9E 1H0DB 2CIIA 5F88A 1A1NB 3AAZB 4HT1L 1OT1A 3BVNA 4O5LL 4OZFG 1NBVL 1CE6A 1K3IA 3FN0H 4ODXB 2F5AH 1YUHB 1EX0A 4ZAKB 3R4DA 2IH1A 4K2UH 5F9AC 3GIZL 4Y4KD 1MFCL 4RBPK 5JPMA 1AKJD 4Y16A 3OXRB 3OR7B 4PJGE 1FZOB 4K7PL 3EOTL 3O3EA 2Q86B 2R0ZL 3I6LE 5HYSA 1NGXB 2B1AL 2AJZA 4LP5A 4I48A 1FV1A 1I3GH 1IKFL 1S5IL 4LASH 5DJ2B 4Z7VB 4BH8A 5IMMA 3U0WH 1ZLSH 5C09B 2OXGA 4XBPA 1W0WA 4NNYB 4U33A 1JPGB 2X89D 3INUH 3BN9C 1P69B 3SJVA 3D69A 3T3PE 2DQIL 1CE6B 3GEWB 4NT6B 2WQ8A 3HAEB 3MOAH 1MWAA 2QQKH 1M7XA 2BNQE 4ODSL 4C56D 5CEXB 4I5BB 3H9ZA 3QQNA 2I60H 1KB5L 3QFDA 5D93B 5D5MA 4O4YL 2I07A 4MNGA 4TSBL 4KDVA 3RGVB 1BM3H 2WBJD 3GGWB 5H37H 1UG9A 2QADB 2XTJD 2ZSVB 3MRLB 2OR7A 2XWTA 3OZ9L 4OLVH 1UYWH 2OR9L 3P40A 1YEEL 1IM3B 1B4JH 1DDHA 1H3VA 1T21A 5LBSH 3V6ZB 1WBZB 2IQAB 2ZUSA 4LGPB 4Z18A 1H5BC 4QXUL 4YH6A 2DI9A 1AGFA 3UO1H 4HBCL 3GMMA 2BSRB 5C0AB 5GGQL 2XZCL 4XP5H 4I4WA 4LCIH 4RAUA 4Y5VA 3WSQH 3ESUF 4Z7OE 4FZEH 1MIEL 1OCWL 2P8LA 5GRZA 2CK0H 3H8NA 5IV2A 4KJYB 3I2CL 3QRGH 1J0KA 4RX4A 2NTSP 5EOQH 4AJ0A 2V5SA 3B2VH 1YNKH 3GK8H 1NGWB 4ZFFB 3GSNB 2AJSL 3MRGA 4KV5E 2Y23A 5A2LH 2E8ZA 2IADA 1NMCB 1V5JA 1MHHA 2UYLB 4GBXD 4NZUH 2G5BB 1ZLVK 5IT2H 3NN8B 5AUMB 3T2NL 1WT5A 1QACA 3OKLA 1G1YA 2WUCL 4R8WH 5F1NB 3N9GL 1WCBB 3ESVF 5ACZA 5D4QA 3BKJL 1UEYA 2FJGA 3UC0L 5K9QG 2ICWJ 4XPAL 4P9HC 2B4CH 1OOAA 4YXHL 2CSPA 1NC4D 5IHUH 4DKAA 5KSBE 5MP6L 4X7TB 4JY4A 1RJCA 2F54D 3IJYA 4Y8AA 2MFNA 3KYNA 5GRXG 1LEIB 1T2JA 3L95B 3KYMB 4JR9L 1QLFB 2YEZB 4MAYC 3HLAA 1NCTA 3DWTA 1GH7A 4NKIH 1U9KA 3SKJH 4BQBA 4L3AA 4CNIB 4G6JL 3P77A 1VHPA 3VRJA 1CGSH 1FPTH 3OB8A 1LP9A 3L9RA 1K3ZA 4LAJH 4LSSH 2OLDA 1OAUH 5ADOL 1CVRA 1A6TA 1TNMA 3T0WA 5D70H 4XAKD 4OJFH 3VFPB 1RZKL 5IJKA 3EFDH 2A6JB 5IBTL 4XNMA 3VG9B 4XRCA 2XY2A 3ZMRA 3FFCB 3RI5F 4PJCA 3V5KA 1S7QA 4JRYD 3VGDA 2DLGA 1BAFL 1IAMA 3QUYA 5GRUH 3TPUB 4C83A 1I1RA 2DYPA 2BNQD 4ZFGL 3EOBA 3KLHC 5DO2C 5DD5L 2EXWC 3VXRA 4WNQA 1SMAA 2CLVB 1KXQE 1I7RA 3PQYB 1AC6A 4XC3H 3LIZL 1MCNA 4NJ9H 3SGDI 3TJEL 1FC1A 1CG9A 4YX2H 3LQMA 3JWOH 1JNLH 1JHLL 1OT2A 4NQUA 3PNWB 4OIIH 1PKQE 5C7XH 4Z7QF 5FYLL 1AJ7H 3MA9H 3NIFF 3F12B 3QNYA 2OTPA 3T0EB 3QJFA 4ELKA 1U2HA 4JO1L 5JXED 3BPOB 4DVBA 3RNKB 3CXHK 5JO5A 2GIYA 3VXSB 4APQC 4M1GH 4FQIL 3VDBA 3LS4L 1AXSA 3VFVA 4WDIA 3B2VL 5J9PB 4N0UB 4Z76A 4Z95L 1QHPA 4G5ZH 2H26A 3I3DA 3MRLA 5J11B 3DYOA 5GSVB 4M6OH 5I2IB 1UWGH 3X3GL 4PGBB 4JPIB 4Y4HC 1I1FA 4LOUC 5KSBA 4TYUA 5F9WB 4HF5H 4G42A 4HJ0C 3FRPA 5C3LD 4DKEL 3U6RB 3VXRE 5C6PB 1U8KB 4N0CD 1Y6MR 4D9LH 4HS6B 3V5HB 1JJUA 2WWKT 3MRMA 4M6NH 5DEFB 1MWAB 3GMRA 3RUGE 5J12C 4ZPTB 3Q5TA 1KB9J 2GFBA 4PJIB 3RRQA 1DEDA 2QTEA 4JEGB 1YEGH 5FGBC 1C5BL 1A4JA 1TJGH 3MCG1 1NUFA 5LG1A 3HUJE 2DQCH 3GNML 5L2KE 2DI7A 4GRLB 3HNVH 5DZOA 5H94B 1KTDB 1P5VA 2EDXA 3T65A 4QGYA 3T0BA 1BP3B 1N2RA 4X8JA 2X41A 1AGCB 1IGTB 3PJSB 5K9JH 2J8UE 3RL1A 3VW3H 2DQDH 1S8DA 4LGSB 2MNUA 2CIKA 2IPKA 1EEQA 2BRRL 3OKMB 3EO0B 1DUYA 1BQSA 3V4PL 4CVUA 3CVIL 1M7IA 5DD1L 2W9EL 3KR3L 5D9SA 2EDYA 4Q6IB 5DMYA 1WF5A 1AQDB 3GO1L 1XR8B 1U8PA 2PR4H 4OKVA 2L0DA 4LEOB 5FAAA 5HYEA 3VWKA 5ILTH 3B9AA 1NCBH 4Y2DD 4NZUL 4U6XA 3N0PB 3QAZB 1P53A 3NCBB 3H9SB 1QSFA 1JHKL 1KJ2B 2BMKA 1YEDB 2H8PB 3B8SA 3U48A 4FTVD 1JK8B 4KFZC 3RVWC 1FZKA 1SBSH 3LN4A 4QRRB 1KJMB 3KPMB 5DEZA 3O2WL 5D7IE 4NRXA 3H42L 3CPLB 1PAMA 1MCWM 3H3PH 5JOPD 5CEYA 5HYIA 1RU9H 5IF0A 1CLOH 2DQFB 5KS9F 4JZJC 1UKSA 3VI4E 5BRZD 5I1KH 5HD8C 5FYKD 5D71L 5LGKA 2AERT 1N6QL 3RIFK 3N50A 3QDJE 3D85B 1NC2D 3MLSH 4DK6A 3EDEA 2Q1EA 3IF1A 1SMOA 4NQSB 5BOZG 4PJAB 2ARJQ 3ZSSA 5D1ZC 4OI9A 3BZ4A 2R4SL 3V7AG 3KJ6L 2ZPKL 5A2JH 2V2TB 1PYWA 3QO0B 3QDJD 1CFNB 1DQLH 5EO0B 4OF0A 4Q2ZA 1REIA 4WW2C 2EICA 2APXA 5TDPA 5DS8A 1CICD 3GMOB 1AO7A 3OKNB 3X13B 5DVKA 4PPTA 2XXMB 5DD0H 2HFFB 1HWHB 3KJ4C 1CICC 1IGYA 2VZSA 3WFEH 1X5GA 3Q2CA 4PG9B 5KSBB 2P8LB 4KUZH 5HHME 4Z7VE 4UDUB 5I2IA 4B50A 1U3HA 5ABDE 4X7CC 4IOIA 3O45B 2YMXL 4EVNB 5GS2D 2BY1A 2FD6H 1U8IB 2VLKA 4JG1L 1E6JL 4DW2L 4E42A 3P4NB 3QYCA 1XCTA 4ZOAA 4U1IA 1RHFA 4KKLC 3WXWL 1KEMH 1UM6L 4UNUA 3V7MA 1T7WA 2N4IA 2GQHA 1MFCH 4IRJB 5D7KE 2DLHA 2C4FU 5C0JA 3V8OA 4LKXA 3OAYK 1H3XA 1QFWL 4XCYB 4G6FB 4OJFL 3QDAA 3FQWA 1NAML 4WO4B 2CLRA 1NFIB 1NL0H 4WUKH 4F57L 3BPCA 1RSFA 4Y4FB 5I76B 2F74B 1HI6A 4X80L 4LRNL 2XTLA 4HPYL 4NM4L 4QXUH 1EO8H 3X12A 5F6IC 3GBMH 4QEGA 5KSUA 3O6LH 4YHLL 4H20H 1PVHA 1NUDA 4ZD3L 4PJCF 5E5MB 2EO1A 2H9GB 2WIIB 1CFNA 4XH2B 3B6SA 5J6HA 2RFXA 5F6HI 4BH8B 5JMOC 5EOCJ 5C0EB 3QNZB 2AW2A 1CDHA 1X6NA 4EKXA 3MFGB 4YDKL 1K2DA 4R8WL 1TETL 1A6UH 2DLEA 4PUBL 5I19L 5IEKB 1NLBL 2EECA 1QEWA 5DJXA 5FV2A 2J6EH 3LN5B 4ZG1A 3FTGB 1PG7L 1TZGH 2ADGA 4X9FA 5CZXC 3D87B 4MVBD 2YRLA 3NH7L 4TSCL 3CU1A 2CO6B 1JE6A 5HGGS 3ROLB 3H2WA 5I30L 5K59F 5ADPH 4EDWH 4O00A 2VL5A 3PP4L 5F7EH 4OIBA 4D0BB 3MZGB 1OAZH 2P5ED 2OP4L 5JW4M 1S78D 3TBWB 2FJGB 1KJ2H 3QQ3B 2BNRB 3IFNL 4XNXL 2NXZD 5HY9B 4PG9A 5TF1L 3SKOB 2JELL 4XVUC 4O51A 5E9DD 5JXAL 4GBXA 1DQMH 4X7EC 5CD3A 1HYRC 2G9HB 4GS7C 4HGKC 3L5XL 4YDIH 3RUGF 4P2RE 1U91A 4JFXA 1KC5L 4LLDB 5TFSH 3EW3B 5F3BB 1D3CA 3RKDC 2MOVA 1PYWB 3D25B 2AJYH 3EO0A 3RA7L 1RURH 2BCKB 4FQQA 1F11A 1P2CA 4GT7A 4KJYA 4JZNA 1R5IB 3MLZH 2YKLH 4G9DB 2NY2B 1BVLA 1UENA 2UZYB 2Z0BA 2QR0B 5IIEB 3T65B 1W8OA 3P0YH 5E99L 4N8CH 1UCTA 4XNXH 3HC0A 1F45A 1YYLH 1X4XA 1R5VB 4JGMA 1P4LB 4ZO9A 2P5WA 5LAXB 5J89A 2Y6SD 3SDAD 5GJTH 1HINH 1KELH 4QGTA 3PGFL 1YY8B 4KRPD 3C2AH 1GPOH 4HJ0D 3GKZA 4KGJA 3TZVD 5HHXH 3FO9B 5JDJA 4L4TA 3GFUA 3HI5H 3LKQB 4XCFL 4P5TD 4U49A 3MJ9L 3MRQB 4NBXB 4Z7UE 4LCWB 4Y5XB 5JIPA 4MA1B 4WFHD 2BSSA 1SJHB 3EOTH 4P2QE 3SGEI 1KB5B 3PHQB 3Q0HA 3U6RA 3TO4A 1MF2H 1RY7B 4X6EB 1A7PL 4OF5A 5ADOH 5FO9A 4LSSL 1TENA 4LKCA 4K94C 4IMLB 4F7PB 1C7SA 4D3CL 2D7NA 1LNUB 3OAUH 1XZ0B 4Z76B 2J8UB 4R2GD 3FRUB 1I7TB 3IFOB 4OD3L 1T2QL 1M7IB 2WP3T 1EJ6A 1KELL 4OZIB 4YHOL 2KQNA 2VN4A 4HFUL 4HMDA 2B2XH 4EI6A 3O41A 5D1QC 3VWJB 4MQXC 3PJSA 3FQXB 3S96A 2VDOL 1MRCH 5C0EA 1AE6L 1NGPL 3ZE0E 2BJMH 3PQYA 4P46D 4PRIB 4JN2A 2DS4A 3KYAA 5D1ZD 3ROOB 1P9MC 1HHIA 4Q6IC 3VCLB 3CLEH 2I9LB 1FNAA 2BOBB 2JB6A 2MJWA 4MA8L 5F88B 3QUYB 5BRZB 1CZ8L 2FGZA 5CJOH 5F3HA 3I3EA 4N1CA 1EH9A 5DJDB 4OLWL 2APBA 2NR6C 1KBGH 1ORQB 4P23A 4X6EA 4GSDL 5DJYA 1CFTA 2MCG1 3ARDA 4TUJB 2UVEA 3NIDF 1Z9MA 1T7ZA 4EZMA 4U4BA 4LCIL 2BNQA 4K94H 3SCMB 3MJ7A 5E4EC 1MLBA 3C60D 2X5PA 4OAWB 3VFWA 2AV7A 5FA3A 1EFXD 3MRIA 4PJEB 1PG7H 2F58L 3T2QA 4RZCA 2EXYC 3QJFB 4HUVA 3BISA 3T77A 4U1IB 3NAAH 1NAKL 3NCFB 5FHAH 5ELIA 5C0BB 1VFAA 4F80A 2UZIH 3O0RL 1OAXH 2Z92A 3PGDB 1FNHA 3PWJB 4UDUA 1A6PA 1T1WA 2BNRD 3GSVA 3ZHKA 2R4RL 1J12A 3RGHA 3CSYB 3UPCA 1KLUB 3M17B 2C1OA 2EKJA 4WW2B 1BQLH 2YC1A 1LK2B 3QXTA 1SBBA 2AJUH 4Z5RA 4H1LB 4OSUH 2ILLA 1U93A 2AK4D 3GSOA 2DWEB 2K7PA 3QIUB 4FTVA 4ISVB 3MRNB 5C0CE 3ZE1F 5BS0B 3QT2A 3KHQA 3ARUA 4XTRC 1JPFA 4HFWB 1YPZF 3CZFA 1CFSA 2Z8VC 5EUOF 4QYOA 1FORL 5DGQA 4DAGL 2X4NB 2X42A 2Q76A 1GZQB 4WHDA 3IS0X 1XF2B 4APQA 1MPAH 4HK0A 3ULVL 4D94A 1JHKH 3GIVA 1NUGA 3QFJB 4CNIA 4HMCA 1PZ5A 2F5AL 1OTSD 8FABA 1LO4L 4LLYB 4XAKE 1VACB 1OGTB 5I8CB 2R29H 3AREC 3VWKD 1P6FA 1MOEA 1XCQA 3KPSB 4FABH 3WXWH 1LD9B 4KUZL 3I6KB 2EDOA 4XBEL 1MIMH 1R5WB 1ZVSA 1FLRL 4EOWL 4Y4FC 1P5UA 3UTOA 5FYLH 4P4RA 3HS0B 5ACZB 1RUQH 3AVEA 4HD9A 3E6FB 2DL2A 1KJVA 2IAMC 4U6XB 4Y19A 3FQTB 4YHMH 5D7JD 1SYSA 3RL2A 3BH9B 4F8TA 2GHWB 4KDTA 5HI4D 4OD2A 5FK9B 3X12B 2JB6B 1RK1B 5DUBA 5MEQB 4YXKL 1WBYA 3MTRA 2G75A 2UWEB 4LLMB 4PJXF 1X5IA 5EZJA 1OL0A 4ZYKA 1NAKH 3NAAL 3QXDB 1MJJB 5EU5B 3IJSB 4CVXB 5TE7L 3ELAT 4P59H 2Q6WA 12E8H 1AQKH 1ZGLP 3BPLB 4WTXA 3P9MA 1QSEA 3IDIA 4M3KB 5SX5K 2VDLL 2FGWH 1KSRA 4DFHA 1F8TH 3DVNA 4XAWL 2X4PA 1XCTB 2GJJA 3NVQA 2ENSA 4GKOA 3UMTA 1PKQA 1A1NA 3AAZA 3AXLA 2AXFB 1H9VA 2FR4A 1XZ0A 3MA7A 2VN7A 4YEFA 4OCYH 1U3HB 3GMQA 5HHNB 2EC9T 4PY8J 4P9HH 1KLFA 4UB0H 1WBXA 3ZDYF 4CJ1A 4J6RL 4I13B 2VDNH 5L9DH 1V7NL 4QXTB 1IAIH 1RJZB 3D85D 1MUJA 4PS4H 5CCKH 2R0KH 3L5WB 4GS7B 4I5BA 3CVIH 1B0GB 4KXZI 3FQRB 1Z3GH 2FDBP 4X9HA 1IM9B 3RY6C 1HK6A 2PR4L 2ENYA 4XX1G 2DIJA 1NLDL 2XKUA 4YE4L 1JZ5A 4G6MH 3L5HA 3QCTH 3T4AA 2NY2C 3CX5K 5I8OL 3HN3A 1HZHH 4LPVA 4OFIA 3OJ2C 5EULV 5BO1L 1QFOA 2XFXA 2JK5A 4DZ8B 3VGHA 1T22A 4Y16B 4HS3A 1VESA 4UTBL 3EYFA 1BVLB 1T03L 5DMKB 2Z8WC 3MNZB 4MJIA 4JRXD 3I6LD 3S98A 2APVA 4I0CC 3BIKB 3UAJD 25C8H 3KPNB 3G04A 4NHCL 4Y8DC 4J4PC 4LVEA 3H9YA 3DUSB 3V5DA 2R69L 4UQ3A 5GGQH 1FFRA 1UH3A 2FL5A 4LLDA 3EO9L 5IM7B 4JPKH 2J4WH 5I74B 5KOMC 3MRHA 4K23L 4XCNA 4MA1C 1JNJA 1XGQB 2NZ9C 4QRRA 1VADB 5TE6H 4NNXB 3OJMB 3DX9B 3ULUD 5DJAB 1OY3B 3KWWA 1F3RB 4ESKA 2HN7B 3MRKA 4YXHH 2HTKC 4FTVE 1WLHA 3AS2A 2KZ1B 1FBIH 4WJ5B 3HUJF 5SWSA 5IB4A 1BF2A 5I1EH 2O5XL 4FS0A 3V0AC 5C1MB 1P7QA 5CILH 3VRJB 1U8NB 2Q3AA 5LJYH 2D3VA 2NXYC 3UTQA 2HFTA 4DKFL 1HZHL 4XXDB 1FYTA 2UZIL 3X17A 1MAKA 5B3JE 2BC4A 2FYYB 1EPFA 4TNWF 4KWUA 1Q9LA 3RIAF 4NJAH 5F9OL 5KJRL 2Z8RA 5LXGH 3MXWL 2FX8H 3G5XB 2VITB 4CMMB 4EOWH 1S7RA 1CD8A 1JN6A 3WFHA 5C6TL 4ODVH 1IKFH 1S5IH 1WK0A 4GQ9H 5CCKL 5I1LB 4L5FL 2H2SD 2QHLA 4V1DE 5DDHB 3NZHL 4Y4KB 3O6FD 4C59B 1SY6H 4YXLL 4PG2C 4LF3B 4UT6L 1X5ZA 5SWSE 3T0ED 3CLFH 5JOFB 3MRMB 3Q3GB 1G9MH 3HZKB 2OP4H 4R26H 2VLRB 5GIRA 5FUOL 1LO2H 1VPOL 3F8UB 3ZDYE 2CDFB 4LK4A 4GW5A 4U6VH 3IXAA 5GJSL 3BPCB 1G6RB 4TN9A 4UTAL 1I1AA 2FX8L 3RX5A 1WBXB 1ED3B 4X5WB 5C0NC 5DHVA 4WEMB 4BQ9A 1EFXB 3PDGA 4I4WB 2X4UA 2AJ3B 4QHNA 4XNUL 1T1YB 1ZE3C 4X0KA 1FRGL 3S5LA 2VTFA 3REVA 5BOPA 4LMQI 3DVNB 3BKYH 2M26A 5F89B 3PV6B 4JFZH 4JHAL 2VLRA 5GIRB 5KVFL 5E6IC 3CFBA 1L0YA 5DJZB 5JOFA 3MYJA 5EU6A 3DRTA 5TH2A 4MJIE 1S9YB 1IM3A 5F7FA 4JR9H 4LSUL 3OR6A 3P11L 2EH7L 1WIUA 5AG9A 1RUQL 4QHUB 3RVXD 4KK9D 1GC1L 1ED3A 4PJXE 1BQHA 2OZ4H 1BX2A 3KGRA 1T0NB 1JWSB 2CJUL 5I9QC 2N7AA 5IESL 1FIGH 2QQQA 1KV3A 4WGVB 5CFHA 1A6ZA 1J18A 1UB5B 4U6TA 1KNOB 4U6YA 1NBZB 3GJFB 4HWNA 4Y1AD 3VDCA 2GJ6A 4S11A 3PGFH 1HH9A 4K2UL 5INCA 3QI9C 4NNPH 2FRGP 5JDSB 5MERA 1T5WA 4TUOB 5DD6B 1DR9A 2EZ0D 3TT1L 2NZ9D 4P57B 4P5TC 4U1JB 3IJHB 5HGDB 2QBWA 3QB7C 2VL4A 1DUZA 4M4PA 4WEUD 1P4IH 1CQKA 4S1RH 2ZSWA 1JV5A 5FCSH 4YQXH 3O3EB 2XNAB 5HYSB 1OWRM 4FZ8L 3SDAC 4YHYB 2VLMD 1CR9L 2O5ZL 1MNUL 4ZODA 4RMQA 3TIEA 1UM6H 1KCUH 3VD5A 1F4XH 2YS4A 3WDJA 4PJHF 2BRQA 1INQB 2DLTA 3AREB 4KJWC 3C60A 1OGAA 3TESA 3HKFA 1TTGA 2BHUA 3OZ9H 1T5XA 3EGSB 2WK2A 5IF0B 3VXRD 2CIIB 1AFVH 3K2MC 2DAVA 3TGXA 1IQWH 4RGNE 3HG1B 1NANI 1ORSA 1F6LL 3JV4A 1GZQA 3TNNA 5SWSB 1FGVH 4KPHH 2O61B 2VDNL 4LCWD 1RZGA 2NY0D 5DZLA 4F33A 4I77H 4NBZB 4LCCB 1JFQH 4NKDA 4FZ8H 3BXNB 1BZQK 1JL8A 1I8IB 1MCPH 1T1ZB 4FQPA 3C5SA 2JK5B 3EFFA 2V7HA 1TZHB 3F7YA 3TV3L 1AGEA 3MRGB 1OF2A 1IEBB 3CC5A 3TPKA 1I3GL 4LASL 3T4AB 2AS5M 5E5UB 3MJ8A 4MXWH 1S78C 2CMRH 1FVCB 4XPBH 3RWDB 2C1OB 1T6VN 4PB0L 4K3DH 4NQXA 5T5FL 3S36H 3INUL 5EBGA 1U0QA 3FCTB 1BFVL 4LPWA 4MJIB 4HIEA 4PRBA 5HYQA 3QUXC 1MF2L 2NY2D 1MJ7L 1T0MA 1ZLSL 3KXFE 3U9UB 4F7CA 3ZE0F 4RCAA 2VZ3A 4ZSOE 4YGVB 4RAUB 1L9NA 4DCQB 3UPRA 2XA8H 3T0DA 2HKHH 4V1DA 1RK0A 2F54E 3DXAA 3LS5H 4GRLA 1FDLH 1ZA3A 5D7SL 1JIBA 1PY4A 1XT5A 5DD3L 4YIQB 5A3ID 1D5XA 1WZMA 2O5YL 3I6GB 1MJ8H 1YMHB 1U3HC 5T33H 3G6JB 1JP5A 2JB5H 3FQRA 2HJKB 4CKVX 4HC1L 1E6OH 4MD0B 3FO2B 4NSKA 1N4XH 4HIIB 3RBSA 5CKAA 4PV8A 5K33A 3VI4F 2XZAL 3MCLL 4U31A 2W91A 4JFEE 2R9HC 4M1DL 5E5RB 3HZMB 4ZS6D 3S37X 2BJML 5C07A 4LSDA 3VXMB 5I0DA 4WWKD 4OZHA 4JFYB 1OM3H 3QUMA 3QXDA 5DJDA 5J56B 2H26B 3SO3C 4MS8C 1A1OB 2FR4B 1R24B 4X4MA 2NY1B 4N0UA 2A6IB 1N64H 4Z0BL 1TJHL 1GGUA 1CBVL 1HQRB 1YNTA 3QDME 1S7UB 2AK4E 4M43H 2WSKA 1FFNA 4S2SB 3MLUH 1GVIA 1X5LA 1UJTA 3VCLA 4ZS7L 3QPXH 1CFQB 4KJQD 5D1ZA 2EEBA 5E2WH 1C1EL 3TJHC 1M6OA 3O4OB 4LLQA 4X7DC 3V95A 5ICYA 4PB9L 4X4ZA 1EJOH 1MI5B 1VA9A 2R56L 2Y06L 3S34L 4LSQL 3VA2C 1Z9SA 3FQTA 3IDGA 4TNWK 4AG4H 2MMXA 3QBTB 3HFML 4FQHA 4Y88A 4M8QB 1NSNL 3DURB 5FYKL 5IK3A 3TZVC 1I9RH 1MH5B 4POYA 4U1MB 1F02I 3TZVA 2IPTH 2PXYC 3VXRB 4BK5A 2A6KA 4L3EA 3IETB 5MEPB 2FATH 5C9KA 3MOBH 4NQED 5IFJB 1CBVH 3SOBL 4RGMC 1F4WH 4RFEB 3FOLB 1B90A 3B9KA 4FQCL 5EA0L 4ZO8A 3KPSE 1T3FA 5MI0B 3U4BH 3WJLC 3VA6A 1OM3L 4WHCA 4NO3A 4N5EC 3GIVB 3QFJA 3HS0A 3GMNA 1N0XL 7FABL 3VWKC 4LCWA 1FNSL 2FBJH 1J0YA 3TT3H 3KXFB 4GG6B 2Q76B 4PRPA 2DIAA 5EO9B 5T1DL 4OM0L 5JNYA 2F19L 4CU8A 4QCIB 4HFWA 2ZCKH 5GRJH 4NZRL 1XF5B 1KCLA 4J4PA 1CK0H 3LKNA 3HR5B 4HWZB 2YA2A 2BOCB 3QEQE 4LEXL 1K5NB 2E9IA 2P8MA 1QLFA 3QDGE 1UZ8A 3H3BC 3LKPB 2AXGB 2NLJA 2QADD 2B20A 4JJ5B 4MHHI 5T3XE 5IW6A 4HJGA 4I2XB 5EWIH 4M7JL 3VH8B 2H1PL 4F57H 4JLRB 3IFNH 2IG2H 1WGOA 4S1QL 4YDLB 2X4NA 2NMSA 4JE4B 4S1SL 3TBSA 4ZUSB 1QKZL 5J3HD 1WCBA 3KLDA 4FQQB 1JVKA 1EDQA 3O6KH 3TEUA 4N1HB 4NC1E 2VLKD 3O3UN 4IRSD 4KAQH 3OHXB 3PWPB 5EIIA 1GXEA 3S3JA 1OAZL 3STZB 4HV8A 2ZKHL 1VEPA 3GRWA 3OKDA 1EZVX 2WP3O 2VIRA 1WZLA 1YNLH 1ZLWK 5CEZE 2BRRH 3L3HA 3SKOA 3ARBA 4CJ0A 5LWYH 4OQ1A 2VDOH 4Z78A 1YZZA 1PG7W 4I0PA 2YD3A 1CGSL 1FPTL 2BNRA 2DTMH 2FECI 5FYKU 3GSVB 4OLUH 2J6EL 4U1HA 4ZUWA 1ZHNB 4D9RD 4HFUH 5DJ6B 5IHZB 2DLIA 5FO8B 3JV6B 4HLJA 3O9WB 1RIVL 5IB3B 4G6KH 1E4WH 3ARGC 1KFAH 1PJ9A 1T04B 4WHYG 5SWZB 3C5ZC 4JM2F 1DZBA 4XWOD 4ELME 1CU4L 5F1SA 3GJEB 1I8MA 4HPOL 1CL7L 3UEZA 4PJEA 4RA3A 2ITCB 1S9KC 5GJSH 1VDGA 1BEYH 3BO8B 5KN5B 1CD1B 4FQJH 2YA1A 4GG6A 4GMTH 2ZSVA 1IC5L 3WMSA 4KVCL 4GAJH 3ISWA 1UM5L 1AP2B 3A67L 3U83A 3NTCH 2HVJB 3QA3B 2ZOKB 5M95B 5DJYB 4WTZA 3VI3E 4P2YA 2GUOA 1SY6L 4NYLA 1MQ8A 1JGEA 2KQMA 4XMPH 3VFUB 1DQQB 4U6HA 3ZTNH 4XC1L 3FN3A 2H2PC 4LOUD 1J1OL 3CIQA 4BFGA 4KK5D 1QRNA 4GW4B 4MB4A 1X9QA 1KACB 3E8UL 3MROB 1YEHH 4FQIH 4XNZC 3P9LA 2J8UA 5DJ2A 2QV2A 5FF6A 4KI1A 4L4JA 1BZ9B 4YX2L 1B2WL 1BBDL 1PDKA 1HH6A 3FQXA 5DD0L 4JFYA 4EDXB 1FSKC 5B8CC 2GUOB 2Q7NA 3NIGF 5FUCE 1TFHA 5C07D 5LBSL 4R2GC 1B4JL 5JLZB 4PJ8D 4DTGL 4ZOCA 4F7MB 3LH2L 2Q3ZA 4L1DA 5CEZL 4JB9L 1KGCE 1FGNL 4WEBL 4HWEH 4G8EB 4LARL 1AIFA 2PXYD 1PKOA 4RDQF 1WFOA 1MVUA 1UKQA 1CGXA 1UJ3B 3MRRB 4WWKC 1EHLH 2ZCHL 2OS7A 3HRZB 4YLQT 5JPNA 1XF4B 3I50H 2Z4QA 3T3MF 3ES6A 2UY6A 4LHQB 4G3YH 3QUYD 2A0LD 2R0WL 3HZMA 3KLHD 1PSKH 4ODBD 3MNVB 4RMSA 5IVXE 4H88H 4HIHA 5CZKA 3DXAB 3RZCA 3KJ6H 4HH9B 5ID0A 2YR3A 3LEYL 3V6OA 1MHCB 3LKOA 3BGMA 5FYJD 1INEH 3NPSC 1YN6B 3CK0H 3TCLA 3R8BB 5I30H 1UB6B 1F00I 2C3XA 1FFOA 4HPOH 1DLFH 2VZ1A 4K23H 1LEGA 5JTWA 4RFOL 1BZ7B 3LCYA 1WIOA 1KOAA 1MI5E 1E4WL 3BGFC 4ELMB 4HEPG 1JGDB 4QRPE 1IEAA 1NDMA 3GBLA 4GMSH 4L8DB 1YQ2A 1JTOA 4LCUB 3JUZA 3SGKC 3VGFA 2XWJB 1OARH 1FZMB 4O51B 4JZOA 1F6AB 2D7QA 4PG2A 5JIHA 1A2YA 4PGDA 5FYLD 3ARGD 4EI5A 1V3MA 2YPLB 1G7LA 1F11B 1IT9H 1TZIB 4OGAC 1JNHB 4PRNA 5D6DC 1CDYA 4OGAD 2ED8A 1JMZA 1GC1C 3C8DA 3CFEA 3WIHL 2D7MA 3O11A 2XRAH 4OGXL 5LGJB 2GTZB 4N9GA 4G6AC 4X6BA 3ZDZE 5J11C 3LKPA 5IW6B 5EG6C 1I3RB 4Z7WB 3J7HA 1YNLL 4KQ3H 1XGTA 4MXQC 1Q0XL 3X14A 2V5RA 4PJ7E 5IGXL 3RNQB 5L8KB 3ARFC 3IB4A 3CFJA 4GUPA 1KTLB 1JPSL 1ZS8B 3IVKB 3KPLB 3BEVB 4ZTOH 2DIBA 3C5JB 2CR6A 1KN2L 3TN0D 4DN3H 5I1CH 3EYQD 5JW5A 2D7TL 3ARQA 3SE4C 4W81A 1CLYH 5BVPL 4G7YH 2WNGA 5DMGC 2VL5B 4PYHA 3T3ME 1KCRH 2BNUB 2JJSA 1DCLA 4GG8B 4ODHL 1P9MA 3MV8D 4QY8A 5E2UH 3O4OC 4P57A 4N0CC 4NN7B 1ZSDA 3OKEA 1G1CA 1U6AL 2V6HA 3UXFA 4LEXH 4YHZL 1KIQB 4OZGF 4X6DB 5KSAB 2KPNA 3ZO0A 4Q9CA 4XZUA 4G6KL 5HGAB 5SWSD 2J3SA 3BP7B 3GDBA 2Z31C 5BQ7A 1W72H 2V2WA 2FZ3B 4FQHB 3X3FH 4H88L 4MLSA 4M1GL 4WI8A 1I9JH 4OCWH 2EYRB 5A2FA 2VR4A 1AI1H 2GJ6B 5KSUB 3QJHA 5BVJA 4QOKD 5IVOA 1KCKA 2X4TA 4LFHD 3RDTA 5SWZE 1A6ZB 1UB5A 4KJPD 5B22A 3ARVA 3VXOA 5IVZA 1CLZH 1MFEH 4IIQB 1I85C 1YEFH 2ORBL 3MR9B 3UTTB 3VI3F 2BVQB 3ZLQC 5JQHC 1Q9KB 3G08B 3THML 1AGBA 1JF1A 1TVHA 4KHTH 3VFRA 4L8CB 1N6QH 1I1AB 3W11C 2H2PD 5BV7H 4EIZC 5IVZB 4DVBB 3NIFE 2DYPD 3FO2A 2HKFH 1CXLA 4LPCA 1TNNA 3QWOA 4F15C 4UUJB 5AYQA 3KPOB 4NKMB 1GL4B 2D0HA 2BVPB 3UZVB 1YMHA 3D0VB 4BJLA 4F7EB 4JHZA 3FJTA 3QEHB 4PY7A 1FN4B 1MEXH 3U2SA 5E8NA 3LQAC 5T3XL 4P9MH 2YD2A 3VXSE 1BQLL 3BP5B 3KLAB 3F65A 1AO7D 4QTIH 1HYSC 4F58H 5TF0A 1BFTA 1ZGLM 1QRNE 1R3KB 4GKNB 4YHOH 4XP4L 1A8JH 2DI8A 3WN5B 2FSEB 4RIRA 1I9IL 3K8MA 1FAKT 2XXCB 5HVHB 3FT3B 1BBJA 3V8CA 3STLA 1LHZA 1K85A 4GMSL 3WIFA 4PP2B 3BSZL 1OQOA 4P2CG 3DO7B 2GK2A 1JN6B 3WFHB 3WLBB 2VAJA 4PR5B 4WV1C 4KDTC 1U8HA 4QHLA 4NFCA 1F13A 2VERN 1JWMA 3BI9X 2OMBA 3ARGB 4GAGH 4FP8L 1NCAH 3C5ZB 3UCRA 1Q9LB 1NUNB 1LE9A 5DJAA 3QG6B 4PRPD 3ZKMC 5C0GA 3KNBA 3MCKA 4M02A 3RGVC 2A83A 5GQBA 2Q7YA 4K94L 1IKNA 4IHOA 4O2FB 4PJFA 4JO4L 1OHQA 1K8IA 2FIRT 4N0RA 4N9GB 5IVNA 2E6QA 2HFGL 3RHWF 4MWFB 3DHJA 4WO4C 1MCRA 1QKZH 5BZWB 4P5MB 2JJUA 3V52L 4UQ2A 4PJDF 3S6CA 2DKUA 4UIMB 3L6FA 5A1AA 1EVUA 1JK8A 1TCRA 4PUBH 4RQQA 4JREC 3BDYL 4UDTB 3MGOB 1EFQA 2CDGB 3EOAB 5AUMA 5F6IB 1D6VL 4M03A 5DA0B 3WCYA 4DZ8A 3QUZA 4OTXL 4CDGC 4BFIB 1FZMA 4DFIA 1MY5A 2BX5A 1NDGA 4JM4L 5B3NA 1O0VA 1I9EA 1HHJA 1DBKL 4WU5B 1C12B 4N8CL 3QDGD 1XIWB 4GAYA 2XZCH 5C0RL 3WFBL 3AMKA 3V5DB 2OR9H 2XKSA 4FFWC 4PJ5B 3T3PF 4RX4D 4FQXD 4R4ND 3NIDE 4N5ED 4POUB 1MNUH 2IBBA 2W1NA 5ANME 1CFVL 3QDMD 1WC7A 1FSKB 5DF0A 3U4BL 5I1GH 5ID0B 1LK3L 1RJZA 3BRDA 5L8LB 2BSRA 4DK3A 2NTFB 4L4TD 1N0XH 3D1MC 5HJ3A 2DBLL 2HT4C 1QO3B 1UJ3C 4WWKB 1RIHH 3ARTA 2LFGA 3U36B 2OTUB 4MHHG 2FCBA 3K8KA 4G7VH 5JPNB 4UBDC 1CS6A 2BERA 2P5WD 3L3KA 4OUUB 2Z35B 4MD4B 1Q9WB 1Z9LA 3QDJA 4X98B 1S7WA 4KVCH 5ESVA 4H0GA 2Y36H 4ORGA 3QCUL 1FNEB 4NNPL 3IKCA 4QTHB 4NWTL 1NKOA 2XWBA 4LSPH 3LRGA 3MFFB 1FNGA 3TNMA 4W68A 3I9GH 5AAWA 3X11B 1RIUL 1JTTA 5EU3A 1P84K 3WFEL 3PIQB 1UM4H 4WHTB 4XPHH 4GRWB 2QKIA 2D2OA 3GIZH 4LQFH 3KDMA 2ESVD 3CDGA 4LSUH 4P23C 4BZ2H 1P6AB 5K9QI 5F8RC 2DYPB 4G8GD 1NKRA 3NACL 4K8RL 4WI3A 3SDDD 3ZKXC 3IDMA 2EYSB 3I84A 4NP4H 4KMTH 1JGEB 4E41B 4GAFB 1U8OB 4NQEA 4HKJA 2XN9D 3UROR 3P4OB 5CBAB 5DO2D 3MXVH 1DVFA 3LPFA 2PXYA 3EJZD 4JZJA 4AENA 4PJ9A 1D5ZA 2EIDA 2RCSH 2V9TA 1R3IH 3HMXL 2EYTB 1IFHH 4OV6F 4OB5L 4P3DA 3RWGB 4X5XA 4ZSOA 5FK9A 4HC1H 1D5BA 4X6CB 2E8YA 4IJ3C 5ANMA 4Y5XC 2IG2L 4BH7B 2H1PH 1ETZB 2I27N 1TJIH 3UTQB 1OGAE 1INDL 2VUOA 4K3GA 3LHPH 1KLGA 1LE5B 1RZJC 2Q20A 4XVJH 5B38B 4OT1L 5JW5B 4YHIB 5DQDH 1FLTX 2PTTA 4HDIA 1K6QL 4DZBB 3TVMB 1J05B 1BQUA 5EB9A 3TC9A 1I8KB 3AROA 5CJBA 1FO0L 3FT2A 3STLB 4ENED 5IB5A 3RNQA 4D9QE 1VADA 2CGRL 2YN3A 1TETH 4YFLI 3V4UH 4XCEA 3RWCB 3S7GA 5E8EB 2JCCF 4N1EA 5GXBB 3DMMA 1J8HD 5SX5H 5E99H 3VFSB 1PQZB 4Y5YC 1N8ZB 2W0LA 4YHML 5AZ2L 2IANB 3OQ3B 3EYUL 3GUTB 3ETBF 5F1NA 4TOYH 43C9A 3BQUB 3UTTE 1UA6H 1H8OA 3QWRA 1DQLL 1A9BA 1T22B 2EDEA 4BKLA 3IGAB 3EDKA 2Q8BL 2IC2A 1J10A 1N3NB 4LCUA 2JIXD 3O8XA 3KPOA 2YC1B 2CDEB 4NKMA 1NEZB 4DOHB 5C0BE 3ARDD 4AEIH 3M17A 1EIBA 4YUEL 2R29L 4AY0A 1K4CA 2V7NA 4YQXL 2QHRH 3FO0H 1YYML 4ZS7H 2VLLB 2OQJB 4NUJA 3UPAA 3CVHB 3IU3A 3MLUL 3QXWA 1JUFA 2LQRA 4QF1B 1F4XL 4TULL 4Z0BH 3LV3A 5C0BA 1CGTA 5DVLA 3WJJA 4M6OL 1XR9A 3VU2A 3WUWB 3Q6GL 4NOFA 3TIDB 1JBJA 4RMWA 4W6YB 3BZEB 2X4TB 2X1PA 3IRZA 3P3YA 2VXQL 3BAEL 5EC1A 1UACL 2H6PB 4ONHA 1E6JH 2P24B 1F4HA 4FFZH 3GB7A 2WBWB 1FH5L 1IAIL 3FFCE 3EOYG 4R96B 5EC2B 3HB3D 1VERA 4EUPB 3D69B 2K3TA 3SKNA 4H5SA 2D31B 1V3JA 4P2RD 1RUPL 3EJYD 1KCSH 4M7LT 5C09A 1XGPA 4OFDA 2E6JA 2O5XH 4I3GA 2R8SL 3KPRE 3DXAD 5HYFA 4HKJB 4O9HH 3SE3A 4K7FA 5E6ID 4JANB 3HNVL 1ES0B 1XGYL 3QIUC 2BXZA 3FKUS 3SDYH 2V5YA 3SDAA 3GM8A 1WQVT 5EFIA 1U95B 2VLJD 2R1YB 3LPWA 4GFTB 4LLMA 3CUPA 2IQ9H 5FM5O 4QRSB 3U0PB 5FHBL 5C09E 2AJXL 3SJVB 3CX5J 3UYRH 4IRSB 1QA9B 3NOIA 4P5TA 4XAWH 1A3LH 2BNUA 2Y5EA 5I16B 1H0DA 4FFVC 3KS0J 3C6SB 4XNQB 4PGEA 3VFUA 1DANT 1AHWB 5D71H 2NR6D 3DROB 4MXVF 4P2OB 3OR7A 4HWUA 3S37H 3UBXB 5A43C 4OZHB 1AQKL 3EOAA 5FA4B 4G6FD 1ONQA 2YK1H 3TO4B 4KTEL 4UT6H 2VXSH 1OAUL 2AABH 2BSSB 1QSFE 1OVZA 4G8GA 2EDRA 2GAZA 2W0KA 4PJHE 5IW1B 1NGZB 2EDDA 4UT9H 4P46C 2GCYB 4PTTB 5LGJA 4JRYE 1ROWA 3U9PH 1TTFA 2PO6D 1JNHA 1C08B 1KN2H 3DX7A 2QJDA 4U1KB 1ZA3B 3QG6A 4WY7H 5D1QD 4UV4H 1C5CL 5DSCA 3P0VH 4K7PX 3UYPA 4KY1H 1G9NC 3GKWL 3AUVA 1NFDE 4HZAA 5JA9A 3ULUH 3EDDA 5D72L 3G5YA 2UVFA 5E1HB 1MJUL 1Q72H 3TM6A 2NW3B 2V5MA 4LP4A 2NY5C 4P3CL 3SBWA 3D2UB 4MLIA 1FE8H 3VFGH 1P4LA 5ICZA 4WI7A 3RJDA 1UZ6F 2DJUA 2JJWA 4DEPC 3VFOA 3HC0B 3CC5B 3HI6H 3HA0A 4EN3D 4H1LA 4QRQB 5KW9L 3NABL 1NCDL 5CD3B 2VDLH 3QEQB 1DEEA 4BFIA 1DBJH 2DQEL 1T83C 1VGEH 3TA3A 5I1DA 4G8IB 5I8KH 2C4XA 4OZFH 3U30B 1MPAL 3ULVH 1IE5A 1TCRB 4YNYA 1H5BA 5KSBF 2Z9TA 3KYOB 7CGTA 4AL8H 1J86A 4JPKL 4XVUD 3TBWA 4RGND 3GSXA 2KDGA 1H3WM 4LGRB 1S7TA 2N1KA 3QIWD 3S35L 4B7IA 2WUBL 3DMMD 2HMIC 1U91B 1FFPB 4JFXB 4WI2A 4OV5A 4CADA 2VLJE 2CUMA 3W9EA 2QEJA 3AS3A 3LSOA 5HHXL 1T66D 3QWOB 3WEXB 2R23A 4G8GB 5F1KC 5JUEH 2ZUQB 3LEYH 5IB2A 4P3WA 5E94B 1PY9A 5FOBA 5JLZA 1QRKA 4DKEH 2DBLH 4HX1A 2AV7B 3TVMA 4P0DA 5FYJL 5TE4L 1QYGH 1MELA 9CGTA 1DQJA 3S4SB 5F7LB 3RKDD 4L9LC 1YEJL 3EYOB 1RIVH 4F37K 2NZIA 4W6XB 3DSFH 1RAMA 3WD5L 2WUCH 3P9LB 4YPGA 5D2LA 4TVSa 2BSTA 5CJQH 1T3FB 4ODSH 2VXVL 3BZDA 4WFFD 4I18A 5B4MD 4ZNCD 4ZFZB 5J6HB 5JIIA 5L6YL 2VKWA 3MV8E 5DLML 1FGNH 1UXSB 1XMWA 4WEBH 3ZKXB 5EFIB 4L4VD 4GKNA 1JGVH 2H32H 2P46B 1FG2B 1KPRB 2DQIH 5GGTA 4PJBE 3T2NH 4Y16C 4PD4K 3MV01 4KKBD 3Q5OA 1JHLH 5JXAH 1NCCL 1D5ZB 1D9KB 1CQYA 3RDTD 2DQJH 4WFFE 3NZHH 4WY7L 4Z8FH 1YMMD 3OXSA 4J6RH 1CD9B 4XCYA 2X4RB 5LGHH 5HDQL 1KB9K 5I6XB 5I74C 5B38G 5F7WC 5ICYB 1HDMB 4JKLA 1A7OH 5HYJD 4D9RE 2X1OA 1KG0B 2FH6A 4QWWC 4MQ7B 3KDMB 3CFBB 5KJRH 5F1IB 2ICWI 1NC4B 2DLFH 5ITFB 3L3JA 2F74A 3SBWC 1GCFA 1T1XA 1NBYB 1RZKH 1NFIA 5GGUB 1LNUA 3X11A 4E0RA 4XXCC 1WTLA 2PN5A 3W5NA 3M07A 5D2LE 3G08A 2NXYB 3LEXA 4QNPF 1MHPH 4M7LL 1CIDA 3W11D 1WWBX 1EEYB 5D7JC 1SJHA 1NBQA 4OZIE 2P8PA 3BT2L 1VENA 3I02A 1XGUB 4I3RH 4PRHB 5HHPA 4XP6L 4KXZH 1I3RA 5E8DH 3G6JA 1EGJL 3L5JA 4M62L 3LSOB 5CGTA 3BEWA 1X7QB 4PRPE 3RUGB 4BA8A 3O45A 1KCSL 5CAYB 3W39B 1IRAY 5CWSA 1S5HB 2ERJB 4KTYA 4JFOB 4HULB 1VKXB 1MCJA 2F58H 3DRQB 2B4CL 4YBQD 2EDFA 4JVUA 5IT2L 4MB3A 1DBAH 5EOCL 4YNYB 4XNYL 1IGYB 1I4FB 3QR2A 5I75B 1HHGA 4XZUB 5FKAB 3TBSB 4LSQH 1WIPA 5JR1L 4YGVA 4XCCL 5D1QB 4NHUB 3VWJC 3WIHA 4KDWA 3ZE1E 1ZEAL 4WUKL 5J1TC 4X4XA 1ZHLA 5DS8B 1U3ZA 2AKRB 3I75A 5E8EA 4QRQA 1QR1B 4ZPVA 5HVGB 1NFDF 2GI7A 3VFOB 5IMKA 1ZSDB 1Q0YL 2Y4SA 3ZTNL 1EJOL 1JYWA 3IDNA 3D3VB 4HUWA 3WUWG 3HI6L 4M4RA 1YQVH 3BZ4B 5GJTL 3DV6A 3SJVD 5D7LE 1NCUA 2X09A 3FMGH 1NDGB 3JTTB 4YE4H 3S4SG 3QUYC 3ABZA 1G7HB 4QRPB 3BXNA 4ZO6A 5DRWB 1WSST 3U46A 5GGSY 5E6IB 5KVMC 3CFJB 3KVQA 2JJTC 2PCPB 5D5MF 4YUEH 2PYEE 5IOPA 3NCCB 5D7IB 5I18L 3SCMC 2XZAH 5E4EB 4C4KT 1FNFA 4R4FL 5D7LA 4B5EA 4JAMB 5FECB 3O9WD 2VC2H 4QWWD 3KNBB 3PL6D 3TT3L 5IFAH 2OL3B 1CGUA 4PJBF 1FVEA 6FABL 4TNVK 1DN0B 2QQKL 4X6FB 2FEDD 4MAYA 4Z7WE 1EUUA 5EUKB 3ARGA 3RL1B 4FXKA 1QEWB 5DR5L 1DLHA 4JDVA 4M7LH 1UWEL 3UBXA 1OW0C 2J12B 4PGEB 4H25B 3DO7A 3SKMA 2ZSWB 4PJAE 3MOQA 4TRPH 4NWUL 5T5FH 5C8JB 2OBGA 3LB6D 4IRSC 2Y36L 4KKNA 2B1AH 3TN0C 2A1WL 1SM3L 5FYLE 5LCVL 1MJ7H 4KQ4L 4NO2A 2APWA 2R1YA 2NNAA 2OL3H 5BS0D 4G7VL 3WHXB 1AHWC 1FFOB 1GYAA 1C16B 4O2CB 2LE9A 3O6FA 5EU3B 3KLAA 1KNOA 3QULB 2UWEE 2R0ZH 3WNLA 3MFFA 4JDZB 3SDYL 5L0QB 4P4KB 2EDJA 5JXEA 3JZ7A 2K9UA 1Z5LA 4JPIA 4KKCC 5L2JB 1A1MA 4KHXH 3TBYA 3RWEA 5H35A 4LQ1A 5K59E 5DTFA 3OR6B 5TPWL 3PDOB 3MODH 1A3QA 4ONOA 5F9JB 1XH3B 4BQ8A 5DJZA 4PIRF 4LNRA 2FJHB 2AJVL 1KIUA 4LCCC 4LHJB 4PJGF