3FMGH

Structure of rotavirus outer capsid protein vp7 trimer in complex with a neutralizing fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
b'QVQLQQSGAELMKPGALVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSINYNEKFKGKATFTADTSSNTAYMQLNSLTSEDSAVYYCARNHGSPDFHVMDYWGQGTSITVSSAKTTAPPVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab of neutralizing antibody 4F8, light chain
publication title Structure of rotavirus outer-layer protein VP7 bound with a neutralizing Fab.
pubmed doi rcsb
source organism Simian rotavirus
molecule tags Immune system
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fmgH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fmgH02
1EVTC 1ZVSB 5IT2L 4Z7WE 1KIPB 4R7NB 4KWUA 1FZKA 5C08A 3RNKB 2D31A 1VFUA 3PHSA 4ZPVB 1DFBH 4PRPB 1EAPA 3DI3B 3DV4A 2ICEA 3GHEH 4RGMC 5GGRA 1E4WH 3W11D 2VZTA 5KAQG 3NFPB 2WBJB 3AREC 5EU7E 4PTTB 4XMPL 5C92A 4D9QE 4UBDD 1PYWA 5FCSH 4HKZB 1KN4L 2PKDA 3K2MC 1DBBH 1DSFH 5C0JB 1A1OA 1DDHA 2FHFA 4DJMA 5JW4R 3GSVB 2H2SD 4OBSA 5JR1H 1S5IL 4FTVE 3CSPA 2HFEA 4MNGB 2YMXH 3MREA 3VU2A 4KVCH 3T04D 4TPRH 4NQCE 4Z8FH 5DT1H 2NLJB 2VSCA 3K74B 2O5XH 4PJ5E 3W2DL 2MTPA 2X4NA 1I3RB 4W4OA 5IB2A 4DK3A 3ZTJH 5I0DA 1VGEH 3OJ2C 3PDDA 5CZKA 1I7UA 4ZFOB 1B88A 3L3KA 1UACL 5FGCB 5CJOL 2ESVA 5TQ2H 1JHLH 4TUJA 5I71C 3TBWA 3C5JB 4FG6C 3AC0A 5I1IL 3QNXA 3T0VA 5BCAA 1DVFB 1YY9D 4LHUB 2ZUTA 1YEJH 2VDPH 5IMKB 5D1XA 4DFHA 4FHBD 4KK8D 4B53A 4NBYB 3U4EA 1VB9A 1JPFA 1TTGA 5EORL 1KJMA 1RURL 1UCBH 4HFWA 1CGTA 3MRLA 2DJUA 4HKBA 1UKTA 3BP5B 1GOHA 1C12A 4W68A 4TOYH 2Y36H 4NN5C 5TFSH 3O11B 4APQA 3MGAA 5BOZG 4LPXA 3GNML 1RJYA 2AXFA 4P5KB 3P11L 4JLRA 5I1KL 5IWLA 3HZKA 1YEDB 1LE5B 3N0PB 2QQLH 4HWZB 3KPQA 1S7VB 3IETB 4U7MA 1H0DA 2P5WA 4ISVA 4IOFC 5CGYC 1Z9LA 1KCUH 1VFBA 1YNLH 2R0ZH 5KS9F 1WZ1H 5E94A 2HFFB 3HZYB 2VN7A 4YHLH 1MQKL 3AU1A 1INEL 4Y5XA 3VD5A 2XACC 3OKLB 3CK0L 2R0WL 3ARDC 2M2DA 2EDBA 4OLUL 2R9HD 1YECL 1MUJB 5JMRA 5TQ0L 1FNSL 3GSNA 3D3VD 5FGBA 1BLNB 5I1HH 2VLKD 3ZKND 3Q1SH 1QFUH 1OTSC 4HJJH 3GKZA 3OKKB 4P3WA 3EYFB 1MI5B 4U1LA 4UAOC 2AV7B 3BQUA 1ZEAL 1UWXH 2FH6A 3MFGB 5E1HB 1JFQL 2VDLL 1LO5A 4M4RA 4PD4J 2EDLA 2FCBA 2MOVA 4HS6B 4KDTC 3B9EA 4L5FH 5JW3H 2DWEA 2CXGA 2G75A 1PQZB 2WSKA 3P73A 5E4IA 2IAND 4K8RC 4PRHE 5FYJE 3R1GH 3P30H 1EK3A 1FZOB 4CL7A 3H3BC 1CD0A 2HKFL 1H5BA 1LO4L 4WGWB 3VXME 4YXHH 5E1AB 5GZNC 2X4SB 3TWCH 2EIDA 1EUTA 3EHBC 4L9DA 3STBA 2PYEA 5F3BA 4K3JH 4PGCB 1BVLB 2YBRB 3PGFH 1JWSA 1CICD 3DVFA 2XN9E 4P3DA 1OWWA 1HIMH 3ES6A 3QEHB 2P8MA 4XP1H 4JREC 5FGBC 3I02A 3RWCB 1XIWA 4F7EA 1OAXL 3V4UL 2YC1B 3D6GA 4MVBC 2FEDD 3T0EA 1BD2A 1QSVA 3BQUC 4KMTL 2X4UB 4MD4B 3GB7A 5K9QG 1SEQL 4FFVD 1AKJD 3FT4B 3VXTB 4X9FA 4PP2A 5F1IB 1NC4B 3VXPB 3SE9H 2F53B 5BMFL 1ZLWK 4KTDH 4LCCA 4YFDB 5CEZD 4QXGL 5D9SA 1GZQA 3UO1L 1IBGL 5DD6A 1J0KA 2IPTH 2A1WL 4Q9QL 1P4IL 4JFDA 1DQJB 3G9AB 3BYTA 2HKHH 4R2GD 4JPIB 1MJUH 4WJ5B 3O3BB 5J11C 2DQGL 4X7TB 2FWOB 3HC3H 3BRFA 4HCRH 2EXWC 1RZFH 1ZANL 3G6DH 4MA7H 1KENL 3MV11 1EDQA 1D6VL 3CVHB 4ZOAA 3MO1A 1ZA6B 2FR4A 3B83A 4NKIL 1CXLA 4BK5A 5L8JB 5SX4H 1ZHLA 2V17H 2EDJA 2EDDA 3U1SL 3T4AB 1MIML 3LKPA 3RWJA 2AKRB 3HC4L 3PNWA 3QULB 2NY2C 4Y19D 4XNUL 1QBLH 5TH2B 4ZTOL 3VXSA 4IJ3C 5DWUH 1MF2H 2OL3L 2EICA 2VKXA 5E6ID 5H2BA 3UTOA 4P2CG 2MHAA 4WW2A 1IEBB 1PZUB 1E4XL 3D2UB 3BAEL 1R3IH 5C0CE 4AG4H 4KDWA 2Z31D 4DOHE 4I18A 3MV7A 4C57C 2IADB 4DEPC 4N68A 4OM0L 3IS1X 4NO3B 1MJ7L 3HPLB 1IM9A 4RAUA 5CINH 3GMLB 1LK3L 1AD9B 4NM8H 4PP1C 1U93A 3O3DA 3CUPA 4LDLB 1FHGA 1RZKL 2A9MH 5ENWA 3MRCB 4U6VL 3C6LA 2NMSA 3BN9D 1BFOB 1H3TA 2VLLA 2EEBA 4WGVB 5HHMD 4R4FL 4PR5A 5MHSD 5D96C 2J4WL 3PP4L 5C3LD 1M7IB 1NPUA 5F7WC 4WNQA 1J86A 5HSFA 3GSXA 1MRFH 2EC9T 1K85A 1E6JL 5DRWB 5JTWA 3PHOB 4NQEE 5DJXA 2R1XB 1GGIL 1Z3GL 1MCNA 2ZOKB 1JI1A 4RBPK 1TPXB 4WO4D 1QG3A 4HAFA 4XAKD 1D5XB 3GMMA 4XWOD 4U1IA 2VUOA 3RPIA 2CRZA 4I18C 1KB5L 2NW2B 3ARBC 3P0VH 3GMQB 3E6HA 2I5YH 3L5XL 4BM7A 3O3EB 3R8BB 4L4VD 4UIMB 4UV7L 4W4NA 2KDGA 3QIWB 4LEXL 1Q72L 3U7YL 3SKMA 3CFKB 4MD0B 5T5NF 4U1NB 1I9EA 1WSST 1HQ4B 1L9NA 3IJHB 4HJGA 3PG2A 4I2XB 4EN3D 1OVZA 3N1MC 3ETBF 4GXVL 3JTSA 2X9XA 2PTTB 5D5MB 3NFNB 2IQAA 1BZ9A 1YMHB 3EOAA 3HR6A 3RGVB 5MEOB 4M9OA 3FONB 3T77B 2EH8L 4ZFGL 1VFOA 2VABB 2G9HB 4ZUTB 3V4PH 4ZFZB 4EDXB 1DE4A 3AS0A 2H1PH 5CBEB 4OUUB 3IXTA 1U8HB 2Q8BL 1MLBA 4Q6IB 5JXAH 5F9OL 2H8PA 4M1GH 1F02I 3QQ3A 1IC1A 5GJTH 1GH7A 1CDJA 2B5IB 3TO2B 5E24E 2I27N 5KVEL 3F8UB 4HBQA 1A4KB 4Z0BL 4PLNC 2F5AL 2IPKA 1S7WB 3V0VA 3ROOB 4RMRA 2B4CH 2Z93A 4KK5D 5EBMA 2Q8AL 1TJGL 4XMKL 3VXQA 3B9VA 4YHIB 4ODTH 1JPTL 2NY3B 4JFQA 4ENED 2H2PD 4XPHH 3PWPD 1DBAH 4HK3J 4PJEA 5D7JB 3L1OL 3OKMB 2ICES 4YH6A 2NR6D 5E8OB 4ONGL 3N1QC 1FP5A 1LEKB 3P4MA 1PEWA 1T22B 5DUMH 5CJQH 3QJHB 4JFPA 2H3NA 2BHUA 2H26B 1CLYH 5EIVA 3WIFB 4QRUB 1UZ6F 3TJHD 1B0GB 4WI8A 3KYKH 4HIEB 2DJ4A 3IAPA 1FYTA 4M00A 2O61A 4OQ1A 1GZPA 3FFDB 4GRLA 4LSQL 4UOW1 5SWSB 3T2NH 3CPLB 5T5NG 4NUJB 5DVLA 4AIXA 3SJVE 2F74A 3TVMC 4KZEH 1E28A 4EI6A 4RSVA 3GSOA 3ARXA 1D5BB 1W8OA 5IHUH 5KVFL 1TCRA 3QEGH 1DZBA 3HI5H 1G7IB 4NZRH 2DOCA 3DIFB 1Q9KB 3G5ZB 2DQTH 5JXEA 1Y0LA 1F90L 2C4FU 2PXYB 2IH1B 5CSGA 4PV9A 3G6JE 5EZLA 1EH9A 4JANA 2R4RH 4V1DA 4LHJB 5BS0E 3VDBA 3F12B 2AJVH 5DMKA 4OKVB 1KXVC 4K7PY 4O00A 5I1LA 3ULSB 4BQ6A 1LQSR 2E7BA 2FX7H 3BEVA 3OWEA 4TQEL 4CVZB 1B0RB 4KZDH 3MNWB 4LSPL 3ZTJG 1JGUL 1L6XA 1A3QA 5CGTA 4ZAKB 2V9TA 1HHGB 5D2LA 5DQDL 1LP9B 4GRLC 4L8SB 1IEHA 2X4TA 3VFNB 2BOBB 1QO3B 1P7KA 5DJDA 2VDOL 5BVJB 4NGHL 3TFKD 3VW3H 1PD6A 4MMXC 2CK0L 3AAZA 4HLJA 5EOTB 5MEPA 5ABDE 3MGOA 4IDLA 5KW9H 1OWRM 3FMGL 1QLFB 3HHRB 3QQ9C 3BSZL 3VFTB 4UTAH 2ZUSA 2Z8VC 4HX1B 3M1BB 1MWAL 5JXEC 3LSOB 2QR0A 5D72H 4Y5VA 2ORBL 4KK9C 2J88L 1P9MC 1UGNA 5IK3A 2AJXL 3QI9C 3ILQC 2ADIB 35C8H 5D93B 4Z7UB 4X4YB 4G7YL 5HJ3A 4FFWC 4L3CB 4NDMB 1LNUB 2ZJSH 4D9QD 5IOPA 2PCPA 4HUNB 4LVHC 1CI5A 5I1JL 1T5XA 4WUKH 2BSRA 1IILE 1UJTA 1Z9OA 3JV5A 1WIOA 1J0HA 3CFBB 4JDZA 3NFSL 2DN7A 1GPOL 3GSWA 1O7VA 3INUH 5FYKE 3IU3B 2VXUH 2OTUB 1W0WB 3MFFB 1F4HA 4FTVD 3MRBB 4NQVA 4ALAL 1NAMA 1HHKB 4EI5C 2DKMA 3GZKA 4NQCD 3FQXB 3STLA 3TYGL 2DLEA 1LDSA 3PDOB 4QXTB 1AP2B 3OKDB 4G9FA 5F7HA 4YDKH 3IVKA 1IKFH 2CJUH 3GJEB 3HRZB 4OFPA 2FLBT 3Q5OA 1J0YA 4HEME 3GHBL 4PJFB 3UJTL 1PSKL 1OHQA 3RKPA 2GI7A 4HDIB 1MEXL 3VI4F 5FO7B 3QXDB 4Y0GA 4IEFB 5CJ5A 4BSWA 1PEZA 3IDIB 1Q0YL 1IGJA 1G6RA 1KIQA 4X6CE 4HH9A 3M8OH 3WDJA 3D3VA 3MRFA 2VLJA 5T5FL 4JFFA 1VESA 2VLKA 4HS3B 4P48A 1HXMA 3HMXA 1NCDL 1U3YA 1A6UH 5D6CA 5T3ZL 3VG9B 1JNHA 2XFXA 2HMIC 2DYPD 1BM3L 1N5AB 4OGZA 3RWDB 2OQJA 2WWMD 1F00I 3WLBA 5BQ7A 1FZJB 1KC5H 4GKNA 3WXWH 3U83A 2Z35B 4FFYH 4CNIA 5D2NC 3GSUA 3U2SA 3SY0B 5I66A 4S1SH 5I9QB 3RY5A 1ZWIB 2FB4L 2MQ0A 1EGJH 3RVTD 5I8CA 1FNEB 3IDMA 4HK0A 1PKOA 2AK4E 4U05A 5KSUA 3S3PA 5MP6L 1QSEA 1RZ8B 3DGCR 4PJGB 1XF4B 4P5TB 4ZNEA 2V5RA 3D69A 3ARGA 3I2CH 3WN5A 4CADB 3FQTB 3QUZB 5DEFA 3E6FA 4OCYL 2IFFL 3IDXH 4L29A 1EFQA 3MRDA 4PJXE 1A21A 2HLFD 4KROD 4PJAB 4QRRD 2O5YL 2Z91A 1U3HA 1DBKL 1KJ3H 4X9IA 5D2NE 3UYPA 2BFVL 5I75C 3G04B 4MX7B 4O58L 2WANA 1YN7A 1SY6A 1DEEB 3RWEB 3BKJH 3WD5H 4YPGA 2HRPL 4G8GE 3CZJA 3SE4A 4DVRH 1LDPL 3P9LA 1WWCA 4H8WH 3RKDD 3OAZK 1A3RL 1ES0B 2RFXA 4XP5L 3ROLA 3WS3B 1G9NC 2OTWA 3QUKB 4ZDHA 5JIKA 1BHGA 1RIUH 2WLYA 4YHKH 1YEIL 3LCYA 1FORH 3MRPA 3B5TA 1Z9SA 1WBYB 1U2HA 3RL1A 4M8QB 2GQHA 5H37G 2DKUA 4PRHD 3MR9B 5FYJD 3WN5C 2Y25A 4PBXA 3OGCA 2AXHA 1HHJB 4X4MA 2BXYA 1KJ2A 1OTSD 5GHWH 4DN3L 4YPJA 1LO0L 2GSGA 2GIYA 4WFHE 3FRUA 2R29L 1BF8A 5HI4C 3U9PH 3MJ9L 2FATL 3HZMA 4XCFL 4EZMA 1NANH 2PUQT 2XN9D 3CXDL 3O8XC 1J11A 4LOUC 4UUJA 4OV5B 5DMIH 1JGDB 1OARH 1DN0B 4D3CH 3QEUA 5D5MF 1JZ8A 3HE7B 4J8RB 4P2OB 2JB6A 4XHQA 1XF5A 3KPTA 5AUMA 4XCNB 1BBJB 5IQ7H 2XQBH 4PJCB 4QYOB 4YHMH 1F6FB 2V2TB 2R1WB 4YQXH 4NO5B 1W72H 2BK8A 5F1KC 3U30C 2B2XH 4YXKH 5HYSB 3MROA 3B9KB 5J6GB 3CU7A 3WNMA 4XCYA 1FVCA 2QQNL 4Q0XH 2BNUB 5DVOA 1OAUL 5F88A 5CSZA 1W72B 4JGUA 1E4WL 3L5WB 4GW5A 5C07D 1NCBH 3H9HB 1T21A 1ADQA 1KIRB 1AD0B 4OCRH 4M7JH 2A6JB 1EVUA 5IB1A 1MVUB 2NY0C 5HTSA 4OZFA 3O6KH 2DAVA 2YMXL 5BJTB 2VMFA 4HXBH 3TH4T 4U1SB 5CUSL 2P42B 4ZTPH 4Z8FL 3NGBC 5DVMA 5DT1L 1OAYL 2F8XC 3QUMH 2O5XL 4OZGE 1F97A 4JY6B 5E2VH 4HIJB 1UEMA 3QUMB 5HYJE 1W2KT 1ZAGA 3CLFH 1I8LA 1UKQA 1P7QA 3U46A 5TQ2L 3ZKSD 4IMKA 4EIZC 3L3HB 2X05A 1D5IH 1KCSH 2YPLE 1HQRA 5I73B 4FQJH 1TETL 2VDPL 3BD5A 2LE9A 4PGEA 4XBPA 2ADFH 4Y1AA 1KN2L 5D6DA 3VRLF 1MNUL 1A6TA 3SGDH 3BW9A 5F7FA 3VFMB 4GW4A 2ITCB 4TOYL 1JF6A 5EO0B 1T04A 2GFBB 2WQRA 1CD9B 5TFSL 1CDCA 4ELMB 3L7FB 5BZWA 2GK0A 5F21B 1GC1L 4UNUA 2XKNA 4M3JA 3Q48A 1T1YB 4WWKD 5L2KE 4AM0A 3TYFB 3O4LA 2AABL 2C7UA 5EC2B 1IZJA 3GI8L 3WEXA 1LEIB 4EN3A 1J8HA 1EERB 4XHJD 4GS7B 1H3GA 4IMKC 5TGBA 2DM7A 3NN8B 1KCUL 2CIIA 1L6ZA 1WZ1L 4G43A 4G8FB 5IJVA 3T8XA 5ACLA 1RD6A 2F19H 1OT2A 5KN5B 4LVOB 5DK2A 2OZ4H 4JRXB 4NZUH 1ZLWH 3JVGA 1LO2L 5CD3B 2WAHA 4NQED 1HWHB 3RVWC 4UIKH 5IFHH 5I1HL 4YUEH 2Q1EA 1NBYA 4HJJL 1MFCL 4G8EB 4PP1D 5EZIH 3DVGA 5ITBH 5E8PA 3OPZH 3WFZA 2ZSVB 2EECA 2BMKA 3PHQB 5EZJA 1AKJB 1IJ9A 2ZCHH 3X12A 5CEZH 4BZ2H 3DECA 5IFJB 3ARRA 1UWGH 1OGAD 4U3CA 2ATKA 3ULVE 1H8NA 4MLSA 1ZMYA 3PWPA 5EU6A 3BISA 2ITDA 3X3GL 2ZUYA 4WV1A 4Q2ZB 3NA4A 3R1GL 3P30L 3KXFA 4LSUL 4Z7UF 4G5ZH 3WLWC 3QIUA 2IH3A 1EEQA 5I18L 5J1TC 1QRNE 2Y7QB 3QZWG 4JRWA 1RJCA 1A1MB 1DJSA 3TWCL 3JWDC 4JR9H 3EOTH 1DUYB 4BUHA 1IKNA 5BVPL 1AI1L 3RVUD 1BJ8A 4OM1H 4LRNH 4Z7VB 4BSVB 1RULH 3PGFL 1UJ3B 4GG6A 4F37K 1JN6B 3D85D 2GTWB 3T4YB 4PJBE 1HIML 3SDDA 5BV7L 1A7PL 4U1KB 4WFGD 3MCLL 4XP1L 5JDSA 2V7HA 1RJLA 1H3UA 3LKSA 4OGXH 1FLRH 1FO0H 4QHKJ 1VFMA 4I77L 1I9JH 1NFIA 5EU3B 2R39A 3D48R 3BJLA 3I3BA 2FSEA 5EO9A 5HGDA 1FO0B 1DBJH 4PJFF 4MQXC 1MCLA 5E5UB 5TE6H 2D2OA 3H7BB 5IEHA 3QRFM 1YUHA 4F7MB 3BP7B 4Y5YC 4Y19B 3SE9L 1BPVA 4WV1C 1YYMH 5EFIA 1VGKA 3CSYB 3QUYC 5GZOC 3CGTA 2APWA 3QIUC 4PYHA 5ICZA 1XF2A 4TSCL 5FB8A 3F7YB 4N9OB 4PTUB 5BO1L 3OF6D 4Z77B 3C5ZD 1BVKB 4OLWL 1I7ZB 4DW2L 1JPST 3TLRA 4IHOB 4QF1A 1TLKA 3L7EA 4WEUD 2DQEL 5FA4B 3VFVA 1IZKA 3ARTA 4MSWB 4R9HA 4ORZC 3FO1A 3ZT5A 1YPZE 1MCPL 1RZFL 4MA7L 5FF6A 5DI8B 2Z4QB 4IOIB 1DQDH 1MAJA 4PJ7B 3K0WA 2PW2A 4RBPH 4WHCA 4D9RE 2HLAA 3GO1L 4R7DA 4IRJA 2FJGB 1WIUA 1N59A 1N6UA 2V17L 1ETZA 1S9VB 3GBNH 9CGTA 5I8KH 1ZHKB 5HDBE 1T2QH 5FYJU 3RL2A 1QBLL 1WF5A 3MLVL 4MJ5B 4PJAF 4DGVH 4TRPH 5D7LE 2VB5A 4HD9A 2DM4A 2JLLA 2X70A 4K23H 3WFBH 5IVXA 3KPMA 4XPFL 5IM7A 1TJHL 3UPRB 5IB5A 4KHTL 4Y4KC 4K7PX 1IEAA 5DJYB 2A0LD 3LB6C 3TVMD 5BS0D 4AG4L 2VLME 2NY1C 5L88H 1S7QB 5CS7A 3UTTE 4JO4L 2VO5A 4FQIH 4L4VB 1F2QA 1FL5B 5I16A 2YWYA 5C0IB 4HPYH 2PN5A 2HWZH 3DV6A 4NQCA 4LCYB 4NM8L 3HN3A 3IFOA 3VXRE 1MFBH 4YC2C 4IRJC 2A9ML 3NIFF 4D0CB 1VCAA 2A73B 4U6HA 5GS0D 3WL9A 3KWWB 2X4RA 1NGPH 4PV8B 1I7TA 5J12C 3VG0H 5ID1B 3JBG7 5IW6A 2AI0L 3F7QA 3LVEA 1U91A 3GSNL 3MXVL 4ZS7H 3ECBA 4XXCC 5D2LF 4N0UB 2YZ1A 4XC3H 5DS8B 5F1NB 2G60H 1HI6A 1R3JB 4JZOA 3GMPB 4AEHH 5SV3A 3CFEA 1DBMH 5EZOH 4ODBD 1IL1B 2AEQH 3ARFC 5LGJA 3PABB 5F7EH 2DF3A 2DYPA 3F62A 2FO4A 4X4XB 2XRAL 4LAJH 4XTRD 3OKYA 3QQ9D 5FYKD 4HBCH 4WHTA 1IAIM 4MA1B 3P9WB 3SKNB 3WO4C 4L4TA 2P5ED 1IGYA 1O7SA 2DMBA 2EDQA 3S35X 4XP9H 1ZT4A 2EDWA 3RBSA 1NUFA 3H3KA 3NCJH 4A6YA 3DX7A 3X13A 5DEGA 5DHVH 1NJ9A 4X8JA 4RIRA 3GIVA 3V4PL 2J3SA 5D1QC 1OP9A 4NC1E 5DHVB 2ILLA 3QP3A 1OSZB 3LEXA 3C5SB 4KJYA 2RAMA 4LFHD 4QRRA 5I1AB 5JXAL 3BN3B 3RGHA 2QSQA 2EE2A 4OFKA 1H8OA 4EI5D 3FZUD 1CD1A 1IAII 3CVIL 5EO1B 5FYLL 2XXMB 5GJTL 2W07A 3MRRA 3WYRA 2VZUA 1Y6MR 1KV3A 5JZ7C 1C16B 4EBQL 4HUVA 1YZZA 5C70A 3TT1L 4CN1A 4RAVA 3L6FA 3RWIB 3WUWA 4IOSD 3UROR 5B8CB 2B4CL 1G7LA 3S34L 5KZCB 4ODUA 2WUBL 4H1LH 1WUNT 3EOYG 1YMMD 1MLCA 4G6AD 3V6ZB 4PJ9C 5HHPA 4ODTL 5EPMA 2J6EH 4XPHL 2OCFD 3HPJB 4QXUH 1DBAL 3VXOB 4XPTL 4WFFE 2A74A 5DLML 5HHQB 4JFOB 3WFHA 2AK4D 1F58H 3MLTA 1RHFA 2BSTB 2MNUA 2QHLA 3VH8B 1ED3A 1VFAB 1KSRA 3PIQA 3TT3H 5MEQB 1M7DB 3LEVH 2P43B 1K4CA 3VFRA 3Q0HA 3NTCH 2ZKHL 4AL8H 1YEGH 1HSAB 1AIFA 3JV0A 3OAYH 2NY6B 2VDQL 4ELMF 1QRKA 4KJQD 1G1CA 2H32A 4R96A 1D9KD 1WBXA 1KEMH 4TNVF 4MNQA 4WI6A 5EC1B 3FOMA 1HYSD 1FJ1B 1WZKA 3QIBD 1HKLL 1ZTXL 1NFDE 2P47B 1RAMA 3IDYB 3PQYE 1NCNA 3T2NL 5JHDA 3EJJX 5A2JH 3SGKA 3MBXL 4KZEL 4X6DE 2DLFL 5HYIA 3RY6C 4JZJA 2D0FA 5IHUL 2GITA 1QFPA 4MLIA 5DR5H 1CDUA 3QEGL 4NRZA 5JHLH 2VIRB 4Z7WB 4H5SA 2QL1A 4MJ4A 3LQZA 3TO4C 4OGAC 1BQHB 1DQTA 4ZUVB 4YXLL 5C07A 4Y2DC 2D3VA 1UVQB 5CWSB 3DHMA 3VGBA 3RDTC 4WFHD 2GAZA 4RNRB 1HHHB 2FX7L 2OSLB 1MRDH 3LN5B 4P9HL 3TGXA 5J9PB 1UZ8B 1NSNH 2K7QA 1N6QH 4LLVB 3RNQA 1F2XK 2UYLB 1ZLUH 4C56D 4GAJL 4BZ1H 1JYWA 3H0TB 1ZXQA 1MHEA 4F33B 1L9MA 1M05A 3HZVA 4RGMB 4PJ5B 3MUGB 4KI1A 3SGKC 3ZE0F 4BZYA 3VW3L 3AREB 5F9WC 4X9GA 3KNBB 5I6XC 3NBNA 4WRLA 4XWGH 5GS1C 5KW9L 1C5DA 4OFDA 1J9CT 4FQXC 1TQCC 4ZUSB 2OJZH 4GKSB 5CAYB 1XCQA 4GKZA 4L8DA 1NMAH 3EO1A 3WXVL 5DURB 5F7NC 3C87A 4L8CA 5CKGA 4U1GC 5AD0A 5AEAA 3FQUB 4NKMB 1OTTC 5DGQA 2X44D 3QUXA 4HHAA 1FPTH 2WLZA 4LOUD 2QTEA 2X1PA 35C8L 3VXUE 1EJ6A 3PGCA 3QO0B 3REWB 4PJIA 3S88L 4WUKL 4UQ2B 4ZUWB 1X5LA 3KS0H 1AY1H 5L2JA 3EYUH 5I71B 4CMMB 2VXUL 2ZUVA 3WNNA 4BFIA 1YNTB 2W0FB 5C08B 4E5XA 2D31B 4WWKA 4QT5B 2XWBB 1EAPB 2KBGA 4DZ8B 3FO9A 1HINH 4YDKL 5ALBL 1IKFL 5ADPH 2CJUL 5K9JH 2H6PA 1O5DT 3FO0L 3AS1A 1JYNA 5HYJD 4N8PA 3C8DA 4IRSC 4U6TA 3DWTA 5A2LH 1V3MA 3S37H 1FGVH 2E6PA 4GQPH 4FQLH 2YPLD 5IHBA 4NN5B 2O26U 1CFSA 4OGYH 5FKPB 5F7UA 4WUUA 3RWGA 5ESAA 4YK4C 1H3VA 4PGBB 1OGTA 3OG4B 1IAKA 1CTOA 1MVFA 3RAJH 4JDTH 4PJ7F 1I7UB 1ZT1B 1A6UL 3ZO0A 2C4XA 3WKMH 1VEMA 3RHWK 4TUJB 1F5WA 3SN6N 3MLSH 3VD4A 3EYOA 1QSFE 4EVNA 3OX8A 1LEGB 4FFYL 4JHAH 3QXVA 5D1ZD 1OGAA 1XZ0A 1MJJB 1S3KH 4YWGH 4P2RE 5FYJH 5L2KD 4S1SL 3ARDB 1JPFB 3NABH 5DMYA 1ZT7A 3C8HA 4PRHB 4HUXB 4WI3A 4MJID 2AS5M 4OZIE 1NH6A 3S98A 3VXMB 4GAFB 3O2VH 1NDMA 8FABA 1C12B 4JQVC 3IDXL 3P4OA 4UAOB 4MCZB 4O9HH 3LKQA 3D85A 4LCWE 1RJYB 2AXFB 3L3OA 4NQDB 4XPGH 1MPAH 2XN9B 4K8RH 4HXAL 4NSKA 1I8IA 4JM2C 1JJUA 4CGTA 4Y4FA 4LMQE 4Y89A 4GBXC 3GMNB 1H0DB 4PB9L 3WD5L 1U36A 5FCUL 5IBUG 4DVRL 1KTDA 4ERSL 2CUIA 5FYKU 4H8WL 5HGAB 2PR4L 5EA0L 2AGJL 3PV6A 1A7RH 1HE7A 2FLRT 4P46D 4XCEA 1UH3A 1FNFA 1IGML 3KAAA 1OW0A 4YHKL 1BBDH 1FORL 5IF0B 5AYQA 3ULVD 2LU3A 4LARH 4PJ8A 1F8TL 4JREB 4OZFG 4DN4L 4F7TB 4S1RL 4XNQA 3MGTA 4PRIB 4I3RL 2GT9A 1PY4A 5JW4M 3V5DA 5GHWL 1TTUA 3BQUB 2BP3A 5JOEA 5KTEH 1OPGH 3NCYP 2Y72A 4J12A 5C0DA 5TDPB 2CRIA 3KPNB 2CH8A 4NCC2 3SE3A 3V9FA 4Z7NE 3P73B 5IJKA 5DMIL 1OARL 2X1OA 1ZHBA 4JFHE 1EZVX 2EDOA 3PWJB 5IMMA 3HG1A 3TJEH 2VZ1A 1DEDA 4PREA 2WUCH 3A0OA 2VZVA 3RUGA 3QDJE 5F7MC 1CXFA 2LFGA 1S9YB 1WV7T 1MREL 4YHML 1R24B 2NW3B 2SEBB 4K7PL 4UT7H 2B2XL 1OTUC 4YXKL 4R3SA 3VFSA 3CAFA 3ES6B 4XXDB 2X7LA 4FQCL 3U9UA 4UNTA 4QRQA 4ZQKB 2AVGA 2X41A 5J11B 3K8KA 4OT1L 5D7IE 1XGTA 3UYRH 4PLJC 1EEZB 4FABH 1BD2B 3CDCA 1A6WH 1S9KC 2DIJA 4WCYL 4TSAL 4OCRL 3HAEH 3RZCD 1KLFA 4MQXD 4N8CH 5C0CB 3SE3C 4PP2B 4HC1A 4JQXC 3DX6A 5EUOE 3VD7A 4DOHB 3O6KL 5IJKC 3UBXA 1EX0A 2JCCA 3HAEB 3W9EB 2NQCA 1YA5A 4ZTPL 3TBYA 2NY2B 4POUB 4TULH 5HGHA 2AJUH 3DXAD 3RRQA 3QXWA 4P23C 4P57A 3Q6FA 5DSCA 4IJ3B 3P9MA 5DD1L 2J5LC 5E2VL 4XNZB 5DD6B 3DYPA 3OR6B 4ONFL 1M6OB 2IALA 1HH6A 1A9BB 1WICA 3BUYA 4D9RD 2CD0A 5FA3A 1VA9A 1T5WA 1JVKA 4Z95H 4JQIH 1S7SA 5M94B 4EQ2A 4X6BA 4GLRI 1TMCB 1G6RL 3LPGA 4JE4B 4N5UA 4GT7A 1FFOA 3K4DA 4DEPB 1XGPB 2AAVA 4LRIA 1ZLVK 2YD7A 2YRZA 3HMXL 1JIBA 3PL6D 5D7LD 2FHCA 1I8MB 1PZ5A 3T1FA 4PYGA 4LKXB 2MMXA 3GMOB 5F7DB 3I50H 4PLKC 5GGUB 1KFAL 4YX2H 2DI9A 3MO1B 4ZO6A 3BZ4A 2BJML 2X2YA 1XEDA 4KJWC 5EWIL 1ZHLB 5IB3B 4OF0A 4U1JA 2ZG1A 1KLUA 4HGMA 4MQ7A 4EUPH 3EJZC 2VLMD 2C1PA 1OAKH 5IQ9B 3UTTD 4Z7WF 5C6TL 1U95B 4F3FA 5D96B 4EUPB 2PW1B 4OLVH 1YYLL 2IPUG 2P5EA 3QJFA 3IF1A 2JK5A 1IC5L 5FM5O 1ZHNA 4JFZH 1JCKA 5H2BB 3O9WA 3VXRD 1Z0MA 1EEUA 1F3RB 3RX7A 3BDXA 4R90H 1II4E 2UZIL 1AGFA 4Y4KD 2R56L 4FXGA 4F9PC 4MNGE 5IMOB 2Q76A 3PP3H 4I18B 4OF7A 2CDEA 3ARBB 2F19L 1V7ML 2VXTL 4LRIC 4C83B 2OZ4L 4PGDB 5CEYA 15C8H 3E2HC 4X6CA 1U93B 1UB6B 4YUEL 2VISA 5FGCE 5T1DH 2NCMA 5EZIL 1CS6A 2ICWI 5ITBL 3I6GB 1T6VN 4N1EA 1WWWX 2Y06L 5E5MA 4M6NH 1SYVA 1IFHH 3BKCH 1Q9WB 2WINA 5DJCB 2ZCHL 1YMMA 5CEZL 4WNQB 5DJZA 1MHPL 4KFZC 5D7SL 1P4LB 3WNOA 2DBLL 2NY4D 3EFFA 4MXVE 4HF5L 1KJ2L 4G5ZL 1ND0A 1FH5L 5FXCH 2XPGA 3MBEA 2C5DC 4ONHB 3EOTL 1CIDA 3GI9H 3B6SB 4YDVB 3V8CA 4J6RH 1KIUA 4CU6A 3E6HB 1RULL 2WM0A 5GGVY 5J3HD 1R3LA 3SDAA 2YEZB 3IXAA 1UADC 4IMLA 4PRBA 3SKMB 3IGAB 4K9EC 1FAKT 5HHXH 4OGXL 2CGRL 1T7ZA 2EE6A 3IFNL 1FO0L 3JTSB 3FT2B 3MJ8B 1I9JL 4RZCB 4U33A 2IQAB 3ILPB 1BMGA 3KDMA 4LLYB 4MXQC 1CXHA 3SJVB 1U8LA 2CLVA 5TE6L 3UTSA 2AK1H 4CVUA 1NKOA 1IGTB 3CC5A 3G5XA 4HIHB 2YD9A 2QSCH 4G3YH 1K8IA 3VGGA 3DRTB 2JE8A 5I1GH 2L7JA 1Q9OA 1EJOH 1YDPA 1EO8L 1NUGA 3MRQB 4WFFD 4NNYA 1XH3B 5D8JH 43C9B 3MRJA 2C3HA 4JZNB 1H15A 2Y07L 5CBAB 1TVBA 4LMQI 5DK3A 4AH2A 3G6JB 5MERA 5JZ7D 5HD8C 2YPVH 4XCCL 5J7CC 1CZ8H 3SDAC 3TVMB 2E9BA 2PO6D 5BS0B 5I2IA 5GGTA 3MLPA 5KOVC 4JO1H 4N0CC 3LQAC 3VXQB 2YPKA 1JBJA 2F58H 4F9LA 3QG7H 3KGRA 4OB5H 4HKXA 2LAGB 4ORGA 4PJ9D 4C56A 2GSIB 4HUUA 1CG9A 3A6CH 4PJEB 2WWKT 4TUOB 5IEKA 5TDNA 1AH1A 2FL5A 1UWEH 1WZLA 3PQYD 3K1DA 3FN0H 4RMSA 4ZO9A 5HHVH 5JDJA 4LLDB 4JFPB 1F42A 2K7PA 2P24B 2KQMA 3HR5A 3GBNL 1GIGL 5DFWH 2DLGA 5GIRA 5BZDA 1U92A 4BQ9A 4B50A 1FN4B 4JY4A 2N4IA 4V2CB 4X83A 1FYTB 4DZBB 1U2CA 1CGSL 4GQ9H 3WFBL 3ZKMD 2DWDB 4GRLB 3BPLC 2NX5E 2R8SH 3KLAA 2F74B 3ZTNL 5FYKH 1JI2A 4TN9A 1E6OL 5D7KE 5L88L 5GPRA 2PYFA 4HLZH 3WFDH 2VLRE 2A6KB 4TUKH 4F8TA 2GCYA 2HAZA 1I1RA 4ZYKA 1UENA 3R0NA 5FHAH 1Y0LB 3SDXB 5JMOC 1QLEL 4KKAD 1X7QA 4YAQB 1MFBL 1KB9K 3QI9B 4OLXH 5JW5B 1RY7B 3IAGC 2ICCA 5HYJA 3ZMRA 1R3KA 4V1DB 4LVHB 5DMKB 4XH2A 2APBA 2YUWA 1AXSB 3HS0B 1W0VA 3VG0L 1FNLA 3K8LA 4LIQL 2YPLA 1N4XH 3WUWG 5DD0H 4JRYE 2ADGA 1FFNA 5J1AA 3GJFA 2HTLD 4EI5B 2EYSA 2G60L 3IDJB 5LCVH 3VXUD 4LPVA 3PWNA 5EZOL 3TA3A 2AEQL 5E70A 5MEPB 3GSQA 3MGOB 4I1NB 1T1ZA 4YBLC 1RZIB 5D1ZA 5INDB 3RZWA 3F5WB 5L2KA 1AXIB 1JMZA 4NP4H 1A0QL 3WIIL 5DRZB 4NCC1 3LN4A 5C09E 4XP9L 2AK4B 2L7UA 3STZA 3T0XA 1INDL 2E3VA 1K8DB 3NCJL 4MJIA 3QBTB 2CSPA 4XBEL 3V95A 2EC9U 4UU9B 4EXKA 2D9CA 1RK0A 1WTLA 2Q7YB 3TBTA 5E8NA 3MV8A 5CSBA 1J0ZA 4NQVB 5IHZA 3BIAX 1T0NB 1NAMB 4YLQT 5I1CL 2APTA 4MDIB 1X6NA 2UV3A 2BC4A 4HAGA 5D2NB 2VL5A 4JY5H 3TA3C 5B39B 2CLZA 2MPAH 3BWAB 5JNYA 1X5KA 3OKEA 4G8GB 2HG5B 3KYMB 1NL0L 2C9AA 4ODVL 1YQVH 4M6OH 4IRSD 4S1DC 1QSFD 4RMUA 1NBZA 1AO7D 3RTQC 5C0GB 4DGIH 2J6EL 1UM6L 2G2RA 4Q9RH 5EN2B 1C08B 4LSVH 3GMRA 5IB4A 1NC2A 3HC0A 1BGXH 4XVSL 4Q9BA 1Y18A 3GIZH 5I75B 1BJMA 1DANT 1F58L 4JFFB 4KTEL 3KVQA 4FFZH 2NXZC 4KKCC 4BQ8A 5DQJA 1T0MB 3TT3L 2XFXB 4FQ2L 1G9NH 4AL8L 2YD3A 1XGUA 3D39A 4U2ZA 5BQ7B 1A6VH 3MLZH 2VC2H 4GKNB 2EZ0D 5HHOE 3TCXA 1FV1A 1KEML 4XP4L 4CNIB 2BY1A 5I66B 2FJFA 4JFXA 4I2XE 2MCPL 4NO2A 1CDGA 5GSRA 5D5ME 4F37F 3CFCH 3NAAH 5KSUB 1EEYA 2HJLB 2HT4D 4ETQB 1QFOA 5DRNA 3ULUE 4NO0A 3W9DB 3D69B 3WN5B 3IU4H 4HV8B 1P5UA 2JJTC 4XRCA 1NGYA 3T2QA 4PG9A 1LILA 4LQFL 3VRJB 1ZS8A 2HTKC 3S3JA 8CGTA 3T2OA 1JGVL 5T3XD 5HDQH 3RFZC 1FFQA 4RGOH 3HUJA 4NQUA 1B2WH 1FG2A 1MAKA 1H3PL 5CHNA 3T65A 1U6AL 4KAQL 3O8XB 1F4WH 1A3LL 4JM2D 2NTFA 1B4JH 4JJHA 4X5XB 1PW3A 3L3IB 3WIHH 5CEXA 4LGPB 1NUDA 2FGWH 2YN3A 1WCBA 2BOCB 3AFLA 3OXRB 2RFXB 3ROLB 3DMMC 4ZDHB 3RZCA 4UQ3A 2Y6SC 1AHWC 4LAQH 3TN0D 3U30B 3JUZA 4K7FA 2FYYA 2ADJA 3DXAA 3QO1A 1A6AB 4WU5B 4MDJA 3BD3A 5EBGA 1FQ9C 4N8VA 3S6CA 3ESVF 1DLHA 2DQHH 4Y4HD 3RJQB 4HZLB 4CMHC 4YR6A 1NQBA 5C0EB 3OJDB 3ZT6A 1I9RH 4MAUH 3LKOA 1B0WA 4WW1B 4QCIB 3AUVA 3TH2T 1JNNL 3NIGE 3FRUB 1OAZL 1MHCB 3W5NA 1ULVA 2X4QB 4KGJA 2NY7H 1HN1A 2FZ3B 2NY0B 2W9EH 3ZYOA 1FRGH 3I9GL 4UUJB 3SPVA 5KANG 1EHAA 3QFJB 1DQML 4AT6A 1FPTL 5I17B 4RDQG 3NGBB 1UA6H 1RUQH 1FNHA 2YA2A 4QHUA 3ZKXC 2OK0H 4UDTB 1SYSA 3V4VH 1HXYA 1AY1L 2UY6A 5MENE 1T03H 4FQHA 1JNJA 1U8PB 2HYMA 3WJJA 3AXLA 5GS3A 3THMH 1TVHB 2BSSB 4O2CA 1JV5A 3UTTA 1IAIH 1QEWA 4U6YA 3S3SA 1EFXA 1FVCB 1S7UB 4HWBA 3VI3E 4G9DB 2VDKH 5CSZB 4HIIB 2WIIB 4GW5B 2DQDL 3BZFB 1HINL 5I8OL 4A6YL 5ADPL 4QRTB 3NZHH 3VXRA 3MCKB 5C0FA 3G6JF 3SBWA 4OZHB 3QXUA 1WC7B 1JHTB 3MOBH 2FX8H 3H3PH 2ZCKH 2QJDA 3GBLA 2VH5H 2IAMD 3A67H 5SWZA 2VTFA 4J3UA 4FQLL 1NLDL 2HVJA 4HKJB 1CL7I 4FRWA 4RRPA 1CFQB 4XC1H 1LP9E 2P7TA 3KPRA 4X98B 5IHLB 2IF7A 1T4KB 3C08H 2EH7H 5SX5H 1KPVA 3CX2A 4PRNB 4I0CC 3OAUL 4JDTL 3OJMB 3WV0A 1R5WB 1U8IA 4LSTL 3O41B 1P7QB 5EU4B 2HN7A 2ATPA 4P3CL 3MLSL 3MNZB 2XOTA 1H9VA 1MCJA 1HQRB 3ULVH 4E42B 4H20L 4O2FB 3NCYS 1N7MH 4LEOA 3FAXA 3LDBC 4XP6L 4PGEB 1S3KL 5FYJL 3N1PC 4Y1AB 2WBJD 2HA1A 3C60C 4FNLH 3FQWA 1F4XH 3VA6A 3HFMH 3OB0H 3REVA 1TQBC 5E03A 3VFPB 1KGCE 3O2VL 1QRNB 1FC1A 3MC0A 5CD5D 2WV3A 3OKNB 3U0TB 3FCTA 3SE8H 3G6AA 4XX1E 3NCEB 4I48A 5BZWB 2GK0B 3BHBB 1GGYA 1RMFH 1MPAL 3JV4B 3O4LB 4PJBB 5TDOA 4M7ZC 3BKYH 4HPOH 5DMGC 3SDXF 4YNYA 1KELH 5INCA 3FQNB 1T1WB 4K71C 3BYYA 2FX9H 3JWDH 5DUBB 1CBVH 3IKCB 1J18A 1EPFA 5IJVB 3FB8A 3E8UH 3P0YH 3NVQA 4J3WA 3C8KB 12E8L 3CJJA 4OTXH 4YGVA 3V5HA 3LV3B 2VZOA 2UWEE 4M5ZH 5FUZL 2ZSWA 2DRUA 4J3VA 2CDFB 3H6JA 2X89D 3IFPB 1EO5A 1OQOA 1WEJH 3KR3H 4U6XB 4MJ6A 5K9OA 4X6CF 4WI9A 1N0XL 2VYRE 1NBYB 4FXKA 3B8YA 2XZAH 1X5AA 1TXKA 3O6MH 3DVGB 4KRMB 5E8PB 5AYUH 4HFUL 2RCSL 4JPVL 1RZGA 2CQVA 5IIEA 3HE6A 5KTEL 4O02H 2EIEA 1AXTL 1KB5A 4LGRB 4ODWB 4BFBD 25C8L 2ATKB 4XVUC 3O2DA 4OZ4A 1JRHI 4Y5YB 4PRDA 4PJGE 4WV1B 1YPZB 2R1YA 3QUYB 1NFDA 1WCQA 3TJEL 1RZKC 3QIUB 4QHKI 4UB0H 3HMWH 2WUCL 2BVPA 3B2VL 3T09A 3ZLQC 2VAAB 4N9GA 4AQOA 5EBLB 3AS3A 3QQ4B 3MA9H 1T89C 5F7YC 4UT7L 3D0VA 2XA3A 4PJXF 1N0LA 5ICYB 5JDSB 3G08B 4PJHE 2N7BA 3W0WA 4XPAL 5IKCB 4QTIH 1FGNL 3LKSB 3DVNA 5D7LB 4M6AA 5DD3H 3UYRL 5JIHA 4TVPE 5EO9B 1ORSB 4HLZG 1NLBH 3P77A 5IV2A 5HGDB 1MFEL 1EHLL 2GJJA 3RWHB 4RWYH 4HWBH 4N8CL 5IEHB 1P2CA 3VWKC 2DLTA 1GGCH 3CFJA 5KSBE 2AP2A 1BX2B 1I8KA 3QH3A 1A5FH 1SJHA 5DRXB 2YSSA 1TIUA 2CMRL 3B43A 1GHFH 5LXGH 3LN9A 1JTOA 2BNRE 5JA9A 1BOGB 4KUZL 4WU7A 5FB8B 2HVKA 1UWXK 4J1UA 4KKLD 3DETD 5FHBH 4M5YL 3MRHB 4Y4KB 4JQIL 4Z95L 5HD8D 3VFGH 4Z5RB 5ID0A 2D03H 2XG4A 3SKJH 1YQ2A 3L7EB 1JK8A 3DTXA 2NY1B 1QR1B 4U3XA 4LVNC 3T3ME 1T7XA 5ESQA 1C8PA 3BH8B 1MHHA 3JWOH 2NY5L 1NCAH 3U0WH 4LLWA 4F7CB 5F3HB 1MAMH 3C6SB 1URLA 2ZUUA 1OP3K 3QXTA 4PJCE 4YC2B 4IRJB 3DRQB 1ETZB 3OR7B 5D7KD 2XKUA 5F97E 4NNXA 1NC4D 2NXYC 3D25A 5J12B 2B20A 5KVGL 1CD8A 4XNMB 1BJ1J 2OP4H 3UJJH 1J12A 3RU8H 5LJYH 3CX5J 4P2QA 5IVXB 2YKLH 2I9TA 3UTQB 2FBJH 5GSVB 2BVUA 3L3DA 4UOW0 3ABZA 1NGXA 3MRKA 2R0LH 3ARFB 3PJSB 5KBNC 4MA3B 3O3AA 2E7LC 4GRWE 2AJ3B 3LS5H 4BH7A 4MAYC 2I60L 4LDOB 1HCFX 5FECB 4JB9L 2BVOB 2HT3C 3MJ7A 1H3XA 1KPRA 5BRZE 4OQTH 3WO4B 3O6FC 1CK0H 15C8L 3SQBA 1WK0A 4OZGF 4N5EC 1EV2E 2Z92B 5T1DL 1BEYH 1P1ZA 5A3ID 1YY8A 3KHOA 4DTGL 4OD2A 1F4YH 1B6DA 2X4RB 4M6NL 4NZTH 5C0RH 1BP3B 1HOCA 1P4BH 3BKCL 4NJAH 4AIZA 1AGEB 2DQFA 1AO7A 1SBBA 1FC2D 2DL9A 3EYQC 5D1QB 3RHWF 1IC4L 1BZ7A 4BUGA 3ECBB 5J56B 4KV5E 1L7IH 1RHHA 5JUEH 4JZOB 3NPZB 2X9WA 3CFEB 4X99A 2B7DT 5C09D 3RWFA 5FKAA 5C9KA 2EKJA 3D2UD 4HWEH 4OZIA 1A7NH 1V3LA 4K3DH 3GI9L 1HHIB 1HILA 4J6RL 5J57B 1F6AB 3I84A 5L7XH 1E27A 2E6JA 2CKBA 3DBXA 3ZE2E 2NZ9C 1A4JA 4G6JL 1AFVL 3S4SA 4PJ9B 4WHYH 4AYFA 2E7HA 5HHXL 1HKFA 1JZ2A 2WWKO 5I15H 3GRWA 3PQYB 2XIDA 4RFEA 2CUMA 4NHUA 1N6VA 1UQSA 4FZ8L 4G42B 4NPYA 5TE4H 2ZUXA 2VDRH 1YEEL 3ZDYE 5DEGB 4X6DB 1IGFH 3FO2A 4X8JB 4JRXE 4M1CC 5KJRH 4O51B 5F44A 2BVQB 3MNVA 5I1GL 1EJOL 1IAOA 1EHNA 3X14B 4M1DH 4PJDE 1OAQL 4QRPE 3UYOD 4LBEA 1D5ZA 4HIXH 5DJ6B 3LZFL 1FVDA 4JFYA 5CCKH 4JG0H 4RAVB 3RVVD 4HC1L 4GLRH 5TE7H 3WSQH 4FQQA 4LLMA 4F2MA 1CZ8L 1T7YA 4U1HA 3MV9E 4TTDD 3EDJA 4FQ1L 4JO1L 4D8PA 3QWQB 3QIWD 3FFCE 5HHOD 3TN0A 1JTPA 4OB5L 4TSBH 3RTQD 3A6CL 2C3VA 1MFAH 2A74B 3OXSA 4RMQA 3TO4B 1U42A 3ULVF 3VMOA 5GS0L 4M48L 3DI2B 2C3WA 2MSPA 3RGVD 4HULB 4Y4HA 4Y2DB 5DJ0B 3FN0L 3ULUD 2M1KA 1NKRA 1OF2A 2V5SA 5FDYA 4Z7VE 4JN1L 1K4CB 5KSVA 1ONQA 3IDNB 3TCLA 3RVXD 4WDIA 4H0HB 4OIAA 3RDTB 3MXWL 2D7PA 4X6EA 3LMJH 3QWRA 1I1AC 4BKLA 1X9QA 3FOMB 4KKBC 4PJBF 2XWTB 3T08A 4RGNC 3KPSE 1ZK9A 4M7KH 4GQ9L 5GRUH 5J13C 3B2UD 3TIDA 3F58H 5DD5H 3VXUB 5ICXA 5H35A 1G9MH 4O4YL 2A6DA 1RK1A 3CMOL 1EAJA 5E8EA 3J8F7 5FYKL 5F9WB 1AGBA 5I6XB 3ET9F 3SDCD 3NH7L 4XB8A 5GS1B 3H9SB 1CVSC 1PDKA 2NY3D 3LKRB 4FQXB 1TQCB 4GUPB 3WFDL 1BIIB 3QWOB 4MD5B 1C5CH 3LQZB 2BNQE 4W81A 2DI7A 3G5VB 3MMEA 5DHXB 5D7JD 4YHYC 4KQ3L 3BP6A 1OT1A 1BIHA 4U1GB 5FHAL 3OKOB 1I1FA 4RGNE 1FIGL 1U8MB 2F54E 3MSPA 4XBGA 3IDGA 2VXQH 4LLUA 4MCYB 3HI1A 1W0YT 1TZHB 2VWEE 5T3ZE 4ZUUA 4R4BA 5GRYA 1JF1B 5LAXB 1F11B 2IAMA 2BCKA 4KVNL 4PBWD 2XV6B 4Y16C 3QDMB 5DD0L 3PF2A 5D71H 1LHZA 3DUSA 4LLQA 3T0DA 3UP1A 1WWAX 1MHEB 4ESKA 3GKWL 4R4NC 1M05B 2A9NL 1YPZF 5SWSD 5DYOA 5LCVL 3MPCA 1OD9A 2I26N 4G6FB 1C5BL 2XNAB 5JPMA 1G7MB 1ZVSA 5ADOH 4IRSB 4R7NA 3RNKA 1L7TH 1KLGB 4ZPVA 3JXAA 3BZEB 1KTLB 5LGKA 4PRPA 5HDBF 4HS8H 2XA8H 1AE6L 2FO1A 4P2RB 3VWJC 3FB6B 3NFPA 2PXYD 4PTTA 2DTMH 2FD6L 3WE6B 4YK4B 4HKZA 5B4MC 3OHXB 4PJIB 4ZSOA 4YHOL 4AEIH 5C0JA 2DQCL 1N5YL 3S8WA 2YOCA 3GSVA 3F7VB 5C0NC 3QFDB 3R06B 3QA3B 4OIBA 2OI9C 1NDGB 2Z8RA 4BFIB 1NGZB 4P4KC 3O2WH 4ZAKD 1KG0A 4LCWB 1OP5H 1N64H 3HB3D 1I3RA 4Z7OE 1KBGH 1ORQB 3FO9B 4ZFOA 3KYNB 1ZE3C 1NAKH 5CLWA 4FS0A 4PIRF 2EDXA 4GFTB 2VQ1B 3UC0L 3C5JA 2GJ6E 1JUFA 4ZO8A 2EIZA 1DVFA 2BY3A 5LKNA 4LHUA 2VXVH 1HK6A 2R2HB 4LF3A 5GGVL 4TNWK 1C7TA 5T1KA 1BFVH 5C6PB 3QCVL 4Q9RL 2X89A 1OGTB 3KYAA 2HFGH 4JM2B 3RBGA 1QKZH 5TPWH 4ZFFB 4J2XA 1VENA 3BP5A 1I1YB 4XNYL 1AGDB 4GBXB 1XGQA 4U7KA 4GW1B 43CAB 1KGCD 3O11A 4N8VG 1G6VK 1A6VL 3AY4A 3MLZL 5A16B 2J8UB 2VC2L 2QKIB 4J4PD 2VDNH 1KXQE 4JFEB 4P5KA 1KPUB 3K8MA 1LE5A 1F3JB 1YEDA 3S5LG 4D0DB 1S7VA 3CFCL 5B21A 3IETA 4AIOA 5HI3C 3LS4L 4MMZC 4WEBH 4YHNA 3IU4L 3X11A 4Z7QE 5HPMB 2HFFA 4YFEA 3QDJB 3HZYA 3P4OB 3MLYH 3OKLA 4WEMB 4NKDB 1AC6A 3LKQB 1T83C 1S78D 1A14H 1SMAA 1MUJA 1B2WL 4JVUA 4U31A 1BLNA 2EIBA 3UXFA 1F4WL 2BRRH 5DMGD 3OKKA 1SJVA 2MJWA 5D7IB 3EYFA 4F57H 1MI5A 2FGWL 2AV7A 3RX8A 5GXBB 1UM4H 4D9LH 5E4EC 1RPQA 1NEZG 2PTUA 3U79A 3PV6B 3L5JA 4HS6A 4XCEB 2PNDA 1J5OH 4MZ3A 1GC1C 3PWUB 3QDGA 5EUOB 1PQZA 2XQYK 1CDBA 1TVDA 1UXWA 5JW4N 3ARPA 4JN2A 4O5LH 4W6YB 2EDRA 1CFVH 1RZ7L 1FZOA 2XTJC 4P5TD 5DFVD 4RRPG 1R5IA 5JOPE 3AB0C 4XNQB 2OR8A 5E1AA 2XI9A 2X4SA 4NBZB 3QUZD 3QAZC 3RX5A 1BZQK 4K3GA 1I9RL 2EE3A 4NFBA 1YEKH 2JIXB 1BAFH 4ODHH 4PGCA 5HGGS 2YBRA 1RIHH 3CDYA 2FEEL 2N1KA 3V6OE 1H3WM 2NY7L 4IDJL 3QEHA 4YBQD 4UZGA 2V9QA 5KSAC 3DURB 3RWCA 1JNLH 2IG2L 2YC1A 2DL2A 4P23B 3HG1B 1NFDF 3TNNA 1LE9A 1A7BA 1QYGL 2X4UA 2J5LB 1KEGH 4TVPD 4KQ4H 4OIIL 1MCFA 4OSUL 1FDLH 1RVFL 3FT4A 3QNZA 4AMKH 4X6DF 3GSRB 4EDWL 2CRYA 4I0PC 3THML 1J1XH 5GISL 3VXPA 4E41E 2F53A 3EFDH 4R3SB 2V2XB 5CP3H 1I4FB 1QPXA 4S10A 4KI5E 4QRQB 3CFDB 4Z18A 3UDWA 1RU9L 2B1HH 4ODXB 5FOBB 2BNRD 2J12B 1K9TA 1KF9B 2YZ8A 4PS4H 3AMLA 3WHXB 2FX8L 3H3PL 5B38B 1DQJA 1UXSA 5HGBA 4DKDC 1A7QL 1ZKAA 5C0BE 4JPIA 4WJ5A 1T3FA 2YXMA 3UBXB 3CCHA 5DGRA 3I75B 3TZVA 5BV7C 1NMBH 4QTHB 2FWOA 4X7SH 4K3EH 5EOQH 3QDHA 1GYAA 1GOGA 4IRZH 4XI5C 5E2JA 3Q6FB 3T0BA 1RIVH 4LU5L 3TV3H 1IM3B 3HE7D 4P2OD 4HWNA 4HCRA 5IVZA 1VADB 1WGOA 2EDNA 4PY7B 5I19H 3W39B 1UT9A 4UDUB 3S36X 3HRPA 1T5WB 3T4AA 2W92A 2XWJA 1RZJL 5C71A 2AKRA 4L3EE 4P9MH 3VJ6A 4GAGH 2P4AB 3B9KD 5HPOA 3ULVL 1A7OH 5F96H 5TH2A 1N7ML 1T66C 4KGLA 3EAKA 4YIQB 3MUJA 2M26A 3BIKB 2X4PA 1RUAH 3UDWC 2QADC 3FN9A 1JPSH 1PZ5B 4HJ0D 5EUKB 3T1FB 1F4XL 1IEBA 3E2HB 3HFML 3D2UA 5I0ZA 4MXWH 2W38A 4UOJA 3MYJA 5C08E 2IADA 3TZVC 3MUHL 4F3FB 5F1SA 1RMFL 2NYYC 3A6BL 4W4OC 4NO3A 1U8NB 3HPLA 4LPWA 3GMLA 4EOWH 1AD9A 4WI5A 1NBVH 4X6FB 4N0YH 1KELL 1N8ZA 2Y4SA 1IC7H 2HH0H 3MRCA 2QQQA 2FX9L 2J8HA 4W6WB 3IJSB 5DK0B 1BFOA 1MCBA 3K46A 4U3HA 2DQJL 5F9JB 5DHYA 5D1XC 3P0YL 4MJ2A 2Q76B 1M7IA 4ONOA 3BT2H 3FQRA 4OTXL 4BFEA 5A2IH 3UAJC 5DRWA 5F1OB 4OF6A 3BPNC 1I3GH 3PHOA 2C3XA 3QHFH 4OJFH 4XZUB 4D2NA 2R1XA 1WEJL 3KR3L 2YHGA 2ZOKA 5CEYB 2ZP0T 5BOPA 2ARJB 2UUDH 5DTFB 2GYSA 4GMTH 3RIAK 5AYUL 4M6ML 2NW2A 4Y8DC 3QEQA 5E5MB 4APQC 5A43C 2COQA 3N85L 1SMOA 3O4OC 4MA8H 5ANMA 4UIMA 3QIWA 4G6ML 1I3UA 3DSFH 5IWLC 3CFKA 4MD0A 4U1NA 1RJZB 1GSMA 2RBLA 2IBZX 5JIIA 3IJHA 4EJ1C 5DA4A 1Q1JH 4NN6C 5HYEA 4Q58C 1K6QH 1Q9LB 1WTGT 5E5RB 5A40E 2PTTA 5D5MA 3NFNA 1YMHA 1U8OB 2MQ3A 3MJGX 3RGVA 5MEOA 4LK4A 4P4RB 1P53A 1XGYH 1Q8MA 2N7AA 3T77A 1WBZB 4N90E 1OP3H 4OZIF 4TNVK 4Y5XC 4HK3N 2G9HA 4ZUTA 2E27H 1ZGLM 3LHPH 4ZFZA 4WVRA 4EDXA 5F9AC 3MA9L 4H26B 3LQAH 5CBEA 1R3LB 3SDAB 3C2AH 4NQDE 3O0RH 4OUUA 1MCWW 4IMLB 4JRXD 1U8HA 3DX9B 4NJ9H 4ZXBD 3AGVA 4M7LH 1TDQA 3TO2A 2IMNA 5AG8A 2P5WE 4QRPD 4OCSL 3RPKA 4BQBA 5GRJL 3L9RB 4RFOL 1TCMA 1A4KA 2NX5B 4MHHG 4N0FB 5HY9B 1S7WA 4LASL 3ROOA 4HGWB 1CL7H 4LVEA 2CLVB 1U0QA 1WFTA 3KS0J 3UTSB 2VKWA 4RWYL 4HWBL 1LD9B 2DMCA 3KYOB 4YHIA 5F70A 4HWUA 2A77L 5C9JA 3NA9H 5FO8B 4ODSH 1FNAA 2VLRB 5ERWA 4M1CD 2AERT 5D7JA 1H5BC 1A5FL 4PRIE 3OKMA 4NNYB 3JWNC 2I9LB 5J6HB 4H25A 2JB5L 4JM2F 4KC3B 1LEKA 1BQLH 1T22A 3QB7C 1QA9A 4ZS6C 3BPLB 3QJHA 1AQDB 5FEBA 5FHBL 2H26A 5JO5B 3GBMH 3SKJL 3WIFA 3L5IA 4QRUA 1SEBB 1G7JB 2R2BA 1C1EH 1B0GA 4HIEA 1XIWC 1S8DB 3OGOE 3CVHH 3QZWA 1CGUA 4Z7NF 4HUUB 2A83B 4MS8C 3K7UA 3T0EC 4JRYB 4OI9A 3JWOL 3KPSD 1NCAL 3FFDA 3U0WL 1CFNB 5HI5C 4KRPC 5SWSA 2FL5B 3CPLA 2VITB 3BDYH 2O5ZH 4NUJA 1HZHH 1XR9B 2PYEE 4Z76B 5EG6C 4UTBH 4YHZL 4XVJL 5IGXL 1AR1D 4LCCC 5CJXA 1G7IA 4DKAA 2E8ZA 3KJ4C 1Q9KA 1MCDA 1MELA 3G5ZA 1I1AD 1BQSA 3Q5YA 3UJJL 4ELKA 2AV1B 2PXYA 1ROWA 2IH1A 2JELL 3T0EE 1BD2E 5FYLE 2F54D 2XZZA 2YKLL 5C09B 5D7IF 5KVDH 5ACZB 3S4SG 1KCKA 1YNKH 1UFUA 7FABH 3F12A 2D0HA 3ULSA 3QDAA 4JKLA 4QY8B 4CVZA 1B0RA 3MNWA 4BJLA 5EUOF 2P46B 4ZAKA 1HHGA 4YBLB 3VFNA 2BOBA 4OQTL 1CK0L 1T7WA 5BVJA 1KACB 3HI6H 4I0KA 2CUHA 1BEYL 5EOTA 1F4YL 3BESR 1QLFA 3MZTA 1R3KB 4DQOH 1I7RA 5C0RL 5CJXC 5T33H 3VFTA 4HX1A 1JRHH 4QO1A 3M1BA 3LSOA 4LL9A 4JHWH 5BXFA 5T1LB 1R5VB 4YDJA 3GJFB 5ISZA 2ADIA 4WW2C 1L7IL 1QSZA 4Z7UA 2DICA 4DGYL 1LNUA 5C7XH 3SGJA 3V7MA 3TA3B 1A64A 3ALPA 1DLFH 5LBSH 5B3JE 3OG6B 1A7NL 3CFBA 5ELIA 2G5RA 4K3DL 4NN7C 5DJAA 4GG8B 3IU3A 2OTUA 1W0WA 1T1ZB 3MFFA 3MRBA 3O2DL 4P9HC 5GS2H 1WZMA 2HJFB 3CMGA 4M3KB 3SHSA 1HHKA 3VXSE 2EDEA 3ZSSA 1SHMA 5DJ8B 5HHOB 3JTTB 2HP4A 3FQXA 3RTQB 2D9QB 4QXTA 1EIBA 1AP2A 3OKDA 2C1OB 3ULUH 4GJTB 3H2WA 3LN4B 3GJEA 3HRZA 3C6LC 1KN4H 1CE6B 1QHOA 4P5MB 4UT6H 3SCMA 5I15L 4PJFA 2NXZB 1G84A 4X80H 3MV7E 4XNXH 4HDIA 3TBTB 1A1NB 5E8NB 3MV8B 5FO7A 3QXDA 5LVEA 1YJDH 5IHZB 5KJRL 2JJSA 1DQQB 3IDIA 5GRXG 4HS3A 4KPHL 2NTSP 4R0LA 1UACH 5CJOH 4M61A 1XF3A 2UY7A 1N5AA 4HT1H 3RWDA 5C0AB 5I1IH 1NGWB 1FZJA 3SDCB 4POYA 1TITA 5CP7B 2Z35A 4KTYA 3T2PA 2MQCA 3TBVA 4OUOA 1HDMB 1ZWIA 3TPUB 1MFAL 1FNEA 2IC2A 1NC2B 4KJPC 1IARB 1RURH 5EORH 3HC0B 1FVEB 3SCMC 1RZ8A 3SDYH 3D5OF 3S9DB 1XF4A 1HCVA 3LD8C 4MXVF 4KRNA 1EGJA 2C3GA 4CADA 5DQJB 1LGVA 3LQMA 3FQTA 3QUZA 4NHCL 5I76B 3HNSL 2FIKB 3D39B 3NZ8B 5DC9B 2BVTA 1LK2A 5IROA 2E8YA 3D0LB 1U3ZA 1MCCA 3FL7A 3GNMH 3DMMB 4PJAA 4POZD 2Z9TA 1JPGA 5CIPH 1IQDB 2FJFB 1AHWB 3I85A 2R4SH 5H94B 1Q94B 3MLXH 4MX7A 5GSRB 2VAJA 4R0LC 1EEYB 5CIPB 1ZV5A 1DEEA 3RWEA 3F58L 2B1AH 4NO0B 3NCFB 1G9ML 1G7QB 1I85A 5HI3D 1T1XB 1PGRB 4CMHB 1ES0A 4PG9B 2QQKL 3WS3A 3QUKA 5KZCD 2CIKB 2ERJC 3N50A 5MENB 2R0WH 4X0KB 1TNMA 4OLUH 4LSDA 1WBYA 1YECH 3HUJB 4M8QA 5TQ0H 4X5WB 3MR9A 4JPWL 3VCLB 1XCTB 1QVOB 3EO0A 3BIBX 3R4DA 2NTFB 3BGMB 1BWWA 1KCVH 5JOPD 2V2WB 3WKNA 1KCRH 2EXYC 2Q6WB 1VSCA 2CDGB 3ZKXB 1J1PL 2V5TA 5I8EB 1E4KA 1JGLH 2NY6D 2YR3A 3S36L 4LGSB 5AZEH 4CVWA 2EKSB 3BMWA 4OV5A 4PJEE 5HVWA 4XMLH 1IE5A 4K7FB 2FYYB 1IRAY 1JGDA 1DN0A 4LHUG 1IVLA 3VFWB 1DCLA 1JZ7A 2IFGA 2H9GB 2HKFH 1C7SA 4OCWL 1LO4H 1I85C 1U8KB 3HE7A 4J8RA 4P2OA 4G6KH 1S9XB 5DVKA 1QBMH 4XCNA 4GOSA 1BBJA 2I25N 2BXZA 5IMLB 4H8WC 1XR8A 4F58H 3OAYK 4QYOA 5ADOL 2V2TA 2R1WA 2APVA 4NO5A 4FP8L 5HYSA 2F5BL 4PG2A 5J6GA 4OBRA 1VEPA 1FYTE 3W11C 1AGCB 5IUSA 1W72A 4HS8L 1SQ2N 1I9IL 2EDYA 4KI5D 4UBDC 3IJYB 3BPCB 5K33A 1BOYA 1NCUA 4BH8B 4KMTH 3Q3GB 1A2YB 1KIRA 4I9WE 4QHUB 3BXNA 1AD0A 2H2SC 1K5NB 1SEQH 1A6ZB 1Y6KR 2CKBL 2A6JA 3CLEL 3EYSH 1MVUA 1CT8B 5I1DA 3QNYA 2CK2A 3MA7A 5JLZA 5BMFH 1A6PA 1GL4B 3O2WL 5DJ2B 1TZGH 2CLRA 1EFXB 1MFDH 5IR1B 4OLYH 3SDXE 3L3JB 1N64L 3LDBB 4PJ5D 2EDTA 1KBGL 3GRWL 3UO1H 1IBGH 2X40A 3ZYZA 5IW1A 1X5HA 3N1GC 3QUMA 3VGEA 3ARED 2DTSA 2A1WH 3BVNB 3C60B 5C0FB 1A9EB 4Q9QH 4V1DE 5TF1L 5T1MA 1QP1A 2B39A 2JKXA 2DD8H 1TQBB 3L3HA 4L1DA 1YY9C 3FT3A 5T3XL 3DUHA 4J3OC 1L4IA 1KTKE 5DDHB 5SWZB 1G9EA 4L3ED 1ZLUK 5DURD 2VXVL 4Y5VC 3KLSA 4RX4D 1TJIH 2DQGH 2R0KL 4G80B 1BFVL 4YHPB 5HYQB 5HVHC 3TM6A 1KYOJ 2UWEB 3UTPE 1ZANH 1KENH 4L9LA 1D6VH 2HFGL 4M7ZB 3VFMA 5HYFA 2J8OA 1CU4L 4NKIH 3ARVA 2C26A 4J23A 2ITCA 4K71B 1GVIA 1CQYA 5EO0A 1FYHB 2FECL 2GFBA 3U1SH 1PG7H 1MIMH 1G7PB 2YD8A 4GRMB 4ELMA 2NZIA 3HC4H 3L7FA 4FG6D 4OFYD 2X4OA 5C08D 1QACA 5A2FA 4XNUH 1T1YA 5CMAB 2VDNL 4LEOB 1XF1A 5EIIB 3TYFA 1YEHL 5IFAH 2IANA 5EC2A 1SJEB 1IGIH 4YO0B 2OL3H 4A2MA 5IG7A 1XFPA 2OL3B 3BZDA 3REVB 1E4XH 3BAEH 4CRPA 3O6LL 1U8QB 4G8FA 1G1YA 1CICA 1SJXA 1TZIB 1X4ZA 4I48B 4YE4H 1Q0XH 3K80A 1DANU 2R9HC 5KN5A 4OM0H 1JWUB 2FRGP 2G5BB 2GEEA 1A14L 1MJ7H 4HGKC 4L9LC 4MZ2A 4G9FE 2D7TH 3ZKNC 1LK3H 3QR2A 4PJHB 2OZ4A 4JCLA 4YNYB 3X3FH 4TVPH 4Z78A 1S5HB 1RZKH 5LGHH 4G8EA 3VDAA 3OZ9L 3CXHK 2ZSVA 4IOFD 4AENA 5CGYD 3PWVB 4YDIH 3VA2C 4D9LL 3PHQA 4R4FH 1KCLA 1AKJA 4DCQB 3ARWA 3FOLA 4PBVC 3PP4H 5ILTH 3CSGA 1V3JA 3EW3B 5IFJA 1J5OL 1U9KA 5D1XD 1YEFL 4U1MB 3V5HB 4GMSH 1E6JH 1FAIH 3M07A 3ARDD 4UT9L 4MQSB 5KSBB 3LIZL 5IBTL 3D3VE 4HG4K 4Q2ZA 2VLJE 4JFFE 3ARGC 3MLWL 3V7AE 5EB9A 3VXMD 1GAFH 2BNRB 1A1MA 5DQ9A 1DUYA 5AG9A 1VACB 1X5XA 1CICC 1FL6A 1FE8H 3IRZA 3L5XH 4BSVA 1X4YA 5E7BA 1U3HC 4UV7H 2VSDA 3T4YA 3U7YH 4NQDD 4U1KA 2CKNA 4KDVA 5DZOA 3VWKB 1JNLL 1QSEE 4OCNC 3IAQA 2FEDC 2Q86B 4K8RD 3SE4C 4ZNEE 4GXVH 1MCKA 4I5BA 3V52L 1M71A 2P5WD 3AM8A 4BA8A 2GHWB 4FFVC 3ULUF 1KEGL 1FO0A 4ZFGH 5GZND 3U36B 3F7RA 2R23B 3EHBD 1F3DH 5SV4A 3H7BA 4F7PA 4F7MA 3BP7A 1J1XL 4OD3H 2W9LA 3D0VB 4Y19A 1UB5A 2Q8BH 1DFBL 1FFRA 2BHZA 5F9OH 3GHEL 3CSYA 1UM5H 4LVNB 4JO3H 2UVFA 5E6IA 4PRID 5KVEH 3C9NB 2A6IB 4DWHA 3F7YA 4MVBD 4Z0BH 1DBBL 4LPCA 4PTUA 1JMXA 1YN6B 1DSFL 3BI9X 1BVKA 4PS4L 3BQUD 1I7ZA 2ZOLB 4NT6B 3TPKA 2ID5A 4GRWH 1MH5B 1FL3B 4IHOA 2Z31A 4R2GC 3WJLA 2IGFH 5JR1L 4KU1A 5FA4A 1KJVB 4XMKH 4GRWB 4PGZA 4KVCL 4TPRL 1V3KA 4L8BB 2NXYB 4ZFOL 1I8KB 4K3EL 5EOQL 3L1OH 2Z4QA 2KZWA 1RIVL 3Q6GH 1VGEL 4NYLB 4PJ7A 3D18B 3TV3L 5BRZB 4ONGH 2OR7A 4X4ME 4YFLI 1CLZH 1PFCA 1JHLL 2CRMA 2FJGA 3SGEI 4ZS6D 5CZVH 1S9VA 1ZHKA 3NIGF 4WY7H 1JK8B 4P9ML 1YEJL 1A7OL 5F96L 3FB5B 4MJ5A 2GTZB 5LG1A 3QFJE 4MAYB 5E6IC 2YUXA 2I07B 3QXAB 1N3NB 5F6HJ 4LSQH 1UCBL 4LLWB 4MWFA 2QHRH 2EXWD 1JPSL 3MUY1 4MNHB 3T0ED 3P3YA 4WO4A 3DO7B 1BD2D 3UPRA 4ZODA 2LABA 4NQSB 3O6FB 5I74C 2DDQH 2Z31C 5DJYA 4JJ5A 2EO9A 3JZ7A 2Y36L 2DQIH 1S7QA 1S7TB 4MXWL 5C0CD 2WP3T 1JWMB 3DSNA 4L4VA 1FL5A 1PKQA 5C0IA 2W60B 2NY2D 4LCYA 1NBQA 3K2UH 3VI3F 4EOWL 3PV7A 2QQLL 1JHKH 4NKOB 1F90H 1NBVL 1I8LC 3B5GA 4CW1A 4OZHE 1IC7L 3BP4B 2A73A 3BN9C 3DGGA 1YNLL 1K4DB 3L3DB 5KS9B 2R0ZL 4H0GA 2AJYH 4TQEH 5ID1A 4QRSB 4YHLL 3BX7C 4BH7B 3BT2L 4FN0A 2HJKB 4LSPH 1FZMB 3NMEA 3MLRH 5D6DC 4DUVA 4I3GA 4N0UA 1I3GL 1LP9F 4OJFL 5DS8A 1P69B 5F1NA 1UH2A 4ZXBB 4WO4C 1R3JA 3GMPA 1ZSDB 4I8DA 2VDOH 3WFCH 3Q1SL 1QFUL 4OF5A 4TNWF 4PJDB 4NGHH 4QRPB 4XWOC 1IL1A 1OCWH 3PABA 1P1ZB 2CK0H 3A6OA 1YY8B 4GMTL 3FMGH 3F7PC 3BSZH 5MHSE 4X4XA 4D0BB 5TF0A 1HOCB 3ARSA 3KPOB 3CDGB 3VE0B 3D87B 3FKUS 4M03A 4MA8L 5CZXC 2DQFB 4L5FL 3MV9B 5JW3L 1MWAH 2B8OT 3SKNA 3DSFL 4HMDA 1QOKA 2W0LA 1EUUA 4Y1AE 1CXEA 3FFCB 2ORBH 3ZL4H 2F8VA 2J88H 4EN3C 1MWAB 2AJXH 1Q1JL 4G7YH 4MQTB 3MRGB 1WVZA 3S96A 4U7SA 4PPTA 4GXUM 1QFWM 4Z0XB 4YXHL 3RWFB 1PG7X 4JKWA 4QHLB 3NFSH 1GPOH 1M1SA 3BH9A 4K3JL 4L1HA 4CDHA 5F89B 2EYRB 3ARBD 4OKDA 5DHVA 5E99H 1OSZA 3JVGC 3C5SA 3O4LE 4WTZA 2WMPA 5GQBA 3DBXB 1KT2B 5EBWB 3JV6B 2ZCLH 1IM9D 3TYGH 4NQXB 3S4SB 3S97C 1V5JA 4JDVB 1J8HE 3KPSB 1HH9A 3V2AR 1C16A 5ETUB 4NC0B 4JAMB 1EZVY 4NM4H 4KK5C 4PLOB 1PX4A 4RFEB 3GHBH 1D6EB 5B8CA 2WIMA 1CL7L 1QFWI 5JOFA 3PP3K 1NCTA 2AJZB 2AEPH 3TIEB 2Y5TB 4ENEC 2H2PC 2DM2A 3KPPA 5LQBH 3V6ZA 4QOKB 1JE6A 4DKEH 3NA9L 4F15C 4H1LA 1Q0YH 4ODSL 3VXOA 4KTDL 2UWEF 5E56A 2BNQB 5ESVB 1I1AB 2NR6C 5HHQA 2J6EA 4JFOA 3L3GA 1RUKH 5T5FH 3BO8B 2BSTA 4RGNB 2F54B 2IPTL 1IKNC 5J13B 5T3ZH 5MEQA 4MB5A 2AXGB 5F7KC 1M7DA 3IYLW 3DROA 2YA0A 1HSAA 3TJHC 1FFPB 3SDDC 2HKHL 1MJUL 5EOCH 5EU6E 2VE6B 1FJ1A 3CVHL 3HC3L 3KXFE 4HCRL 3QCTH 2C3VB 3OXSB 3G6DL 5MP6H 4PJGF 4YHYB 3C09C 1MOEA 1XMWA 4GO6B 3SJVD 4JPKH 4OCYH 5JPNB 4DUWA 3PGDB 1CFTB 2ZG2A 1N2RB 4GG6E 3PE9A 4PY8J 2GUOB 3EGSB 1QQDB 2VIRA 4Z7WA 5KAQF 2E9IA 4X5LA 2O5YH 5JORB 1BQHA 2BFVH 5DWUL 1MF2L 3FHQA 4Y16B 3IFLH 2MFNA 4PJHF 3EBAA 3H42H 1UVQA 5CWSA 5E9DB 2HRPH 2VL4A 4YJZL 5H35B 4JGJA 1LDPH 4NFCA 3R0MA 1A3RH 3O45B 1VKXB 1R3IL 4RNRA 5CFHA 2OSLA 5J9PA 3GEWB 1UZ8A 1YEIH 4LLVA 2DM3A 4FTVA 1KYOK 2UYLA 1B4RA 2FHBA 1X4XA 3H0TA 1JP5A 5KSBF 4F33A 1K3IA 5CINL 4PJ5A 3TFKC 3MUGA 3SKOA 3ELAT 3VWJB 4XBGB 3IDGB 3PWLB 3AREA 4DN3H 4LNVA 1LO0H 3VDCA 1IAMA 2RHEA 4PB0H 3ZSTA 5I30H 3BGFC 3MJ9H 4GKSA 3VFUB 2FATH 1CCZA 2GJ6B 2XQYG 2BCKB 3EYVB 4JKKA 2E7CA 4RX4A 3CXDH 1MRFL 2EYTB 1XAUA 1FYTD 3FQUA 3SO3C 3DUSB 2OI9B 3MYZA 3WBDA 5DVNA 4LLQB 4ZPTB 3T3MF 4P4KB 1QNZH 5AAMA 1INQB 2ED7A 4GRLD 3REWA 5DYOB 5C7XL 1S7XB 3N06B 2YRPA 4I9WD 3MV01 4M7LT 4NC2B 2R69H 3AS2A 5JPMB 4PJCF 3P0VL 2I5YL 4CMMA 1YNTA 2W0FA 4OFYA 4QT5A 2QQNH 2XWBA 4XAWH 1OAUH 4DZ8A 1JZ5A 5JXED 1RUMH 1HNGA 4NNPH 5IVXE 3ULUL 4KK9D 4Y8AA 3QI9D 3ILQD 4X8XA 4UT6L 4FFWD 4ZSOB 4C55A 1V7NH 4V1DD 3FB7B 4X80L 2J2ZA 4XNXL 2GW5A 5EH1A 2WK2A 2H1PL 5FKPA 4GRWF 5GGSY 5CUSH 1ZGLB 1YJDL 4RQQA 1QUNA 5ACMA 1OAYH 1KG0B 4M1GL 4B5EA 4PGBA 3UTPD 3LRSB 32C2B 3FTGB 1ZT1A 3UZQA 2WWMC 4K94H 4HT1L 5AZ2H 1JUFB 2EIZB 3CDFA 3SQOH 1LEGA 4HUKB 1TETH 1UYWH 3RIAF 4LF3B 1MJJA 5T1KB 1I1CA 3RVTC 1AC0A 3ARDA 4NUGH 2VDMH 1QLRB 1KN2H 1EBPA 1MNUH 2ZG3A 3WO3B 4PRHA 5GGSA 4HUXA 4KV5F 3SDYL 3VXMA 1MCSA 1G0YR 5FOJA 5DUML 5CJQL 1XGQB 3QISA 3T0WA 3G5YB 1LO3H 2ENYA 1CXIA 2HMID 4MCZA 3VMNA 2B0SH 1CLYL 2HLFC 1CF8H 5E4EB 3EDDA 4KROC 1GC1H 1ERNA 2YXFA 4KK6C 4L4TE 3KYKL 4KDTA 4NQDA 2XN9A 2AABH 1WAAE 3ZE2F 5M95B 2R4SL 4G9FD 3B3IB 5E2WH 3MLXL 4B41A 3GI8H 5FDWA 5HYSG 3GMNA 4F8QA 2P8LB 5JQHC 2B1AL 3RKDC 2XTJB 1GGTA 4G8GD 4YHNB 1Z5LB 3X11B 3AB0B 3DUUB 5HGAA 3P2TA 3QAZB 5FV1L 3ZDYF 4OAWB 1CDIA 3P4NB 4KMLB 5CILH 3CZFB 5IF0A 3OBAA 3HI5L 4QRRE 1D5MA 3VFOB 4NZRL 4E41B 2M8XA 1GXEA 1U8JB 1LO2H 1ZVYA 2DQTL 3B5HA 3AMKA 5KSAB 2VLJD 2R2EA 4F7TA 4JFFD 4PRIA 1KNOB 4PJDF 1MFCH 1VERA 1KCVL 1KCRL 1P5VA 1NFKA 3BE1H 3U4AA 4QHNB 2R4RL 4PUBH 4LHQB 3MUZ1 2AJVL 4S2SB 1T20B 3L95B 5GJSH 1JGLL 5F8RC 3TNMB 3FN3A 3C2SA 4KZDL 2OXHA 5TDPA 3KPNA 2KL6A 5AZEL 4I0PB 3QDGB 5C0BB 2BDNH 3ARZA 1JGEB 4ETYA 4XMLL 3X3GH 1UXWB 4B7IA 4JN2B 3LKNB 4LSUH 1QSED 3PWJA 1R5IB 5GRZA 1SM3H 4NRXB 3ARGD 4G6KL 4JZJC 4X7DC 5I18H 1HEZA 4LKCB 4BELD 1QBML 2OJEB 1X6LA 5BVPH 1AI1H 1S9YA 4F58L 1R24A 4Z7VF 1UC6A 2NW3A 2SEBA 3VD3A 1A47A 4UTAL 3T3PE 5HI4D 4HZAA 4L3EB 2XY2A 4MNQE 5SWQB 4XXDA 5BV7H 1A7PH 1S9WA 1U3HD 2QV2A 3MCLH 5D72L 4ZQKA 3UJIH 1OB1B 3O8XD 2GJZA 5BV7B 5JHDE 5KG9B 1EEZA 4I77H 4WI2A 1TTFA 2ZJSL 3TNNB 1LE9B 3QNZB 3H9SE 3EYSL 5C0CA 3INUL 2FGZA 1FZKB 3UX9B 3HAEA 3W9EA 4ACPA 3RY4A 1TZGL 1MFDL 2ICEB 3DV4B 5GGRB 4OLYL 1EMTH 5C07E 4IBLT 3VGAC 4QNPE 3OR6A 1PYWB 2QADB 5C86A 4TSCH 5J4MA 1M6OA 5GRVK 1A9BA 4QWWC 5BO1H 3MRMA 4OLWH 5H37H 4DW2H 1A1OB 1DDHB 3HNVH 4HUWA 2DD8L 4W6XB 1QR4A 1UXSB 2DQUH 5HGBB 2DQEH 2HFEB 3QDME 2LVCA 1AJ7H 3MREB 1T3FB 2NY0D 3QUXC 3CCHB 1TJIL 3TZVB 5L0QC 4GH7B 3QFJD 1XGPA 1OD7A 1MCPH 2X4NB 1I8MA 4NQEA 3M8OL 5IB2B 4LKXA 3GMOA 5F7DA 5GGUA 5IVZB 4S1QH 3L3KB 3TESA 3GO1H 2ESVB 1KB9J 1KULA 5IB3A 3TBWB 4OCXH 1PG7L 2XWJB 3QNXB 5IQ9A 4WWKC 1KC5L 2FBOJ 3VJ6B 3WXWL 1U95A 5D1XB 3MLVH 5CLTA 4EUPA 5HDOA 2PW1A 3I6LE 5IFAL 4LCIH 3U4EB 4YZFE 4XNZC 1WFOA 1IGIL 2X4PB 4E9LA 1EGJL 1CWVA 3GM0A 1KJMB 4XHJC 1P6AB 3BPNB 5E95B 4CDGC 4PJIE 4XPFH 2D0GA 1TJHH 4HFWB 4P0DA 3MRLB 3I2CL 4HKBB 4KHTH 3GK8H 3FJTA 1MIEH 2EE9A 3SEPA 5IMOA 2LVEA 3MYJB 4JO4H 4APQB 3ARBA 4YE4L 1Q0XL 4I3SH 4JKPH 1VEOA 1F13A 2XYCA 4IIQA 4C83A 1U41A 3O4OB 1FG9C 1KJ3L 4BYHA 2VERN 4PGDA 2D7TL 4JLRB 3HZKB 2NY5C 1OM3H 1UB6A 3KPQB 4Z7OF 3X3FL 1N8ZB 4TVPL 5DFTA 4K55A 2P8PA 5LGHL 4NN6B 2OS7A 2P5WB 3BKJL 4ISVB 4OV6F 5IBLC 4DK6A 2AW2A 1P7QD 3I6GA 1VFBB 5E94B 4YDIL 2WBWB 1Q9WA 5DHYB 5ILTL 2AI0H 3AU1B 1RIUL 4Y5XB 5DJCA 3DO3A 3FQRB 4WUUE 3GSNH 3IS0X 3MXVH 1P84K 3CH1A 4GMSL 1P4LA 1FAIL 2E9JA 4Y1AD 2QSTA 5SX5K 1WFNA 3GSNB 3L5HA 2CR3A 2UVEA 4JM4H 2ICWJ 3RVWD 1GAFL 3RVUC 1N26A 3OF6A 1QRND 3C5ZA 4ONHA 4U1LB 3B6SA 4YDVA 3QEQB 1QTYT 1LO5B 4NWTH 2XRAH 1FE8L 3U9PL 2J8UE 4IIQC 2K3TA 2YEZA 3UCRA 5ANMB 1OGAE 4JFEE 4BQCA 2DWEB 5CZXD 3O4LD 2G75B 3IGAA 4Y4FC 3N9GH 3X17A 4KKNA 5DEZA 1J8HD 3FT2A 3OB0K 3MJ8A 1H5BB 4RZCA 4D3CL 3ILPA 4LLYA 3WLWD 3SJVA 5IQ7L 2XQBL 5FM4A 2PYEB 1OW0C 4Z7QF 5F3BB 1IGTA 4HIHA 4YQXL 1JWSB 6CGTA 1W72L 2X9YA 4OD3L 3DRTA 4WFGE 4P3DB 5IVOA 1CGWA 4PJ8C 4Q0XL 2P8MB 4X7EC 3I02B 1ZA3A 3MRQA 2IBGA