3BN9D

Crystal structure of mt-sp1 in complex with fab inhibitor e2
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
229
structure length
211
Chain Sequence
QVQLVQSGGGLVKPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCARPYLTYPQRRGPQNVSPFDNWGQGTMVTVSSASTKGPSVFPLAPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Fab-protease complex reveals a highly specific non-canonical mechanism of inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Membrane-type serine protease 1
total genus 35
structure length 211
sequence length 229
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bn9D01
3KYKH 8FABA 2A77L 2H6PA 3Q2CA 5CEZL 4XBPB 3SDYL 1H3WM 2OR9H 4GS7C 1ZLWK 4WUUD 2L7UA 2JLLA 3H3KA 3QDHA 1A6PA 4O51B 3IF1A 3QXAA 4ZPVB 3O2DA 3HZVB 5B22A 4LRNL 2BY3A 3QNYA 4KRLB 4V1DD 5L8KB 1DBKH 5KS9F 4EUPH 1O0VA 1RZIA 2DLEA 1N64L 1FG9C 3GBLA 1UCBL 5HHXH 2GI7A 1UA6H 3GO1H 4OLYL 3VE0B 4ETQB 5LCVL 4G9FD 4CMHB 2FX8H 3NZHH 3GUTB 4LFHD 5JO5A 3GB7A 2DKUA 2EDOA 3DXAE 2JIXD 1UENA 5C0BB 3KJ6H 4UILH 4LRNH 1RHFA 3RWDB 5D70L 1BWWA 3V5DB 5EU5B 2WBJC 4WHTA 4AG4L 3MRCB 4FQIH 1AGFA 5L7XH 1MLCB 5EOCL 4B0MM 3UPAA 2AJZA 2GY5A 3GBNL 5DT1L 3UO1L 25C8H 1M4KA 2JIXA 3BIBX 3GSXB 5IMKB 5J1SC 3DV4A 1YYMH 3S5LA 4HS3B 1LK3H 2CKBB 5DJDA 3CNKA 2FZ3B 4Y19E 1M05A 5IEHB 4O2CB 3I02B 1ZGLP 3TO2B 2MQ0A 3VRLF 4G8IA 5EPMB 4R7NA 4LDEB 3GGWA 2EDFA 2EIDA 4HK3N 3VI4F 2VQ1B 1OQOA 3B2UC 4Z7OE 4TNVK 4MMZC 1V3LA 5CJ8A 3WO3B 5TJWK 3FO9B 2VZ3A 3RBGA 2NY2B 1TZIB 4OGXL 4YFLI 4KUCD 4LU5L 4QHUA 4O02H 2HTKC 1CICD 2XI9A 3S3JA 4TVPL 1OB1A 4ORGA 1G7PB 2RCSH 3QFJA 1RK1A 1R5VB 5D1QB 4OLWH 1NFDF 3F5WB 3BMVA 1RULL 2VXUH 3SJVD 2QHRH 5C71A 3GSNH 4L4VB 1MCHA 1MI5A 1BPVA 4DKEL 1SJEA 3FOMB 2VLME 3L1OL 5EU6D 5DA0B 4AEHH 4F33A 1IE5A 4LSSH 1P9MA 1CDJA 4EDWH 2O5ZL 2E7LA 1XR9B 3EO1A 2CKBA 4YHKH 4FQ2L 5TDPB 4X6EA 5A16A 2K7PA 4XX1G 4X7TA 3PHOB 1BVKA 4CADA 2CRYA 3I3EA 3BZ4B 3S3PA 3SPVA 4XP5L 1UWGL 2XZZA 2JK5B 3DURA 2HJLA 4ZO8A 1CFQA 4IS6A 1D5XB 5ID0A 4WJ5A 2C9AA 2DAVA 5KVGL 2NY1D 5I15H 1I9RH 1F90L 1FVDA 4OLEA 4C57C 4ZUVA 2RFXB 3SDXB 2Z31B 4XNZB 1QFWH 1U36A 2OXGA 4N9GB 3PDDA 1WCQA 2EYSA 5EZIH 1SJXA 2VITA 4P9HH 1P4BH 2VMFA 3I9GH 2NW2A 2YKLL 3MCKA 2WBJD 3FONB 2UY7A 4NCDA 1LO3L 4M43L 2PYED 3O45B 5GISL 4D0CA 1BGXL 1DQTA 1G9ML 4OCYH 2AEPL 4JFDE 4D9QD 4IRSC 5K9QG 4MJIE 2AXHA 1BFVL 2A2QT 1FHGA 2E3VA 4U1MA 5GRUL 3K1DA 1BEYH 5MP6H 5MP6L 3WN5A 3WE6A 4HT1L 5F96H 4NBZB 5TPWH 3VFMA 5EU4A 5HYFA 4I1NB 4HCRL 3MBXH 1BGXH 1VFAA 3B9EA 3C5ZA 3B2UD 4OSUH 3U1SL 5ISZA 1H15A 2AJYH 4QHLB 3C8HA 1HH6B 3BXNB 1LO4L 4M7JL 3WKMH 3F65A 2HTKD 1JK8A 4I77L 3T0EB 1PYWA 3QFDA 4Q58C 1JZ8A 3QIBD 3ZSTA 1U95A 2PXYC 5CIPA 3OZ9L 3C60C 4Z7WF 5IMOB 4XAWH 4UV7H 5J12C 3DXAD 4HDIB 5KS9E 5DRWB 3O3DB 1YEHH 5FYJU 2VXTH 1AC6A 1NUGA 4PJ9D 1RJLB 4X6DF 4XP5H 3M8OH 2YPVH 3H9SB 1KBGL 4PJCE 1Q0YL 4K23H 4WNQA 3S98A 4U6VL 3MGTA 4LGRB 5GGQH 1AXSB 4EI5B 3C8KB 2F8VA 3TO4D 1BZ9A 2HWZL 3TZVD 4CNIB 3UP1A 4WIQA 4ZYKA 5DMYA 4GAJL 5TE7H 3LV3A 4KVCL 3OR6B 4HMEA 3MOBL 1NFIA 2CO7B 5FDYA 2F53E 2DD8H 3LN9A 5T1MA 4Z0XA 4XRCA 1AGCA 2B0SL 5F88A 1EHLH 3W2DL 4LGSB 1CF8H 4KZDL 2MCG1 1T2QH 1T2QL 3GKZA 5DJ0A 4ZXBA 4PBXA 2ZPKL 1U8JA 3GM8A 4XNYL 1SQ2N 2HKHH 3Q5OA 4MQ7B 2QSCL 2VXSL 1JMXA 2O5XH 1KN2L 5I2IA 2NY1C 3QJFB 3C2AL 3WFEL 1MJJB 4R7DA 4GXUN 3DVGA 3V5KB 3N06B 3VRLE 2BERA 5L2KB 1LEGB 2IPTH 5FM5M 3QI9B 1T1XB 5DWUH 5GGSA 3W0WA 4UUJA 5INCA 1GGTA 5E03A 5IW3A 4O51A 4OCLC 1GYAA 2IG2L 3VXMB 2J6EL 5D7IF 5A2JH 5BRZD 2XZCL 4HH9A 4P59L 1JUFB 1INDL 5SWSB 4J8RB 3PJSB 4K8RH 3U4BH 4FNLL 1RV6X 2UVFA 1FO0L 3DSNA 5FO8B 1JGEA 2OR8A 4IMKC 3LKNB 4MJIB 4ENEC 4QRUA 2QQLH 1QRNE 1T1WA 1U8KA 2JJSC 4GOSA 1JZ7A 2IFFL 5GPRA 5CD5C 1EX0A 2IEPA 4PJ5A 3QNXB 4H26B 5I1HL 5I19H 1GZPB 3BDBA 4NKOA 4XVUC 4LQFL 4ZUSA 1H5BC 1KTLB 3B3IB 3VXQB 1AO7B 1T5WB 4YDLC 1OPGH 1TVBB 5C0EA 2X4PB 3VFWB 4M9PA 5KW9L 3QI9A 1UC6A 5GGTL 4LCIH 1FVEA 4DK6A 4X4MA 4TUOB 3QHZH 4Z7WA 4QTIL 4WEUD 1EO5A 4WWKC 3DYMA 3RKDC 2C1PA 4JREC 4NO5B 4I5BA 2R4RL 3ME0A 3NCCB 4DVBA 5DGRA 4HKZB 1U41A 1S5IL 2NLJB 1IC7L 4N9GA 2RQ8A 3MTRA 4KUCF 4TNWF 3HG1B 5HVFB 1RJZA 4PRHB 3K74B 3CZJA 4LSRL 3WIFB 3VXSB 2CR6A 5DUBA 3TBVB 4LF3B 1LDPH 1A7OL 1LO5B 1MCQA 1T0PB 5F9OL 2KQMA 1D6VL 5L7XL 4Z7QF 4LLYB 2HMID 3RKPA 4KKAD 4OCXH 1KELH 1WV7T 2A73A 2FJHA 3KYMA 1JGVL 2R23B 1EVTC 4RNRB 3B9KB 1MHEA 4P9HC 4E9LA 1FFQA 4XBEH 3RWGA 3LKSA 5EC1A 1T7ZA 5HGHA 2GW5A 3HZYA 3S4SA 3TBYB 2B5IB 4LPCA 2B2XL 3H9SA 4Z7WE 3KPSB 2BFVH 3HG1D 4X6CE 2D0FA 4GBXD 2R9HD 1JYVA 1OWRM 2OJZL 3VXOA 4HEME 1ZS8A 2IAMB 4HV8A 3UTSA 4BZ2H 4Y4FC 4TTDC 1NEZA 5J13B 4PJBA 2VAJA 3EOAA 3JWOL 1J1XH 3O0RL 3ULVE 1TVBA 1PG7W 4HPYL 5F9WC 2WWMC 1L0YA 3D0LA 5IBUB 5DJYB 2AK1H 4UNTA 5ELIA 3PV6B 1W0VB 4RA0C 5C0ND 2R56L 1F4YH 3MNZB 1MH5B 3TO4A 1FH5L 1N0LA 2Y7QA 1WITA 3GMOA 3A6CH 1NFDB 2LU7A 4K3GA 1OGAA 4D0BB 4YXHH 4F7TA 4NNXB 4RGOL 1RZKL 1M05B 4I18C 5EBGA 1HOCA 3IAPA 2Y1VA 3RJQB 3WEXB 4PJGE 4TSAH 4Y2DB 1G7IB 1AD0A 1H3TA 2NY3C 1A47A 3P77B 4KHTL 2Z31C 5D7JD 1S9XB 3QQNA 1WZMA 3KHOA 3OF6D 2EZ0C 2XTLA 1RZJL 3MJGX 4Q6IA 2EE2A 2YPKA 4JFYA 3VXPA 1JZ6A 2R1YB 2FGWL 1NGZB 5EIIB 4LK4A 2IH1B 3OAUH 5H35B 1AXIB 3NAAH 1U93A 4U1JA 2XXCB 4QO1A 4RGND 1UB6B 1I75A 1MFDL 4FFVC 1NCNA 2GYSA 1CK0L 2ICES 2XIDA 1S9VA 1ZEAL 3CDFA 4Z95L 3SGEH 1MVUA 2HP4A 1U0QA 1ED3A 1PX3A 2FYYB 1IAIL 2C1OA 2ADGA 3FB6B 1I8MB 1H5BB 2X4UA 1Q38A 4NOBA 1KTDA 4YPJA 1LDSA 4Y16C 3V52H 1NAMH 3L3JA 4MX7B 1KIQA 2DQFB 5D2NB 1RIUH 1U8NB 4YGVA 5EBMA 2DYPD 4H5SB 3N1QC 4LHJB 3RDTB 4ELMB 3D2UA 5T1KD 5HYSB 2Q87A 3I6KA 4OM0H 3DX7B 3W11D 4U1IA 3O2WL 4LARL 5E08H 3B4NA 3V5KA 3CXHJ 2VDOL 4AQ1B 5GRXG 1RVFL 2Z35A 3O3BB 5DEFB 1F2XK 4M5YH 3MQIA 3Q6GH 4G9FA 3BW9A 5DTFA 4I48B 1B88A 1A6VH 2ICWB 4C55A 5C0DA 3DWTA 5IBLC 3RVTC 1EO8H 1IM3B 1LDPL 1IC7H 5LCVH 1AKJB 2ZNXA 4NQCA 5A1AA 4JVUA 2RJMA 5IGXL 5DK0A 2G2RA 1P7KB 3EZ8A 4OM1H 3ZE0E 3T8XB 2P48B 4AEIH 1NKRA 5C0CD 3UJTL 4HIXL 5FYLH 2JJTA 3LN4A 2YPKB 5E8NB 2KUTA 4PJIF 4H8WL 1JGUL 2L7JA 3QEUA 4Z7UE 3HAEA 3G6JA 3K3QA 1JGVH 3P4LA 4NQEE 2N7AA 2R9HC 2VLKA 2WLZA 4S11A 3IDJB 2FEDC 3AROA 5J13C 3TNNB 2CK2A 3U48A 3SGKA 2GTZB 1EH9A 2V17H 4DZBB 1MWAH 2J3SA 3BT2H 2R1WA 4KRMB 1A14L 2V2XB 3TIEA 5I30H 4X99A 5BS0E 2Y06H 4ZUWB 2ZG1A 1ORSA 5HVHB 3ZL4H 4PJFA 3STBA 5MEQB 2MJWA 1OAZL 1MFAH 4K9EC 3SDAD 4HV8B 3UTSB 2H3NA 1X4ZA 2DMKA 1DFBH 4OCNC 4PJEA 4QOKE 1MCEA 3EFFA 3S4SG 4KKNA 1BFOA 4LASL 5J0BA 1WICA 3BP5B 1JNLL 2CRIA 1P5VA 1FO0H 3TA3C 3MRGB 4GKSB 3WHE1 5FKPA 2FWOB 3THMH 4HMDA 3VD9A 3EKCA 4FZEL 4JPIA 4Y4HD 3MSPA 4HKXB 5CHNA 5E6IA 5C6TL 5DRNB 4HLJA 1E4XH 1HINH 1FJ1B 2VAAB 2QSQA 3EYVA 3WDJA 3V0AC 2UVEA 4JZJC 1S9YA 3LHPL 1GIGL 4OCWL 4GRWH 1MRFH 1FZMA 4QRQB 5TH2A 3W2DH 1S8DA 1ZHBA 3ISWA 1R3HA 5D2NC 3U4EA 5KSBE 3L3OB 1KTDB 1AFVL 1IKNC 1Q0XH 2NY5C 3ULVD 3QIWC 1CD8A 4WI5A 1L6XA 3H9SD 5GGVL 3RY5A 4ZFOL 4WI9A 3N85H 1V3KA 4R96B 4I2XA 3VXNA 1WJ3A 1AGEB 1N5YH 3A6BH 3CVHL 4DGIH 15C8H 3KPTA 4RQQA 5L2KE 3PWLB 3HZKA 1BD2D 4ZUSB 2Q7YB 2FO4B 4H5SA 4G9DB 4Q6IB 4P46C 3RU8H 5C07D 3WD5L 3KPRB 4CDGC 1UACL 2EECA 1M7XA 3Q5YA 1G7MA 3NN8A 4WY7H 2AEPH 4LVOC 2PF6A 1IBGL 1IBGH 1S7TB 5J89A 1P5UA 4GMSH 3HR5A 4N1EA 1S9VB 2DB8A 4WFEE 4NFBA 1F00I 3CDCA 4LCCA 5T1LB 3U36B 4YJZL 1FNGB 3LEYL 2LTQB 4R96A 5HI3D 4X6CA 5D5MA 4P48A 4MB3A 2QL1A 4OBSA 3QR2A 5E6ZA 4WI4A 4NM4H 4NM4L 5FHBH 2JJUA 5AG9A 3S96A 2YUZA 4IOIA 1DP0A 5TPWL 2ESVE 4XCEA 3LQZB 1G9NC 3GSQA 4QRRA 3IFPA 3ZHLA 3JWDH 2NY6C 3LH2H 2B5IC 1H3VA 1T1XA 3T09A 2BDNL 3DECA 4LCCC 5IKCA 2V7HA 4NQDB 2EDXA 1F4WL 4JFZH 3OGCB 3QH3B 5L2JA 3I85A 2MCPH 5C92A 5T33L 1NGQH 1IGJA 3LSOB 1T1YB 5AUMA 5EU4B 4R90H 4R90L 3UDWA 3G9VA 3OKDA 2YPLD 4YBHA 3E2HC 1QYGH 4HXBL 3WL9A 3L3KB 3NFNB 2P7TB 5C0JA 1YN6B 5JPMB 1LE5A 4U1LA 1NBYA 4XZUA 4LIQH 3RWFA 4XB8A 4ODTL 4JGUA 4ZO6A 4V2BA 3OKYA 2G60H 4XPFL 3SE8L 4JB9H 2Z8WC 1ZV5A 3JV4B 3BH9B 1W8NA 5IVOA 1IKFH 2Z91B 1GCFA 5GRJL 1FL6A 2CSPA 3QFJD 1NMCC 4OZHE 4HUNB 1HHJB 4MS8C 4TULL 4TULH 1A6TB 2EEBA 4HK0B 3SKOA 4E41B 5GJTL 3BP6A 4IRJA 2FWOA 1GGIH 3QEQB 3G6AA 1H9VA 3RAJH 3NIGE 2BNUA 4POUB 5E6YA 2OTWB 3SCMC 5DJ2B 3L95A 2D7PA 3BEVA 5GGSY 3RZCB 1I7RA 3K80A 1INEL 3VRIA 3V0WL 5T3XE 4FXGB 4JO1L 3U2SA 3RWDA 3CZFB 3RU8L 4HJGB 5LGJB 4HBCH 1FC1A 4LSDA 4DZ8A 4YXKH 5MENA 1BBJB 5B21A 3OKEA 4NJ9H 3CH8A 4QRTA 5IG7B 3MFFA 5IEHA 4FQQA 4LVHB 3RY4A 3EIFA 1IT9L 5J06A 5DLMH 3SGEI 2BK8A 1N6QH 5FCUL 1YDPB 5TE6H 5E7FA 4OM1L 1BX2B 3MYJB 4JRYA 5CEYB 5EBLB 3KPRA 2PR4L 2FO1A 4B50A 1YY8A 1UEYA 4N0CD 2D3VA 4DTGL 3HS0B 3S9DB 1JUFA 1TZGH 5AZ2L 1M71B 2J8OA 3LN5A 2ZUUA 1INQA 3O3BA 3S34L 5E2UH 2EKJA 3UROR 2HFGL 4PJ5D 1T0MB 4XCNA 5HHQB 4O02L 1I7RB 2HJLB 5GRUH 2ITDA 2BVUA 2ORBL 3DBXB 4YQXH 5DQDH 1FDLL 4MNHA 4IIQC 5GS1A 1N4XL 4LCWD 3KS0J 4PRDB 4MJ5B 1HHHA 1RK0B 4K23L 4I13B 2C5DC 4X0KA 1PFCA 1ZXQA 2IJ0C 4JFZL 4EIZC 3WN5C 5DK3A 3D3VE 4JFPA 3BD5A 4R3SB 1J8HE 3F7RA 4PTTB 1ZSDA 5AD0A 6FABL 5EB9A 2JB6B 3HS0A 4LU5H 4GFTB 2GJ6E 5BOZG 4YHOH 1AR1D 4HX1A 1WZ1L 2NXZC 4WWKA 4S2SA 2AGJH 1HHGB 1P2CA 4EUPB 1N6VA 3GIVB 2F74A 4RGNE 3PHOA 2C1OB 4IM8A 1SJHA 1E6JL 3GJFH 3SGJC 2W92A 4UOW0 5DJZA 4ZDHB 4JFEA 4Q97A 3PWNB 2PN5A 1JI1A 1XGTB 5IHZA 4CNIA 1D5BA 1IFHH 2PO6B 1NEUA 4GRMA 3BH9A 4A2LA 3GRWL 2JB6A 3V6FB 1AXTH 3RPIA 3QCVL 3VFOB 4K9EH 1SM3L 5D4QA 1A7QL 3QUZD 4HF5H 4N90E 5C07A 4A2MA 5I1CL 1RUKL 5EU3A 1UWGH 4RMSA 1JHTB 4OZFA 2AXGB 3E6FA 3CMOH 3DRQA 2E27H 5ENWB 2GJ6A 4X4XA 3ARBC 1BZ7B 4PD4J 2PO6A 2PCPB 4GRLD 4PRIA 1KNOA 3NVQA 5I71C 2X4RB 2D9QB 2AABH 2CH8A 1NMAH 1PQZA 3HNTH 4IRJD 5J9PB 5GRWA 2FD6L 5D71L 4O2FA 3TJHC 5IW6B 3MRJB 1ZVSB 3CDYA 3GI9L 3OMZA 3GSVB 4ZXBD 2R2EA 1T3FA 4LP4A 1PBYA 4UB0L 2CLRB 4IHOA 4KJYB 1T6WA 1S7XA 5HY9B 4Y1AB 5JLZB 5GRZA 4BKLB 3WFBH 2F74B 4X83A 1BBDL 2VLMD 3THML 4ZFGH 1I3RA 4NQED 1ZEAH 1KC5H 1NCAH 2IPKA 3BPLC 1MCFA 3VG9C 1WLHA 3VFUB 1NGYA 3PF2A 4UTAL 2R2BA 4X4YA 3BISA 3MXVH 2YXFA 3LPFA 1HI6A 12E8H 1SVZA 2WWKT 5FF6A 5IMKA 4G6AC 3QXVA 1TJGH 3LHPH 1MRCL 5B39A 1RZJH 2YUWA 2NY0B 4WTXA 1MIEH 3DMMD 4C54A 4Y1AE 1U91B 4DZ8B 4YHLL 1NCTA 1P69B 1RURH 4OLXH 5I9QB 4YO0A 1KN4H 1LMKA 1IGFL 1YJDC 4R6UA 1QFOA 2B1AL 3FT4A 5E00B 1RAMA 2R2BB 3BHBA 4X4YB 4X6BB 1HWHB 1ZHNB 3VXTA 1XGRA 1DJSA 2Z9TA 5DUML 1GZQA 4LNRB 4X6CB 1WF5A 3ESVF 1I1AA 2PYEB 4YH6A 3LD8C 4WI6A 3UMTA 3OSKA 3MLPA 3AGVA 1MPAL 3ZKND 1IZKA 2P46B 3ZE2F 4JRYE 3EGSA 1YY8B 1K4DB 2MTPA 3ZYJA 3ALXA 3JV6B 4BK4A 3O3UN 3E1F1 3C6LB 4BSWB 1CVRA 5BS0A 4F9PA 4U4BA 1BM3H 2BFVL 3BPCB 3VFNB 4PGEA 5MHSD 3VXSE 2VNCA 3E8UH 5BZWA 5C0AE 4IDJH 1CR9L 2XWJB 3TV3H 3NA9L 1NC2D 1VEPA 2DDQL 3GM0A 3MLZL 3X3GL 3LKPB 3TPKA 4N0YL 2AEWA 3IFLH 5B38A 2FX7H 1X6LA 4X6CF 3O41A 2R2HA 4ONFL 3RZCD 1BF2A 3OKKA 1XAUA 1TENA 1BECA 1I1RA 4HIXH 1J5OH 2Z92B 7FABH 3V6OA 4YDVB 4NBYB 2VQ1A 3O4LA 4KUZL 1DVFA 3D39D 4GXUM 3UBXB 5F1IA 1FH5H 3K4ZA 2FGWH 2BJML 1NSNL 4EN3B 4ACPA 2YD9A 4O5LL 5I71B 3OG6B 4L3AA 3RWHA 1IC1A 1YECL 3R06B 2HJFB 3LKPA 3QQ4B 5ESVA 4KZEH 4XI5D 5AWNL 3WXWL 3BEWB 1DSFL 3HMWL 4MXQC 4A6YA 1IGTA 12E8L 3QUMA 2YK1H 4KMLB 2JJWA 4HAGA 3VMPA 1NCDL 4BFIB 1J0ZA 3ARXA 4KK5D 3S97C 4OI7A 2W0PA 1KC5L 4ZXBC 1KXTB 3HRPA 5E08L 5J8OA 2W60B 4MSWA 5HHPA 4PS4H 2UWEA 4K3EL 2VB5A 4KROD 1JGLL 2NW2B 3LPWA 4Z8FL 3BQUC 1U6AH 2DQCL 2VXSH 2BOBB 4PJ7B 4X9HA 5DUPH 2APTA 2GT9B 2OMBA 3BKMH 3NOIA 4YBLC 2FEEL 5M95B 1MCWM 3C8DA 3L3JB 4QWWD 4W4OC 2H2PC 2R69H 4YX2L 1FNFA 3EYSL 5EOQH 3CSBA 3FOLB 5D1ZA 4HWBL 4KRNA 3KNBA 3B9KD 1FG2A 4XMPH 4X7DC 1A7NH 5H37G 1QO3B 4OCRH 3DSFL 1M6OA 3ZTJH 3LRSA 4JY4A 1XF3B 2K3TA 5TFSL 3MLVH 2Y6SC 3LAFA 3MMEA 4F3FB 1U92B 1RIHL 1NL0H 3C2SA 2OI9C 1W72H 3QHZL 2NX5A 1A6ZB 4N0UB 3WBDA 1QHPA 3MV7B 1MAML 1HCVA 4OZHF 1BJ1J 1J87A 4H1LB 5HGDA 2YPVL 3I02A 2NX5E 3AU1B 3LD8B 3WN5B 1A6AB 3HAEG 4WW1A 3DO7A 1OTUD 2CMRH 2P43B 3ARFC 2AJXH 1I1AC 1OAYL 3SE3C 2BVOB 3ZTNL 4TVPE 2YRLA 1FC2D 3WUWG 1F6AA 4QTIH 3KR3H 1FBIL 1SJEB 3SE9H 5KJRL 5JQ6H 4JY5H 4GAYB 3BSZH 1MJUH 5JMRA 3UTOA 1P4IL 3BIKA 1LWRA 4JANA 4XHJC 1NDGB 4DN3H 4F3FA 3FT2A 4UAOC 3FRUA 5JZ7D 2GUOB 4BFEA 4WO4B 1BAFH 1AY1H 1I1FB 1I3GH 2JB5L 4X5LA 5LWYH 4YGVB 4YPGB 5BV7H 1XGRB 3TFKD 1AE6L 2QQNL 5T3XL 5T3XH 3QPQC 5A2IH 1CD1A 2BZDA 4S1DC 5I8KL 2P8LA 5C9JA 4U6YA 3ROOB 3X17A 1T21A 5IB4A 5F88B 1ZT7A 3NIDF 2ZJSH 3SDAC 3IDXH 1T1ZB 4KKCD 4R2GC 6FABH 2XZCH 4P59H 2CKNA 3O6FC 5FUCC 4FQJH 5GS0H 1QEWB 4R8WL 5J3HC 1OCWL 4PBWD 3LMJL 2QQNH 3KPSA 5DMIH 4M93B 4JFHE 4OT1L 1G9MC 3TP4A 1D5ZA 5CFHA 2MNUA 1GOFA 2QTEA 5KVFH 1YY9D 3RWEB 2EDWA 5IB2A 4OLZH 2HFFB 4RMWA 3QBTB 2PW2A 1S7RB 3V0WH 1MUJA 3KYNB 3J8F7 2XV6B 3CUPA 2X10A 1P6FA 1CXIA 1ZT7B 5E1HB 5IF0B 1NPUA 5I1IH 2ADJB 4O4YL 3SQOH 3T3ME 4GQ9L 1HXYA 1A3LL 3ARRA 4QXWA 3BQUA 2R4SH 5D6CB 1JF1A 2CMRL 1VEMA 4NJ9L 2D7QA 1CGUA 2QBWA 3W82A 4ZNEE 1ZGLM 1U8KB 2I9LB 1JFQL 1YEJH 3OXSA 4Z76B 2YD5A 2UYLA 3U83A 3RUGF 3K46A 1MCLA 1NL0L 1N3NA 3O2DH 1A1OB 2AK4E 5DFTA 4TUJB 1L9NA 4RFNC 1DN2A 5L88H 1ONQA 1HSAB 1CFBA 3TN0A 5KSBB 1RSFA 2EXWD 2QSVA 2F19H 5K33A 1J0KA 4CJ1A 5ITBH 4P5TC 3I3DA 2J6EA 4XPAL 1DLHA 1BFVH 4NQXB 2JCCF 5D1QC 5D72L 1KEML 1UXWB 1FNGA 5FGBC 4LF3A 3TT3L 5AAWA 3P30L 4KHXL 1KJMA 5FYJH 4H1LA 5KZCD 3IFLL 1MFEL 5JIPA 1EK3A 4PJDE 1F6LL 3PGDB 4OZHA 4PV9B 3HE7C 3V4PL 2LV4A 4B7LA 4HHAA 1FSKC 3CXHK 3V6ZA 2BCKA 2CPCA 3KDMA 4GKZB 5H2BA 5JZ7C 1NDGA 3HC0A 5B3JF 5KSVB 2ZOKA 5K9OA 2FL5A 4HLZH 1LEKA 3IDXL 5CP3H 5FYKD 3Q48A 3ILPB 2FB4H 4NKMA 2UY6A 5HYSA 1BMGA 4FQJL 2CRZA 3MCLH 3U6RA 4BYHA 4JPWL 1ND0A 4UU9B 3VFSA 2MMXA 5F1OB 5KS9A 1AGDA 4LEXH 1JGUH 3UAJC 3WUWA 5CP7B 1T7WA 1A7RL 4G5ZH 5IW1A 5ALCL 4CVZA 5GHWH 1QVOB 3BP7B 4KRPB 5JA8B 4C56D 4WTWA 3CFKB 4U2YA 2O5YH 1AQDA 1HZHL 4AT6A 4QY8A 4CMHC 2O5ZH 4YFLF 3HPLA 4OJFL 5C0CE 2IQ9L 2Q3ZA 1ORQA 1CLZH 4KDVA 4XNMA 3V52L 5IHUH 3GNML 2GKIA 3RRQA 1X7QA 4FQXD 2QSTA 4HJ0D 1KIPA 3H3BC 2VDPL 4MA8L 3MREB 2P47B 3VFTA 4I0CC 4PB0L 3B6SA 4UOJA 3U4AA 1N0XH 3WFDL 1H8OA 1FGNL 5JOEA 1T7VA 4NQDA 1I3UA 1W0VA 4XBGB 3GMLB 3Q6GL 2AXGA 1QFWM 5F21B 4K55A 5DHYB 3ZZ1A 4PJ9C 2BSSA 4PJ8B 4PFEA 3QQ3B 1EHAA 5E2VH 4G6ML 4AT6B 2DN7A 2EIBA 1Z0NA 4PJAF 1CGSL 4NO0B 4C83A 1KB5L 1ORQB 5GGVH 1YNKL 4XX1E 3RVWC 3FN0L 3VXSD 4Q74A 4LKCA 4P2RD 1NDMA 4OCWH 1TZHA 4HUXA 4HFWA 5DS8B 5IHBA 4P3DB 1IQDB 1FIGL 5D1XB 4L3EB 3V6OC 1FVDB 3IXTB 3P3YA 5J12B 1TCMA 1CXHA 4ZNCD 5F1IB 1U6AL 2DWDB 1U8IA 1UB5B 1YNKH 1IJ9A 5CMAB 1DQMH 3FB5A 4KK8C 5HHVH 4ODUA 3DVNA 1IEAA 3SBWC 2Y4SA 1HHHB 1YEFH 2OS7A 2VABA 1GGCH 2WSKA 5GSVB 4DVRH 3RNKB 2XKNB 2R0WH 5BVPH 2P44B 5FHAH 5GHWL 3QXWA 2X1OA 1MCNA 1CGTA 5IMLB 3LZFH 4K7FA 1CICB 4NM8L 3DYPA 1MCOH 2GIYA 3DX7A 1RZ7L 3ZKXC 4OCXL 2NTFB 4MNQE 4BSVA 2MSPA 5JHDA 2EE6A 1S7TA 4NJAH 1Q9LA 2IFGA 2X70A 4YAQB 4CBPA 1VB9A 2IQ9H 4M6OH 3ULUC 2RCSL 3CJJA 3W39A 5EH1A 3L6FB 4U1HB 2YR3A 5HGGS 3MROA 1BD2E 5I1GH 5FA4A 4Z7UB 3T77B 2DLFH 2ZUVA 1ZA3B 3WNOA 5HPMA 3MZTA 5C2UB 1JTPA 3LQMA 4YNYB 1KPRB 4OZIA 3EO9L 1HH9A 4LSQH 5GRVL 1RUAH 2AXJA 5I8CA 2XZAH 4U7KA 3DRTB 1A7QH 5GGUB 3U0PB 4NRYB 2BXZA 5I1CH 3P77A 1N64H 3B2VH 2EXYD 3DX9B 3CFIC 2VR9A 2BY2A 4I0PC 3MNZA 1D5MA 2NTFA 4BSVB 2CDFB 1HXYB 4O58L 1SEBB 5HYSG 3DX6A 3AM8A 1YC8A 1I9JL 3ZKMD 5DK2B 3BJLA 3WJLC 1TITA 3MODH 3MRFB 3EOTH 4KI5C 3SPVB 4MHHG 4BH7B 4U1SA 1S7UB 1HIMH 2P5WB 4TSCH 4G7VL 3U79A 1JPGB 1A7PL 4XWGH 2VSCA 2YMXH 1CDGA 2YPLE 1WAAE 1AR2A 1XF5A 3U4BL 2I27N 5K9QI 5E2TH 3INUH 4KV5F 3EOYG 5FK9B 5CZXC 3IDIB 3CAFA 3QO1A 4PRID 3MO1B 2VKXA 5D7IE 2W9EH 1KCSH 1YNLL 1P7QB 4KQ4H 1O7VA 1YMHA 3U7WL 3ZHDA 5E5UB 2A6JA 2ICWJ 2YN5A 1F4AA 4XNYH 1C16A 4R4BB 4TTDD 4PRHA 3S6CA 3FQWB 4LVNB 4LEOB 2NR6C 2YZ8A 3O9WB 1PZ5A 2EE3A 4U1KA 4YHMH 2YOCA 5L8LB 1HDMB 5C09B 3N0PB 4U1SB 5I19L 1R5IA 1U3YA 4LLWB 1LEIB 1SBSH 4UTAH 4XXDA 4QNPE 4OFKA 3MZGB 3CPLA 4NKIL 2QQLL 5SV3A 5D2LE 2H26B 1JHTA 2IG2H 4OZFB 4NQEA 2A83A 2ORBH 4YQXL 1FNAA 1I85C 4G8EA 4GW1A 3S36L 1N6UA 2ID5A 2R4SL 1EMTH 4MGXA 2YS4A 1G1YA 4IOIB 4NRXA 2R0WL 5KTEH 2K7QA 4EI5C 1IILE 4XNQB 2CLVB 1KXQE 4FQXA 2X9YA 3X13A 32C2A 1VEOA 4OIBA 4NKOB 2F58L 4NRZB 1YJDH 4D3CH 4U6VH 5DSCB 3WUWB 1TZGL 5AZ2H 4NN5B 4ISVB 1QFHA 1J0IA 4MAUL 4ZPVA 1JN6A 4ELME 1GAFH 3EDFA 2MQCA 4WI8A 1N59B 1G6RL 3L7EB 5ISZD 3DARA 5C7XL 2X4NA 1T2XA 3P4MB 4LDLB 2F19L 4IHOB 4NZUL 1AQDB 2Q7YA 5F96L 2MKWA 3MXWL 3EDKA 2W91A 4FQCH 5CJBA 3ARDC 2E6QA 4AY0A 2GFBB 2KH2B 1BQSA 3O3EA 5DQ9A 5LQBL 1IFHL 5JHDB 3KS0H 3L7FA 1AC0A 3FB7A 4NRZA 1OTSD 3NACL 4PP1C 1MIML 3LOWA 3DMMB 3MRKB 4HG4K 4WJ5B 2VR4A 1CQKA 3QB7C 2EDLA 4KRPC 2J5LC 3LKQA 5EULV 3BO8B 4PJ5E 1LO0L 2PUQT 1CFTA 3QCVH 4ZUVB 3HNTL 2J8UF 2D7MA 4NO2A 4NQEB 2PTUA 4IEFB 5IBLD 1V7MH 1KJVB 5T1MB 43CAB 3DI3B 4KI5F 4W6YB 3DO3A 1KV3A 2YKLH 3BKYL 3Q1SL 4JM2C 4PGJA 4YHIB 3WNLA 1ZVYA 4RAUB 4P4KB 4MCYA 5EC2A 4JHWL 1XGQB 3IU4H 1R5WB 3OKOA 4OT1H 3O4OC 5LGKA 3WL9B 1HK6A 1QLRB 1QFPA 1YEGL 3G5ZB 5BCAA 1V3MA 4H20L 3CK0H 5I15L 4HX1B 4QRTB 5F6HI 5L9DL 2O5YL 3FQUA 5T1DL 4L8SB 4PJEF 2WWKO 1G6RA 3MGAA 1QSFB 1VACB 2X6MA 3C87A 2YPLA 3ZDZF 4KROC 4KKBC 2F53A 2BSSB 4P23B 4F9LA 1MAMH 2DM3A 3GB7B 2G75B 1PEZA 2PKDA 3L3IA 3QUKB 1OLZA 2P1YA 5DRZA 3U2SB 3QXDB 1KYOK 4X5WA 3ZDXE 3BO8A 4L5FL 1E4KA 1BOGA 4K3EH 3VXUB 2DIAA 3LB6C 3MRPA 4PJIB 3I3BA 4K8RL 4WUKH 1T0MA 4XCNB 5T1KA 4ESKA 1IM9B 5IHLB 3QNYB 3UTTD 4D3CL 2WM0A 3WD5H 2AEQL 1FRGH 1TQBB 2X89D 2DQUH 1S3KH 1DN0B 1CZ8L 1CZ8H 1UZ8A 2EDBA 2FRGP 3STLA 2BNQA 2D31B 1MFNA 3TLRA 1J8KA 3CH1B 1ZWIA 5J6GA 1GC1L 1S7WA 4F7EA 3PNWB 1YEIH 1F3DJ 35C8H 1FLRL 2AV7A 2AJXL 4JG0H 5GJSH 4R3SA 1B0RB 5JMOC 3GMNA 1QLRA 1IAIM 2FHCA 4Z7VE 2VOTA 3G5XB 5F9WB 3WDIA 3ULUL 1NC4A 3FFDB 2H9GA 3DGCR 3MUGA 4MAYB 1ERNA 1I8IB 3T1WA 3F12B 4HG4J 5DRXB 4S2SB 5IB1B 5DEFA 3ARGB 3HN3A 4L8BB 5AYQA 5TQ2H 3S37X 4Y8AA 4XNXH 2DBJA 2UZIL 2X05A 1A9EA 4NSKB 4XHJD 4GW1B 1SEBA 4PB9H 2GQHA 4JM2F 1MEXH 1DUZB 4JG0L 3R1GL 5GJSL 4YFDB 5C1MB 1RZFL 5IROA 1OP3K 5HDLA 4XTRC 3VXTB 1IVLA 2W9DH 3WHXB 4O2EA 1Q0YH 4PV9A 1OGTA 2R0KL 4RFEB 2XWTB 3HMWH 1BLNB 2BHYA 1B0RA 3UJIL 2X1XR 2ZUXA 4XWGL 1JNJA 2HYMA 4P46A 4W6WB 2G60L 3B43A 3ZL4L 2JB5H 5GS0L 1OAZH 1Q9WB 5LWYL 5IB1A 1GGYA 4HQQH 2H45A 3QO1B 2EEAA 5JIIA 2FBJH 5J3HD 2BNRB 3T0AA 5IFHL 1VKXA 1RUPL 3P4NA 2R1XB 2ZWLT 4F7EB 4E0RB 1QYGL 4HXBH 1FN4A 4PRBA 3QNXA 4H26A 2AVGA 1JNLH 4LRIC 2V9RA 4FABH 3HE6D 3WMSA 3MRJA 4QRPB 2L4OA 1UM6H 2OQJB 4Q6IC 3CZFA 1ZA6A 2AS5M 3KXFD 4JB9L 5F1KC 4FXLA 1U42A 3HG1E 4KROB 4JFFA 3CSYA 2HN7A 3CLEL 3CLFL 3Q6FA 5I76B 3FAWA 3HC4H 1KJ3L 5FYLE 3U46B 5DD0H 2XTJB 1QLFB 1C1EL 2VDNL 2Z8RA 3QCTL 3CVIL 4F37F 5FYKU 4G8GB 1H3UA 3EDEA 5HI5C 3BPOB 2DM7A 3SE4A 1L7IL 3SO5A 1YQVH 3HAEH 4FN0A 5F89A 4X7SL 3QWOA 1AXSA 3SDYH 3G9AB 5EPMA 4X5XB 4Y5XC 1RJYA 3C6SA 2E7MA 1IQWH 1KPRA 1OLLA 2AXFA 4KFZC 1JHKH 3G5ZA 5GIRB 1QR1A 1JYWA 3QULA 2VKWA 3QDGA 1C7TA 2ICWA 4ZO7A 1UYWL 1G7QA 2PTTB 4NC2B 4CGTA 3V79C 1A6TA 4NZUH 1KB9K 1E4WH 1U2CA 1F45A 3CH1A 5J6GB 2YD1A 5GZOD 2LVCA 3GSVA 2E6JA 5D2LF 1U8HB 2FH8A 3KPLB 3NCEB 4WHCA 2IQAA 3U30C 3QDGD 1EAPB 3RFZC 5ERWB 2WIMA 4C4KO 3KLAB 2OJEB 5F71A 3H3PL 4GO6B 4WY7L 1YN6A 5JPMA 1R3LB 4A6YB 1ZT4A 4FFWC 1A14H 4XC1L 1LNUA 3JWDC 3O6LL 7FABL 2O61A 2CO6B 4TSBL 1CU4H 1JP5A 3BZEB 1UQSA 5FYKL 1CDHA 5KSVA 1UXSB 5IB5B 3H7LA 1X5ZA 4UQ3A 4M6MH 3SE3A 3U82B 3D9AL 5JO5B 1Q0XL 3UJJL 2DQJH 1FZJA 3HFML 3ELAT 5HXMA 2VZ1A 3S35X 3O3EB 5DHVH 5HBBA 4S10A 1A4JB 4PRIE 5E5MA 1G7IA 4EBQL 3CC5B 3QA3A 4XC1H 1Z9MA 2JF1A 4NWTH 1N2RA 2BVPA 3CXDH 5ADOL 4I4WA 2IALB 1Q72L 4XVJH 4PJHA 3DXAA 5BV7B 4PJXF 3UAJD 5JHDD 1PLGH 5F97E 3CLEH 3QPXH 2IH1A 1TETH 3MV7A 3BP5A 3D9AH 4LGPB 4KJYA 4OGXH 1E27B 5BS0B 2R15A 4XPTH 1F97A 3MLWL 3Q3GB 2ATKB 1FVCB 2Z31A 1ADQA 2H2SC 4RISL 4R26H 2J8UE 1A4JA 4FABL 2AGJL 2C26A 2D7NA 2X89A 5HHXL 3QIWB 1A6ZA 4N0UA 5HYIA 4LVHC 4TVPD 2BNQD 3N1FC 4X9IA 2CK0H 4OQTA 1WBXB 5J11B 3EYUL 4FQXC 1KB5B 4R7DB 4ELMF 3D87B 2FH6A 3MLUL 4HIJA 5E8PA 1DDHB 2ERJB 5HTSA 3MODL 5C8JB 1OGTB 5HHOB 3MRNB 3UYRH 5C0CA 1PD6A 3HC3H 1NCCH 1L7IH 4QHUB 2XZAL 5E2WH 5JXEC 3KJ4C 1TFHA 4KKAC 4M6NL 3VRJB 1QLEH 4HJJL 4Z77A 3DVIA 2NXZD 3ALPA 3JVGC 4Y89A 4ZUTA 3WFDH 1V05A 2B8OT 3RHWF 4QRQA 2VDQL 4NQXA 5KN5B 4KJWC 5JORA 4Y4KC 5KAQF 5FXCH 2C4FT 1FFOB 5ACLA 4U0QB 3SE4C 5HDOA 3PWNA 3H7BB 3TNMA 4HGWA 1F4HA 3W9DB 3QIUB 5GRYA 5AZEH 4DGVH 3QG7L 4ZAKD 1YEFL 1A6WH 3FRPG 5JW5A 3RA7L 3O2WH 3QUZC 3WS3B 1UCBH 3DGGA 5C8JA 4Q9QL 5FK9A 5GZOC 4JN2B 3FO1B 3DX8B 2XG5A 2F54D 1GRWA 5KSUA 4L9LB 3O8XA 1KJVA 3E2HB 4AL8H 4ZUTB 1DQML 4ZG1A 4P4RA 3B8YA 3TT3H 1Y6NR 4WTZA 1ETZA 1H0DA 3HUJF 1NGWA 3PABB 3I6KB 5I1GL 1GGCL 2YN3A 3LEXA 1LE9A 5D9SA 5BVJA 5FYJL 2O5XL 2PO6C 1S7RA 3ARGC 3ZDXF 4HBCL 1TQCC 4QGYA 1KJ2B 3ZDYF 2Q20A 1G7LB 2A9NH 1RZ7H 3QI9C 3FT2B 3UTPE 2YBRA 4M1GL 3TESA 2CUHA 3H9SE 3IRZA 4XPAH 2R0LH 3MRIA 4QRRD 1QRNB 1U93B 3VFPA 5CILH 3T0ED 4RGNC 5EA0H 1TETL 4FFVD 1QKZH 3LPGA 5HHNB 4JLRB 3V7AE 1U92A 2DTML 1DUYA 5C07E 4G8IB 5EBWA 4ZS7L 4KMQA 1XCTB 2EDJA 4WFHE 1OARH 3PDGA 1CLZL 4EBQH 5FUZL 4RA3A 2H32H 3GRWH 1NBZA 3RIAK 3LIZH 4WFED 4X0KB 4Z76A 4NO3B 4JFDA 4ZUUA 4WEBL 2DYPB 3SDDB 1Z9SA 3DUHA 1FIEA 1GOGA 1N0XL 4KI5E 4O4YH 4LLUA 3EJJX 1AKJD 3TZVA 4PJGA 4JREB 1WBXA 2ERJC 5JUEL 1UM4L 4UINH 3MV7D 1CF8L 1UXWA 1QBLL 2BC4A 3KJ4B 1D6EA 4MJ6B 4LSRH 1NGYB 4F15C 1DBMH 3PGFL 2HRPH 5I74B 2B4CH 3EW3B 4HPYH 3CFBB 1BQUA 4YHNB 4WW2A 3KAAA 5EO0B 3FFDA 1XR8B 1YMME 1OGAD 3UBXI 2X1PA 1KELL 5DRWA 3ZT7A 3FMGH 3VWKA 1WZ1H 1P84J 4DUVA 1RUKH 4MDIB 1EO7A 2AJUL 5HGDB 3IB4A 3BE1L 1RUPH 4GJTB 3VXMA 2RB8A 1HKLL 5MI0C 5EORH 5EORL 1AFVH 3HUJA 4Y4HB 4UIKH 3C5JB 4NNXA 3KYAA 2RR3A 5LGHL 3I50L 4IMKA 3WIFA 2F8OA 5JW3H 3OKKB 1OP9A 3IU4L 4UNVA 3B6SB 4W70A 1L7TL 2PR4H 5DQJB 2EE9A 3QWOB 4L4TB 1QSEA 3LQAL 5FB8A 1LEIA 4PJAB 4MMXC 4MAUH 4I5BB 1TDQA 3GMRB 3U4EB 5KG9A 1EUTA 5CILL 5DHYA 5GGTA 1FZKB 1Z5LA 2ZKHH 3WS3A 5J6HB 3F6LA 2VH5L 3U9UB 3VDBA 1ETZB 4PLNC 2LU4A 3DX8A 1QSEE 1F5WA 5IF0A 1TQCB 4MCZB 2ZSVA 3IKCA 2OL3H 1DE4B 1K3IA 1PW3A 3O45A 2NW3A 3OB8A 1QSEB 5GS3A 4R0LA 2BX5A 1HSBB 1Q8MA 2VDMH 5KSBF 3QNZA 1NUFA 1RU9H 4GXVL 2SEBA 2Y9RT 3IJYB 3S88H 1BP3B 2ZCHH 4MA7L 5EC1B 2AJZB 1W72L 2EDTA 3BQUD 3GIVA 2E5EA 3DV4B 2ITCB 3MBEB 1DR9A 1JNNH 1OP5H 4G6JL 4G6JH 4RX4A 5ICYA 5HSFA 1A4KA 1OTSC 4KAQH 2Y23A 1MJJA 4LP5A 4KJQC 2QHLA 3ULVC 4GXVH 4X99B 1GZQB 4XVSL 2ZCLH 4J4PC 3RNKA 3AMLA 4H0HB 5FGBA 1XF4A 4JKMA 2WBJB 4PJAA 4Z0BH 4ZTPL 5LXGL 5F3BB 5CBEB 3P73B 4RIRB 4HKZA 5K9OB 4G7VH 1T1YA 3CFCL 2OZ4A 4ETYA 5TQ2L 5JNYB 5H35A 3RTQA 4M62L 1NAMA 3HE7A 3QUZA 4HC1A 4QY8B 1UJ3C 3ARFD 5ETUA 3MJ8B 3LMJH 5I18L 5LGHH 2MWCA 1OY3B 1BX2A 3MYJA 2HH0H 4YZFE 3C5SB 1VFBB 2GJ6D 3KLHC 5C0FA 2KZWA 5DI8B 5HGBB 4K94C 4PLKC 3D69B 4GRLA 4Y2DA 5GS0C 3BE1H 1QPXA 3VFSB 5JNYA 3QQ9D 4PP2A 2VN7A 2NY6D 2VXVL 4QRSB 4KQ4L 4FTVB 4F33B 4Y4KB 1B9ZA 2YA1A 2OCFD 2HLAB 3QHFH 5JTWA 4NUJA 3W9EA 1H3PL 4G8EB 3VW3H 1ZVHA 3OF6A 4OLVH 4P4RB 3ZE0F 1XIWC 3DTXB 4O9HH 5D2LB 3QUZB 2P5ED 3KXFA 4HIIA 3CCHA 3DVGB 5HYQB 2AP2A 4I2XB 4TSCL 4OTXH 3DURB 1ACYH 5ANMB 4EJ1C 1FJ1A 1TJIL 3WIHH 5FV1L 1L7TH 3LZFL 3ARYA 4OM0L 4LL9A 3C6LC 5C0GB 2GJZA 1SMAA 2MPAL 3L3OA 1K5NA 4NUGL 5JHLH 1ZE3C 3B9KA 4U1MB 1HHJA 5IMMB 4NIKB 3DSFH 5TH2B 1RIVH 3BP6B 4ONGL 3T4AA 4YHIA 4NQUA 4QHKI 4EDXA 4I18A 3TVMD 4EUPG 3VXOB 3BN9C 1FNEA 4UV4L 4ZS7H 1LO2L 3H9HB 5IV2A 2A77H 3HI1A 3I75B 3ZE1F 3SGJA 1J86A 3BGFC 3WDHA 3IJYA 3BN3B 2VLJD 1Q94B 2N4IA 2Y72A 2Z4QA 2EDQA 3CFDB 5IMMA 1MAKA 5CKGA 5EG6C 4PIRF 2W38A 3SDCB 2D4DA 4RGMC 5IR1A 5LQBH 4EN3C 1T03L 3RNQB 1T20A 1YEDA 4Y16A 2I26N 2XFXA 1VGKB 4UT6H 3MXWH 4FQCL 1LEKB 2AV1A 2GAZB 3DTXA 4HIHB 5CD3A 4KJQD 4OLYH 5ILTH 3DETC 1URLA 2DJUA 2DQTL 1H3XA 4GG6E 4MD5B 3GSQB 4PJCF 4QRRB 1BREA 4HWBH 4ZS6D 2ICEA 2WBWB 1EFQA 3PWVB 4NQSB 5IEKB 4MX7A 2BVOA 3I2CL 1TPXC 5K9JL 3MR9A 4NP4L 4XCEB 1T03H 3NGBC 3MREA 4GG8A 2EKSB 2J8UA 1EEZB 5CKAA 4J6RH 1A9BA 3P9MA 3QDJD 1EPFA 1UB6A 4YK4C 4GSDL 3QUXB 1AO7D 1J1XL 5ESAB 3GRWA 4RZCB 5JLZA 3H0TA 1HHGA 1P2CB 5DO2C 4EUPA 4WDIB 1WGOA 5GZNC 2W9EL 5FV2A 4P5TA 2FJHB 5DJXA 4Z7UA 1ADQL 3BH8B 2AK1L 3T77A 2Q86A 2CUIA 1JGLH 3QA3B 3CC5A 3FTGA 3VFVA 4V1DB 4UT9L 4UTBL 4OFYA 2X70B 1CG9B 3T0XA 2J8HA 4WW2F 5FKAB 5GS0D 3HE7D 4NQDE 5D7KD 4Z78A 1PY4A 2J8UB 5IFAH 1QSFD 1JZ5A 3AREA 4PS4L 3BIAX 1PKQA 5F7NC 4Q9RL 5IJKC 1SYSA 1IGML 1DBAH 3TO4B 2GK0A 1IGYB 1C5BH 1KEGL 2VLRB 2OTUB 5D7LD 5AWNH 5CLTA 4L29A 5CGTA 4Y5VA 4YC2B 2D4FA 2JTDA 3MA9H 3EO0B 3RVUD 1DBBL 1F8TH 3ARFB 3QYCA 4P0DA 3G5VA 5CEXA 3D85A 2H1PL 2X7LB 4YUEL 2IAMA 1EAJA 5FM5O 1BQHA 1J8HA 4P2OD 5C6WH 1D5BB 4DGYH 5JPNB 4LEOA 3ZKSD 3KYKL 1TTGA 1JZ3A 5I1JL 5F70A 3P9MB 3G04A 1NJ9B 4RMUA 1ZANH 4J3WA 3G5YA 1Y0LB 2ARJA 3BDYH 1DBBH 4PJEB 4QXGH 3RL1A 2E8ZA 2Y5EA 3JUZA 1XF2A 1I8KA 1ZTXH 4HDIA 4JPKH 4M5YL 3QZWG 3DLQR 3L3DB 1AGBB 1T66C 43CAA 3LEVL 4MQSB 4JFED 3P11L 3FJTA 1W0YT 4IJ3B 3BKJH 2CIKB 4MCZA 4HUUA 1KNOB 1CXLA 2PYFA 4IBLT 1FNLA 4FFWD 4NWTL 1H8NA 3CSYB 4IRJC 2XICA 3MRPB 3TJHD 5FDWB 3WFCH 1C5CH 3RNQA 3QZWB 2OL3A 4JHZA 1IGJB 1EJOL 2UZYB 1G7JA 2EIZA 3OB0K 1E4XI 3QEHB 1X44A 1D5IH 4KHXH 3VGGA 3RWIB 2VR5A 3JXAA 3H9ZA 4KKLC 4YDJB 4ZS6C 3S35L 1KEMH 2G9HB 3HPLB 5CJOH 5A3ID 1IL1A 3GHBL 3HI5L 4TNWK 3T2OA 5F7HA 2I60H 1YPZA 3VU2A 2EC9U 3HLAB 4DVRL 3BRGC 4D0DA 2BOCA 3X14A 2NXYB 1N59A 2Q6WB 2V5MA 4G6AD 3MACH 1P7KA 4QXTB 5BXFB 1SBBA 5DO2D 1NH6A 1ZGLA 5GZND 4HFUH 3IVKA 5ACMA 1IZJA 4WEMB 4G9FB 4F58L 4KWUA 3SDCD 3PQYB 4H1LG 5CEZD 2LAGB 1A5FL 5F93C 5CMAA 1K6QH 3BVNA 1OSPL 3BHBB 3QJHA 4PR5A 1CE6B 4HUKB 5C9KA 3DIFA 4JHAL 3KXFB 1A3RL 5DD3H 1MFEH 3VDAA 4LHUG 1PSKL 1JGDA 4FFZH 1FGNH 1CE1L 5I66A 3LVEA 5SWZB 1XH3B 4UBDD 2DYPA 1X5HA 1FO0A 1N8ZB 3EJZD 3DMMA 5FUOL 4WUKL 3CFEA 4W4OA 2I25N 4HJJH 4Z78B 5JXAL 3PQYA 3T65A 3GSNB 5A2KH 4KVNH 3QUXA 1FZOA 4GQ9H 4S1QL 4HWZA 1JPFB 5HY9A 3IVKB 1C1EH 3UXFA 2BP3A 5IQ9B 3BH8A 1U8HA 2GHWB 2QADC 3VDCA 32C2B 5CAYB 3SO3C 1UKTA 3LQAC 2OXHA 1JVKA 4AEFA 1RUQL 2FCBA 1A7RH 1XGPA 2GSGA 1T3FB 2VLLB 1V8HA 1EHNA 4ZAKC 5IWLC 3LRHA 5BO1L 1T2JA 5C3LD 1N3NB 1OTTC 2DWEB 4FRWA 4MVBD 1UQSB 1A21A 1KIRB 5JDJA 4QOKA 4K7PH 1J05B 1F4WH 4PJ8A 3PE9A 2XPGA 4ODXA 4XHQA 2P5WD 3SCMA 3BGFB 2VLKD 1QFWL 4IRJB 2YPLB 5D93C 4OZGA 4K3DL 4OFYD 1WCBA 3ILQD 3O6KH 4F9PC 1CCZA 3ZSSA 3BEVB 3RZCA 5JR1H 2HN7B 3VGAC 2ZSWA 4KK5C 3TVMB 3AY4A 4OI8A 2B20A 4CVXA 4YXLL 4QEGA 5IROC 1S9KC 2B7DT 2W59A 2GCYB 2NY2D 5F8QC 3IU3B 3S34H 2CGRH 3P30H 5KVEH 4XWOD 1R24A 1P4IH 2A9MH 2CDEB 1HN1A 5A3IC 1SEQL 3GMPB 4KC3B 2IPUG 2NW3B 1QPPA 3PL6D 4N8PA 1WBZB 3NGBB 5IHZB 2D31A 2FECI 3X11A 4QWWC 3EGSB 3VD7A 5I1HH 4LLMA 3VMNA 1IMHC 3ULUF 1CT8A 1F02I 5FIEA 1DQLH 4DTGH 4E5XA 1SJHB 4JN1H 4OZGB 2V5RA 3HR6A 5KS9B 2G5RA 2OLDA 1LP9A 4WEBH 4I77H 4P2OA 2ZCKL 1UKQA 5C0CB 5JXAH 2ZCLL 5JOFA 2WIIA 3VXME 2OL3B 3C5ZC 3QDGE 5FUZH 3VRJA 2GJZB 2AW2A 1BD2B 2NYYC 2VXUL 2GK0B 4JZOB 4XH2A 4ODSL 3VXRE 3NIFE 5ENWA 1X5LA 4J3VA 1V5JA 4POYA 1X7QB 2Y5TA 2EYTB 5E56A 3BGMB 5L2JB 4K2UL 1CGVA 3BPCA 3NFPB 4PGEB 5DMIL 1OT2A 3V95A 4JFDD 3QWQB 1CGYA 1NC4D 3D6GA 4NT6A 4R7NB 5D2NA 1HEZB 4Q9CA 5L6YL 5D1XC 1HH9B 3K2MC 4YIQB 1KBGH 1HXMB 1OAKH 1OAKL 4OLZL 1EBPA 1DQJA 1MCWW 3QUYC 2DBLH 3MOAL 3P4MA 3FMGL 1ITCA 1DVFC 2A74A 3ARDD 2QADB 1Z9LA 3H6JA 2GFBA 3WLBA 4JKWA 9CGTA 4NFDA 4NO0A 4C83B 3PNWA 1CFNB 4S1QH 1NQBA 4XBPA 3VFRA 4BQ9A 2VH5H 1IAOB 1RHHB 1X5AA 2BNQB 4X80L 3BGMA 3ETBF 1FYTE 4JPVL 4Y19D 4I0KA 5DJCA 3C08H 5E2TL 3LQAH 1MUJB 4P46D 2ZZUT 1KTKE 2BVQB 3CX2A 4HKBA 3CK0L 5CEZE 3QDAA 4MZ2A 3MBED 4NOFA 5EN2B 1C5CL 1M7IB 1XZ0B 1YNTB 1MCPL 3CU1A 5DVNA 2HG5A 3W0WE 3ARDB 2GT9A 5TE4L 5A43C 1I8IA 3FT4B 5E00A 3NZHL 1VESA 4F7MA 1WK0A 1RZIB 4U31A 3SKOB 1IAKB 3V5HA 3FT3A 1GJIA 3KJ6L 4UILL 5ABDE 1A1MA 4KJPC 1AO7E 4K3JL 3BD4A 4BK5A 1S9WA 2VZOA 5CSGA 2B1AH 3SY0A 3L3DA 3FTGB 3C8KA 4KK9C 4H0IA 4X8JA 2A38A 3PGCB 3TJEL 4IS6B 2DTMH 4KDTA 4AIXA 4CN1A 4ELKA 3O9WA 2M2DA 5JOPE 4NC1C 5HD8C 2YEZB 1HSAA 5TFSH 2D7TH 3SJVE 5C2BL 4JKKA 1SHMA 2IBZX 4I0PB 4NQDD 4X6EB 1RUAL 1WZKA 4M1GH 1J1OH 1MAJA 3OKLB 3T3PE 4ODHH 3TVMA 5CIPB 2R29L 1ZHLB 1G7JB 5EU6E 3WS6A 1E0OB 5F3HA 3KPMB 1Y18A 2CKBH 5KZCB 4N0UE 1B0GA 1CWVA 2JELH 3FZUC 3KG5A 5DUPL 1OW0A 3PABA 2ARWA 4YBLB 1LE5B 1J1PL 5T1LD 2NY5L 4KK6C 1CR9H 3V6ZB 1KENL 4PLJC 1CFSA 5DHVA 2AJSL 4XMPL 1T20B 2Y07H 4MNQB 1GAFL 3GMRA 5FGCB 2C3VB 2DQIL 3ULVH 5F3HB 3DUSB 3Q0HA 3EOBB 3DI2B 3U0PA 1QRND 1H8SA 1DQQA 3NACH 5D7SL 3LKNA 5ALBH 1J88A 4R97C 2OI9B 3BIKB 5GXBB 3GMQB 5KTEL 2ADFH 4WFFE 1I9IH 4P23D 1TIUA 2A6IB 4G8GD 4IDJL 4QXUL 3U9PL 1EGJH 3IDNB 3GGWB 4GKNA 1F13A 3PWJB 5SWQA 4BQCA 5CP7A 1RFDH 4MA8H 2DQDL 3MCKB 3NFPA 1AGEA 4PLKD 4N8VA 4GRLB 1I1AB 3ULSA 2Q8AL 2A74B 2ENYA 4MJIA 5T1DH 1MHHA 5CBAB 1UG9A 5CGYD 4O58H 3QRFM 3CFEB 2VWEE 1F4YL 3RY6A 4LLUB 4Y4FA 3VE0A 1VADB 2FL5B 2GTWB 2WP3O 3WXVH 3D18B 3TV3L 3EYQC 4POZD 1GC1C 1T04A 2X4QA 4MJID 2W0LA 4ZAKB 3O2VL 4DKAA 3GSUB 5DEGA 1VHPA 1T6VN 4HS8H 5C0RL 4R9HA 4ZSOE 3VFWA 1A7PH 3KPLA 2DJSA 3GK8L 1KUMA 1A6UH 1RZJC 1NCDH 4XXDB 1MHPH 3K4DA 4AG4H 5ID0B 3SJVB 2ZG2A 3TWCL 4P2QE 3ZYZA 1SY6A 5FGSA 1IQWL 1ZT4B 3AREC 3SOBH 1M1SA 3ULSB 4NNPH 2PXYA 1UH2A 1RJLA 1WTGT 4WV1C 3O6FB 4O00A 1ED3B 3BEWA 5HHQA 2FIRT 4QF1B 3TJEH 2IAMD 43C9A 4G6FB 2ITCA 1NMBH 3MBEA 4HUVB 5C09E 3TVMC 3QDME 1YMMD 4K3JH 3V6BR 3DUUB 4JPKL 5SX5H 1U8OA 5K9KA 2VJXA 5KN5A 5IGXH 5ADPL 3LEXB 1BIHA 2YBRB 5KSBA 4CAGA 1C8PA 1CDBA 5IBTH 3NCYP 1U9KA 3VFPB 1NAML 4Z7NF 5C6PB 1YEEL 2EYRB 2YUVA 5E94B 3CMGA 4NQCE 1WFTA 5C7XH 5LBSH 4XBGA 1IAIH 3O3AA 4TUKL 1CU4L 1KPVB 3ARDA 1FZKA 1Z5LB 4NCC2 4NYLA 3GMOB 1ZS8B 1MHCA 2JKXA 2IFFH 4TVSa 1F11B 1KN4L 4JDZA 1X5FA 1YYLL 5EZJA 3F7VA 2D0GA 4BSJA 2PYFB 2WW8A 4N0YH 3O4OB 4Q2ZB 4PLJD 1A0QH 5MENE 3C5ZB 3PXJA 5E1AA 1JFQH 4HK3J 4E42B 5F6IB 4GLRI 4ELKB 4FXGA 3IFNH 4OIIL 3LS4L 2W60A 3V6FA 1KACB 2WUBH 2VRAA 4MA1C 3MOAH 5I17A 4PP2B 4TQEH 4ZTOL 4QRUB 3KPNB 1XCQB 1G0YR 1U3HD 1JNHB 1CDIA 2DIBA 2HT3D 3LKRA 4P23C 5DYOB 1A6AA 3DO7B 4RAUA 5C0NC 1MVFA 1WIUA 4PJCA 1CQYA 2P5EB 1YMHB 4F2MA 1I3VA 3GSWA 1AGDB 4U3CA 3RDTD 3T0BA 1MEXL 3H7BA 3ILPA 1WSST 3TNMB 4FTVE 1E28A 3CDGA 4GRLC 1I9IL 4KK8D 4U3XA 4APQC 4XCCH 5TE7L 3K1KC 3VXSA 4HIJB 5M94B 1K2DA 1NCUA 2VLKE 3MV8D 3QIUD 3ARVA 3TBWA 4GSDH 4ZOAA 1M6OB 3VH8A 1CFQB 3EDJA 1J12A 1SYSB 2EZ0D 1XZ0A 1YNTA 3PHQB 4G43A 5DURD 4Y4FB 3QEQD 3BW9B 1WISA 4OUOA 5DTFB 3ZYOA 4Z7VA 1F6AB 5EOTA 5HVWA 2Q8BH 2APXA 3MA9L 1U8NA 5EBMB 4DUXA 4LFHG 4XMLL 3VI3E 5JHLL 2OJZH 1F42A 3RI5K 2NXZB 3K81A 3RVUC 1KPUA 1U8LA 2ZUYA 1CDUA 1K2DB 1WTLA 1JJUA 1RZKH 4RGOH 1D9KD 2IQAB 4RCAA 1A3LH 3P2TA 3VFRB 2FD6H 2XKSA 5D71H 1N2RB 3HMXA 2D03L 2UUDH 2DM2A 3VGHA 4ZYKB 5IBTL 1QACA 2X40A 4IRSD 4P2OC 3O11A 1IAII 1SMOA 4TRPH 3BPNB 3G6DL 1A9BB 3VWKB 1QRKA 2J1KA 1MHHB 4BFIA 4QRSA 4NUGH 1JPFA 4K71B 1H3PH 4RZCA 1AKJA 2DTSA 1I7ZB 2EXYC 4PPTA 4M7LL 4XB7A 4MJ2A 5DD0L 2BHUA 3BSZL 1PVHA 1BJMA 5J1AB 2CLRA 4UT7L 3QCTH 3UTTA 4E41D 1FZJB 4OLUH 3BP4B 1T66D 3ZKMC 3QG6A 5CIPH 3O11B 3GDBA 1K8IA 1JHKL 2IADA 4G7YL 4L4VA 3FL7A 5ESQA 1OAYH 4RMRA 2NXYD 4G8FA 3U1SH 1HH6A 3BXNA 4HJGA 4JR9L 4W68A 5A40E 4JFOA 4LHQB 5DJYA 1HQ4A 2BCKB 3BAEL 4HWUA 4QOKD 4JY4B 3JSSA 4HXAL 4Z18A 2DQHH 4AIOA 2BNRD 1MCPH 2H26A 4X98B 5B39B 3RVVD 4QHNA 1HHIB 3KNBB 4IMLA 2UWEB 4L4VD 5EOTB 1P1ZA 2E7LC 4I2XE 1HYSC 3GSRB 1MRDH 4CN6A 4YDLB 3OJDB 4PGDA 4DWHA 2F5BH 4PJ8C 3P0VH 3MUZ1 5FKPB 3CGTA 4M48H 2O26U 4P9HL 5F6IC 4YDKL 4HQQL 3MRDA 5MEOA 1YEKH 5GS2D 5J1TC 1C16B 3BWAA 1MNUL 1HSBA 1FL3A 4MA1B 3NTCL 4NCC1 3I75A 3IS1X 4U6XA 4QCIB 2NR6D 3V5DA 4JAMA 4N0FA 3SDXE 1NJ9A 2Q3AA 5E8DH 1AI1L 5SWZE 3TBYA 4L4TD 4P99A 4MA3A 1LILA 4U0RB 3NCYS 3NCJL 2YRZA 4LDOB 2SEBB 3S5LB 4OZIF 4OB5H 3G08A 1EHLL 1HCFX 4MD0A 2X41A 5DZNA 2VIRB 3VMOA 1CS6A 1BQLH 1R0AH 5DHXB 4C59B 4J3OC 3UTSE 5F7DB 1KULA 4OKVB 4AYFA 1KXVC 1A3RH 5DD3L 4MXQD 3QUKA 4L1HA 1A1MB 3TBVA 3QIUC 5BZWB 3TBSB 4XNMB 3ROOA 3S7GA 5B8CA 4TN9A 3S5LG 1HQ4B 3JWNC 4JFXB 4LMQE 3RDTA 4ELMA 2IPTL 3AS1A 3PIQA 4JO1H 5SWSD 5L6YH 3ARWA 1Y6MR 5EU7E 5JOPD 3MV11 4XP1H 2X4TB 4GW4B 1CICC 3QISA 3D3VA 4NZDA 3OKLA 1MELA 3BWUC 4FQ1L 1GC1H 4EDWL 1XGYL 2VLKB 4JJHA 3RAJL 1LQSR 2WP3T 5DQ9B 5SWSA 4WGVB 3VXUD 1QA9B 5KVFL 2D9CA 2APFA 5DXWA 2OX5A 2HFEB 1JGEB 3BPNC 1HNGA 1ZHNA 5C0FB 4NC1E 5GGQL 3PIQB 5AZEL 4DGVL 2LVEA 1VFUA 3TA3B 3FONA 3ULUH 1UH3A 1IT9H 4UIKL 5JXEA 1HINL 1E4XL 5D8JL 4KRPD 1UEMA 4GAJH 1RJCA 3W5NA 1VFOA 1QO3A 2CD0A 4XP1L 3QUYA 4QYOA 4TRPL 4CW1B 4I3RH 4GKZA 4JDTL 4OAWA 3T1FA 4GG6B 1CICA 1GGIL 1AHWA 4MVBC 4FTVD 1MRDL 4NN6B 2YSSA 1W2KT 3HG1A 4OCSH 3MJ9L 2XN9A 5I1AA 5D7KE 1JF1B 1N5YL 2OJEA 4MAYD 4FS0A 2FYYA 4LSTL 3NTCH 5IOPB 3TBSA 2AJVL 4AL8L 4Z7NE 3WSQH 4QKXB 5D70H 5FYJE 4YDKH 1FNSL 1OVZA 3EYVB 1A4KB 3GKWH 1KTLA 3C08L 3TYGL 4PJAE 2R1YA 4Y16B 1EHXA 4FA8A 4GW5A 3E0GA 1ZLSL 4QXTA 5KJRH 3TIDB 2PNDA 1AGCB 3HZMB 1UA6L 3GO1L 3RY6C 1LK3L 3MJ9A 2R39A 1DEEA 1U8QA 3MLXL 4JFFE 4PGDB 5DVKA 3AS2A 4DN3L 1XGUA 5HJ3B 4JM4L 3VG0L 4LCWB 2ADIA 4HUWB 2P8PB 2AI0H 3RWHB 3V4UL 5EZIL 1WBZA 3TFKC 1UWXH 3MRGA 2QR0B 4FG6C 4ZNEA 5L8JB 1D9KA 1BVZA 2HT4D 3CXDL 3MXVL 1MJ7L 4JKPH 5FO9A 3HPJA 4JFOB 3RWFB 3L5XH 3O9WC 2FBOJ 3IJSB 1TCRA 1MY7A 1IGMH 1IC4L 1QG3A 1OB1B 5D96B 1NCCL 1VGKA 4K94H 1T83C 4LSSL 3L3HB 2J12B 1NFDA 4XXCA 4LKXB 2PYEE 5CJOL 4LBEA 3TT1L 3VGDA 5I30L 4LCCB 5T1LA 3LIZL 1DZBA 1UZ6E 3F58L 1L6ZA 4RBPH 2QHRL 2HTLD 2A6JB 2OR9L 3OV6A 2WUCH 4FHBD 5IK3A 3IJSA 1CG9A 3QCUH 4UMGA 2GY7B 4OIIH 4PJBB 4RRPA 2WBKA 4NM8H 4X6FB 3TYFA 2PW2B 4S1SL 3C6LA 3HZKB 2OR7A 5ESAA 1I7TA 3K8LA 4OGAD 4HC1L 4DAGH 1L0QA 5DJ6A 2EDYA 4OF0A 1U3JA 5D7SH 1C08A 2AK4D 4NQCD 5I1LA 4QGTA 3O3DA 3MGOB 3M1BA 1SM3H 4L29B 3GUTA 5F7KC 3VFGH 2ED9A 4NKMB 4GRWF 5CWSB 5CSZB 4JG1L 1NAKL 4W4NA 1T80A 5KSAA 1MOEA 4XPHH 4DKEH 3LKOB 1XT5A 1YNLH 3VWKC 5JORB 4PREB 1G9NH 2IH3B 2DLHA 5BZDB 3RIFF 2X42A 5HYJB 3MRCA 2C3GA 2V7HB 1J10A 1D5XA 4CU7A 3QIBA 3U46A 1AO7A 3UTZA 1GVIA 2MHAA 3IFPB 3SDAB 1M71A 2J88H 4P5TD 2Q76B 4KUZH 5GGUA 2C7UA 4U3HA 1JWUB 5DJAB 3BGAA 1ZGLB 1NANI 3U0TA 3WNPA 4PJ9A 4QNPF 2VDLL 2P42B 1U3HB 3TPUA 4DVBB 1FFNA 3EOTL 4OD3H 3G6AB 4GUPB 2QQQA 2F54A 4P3CL 1XEDA 3DHMA 1ZA3A 4M93C 4LLVB 2J2ZA 4PJHE 1U58B 4JM2B 2FEEI 3UYPA 1FIGH 2DLFL 3HI1B 3C5SA 3NABL 2FX9L 5KVDH 2J7LA 2KL6A 3LKOA 3IF1B 3QXAB 4WHDA 3HNVL 2YMXL 4XNQA 3L7EA 4L3EA 1MHPL 2C3HA 2HVJA 4MAYA 1OP5K 5CZVH 2H8PB 1KCRL 5GGSB 2EO9A 2CR3A 1FLTX 2I5YH 4LKCB 3N1MC 4WDIA 2GITA 3WV0A 4LRIA 1KCSL 3LS5L 1YYML 2CJUH 5E8EB 4QHMB 5CZKA 1O7SA 3MRIB 4JE4B 1WAAF 1HYRC 4ZQKB 4LPXA 4X4XB 3AY4C 1G9EA 2YWZA 4F7TB 2XQYG 4G80A 5F7DA 5D6DC 2N1KA 4MDJB 3SKMB 3MLUH 2G9HA 1X6NA 4Q0XH 3EO9H 3PWVA 4PGCA 1U8IB 1UB5A 3KPQB 5IKCB 4RX4D 4KK6D 1G84A 1TLKA 4XCYA 1JRHL 2A6KA 2VDOH 4ODHL 1QTYT 2V2XA 3GSOA 4HUUB 2HFFA 4ONFH 4KGJA 4U1KB 4XCFH 1Z3GL 4NP4H 1D7FA 4H25A 2HVKA 2NY5H 5C07B 4RDQF 3KYNA 4XBEL 4LLWA 1I85A 3RKDD 4FTVA 4OIAA 3BOVA 4W6XB 2DWEA 5EO9B 4LLQA 3T4AB 2CDEA 3MCLL 4Y4HC 3BN9D 1I3RB 5CCKH 2DQTH 4XZUB 4HUWA 5J57B 1UFUA 3QO0A 1R3KB 2I9TB 1EAPA 2JCCA 2CDGB 1MF2H 3ARBD 3W9DA 1RFDL 4M00A 4MD4A 2NY0D 5B4MD 2NZIA 2UUDK 5FEBA 3I2CH 4MCYB 5EC2B 1CIDA 1LO5A 5FGCE 1FE8H 4XAKD 1MFBL 3VCLA 4DEPC 3WKNA 3MOBH 4OGAC 3QH3A 4XCYB 2IANA 4P57B 2LAAA 1EFXB 5T1KB 5DFVD 1R3JB 2JCCE 4JG1H 1X3DA 3T65B 2G5BA 3GI9H 4Y2DD 1SJVA 2GCYA 5I1AB 3AXLB 3DETD 4M8QB 2ZPKH 1SYVB 4UB0H 4DFIA 4N9OB 4XMKL 4H8WC 2DQDH 3QXDA 3MV8A 1RZFH 4J12A 2BY0A 1AIFA 3VXMD 2DLIA 2J4WL 2A1WH 4PY8I 2XRAL 1CE6A 1NMAL 4J1UA 5DI8A 3ARBB 5HGBA 3TA3A 1NSNH 3JWOH 2BRRH 3FB8B 4JO3H 1L4IA 1P4LB 2X4NB 1KSRA 3O4LE 1ZLSH 1MFDH 3IYLW 1OPGL 1MCDA 1Y0LA 3G5YB 4JO4H 4KY1L 5CZVL 1IAMA 2A9ML 2E7HA 5DDHB 5C0AD 4N0RA 8FABB 5CUSH 1VDGA 4UZGA 1NEZG 3WFBL 4HCRH 3KYOA 4ZSOB 5F9AC 1IC5H 5GGVY 3IDYB 1UCTA 4OLVL 5EFIB 3T4YA 2VO5A 4LAQL 4BFBD 5T3ZE 2ZP0T 4NBXB 4X7SH 4URTB 1GXEA 4XPBH 5K93A 1OD9A 1WQVT 8CGTA 3KVQA 4RQQB 1AD0B 3MFGB 4ORZC 2OTPA 4G9DA 3BPLB 4NO2B 3ZT6A 5IJVA 4YDIH 4RMTA 4HS6B 3LCYA 3CLFH 2EIZB 4LSUL 1UM5H 3GZKA 4M8QA 4ZMAT 3TH3T 4KI1A 2XZQH 4PJ9B 4JKLA 4PV8A 2WV3A 3ROLA 5DRZB 1BVKB 4Y16D 2VISB 3WSQL 3OX8B 2IMMA 3FB5B 3BPOC 3MA7B 4ERSL 1A7OH 5F9OH 1X9QA 5EU7C 1QSED 1FBIH 4MJ4A 1Q1JL 1YC7A 1HE7A 5HGAA 1GH7A 5TGBA 4ZD3H 3QEGH 3CFCH 4BZYA 4QHKJ 4F7CA 3VD4A 1ZVSA 4UI2A 4M1CD 4PJCB 2HLFC 1C08B 2IPKB 1QBBA 3ABZA 5MEOB 1ZT1B 3OQ3B 1I3GL 2BMKA 1R5VA 5D1QA 5EZOL 4LQ1A 4H88H 5HHME 4DEPB 1I1YA 4KTEL 1RZKC 4KZDH 4JPVH 2DMCA 3D85B 5F89B 1UZ6F 1S9WB 3VWJB 4L4TA 3NZ8B 4AMKH 3D0LB 3QFDB 1DBJH 4I9WE 5KVMC 3KPSE 1TJHL 1AE6H 4XNXL 3WFEH 3MUHL 4M4RA 1CDCA 4IOSD 5FYJD 1G7HA 3MNWB 5IVZA 3QI9D 4NYLB 4WCYH 2XNAB 1RK1B 2EC8A 2X2YA 3HE6A 5CUSL 5HI4D 1MHCB 2AEQH 2Y36H 4PGZA 3JTSA 4PBVC 1KB5A 4IOFD 2J6EH 3CCHB 4Y1AD 1T4KB 4IJ3C 4LCWA 3DRQB 4JFFD 4ZDHA 1NLBL 4R4BA 1OSZB 5CD5D 4BZ1L 2V7NA 1UVQA 2X4SB 4N0CC 1FLRH 3QRGH 3QRGL 3B3IA 3I6LE 3FO0L 4ONOA 3S37L 3S37H 4AQOA 1CXEA 2NX5B 4ZOBA 3SHSA 1MRFL 1UH4A 2MOVA 1MLCA 2E6PA 1T83A 1IRAY 3ARZA 4MLSA 5IMLA 5DD1H 4G8GE 2DF3A 2AEIT 1K4DA 2VUOA 3GMQA 4U6HB 4OFDA 4F80A 2Y6SD 5DC0A 1RIVL 5DJAA 4F7MB 1RJZB 1RIHH 2APVA 4X9BA 3CD4A 2DJ4A 2ATPB 1T04B 2X4QB 4HZLB 3WHXA 3FQTA 5M7QA 1LVEA 3FO0H 5I1IL 3P0VL 4M7LT 2DL2A 3TCXA 4FQLH 1JZ4A 1PZUB 1LE9B 3HNSH 1FCGA 4UBDC 1I9EA 2NXYC 1AGFB 4UT7H 4PJHF 1W0WB 1U91A 2MFNA 4K3DH 5CBAA 4WENB 3O6KL 2HMIC 3D2UB 3HRZA 4LLMB 5I16B 5FA3A 4U6HA 4EEEA 3O8XB 1VADA 1INQB 4JDTH 3RVVC 4JJ5B 1IGCL 1B0GB 1EBAA 2VL5B 2FLBT 3ARSA 2DQCH 4JN2A 3MRRB 1R24B 4MQXC 1ZHBB 1JNHA 5DJ6B 5C08E 4YWGL 4YWGH 2BNUB 4ZD3L 1LK2B 3IXAA 2BOBA 4PJ7A 3I9GL 1JTTA 2BXYA 3MLXH 4F2MB 2AV7B 3M1BB 4H1LH 4GBXC 4LVEA 5FHBL 4JCLA 2QLVB 3FN9A 1UJ3A 5I9QC 4V1DE 5ESVB 5F7YC 1HHKA 1ZWIB 4CDHA 4QCIA 3DUSA 4S0TD 4BQ6A 5BV7L 4ERSH 3QPQD 4L3CB 1JE6A 3CVHB 4NT6B 3W0WB 4H8WH 1QBMH 2AJ3B 2YD4A 4WI2A 2EDNA 4U1GB 5IM7B 1EO8L 4KKCC 4Z77B 3HHRB 1G7PA 1B2WL 4O5LH 4DZBA 1KLGB 4ZO9A 4LSPH 4JM2D 5D6CA 1P84K 3BKCH 3VWJC 5I75B 2XT1B 3FOLA 4S1RL 3S35H 3T08A 4F58H 3IETA 3LEYH 5H94A 1NGQL 5C08A 4ORGB 1DDHA 3TH2T 5ITFA 4Q2ZA 4PJFB 4UAOB 3EYOA 4F8QA 3FQWA 2Z31D 4L8DA 3VI4E 4G42A 1YEGH 3OR6A 3VD5A 5LGJA 1G6VK 1J0HA 5DD1L 3A6CL 3M45A 4X4ZA 3B5HA 3FRPA 5HGAB 4M7KL 3RI5F 5JW4N 5IB3B 1ADQH 4MDIA 3WIIH 1QSFA 1VACA 4IOFC 3OKMA 4OZIE 1WIPA 4R0LC 1OF2A 4GS7B 4QHMA 1JV5B 5DMJB 4YHKL 5HPMB 4GKSA 4I4WB 2WINB 1IAKA 1VFBA 4WW2B 3P4NB 2BC4B 3DMMC 4WHTB 3NAAL 4L4JA 3PUCA 1BQHB 1J8HB 1U8PB 1G9NL 5IB4B 3PGCA 4WI3A 4J1UB 1CFVL 2NYYD 3D48R 3GMLA 4H0GA 5EU6B 3FRUB 3BMWA 1QLFA 4LLDB 3VJ6B 3EAKA 5E95B 4HXAH 1KLFA 2EYSB 3D18A 5KSAD 2EXWC 3GBML 3SDXF 5CSZA 1DBKL 4HZLA 4ZAKA 1CN4A 1YYLH 1BQHG 4K7PL 5D1QD 1RI8A 4YHYC 4I9WD 1JHLL 4YE4H 4CN4A 4P4KC 4YHPA 3T4YB 2VDRL 3QEQE 1XCTA 3GHBH 3GI8L 1UWEH 3C09B 3IFNL 3QG7H 1XGPB 2GSGB 2VLLA 4JFYB 3VXPB 1E4WL 4OQTH 1DVFD 4J8RA 4OZHB 2H6PB 4U6TA 3ARUA 2E9BA 1EV2E 4PLOB 1ZTXL 2ATKA 5AEAA 5HHNA 1FAIH 5DMKB 1EUUA 4FZ8L 3IDGA 3PJSA 4NJAL 2B39A 1CI5A 5E4IA 4CUCA 3U7WH 4D0DB 1ZK9A 3GI8H 3F6IA 4M6AA 3OXSB 2HT4C 2XACC 1J18A 3FOMA 4JFQA 3T0EA 2Z93A 3LRSB 4LHUA 4JFHD 1EXUB 4M03A 1TCRB 4TUJA 1DVFB 3UBXA 5I16A 4OV6F 3VGEA 4K3HA 3TGXA 4D8PA 1RURL 3H42L 5I75C 3HI6L 5E2WL 1Q72H 3FQUB 3RX8A 1Z3GH 3BZEA 1BVLB 1H5BA 2X4UB 2P5EA 4P2RE 4PJBE 4GMTH 4HGWB 4FFYH 4B5EA 2FDBP 3PDOA 5F6HJ 1QOKA 3KPRD 5TF0A 5JA9A 5JW5B 5EZLB 1HZHH 4MSWB 1QR4A 5T3ZD 1QNZL 5ADOH 3MLWH 1MFCL 3CVHA 1MHEB 3F62A 3BUYA 3IXTA 1I4FA 4EQ3A 2D0HA 3OAUL 3A67H 2B1HH 3VXRB 5IQ9A 4QF1A 5HJ3A 2NY1B 4Z95H 2NY7L 3FZUD 4WW2C 2H2PD 4JZJA 3RX7A 5DR5L 5I1EL 1DCLA 2HJFA 2YD6A 5LAXB 4JPWH 4PV8B 3ROLB 4YBQC 3JTSB 4I3SL 4HC1H 4DAGL 1OF2B 4NO0D 4AH2B 3VWKD 3SY0B 3UCRA 3UBXG 4NZJA 4OF6A 1HIML 5K59F 4XVSH 1WFUA 3RZWA 3HRZB 3HC0B 4Y5XA 4G42B 3VXQA 3FO9A 1AD9A 3RUGB 3AVEA 3W9EB 2XQYK 3HMXH 3IGAB 1YZZA 1WC7B 2VLRA 3MX0A 5J6HA 1MQKL 4JFFB 4HF5L 1FFPB 1SBSL 3JZ7A 5I1KH 2XKUA 2WWMD 4FZ8H 4OJFH 5AAMA 4CU8A 1TVDA 2C1PB 4AK1A 3O6ML 3O6MH 2HLAA 4P2QA 4HAFA 1I8MA 1KPVA 4HUVA 2V6HA 5HI3C 1ZT1A 4RSVA 4JM2A 1UJ3B 1LP9F 4PG9A 2GSIA 3QIUA 2VZVA 1EA9C 5INDB 4N90D 1TJGL 3H3PH 4PJDF 4LNRA 1NGZA 4OSUL 5EIIA 1TJIH 4YXKL 4MXWL 3RL2A 4OD1H 1FFPA 2H41A 4NPYB 4NKQB 1JIBA 4JKPL 4ZFFB 4L8CA 1CL7I 3PWUA 4JRXD 1SVCP 4GBXB 3VA6A 3TH4T 2KQNA 1DTUA 1EZVY 3KPSD 3T3MF 5IVNA 4POZC 5F1SA 1T0NB 2JJTC 4RFNB 3OKNB 3K8KA 5HDBE 2DQEL 4LBEB 2RFXA 4S1RH 5GS1B 2NQCA 2VLJA 3P0YL 4XVTL 1FPTH 4C56E 4DOHE 2NLJA 1FP5A 1JGDB 4Y5YA 2XQBL 1JNNL 1LP9B 4ZFOB 1I1FA 4LQFH 2OK0L 2HJKA 3K8MA 3WFHA 5CJXA 1FO0B 1N8ZA 1H0DB 2WIIB 1OOAA 4Y5XB 5IESH 1CXKA 1ZAGA 3ARED 3LS5H 1ZLVK 2P49B 3W11C 5HHOE 2FLRT 1IGCH 4ODTH 4QT5B 2FB4L 4LCIL 1X4YA 3L9RA 5D7IB 2ESVA 1F2QA 2IAMC 4LCYB 5DYOA 4JHBA 4R26L 1MJ8L 1A64A 3I84A 1BWMA 1ZLVH 4LSQL 2HFTA 2ADIB 4JFEB 5C0IA 1QZ1A 4OZFG 3GNMH 1EEUA 2P5WA 3SCMD 4W81A 1KFAL 4PG9B 3S4SB 5HGHB 1MJ7H 3CSPA 3HLAA 3GMNB 3RVTD 3PWPD 3V7MA 4KGLA 1F3JB 2D7OA 2HRPL 3IKCB 2LFGA 3PL6B 2ZCHL 4MA7H 1Z9OA 5SX4H 3ZKNC 4X5XA 5IEKA 4R0LB 5J7CC 3T0DA 3NA4A 2EH7L 4OD2B 2BHZA 3MMEB 5BOPA 5GIRA 3WCYA 5ECJE 3C9NA 2VTFA 4JRXB 2M1KA 3CX5J 4QXUH 4M62H 3U9UA 4LOUC 4Y2DC 3OGOE 1F3RB 3KPOB 3MRLB 2FECL 4Y4KD 3MLTA 1FYHB 4M4PA 5I0DA 3IDJA 3KLDA 5DC9B 3OG4B 1KN2H 1HDMA 5BRZB 2ED8A 3C2AH 3PL6A 4XPHL 2FEDD 4MD0B 3VGBA 3D5OF 2GTZA 5LAXA 3KLAA 1KIPB 3T1FB 4P3CH 4S1SH 5KVGH 3HB3C 4GT7A 2RBLA 4MHHI 2HVJB 3KGRA 4RNRA 1I9RL 3MLSH 4Y19A 1BIIB 2QEJA 4M7KH 2AERT