4MAYA

Crystal structure of an immune complex
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
IVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2013-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mayA01
2XKUA 4O51A 4X7CC 3ULVE 1J1OH 1ZKAA 5M7QA 4J6RL 4WUKH 4NN7B 5D96C 3S35H 3U6RA 4QWWD 5B39G 3VGHA 2F5BL 1RZGB 4Z6AT 3H3BC 5IB5B 4HKJB 4MCYA 4PJHB 3SE4A 1O0VA 2CO6B 3SE4C 1R0AH 2YEZA 3OKLB 5BZWB 2Y72A 4HIXL 5JW4M 1CXHA 4Y5VA 1H3TA 5JNYA 4Y5VC 2W9EL 5E8PA 4JFOA 3VI3E 4NO5B 1W0VB 1FHGA 3KLAB 3O9WB 5C09D 1S8DB 4IM8A 3ARDD 3KPPB 5HY9A 5CEYB 4HJJL 4NQSB 4KZEH 4KK5C 3QDJD 3SCMB 3LS5H 2P24B 4Y1AB 2HRPL 2I26N 3DV4B 1SQ2N 3QUKA 4NKQB 3IKKA 3DX6B 4U1MA 3U79A 1ZLUH 4UDUB 4I0PD 1NC2D 4IRSD 4P2YA 4G3YL 4XHQA 5IF0A 4MAUH 5I16A 2DQGL 4QHMB 2EC9U 1QRNE 3MNVB 3F65A 5E08L 1BM3H 1W2KT 1MRFH 1DP0A 4LHUB 4HBCH 3HNVL 1QACA 2Z93B 4YDKH 2C3XA 4PJCF 4KJQC 3T0VA 3QULB 2VISA 1PZ5A 1G7LA 3L3IB 3JV5A 3QO0A 1AXTH 1RD6A 4PJBE 1HINH 2H2SD 4PJ8B 4U6XB 3VGFA 5J12C 4GKSB 3HNSL 4PJ5B 4KMTL 4QRPA 1WGOA 1EVUA 5KAQG 2CK2A 1KC5H 3TCLB 3I2CH 2VE6A 3O6FD 1HIML 1FNAA 1QKZL 4WHTA 5D2LA 4MCZA 1NFKA 5E2TL 1ACYL 4P9ML 1R3JB 5DT1L 1MCWM 4TNWK 3S5LB 5D2NE 5E2WH 4RBPH 2FR4A 1S7SA 1F4WL 1KCSL 3ZKNC 3U30B 1TZIB 3RNQA 1JVKA 4GQ9L 1NGQH 4XNMB 3C5JB 3TPUB 4P57B 4OAWA 5DJZB 2XTJD 4OZFB 5D71H 4GXVH 1S9XB 3TZVB 4AYFA 5I1JL 2VERN 3OR7A 1XF1A 3D25B 1YJDL 1IC5H 4QRUA 1S7VA 4FG6C 4H0IA 1IQWH 5CJXC 2BSTB 4AL8L 1MCBA 5KW9H 3KPMB 4DZ8A 2FHFA 4NM4L 4MLIA 4FQJL 2GY5A 5CSBA 4QRSA 3RKPA 1IMHC 3W11D 5MEOB 2YSSB 3I6GA 3UZEA 5T1LA 4LLYB 3MV11 2J8UB 2MWCA 5J56B 3T2NL 5KSBF 3DV6B 4HUWB 2DLHA 2RQ8A 5I1HH 5F7KC 1DQML 4OTXH 5C07E 1LNUB 2O26U 1RZFH 4IBLT 4FZEL 4MHHG 3L3KA 4EXKA 3GNML 3ES6B 5IIEA 3GSRB 1F3JA 1MCEA 2FLRT 4YDVB 3BUYA 2K7QA 3IDNB 4PRDA 3SE9L 4LSSL 4GRWE 3MRGA 4E41B 4HDIB 1A6UL 4OF0A 4CVZB 3KPSB 3VDBA 3LN5A 1V7NL 2R0LL 4JKMA 2G75A 5FUZL 4KY1L 1XGUB 4Y4HC 3L7FA 2P4AB 4P4KA 2B4CH 4NQDD 2ZPKL 4HWNA 4HJGB 1N4XL 1AE6L 5EFIA 1U8QB 1FNEA 1NDMA 3CSPA 3H9SB 5EOQH 2GJZB 3TA3A 1OAXH 3VXUB 1EO7A 2C3VA 1KFAH 4ZFFB 5JPMA 1LK3H 3PWVB 4MDJB 1G1CA 2LTQB 3GJFK 2VZUA 2DQCH 3TLRA 3RDTB 4NJ9L 1JHTA 3HR6A 2HTKD 3D0LA 1NSNH 5GPRA 1QFWM 3FFDB 2JIXB 4XPAH 4JPVL 3ZT5A 5HHMD 3ZKQD 3R06B 3QNYB 4PLKD 5IBLC 3FQNA 5I8EA 4OFVA 4QF1B 1WWAX 2QV2A 1KNOA 2VXSH 1F8TH 2OP4L 4O00A 3R0MA 4EN3A 2HP4A 3OL2A 2VR5A 4EN3C 4U1SB 2ENYA 4HG4J 2D9QB 4AENA 1U8NA 2F54E 3EFFB 3OZ9H 1RUPL 1CLOH 4MDIB 4X9GA 4XMKL 1PVHA 2UWEA 1OP3H 1LWRA 3S34L 4QTHA 5IEHB 3LKSB 5FO8B 2D7TH 5EO0A 3C5ZB 4PJ7E 5F1OB 5D2LF 2NTSP 3VE0B 3O3UN 4JDZB 4K7FB 1EXUA 3ILQD 4X80L 1BPVA 3PWPB 3SJVA 2DOCA 3DSNA 4JFHD 3WFHA 4XAWH 2MQ0A 2XQYK 3SDYL 1RVFL 1T6VN 2DQIL 2HVJB 3UO1L 2H1PH 4H5SB 4OD1H 2A6DA 5GRYA 4YBHA 5ITFB 4OGZA 1BX2A 3PNWA 2YPLE 1OSPH 3KWWB 2NY5H 5ITBL 1B3JA 3VFRB 2BMKB 4G43A 1C12B 3QQ9C 1X5KA 5ESAA 3V6OC 3Q6FA 3MSPA 3REWB 3MROB 1DL7L 3LRHA 3WN5B 3U7WL 2A6IB 1F90L 5DJ6A 1NCCL 2DLFL 4RAVA 4L3AA 4W4NA 1A7QL 5ISZE 3KLHC 5C0JB 1QQDB 5E00A 4LSUH 3T77A 3QEGL 4Z76A 1Z3GH 1T1XA 1V7ML 5IMMA 1ZS8B 2AV7B 5JHDB 5EU6D 1E4WH 2XA8L 4HS8H 5IW1B 1TZHA 3TH3T 3I3BA 4NC0B 1JF1A 1R5WB 3I9GH 1F6AA 5FOBB 3UYRH 1PYWB 4LSQL 1T66C 3LKPB 3U36B 2WLYA 3HC0A 4CBPA 3TJEH 5KSVA 2DI8A 3P77B 2VLRB 1I3GH 2V2WB 4XP4H 3MV7E 3BAEH 1A14L 2MKWA 4KRPC 3F5WA 1SY6H 3O3DB 3UBXG 3GBMH 3S37L 3U9PH 1QHPA 3U1SH 2DQTH 4XX1E 4KAQL 1FZOB 4FFVD 5D1XD 1IAIM 3RBGA 5EH1A 3OAUH 1I8LC 3QDHA 3L95A 1G6RA 1HOCA 2IFFL 5I17B 3PIQA 3ALWA 1TCRB 3QDAA 3MXVH 1LDSA 4M1CC 4S1SL 1GIGL 3UTZB 1U8HB 5JORB 4KJPC 1BQHB 2ORBH 1GGBL 1MCQA 3BKYH 3DGGB 5IV2B 5GGTL 4PTUA 2WAHA 3GUTA 3LCYA 3MPCA 4D3CH 3T65B 2OJEA 4LAQL 2ED8A 4M8QA 3DYPA 1IGCL 4Z7NF 4Q97A 5EU5A 2HH0L 5D1ZC 5INCA 1CE1L 1U8JB 3B9EA 2LVEA 2ZUYA 2AEQH 4X6FB 4Y4KB 4KRNA 3CZFA 3NIGE 1U8IA 5ICYA 3PJSB 1BJ8A 3OR6B 1L7IH 1RPQA 5HYSB 3MJ8A 2LV4A 3V4UL 4ZUSA 2QLVB 1NGYA 1KTLA 4AMKL 5IR1A 1RUML 4KQ3H 5DVKA 2ITDA 1PQZB 1N64L 4JM2A 3W9DB 3L3JB 3HLAB 1MHPL 4FNLL 1RFDL 2JE8A 4JM2C 4PJCB 5DK0B 3QDGB 4YXLH 5KVFL 2AK4A 3QFJB 3STZB 2XZQL 2IALB 4P2RE 1J87A 2J4WL 5C8JA 3L3GA 5E5UB 2DWEA 1UQSB 3HUJA 4GMSH 4C58B 1KJ3L 5HYJD 5IFJB 3ARBD 2UWEF 2EE2A 3GI8H 4HLZG 4WHDA 1CTNA 4KJWC 4XGZA 1ADQL 2YRPA 3VXSD 2EKSB 1HDMB 4N0UE 2B7DT 4LLDA 2J12B 4XBGB 4KHTH 4XP9L 5I8OL 1NLDL 4NQEA 3ARGC 3PWLA 1TJIL 2FATH 2LU7A 3LRGA 1IM9D 1CQKA 2NYYD 4QLRA 5FYJL 4YZFF 4CMHC 5JR1H 4QXTA 2NR6D 4P46B 1B0RA 2Q7YA 3UTTD 3QB7C 1H5BA 3K8MA 4X8JA 1JTPA 4OD3H 4R7DA 5E6ZA 4O58H 1H5BC 2HMIC 3MA9H 1P53A 1RJYA 2BVEA 5D7SL 4XNZC 2H41A 1MJJA 2ILLA 4FQLH 2CGRH 3X14A 1X5JA 3FO9B 3V79C 4EDXA 3MRIA 4QOKE 2BOCB 1UADC 3NFNB 2ARJA 4TTDC 2DWDB 2XRAH 4YDJB 3SDDA 5SWZD 5ADOH 2H32B 4KMQA 5ACLA 1ZGLP 1TVHB 3QHFL 1MJ7H 4J8RB 1MNUL 1D9KB 4HKZA 1LO4L 1P84J 2UZIH 4HFWB 3FRPA 1FLRL 3CDGA 3HI5H 5FO9A 5AUMA 4I0KA 1EK3A 1U8OA 4HPYH 1KTDA 1J8HB 3IJHB 2YZ8A 1P4LB 4YBQC 3EYSL 3LMJL 3U0TB 1DBMH 3VMPA 3V4PH 4BA8A 1U42A 3BPOB 4PD4K 2EDDA 5AYUH 4AQOA 4PRHB 1K8IB 4XVSH 3UPCA 4HC1L 4HFUL 2ED9A 3GSNB 5LG1A 4HT1L 4KXZI 4BK5A 4JG1L 2A1WL 2VAAA 4N5EC 3H42H 3L5WA 5BW7A 1JMZA 5JXED 4L9DA 2Z8VC 3VGEA 5DJ0B 5I2IB 4CU7A 3OSKA 4G5ZH 3KLSA 2P45B 1IL1A 4I18A 3FFCB 3RGVB 2NY7L 2FD6L 4JQVA 3VXRA 1M71B 3LRSA 3QQ3A 5GRXG 4JQVC 4TUOA 4XVTH 3JWOH 5I18H 2VLLA 5I6XC 1MFCH 4X4ZA 4AH2B 4EIGB 1UWEH 2HKFL 4P5TC 3W81A 3CVIH 5CD3B 2R56L 3T0EE 2DAVA 3DUSB 3VXPB 3O8XC 5DLML 2CKNA 3AAZB 3VFSB 1G9NC 4S2SB 1GZQB 4YHYC 5I71B 2CJUL 5SWQB 1PAMA 4UNUA 1LK2B 1U92B 2A9ML 3ZYIA 4BFIA 1ADQA 2ICES 2B0SH 4PJDB 2CIKA 4J23A 1OSZB 3ROLB 4KVNL 4K8RH 4WI8A 2IANA 1BAFL 4JM2F 4G6MH 4LSTL 4QHLA 1RURH 4NN7C 4O9HL 2RCSH 4U2ZA 4ZUTB 5ICZA 5C08E 2W59A 1PZ5B 1G7LB 3CVHL 2FIKB 3SPVA 4LPYA 1JPSL 5I1AA 1OGAA 3HUJF 1VFOA 4XXCC 5L2KE 2FGWL 3PXJA 1MQKL 3VRLE 5SWSA 1RZIA 2Q8AH 1OAYH 1KLFA 4QT5A 1KBGH 4Z8FL 5DMYA 4PREB 3MRFB 2BNQA 4JE4B 4WHTB 4KQ4H 5C0CA 5C0EB 3HB3D 1JHLL 4XBPA 1PLGL 3V0VB 1NC4B 1BF8A 2HJKB 2BNRB 2V17L 4BQ8A 2GQHA 4DTGH 3GJFA 4RGNE 4J3TA 3OKKA 4MZ3A 5HGBA 2XA3A 5FGCE 1RK1A 1J0KA 1DUZB 5E2VL 3RU8H 5I8CA 2JTDA 3ZTJG 1AO7D 5CBAB 2VL5A 4IOIA 5BS0A 3FT2A 5HSFA 3SDCD 2VC2H 1X9QA 2PYEB 2JK5A 5CSZB 1YZZA 3VFTA 3CLEL 1FYTA 1S7VB 4IMLA 3FN3A 5C2BL 2ZUVA 3DHJA 1BFVL 4HX1B 3TN0D 2HT4D 5E6ID 3MZTA 2MCPL 3GMQB 2PO6A 1N6QL 1D6VH 3MFFB 5H8DA 1NEUA 1MCFA 4KV5E 4QRSB 3SGEH 5IHZB 3NAAL 3GZKA 5DD0H 4BSWA 3KNBA 3ALXA 4MA3B 4PJ8C 1MRCL 1IGTB 1OB1A 3VGGA 3LS4L 1FNFA 3GMMA 3MODH 5JW4Q 3IT8D 5L8JB 1HEZA 4Z0BH 1I8KB 3DNKA 5F7EH 1HQRB 2IPKA 2ITCB 4G9FE 2BVQB 2X05A 4I4WA 5KN5B 1LO5A 5TDPB 1BGXL 4JFXB 4XTRC 4U7KA 3GM8A 2D3VA 5FUOL 4M6NL 4JZJB 5GGVL 5IFAH 1X5ZA 5B8CC 3B5GA 1UACL 3LKOB 5GRJL 2R4SH 5C7XH 1N5YL 1XF5B 5HGHB 3U30C 3LD8B 4HJ0C 1TITA 3MR9A 4MJ5B 4W6WB 4YFLF 3Q6GH 2VOTA 2Q8BL 5GGUA 5CSGA 1CDCA 3GM0A 4PRDB 2R1WB 4RX4D 5E5MA 5ACZA 3ZDZE 1A22B 4JG0H 5C09B 1UWGL 2FWOB 3ARUA 4M4RA 5FEBA 2YBRA 4QRRB 5ETUA 4N0FA 2A83A 1FFPB 4MWFB 3EUUA 3QDJB 3TBSA 1NAMB 3W0WE 3FCTA 4OZGB 5C0BD 1W8NA 2XY1A 1HYRC 3KYNA 3L7FB 2A77L 4P4KB 4RWYH 4PLJD 1AP2A 4U6VH 3EKCA 2NLJA 3KXFA 4HUKB 3TA3B 3GSQB 4OGAC 3WSQH 4NCDA 3WO4B 4XP1L 4AM0A 5B4MC 4R8WL 3QISA 4F7EA 3CVHA 4RFEB 3IETB 4EDWH 3HG1A 4FQIH 4R2GC 3WHXB 5CEXA 1S9VA 1ZA6A 1ODAA 4O5LH 3ULUC 5DA4A 3FO0L 2EH7H 5ADPH 4XCYB 2OL3H 2AW2A 1RZ7H 1AJ7L 4G6FD 4PJIE 1ZANH 2XZZA 4HGMA 3UPRB 1JF6A 2B1HL 4ZAKC 5FYLE 1MREH 2DIBA 2PYFA 4PJXB 5JQHC 1J86A 4M48L 5I8EB 5DRWA 1OWWA 4ORGA 4APQD 4HMDA 4NQXA 1Q0XH 2MJWA 2W60A 3SO3B 3B2VL 4FQQB 3MRMA 1OARL 4P4RB 1U8NB 3B2UD 3K8LA 3QUZD 5ALBH 1CFTA 3N1QC 4OFKA 4WFGD 3MA7A 4L8CB 3D2UD 1B4JL 1FAKT 3SKJL 1ZGLM 2BFVH 3WNKA 4PRID 5HD8C 4FRWA 3R4DA 4P3CH 4H88H 4JRYB 1CL7L 4D9LL 2J7LA 4YHKL 2BHYA 5KBNC 3I02A 2X70B 5GIRB 5D6DA 1EHNA 2XTJB 3KDMB 3S4SA 2X1OA 4KRLB 3M8OL 3QDMA 5IJVA 1HHGA 5EORL 2FB4L 3P0YL 1I9RL 1ZEAH 3HZYB 2ZUQC 4D0CA 2I24N 3G6DH 2Z0BA 1KG0B 4AIOA 4K94L 4OFYD 3QEQA 1IGFH 4XP6H 1A3LH 5F71A 1G7IA 2ZP0T 3RDTC 3PNWB 4LGPB 4JAMA 3THML 4J6RH 1NGXA 3BGAA 4M4PA 1PKQA 2R9HD 4G43B 1Q72H 2ZCHH 2F5BH 2AXJA 1IKFL 4BH7B 4UAOB 3FHQA 1DEEB 2GJ6E 1XGTA 5HPMA 2YD1A 4NQVA 4ZPTB 3LV3B 1K2DA 5DQ9A 5FF6A 4HIXH 4MVBD 3HE6A 2VXQL 3HE6C 2Z31D 1T1XB 2WUCL 5IG7B 3FTGA 2FZ3B 3QA3B 3QPXH 3MLWL 1EHLL 3K1DA 4P59L 2W0LA 5KVGL 4MAYB 4KUCD 1UCTA 5FK9B 5HGDA 5KS9A 4A6YB 2VN7A 3X13B 5DYOA 5C9JA 1YMHA 1FBIH 4X6BA 4NHCH 5AZ2H 3BPLC 1WJ3A 3TVMA 4YGVB 4XI5C 5JQ6L 2AV1B 2MNUA 4G3YH 3TVMC 4U3XA 4WEUD 4HUVA 4BZ1H 1BJMA 5JIPA 1A4JA 3GKZA 3O45A 4XC3L 2DQGH 4XB7A 5HVWA 1UG9A 4RAHA 5E08H 1TETH 5J9PA 5JDSA 5CINH 4CDGC 4NQDB 2VZVA 2OTUB 4G6AD 1NCBL 5IHBA 5F89A 1AD9A 5TF0A 3P2TA 2GTZB 4Z7UA 2XNAB 3X11A 4RSVA 2PW2B 4V2BA 5SX5K 4IS6A 4PTUB 2AJZA 3D39E 1K5NA 1Z9OA 5IK3B 4KMTH 4ZOBA 4L3CA 4PFEA 2Z8WC 1QOKA 1L0YA 5EU5B 4IMKA 5HHMB 4HPOL 3AGVA 5IW6B 1JBJA 1U8KA 2CIIA 4IMKC 1H15A 1YECL 4Z77B 1KGCE 3TNNA 4MA7H 4OKVA 3CZFB 4P9MH 2E8ZA 5DT1H 5C07D 4FQHB 1FFQA 5ELIA 4ZO8A 4HIIA 5FCUL 5T1MB 1Q9OA 5DC0A 2YXMA 2RIKA 4X7SL 3NA4A 4YIQB 1RAMA 3JTTA 4HXBL 5IR1B 2R39A 3QEHB 3TIEA 4KHXL 4HV8B 3UTSE 4TNVK 3TYGH 4FQCL 1UKQA 2AK4B 1F00I 5DA0B 3QXAA 5C8JB 1SVCP 4RNRA 3LDBB 5DHXB 5AG9A 4JLRB 3OMZA 4ODSH 2LFGA 3T1FA 5GRUH 2NY4D 2XKNA 3PGDA 2HVKB 2V5SA 4FQJH 6FABH 4BFBD 3UC0L 2WBJA 4Y5XA 1FPTL 2F58H 5EC2B 1DQDL 2WBJC 4Y5XC 1LHZA 4XAKE 2J2ZA 3LQMA 5AAMA 5FM5O 2V5MA 5JIHA 3EDFA 4TVPL 3DXAA 1ZWIB 4FQ2H 3K74B 3M17B 5J13B 2YWYA 2ZSWA 3MJ7A 2ERJC 4GAYA 4R7DB 4Y4KC 3IAGC 1DQMH 4M1DL 3QNZB 2XWJB 3HPJA 4Y89A 1RQ5A 2AJXL 2E6PA 1JZ3A 2A73B 1QP1A 1R3HB 5IMOB 1I7UA 1FNGB 1G7JA 2IBBA 3MLXL 3MLSL 4LL9A 4R9HA 5DD5H 1E4XI 3QHZL 5K59F 3SDDB 32C2B 3H6JA 1BLNA 3SE9H 2Z91A 5EU6B 1A7RL 3MLPA 3IFOB 5A2IH 1P7HL 4M9PA 3JBG7 2VXTL 2WZPD 3W2DL 2D4DA 5MI0C 4KTDL 2B5IC 3BD3A 3OKOA 5EBGA 1SBSH 2PXYB 2QJDA 5FUZH 2VLJB 2WBKA 4KROD 1X7QB 3O4LD 2XG4A 1XGRA 3EYOA 1SJHB 4C55A 5KG9A 3CMOH 4RZCB 3QT2A 1N4XH 3BP6B 4JFQA 5KS9F 3DRQA 3U0PB 1JYWA 5T3XL 2WINB 3F7VB 5D1XB 3PWNA 5F6HI 1FP5A 3VI4F 1G6RH 2ARWA 2WIIA 4MB4A 3VD4A 5LGHH 1CFVL 4NJ9H 2OTPA 4P2CG 1RY7B 4NZTL 2YPLD 1EUTA 4Q9BA 4JPVH 4P9HL 3GSOB 3C8HA 1DJSA 3D85D 1KELH 2VYRE 3G9VA 2LE9A 5HHOA 4JKPH 3C6LD 3PV6A 1X5XA 2VH5L 4XH2B 4DVBA 5D93B 4Z7UF 2VZSA 2B2XH 2VLLB 4OF3A 4LHUG 4MHHI 3FZUD 2RFXA 3WIHL 4BQBA 3HZKB 3N50A 2FJGA 2VXVH 2ICEB 1NLBH 3S34H 3QZWA 4L4TA 4P23D 3RP1A 1LE5B 1RZKL 2XXMB 3DUUA 4UOW0 4LF3A 3WDJA 1IM3B 1BZ9B 2EDHA 4LU5H 1ZA3B 1YDPB 2AXGA 1A4KA 1QR1B 3QUXB 4N90E 5EA0L 3EJJX 1PJ9A 3MV7D 5I76A 3KYMB 3IDJB 5DEGB 3RWJA 1OAKH 4R3SA 1OTSC 2Q86A 3NABL 2FEDD 3UO1H 1NCAH 3S5LG 1CR9H 1QSFE 3ARBB 3TV3L 2C1OA 3FRUA 4QHLB 1BBJB 1GGTA 2XQYG 2W92A 3SKMB 5J0BA 3BGFB 5LQBL 2YOCA 1SJVA 3WD5L 5ITBH 1U3HB 1C08B 2KBGA 4Q2ZA 2AI0H 1SHMA 4XT1C 2YMXL 5FOJA 4OZFG 2KQMA 1DL7H 1RHHB 2VDMH 3RGVC 1AFVL 3MV9D 1DR9A 3TBWB 4H1LA 3VGAB 1NCCH 1CXFA 5IP4A 2HLAA 4EEEA 2AXFA 4BKLA 4KI1A 3QEGH 3P11L 4XBPB 1YMMB 4YHZL 4GLRH 2EKJA 5BXFA 3JXAA 4U1GB 1T5WB 1BFOA 4DCQB 4K3GA 3OKKB 3KPQB 2E27H 2C3GA 3BH8B 5GGVY 4YHNB 4LSQH 5JPNB 4P2OD 3OKDA 4RGMB 2A0LD 3IDGA 3D3VA 3T4AA 1T5XA 4HUNB 3DROB 4PJEA 1MFNA 3K7UA 4JRXE 4IHOA 1SYVB 1CWVA 5C2UB 3C09C 3MO1B 1XF4A 4R7NB 5GISL 5E8DL 1G9EA 4N0RA 5I15L 3L5IA 4QYOB 1YYLL 2YUVA 4IMLB 3GMLA 4WU5A 4P2RD 4HUXB 4Y19A 1DFBL 2PO6B 5E8OA 2QADC 3FL7A 3MRLB 1NJ9B 4IRJD 2P7TB 3GFUA 1TZGL 4E5XB 1GIGH 5E9DA 5DTFB 5BOPA 2HN7B 4QO1A 5HGAB 1QFWI 4DGVH 3S7GA 4GO6B 5MEQA 4PGEA 1GGCL 5FYKL 4I4WB 1UZ8A 3H7BA 3V7MA 3MRRA 5CGMA 5T3ZE 4KRMB 3FO1B 1MLBA 1J1PL 4I2XE 1S7WA 4X98A 5TE6H 3WIHA 3CFDA 1LO3L 4L5FL 4MX7A 4ZDHB 3K2UH 3MR9B 3GHBL 1A9BB 5LWYL 4C83A 5I0ZA 5DGQA 3TT1L 4QOKD 3V4UH 4X4YB 2D7MA 4NO3A 5EUOA 4JKWA 4AMKH 1RUMH 2NY3D 5FIEA 5M95B 3KR3L 1CXLA 2XIDA 4L3EA 1C5CL 2Y4SA 2DJ4A 4FNLH 1RFDH 2ZKHL 1MI5E 3N9GL 3NFSH 4NRYB 3WLWC 1C7TA 3O6ML 2XZQH 3VRIB 3EDKA 1I7ZA 3H2WA 1NGZB 2VABA 5CEZH 1G9NH 2JF1A 2OI9C 3UBXI 2GSIA 1T6WA 2WWMC 1OQXA 3WDHA 3V7AG 4YAQA 1ADQH 1ZK9A 4PUBL 3OKMA 2N1KA 2KDGA 4TYUA 4FXLA 1NLDH 1GH7A 2EDTA 4M3KB 1U0QA 1KIQB 3B5HA 4UIKL 2PCPA 5J1AB 1TJIH 3V0AC 3O2WL 2BCKA 2BXZA 2GSGA 4JHAL 4QWWC 5FYJH 1KLGB 1JGEB 4YE4L 1CN4A 3NCEB 1LP9A 1QBLH 4XRCB 1C5BH 1GPOL 4DFIA 4C56E 1FFNB 3PQYA 1Q0YL 1RUAL 3ZTNL 1CFBA 2SEBA 3BWUC 2IAMD 4NUJA 4R4ND 5JA8B 5D1QD 1ERNA 4LGRB 3MRMB 4JO2H 1JZ4A 3M1BA 1RULL 5EO9B 1OL0A 3BRFA 2EO9A 3LIZH 3ARDC 3QHFH 1VEPA 5AWNL 3GJFH 1HXMB 1UH3A 1CD8A 1WICA 4WEBH 4AG4L 3NBNA 3VWJA 4OLXL 4Z95H 1N0XH 1K4DA 4EBQH 1IAII 1HWGB 1P69B 2XPGB 4I0PA 3T0ED 3S4SB 3GRWA 4IRSA 5I1DB 1AO7B 1ONQA 4I0PC 1MCJA 3MC0A 1TJGH 4IRSC 5TH2A 3UDWA 1ZV5A 4NT6A 5DRXA 3UDWC 4M61A 4XPBL 3FONA 4ODHH 4OGXH 1I1YA 3LMJH 5E8NB 1YEFH 2XOTA 1ITBB 3KVQA 4PY8J 2WV3A 2E7BA 4PJEF 2R1YB 3TN0B 1CLZL 5E6IB 1F4AA 4TSAL 2CMRL 3GB7A 5EU7C 3OG6B 5J1TC 3HZMA 2M2DA 3PHOA 5TE7L 1PKQB 2YWZA 2FRGP 4LP4A 3HRPA 1FLTX 4Y5YB 3C8KB 4KKAD 5L2JA 2F9BT 4HT1H 4I5BA 2FHCA 2DQFA 2H2SC 2XTLA 3ZYJA 1EERB 4O4YH 5L2KD 2F53E 1QO3A 3LEVH 4RDQF 4H8WL 2VN4A 4NQVB 1FC2D 3O6FC 2FD6H 4WGWB 2XG5A 3I50H 3P4OB 2EIZB 1F13A 2O5YH 4PRPD 1UB5A 2F19H 2EZ0D 4ZTOL 4TUKH 2Q76A 2H8PA 4F9LA 3CFEB 1MAJA 5J6GA 1BQHG 5HGDB 1Z5LA 2R56H 4LNVA 4RGND 3S8WA 1CBVL 1BVZA 3KPTA 4OZFH 1N6UA 3WFCL 4I48B 4GAJH 3T4YB 5JA9A 2XTJC 1N3NB 3IDIA 3LPGA 4IIQA 4NWUL 4XP5L 3MLZL 4HZLA 4G42B 4GW4B 4KDVA 1XIWB 2YC1B 1NCWL 3CFCH 4PJHE 1E6JH 4ISVB 4Z7WB 3QIBB 2IBGA 4GBXA 4EUPB 3QUMB 5C0BB 5EUOF 1G7PA 4GBXC 5MEND 1F5WA 5JOFA 1K8DA 2ADIA 5C9KA 5BQ7A 3QG7H 5HYSG 4AEHL 4CN6A 4RAUB 4I13B 3RNKA 1KJMB 3LQZB 5GZND 3W11C 5BV7B 3CVHH 2CLVB 3X11B 4JANB 1JPSH 4OM1L 3EZ8A 4K9EC 3FQTA 4LSRL 1R5IB 3BSZL 3L1OL 4G6KH 5I19L 3PP3K 4GRMA 1K5NB 4UIMB 4Y1AE 3WUZA 1MY7A 5EO1A 2D2OA 1T3FA 4KKNA 2YRZA 5IB4A 1RZ8A 3DVGA 3W9EA 1RUQL 3S9DB 4G9FD 3E6FB 1U8KB 3HPLB 4JVWA 4OSUL 1AQKL 3FT3B 4OKVB 1YEDA 5FA3B 4FZ8H 5IM7B 3TO4D 5A40E 2CLZB 4APQB 4M3JA 5EN2B 4ZOCA 4WUUB 1OWRM 1LP9F 2O61B 4BUGA 3QUZB 1KF9B 2FJHA 1UVQA 1ND0B 4Z5RB 4D8PB 4MD0B 5BOZG 3MJ9L 3MYZA 2EE6A 4NYLA 5I30H 4PRIB 2OR8A 2XN9A 4PJ5E 4NBZB 2ZJSH 3CLEH 4F3FB 3GBLA 1BIIB 1N59B 1NBVL 3CX5K 3W0WD 3T1FB 4DQOL 1BFVH 1ZVSB 5TPWH 1KT2A 3TBVB 3PGDB 5F7DA 3RIAK 1N6QH 3GSXA 4PG2A 4TSBL 1JPST 1NANH 3NAAH 4FQXD 1RJZA 3TJHD 1JWMA 1OT2A 3P40A 4O2EB 3NCBB 4OCSL 2K7PA 3F12A 4EI5D 4F2MB 2HTKC 1BVLB 1WT5C 5E94B 5DEZA 1FV1A 3DX8B 3IRPX 2CK0H 4K3JH 5KTEL 2BSRA 2C5DC 1B2WH 4HG4K 4M7ZB 4F9PC 4PP2B 4NP4L 1A6ZA 4PLKC 4P0DA 5GGVH 3H9HA 1UACH 5FYLD 5HHXH 4ODTL 4C4KT 1N5YH 3K1KC 1EMTL 3D0VA 1AHWB 3MLTB 2DF3A 1I7UB 1URLA 1EEUA 2NPLX 5FGSA 3WFDH 4TNVF 1WC7B 2D7QA 2C1PA 3DMMD 5GHWH 3VXNA 4HIHA 3FMGH 5GS0D 1YEJL 4DN4L 4YK4B 1D5IH 2Z91B 1T0PB 4I77L 3U4EB 4RRPG 1CDGA 1NFDB 5CP7A 4HKBA 2DTML 3T2QA 2J8UE 1SYSA 2EYRB 4CADB 3LDBC 3N06B 3ULUE 4Y16D 3H3KA 1YNLH 3MRBB 3ILQC 1HILA 5GSVA 5C0AA 3G5VA 4YX2L 3HI6L 3RZWA 4MS8D 3BXNA 2BK8A 3X3GL 1Q9KB 5E1AA 1N7MH 4RA3A 5EIQA 1KB5B 3V5HB 4NNYA 2WIIB 1L9NA 5JO5B 5I75C 1S5IH 4PS4H 3MBEA 5AD0A 1VPOL 3WL9A 3MBEC 1CFNB 1KPRB 4YQXH 3FO0H 1G7HA 3DVFA 1MFDH 2A6JB 1F3DH 4E41E 3N0PB 5GRZA 4OF7A 2M8XA 4WW2C 3KPSE 3L3OA 4G8EB 3EDJA 1JV5A 5ID1B 1OAUL 2LABA 1RU9L 5FA4A 4QHUA 2MMXA 1FAIL 1BBDH 1KIUA 5I8KH 5HDOA 2HJFB 2KQNA 3ET9F 2GJ6D 4MA8L 5KZCD 4PV9A 5KSAD 3KHQA 4WW1A 2RBLA 3WYRA 3H9SE 1OVZA 3N1PC 1A2YA 4IOFD 4U1NB 3VXUE 5C07B 3C60D 3U7AA 4HGWA 5K33A 4XVUD 5MHSE 5EU3B 1B0GA 1HNGA 1BWWA 3MJ9A 1MAMH 1TVBA 2LAAA 3BEVA 1A3RL 2HWZH 4LF3B 2WANA 4D9LH 1S7TA 1RJLB 1XCTA 1OGTB 2P44B 1BWMA 3UX9B 1QSEA 2IJ0C 5DK2A 5H37H 1A4KB 4PLNC 5A16A 3OB0H 3M8OH 5DJ8B 1YEGL 5D1XC 4FFVC 2R4RH 2ESVD 5I76B 3ILPA 3VFUA 4ZXBA 2ADFH 4X6EA 3RWJB 1C1EL 2X4TB 4X7FC 5IGXH 2DQHL 2VB5A 3V7AE 4HWZA 1P9MA 3ME0A 1JF5A 5MEPA 4XCEB 3U46B 5D5MB 4Y88A 3DETD 1FGVH 4JQXA 2YD9A 1U8LB 3IU3B 1NDGB 3OBAA 4NZRH 4JQXC 4UILH 4NQCA 3P3YA 1MY5A 4PJGB 1OQOA 4H1LB 3LHPL 1OOAA 3D39D 4GW5A 4Q58C 3VGDA 4KC3B 1T21B 1F02I 1T1ZB 2HLAB 4HK0B 2AXFB 4V1DB 1TJHL 1JJUA 5FKAB 2VXQH 1MCOL 4M03A 4EI6A 3PWPE 2PF6A 1NMAH 1FNHA 5GS1B 1EHLH 3LN4B 5KVGH 2NY2D 1SEQL 1I1AD 2PETA 5DMKB 3T4AB 1MFAL 3BO8A 3MCLL 4PJEB 1FRGL 5T5FH 4N8VB 2MKLC 4XB8A 3RHWK 1TVDA 3MREB 2AQ1A 2I9TB 3ZSSA 4F15C 5HYJA 1R3KA 3WIFB 4U1JB 3FOLA 4U6YB 2R1XA 4R26L 4XWGH 3ARBC 4KROB 3O4LB 2CDGA 3FOMA 5J89A 4N68A 1F6FB 2DQUL 5IVZB 3GIVB 1KYOK 1NCBH 4OZHE 3OXRB 5JHDE 1FZKA 1JZ6A 4YXKH 2DN7A 1MUJA 1H3XA 3TBYA 3WFEL 3B9KD 5CZXD 1MF2H 3SDXA 4L8SC 1H8NA 4Z0XB 3MMEB 1AGBB 5A3IC 3PL6D 2NYYC 3W39A 1MCPH 5IHLB 5I74C 2NR6C 4YHPB 2J88L 2VLRE 4L9LA 2IQ9L 1HHIA 3H7BB 2VAJA 2YPLB 4L9LC 3LKNB 4WFFE 4HPOH 3FB8A 3D85B 1YY8B 2JJTA 4QY8B 1ES0B 1XF3B 3C6LB 3GSWB 3CFDB 3TBTA 4MX7B 1I4FA 3MRHB 4B50A 4JPIB 4R4FL 2FO4A 3GMRA 1KLUB 4UT9H 4RGMC 4PJFB 5F1IB 5FCUH 3T3PE 3SE8H 2ATPA 5CMAA 2YN3A 3MRDA 1VADA 5EUOB 1J5OH 1F11A 4NWTH 4WFED 3S98A 5JLZA 3MV8D 4YBLB 4UINL 2D0FA 4Z7VA 5HDBF 1QFUL 1P4BL 5LCVL 1A6AB 4XPTL 4LLAA 4NRXB 1P5VA 3P4NB 3SHSA 3GDBA 2VZOA 1FN4A 2VITB 1EBAA 3FN0L 4XMPH 4S0TD 3V52L 1MRDL 4FMFA 4DKEL 1HZHH 1HH6A 3V9FA 4M93C 3MV7B 1AD0A 1DDHB 4IRZL 2AERT 3VDAA 1T04A 4UV4H 5CAYB 1QEWB 3MLVL 3O3AA 1INQA 2L7UA 3GSNH 2N4IA 4MD5A 5F72S 2GSGB 4WDIA 2EDQA 1CF8L 5D7LA 1JGVH 1HHJB 4PJCE 5JXEC 3IJSA 3OJMB 2QKIA 3QFJE 3MRNA 3GMOA 5EOCH 3BYTA 3G6JA 1IAKA 2DKUA 3MV9B 1T7ZA 1PG7X 2AJXH 2SEBB 5LAXB 2BX5A 4OZIA 2KH2B 1U2CA 4LCIL 2R23A 3PXHA 5HI3D 3STLB 2FL5A 3MLSH 1RI8A 2ADJB 3QCUL 4NGHH 2E6JA 2F8VA 4QXGH 4JVPA 1EUUA 4YFEA 1RK0B 3AMLA 4PRAB 1MWAL 2UUDK 3BJLA 5DJ2A 3TT3H 1U8PA 4QRTA 3VMNA 3DO7A 5IQ7H 1MVUA 4P2OB 4KTDH 1KJ2A 3CSGA 2ID5A 1ED3A 5DHVB 3V5DA 1T1WB 2V7NA 4H26B 4ODUA 1L7TL 3HI1B 5TH2B 4NT6B 3RWCB 3FONB 2BVPA 4FFYH 4IJ3B 4N90D 4XVJH 4RMUA 2FSEA 4I8DA 4GRLD 4GG6A 1LD9B 4PGDA 4P2RB 4F7CB 3RTQA 3VCLB 4OIIL 1JWUB 4PLOB 4PR5A 3RTQC 1K4CB 1T83A 4IRJB 1JPTH 1Y18A 3PHOB 3VXMD 1T83C 4NNXA 2NTFA 5ESQB 5IESL 4ONFL 4PG9A 1LVEA 3HMWL 4BFEA 3OHXA 1KJVB 4NZTH 1RIUH 3BH9A 4P9HH 5DD3H 4N0UB 3HAEA 3ECBB 4G8IA 3F8UB 2F8XC 3E2HB 3ULVL 3VD7A 1B88A 2EXWD 3BIKA 1FL3A 1JGDB 4JFED 3TIDA 5C0IA 1EEZB 1DVFB 2DQEL 4KZDL 4Y2DD 3HR5B 1J8HE 3RVVD 3RZCD 4BSVA 3PWUA 4OJFL 3SDXF 1R3IH 2APVA 1S7UB 3DIFA 5K93A 1H3PH 4KKBC 3UEZA 3WIHH 1R3LB 4PGJA 3ZDXE 2E7LC 2QSCH 3UYOD 3BZ4B 5F1NA 5EIVA 5DRNA 1JFQL 5L7XL 4PRHE 1K85A 1LEGA 2H3NB 1A5FL 2VSDA 3SDCA 5DQJB 3FB7A 3SDCC 4XCCL 5ID0B 3CCHB 5I1IL 4JZNA 1YN6B 5EA0H 4K3HA 4ELKA 1EJOH 3VFMA 4E42A 3FFCE 4NO0A 4WNQA 3MLUL 2ZNWA 2HT4C 5E6IC 1FVCB 1K8DB 4ZTPH 3FQXA 5ABDE 4PRNB 3VA6A 3TV3H 2UYLA 3K0WA 4HH9A 3ZT7A 4JN2B 4Z7VF 3RNKB 5LQBH 2I25N 4H0GA 3FQRB 1JN6A 1DN2A 4CDHA 3CXDL 3P0VH 2W0FA 2NXYD 3WXWL 3VFGL 1NAKH 5F7HA 1DQQA 4JDVA 5EO1B 5AZEL 4NUGL 5C6TL 1KN2L 2EH8L 1CG9B 4NOFA 1CDUA 5DDHA 1E28A 2XICA 2EIBA 5T3ZD 3O4OC 2EIEA 4PJDE 1TFHA 2G2RA 3AU1A 4X0KB 3QEUB 2BVUA 3QQ4A 3FT4B 1MWAA 5F7NC 4DAGL 3V95A 4PY7A 1OTUD 1M6OA 4NKDA 1KIRA 5D1QB 3QIWD 2CUIA 1QLFA 5FUCC 4OCNC 2X4NB 1UVQB 3G6JF 2P8PB 5SX5H 1XF2B 5JUEL 5GSRB 4OZIF 4GKNA 4P49A 1VKXA 2PN5A 1J05A 1NAMH 4N8CL 4PJ9D 1AR2A 5DURD 4GSDH 4ETQB 3BHBA 2ZG2A 4XXDA 2YD5A 1J1OL 3GRWH 1YPZA 3CU1A 3T0EB 1I1FA 4BZYA 4GG8A 3S35L 2Y7QB 4JFFA 1CLYL 4LLQB 3KPRD 2Q3AA 3L3DB 4S10A 5BV7C 3GMPA 4X7DC 1MIEL 3MRQA 4K7PY 2BNRE 1HNFA 3JV4B 3LVEA 2D7NA 2ED7A 1N8ZB 2P5EA 3F12B 2QQKL 4LCCA 1R0AL 1H3UA 2P49B 3MOAH 1BQLH 3NIFF 2JCCB 4U7MA 5CHNA 1ZHLA 1E6OL 1GGCH 5FYKH 5DZNA 4Z78A 3OKEA 1FDLL 4OCWH 4GG6F 3UTQA 1XGPA 4ZUWB 1A6ZB 2PYEE 4KK8D 5LGJB 3CAFA 1J1PH 5IQ9B 1IT9H 3ARED 4C56D 4KZEL 4OF5A 5C1MB 3GHBH 2CDFA 2NW3A 4WU7B 3B2UC 1P6AB 3BPCA 3QUZC 4PRPB 1OCWH 2DYPB 3EO0B 4TSCH 3D2UA 4NRZB 4LCUA 1RSFA 2BP3A 3RIAF 4Z7OF 3NN8A 1BM3L 3IJYA 1KPVB 4RGNB 4HBCL 5D72H 3MNWA 3N9GH 4YDKL 3R8QA 4WENB 4YUEH 1W72A 5GSVB 1M05B 2X4RB 4ODVH 3V6ZA 1U91B 3BQUA 4YWGL 5E1AB 2WWKT 2YUXA 1HINL 4OFYA 4M9OA 1OAQH 4PUBH 3B3IB 1QRNA 4G8GA 4OUUA 1KPUA 5MENB 1TQBB 3I2CL 2IF7A 3K80A 4CVUA 1XFPA 3OGOE 4NC2B 4IDJH 4JHAH 2R9HC 2NY1C 3BKMH 5C09E 1L0QA 1S9YB 4MQTB 2GFBA 4QRRE 5E2WL 2GJJA 4PJBA 2GAZB 1GPOH 3KYOB 2MHAA 1AHWC 3QWQB 4OZGE 4D0DA 4OUOA 3ZTNH 5E56A 1NGQL 1MEXL 4MVBC 2F53D 4HKXA 3G5XB 5GS3A 3RWIA 2FH6A 4Q7DA 3JV6A 5F8QC 2Z31C 4LLUB 4MNGB 4GXVL 4JVUA 2WUBH 1FL6B 4Z7NE 3T0BA 5D2NA 4QHNA 5K9KA 5HYIA 5AWNH 5D2NC 5EU4A 3T08A 1IC5L 1VSCA 1QFPA 1IQWL 2BY0A 3BEVB 4NZJA 4AG4H 1NANI 2EE9A 2IH3B 4YEEA 25C8L 1AIFB 2D31B 5A43C 3QRGH 2PTTB 3QP3A 4FQ1H 1NH6A 3FB5A 3S3PA 4WEMB 1S7QA 5FECB 5DK2B 1CK0H 3A67L 5E6YA 3QYCA 3SDAD 1I9JH 5F1SA 3LH2L 5CIPB 3ILPB 4ZXBB 3SEPA 2ADGB 1YEKL 2W65A 3ARTA 3QH3A 2N56A 3CD4A 1CDIA 2CMRH 4G6AC 3Q0HA 1VACA 5DJCB 2B1AL 5DVNA 2Y6SD 3Q48A 5TE7H 3PHQA 4FQXB 4PP1D 1RZFL 1CT8A 3O9WD 1YPZF 2MCG1 3B4NA 2BHUA 3MNZB 4JRYE 4JY6A 1UJ3C 2A9NL 2QEJA 5C86A 4YDLC 3SCMD 4HQQH 1F3RB 4Y1AD 2XTJE 3VRJA 3L3HA 3ZE0E 3CH1A 3A6OA 1B9ZA 2CLRA 4OLEA 4UDTA 4P3DB 3ULVF 3VDCA 4LIQH 5HVFB 5C0GB 2COQA 5C70A 5E4EB 3V5KB 5IMLB 1FZJA 3FB6A 4G8FB 3V6BR 3TFKD 5BO1L 3RVWC 5DR5L 1CBVH 1IGJA 2B4CL 2UY7A 5CJQL 3GIZH 8FABB 4F8QA 5F6IC 1OAXL 1P1ZB 4JY5L 3GGWA 4LRNL 4NWUH 3MGOA 3MLZH 1KFAL 3TO2A 2Z35B 3ETBF 3IS0X 1Z0NA 1J7VR 1SM3H 1MLCA 5DMIH 1NCWH 3DO3A 2DQCL 2EEAA 1GVIA 1UXWB 4MMZC 2R1XB 3LB6C 3ESVF 3QO1B 4PJ5D 5BRZA 5HHVL 2NY4C 3KPNA 1DLHA 1JI1A 4XPAL 5HI5D 2EDEA 1AR1D 1VERA 5GGSA 5GRVK 1U93A 1RZJL 1DTUA 4BQCA 1REIA 5C0DA 2HKHL 3IDMB 5D9SB 4HS6A 1VFUA 2AQ2A 3GBNH 2VXSL 1F8TL 4ZSOB 1KULA 3H0TB 4KGJA 3VFNA 3PP4H 3G5YA 3AY4A 3OZ9L 3S3SA 3NGBC 4LKXB 5GQBA 3AY4C 5HTSA 2WLZA 3PHSA 5ENWA 1AQKH 2D7TL 5INDB 2I9LA 1K6QH 4OCLC 1KV3A 1T1YB 2ICCA 1JYNA 1VA9A 3RHWF 2FGZA 4NQDE 2CRYA 5KSAB 5C3TA 2YD7A 2ATPB 2APFA 4OGYH 4PJBF 1VADB 5I73C 3TESA 2F54A 1F11B 3KJ4B 4XAWL 1YEIL 2OSLB 4NO2B 1OHQA 2O5ZH 4PJ7A 4OD1L 3UZVB 4LOUD 2ZG3A 2X7LB 2NY5L 2DI9A 2VZTA 4KUCF 5HHME 2EYTA 4Y4FD 2A38A 1EX0A 4UBDD 2CKBL 2IFGA 2GT9B 2ESVB 2X4QA 4TSBH 2BSSA 1T04B 35C8H 3EYVA 1DN0B 2F74A 3X17A 4NKOA 4WI4A 4DGYH 3O3AB 2BOBB 1INQB 4OB5L 1JI2A 3O3EB 1KEMH 4GKZA 1TTGA 4LSUL 5CZVL 3CSYB 5JMRA 3CH8A 4WWKD 2Q6WA 1Z3GL 5FGBA 4GW1A 5DC9B 4MJID 3IVKB 4ZFGH 5D7LB 5H94A 1E4WL 1D7FA 4Y2OA 2AK4E 1JK8B 3S4SG 3MRNB 1G7QA 3GMOB 4NP4H 2RR3A 3UYRL 3G6JB 1ORSA 4ODTH 5ISZA 5T1KD 1WZ1H 4WWID 3TJEL 2BVOB 2X4PA 3M07A 4ORZC 1CICA 2WMPA 4XP4L 5KJRL 1Y6NR 3FZUC 1E0OB 1YEJH 4DN4H 2WSKA 5IEKA 4LVHB 3U9PL 4LLMA 3DUHA 3U1SL 3H9SD 1WIPA 5K9JH 2J5LB 1GHFL 2DQTL 4P23A 1Z9LA 1MFBH 3VXUD 3OAUL 4P23C 5J7CC 1AQDA 1GZPB 2FYYB 3F6IA 2NY2B 2V5RA 3K2MC 1MVUB 5MHSD 3QHTC 2MOVA 2Y9RT 2VTFA 3O11A 4PTTA 3MXVL 2G5BB 1ZHNA 4K7PH 3S37X 3ARXA 1YNTA 4YHIA 2JIXD 4YX2H 2IH1A 3X3GH 3QFDA 4BYHA 2QR0A 2FSEB 4NOBA 4GRWF 2MQCA 2FEDC 3P73B 1XR9A 3B8YA 4G7VL 2NY6D 1VFBB 3IDYC 1VPOH 1NMBH 2IQAB 4NNXB 4XCNA 2EDXA 4PG9B 1LQSR 4XZUA 5EU6E 5IVXA 1S7RA 3B9KB 1R5VB 1L7IL 5B39A 1JUFA 3PL6B 1RU9H 1WSST 3C5ZD 5C0IB 1FAIH 1T0MB 2VLJE 1DQJA 4QHKI 3QNXB 4EUPG 4MA8H 3GMNB 4KQ3L 1CGVA 3EYUL 3FO2B 1AGCA 3OGCA 1WCBA 4YXLL 3BT2H 5DGRA 1CVSC 3F62A 2BXYA 4NDMA 3EDDA 2Y5TB 5KVEH 3HRZA 1OP9A 1NEZB 4P2OC 1GCFA 4R96A 3GJEA 4X6CB 4YR6B 1A3RH 4Y7MA 1EFXA 3GI8L 4K2UH 1FH5H 5DHYA 5A1AA 2XI9A 2APTA 3MLYH 2CR6A 3MV8B 4ELKB 1R24B 2CKBA 3A6BL 4F7MA 1FCCA 2GTWB 5I1KH 4L8DB 3FQXB 2AAVA 3NFPB 2AJ3A 4HH9B 1A21A 4OD3L 4PJ7F 1CDJA 4O58L 5TFSL 4JJ5B 1JN6B 3MA9L 4MQ7A 3P0GB 3C9NB 2A6KA 2Q87A 3BP4B 1S9WA 1ZHBB 3E2HC 2NX5D 4FQLL 1A6TB 3S36X 3BN3B 3EYFB 1DQQB 2P8MB 4U1IA 4ZQKA 3WHE1 1MAKA 3LHPH 2N7AA 2UZYB 5ADOL 3NCJH 2JKXA 1EZVY 1TJHH 1BECA 2D0GA 1MJ7L 3DX9B 3RWHA 3VFWB 2UZIL 4WFFD 4N1HB 3LKRB 1AGDB 2AEWA 3UAJD 3HI5L 4JM4H 1WBXA 1BZ7A 4PY7B 4LKCA 4QOKA 2HLFC 5DJDA 3RAJH 4BH8A 1JZ5A 4HWEH 1AGEB 4NPYA 5H2BA 2NY3C 2OCFD 3MCLH 4KGLA 4I0CC 1DBML 3PP3H 4WTWA 4B0MM 1KJ2H 5FV2A 4ODWB 2Z92A 3VFVA 1J88A 4KI5E 1G7MB 3HHRB 1LGVA 4JFFB 1SVZA 4AT6B 3RX5A 1FIGH 1CE6A 4U1KA 4R6UA 1YMME 2NXZD 3H42L 4X7EC 2GK0B 1KENH 3Q1SH 2APWA 4L4JA 4GRLB 4FN0A 3WFEH 4LCCB 2XWTB 2DJUA 1ZT1A 4XNXH 1LILA 1QFWL 5CJBA 3VXMB 5I18L 5CBEB 4N9GB 1MFCL 2J88H 2X1QA 3RL2B 2OQJA 4IEFB 2WNGA 3KPOA 4W70A 3HAEH 4JPWL 5GGSY 1UWEL 7FABL 5ILTL 1FGNL 1Q9WB 2IAMA 3MGTA 4P2QB 4JFEB 2VMFA 2IAMC 3LKQA 4R4NC 4Y2DB 5IVXF 4R4FH 5D1QC 2ZSVA 2QTEA 3BP5B 3HE7D 2NW3B 3RZCB 3K46A 2GIYA 4F37K 4FP8H 3O2VH 1RIHH 2E7HA 1HHKB 4GS7C 3H7LA 3MUGB 4OIAA 1OD7A 4K8RL 4GMTH 1ETZB 4UINH 5IMKA 1QFUH 3O0RL 1P4BH 5BJTA 5LCVH 2Z8RA 1RURL 3BE1H 2RCSL 3NIGF 3T0EC 2G9HA 4OI9A 5TDNA 3WEXA 3DSFL 4DW2L 4P46D 1VGEL 1UA6L 5BMFH 3ORJA 3FN9A 1MRDH 5HVHC 3NMEA 2ATKB 5F3BB 3T0XA 1QZ1A 3EOAB 4G8GB 2YXFA 5I1GL 4F7TA 4MNQB 3C5SA 4UNTA 3MLVH 4CJ0A 3KG5A 1Y6MR 2BY1A 3AM8A 1KBGL 2BVTA 3AM8C 1S5HA 5C08A 3S6CA 4X83A 4KQ4L 5KSUA 2EO1A 5GGRA 4KKAC 1T22B 4ONGH 4X99B 3MJ6A 4DTGL 5IKCA 1HE7A 5L2KA 1D9KD 3QIUA 1D5BA 5FO7B 3KYKL 2BSED 3CNKA 4PIRF 3G08B 4PJAB 1OM3L 2E7MA 2VXUH 3RU8L 3WJJA 2PKDA 3DBXA 3WJJC 2EZ0C 5M94B 1FO0H 1KCVL 3QXWA 5TF1H 3QCUH 2F8OA 2H6PA 3S88L 4NSKA 4WO4B 2RAMA 1K9TA 1EAPB 1I7RA 1ZVYA 2GUOB 5EU4B 4FFZL 5J6HB 2I5YL 1NBYA 3MRPA 4RGNC 4UB0L 4MJ2A 4X6DB 1A02N 4AEEA 4K3EH 1D6VL 3MRJB 4OD2B 4PRHD 4XC1H 4M7KH 3BGMB 1N5AA 3D87B 2GI7A 5CP3A 1TQCC 4H1LG 5DD0L 1L7TH 1IC7H 2VZ1A 5DURB 3VJ6B 1A7BA 3FHAA 3N1FC 5EBWA 2C3WA 4Z0BL 5F7EL 4LSPL 5FFLA 4M7JL 2Q3ZA 4ZD3H 4JB9H 1NBQA 2C7UB 1T89C 2K9UA 3KPRB 5EIIA 3U0WL 5DFVD 2X5PA 5GZNC 5IESH 5IFAL 1O5DT 4FMKA 4OCMC 2R4SL 5C7XL 1WZMA 4PV8A 2P5WA 5JW4R 4N8VG 3Q6GL 3ULVH 3L6FB 1IEAB 4KXZH 4JY4A 4JFDA 4BSJA 1EA9C 5FKPA 1AO7E 3QUYA 3VXTB 1CXIA 1ZT7A 2BVYA 4JG0L 1TENA 2H26B 5C6PB 2AABH 4OJFH 2VR4A 5F7WC 3TO4A 4UDTB 2ZWLT 4HW6A 3TO4C 1BOGB 3ARPA 3MXWH 4YNYB 1XH3B 3I6LE 1FZJB 3FB6B 3CFBB 3U2SA 2MSPA 7CGTA 1JFQH 1XGQB 1UB6A 1A1OA 4C4KO 1LEKA 3LEXA 1IGJB 1GJIA 1PKQE 1I9IH 3IDUA 1T4KB 3WSQL 4YO0B 3MGOB 2V2XA 3P4LA 4WI9A 5D7IA 3EGSB 1Q9LA 4EDWL 4FQIL 4DEPB 1QA9B 3W0WA 4O5LL 5F9OH 3RQ3A 3UBXA 2EH7L 1HKLH 1M7DB 4QRPD 2ZOKA 1W72H 2OL3L 1PDKA 3CDCA 1QSVA 1ZANL 5IOPA 3TC9A 3FQUA 3OKNB 1U93B 1MREL 3TJHC 4ERSL 2VKXA 1NC4D 3ZHLA 43C9B 4EI5A 5E7BA 1D5MB 3ZKND 1F4HA 4EI5C 1Q0XL 3VFGH 1PG7W 3VI4E 4HS3A 3G5YB 4PJIA 3JZ7A 4NUGH 2DI7A 4NBYB 5HDQL 4LPTA 5ALBL 2EH8H 1TTUA 2QHRH 1NCNA 3T04D 2WK2A 2BFVL 3QJFB 2PYED 4P3CL 1IQDB 5F70A 5C0BE 4HUUB 1JPGB 3DMMA 5L9DL 1XR8B 2VQTA 3DMMC 3LSOA 4DAGH 1DBAL 3CIQA 5GS0C 3D9AH 3WS6A 4EOWL 3WUWB 3RIFF 2PW1B 4R97C 1KIPB 3S96B 3VG0H 1H8SA 3WS6C 1U6AH 5IB3A 3VRLF 1FC1A 3FQWA 5MERA 2V9QA 4LBEB 3DVIA 3ARVA 3I6KA 4X4XB 3G6DL 1H0DA 4EVNA 1I3RB 5C3LD 3IU4H 4KJYB 1IGFL 4XP6L 2EDBA 2IPTL 1A3LL 5T1LD 1MFEH 4Y16C 2GCYB 3CZJA 4ZPVB 4LRIC 1HSAB 3DRTB 3MCKB 5CJ8A 4E9LA 4MS8C 1Q72L 2ZCHL 3SDAB 1CLYH 4U1HA 1IKNC 4WI2A 3SKOA 3TYFB 1U2HA 1MIEH 5ICXB 1MCHA 1NBZB 1FVDA 4LSVH 2A74A 2QQKH 4WUUE 3EOYG 4MJ6B 5EC1B 4GKZB 3RPIB 4J3WA 1PEWA 1Q94B 2Y06H 4GW1B 1E6OH 4WFGE 3ARFB 3QPXL 2HJLB 1FDLH 2QSQA 4HHAA 1CFQB 4PRIE 3CDFA 4XNUH 3IXTB 4X7TB 4HWBA 4QRRD 1U8MA 5HYQA 5DJYB 1WFOA 2GJ6A 5E8EB 4ZUUA 5KSAC 5L0QC 1QLRB 2H2PD 1FBIL 3QI9B 4P4KD 1AXSB 1FG9C 2VZ3A 3NVQA 4NHCL 5AZ2L 3C60A 5CZKA 3C60C 5JHLH 4LLWB 3TA3D 1WFNA 4Q6IA 4BZ1L 2VRAA 4Q6IC 3IRZA 3RWDB 1TETL 2UVEA 5CINL 2I07B 4GRWH 4KWUA 2JB6A 1ZHNB 4B5EA 1YNTB 2OL3A 4MQXC 1HN1A 3B6SA 1KSRA 5F3HB 1ZLUK 4P5KA 2V5YA 1ZOXA 2Z4QB 4YWGH 3MZGB 2QR0B 3EOBA 4OM0L 3SY0A 1FVEB 4J3XA 3ZDZF 3G9AB 4JFYA 3U9UA 3ABZA 3WFZA 1P7QB 1RIVH 5ANMB 5F7YC 5D7IF 1C5DA 3ULSA 4EN3D 2UUDH 4MA7L 5IVXB 1CGSL 1YN7A 3HS0A 3O6LH 4E0RA 1NFDE 1V3KA 3RWEB 3UJIH 1WISA 1A1NB 3K3QA 1AI1L 4QTIL 1EZVX 1FZMB 3I84A 2FX7L 5DQDH 1W0WA 1I7TB 4JRYD 1MEXH 3RWGA 4LVHC 2V6HA 2MPAL 1ULVA 5GGRY 3TYGL 1FFOA 3AC0A 1LE9B 4U6HA 3SJVD 3DPBA 3CGTA 5C0FA 4PJIF 2NY2C 1I1AA 3BVNB 5CJXA 4MLSA 1I1AC 3BFOA 4ODSL 2VDPL 5IBUB 5GRUL 4ZUVA 25C8H 1YUHB 3BW9B 4LVNB 3B9AA 3NA9L 6FABL 2ZUWA 4LFHD 3UTSA 3WIIH 3R8BB 3A67H 2FNBA 2F58L 1CU4H 3LH2H 3HTLX 5DD6A 5HYEA 1HH9A 3L9RA 1YEKH 2HA1A 1S7XA 2VIRB 1ZXQA 4FQ2L 3D69A 1UEMA 2AS5M 4Y4FB 1D5ZA 4POYA 1GC1C 2B1AH 3C2AH 4QGYA 2DDQH 3B9KC 5DEFB 5CZXC 2A6KB 1UZ6E 3IXAB 4J3UA 2P43B 2H9GB 4NNPL 2VO5A 1T66D 3L7EB 4Z9KB 3V6FB 3PL6C 4OZ4A 4MAYD 4ZQKB 4ONHB 2A9NH 2V9RA 3HCVB 5DD5L 1HHHA 4MA1C 4WWKB 4ACPA 4MJIB 5DWUH 5FYKU 3NH7L 3O41A 1MHHA 3GK8H 4D0BB 2LQRA 2OYPA 4O2FB 3ZO0A 4YC2C 5A2KH 2IPUG 3QQNA 3F7RA 5T1KB 1HCFX 1SBSL 3GSUB 4JREB 5SV3A 4HMEA 4LCYB 4U1LA 4WI3A 4Y4HA 1CFSA 2CD0A 5BO1H 2W9LA 5DR5H 3CMOL 5DRZA 5H35B 5D5ME 4TVPE 4MNHB 4WRLA 5CJQH 4B53A 5T5NG 2QQNL 2Y07H 4JFPA 1YC7A 4XPHH 4LRNH 4JY5H 1FL5A 1U58A 1OF2A 3F58H 1G6RL 2NW2B 3GSVB 4PJGE 3J8F7 2HT3D 2Z92B 2NNAB 5LGHL 3D18A 4WV1B 2R2HB 5HHVH 4V1DE 4AIZB 1CE6B 3MACL 2BZDA 2EYSA 3RUGA 1KELL 2R69L 2HFFA 1RZJH 3WLBB 4JKPL 2HG5B 4DJMA 1EH9A 1NFIA 3ROOA 2HKHH 1VGKA 1T7XA 2NY6B 2B2XL 3IS1X 5HHQB 4KKLD 3PDOB 2V9TA 3RVTC 4PJEE 3SKNB 2BJML 4M6OH 4M62H 4HK3J 5KVDH 3QAZB 3IFPA 2VXVL 1LMKA 1TPXC 1NLBL 1LEIB 5T3XE 5DVOA 4I3SH 5B22A 2HFGH 1EVTC 2AK4D 4MD4A 3LKQB 4FFWD 5HI3C 4QGTA 3O4LE 3KLDA 4OLZH 4EKXA 3BP7B 1BVKB 4LU5L 3RI5F 4OV5B 1UH2A 4WI6A 1R6VA 5E9DE 1L9MA 5B21A 2IMMA 1SEBB 1DUYA 1OAKL 1YEIH 3Q3GB 5D6CB 1NCAL 4ZYKA 4NQED 1CR9L 2X9WA 1N26A 43CAA 4J7RA 5FB8A 2G9HB 2ZCKH 3WE6B 5CS7A 2R2BB 5CWSB 2AI0L 4X9IA 1WEJL 3V6OA 4NFCA 3P9MB 3BIAX 2CKBH 3O81A 9CGTA 4GRLC 3PWJB 3F7YA 1ZHKA 3MUJA 4MSWB 2VDML 1J18A 2CXGA 1JPFB 1QSFA 5TQ0H 4GJTB 4PJFE 4OB5H 4NBXB 4WFHE 5CZVH 5EUOE 3U83A 1AKJA 2HFEB 4K71B 5EOTA 3SDDD 1H3GA 2KKQA 4MGXA 1EEYB 1F42A 4OZHB 1T7VA 3E1F1 5IKCB 2NX5B 2EXWC 4BZ2H 4F37F 3CUPA 3QIUB 2E27L 4KDTC 4Y2DC 5I66A 3OXSA 1WZKA 2PXYD 5HHPA 3RZCC 4JPKH 2VLJD 1CXKA 4HIJA 1F3DJ 5KJRH 4OFIA 2X2YA 4LPVA 1GHFH 1I8LA 1JCKA 1E4XH 3MRPB 4Y0GA 2XFXB 3G04B 4CN1A 2NY0B 1WIUA 4O2CA 5EB9A 4LMQE 5TGBB 1W0YT 1JWSA 4X9BA 4YPGB 4JRXA 4FXGA 2J8OA 1ZTXH 4FTVA 4N5ED 1PY9A 2C4FT 2DL2A 4DGVL 1C16B 4PD4J 1JP5A 2X4OA 5HJ3B 4LPWA 4FXKB 3MV9E 3ZKXC 3AB0C 1JGLH 2DQJH 1ACZA 4JCLA 4OQTA 1B0WA 2JJVA 5D7KD 4G7VH 2E5EA 5D1ZA 3VXRD 1IEBB 3VG9C 1N2RA 2NXZB 2XACC 4W6XB 3QJHB 4TUJA 3VWKB 3OG4B 2NXYC 1QVOA 5TE6L 2P5WB 4F58L 2IWGA 5CUSL 4NQUA 4JHWH 3K2UL 5DUBA 3T2OA 5HHNB 3MYJB 3DX7A 3H9YA 4JQIL 2PUQT 4JGMA 4JY4B 3RUGF 5BVJB 4FS0A 4JFDB 1I1CA 3BPNC 1I8MB 5EPMB 1G9MC 1JZ7A 1WAAE 1F4XL 1MCKA 1DSFL 3EYUH 4I2XA 3QUXD 3SBWC 1WITA 3NFSL 2AQ3A 1WFUA 4V2CB 4F7PB 1ZGLA 2P8LB 1OTUC 3QIWA 4RIRA 5ALCH 3RWFA 5CEZL 1G9NL 3QIWC 2IAND 3HE7B 1XCQB 1SJEA 1DE4A 1TDQA 3I75A 5ERWB 1GL4B 5DSCA 1Q38A 3FAXA 1KCRH 2VDQH 5EZLB 2AKRB 3PABA 4PJ9A 5D7JB 5FYJD 1U3HD 4R4BA 1KXVC 4UQ3B 4PJ9C 1OGAD 1MI5A 3ARGA 1J8KA 5JW5B 4UV7H 3A6BH 4MXWL 5SWSD 2FEEI 2D4FA 2X1WL 5EBLA 3VXOB 3BDYL 4KI5D 2BNQD 4U0RC 1QBLL 1C5BL 5C0CD 5TFSH 1YMMD 1HXYB 4NKIH 4DUWA 4LVOC 4CVXB 2WWKO 1U95B 4L8BA 2APBA 1PW3A 1MHCB 4PRBA 2V7HA 3QXDA 4JO2L 4R0LB 4MXVE 5FDWA 3ZHKA 1JRHH 1ZSDB 3CJJA 3LIZL 1HQ4B 2VLKB 2R2EB 3AREA 4C56A 4DWHA 4WEBL 3E6HB 3AREC 2FJFA 4UUJA 5FM5M 4Z95L 1D6EB 1N0XL 4LCWA 5IW3A 4ZFZA 2XWBB 3VA2C 1FYTD 4EBQL 1P7KB 2DB8A 1T0NA 2BNUA 2PO6D 3EYQD 1TJGL 2VDNL 3IGAA 5KSBB 5HBBA 4Q6YA 4OGXL 4ODHL 4H25A 1YEFL 3UJJL 4P99A 5FAAA 1H0DB 3T3ME 1WBYB 5DFTA 3VH8B 2FECI 4XMLH 3QR2A 3VFOA 1FE8H 1QBAA 5EZJA 3QG6A 4O51B 3JWDC 5K9QG 5D96B 3VFPA 5CP3H 5C0NC 3U6RB 4X5XA 4U1HB 2VUYA 3IKCA 4MCYB 4O4YL 4ZO6A 3LEVL 4HJ0D 3WS3A 2YRLA 3CPLA 2YEZB 1TMCB 1DBKH 3PV7A 3I50L 2VJXA 2VLME 4Y5VB 2O5YL 1QFWH 4XBEH 2F19L 5JNYB 5E8PB 1CL7I 3HFMH 4JFOB 4TUKL 5FHBH 3VD9A 4PGBA 1C7SA 4JPWH 4P5TA 2XN9E 5HY9B 4HIEA 2IBZX 7FABH 5D4QA 5ILTH 5IB1A 5HYQB 2F53A 2PTUA 1FGNH 4GAJL 3O8XA 1G6VK 3QUKB 3U4AA 1YY9D 3MRCA 1UM6H 4HF5L 2KZ1B 1JNHA 1A8JH 4U1MB 3IF1A 3BZFA 3ESUF 3KXFD 3CFCL 1E6JL 4LLVA 1KEGH 4BQ6A 5IF0B 1RUKH 3L5JA 5I16B 5EOCJ 2QL1A 1IC4H 2VWEC 3HG1D 3W5MA 2JCCE 3O0RH 5GZOD 5JIKA 3QG7L 1I3UA 1E4KC 1RZGA 2OL3B 1MHEA 3SDAC 2VISB 3CX2A 3DSFH 4DW2H 1VGEH 1UA6H 4P5KB 1AGFA 5BVPH 5IB5A 4HKJA 4XXCA 4PJHA 5J12B 3QO0B 3ULUL 4G6KL 3V8OA 1S3KH 3OKLA 4QRPB 5BZWA 5I1GH 3NCFB 4NJAH 3K81A 4Z18A 4D94A 2VE6B 4OCRL 4UTAH 2VR9A 4L4VA 4PRPE 3OQ3B 1NEZG 3BISA 3C87A 1W0VA 4PP1C 5D2LB 4MCZB 3KLAA 3BN9D 3O9WA 1S8DA 2BDNH 4YJZL 3KPPA 1INEH 3O9WC 4FZ8L 5CEYA 5LXGH 2FR4B 1S7SB 4NQSA 4ELMA 4JDTH 3INUH 3SCMA 5IT2L 2X09A 2P24A 1J12A 4Y1AA 3DV4A 3RNQB 1CI5A 5T1DL 3SCMC 4CJ1A 4LDEB 3KYKH 4QXWA 1BF2A 1OM3H 3UCRA 3LOWA 3NCYS 4UDUA 4OAWB 5FYLH 1VFAA 1KCVH 3QDMD 5I30L 3S88H 4QHMA 4U6HB 2AJUH 3OR7B 3MNVA 5GS0H 2FIRT 4YHML 2ZJSL 5MENE 4LHUA 5SX4I 4QRUB 3TFKC 2CO7B 4FFZH 2I5YH 2Z93A 3QEQD 3I6LD 4UB0H 4HWUA 2DM3A 5TPWL 3SQBA 2BC4A 3QULA 3T0WA 4DZ8B 5DZLA 1IVLA 2ZUXA 3L3IA 1O7VA 4PJ8A 4U6XA 4GKSA 2VDRL 1CD1A 1IAIH 3I6GB 3CMGA 4PJ5A 5T1LB 5DD6B 3ISWA 4S1QL 3TCLA 3GI9H 4Q9RH 3LPWA 1KUMA 5CCKH 4LSPH 4KTYA 4TNWF 4M7JH 2VUOA 3KJ6L 5HI5C 4K3JL 2CK0L 1AR1C 4MNGE 5CKAA 2D7PA 1B2WL 3HE6D 3R0NA 1R3JA 3SE3A 3U0WH 3S5LA 2O5XH 4IOSD 5B8CA 3SE3C 4HLZH 4JN1H 1JMXA 4N0YL 1J9CT 3L3KB 5HHXL 4AEFA 5IIEB 1F3JB 1TZIA 3WFDL 4G9DA 4XNMA 5GHWL 3C5JA 3WJLA 3FMGL 3OWEA 3TPUA 3BUYB 4P57A 3WJLC 1MCDA 4LPUA 5DJZA 4OZFA 1D5IL 1L0XA 2UY6A 1EGJL 2EDLA 1BP3B 1RMFH 1NCUA 2HYMA 3MRGB 1S9XA 3TZVA 3TZVC 4HWBH 3TVMD 2X89A 4TN9A 1XIWD 4WCYH 3D25A 3LN5B 2OR9H 1I8IA 4I9WE 4ODXA 3QIBD 2BSTA 2G75B 2M1KA 3KPMA 1YNLL 4Y4HB 5E03A 4UZGA 1D3CA 4M1GH 5EFIB 1FNEB 1NDMB 4JFPB 1N7ML 2YSSA 2C3VB 5EWIH 4LLYA 1AC0A 4F33A 2J8UA 5JPMB 4LOUC 1S5IL 4PS4L 5HVGB 3DV6A 4HUWA 4X5WA 1T2QH 4WHCA 4YQXL 5CFHA 1JHTB 3D0LB 1MFDL 4Y4FC 4LDLB 1A6VH 4UBDC 1LNUA 4ZAKA 3RUGB 4DOHB 2ZZUT 1VENA 3OJDA 3ES6A 3GSRA 4ERSH 3BYYA 3FQNB 1BBDL 5I8KL 2FLBT 4OF8A 3UZQA 3TF7C 4YDVA 2DM7A 1KNOB 1VHPA 3IDNA 5KVMC 4EN3B 4WWKC 4ALAL 4WUUD 5JZ7D 4PJHF 4E41A 3QRFM 4AENB 4JO3H 5KOVC 5HDQH 2AJVH 4CVZA 3KPSA 2D03H 2UWEB 1V8HA 3UP1A 4QTHB 4NFDA 1MAML 5F44A 1MCLA 5EO0B 2HWZL 2CQVA 1XGUA 4MD4B 3R1GH 3DVNA 3BMVA 5L9DH 5LVEA 3LEYL 1EXUB 1MPAH 1DBAH 4EOWH 1U8QA 3H9SA 1RJCA 4ELMF 2X40A 5KANG 2XKSA 3VXUA 3HC3H 4JO1H 2R4RL 3SJVB 4ZFFA 3IDXL 2ADFL 4MDJA 4GKOA 3WFHB 5IGXL 1KACB 4ZSOE 2LTQC 3RDTA 2IPTH 2A6DB 3PG2A 1BX2B 3I3DA 3FFDA 2JIXA 3BOVA 4WI7A 3DXAD 4N5UA 3L5XH 3R06A 3RVUC 3QNYA 5ESAB 1FGVL 3Q6FB 4UILL 2YUZA 4N8PA 4NZRL 2X10A 5F7FA 2NY6C 5DJ6B 4RAVB 2ZCLL 4U1SA 1GC1H 5E00B 3T77B 3EFFA 4Z76B 1NUDA 3H3PH 4MDIA 1NMAL 2G60H 5IMMB 3OAYK 1EGJA 3GO1L 5IEHA 1TZHB 3LKSA 5FO8A 1JF1B 2Y36H 3I85A 1F6AB 3AS0A 3A6CH 3C5ZC 4LARH 4WTZG 3VE0A 4JDZA 4K7FA 1BD2A 3HC0B 3IYLW 3S97C 5KSVB 1X6NA 4L1HA 2CH8A 3DHMA 5T5FL 3PWPA 4RMRA 2ESVE 3F5WB 1LO2H 3SGJA 3SGJC 4H5SA 1YEEL 2AP2A 5JW4N 5ITFA 4XWGL 4MXQC 3L95B 1G6RB 1GAFH 1HOCB 2YA1A 3KWWA 3PIQB 4O2CB 1UKTA 4QNPE 2F5AL 4LMQI 2BMKA 1U3ZA 5D7LE 1IFHH 4YXKL 4FTVB 3REWA 1UFUA 3MROA 1YA5A 3BDBA 3RA7H 1MF2L 3WN5A 3G6JE 3ZTJH 2A6IA 3WN5C 2Z9TA 4OM0H 3GUTB 4OZIE 5C0JA 1QQDA 1MCPL 5AYQA 2OJEB 4M8QB 2J8UF 1X5HA 1ZS8A 5INCB 2AV7A 5JHDA 4XHJC 5IW1A 5F7LB 3ULUF 1CGSH 2JJSA 1QVOB 3IFNH 1R5WA 1U8IB 5ICYB 5FOBA 2JJSC 1PYWA 1NUFA 5DUBB 4CW1A 3U36A 4QTIH 1AI1H 4UT9L 4K23H 3MJ8B 2FX7H 3DX7B 3SE8L 4ZUSB 2VLRA 2V2WA 3QWOA 3T2PA 1NGYB 1KTLB 1J5OL 3O3DA 2ITDB 4NWTL 3RKDD 4JM2B 4NHUA 2MPAH 1FZOA 4CU6A 3BZEA 3UAJC 2P46B 1ZMYA 2DD8L 4RIRB 2W38A 3L3GB 4S1RH 1HSBA 4ZNEA 4LPCA 2DWEB 5MP6L 3HUJB 1TCRA 2VDPH 3MX0A 3UTZA 4UOW1 3W82A 4XMPL 2CUHA 1U8HA 5JORA 1BQHA 1HZHL 4XGZB 2JLLA 4TVPD 1ZE3C 3NA9H 4UV4L 3DGGA 5BCAA 4LLDB 4BK4A 5IV2A 1X6LA 2X1XR 4JFZL 4OIBA 3TH4T 4NQEB 3PWLB 3GSNL 3T65A 4CMHB 4TPRL 4QXTB 5EBLB 1B0RB 2Q7YB 4V1DD 4X6FA 4Y4KA 1JGVL 3JWOC 2DM4A 4J3SA 1H5BB 3UJTH 4X8JB 2VDLH 3WUWG 3PJSA 3RBSA 5EOCL 4XNZB 1RJYB 1UJTA 5HYSA 1MJJB 4X6CE 4NNPH 3X14B 3T0AA 4PRBB 4EDXB 3MRIB 5C92A 1Q1JL 2ARJB 5DJAA 4NGHL 1UWXH 1KN4H 4QXGL 3W9DA 4WFEE 3L3JA 3NH7H 5DK0A 3QDGA 4FQPA 3MV8E 3QFJA 3Q5OA 3MBXL 3STZA 4HKZB 3TT3L 1OPGL 3AS2A 5IQ7L 1UQSA 4LCWB 5T3XD 3CDGB 2HAZA 5FO9B 5IFJA 5AUMB 1DLFH 3HE7C 1IGML 1IILE 2OZ4H 3RRQA 1U8OB 4NZUL 1KTDB 2EKSA 4LQ1A 1GOFA 3OAZH 2QQNH 1DQLL 4FFYL 5E9DD 4XVJL 2FX8L 3WV0A 1MQ8A 3QG6B 1X5IA 1H3VA 1JPTL 4DVRH 1II4E 2YK1H 4P46C 5GJTH 1IRAY 1RIUL 3MTRA 3IKCB 3MACH 5DD3L 1QFOA 2VAAB 3L5WB 2R69H 3MJGX 3QCVH 1IGIH 2YN5A 1A64A 3FO9A 4OQTH 1IL1B 4I18B 2BOCA 4X5LA 1S78D 3NFNA 2ICWI 2DKSA 2DWDA 4YDJA 4P5MA 3VXRB 3LRSB 2H32A 3QQ3B 4TUOB 1TVHA 1R3IL 4W6YB 4WFHD 3E8UH 1H3PL 4J8RA 3VXQA 2BJMH 1D9KA 3UPAA 1D9KC 4HFWA 2QSCL 3NACH 3DGCR 3HN3A 1EBPA 1YPZE 3OB8A 1G9MH 1J8HA 4JFFE 5T3ZH 4YHYB 3IJHA 4POZD 1P4LA 3U0TA 2EDRA 1EJOL 5F21B 4BFIB 4U33A 2P5EE 3QXUA 3RFZC 2CIKB 3BPOC 4PRHA 1K8IA 5CGYC 4RRPA 2IANB 4ZTPL 4KTEH 3VXME 3EJZC 3GSNA 5JDJA 5ICZB 1MHEB 1EIBA 3SPVB 4OT1H 1DBJL 3WBDA 1AGFB 3P0VL 4PPTA 1WEJH 4KK6D 5DJ0A 1EPFA 1OGAB 5I1AB 3T3PF 5I2IA 1JRHI 4P2QE 1NAKL 3FFCA 4JFEE 3RGVA 3PQYD 5SWSB 3U4BH 1RZIB 4Q9QH 1M71A 4QT5B 1MCNA 1J0HA 4L4VB 5DFVC 4AH2A 2BNQB 3B83A 1A9EA 4UI2A 5IBUG 5C0CB 1JTTA 5CD3A 2JELH 4ELMB 3GJFB 2CUMA 3VWJD 3DUSA 5HGBB 3VXPA 1RK1B 4DK6A 3HC4L 3AAZA 3VFSA 1X3DA 4S2SA 5I8CB 1GZQA 2VQUA 5SWQA 2GY7B 5I71C 1LK2A 1U92A 1VFAB 2VL5B 4IOIB 1NAML 5BS0B 3CFKA 3FT2B 4BFGA 4PJDA 1ZLWK 2CRZA 4G8GE 4GSDL 2Z8SA 3GKWH 2JK5B 1OSZA 1A1MA 3ROLA 3VFTB 4MNQE 5CGTA 1FYTB 3E3QE 2XYCA 3GRWL 4UOJA 4LEXH 4ZUTA 2BC4B 4OFDA 1JNLL 2FIKA 4XPFH 3BI9X 2GEEA 2MQ3A 5FYKD 4BSWB 3KNBB 2LU4A 4HULB 1CD1B 1OB1B 3JWDH 3GMMB 3MOAL 1BQLL 4PJAE 1HEZB 3NZHH 1BHGA 1BEYH 3S35X 2IPKB 4KPHL 3V4VH 2EDWA 4PREA 3MRFA 3BDXA 1LO5B 1DVFD 1NCDH 4FA8A 4PYHA 5C0EA 4OCWL 3V0VA 1NC4A 5B8CB 2HJKA 2BNRA 4ZO9A 1IT9L 4F58H 2WW8A 5CUSH 3NIDF 4X6DE 2JJWA 1J1XH 4G9DB 1DUZA 3QWRA 5GGUB 4MYWB 4JQIH 1OCWL 2DL9A 4S11A 5E5MB 5FGRA 5CBAA 4TSCL 5ACZB 3MCG1 2UVFA 2PYEA 4ETYA 1F4XH 3EJYD 5CSZA 2YBRB 1DSFH 5ETUB 1I8IB 4N0FB 4ODXB 2A83B 5D72L 4GBXD 3TBSB 4HX1A 3FCTB 3GMQA 4U0QB 3MFFA 3TGXA 3KYNB 1CZ8L 4YUEL 3KPRE 1AP2B 5IHZA 4ODVL 3RX7A 2NLJB 3KXFB 4GFTB 4MA3A 1OAQL 1A7PL 1IGTA 4AM0B 4F7EB 4F33B 3CVHB 4R2GB 1I8KA 3HG1B 1HQRA 2AEPH 1WUNT 3UROR 2L7JA 3DI3B 5CEXB 1S9VB 1ZA6B 4X5WB 2ITCA 5EZOH 2BVQA 1KTRL 1L4IA 5KN5A 1A7OH 4X4ME 5TDPA 4JFXA 4MXWH 1YQ2A 4IDJL 1JHKL 2KUTA 1EHAA 3ZDXF 1NL0L 3BKML 4ZAKB 4K9EL 4JZJA 3BDYH 1QFHA 3LKOA 4JZJC 3OJDB 2PYFB 1XF5A 5HGHA 2C4FU 5DRWB 4MJ5A 4ORGB 3LD8C 8CGTA 1OAZH 1UT9A 4NQXB 1EV2E 1NKRA 3U7YL 1UYWL 2QQLL 2R1WA 2W60B 1J11A 5DXWA 2IGFH 4YHLL 2WUBL 2VLMD 5C09A 3ARDA 2FWOA 1OD9A 4CVWA 4NM8L 1CFTB 4QRRA 3MA7B 4A6YL 4MWFA 1FFPA 4KMLB 3QDJA 1NAMA 4OZGA 2XN9D 3TM6A 5D8JH 5BRZE 3DVNB 4KKCD 3QRGL 4U4BA 4ODBD 2H2PC 3I02B 4FQ1L 4P4KC 2DJSA 1NC2A 1CK0L 1P4IL 3GSQA 5E1HB 1I9JL 2VDNH 3QDMB 3TA3C 5IJVB 1HHGB 2ZUQB 4RFEA 3WO4C 3IETA 5T33H 4D0CB 3UJJH 3WHXA 3CX5J 1VB9A 2DRUA 3QEQB 1CLCA 4XCYA 5I1LA 1DBBH 1G7IB 1H8OA 4PJDF 4JAMB 3UPRA 1NGXB 2FBJL 3STBA 1PSKH 1KCKA 4PJXA 5HI4D 5EG6C 4XWOD 5I0DA 2YUWA 2C3HA 1IE5A 1XGTB 5HPMB 3O6FA 4FQQA 4HQQL 4RFOH 3SO3C 1JGUH 1K2DB 5DQ9B 5FF6B 4P4RA 2W07A 1QNZH 3HE6B 2P48B 1XMWA 2DYPD 4PYGA 4L8CA 2AXHA 3FTGB 5E99H 4LIQL 4PB0H 2HRLA 2G5RA 1E4JA 2VWEE 4JRYA 4I3RH 2J6EL 5KS9B 1N6VA 3ARZA 1BD2B 2X70A 5GIRA 2PTVA 1YJDC 3GIZL 1MJUH 3KDMA 2W91A 5DYOB 5C9JB 3JTSA 1YMHB 4HF5H 3C08L 5C0AD 3BPLB 4X6BB 3HZYA 3TVMB 1SM3L 5DMIL 4G6JH 1KG0A 4FOMA 4HUVB 5DMGD 1A4JB 1JZ2A 3O45B 1CIDA 1NQBA 3MBED 5J9PB 5JDSB 3C2SA 5F89B 1AD9B 1F6LL 4Z7UB 2AGJH 2E9JA 4BH7A 1F4YH 3GBNL 1DEEA 4IS6B 4UAOC 2VL4A 5K9QI 3ULUH 12E8H 1ROWA 1FORH 2AJZB 3ZKMD 4ZPTA 2YPKA 3LV3A 4L3CB 3PP4L 2OX5A 4OCRH 4LSDA 2DBLL 5IG7A 2CIIB 2FZ3A 3QA3A 1H15B 3TNNB 5F8RC 4JCMA 2FBOJ 4N1CA 3WXVH 1MH5A 4MAYA 5FK9A 1K6QL 4CW1B 4A6YA 4WY7H 4MAYC 4H0HB 4HIIB 3X13A 5IT2H 1Q9OB 2R0KH 5T1DH 4OGYL 1C8PA 3QWOB 2X41A 4ZOAA 3JTTB 4O02L 1OLLA 3TIEB 4CL7A 4YGVA 2O93L 1QSED 4NHUB 2Y5EA 2AV1A 4F57H 3BZEB 5E7FA 2O5ZL 3TWCH 2HFTA 3QXAB 4ZXBD 1HSBB 4YHMH 4I9WD 4RNRB 2NZ9D 4NQDA 5ANME 2OTUA 2XKNB 1J10A 2GTZA 5IVXE 4OZGF 2XNAA 2PW2A 2I60L 4ZO7A 2WBJB 4Y5XB 35C8L 4URTB 3ZDYF 4DGYL 2VDRH 2HT3C 5IK3A 4PY8I 4NQCD 4S1QH 1KEML 1WT5A 3X12A 2JB5H 5IW6A 3DXAB 3KJ6H 3VGBA 3ZSTA 2ERJB 4ZFGL 4Z77A 2ZSWB 4F9PA 2EDOA 3MJ7B 3EO9H 4GAYB 2X4UA 3MFGB 4FQHA 3HPJB 5F1KC 4N0YH 1LDPH 2IEPA 4EQ2A 5T1MA 3BJ91 1WIOA 1WZ1L 4WGVB 4YIQA 4KKLC 1G7JB 3OPZH 4PJXF 2AJSH 5DJAB 3VH8G 2YPVH 2J6EA 3QEHA 1NGPH 5GJSL 4OLUH 1BLNB 4RISH 1EGJH 1G0YR 4HV8A 5K9JL 2J1KA 1DQTA 3QCTH 1MFBL 4NKMA 1AXIB 1QYGL 5MI0B 4OCXH 2B5IB 4OLWH 4FFWC 4JLRA 5B3JE 3OKOB 4TRPH 4K7PL 2OBGA 1XGRB 3EYOB 2HVKA 5KG9B 4TQEH 1Z2KA 4JFQB 1B4RA 3DRQB 5EC2A 1DEDA 3PWNB 3ZE0F 4RCAA 2VSCA 5A3ID 4DGIL 3KS0H 3S36L 1ZWIA 2E9IA 1NMBL 4Z7QF 3SKUD 3M17A 1KYOJ 2YKLH 2HT2D 4MJIE 5J13C 1MVFA 3QNZA 2XWJA 4WW2A 1AC6A 1J0YA 1DCLA 2A73A 5HHOB 1R3HA 3BD5A 5IMOA 3PV6B 1FNGA 4DVBB 4FABH 4P5MB 32C2A 3SDDC 4ALAH</