3FMGH

Structure of rotavirus outer capsid protein vp7 trimer in complex with a neutralizing fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELMKPGALVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSINYNEKFKGKATFTADTSSNTAYMQLNSLTSEDSAVYYCARNHGSPDFHVMDYWGQGTSITVSSAKTTAPPVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab of neutralizing antibody 4F8, light chain
publication title Structure of rotavirus outer-layer protein VP7 bound with a neutralizing Fab.
pubmed doi rcsb
source organism Simian rotavirus
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fmgH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fmgH02
4LRIA 3AUVA 4NO0D 5E2WL 3L3HB 1MNUH 3OAUH 4TN9A 3MV9D 5C0IB 2HYMA 3MR9B 1G7HB 5C0BB 3EYUL 4Z0BL 2FLBT 3KPLB 4JFDA 3E8UH 3EYOA 3NCCB 3GMOB 3LIZL 2DLFH 1E6OL 2Q76B 4NHUB 3C5ZB 4NCC2 1JZ3A 4HHAA 3IDNB 4EKXA 5I66A 5F1SA 5J3HD 2SEBB 2BXYA 3ME0A 4LLVA 2UY6A 2JB6B 3D3VE 3DURB 3GSNL 3L1OL 5EZJB 3HNSL 2R0WL 3MRGA 3RPIA 2RCSL 1PKQA 2WWKT 1K5NA 1NUNB 1F4XL 3FO1B 5DQJA 3EGSA 1LK2A 4FXKA 4QCIA 4R8WL 2V5RA 2YK1H 4RWYH 5CJQL 4O2EA 1LO0H 2I07A 1P4BH 4NO2A 1UA6L 2HT4D 1NGWB 3FB5A 2IBZX 2R29H 3BIKB 4LHUA 1F02I 5I0ZA 3NZHL 4LSDA 1CL7L 3RY5A 3VDBA 4MXWH 4GLRH 1GGCH 5IEKB 3BSZH 4I18C 1YDPA 4IBLT 3QZWA 4AEIH 4JFPA 5EBLA 1MAMH 5D7IE 1NBZB 3VFSB 5IQ7L 3VE0B 2P7TB 3WUWG 4FQ2L 1GXEA 3PWPA 5L6YH 2CRIA 3TJHC 3VMOA 3R0NA 2F5AH 4FFYH 5IFHH 5IFAL 3LVEA 5HGHB 3KPRE 4NO3B 4N0UE 3STLB 2VQ1B 2F53E 4ZO7A 3FTGB 3CU7A 5HY9A 3LS5H 2NNAA 2CUHA 1JK8B 1FCCA 3G5XB 1ETZB 2GJ6B 2VDML 5CINL 1ES0A 1P2CA 1F97A 4GG6B 4OM1H 2VL4A 1F5WA 3QUYD 2K1MA 3U9PL 4Y0GA 1FZKB 1U8PB 5J6HB 1OAUL 1MHCB 3T3MF 5K9JL 4RGMB 2DLHA 2PKDA 3TA3A 4Z7QF 2R39A 1DBML 3CGTA 4QRTB 1CGUA 2FH6A 5TDNA 1I1CA 5GSRB 4QOKE 3DTXA 1KEGH 4HAGA 1QFPA 5EUOE 5IVOA 5GS0C 3SDXF 5TDPA 2NY2D 3I6GA 1EJOL 2IPUK 5E2WH 3QUMB 3SDCB 1NH6A 1S3KH 1YPZA 3EYUH 4Z0BH 3HNTL 4YBLC 5IBLC 1IC7L 1XGTB 3KYMB 4GS7C 5ENWA 3RBSA 4DKDC 1E6OH 3O4LA 1TQCC 1DFBH 1IGIL 3PXJA 1MCOL 1F11B 4U0RC 1NMCB 4HWUA 1S7QB 2FB4H 5I30L 2FJGB 3OX8A 1K4DB 2A9MH 1U8MA 3WJJA 1NANH 3B9DA 3L1OH 3W82A 1HHIA 3EDEA 1FC2D 4IHOB 3G08B 3HNSH 2R0WH 1LP9A 3TZVA 3AXLA 2CLRB 4DK6A 1H5BA 2DRUA 5I1JL 2UWEB 4D9QE 3SGDH 1IT9L 5K59F 2R2HA 1XGRB 4HUUB 1F4XH 4WW1B 5C2BH 4I3RL 5BVJA 2FZ3A 3MMEB 3MBEA 1GIGL 2B5IB 2FEEL 5HD8C 2GJJA 3H8NA 1BD2D 4R8WH 2W38A 3V4UL 3HE7B 3QUZD 5CJQH 2VLJD 5EU5A 3VA2C 1T2QH 4U1IB 4F7TB 1HINH 1T1YB 3SPVB 4ZXBD 1X5YA 1H8SA 1TPXC 1UA6H 3INUL 3GMLA 5A2LH 43CAA 3EO0B 5HYJD 3IXAB 2YS4A 3MRBB 3NZHH 1CL7H 4PG2A 4IRJB 4KKLD 1ZTXL 3K8LA 4YC2C 1BQHA 2HH0L 5ITFA 2FWOB 4HLZG 2VZSA 2EKJA 4ZO6A 4HKBA 2X4UA 3HRPA 3RVVD 1OAQH 5IQ7H 5D5ME 3ARQA 4YXLH 4U1SB 3GMNA 1ND0A 4TPRH 4M7KL 4OF0A 1WBZB 2HT3C 4NN6B 5IFAH 5C9JB 1HILA 5K9KB 4HLJA 2P5EE 4RAUA 3TNNB 4QY8A 3ZE1E 1GC1H 3TBSB 5HHPA 1HHGA 2R0LL 2DYPD 4NFDA 5HYFA 1MWAL 2ATPA 2J1KA 4RQQA 1SYVA 5CINH 1YC7A 1A0QL 2VDMH 3BD3A 4WI5A 4ZOAA 3VXRA 5KTEL 4YZFE 5DI8A 4UU9A 4R9HA 1NLBL 4YDLC 3RA7L 5EO9A 1N6QL 1I1FA 5DS8A 3L3JA 2GJZB 4X5XB 1R3LA 3KS0J 2R23A 3GSOA 5K9JH 4DVRL 1P84K 2A74B 3FFCA 3M45A 3PHQB 1EUUA 2NXYD 1KCUH 1DBMH 4UQ3A 3OAYH 4TYUA 3EJZD 3GSNB 1GAFL 4Y4KD 3BO8B 4O2CA 5C0JB 3FOLA 5DXWA 4W68A 3SJVB 3T0EB 3FN3A 4P4KD 3QQ3A 1YY8B 4MS8C 5C3TA 2JJVA 3GMPA 4GBXD 3HRZA 2E8ZA 5GRJL 3HNTH 3PDGA 3EUUA 1IC7H 4XP9L 3GIVB 2J6EA 3PGFH 4OTXL 3VWKD 3GB7A 2YRZA 3BPOB 1IGIH 4QO1A 1JNLL 3B8YA 3QISA 4KXZI 4S1DC 1QQDA 3RVTC 1WIUA 2WUBL 5I30H 3AC0A 1PQZA 3QBTB 4PV9B 2WV3A 1IQWH 5D93C 5T1LB 4PJ9B 3RWEA 2D03L 5SWSB 4P2RE 3QIBD 1N59B 2NY7L 3TBTB 4JGJA 1HNFA 5I1JH 5E5RB 3GBML 4OFYD 4YDVB 3GRWH 3FOMA 5DA0B 1D6VH 2FECL 3DX7B 3PQYE 5FUZL 5JLZB 1GIGH 5TE6L 1NDGB 1CFQB 5FHBH 3PJSB 4N1CA 5CZXC 3UPRA 5IMMA 2GT9B 2HKFH 4X7SL 4POZD 3QFJE 1FVDB 1U8HB 1DN0B 3MFGB 5I6XB 4KDWA 1H3PL 4RGNC 4U3CA 3AMKA 4EBQL 4HUXB 5F6HJ 4OFKA 2E7LC 3BD5A 5MEOA 1VACB 2AJUL 3EO1A 4YJZL 3DVNB 3KDMB 4MNQD 1K4CA 1WIOA 5CKAA 2XKNA 4JFEE 3O6FD 4M7KH 1I1YB 1CDGA 4HUMB 4UT9H 3DX8A 3OTTA 5F89B 2YUVA 4C58B 1H3XA 2AKRA 1M71A 4HKZA 4LCYA 5IFJA 4HH9B 1LO5A 4U1JA 3UC0L 3TM6A 4JRYE 1RZKL 4X80L 5J56B 4RGNE 2R0LH 2B0SH 4Y2DC 2HTKC 1U9KA 4PJIF 4X6CA 1MWAH 3X3FL 1DBJL 3VXSA 5IR1B 2MJWA 3GJFB 3BPNC 5E6YA 4KU1A 3ARBD 1A0QH 5KTEH 1NC4D 1QSED 2PF6A 2OQJB 4MLIA 1LEKB 3D69B 1VCAA 2EO9A 4YHOL 2WINB 1QLEL 2HAZA 3FZUC 3IDXL 1R24B 3RA7H 3NA9L 1A6WH 1TQBB 2A77L 4JE4B 1N6QH 3LRHA 1VADA 4P9HL 3OXSB 3STZB 3O8XC 3O2DL 1FZOA 4U6YB 2AEQL 4DVRH 3ULVL 3RWHB 2CSPA 3U6RB 1GZPB 2UZYB 2ATKA 4OB5L 8FABA 4RZCA 4J4PA 4I0PC 4NN7C 3QXUA 1U8IB 1UQSA 4QNPE 2EIEA 4AZ8A 5ACZB 4ZUUB 3RDTD 3ARGB 2YEZB 1JF1B 2KH2B 2C1PB 3O6LL 1A5FL 1UC6A 3TPKA 2HFTA 1UM6L 4X4YA 3B83A 4XP9H 5DO2C 5JQHC 1FL3B 3RL2A 1EEYB 5SWZE 1SM3L 1JNLH 4RISL 3SGKA 2HJLB 4OCMC 4NRYB 1MCQA 2WUBH 1RUQH 1T89A 3W9EA 5SX5H 2D7QA 3RL1B 2D03H 1KXQE 2M26A 2C3GA 4U1LA 1UM5L 1B4JH 5DC0A 3FQXB 4PB0H 4M6AA 5C09D 2AK4A 3BKYL 2NY3B 5D1ZB 5JHDB 5FUZH 3FJTA 2JCCE 1OW0C 5IVZA 1QTYT 3QDME 3CSGA 4G7VL 1UB5B 1NL0L 3MJ9L 1XCQB 3MJ7A 3AY4A 4ZPVA 3MOBH 2FBOJ 2JK5B 2V5YA 5DRZB 3IKKA 1GOHA 3CC5A 4CU7A 1KJ3H 5DK2A 4OCLC 4L9LC 5MEQB 1H3PH 1NFIB 5IJKC 2ED7A 2NY0B 4EBQH 3TT1H 3FT2B 4K94H 4DEPB 1AE6H 4MJ6B 3WDJA 5FKAA 2LTQB 2EDEA 5D7KE 4U6VL 4XMKL 3WKNA 3MLXL 2AJUH 4F7PA 3VXTA 1C7TA 2CRZA 3LN5B 5IJVB 1G9NC 2WBJB 4PRID 1KTDA 1ZKAA 1BFOA 1C16A 3BP7A 3D9AH 3UC0H 5BVPL 1OSPH 3O3AA 2VLRB 2C3VB 2BVYA 3NABH 3X3FH 1DBJH 5CIPB 3F6LA 5D7JB 1B6UA 3OGOE 4GSDL 4GO6B 5MENE 4GH7B 2NW2B 3IS1X 1T04B 5FECB 3ARFC 2ADIA 1WK0A 4X4XA 2A77H 3RGVC 4P9HH 3O3DB 3S97C 3O2DH 4C54A 4O2FB 4XPAH 5D1QA 2AEQH 3SO3C 5IROC 1FNGB 2NY4D 2I9LB 5HI4C 1BHGA 4KRMB 3U0PB 2C9AA 2H6PB 4WUUA 4X0KB 2AABL 1EAPB 2VC2L 3HG1E 3MLTA 4WY7L 1JCKA 1TJGL 1WZLA 4AY0A 3T0VA 3W2DL 3K74B 3RZCD 3SOBL 1BVLB 5FYKH 4OFDA 4IOFC 1IAMA 1R3JA 3WMSA 3LZFL 3O6LH 1CFNB 1S9XB 1A5FH 1YN7A 4PGCB 4OF8A 3BP4B 1KACB 4QXTA 4ODTL 4LRIC 4M1DL 3S9DB 5JNYB 4HH8A 2A2QT 1T6WA 1SM3H 1AXSA 5C0CD 4RISH 4I2XB 3AU1A 5BO1L 2OI9C 3BEVB 2DQTH 4P2QB 3KYNB 4G8GD 5E94A 3K1DA 3UTSE 5D2NB 2W59A 3I75B 4QWWD 1H3GA 5BXFA 4OLXH 1KELH 3VGHA 4PJ7E 2AK1H 3BKYH 2E3VA 4PJXE 5ESQB 1FO0H 2DB8A 5GRUL 4G7VH 3MJ9H 5ERWA 4Z78B 1KCVL 4JFDE 4NM8H 5C0DB 4J3OC 1HHKA 5FM5M 4M5ZL 5IW6A 3W9DA 3EDFA 2EYTA 1FYHB 3HMXA 1DP0A 3UTTA 1CK0H 4G6FB 1FG9C 2XFXB 4C56E 4PGEA 1DLFL 3KPNA 4XMKH 1I7ZB 3MLXH 5EH1A 4XP1L 1JV5B 3GI8L 2XN9D 2JCCF 3I6LE 2DKMA 1A7OL 4W70A 2PN5A 1DBAL 3MTRA 4LVOB 5IBUG 2OR9L 3TBWA 3O3EA 1PYWA 1J8HE 3DRTA 4L8SA 1JUFB 2Z4QA 1I3GH 4G9DB 1OPGL 4NQVB 5EU6B 2BOBB 3AGVA 4LVNC 4UT6L 3ULUF 4HEME 4ENEC 4PJAB 3QEHB 4I3GA 1NEUA 2VLME 4XXDA 5IUSA 2PNDA 3MRIB 3AVEA 1N2RA 5CUSL 3IDMB 2OL3A 3BWUC 1RU9L 4HK3N 5DRWA 3DROB 1NBVH 4XGZA 1ORQB 2YPLD 4KI5C 4OZHF 1MY5A 1AP2B 1FORH 1DDHA 2YD9A 4ZTPL 3ZKXC 2CDFB 5H2BA 5HYSG 5JO5A 2NXZC 1A2YB 2VC2H 1ONQA 4RAVB 4WY7H 5HGDB 1TJGH 4NO5B 3QUXD 3TA3C 2GY7B 4FFWC 4I9WD 5JA8B 4KROD 4GW5A 2VJXA 4JQIL 4YNYA 4OCSL 4XTRD 3LZFH 4GAGL 3UXFA 2P44B 4YAQB 3DXAD 1C5CH 3PWNB 1OAXL 4QRRD 5BO1H 3QXAB 4OLWL 5KSVA 4F37F 5ESAB 1CGTA 2BNUA 4NNXA 1FJ1A 4G42A 3HI1B 4WWKD 5D9SB 1AQDB 3SKOA 4JGMA 3GMRA 5BMFL 4P46A 2QSVA 1BBJA 3WJJC 3KPSA 2P8MA 5GRUH 3TZVC 5FYKD 2YRPA 1RQ5A 1H5BC 1ZS8A 1RZJL 2L0DA 1ERNA 1YPZE 1H15B 1KCVH 1MCFA 4DJMA 4Z76B 2OXGA 5CEZH 1FFNA 3MBEC 3QEUB 1DSFH 4XRCA 4D0CB 5D7LA 2D4DA 3O4LE 4GMSH 15C8H 2ZSVA 4NUJA 2W9DL 1LE5A 4JRXA 1OAZH 2GI7A 1I1AB 5H37H 2CMRL 4OZ4B 4WI6A 3REWB 4PG2C 5F3HB 1WUNT 1A14L 5KN5A 5T1MB 1A7OH 4LGRB 3ZKNC 1DBAH 1OTUD 4CDHA 2DDQH 2OR9H 1FIEA 4ZODA 1A6AA 4ZSOA 3MNWB 4Y19D 4NNPL 1HI6B 1OLLA 3UO1H 5DEGB 2PCPA 4MWFB 4LFHG 4Q0XL 1J18A 5F93C 5F7HA 2Z93A 4U2ZA 1EEQA 4Q74A 2QQNL 1MCWM 2KPNA 2IH1B 3PWLA 1UKSA 4NYLA 2CKBA 3DUUB 2WMPA 3I3DA 3WNMA 3EHBC 4UIKH 5BRZD 4P3WA 5CUSH 3ROOB 4E41A 3H9SA 1TVHA 1OTSD 3KAAA 4MXQD 4P23B 1XF2B 3G9VA 1AGEA 1Q94A 4U6XA 3F7YB 4OZFG 5J57B 4ODSH 1LK3H 2C26A 4ZMAT 4N8CH 3BH8A 1UACL 3FN0L 4OF6A 1JP5A 3IJYA 3MQIA 2XWJA 4JANA 3VD4A 2BVOB 5IESH 4JPVL 2DS4A 1CU4L 1T0MA 2W1NA 4JQIH 4D9RE 4NM4H 4GAGH 3C9NA 3VXRE 4FS0A 4MJ5B 4EI6A 4XAKE 1A6ZB 2YMXL 4QF1B 2COQA 4F33B 4OCXL 2WANA 4ODBD 4CDGC 1VEPA 1QO3A 1ZMYA 5EZOL 4PLOB 5J11B 5D72H 1JPFA 5K9QI 1JZ5A 3FFCE 4QRUB 2HG5B 5ID0B 1A21A 3SDYL 4IS6B 5LGHH 1JF5A 5TE4H 3BYTA 2EDBA 3OB8A 2IAMB 3JUZA 5BMFH 4NNYA 1I8IB 2PXYB 4R3SB 3P9WB 5CSZA 4QYOB 4DVBA 3FONB 1U8OB 3QNYB 4N9GA 1JNNL 5IT2L 1F4WL 1UB6A 3DIFB 1DE4A 2F74B 3ESUF 3GSUB 2FSEA 3FO0H 4WVRA 4FQXD 2VZVA 3LCYA 2G9HA 4WI4A 2D2OA 5DD6A 5IB3B 2CMRH 2OZ4L 2G75A 4O4YL 1A14H 4OIIH 2HFFA 4LKXB 1JPSL 5D1XD 4GW4B 4YHPA 4CJ0A 5BJTB 3S36X 4GKNB 2ESVB 4XNZB 1XGPB 4RNRB 1YMMB 1HEZA 3WO4C 3PNWA 3QUKB 3WS3B 5CEZD 1CDYA 1P53A 5DD1H 5IIEA 4LOUC 3U30B 1ZSDB 2QQNH 1KLFA 1G7IB 4LBEA 4LCWB 2PUQT 2QSCH 1BJ1J 4XPTH 3ZT6A 5CBAA 4OFVA 2DQEH 2V7NB 4FOMA 5I1DB 2EEAA 4U1MA 2RFXA 4YBHA 5HJ3B 5ISZB 2B1AL 1KLGA 4A2MA 4R97B 1QFOA 4X7TA 5CBEB 3TCXA 4LLMB 2Z91B 3FN0H 4BUGA 2P42B 1WBYA 4JPVH 1QR4A 4WNQB 4X6CE 4NO0A 1CU4H 4JO1L 4BFIA 3VXSE 1XIWC 3MV9A 4ODXB 1RZ8A 3NMEA 4MNGB 4TRPH 2Q7YA 4J4PC 4O5LL 1GSMA 4LHUG 5CP7A 5L2JB 4HWZA 4F7EB 2C3HA 2NY6C 4JFOB 2A9NL 4OCXH 3C8HA 1UZ8B 1FVCB 5EZOH 1N0LA 4PTTA 4OM0L 3H0TA 3TBYB 1MCEA 3F58H 5TFSL 3NFNA 2DKUA 4PGBB 1RZGA 2FBJL 3I3EA 4B0MM 4RMWA 1AHWB 3EYQD 1EUTA 3SGKC 4H8WH 4KV5F 2ZOKB 3N85H 4DQOL 4PJEF 1T89C 4DUWA 2VITB 2ICWA 2Y6SC 3RWIA 5ALBH 3SQOL 4JR9L 1QHOA 2FYYB 1CDBA 2R2BB 1F4WH 4M1GL 5KZCD 4GRLA 3L3KA 1QBLL 2BCKB 3RU8L 5IEHA 4F8TA 5LJYH 1EPFA 1F6FB 2D31A 1N0XL 3VXME 2V2XB 4OZGB 2XTJD 1IGCH 1A1NB 3AY4C 4ZFOB 3SKNB 3TBVA 5FDWB 4FN0A 1OP3H 1N4XL 5E6IB 1OM3L 3AS1A 4U7SA 5L0QB 3DO7B 2DTML 2OZ4H 2P8PA 4O4YH 2GKIA 4R96A 4X9BA 4PLKD 4FMFA 3RIFF 1JPSH 3QWOB 4HBCL 1KBGL 5E1HB 3WL9A 3GUTA 3VGBA 5F9OL 5E8PA 3WHXB 5IKCA 1H3UA 1PX4A 2W92A 3KPLA 4L1HA 1F42A 1EHNA 3GMOA 4JKWA 3A6CH 5DHVB 3NCJH 1GYAA 4PBXA 4G8IB 5J7CC 3IDNA 4ZFFB 5LGJB 5C70A 3L5JA 1DL7H 1T1WA 3MLYL 1GJIA 2JB6A 2G5BB 3DURA 5EZJA 2QTEA 3V6FA 4V1DD 2LU3A 1HN1A 3I50L 4AG4L 3JV4B 1WAAE 3FO1A 4NZRL 3QXDA 3AM8A 1HH9A 2Z92A 2XXCB 4NBZB 1IGFL 3GKWH 2WQRA 1IFHL 5D1QC 3OBAA 1IKFL 3OWEA 1S7TA 1A1MA 4MYWB 3LV3B 1KN2L 2VABB 1NGWA 2X4TB 4D9LL 4JO1H 1OARL 3VJ6B 3QEGH 3IYLW 4O5LH 1L0QA 1T66D 3QAZC 3MRHB 2FD6H 5CHNA 1CXLA 4EI5B 1PG7L 4MX7A 2VTFA 3QEQB 4JM2F 3SKUD 3MCLL 4OM0H 5HDBF 1FE8H 4EUPB 1XGYH 1CGSL 3EJYC 2F54B 4DOHE 2K7QA 4NO3A 3O6KL 1G6RL 1Y18A 2DL2A 4WUUE 5IB2A 4X6EB 1RK0B 3LH2L 1OVZA 1ZT1A 4QHLB 3OKDB 4FQJL 3OG4B 1ETZA 1BD2A 1LNUB 4KVNH 1PG7X 4R90L 1KB5B 4GG6A 2YR3A 4GKOA 2VLJA 4NRXA 3SQOH 4JR9H 3QI9B 1J1PH 4ZXBA 5JDSA 5JIHA 1AGBA 4YHLL 3C87A 1H0DB 5HYJA 1MJJA 3RU8H 5I1LA 4GAJL 4PBWD 4HMEA 4EDWL 2GK0A 2A6IB 1RJYB 2RR3A 1Q1JH 2DBJA 4QRTA 1WFOA 5JMOC 1N4XH 1OM3H 4K3DL 2DQGL 4FQCH 1A6TA 1KCKA 2DTMH 3GZKA 5C0AD 1G7QB 4XNMB 4WTWA 4NBXB 4C83A 4L4TB 4MQ7A 1VSCA 2E9IA 1CD0A 3KYOA 3I84A 3GO1L 4BH8B 4LSVH 3W11C 3QUMA 4PLNC 4HS6B 1F8TL 2MQCA 1GH7A 4X6DB 3KG5A 3RTQD 4U6HA 3IRZA 4KGLA 1TETL 2DYPA 3KYMA 4WEMB 5EOTB 4KUCD 4WEBL 4HLZH 4EDXA 4KQ4L 4O58L 4ZAKB 1RZIA 2OJZH 4NT6A 5ADPL 2X1PA 4L8SC 1YEGH 4XP6L 4HIXH 2NX5B 5C07D 3UTTE 3TVMB 1GOFA 2IQ9H 3FKUS 4L3EB 3SE3A 4U4BA 5GPRA 5KSBB 2X10A 3G08A 3STBA 5CLTA 3AAZB 3I50H 5DZOA 2UWEA 5DTFA 4G7YL 4NZRH 5GIRA 4NKIL 7CGTA 3O6ML 4TULH 4GOSA 4Y4KA 1IGFH 3RIAF 1OCWL 1F2XK 1NMAH 3S5LG 4EOWH 1G84A 1E27A 4F7TA 5GJTH 2HWZL 3MUZ1 4M6OL 3SPVA 3V95A 1KN2H 2HJFB 2P5WB 4UIMA 3PXHA 5ICXA 4D9LH 4XNYL 1OARH 4GBXA 4UNVA 1IL1A 3QR2A 2DIBA 4Z7VF 3DOSA 2BC4A 1PKOA 5F44A 4ORGB 1WAAF 2VO5A 3F62A 1P7KB 3VWKA 1JHTA 4J3VA 4JJ5B 2CUMA 3SN6N 5DVOA 2LAGB 4FQPA 5LKNA 1ACZA 5KG9B 3ROLB 2P48B 2BVQB 3H3KA 1JRHH 4UOW0 1KUMA 2R1XB 4UINL 3CDGB 2AGJH 4ZUVB 3V0WL 1G6RH 5JOPD 3EYFA 3TBSA 1U8NB 4OFYA 3T1FA 1F4YH 3TCLB 2CLVB 1G9EA 4P57B 1FSKB 4FQJH 4QTHA 4Y4HD 3WFZA 5JQ6H 4N0CC 4BKLA 1MI5D 4R90H 5GRYA 5GJSH 3O9WD 4POYA 1CE6A 2AV1A 3V0VB 4PJ8D 3QIUD 4P46C 2Y07L 1D5XB 1BZQK 2WIIB 4L4VB 5IOPB 2HKHL 4X5XA 4GAJH 5TGBA 4OV5A 1UG9A 1G1CA 3P30L 5BQ7A 1EJ6A 4JB9L 1KCSH 4LAQH 2OK0L 4K3DH 2DQGH 4MNQA 3GSNA 2IQAB 1OLZA 3MNZB 3BO8A 3O6FA 5GGRB 4PLJD 5TH2A 4OCYH 1MFBL 4H88H 1CFSA 5C0NC 3KJ4C 1HOCA 1O0VA 3WNOA 4NQEB 4KZDL 5C08E 3NAAH 3CSYA 4AH2A 3OKMB 4KVCH 4Y16D 1KXVC 2FGZA 4P9ML 3UPAA 1XMWA 4O58H 3ARBA 4TSCL 1UH3A 1NC4A 1VFAB 4Y1AD 4JFHD 4XP6H 3CLFL 3QHTC 5HPOA 3FO9A 4JRXE 1Z9SA 1JE6A 1KG0A 4PJ9A 4S2SB 2ORBL 1EEZB 1S7UB 4CBPA 1I9RL 2OTUA 1CDCA 4YDVA 5HHQB 5A2JH 1YEJL 3O6MH 5JLZA 3BKCL 4Y5YB 1F45A 3ETBF 4PY8J 2YBRA 1J5OH 1JGDA 1FZJA 5ADOH 3NN8B 3PGCA 3PJSA 5JPNA 1OCWH 2NY5L 4LLQA 2HWZH 2GT9A 1W0YT 3G6JF 4F37K 3E2HB 1FDLH 1FVDA 1U8HA 1DN0A 2IADA 1ZEAL 2QADB 4H1LB 5JIPA 2EZ0D 3MUGB 2L7UA 1II4E 3GM8A 4HUXA 1S7RB 5SV3A 5SWQB 3IU3B 3OJ2C 5EU7E 3R0MA 3NGBC 5GS2H 2VN4A 4E41E 2VQTA 3H9SE 3CFJB 1J7VR 4HCRL 1P4LA 1MJ8L 3CZFB 3CCHB 2P49B 2Q86B 1D5MB 3DETC 1U3HD 5B38A 5F89A 4LCIL 4CJ1A 2C3WA 4QXWA 5FM5O 3V0WH 4O02L 3UJIL 2IANE 4JZNB 4ZPTB 3U82B 5C09A 2BNRE 5T3ZE 3U0TA 4LSQH 5BZDA 2CH8A 1WTLA 2AQ2A 2OQJA 3D69A 3RPKA 2WINA 2Z35A 3NZ8B 4PRPB 2CRMA 4YDJA 2DLGA 4MDIB 3LOWA 1YY9D 1X6NA 3ARPA 1JWUA 1X3DA 3BGMB 1PSKH 4M1CC 4K07A 2NR6C 2NYYD 2Y23A 1TTFA 3P30H 3JTTA 3LEVL 1J10A 3U6RA 2YKLL 4ETYA 3OJDA 4PJGA 3V6BR 2XG5A 1QRNB 4BZ1H 2OK0H 1JWSB 3VFRA 3K3QA 2X4RB 1M7XA 4XI5D 1IAIM 3KLHC 1NGZA 2GK2A 1IAKB 4F9PA 4HXBL 5CEYA 3P2TA 5ACZA 2OP4L 4PRIA 1TTUA 2JJWA 3B9AA 4TUJB 1EO7A 2HN7B 4JFZL 1RAMA 3VXNA 4FABH 5FA4B 5LXGH 2QKIB 3PGDB 3UJJL 3DGGA 2GSIA 1WSST 1F3RB 5FF6A 4MGXA 3ZTNH 4NKMB 4YPGB 1FL3A 3DV4A 5F7LB 5B4MD 3PWJB 2CDGA 3L9RB 5EOCL 4Z0XB 1T3FA 1S7XB 5DSCB 3MRDB 1KSRA 3U36B 5C9KA 1QOKA 5D70H 4CAGA 4K7FA 1QFWI 1JL8A 2AEWA 3MV8D 4HUWA 4HIJB 3RRQA 2IH3B 2Y5EA 5HHME 3RL1A 3U2SA 2ORBH 1I9RH 3W0WB 4JREB 4RAHA 1IGML 2R15A 4TVPE 3A6BL 4BQ8A 5D1ZA 1R5VB 5IVXB 3ZL4H 4MAYB 5ACMA 4XH2A 1UWGH 4MB4A 3CPLB 4UV4L 3BP6B 4BUHA 3BZEB 2DWEA 4PRHD 5CGMA 3RZCA 5JA9A 1MWAA 3LB6C 1Q0YL 5D8JH 3MFFA 3D3VD 1NFIA 5GGVL 4ACPA 3BN3B 1UYWL 1GOGA 1RJLB 1TJIL 5MERB 1NGXA 3P0VH 3G5ZA 1VB9A 5C0CA 4XPFL 5A16B 3P3YA 1TDQA 2BDNL 1EGJL 5IJVA 4LQ1A 3L6FB 4G8GA 5IMLB 1NFDE 4HMCA 4LCIH 1DUZB 4LPUA 4TNWF 1N7ML 3UJIH 5J3HC 1VDGA 2ENYA 3VFWB 5FM4A 4JHZA 4WWID 4MD4A 2IALA 2YA2A 1BQUA 4DGIH 3MV9E 2NW2A 2CIKB 4QRQA 5I1AB 5EBWA 1PJ9A 4P2CG 1P5UA 2XQYG 4OD2B 1MCSA 1CTOA 4DGYL 1LQSR 4FXGB 4ZUTA 5GS2D 4O2FA 4U0QB 3KPRD 3VG9B 3NACL 2JIXB 5DHXB 2HT4C 3ALPA 2MTPA 4LP4A 2FL5B 4KJWD 3DUSB 2XN9A 2H6PA 1O7SA 4P2OD 2YOCA 2YPVL 5F7FA 1REIA 2OP4H 3B3IA 1UENA 4XWOD 5DD5L 3K46A 4JFZH 1MCNA 2EDHA 2FJFA 1Q38A 1ZA6B 3OZ9H 4PGCA 4HFUL 4UNUA 3P77A 1MJ7H 3BP4A 3LPFA 4KJPD 1A4JB 1KLUB 1JGUH 1KTRL 2DM4A 1A6PA 2O26U 3IDYB 4PJIB 5AD0B 5JNYA 3HFMH 4X99A 5EOCH 2J8UF 4OT1L 1FL6B 5F1OB 4JFFE 4NQCD 4QOKD 5DUBB 4F7MB 1IBGH 3GMQA 5TJWK 4GUPA 3RNKB 5KS9F 3QQ4A 4B50A 1QKZL 2EDLA 4JN2B 5E00B 2P24B 3UYOD 4CVWA 1IGMH 2YPLA 4AIOA 3A6BH 5IK3A 3UPCA 4EZMA 2IFGA 4PJHA 3CXHK 1U8JB 4UV4H 5C0BE 4U7MA 1DUYB 1IEAA 2AJ3B 3QUXA 1HKFA 1U93A 4J3SA 4OJFL 4OCNC 3N9GL 2VZTA 3AM8C 3NPSC 1Q0YH 1Z2KA 3F5WB 3IFOA 2MKLC 3ORJA 4JDZB 3ULUL 4CVXA 5GGVH 5LGKA 1QVOA 1UYWH 3PV6B 1R5WA 2NY2C 1TJIH 1UWEL 3DXAA 1RZ7L 4HK3J 1KULA 1JV5A 3P11H 3MSPA 3SDDB 4DZBB 4QRRA 4XPFH 3O2DA 4IOIB 3DARA 3DMMB 1EGJH 4XXCA 1RVFH 4LKCA 1JFQL 4WCYL 4WWKA 3ILPA 1WWCA 3VXPA 3MLUL 2AW2A 2BOBA 1NUGA 3HZKA 2IPKB 1TCRB 3BKML 3BJ91 2KQNA 4HWBH 2H3NB 3DGCR 3RIFK 4NZJA 1DN2A 1SY6H 4LIQL 4NQUA 5HYQA 2X05A 1ZXQA 5M95B 7FABL 5T1KD 4RMSA 4DGYH 3QUZC 1M05B 2VLKB 3DROA 4OD3L 3NACH 4ZXBC 1X6LA 2YD7A 3N1GC 5J13C 1CT8B 3G9AB 2X4PA 4P59L 2E7MA 4KKLC 2YPVH 3VMPA 3VW3L 4XP4L 1S7SA 1KPRB 1E4XL 1O5DT 3BPCB 5GGQL 5DD5H 1M7IB 5D2LF 3LD8B 1VGKB 4NWUL 3RVVC 4Y19A 1IAOB 3OKNB 1FO0A 1XF4B 4GG6E 4PJDA 4YAQA 4HFUH 3MJ9A 4P4RB 1NUFA 1H8OA 4HD9A 3PWNA 1QSFD 4OT1H 3U7YL 5IBTL 2FHCA 3O45B 1YECL 1RZFL 5F7EH 1FZMB 4M6NH 2R4RL 3KPOA 1E4WL 4UDTB 4HIIA 1Y0LA 2W65B 3BIBX 1NMCC 4QRPB 3QRGL 1BQLL 5I8OL 4K7PL 4O51B 3SE3C 3U79A 1T0NB 1XF5B 5F72S 5I19L 5T1DH 1JYXA 2C7UB 4QXUL 5D96C 1PZUB 2CR6A 2W0FB 1MLBA 5CMAB 5I1IL 2NXYC 3HTLX 4OJFH 3V7AE 3N9GH 2B5IC 4KHTL 3EJZC 5BOZG 4Y4KC 4AL8H 3FHAA 1MAJA 4BSJA 2XZAH 1MFDH 3UJTL 5FA3B 4MS8D 4OF7A 1XGUA 3DI2B 3F7VA 3RKPA 1QR1A 1C12A 1UWEH 1I1AA 1D9KD 3X13A 4GBXC 4K7PX 2EDWA 1P9MA 3PQYD 2BX5A 4Q9CA 5CWSA 1OQXA 1I75A 1NAML 12E8H 2UWEE 2EYSB 2X4QA 1N6UA 3VWKC 1JFQH 4LPXA 5J8OA 4S1DD 2HRPH 4ZDHB 3BDBA 3BW9A 3D6GA 3FB7B 1CLZL 4DKEL 5H35B 2QJDA 3IU4H 4MWFA 4X98A 3QIBC 2VRAA 2L7JA 3BKMH 3RWDB 4LCUA 3MODH 2WWMD 4JFED 4M3JA 3VFUA 1Q9OA 4LIQH 2HP4A 2AJZB 4Z7OF 7FABH 2VXSH 3ROOA 3I2CL 4F2MA 2ADJB 1XF2A 1SVCP 2Y4SA 4OD3H 3FB8A 4R6UA 1MCKA 3F7YA 5GGRY 4POZC 4FQXA 4JRYD 4JY4A 5GGTL 3X12B 4P59H 3RUGF 2BVPA 1NGYA 1WC7B 3VW3H 1YUHA 3F6IA 3F65A 2AQ1A 1E4XH 3B2UD 2YPKB 5HI3D 3QRFM 4JG1H 5GGQH 2ICWJ 4NWUH 1D5BB 3IFPA 3O6FC 4MA8L 4RRPG 4MJ5A 5F7DB 3QDJB 3HE6B 3CD4A 4MA1B 3V5DA 4U3HA 3ESVF 3OKOA 3BHBA 3U7YH 3RVUC 3RIAK 5KOMC 1MAKA 4Z5RB 1YECH 3PHSA 1RZFH 1B90A 2X89D 4QRUA 2HG5A 1E4WH 5ID0A 3ARBC 4NKOA 3BPOC 4IS6A 1XGQB 3SHSA 4MNQE 1P5VA 2QHLA 2KL6A 2YD1A 4X7CC 2NTFA 1CQYA 3QRGH 5I8OH 4K7PH 5JW5B 3ECBA 4PJFF 4R3SA 4PJ9C 2DMKA 3QNXB 4QXUH 4DGVL 1KJVB 4HF5L 4WHTB 5SWZD 1INEL 5I1IH 1HXYB 4KHTH 4KPHL 1XR8B 3KXFB 4LNVA 5E5MA 4DN3L 4QHUA 5IB4A 2XTLA 4PPTA 4HUKB 2GY5A 1FGNH 2MPAL 4FZ8L 5DJ2A 1IGJB 2WWKO 4LDLB 5I6XC 1INQB 1MREL 3ZE2E 2I25N 5EIIA 4LKXA 3QDMD 5I1HL 5JOFB 2PW2B 4G6KH 4LFHD 1XGPA 2NLJA 4DKEH 1CLZH 2G60H 2AXGA 1RIHL 3QUKA 4G9FD 4OI9A 4H20L 1RV6X 2YWZA 5CJ8A 4DTGL 1JGVL 3ULSA 1RHHA 5D7KD 3QNZA 1BBDL 4NSKB 3DO3A 1OT1A 3ULUD 2Q6WA 1ZSDA 2KQMA 1G7IA 2J5LB 4TUOB 1CDIA 4ETQB 3AB0B 1MFCH 4KUZL 1OF2A 3O2WH 1BLNB 4UZGA 5LWYH 3I2CH 4JKPH 4LPCA 3VDCA 1MHEB 1NBQA 4Z7WB 1L6ZA 2BMKA 4PGJA 2X5PA 3QJHA 1TQBC 2H32H 4QHNA 5GGTH 3L95A 3ARZA 1B6DA 3QQ9D 4KTYA 4P5MB 4OLYL 5FKPB 5C09E 3EBAA 5E4EC 4WNQA 2ERJC 5GSVB 4YQXL 3DSFL 4MA8H 4F9PC 3JV6B 4JFYB 4RMQA 4Q6IA 3FO2B 5HPMA 1NCAL 3ZKQD 1JHKL 4JFOA 4APQD 4BH7A 2G2RA 1U3JA 3LKSB 3QSKB 1L6XA 2E8YA 1MH5B 5ALCH 4MCZA 3WIHL 3D0LA 3QFDB 3TBYA 4NOFA 4WDIA 1AC6A 1EO5A 2NY1D 4AJ0A 1NQBA 2AJYL 3TN0B 1W72B 4V1DA 3G5YB 3ARFD 4C57C 4RBPH 4OI8A 4RMVA 1NAMB 2Y25A 4ONOA 4POUB 4PRIE 5EU3A 3CFKB 2H45A 1P7QD 1KJMA 5J12C 4I4WB 3LN4A 3MRCB 4YO0A 3B9KD 4AYFA 4HF5H 3UBXA 1INEH 3S3SA 2NY4C 3WFHA 1T21B 2NY3C 3FAXA 5D1ZC 2CLZB 5DZLA 4Z9KB 4PJBA 3MZGB 5DK0B 4EQ2A 2V2XA 3V6OA 4ZNCD 1M6OA 3K0WA 3O3BA 1G7PB 2QL1A 3D39D 4IOFD 4L29A 1I4FB 3RZCC 4BZ2H 4FZ8H 1NCNA 2XQYK 1WCBB 1UVQA 2X70B 5GS1B 3F8UB 4OD1L 1DEEB 1MREH 4YDIL 5I74B 4DEPC 3IJSB 3V5KB 1ED3B 3CFIC 5IG7B 5I1HH 5CGTA 5DMIL 1MIEH 4JFDD 2QQKL 1CDJA 4O9HL 1WJ3A 3C60D 5DUPL 3VFPA 5DFVD 3J7HA 4KK6D 3UTQB 4I77H 5GZND 3LPWA 3IF1B 2A38A 1CLOL 4KK9D 4C56D 4DTGH 1JGVH 1KIQB 1HCVA 4QWWC 1A7PH 3MOQA 1CD8A 2H1PL 3H7BB 4M7LL 1NGQH 4YHYB 5LGJA 4H26A 3L5WB 3S4SA 3ZE2F 3FQUB 5F1IB 2J3SA 2FO1A 1A7QL 4KTDL 4RMTA 5DGRA 5C6WH 5DRNB 3C5SB 1CGYA 2D0GA 1UXWA 1N3NA 3FT3B 1NLDL 4I8DA 3T65B 3Q5TA 5CJ5A 5C0CE 3VI4F 1J8HD 4TQEL 1LP9F 3IGAB 1UJTA 2AVGA 4CRPA 1TFHA 1CLYH 3H2WA 4G8GE 3M1BA 2PO6D 1K8DB 3LKPB 5C0AA 1AXTL 3BUYA 1HSAA 1AI1L 2R2CA 2YD3A 2VLRE 4LHUD 5BS0D 2VH5H 3JZ7A 5FO7A 2X4TA 2C3XA 2VLMD 5I17B 4YQXH 1AGCB 1XH3B 3IAPA 1YEHH 4XNXH 3DSFH 2XACC 4HG4K 3WLWD 3EOAA 3MLRH 2BFVL 1ZLVK 1NCAH 4GRWB 1KJ2B 4PJCA 3MV7B 3OL2A 3QEQA 1T1ZB 3LKNB 3GK8L 2OSLA 3BGFB 1AH1A 3C08L 1C08A 3KNBB 3ARSA 3ZSTA 4PYHA 2F54A 2AJYH 1X5JA 5F88A 5MP6H 2XN9E 1GVIA 1RK0A 1JBJA 2OZ4A 1RK1A 1YQ2A 3D85B 1IGYB 1JNHA 1HZHL 3OKDA 3FQTB 2GSGB 3CH1A 3K80A 3THML 1E0OB 2GTZA 1YQVL 1EA9C 4GRMB 4MNHA 4TNWK 4ELMA 4WO4D 3QUXC 1RZKC 4I2XE 3AS2A 3WUWA 1W0WA 4KROC 1FLRH 3HUJA 4P2QE 2X40A 4TSAH 4XTRC 1S7VB 4TNVF 4L5FH 4OD1H 4XNMA 4J1UA 3P4LA 4P3CL 4YDIH 4JLRA 4YDKL 2Q7NA 5DMIH 4BH8A 4M48L 2AV7A 1DQLL 4P9HC 4O9HH 4YGVA 4JFQB 3CDCA 3KLSA 5DUPH 2R1WB 1MHPL 2VDRL 5BZWA 3MGOB 1K8IA 3O4LD 1AFVL 4XXCC 3Q1SL 4LVOC 3GBLA 4I9WE 1CLOH 4Y4HA 4HKXA 4X8JA 1QNZL 3E6HB 1MI5A 1BF8A 4WWKC 1MRCL 4UOJA 2H1PH 1F58L 3O9WA 3T4AA 3VI3E 4PJ8A 3QIUA 1M4KA 3DBXB 5F7NC 4N0RA 1A7QH 3ZTJG 4ZTOL 4L3EA 3DXAE 1CICB 1VENA 2Y7QA 1A3QA 2W9EL 1TITA 1DQJA 1NLDH 1ZT4B 1F3DH 1FFPB 3QP3A 5DJYA 4J3XA 1G7LB 4MDJB 2HTLC 3PIQB 1ZHKB 3ULVE 5BV7B 3MLZH 4GAYB 4DW2L 2VMFA 1A3LL 3B6SA 1AI1H 5IGXL 3KPPB 1EXUB 2EYRB 5EU6E 1EK3A 2KDGA 5EC2A 3MRPB 1CCZA 3KYKL 1EHAA 4NJAL 4ORGA 1IRAY 1OTUC 1BVKA 4Y16A 3WLBA 1HSBB 5F6IC 2VE6B 1FAIL 3UMTA 4Y1AA 43C9A 2X9WA 3W5MA 4PV8B 3GK8H 5GGUA 1V05A 4AENB 3OHXB 3C08H 1EX0A 3IETB 5KG9A 1DTUA 3TPUA 1MF2L 3CDGA 3MNVB 5DJ6B 3O4OC 1U8NA 4D9RD 3T2PA 3JSSA 2ZCHL 4XAKD 3OKKA 4UT7L 4OUUB 3T0XA 3THMH 2A6DA 1MHHA 5DJZB 1N5AB 1OTSC 4KAQL 4MXQC 4Y19E 5HDLA 3LKOA 3NVQA 3QJFB 4XX1E 3SCMD 2WLZA 3C6LD 1S7WA 4Y5XB 5EBGA 4UDUB 4YIQB 2BY3A 1CXEA 3Q6FB 5IV2A 5I8CA 4ZUSA 3Q48A 4S1QL 5FDYA 1HDMB 1SYSA 3S98A 3HN3A 3DYPA 1CE1L 3D2UD 3DVIA 5DEFA 4HWEH 2E6JA 4WTXA 4V2BA 1QFWM 5I15H 4YDKH 4JG0L 1CLCA 4M48H 1I1AC 5JW4N 4FNLL 3MLWL 4OIBA 1DVFD 2BERA 2VQUA 3QO0B 2EE3A 2JKXA 2J8OA 3OB0K 5B8CA 3Q1SH 3WFCL 2A0LD 4U1NB 3WN5B 4JPWH 1A64A 1MRCH 1YYLL 3JWOL 1ACYL 1F58H 2X4OA 1H8NA 5I9QB 5K9QG 3CXDL 4P5TB 1EZVY 3T4YB 3RAJH 4G6ML 4ZTOH 1FFOA 3ZT7A 2VL5B 4S2SA 4BFEA 3TIDB 1A6UL 3P4OB 4DKFL 2V9TA 5T5NF 2ZUTA 5FGRA 5A1AA 5DMKA 3DV6B 4R7NA 4LVHB 2ZSWB 3T09A 2FO4B 5LAXB 4QTIH 1G6RA 1A3LH 2GFBB 5IGXH 3VI3F 4KRPD 4FQXC 3MRMB 3G5VA 1JZ2A 4HQQL 4XB7A 3FFDB 3SDXA 4F7CA 2A83B 2WSKA 3DHJA 4MQSB 1AO7B 3WD5H 2CDEA 1PW3A 2H9GB 1RULH 1PLGH 4NPYB 3IXTA 3M07A 4Z7UB 5JIKA 5ID1B 4HGWA 4NRZA 3GI9H 3MJ6A 4JM2D 2AJXL 4WU7B 1V7NH 3CZFA 4NOBA 4NQDD 4I3SL 1YZZA 1BM3H 3MV8A 3SBWA 5TE7L 4FQIH 1JZ8A 3CVHL 1MF2H 1S78D 4JDVB 4XCEB 3WIFB 4NGHH 4HUVB 4JZNA 4LLYA 5E1AA 3VXSD 4LLUB 1QEWB 1CGWA 4PJAF 4BK5A 1DCLA 1T22A 4FG6D 4N8VB 4UT7H 5F9WB 4JZOA 4KAQH 4DAGL 2Y1VA 4LARL 3SKJH 3NZ8A 4PRHA 4PRPA 5AZEL 1WICA 1F6AB 4PJ5B 3NH7H 3BGMA 5JMRA 2V5TA 3D3VA 3BKJH 5DYOB 4Z7VB 1OT2A 4XPBL 3P9LA 4XC3L 4S1QH 5JDJA 1NMBH 4OZIB 4J4PD 3IDJB 1QRNA 4ZFZA 3VFVB 1JWSA 1AGDB 1CE1H 4WV1B 3MBXL 3V6ZA 1BOGA 1QD0A 4PBVC 1U8LB 1V8HA 2ZG1A 3WHE1 5IMKA 1UZ6E 4Q9BA 4JG0H 3HMWH 1EDQA 1Q0XL 3MLWH 1EVTC 1KPVA 4HPYL 1SJEA 2D3VA 2YSSA 5JZ7D 3WFDL 3VXMD 2DQUL 4DFIA 5D6CB 1X5XA 3UAJC 1GL4B 3S37L 2X4SB 4XNZC 3EYQC 4Z0XA 1HH6A 4GW1B 1WZKA 3JWOH 3GSRB 4EVNA 2PYFA 3CXDH 4HIJA 3WXVL 5ACLA 1JPST 3MA7A 4ALAH 5FXCH 2LU4A 3HLAA 4H0HB 1AKJB 4FQHA 1A6UH 4S1RL 1KENL 3OKEA 2BOCA 4N0UA 5FB8B 2BP3A 1B2WL 4PRBB 5J1AB 1R5VA 1S8DB 5FOBA 4MAYA 1TZGL 3BQUB 3FT4B 4NQSB 4P2OA 2ESVE 4ELKA 3CPLA 3S37X 2XTJC 5T5NG 1YA5A 4UILH 2ITCA 5EBMB 1J8KA 3GSVB 5HHXL 1RSFA 5FYJL 1ZE3C 1N6VA 5IHUL 3LQAL 3VG0L 1ADQL 4CN4A 1E6JL 2CXGA 4HDIB 3MYJA 4FQ1L 2XA3A 1W2KT 5HVGB 1I7RB 4XCNB 1A4KA 1RZJC 3QG7H 4Q6IC 4HV8B 3GHEL 2XTJE 4NQCA 4I3SH 3ZZ1A 4O00A 4OAWA 5TE7H 5T3ZL 4I5BA 3WCYA 1OAYL 3CVHH 3BVNB 1ZHBA 3P4NB 3DNKA 4U6TA 2V9QA 5TPWL 1TJHL 5B3JE 5EO1B 4WFHE 5DJAB 2Y5TB 4XCFH 1VKXB 3VH8B 4MNGE 4DAGH 4LARH 3MRRB 4RGOL 1LEIB 3RWJA 4M9OA 5AZEH 3G6JB 3PWUB 5I73B 3L3DA 2DLIA 2VWEC 5ICZB 1HHJA 2JIXA 2Y9RT 2R9HD 3D0VB 4XC3H 3C2AL 1ZT7B 2OXHA 4K23L 2FX9L 4ODUB 3BDYH 4V1DE 3MBXH 4R2GD 1T66C 3V6OC 2EE9A 4P3DB 4BJLA 1F3JB 1ZLVH 4AMKH 3BZ4A 5KSUB 1X5ZA 4M62L 3MREB 1Q0XH 2D7MA 4HZLB 1U58B 2FATL 3CX5K 3QH3B 4D8PA 2VWEE 2DD8H 1RUKL 4XX1G 1BECA 1T7VA 3RWCB 5JUEL 1HQRA 1CF8L 4TVPL 2FJHB 2XNAA 3V6OE 1NEZB 1Z9OA 2ZZUT 1AQKH 4KWUA 4F7MA 3EYSL 4EN3B 1R3IL 1ZLWK 4OSUH 3TYFB 4JN2A 1BGXL 2P24A 1KENH 5D7IB 5I2IB 1T5WA 3PL6B 2P1YA 2LABA 4D0DA 3TNMA 5EN2B 3H9ZA 4UQ2A 2BRRL 3IDIB 4YR6B 1XCTB 1DUYA 5HHOB 1AY1H 4Y4FD 1R3KB 3I6KB 4XT1C 4ZS6D 3CAFA 3UTTD 3S88L 2F53B 3F5WA 2CKBH 1NCWL 1MFAL 4I18B 4K9EL 4I0KA 3NFPA 5IHUH 4MD5B 2CIIA 3LQAH 3VG0H 2V5SA 2XY2A 2QSQA 1E6JH 1V3KA 1GGUA 1QSFA 2FR4B 4FQ1H 3NIFF 2IG2L 3VMNA 5DHYB 1IM9B 4PRDB 2Z31D 3GHEH 1AXIB 1KNOB 5EULV 5T3ZH 1OAYH 4ODHH 1FCGA 1LD9A 4OKVB 5C0AE 4WFFE 4OV6F 2DQHL 5IB1B 5TPWH 1GZQB 1TJHH 4BFBD 3LRSB 3UCRA 4WHCA 3QO1B 4HJGB 5KVFL 3MLPA 2IPKA 3MLSL 3T3PF 1FLTX 3FCTB 5EUOB 1FAKT 4CGTA 4X9FA 1FL5B 4JO4L 4PJCE 2R1YA 4ESKA 4Z7NE 2V9RA 4G43A 4HAFA 3QEQE 4HK0B 5I16A 5EWIH 3P40A 3VD3A 4K23H 1D9KA 2FX9H 2F54E 4DN4L 3FB6B 1E4JA 4OQTL 1KPRA 1Q9LB 2VNCA 3QULB 1OGAB 3HAEB 2FHFA 3KPMA 4KJYB 4YBLB 4LDOB 3M8OL 2FATH 4NQXB 3O41A 1XF4A 4GS7B 5DVNA 5E8EA 3MGTB 3VFOB 5J89A 4GXVL 1KPUB 3FRPG 4P4RA 2VLLB 4MJIB 1TQCB 1UH2A 1YEFL 4PS4L 3MO1A 2D7OA 4NJ9L 3G04B 4ZNEE 2DQFA 4U0RB 4N0YH 5IP4A 1RURL 3AMLA 1J0IA 4ELME 1NJ9B 1CF8H 1FZMA 4JFEA 4TVPH 2Z8SA 3GDBA 2A73A 3NCYP 3OGCA 1QLRB 3MRQA 4WEUD 2V17L 4Y4HC 3VXOB 1WQVT 4P46D 5LQBL 5D7SL 4JPIA 5HYSA 3O9WC 1BGXH 1LEGA 1FNEA 4PJ8C 3QIUC 2VAAA 1IM3A 2HVJB 2FX8L 5C08D 1CZ8H 1EGJA 1RFDL 3HCVB 1XF5A 3BZFB 4MMXC 4EXKA 2XWBB 3V52H 1YEIL 1Q9WA 1B9ZA 1TPXB 3ZSSA 5JOPE 4OZGF 4KXZH 3V4VL 4XBGA 2UVFA 2P5EB 4MQXC 5E9DB 1ZVSB 4JAMA 5C7XL 3FQNB 4R4ND 4JRXD 1NCWH 1MFAH 2XQBL 4PLJC 4YC2B 3OKYA 4K9EH 4PP1D 5DJCA 4ZOBA 2XWTA 1I8KA 2NX5E 2OJEA 1U8KB 1BWWA 1JJUA 4H25A 4L3EE 2H8PB 3BD4A 1UJ3A 5DC4B 5DUMH 1Q72L 2X89A 4Y16C 2EYSA 2N56A 5EZLB 4CNIA 2LV4A 3HPJA 4L8CB 3PWVA 3CU1A 1AIFB 5L7XL 1IJ9A 1K6QH 3FB7A 5K9OB 3DI3B 2DQHH 3U7WH 5I76A 4J6RH 1MVUA 3B9VA 3MLSH 2P5WE 4YXHH 1MUJA 3HR5B 4TNVK 3RWDA 2ZG2A 5SWZA 3U4EB 4YDLB 3ALWA 5INCB 1GGBH 4JO4H 2EIBA 3H9SD 3T77A 5CLWA 1NKOA 3VGAB 3G6DH 1QLFA 1CVRA 4Y1AE 5E2VL 1YEDB 4JFHE 2IAND 2MHAB 4GG8A 3KLDA 2IC2A 4MA3B 1QA9B 5GRZA 1MCPH 2NW3A 2BNRD 4FA8A 1W0VB 5T3ZD 1CD9B 4DN4H 2EZ0C 2JCCA 4X4ZA 3QDMA 4P2RB 5DJ0A 2X7LA 1UGNA 5EDXA 2R0ZH 1HHHB 4GXVH 4DZ8A 5F7DA 4FQLH 4C55A 4XBEH 4G9FA 2ZP0T 1UKQA 5AAWA 4FTVD 35C8H 5DDHA 1G0YR 4LNRB 3RWFA 5MI0C 3D25A 3F12A 3QFJB 4GKSA 2OBGA 1D5IH 1RURH 2O5ZL 1L7TL 3JTSA 4OLZH 1FG2A 5B8CC 5INDB 1SEBA 1DLHA 4OZFA 1FBIL 2V17H 5TQ2H 1EBAA 4U33A 1I3RA 3P4MB 1FN4B 1DBBL 3TIEA 4AM0A 2F15A 3IFNL 32C2B 2FX8H 4NQTA 1YY9C 1YJDL 4OZHA 4J3UA 3PP3K 1JTTA 1RUAH 3X14B 2ZPKL 2HT2D 2NYYC 4Y8DC 3MJ8A 2VKWA 1HXYA 3V4VH 3MRKB 4GKZB 2VXVL 3LEXB 4XI5C 1T1XB 1XR8A 5EPMB 4RGNB 5D2LB 3TEUA 3E6FB 2A6JB 5HHMD 1ZHLA 3WE6B 3K1KC 2N4IA 4A6YB 4APQA 4TVPD 1BEYL 4K3EL 9CGTA 5C0EA 3ARED 3OXRA 2PTTB 4X6DF 3B2VL 4PG9A 4QGTA 4EEEA 1U42A 2BSTB 2Z8RA 3T3ME 3SDAD 2VDNH 1WEJL 4Z7QE 1T20B 4LLDA 2XA8L 3PDOB 2X4NB 4RX4D 2R8SH 4LSUL 4Y2DB 3PG2A 4LHJB 2RAMA 4Q9QL 4BQCA 3ALXA 2DQDH 1U2HA 3BPNB 3SBWC 2GQHA 4DK3A 3TO4D 3QDGD 4NSKA 3B9KA 5KSBF 1JWMB 4JPKH 5JR1L 4J8RB 4IMLA 3O8XB 3S96A 4MB3A 2HVKA 3AFLA 3ARDD 5E2VH 4PREA 2EE2A 4ODVH 3D39A 1RUMH 5HHVL 4G8EA 2F58L 1GGTA 3MV8E 5C0FA 4NN7B 4I0PB 5J6GB 3OKLB 4PJXA 4KKNA 1DEDA 5ILTH 1QACA 3VGFA 2A6KA 5ICYB 2BHYA 3NCEB 5K59E 5GSVA 3GKZA 1V5JA 4KKBD 3C60A 5E8NA 1U41A 5DF0A 1DANT 4QGYA 1FV1A 1A6VL 1JN6A 1NUDA 4PRHE 1X5HA 4PRPE 4C56A 2ADGA 5KAQF 1IGTA 1NBYA 3D1MC 3VWJD 3QFDA 3G6AB 1L7TH 4EUPG 4DCQB 5I18L 3DECA 5FO9A 1S9WB 1Z9MA 1AD0B 4ZYKB 2BVTA 4JY5L 5F6HI 1QRNE 5DD3L 5TF1H 5M94B 3QUMH 1DBBH 1N64H 1WBXB 4HIHA 1J8HA 2I9TA 1NAMA 3IFNH 5DQDL 1KIPB 2MSPA 2PYEB 4BSVB 5FCUH 3VXQA 1YNKL 2PO6A 2BRQA 5F9DC 1TZHB 4GRLD 3BWAA 3RUGB 1VHPA 1B88A 1FNAA 1T21A 5BS0A 1YEEL 3QPXL 5F97E 2EE6A 4KJWC 4L9LB 4NZUH 4MAYC 4JFFD 1VPOL 4P2OC 2VDQL 3FQRA 1PEWA 1TVBA 3RP1A 5KSAB 4XWOC 4IRZL 5MENB 1I4FA 1CS6A 1BEYH 4K3EH 1UCTA 1WCBA 4IRSB 4HIEA 5IF0B 1UEYA 4HKJA 5TDOB 3UROR 3NOIA 2AEPL 1JIBA 2VXUL 4JHWH 4KJPC 1MCBA 3O11B 3V5KA 5IG7A 3GSWA 4AIZA 1OB1B 4ORZC 5C0BD 4K3JL 1QUNA 2X1XR 4XZUB 1WEJH 2H32A 5GGTA 4CU8A 4WU5A 2DQJL 1JTPA 4DUXA 4JKKA 3C5ZD 3BRDA 4YPJA 3HG1B 1KIQA 4PJFB 3H9HA 3GHBH 1ZLWH 4LGSB 1KIUA 1J0HA 5HHNA 1VERA 3NFSL 3RGVB 2VYRE 5FGBA 3QXVA 1ZHNA 5E4IA 3DX6B 5F8RC 4X5WB 5DRNA 5IMOA 1LHZA 3HI5L 1N8ZA 3SO3B 4WO4A 4NDMA 1HYSD 4CVZA 1F4HA 1YNLL 3GBNL 3SQBA 5I8EA 4UAOB 4ONFL 2V7HA 2F58H 3JV5A 4NQCE 4HFWB 1LE9A 1U3YA 1YMHB 5E2UL 4L3AA 3UTSB 1I7TB 4L8BA 3EDDA 1Q8MA 2C1OB 3VFNA 4RMRA 4ZG1A 1XH3A 4PJ7B 3R06B 3LIZH 2DI9A 3LS4L 1L9NA 3EYVB 1A6VH 3MV7A 1ITCA 3WIIL 2RB8A 3EYOB 5IB5A 3GSNH 3DRQB 3SKMA 5GZOD 2NY5C 1LO2L 5I18H 3HS0B 4JY6A 2RCSH 4HHAB 4KMTL 5DMYA 4JY5H 5I66B 1KB9J 4E9LA 2GJ6D 4LLVB 5DQDH 2KZWA 1MY7A 4XVSL 1INDL 3MRGB 1YNKH 1P1ZA 3RPIB 2BSED 2YD5A 2ZOLA 3MRNB 1PKQB 4PY7A 4ONGL 4FXKB 5T33L 4QCIB 2OTPA 1YEEH 4RFEA 3B4NA 5ESVA 1WISA 3HB3D 4PJIE 2VDQH 4KC3B 2I07B 3QA3A 4G80A 3LHPL 4JKLA 1MRDL 2C4XA 3FB5B 4IRZH 4Q58C 1SJHA 4FQ2H 3CIQA 3B5GA 1S5IL 1YDPB 3EOYG 3Q3GA 3QZWB 3SDCD 1P4IL 2VXUH 4JFPB 1I3UA 4M61A 2W60A 1CXIA 4RA3A 4BQ9A 3PWPB 1JGEA 1CG9A 4LVNB 4PJEA 5DJXB 2V2TA 3E6HA 3U9PH 5DFTA 4WGVB 5HY9B 3R8BB 4CW1B 1OAUH 5GHWL 1MQKL 5HYEA 3NFSH 3SCMA 1ES0B 1P2CB 2CPCA 3C6LA 2ARJQ 1ZK9A 2BY2A 2N7BA 2QR0B 1QSFE 5IVXF 3HI5H 1ZT4A 3EKCA 4XC1L 3WIHA 1YNLH 4P2YA 3ZKXB 1G7LA 5DRXB 3U7AA 2DLTA 3HE7D 4ONFH 2NXZB 1L7IL 3D2UA 3GJFH 5E2UH 1LO3L 3TA3B 1EJOH 4UOW1 5TDNB 1B0GA 4IRJD 1D9KC 1DVFA 1I7UA 1U91A 1V3JA 3DTXB 3C6SA 4H1LG 6FABL 2VOTA 3LS4H 5TDPB 4E5XA 3I6GB 1HSBA 1MCOH 1YPZB 5M7QA 4X6BA 1TZIA 2GTWA 3CMGA 5ENWB 3OHXA 3D18A 3KPQA 3IETA 1A9EA 5CD3A 1IT9H 1R0AL 4I3RH 1WZ1L 5ITBL 3OX8B 2R56L 2WWMC 1U8MB 3JWDL 3S5LA 3V4UH 4HXAL 1HHIB 4XVSH 1LP9B 3TZVB 3AXLB 4JDTL 4OUUA 1H5BB 3RI5F 3QCVL 2R2HB 1JPTL 3QCUL 1NSNL 3INUH 4ONGH 5BVJB 2FZ3B 3MBEB 1I3VA 3GJEB 1ZTXH 1Z5LA 4U1HA 5GRWA 2HH0H 4Y7MA 3B2UC 3IT8D 4XPGL 5HI3C 1KYOK 3EW3B 5ANMA 3GMLB 43CAB 3BXNA 2FDBP 3EOBA 2VIRA 4WW2F 3SJVD 2J12B 1S5IH 1BQHB 4JM2A 5ITFB 3T0ED 4PJGF 1A02N 3MOAL 3KR3L 4NQDA 4QRPE 4HKBB 2AJSL 3RVUD 1ZLSL 2X4UB 1LDSA 2DJ4A 3CUPB 3GMNB 4W4OA 1ND0B 2Q8AL 4Q9RL 1UJ3C 3QO0A 2F8OA 2HJKA 2FHBA 1QBBA 1HILB 3WN5A 1LGVA 4RAUB 4QY8B 1NLBH 5HHPB 2K9UA 4OCRL 1NGPL 5L88L 1YNTB 2ATPB 4RQQB 5T1LD 3CVIL 3IVKA 4PJ9D 5GHWH 3T2QA 1MQKH 4QRSA 5SWSD 3PP3H 3VXRB 5CEXA 5AYQA 5DI8B 4UU9B 4URTB 3P4OA 2AXFB 4M7JL 4XC1H 1I1FB 5DS8B 3MROB 2WK2A 3HC0A 1I8LA 1GAFH 4R4FL 1L7IH 3SGJA 1R3LB 3MCKA 2EDYA 3GSOB 3ARXA 3FFCB 2FO4A 5CIPH 5LAXA 1LO3H 4UQ3B 5KANI 2F9BT 3AROA 5GRJH 3GGWA 4NKDA 3PDDA 4O2CB 4XP5L 5L8LB 2NZIA 2WBWB 3FOLB 3OJVC 3FMGL 4HEPG 4OTXH 6FABH 3VXMA 3QQ3B 5I1KL 3HRZB 4PP2A 3K7UA 1X5AA 3KVQA 1VFMA 4HZAA 3WHE0 3GB7B 1U6AL 5AUMA 2NY7H 5JORA 3GBMH 3K8MA 1QQDB 4JDVA 1R0AH 1SBSL 3WIFA 3ULUC 1BZ9A 5ITBH 1PQZB 3JWDH 5TE6H 3RWEB 1MCDA 2CQVA 3TO2A 3O3UN 4JDTH 4X7SH 3QCVH 1EIBA 3VGDA 1NSNH 2YHGA 4NC2B 1FH5L 4G9FE 5CGYD 4Y89A 4OLUL 1ZWIB 3Q2CA 3UPRB 5IMMB 2AAVA 3QQ9C 2X1OA 4ODWB 4XCCL 3ULUE 4LSTL 1URLA 4NCC1 4LEOA 1A9BB 3PHOA 3DUHA 3EFDL 3IDJA 1WAAA 3LY6A 4UNTA 3VFVA 1AGDA 3DVGA 3T8XB 3GSQA 4KKAD 1TIUA 5MEOB 3UTZA 1JYWA 3ARGD 4APQC 3N1QC 1ZLSH 1K4CB 1A7NL 1A1OA 1RZKH 1Z0MA 2XKNB 4OZHE 4X80H 1PDKA 4PRNB 4Q9RH 3WO4B 4KQ3L 5CJOL 3IJHA 3DX8B 3MRFA 2D0HA 2NY1C 2R2EA 2AKRB 1M71B 4HKZB 4LCYB 2J2ZA 5E99L 1LO5B 4U1JB 4YHOH 2BSRA 2X4SA 5I75C 2BNQB 1QLEH 2EEDA 3IDXH 1WWAX 3VA6A 4LCCA 3NA9H 1NGPH 4PUBL 4X6CB 3CVIH 3V9FA 3L7FA 4LK4A 2YUZA 1MLCA 3ULVH 4LIQE 3B9KC 2NY3D 3QIWB 4QLRA 5D1ZD 5JHDD 4LLAA 4M7JH 4OB5H 1VADB 3LKRA 4HT1L 1GGIL 2X2YA 3HC4L 3QWQB 3H42L 1AGFA 1FZOB 2JJTA 4XCYA 1HYRC 3ET9F 5GQBA 3RX7A 3VFTA 4CMMA 4YHML 4F9LC 2VSDA 1XIWB 5EBMA 8FABB 2NY0D 2B20A 4RZCB 8CGTA 1UM6H 2XIDA 1UQSB 3BMWA 4XP5H 1BREA 2E7CA 1IZKA 2NY6B 5FEBA 1IAII 3GSXA 4B7LA 4XBPB 3C60C 2ZUUA 5DFVC 1CD1A 2WBJD 5EOCJ 4KK6C 4HULB 5HTSA 3E1F1 1R3HA 5GZNC 1KIRA 5EB9A 4KK9C 1UM5H 3D39E 1ZGLM 3TLRA 1KT2B 2VLRD 1KC5L 3LDBC 1SBSH 2A1WL 1X7QA 4ZUWA 5D7JD 2QHRL 1I1RA 3W9EB 1G0DA 1PGRB 1NL0H 4JCLA 1FYTB 5F3BA 4B5EA 4KY1L 2Y5TA 3WJLA 4WTZA 3IB4A 3WFEL 3DPBA 2AK4B 2AJVL 2G5RA 3LQZB 4JHAL 2OR7A 4Y4FA 4MCYA 3ZDXF 2PO6C 4U6VH 4ZPVB 2JELL 4XCCH 4LSTH 5C71A 5FYLL 5DK2B 5KVGL 4N9OB 3EFDH 4ODUA 4XWGL 3BYYA 3U0WL 3WLWC 5FKAB 2Z31A 4F7PB 3VXTB 2Q20A 5KSUA 1OWWA 2OCFD 5BVPH 1A7NH 4M8QA 2PR4L 1RUPL 4HZLA 2EKSB 1OAKL 5E56A 4KQ3H 2VXTL 4JCMA 1KTDB 3NBNA 2ITDA 4GSDH 5IHZA 1MVFA 1BFOB 1C16B 5BS0E 3BP7B 5E99H 2X1WL 3O3AB 2IFFL 4P2QD 2DKSA 2APTA 4NIKB 1A22B 2O5XL 1YN6A 5GXBB 3F7PC 4CADA 3LKQA 2ADIB 4EN3A 2YN3A 3SGEH 2AABH 1I9JL 4UBDD 4HT1H 5FGBC 1GGIH 3ZE0F 3HC4H 3FAWA 3PL6A 4TUKL 4LRNL 1ZA3A 5D1QB 3RZWA 3CVHA 3W2DH 4WO4C 4WI9A 1XCTA 2O5YL 3SOBH 3SE4A 4DOHB 2FLRT 1R3KA 3I02A 1UH4A 4YHMH 4QXGL 2UYLB 5C0GA 4WUUB 2RQ8A 3TWCL 3MLTB 2GUOA 4G6FD 3WEXA 1BF2A 4KDTA 1RJZA 3DX9A 3QAZB 4ODTH 3VRLF 4M1DH 1S9VA 3UX9B 4MD5A 4LLWA 2DJSA 1R3JB 3QG6A 2FR4A 1YN7B 4YHIA 4Y5VA 3ULVD 1Q9KA 4QXTB 1CFTA 5I1GL 1J9CT 1AXSB 5EU6D 4IJ3C 3AU1B 1A7BA 1ORSA 4NHCL 4YBQD 5IB1A 4HW6A 5J06A 5F70A 3C09C 5C08A 5DURB 5E94B 3LSOA 4ZOEA 1UXSA 4KY1H 5BXFB 1GPOL 3WFEH 4Z8FL 2HTLD 3I9GL 4M5ZH 4JHAH 4FFZL 3H3BC 2JLLA 4Y8AA 5IM7B 2GAZA 4Z7WF 4HSQA 3L7EA 4GRWE 4LU5L 3P73A 2RGSA 2E7BA 3MV7E 5ERWB 4HX1A 2APWA 1DLFH 1OSZB 1VFBA 5F96L 2IGFL 2JELH 4XP1H 3GI8H 3RVXD 5FYLH 4L3CA 4K8RL 2EYTB 5IW6B 5DMGD 2FH8A 4R7DA 3GIZL 5KVGH 5HGGS 4NZTL 3AS0A 5J0BA 4N0FA 3GNML 4M93C 4XWGH 3UTPD 4PGEB 4JEGB 1OPGH 3BEWB 2PR4H 1RUPH 3PABA 4NQXA 3MRLA 3IKCB 4UT6H 3C5JA 1KPUA 1QBAA 1WZMA 3TBWB 4X9GA 3O3EB 5JW3L 5H94A 1PYWB 3D5OF 4L8SB 4ZFOL 2Z4QB 4Q2ZA 3GMMA 2IFFH 3X11A 1HXMB 4LPYA 4X7DC 2DLEA 3HHRB 1ADQA 2EDFA 5HXMA 1RU9H 5FK9B 1XF3A 3LMJL 1EFXA 4XXDB 3KLAA 4ZTPH 1ODAA 1XAUA 2IANA 3SCMC 4JZJA 4E42A 4LF3A 1N2RB 2OL3B 4TUKH 3C6LC 4F57L 4LRNH 2BNRA 5DD0L 5DRWB 3D87B 4BSWA 4XGZB 1OTTD 3PE9A 3ILQC 1DDHB 4U1GC 2DWDB 2O5YH 4RIRA 4OCSH 4R0LA 1BFVL 2D0FA 4M6ML 4KMLB 4KV5E 5H2BB 5JO5B 4F3FA 1QFWL 4PJEE 1ONQB 3FQNA 4X4MA 3HKFA 1LVEA 1BP3B 5DJDA 1OGTA 1I1AD 3UZVB 5IQ9A 4WI8A 1OAXH 4XAWL 4GW5B 4YNYB 4N68A 4BQ6A 4P5KA 4FTVA 3OSKA 1DVFC 4R4BA 4OLWH 2H8PA 5MHSD 4QT5A 2IMNA 4MVBD 2J8UA 5HVHC 4MZ3A 2R4SL 4AT6B 3DYOA 5DJ8A 4MSWA 5I1GH 2A0LC 2J8HA 3C8KB 3EZ8A 3RVWD 4YFLF 2YC1B 5KSVB 5KS9A 1WWWX 5EZIL 3HZYA 4BELD 2BNUB 1SVZA 1T4KB 4IEFB 1S5HA 1RZJH 4G42B 3S36L 3BZDA 4BQBA 1DANU 4PGZA 4NN5C 3SKOB 4YK4B 3GMRB 5AYUL 3U4EA 1BBJB 4FFZH 4OGAD 4WI2A 3N06B 2W9DH 3KPSB 4P23D 2P8MB 4WHYG 1ZS8B 4DUVA 4UB0L 5F96H 1FFNB 2IGFH 3NCYS 4KRPC 5FO8B 3DLQR 4AK1A 4JVPA 4K8RH 4XRCB 5D7LB 5ETUB 5JW4M 2Q3ZA 3GIZH 4MA3A 5GGSA 2ZSVB 3AREA 1RMFL 1LE5B 3GNMH 5E8OA 3B43A 5DR5L 1KB5L 3IAQA 3CFEB 3U46A 1UT9A 3KJ4B 5C0RL 4NNPH 3SDAA 4GRWF 5KN5B 2ZKHL 4RX4A 4JM2C 2XT1B 4Q0XH 2HLAA 1HHHA 1D6EA 1IEBA 1B0RA 4WFED 4M7ZC 1XZ0A 4ZSOB 2VB5A 5JW3H 2WP3O 2MCPL 1S78C 1U8QA 4W4OC 5CJXA 5L9DL 4PGDA 3TO4A 3QDGA 1QFUL 5F9JA 3HZVA 4ISVA 2PCPB 1JF6A 2ZUSA 1JVKA 2P4AB 5ANME 2YUXA 5FYLD 4FG6C 3WN5C 2IAMD 3VFGL 3BPLC 1M7DA 1NFDA 1SEQL 2PXYD 3ARDA 4WENB 3PWLB 4NYLB 5I9QC 4F15C 5HDBE 1UACH 2J7LA 4NQDE 4E41B 5DD0H 1AGEB 5HI5D 1I8MB 1Q94B 4U6XB 1EV2E 5EUKB 4IOSD 1I8LC 4RRPA 3BH8B 3SGJC 3LEXA 5D2LA 2YMXH 3IJYB 5HDOA 2XWJB 4JANB 1FVEA 1OD7A 5JW4Q 4Q7DA 3WSQL 3RI5K 4EI6B 1EH9A 3VWJA 5JZ7C 3HZMA 2PW1A 4XVTL 3UAJD 2ESVD 3SDYH 1DBKL 5DK3A 1YYML 1YMMD 3OR6B 1NDMB 3ES6B 4M5YL 1C7SA 1AR1D 1JPFB 4AEFA 3PDOA 1R5IA 2MCG1 4OQTA 3E0GA 3FQWA 3JWNC 1M1SA 4YH6A 1FRGL 3OR7A 4PD4J 3ARWA 3S36H 1JNNH 1GCFA 5IT2H 4LCWD 1PZ5B 2K3TA 5AYUH 3HPLA 1KOAA 3EJJX 4PIRF 5B39A 5F1NA 4J8RA 5CSZB 1EHLL 5JXAL 4JFFA 3NCBB 3SY0A 4DVBB 2X1QA 3T1WA 4FMKA 1SMAA 4KK8D 4N9GB 2VSCA 5ISZD 2ZCLL 4UB0H 1BFTA 1UB6B 1KFAL 1DE4B 2P8LB 4KTEL 1JPGB 2GITA 2FSEB 1QG3A 1RMFH 2QQQA 3VDAA 4WFHD 1JHLL 2E9JA 3L3HA 5DR5H 2G9HB 2VXQL 3H7LA 4RFOL 3MR9A 5DD6B 1G7HA 4MXVF 5C0BA 5C0IA 5C0RH 1ZLUK 3TF7C 2G75B 1NC2B 2HFFB 3HR6A 5IW1B 4YHPB 2Q76A 4NHUA 5L2KB 4BYHA 1KCLA 3C5ZA 1MNUL 4PY8I 2P47B 3OAUL 4K3GA 1MRFL 2MCPH 3T0DA 1HEZB 5L9DH 1G9ML 3E8UL 2SEBA 3VXUB 2QSTA 3B8SA 1QFUH 3PNWB 4PJ5E 4IDJL 4Z77B 4TVSa 4LSPL 2DLFL 4Z7VE 4K8RD 4JKMA 5IIEB 3IRPX 4LCCC 4PB9L 1SEQH 2B1AH 2UUDK 1I85A 1UFUA 4LSRL 5EIVA 1RHFA 2PYEA 4N90E 5CBAB 4U1MB 2RFXB 3RUGA 2R9HC 1KLGB 3BIKA 4JGUA 1FNFA 2X9YA 5IEKA 2AI0L 2JJTC 4R2GC 2A9NH 1P4BL 1WBYB 5E6ID 1NBZA 4NO0B 3EIFA 3VFSA 5KSAA 3VE0A 4BFIB 1CR9L 3MV9B 2P7TA 5EC1B 1RZ8B 2Q7YB 5TFSH 4MXWL 3X17A 4IRSA 3NA4A 3ZKMD 2FBJH 5IF0A 2ZUWA 4HWZB 3HUJF 5CD5D 4AEIL 4XVTH 5HGHA 1DBKH 1MAML 1YYMH 3STLA 2VQ1A 4M5YH 3H0TB 4EIZC 3FTGA 2YD2A 5LCVL 4DQOH 4HMDA 3NFNB 1JK8A 3G5XA 2GJ6A 5IFHL 4K71B 3L3OB 5A3ID 1PY9A 2GIYA 1FRGH 5F7WC 2YD6A 4KH2A 3NIDF 4PJFA 1FZKA 1U8PA 4M1GH 5J6HA 1JYNA 2VUOA 3GFUA 1QBLH 2YD4A 1W8OA 2ICWB 2ENSA 1MHCA 1EHLH 4V2CB 3RWIB 1N0XH 3U48A 3DX6A 4YEEA 4X5WA 4UUJB 3WJLC 5JXAH 2ZCLH 1BZ7B 4Y4FC 2NQCA 5GSRA 3L3KB 5SX4H 4ZS6C 2KKQA 4WFFD 1U95B 5IEHB 4HFWA 2DMBA 5IVNA 4J2XA 2D31B 1KGCD 4HBCH 4HGMA 1KBGH 1JHLH 5F9OH 4RWHA 3JWOC 3SDCA 2QBWA 2VXQH 4RFOH 1IC1A 1U0QA 2P8PB 1XGTA 4R96B 2NZ9D 4EI5D 4Z7UF 3GUTB 2Z31C 5FGCB 3QEQD 5E8PB 4ERSL 3EYVA 5IKCB 1F11A 1MRFH 1S3KL 3I85A 1S7QA 1UKTA 1G9MH 2FJGA 3G6JE 1K4DA 4RDQF 3MLYH 4IDJH 2F54D 3DRQA 4LSPH 4IHOA 4G6JL 1G1YA 1DFBL 2CLRA 3HS0A 2IF7A 1XGRA 2EICA 4HUUA 3V2AR 4AG4H 4WW1A 3KHOA 2FB4L 3QUYB 4PB9H 3MMEA 2A9ML 3UYPA 1T1WB 3L3GB 1F3DJ 4LSRH 3HE7A 3V6FB 1IFHH 2E5EA 1IKFH 2D7TL 4NP4L 4U1IA 1T1YA 3MRNA 3QI9D 4EN3C 2ICEB 5ECJE 5C2BL 3QXDB 1G0XA 3EO0A 1HH9B 3IXAA 3NPSB 3V7MA 3MRBA 2Z92B 3PL6C 4IRJA 1NCDL 4OZIF 3T08A 2AI0H 2FWOA 1T2QL 1PG7H 1HINL 1S7TB 1A1MB 1MFEL 3SE4C 2NY2B 4U31A 1F13A 4KHXL 1CR9H 3MCLH 4U1SA 1SJVA 2OTWB 4L4TD 1WBZA 4KDTC 3OQ3B 4GXUN 1CGSH 5CHNB 4MX7B 5C9JA 3ARVA 3O6KH 5K9KA 1ZOXA 3TNNA 1OAQL 3LH2H 1D7FA 4KDVA 4YXLL 5E08L 5LCVH 4RSVA 4TPRL 4Y5VC 4X83A 4H1LH 4ZAKD 5HHOE 3Q0HA 1T5XB 2DAVA 1J88A 1Y18B 5IB2B 5DJXA 1GC1L 2NX5D 1ZT1B 3TVMD 4HC1L 3T0WA 4M03A 4YHLH 5J4MA 2E9BA 4L3ED 4CW1A 1U2CA 2GJZA 4AEHL 5HBBA 2CGRL 1BD2B 5FUCC 4EDWH 3MLVL 2A74A 3PHQA 3QUZB 2VLJB 2QR0A 4NRXB 4K2UL 4ZXBB 5JDSB 4MQXD 1AGBB 1TVDA 1X4ZA 5DRXA 5J13B 2Q8BL 1JMXA 5HYJB 1MJJB 5C0JA 5I1LB 4R4NC 2H2SD 4Z95L 3RGHA 4CMHC 2GK0B 3SJVA 2VZOA 4PP1C 3GO1H 3T0EA 2P5WD 3U4AA 1KCUL 1YY8A 3QPQD 5HSFA 1BPVA 1BVZA 1F8TH 3UEZA 1A6TB 3VRJB 5FUCE 1TETH 4C83B 4MQ7B 3GIVA 4WEBH 3KYOB 4KQ4H 5ADPH 2MOVA 4ERSH 3DHMA 4BZYA 4U6HB 4PV9A 2DYPB 5C1MB 5T1LA 4EDXB 3PGFL 4G6JH 5SWSA 1N59A 1RZIB 4NT6B 3TBTA 3DSNA 4G7YH 3OG6B 4RDQG 3V8CA 1VEMA 5GISL 5EU7C 4NKIH 3DX7A 5DA4A 2WW8A 1IQWL 1NDGA 3LQAC 1CFQA 4IIQB 3HI6L 1OGAE 2UVEA 4X6FB 2D7TH 4NP4H 4M6OH 5D96B 5DTFB 1PG7W 3GRWL 4N8VG 4L4VD 1D6VL 2NXYB 1DQQB 5GIRB 4JZJC 4XNYH 3GJEA 4Y4KB 5FHBL 4MJIE 1NCDH 2ZUVA 3VD9A 1E27B 4LVEA 3EDJA 2HKFL 1MFEH 1VACA 4R0LC 3QWRD 3KHQA 3DVNA 3KDMA 4P4KB 4UIMB 4YHKL 5FYJE 5ICXB 4KHXH 4GBXB 1TXKA 1IL1B 2BC4B 3KJ6L 1I1YA 2ID5A 4HH9A 4UINH 3VWKB 1JHTB 3Q5OA 1MIML 4NQED 1KCRL 3CUPA 5E08H 5DLML 5IR1A 4UT9L 2X09A 3GJFA 1QYGL 3BN9D 2D9QB 1LEKA 3QIBB 5KW9L 5E9DE 3MGAA 2F8XC 3EYFB 4X4ME 2Y07H 1R24A 3T1FB 4HC1H 2B0SL 3EDKA 1YNTA 4AEHH 3OXSA 2HKHH 3STZA 4QTHB 5J1SC 2CGRH 3V4PL 5D7IF 4BKLB 4U6YA 2HT2C 3MLVH 4FTVE 2BZDA 3V79C 1K2DB 1CE6B 2AV1B 4K2UH 4OFIA 3RWHA 5DZNA 5HGBB 1GZPA 2AXFA 2J8UE 4JB9H 1A6WL 3V5HB 4MB5A 3MROA 5HDQL 5AEAA 1L0XA 1ZVHA 2Q8BH 4GT7A 3T2OA 2CXKA 1U8IA 2CO7B 4X9IA 5TGBB 4OV5B 4Z95H 3VGAC 4ZUUA 1MFBH 3ARGA 2YEZA 1JF1A 5KS9E 5BQ7B 2C1PA 2QADD 4MNQB 1OD9A 4KZDH 3AREC 5E7BA 1J0YA 3O6FB 5KVEL 4J23A 3HNVL 1P6FA 5TH2B 4P9MH 1CFSB 1EEYA 4TSCH 1HOCB 3SDAC 4B41A 2HJLA 3CLFH 4NRYA 3A67L 2BHUA 3CSYB 4AH2B 4GAFB 2B8OT 2UY7A 3ARBB 1NC4B 3LEYL 1QSEB 3FQXA 5CJXC 3TO4C 5GISH 3N1MC 1YEJH 5JHDA 1RUQL 3FO9B 5EUOF 3BKCH 4K9EC 1RD6A 1KG0B 4XMPL 1UB5A 2EO1A 1XCQA 3HI6H 2NY5H 2RHEA 2OTUB 3DYMA 1B4JL 4PB0L 2JK5A 4PRPD 3ARDC 5DRZA 3MA9L 4WTZG 5EU4B 3VH8G 4XHJD 4LASL 3CFCL 1ZEAH 4C59B 2OYPA 5MEQA 2YBRB 1JGDB 1A7RL 1FZJB 3PGCB 3FT2A 5JPNB 2ED9A 1ZWIA 4MJ6A 4LLQB 1H3TA 3W81A 3MOBL 3QDGE 4NKQB 3RDTB 4ODWA 1QRND 4Q6YA 4YHKH 1KJ3L 2IADB 1ZLUH 1A9BA 2H26B 3LN5A 4HCRH 4KKBC 1MJ8H 3KJ6H 3TT1L 3T8XA 3EAKA 4K94L 2WBJA 1AE6L 3PV7A 5E2JA 2DF3A 2Z9TA 4O02H 1MIMH 2VLRA 2C3VA 1KCRH 3RNQB 4PRNA 3VWJC 1CXFA 1P4LB 5DLMH 5CIPA 5B38B 4OI7A 5D7JA 4MQTB 1QYGH 2XV6B 3BIAX 3D9AL 1T04A 3RX5A 5KW9H 5FECA 1OSPL 2BNQA 1LWRA 5D2LE 5C09B 5HGAB 3NABL 2UUDH 1HKLL 3U0TB 3O3DA 5BZDB 4LPVA 2ICWI 3W0WD 5E7FA 3TH3T 3V4PH 2EECA 1FNLA 1K85A 1NEZG 2KUTA 5D5MF 1FNGA 3LEVH 4RFNC 2Z35B 2I9LA 4GRLC 2YKLH 3QIWA 3TV3L 4YDJB 4MAYD 3U0PA 4X0KA 5HDQH 1EAPA 1JWUB 3RFZC 2LU7A 4HXBH 4EIGB 2ZJSL 4XPAL 3ZE1F 3AS3A 3JTTB 5GGSY 1KF9B 4IMKA 4WW2B 1BVLA 4HG4J 3OJDB 5E4EB 4PJGB 2P43B 3WKML 2ERJB 3UJJH 1CFNA 3VFRB 1S9XA 1XIWA 4Z18A 2W9LA 1NGZB 5KVEH 1OOAA 3HNVH 4P0DA 4YZFF 5CEYB 2BY1A 4PRIB 2P45B 3VXNB 5FYKL 1T0PB 3QXTA 4I2XA 3DGGB 2I60L 2GSIB 4XBPA 3T0AA 3BEVA 3A67H 5FF6B 3WO3B 4R26L 1HWHB 4P2QA 3KYNA 1C5DB 2ZUQB 3QHFL 1DQML 3DV4B 3C5ZC 5E6ZA 2CDGB 5D2NA 3I75A 3LEYH 1T3FB 2EDTA 1KT2A 3EZJB 4LSSL 4IM8A 4K7FB 4P49A 2DQTL 3GM0A 4HUWB 5ESQA 1WGOA 4XMPH 3U2SB 5J12B 1FYTA 4Z78A 5C0DA 4OLXL 1KELL 5KJRL 1EZVX 3KGRA 2AK1L 2NY4B 3LQZA 5A2KH 1HYSC 3MA9H 3Q6GL 1I85C 4LASH 3CFCH 1FO0L 2W91A 4XH2B 1A7RH 2JIXD 5CFHA 3BX7C 2XFXA 4NM8L 2DWEB 1I7ZA 2X41A 4FFVC 3WNPA 3RZCB 1MWAB 3UZQA 3MFFB 1CN4A 2XG4A 2BDNH 1CK0L 4Z7OE 5DC9B 5KSAC 3QDAA 1N7MH 3BJLA 1JUFA 1NGXB