3FMGH

Structure of rotavirus outer capsid protein vp7 trimer in complex with a neutralizing fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
221
Chain Sequence
b'QVQLQQSGAELMKPGALVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSINYNEKFKGKATFTADTSSNTAYMQLNSLTSEDSAVYYCARNHGSPDFHVMDYWGQGTSITVSSAKTTAPPVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab of neutralizing antibody 4F8, light chain
publication title Structure of rotavirus outer-layer protein VP7 bound with a neutralizing Fab.
pubmed doi rcsb
source organism Simian rotavirus
molecule tags Immune system
total genus 43
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fmgH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fmgH02
1P2CB 3ARBA 1WBXA 2D0HA 3LSOA 2DDQL 3F7YA 4WUKH 4JFED 4M4PA 1P7KA 1CD9B 2Z93B 3GUTA 4KHXH 1JTOA 2VXTL 2DRUA 3CZJA 4Y4FD 2OJEA 3SKNA 1WCBB 4FZEL 2DF3A 5T3XD 1KN4H 4ERSH 4LLVA 4MS8C 5C09B 1XR9B 4UTAH 3IETA 1N7ML 2F53D 5KVEL 2X7LB 3SDDB 3P9LA 1RD6A 5DLMH 2X4SB 5CHNB 1R0AH 5I1GH 2J5LC 4QYOB 3UJIL 1BQLH 1EMTH 4AT6A 4NQDB 1FE8L 5D71L 3KPTA 4GSDH 3VFOB 2OTUB 1WAAF 3TNMB 5TE4H 2VXQH 5HGGS 4EI5C 2K7QA 4M00A 4JO3H 2FWOB 2F8VA 2ADGB 3EYVB 3LPFA 1G7QB 1T83C 3C87A 1G9ML 2H3NB 3SCMC 3VXRB 3X3FL 5ACMA 4JHZA 4JAMB 1UZ8A 4HZLB 1FFPB 2LFGA 3JZ7A 1XF4A 1CZ8L 4KKBC 3RGVC 5KN5B 1KJ3L 2ZG2A 3QNZA 1GH7A 1LD9B 5IW3A 2HT3D 4HUXA 1OWRM 2OTWA 3O6FC 3WXWL 1EEQA 4MQTB 2OL3A 1LO2H 5C0BA 4JM2F 1QLRB 4LFHD 4N68A 5HD8C 1ODAA 2PTUA 3OX8A 2R8SH 1N0XH 1GZPB 4PJ5B 1AR2A 4LEXH 3T0AA 5KSAB 4Y16B 1NCDH 4PG9A 2FLRT 3BKMH 3U0PB 3CFEB 5IT2L 1RULL 4G7YH 1EDQA 4X5XB 2X70B 2R23A 5E8EA 3OKKA 3WFZA 2VDPH 3NTCH 4XBGA 1OSPL 2M1KA 5EA0H 5HDBF 2FD6L 1RZJC 2R15A 4P2RD 1E4WL 5EOCJ 4D8PB 1NCBL 4LSPL 1CLYL 1MUJA 4G8IB 2P44B 1T2XA 3P0VL 4NGHH 4G7VL 2B5IB 4FFZH 3RPIA 4QXUL 1A4JB 3Q5YA 3KPSA 1JZ3A 1D6VL 5MI0C 3RL2A 5DYOB 3DRQA 5EIVA 5JDJA 3DX9B 5GGQH 4DFHA 3LZFL 1EEYB 1OPGH 2XFXA 2R4RH 1CXIA 3QXAA 1TJHL 4LLUA 2CDFB 4AIOA 2CPCA 4LDLB 1QNZH 3LMJL 1V5JA 2R4SH 2OXHA 1J05A 3RZCB 3MOBL 4MA8H 1IGYA 1JNLH 3GBNL 2BVTA 3UBXB 4JQXA 2FHBA 5D2LF 1A3LH 3ARED 5IKCA 2H2PC 2YRPA 5CMAA 3UO1H 3IU3B 35C8H 2CKBB 3ILQC 3MBXL 4KRPB 3WD5H 2XIDA 3HR5B 5D1ZC 2XN9B 4ELMF 5CWSB 1I9EA 2X5PA 1OAQL 3PWJA 2D7MA 2PO6C 3ARUA 1R6VA 2EE2A 1WZMA 3FQTA 5EC1A 1BHGA 5FB8B 4Y4HB 4XC1L 1N8ZB 4QHKJ 3QFDB 4NZTL 1HN1A 5BMFH 2DWDB 4NM8H 1NDGB 3JTSB 1U6AH 3V6OC 3FTGA 5JHDE 1EERB 1MY5A 1BZ9B 3G5ZB 4CGTA 5HJ3B 2M8XA 2O26U 4MVBD 4XPFH 4FTVE 2PYED 1B6DA 3WS6C 5CAYB 2YWZA 1ROWA 5D7JB 4GKZA 1MFDL 4UINH 4BK5A 4C56B 1G6RL 3L6FA 4U6HA 5DJDA 3U30B 2DI9A 4J4PD 4QRUB 1OAXH 4MMZC 4UV4H 3QWRA 1X4YA 5I1IL 1MCKA 4WU5A 3KYNA 3AAZB 3MV7D 3OAUL 2PYFA 4Y4KA 4RA0C 3UTQB 2ZCLH 3QRGH 3GO1L 3QQ9C 2C3XA 2QLVB 2YD9A 3FAWA 4PG2A 4XP9L 3MC0A 4ZPVA 1BD2D 2EDWA 4F7MB 1QSFB 3QQ4A 4O5LL 3N50A 4OLXL 5EO9A 5FO7A 1H5BC 5EBWB 4C83A 1NGWA 1T1ZA 2XXCB 1CU4L 1DTUA 1LK3H 4Z7VE 3VXSB 3KGRA 4RWHA 5T1KA 2F58L 5E8OA 4HEPG 2VLKE 5E8PA 6CGTA 5H94B 1PYWA 3PIQB 2OL3L 5CSZA 5D70H 2VQTA 2GTZB 3QI9B 1Q9OA 4DUVA 2AXFA 1EEZA 3O2WL 1H15B 3PGFH 5LAXA 1M7IA 1JPGA 4H1LA 3N06B 1UZ6F 4OT1L 4KRMB 4PBWD 1R5WB 3B3IA 1DQJB 1CE1H 2VITB 1TQBB 3MRCA 3IVKB 5L2JA 1FNHA 3FB7B 1IKNA 4HH9A 4Y1AE 3KVQA 5GXBB 3EO0A 4G8FB 1JHTB 4G42A 3O41B 5D8JL 1Q1JH 3RTQD 2EE6A 3N9GH 3MRGB 1ZSDA 4W4OC 3OB8A 5D96C 5JHDA 1IGIL 1MFBH 3BH9B 4HUWB 3JBG7 3X14A 4ZAKD 4XZUB 4HG4J 5EUOE 4HGWB 4L8SA 1RUAH 2SEBB 4XH2B 3RX5A 2BC4B 2B1HL 4P2CG 1FZJA 3H3PL 4FTVA 5HDLA 3QSKB 3MLZH 1ZGLB 3MRLB 2HLAB 3BYTA 4DN4L 4GMTH 4LAQL 1MCLA 5JOFA 2F9BT 1NCWH 3NFSH 3D3VE 1DFBH 4X5WA 1CCZA 4AJ0A 2YC1B 4JGUA 4R4FH 1KN2L 4YIQA 3DMMC 2UY6A 3ORJA 3KLSA 4TVPD 1XCQB 4N1EA 3TVMD 2I9LB 4YHOH 4NYLA 4BFGA 2ZOLB 2QQLH 2YR3A 4CDGC 1Q9KB 1BEYH 1FH5L 3D85B 3NCBB 1OSZA 1KCKA 2Q86A 3Q6FA 1U8KA 5DQJA 4JFFD 1DCLA 4YFLI 4Z7VA 2VLJA 1KGCE 4MA1B 4EN3D 4PYHA 1EIBA 1JE6A 2VLKA 4P4KA 5FM5M 3QJHB 2RIKA 1YEHH 4LU5L 3RVXC 1BGXH 1HHHA 5TFSL 5FYKL 2BRRH 2C7UA 4NQEB 1ND0A 2VLRE 5IBTL 2AAVA 1BZ7A 2KZWA 3BE1H 3ARPA 5IQ9A 5F3HA 4XNZC 1RURH 5DTFB 1UM5H 1QTYT 3ARFC 3V4PL 1S5HA 4MDIB 2IGFH 1EVTC 1EFXA 1EFQA 3TO4B 3S35L 4WHCA 4ZTOL 1RY7B 3HCVA 3CK0L 3LEXB 2LE9A 2AKRB 2YPVL 1MHEB 4C58B 3FN0H 5DC4B 4M6NH 3CZFA 5EUOA 5EZJB 1OTSC 2AQ3A 3FMGH 2DWEA 1EAPB 4YX2H 4M5YH 5I8EB 2R1XB 4KKLC 5JW3L 2R2EA 4X0KB 1Q72L 4Y2DD 4TN9A 4U1HA 3E3QC 4XP4H 3EHBD 3MUJA 3D3VA 4QRSB 1OAUH 5FXCH 3SJVD 4PJ9D 3GSUB 5BRZA 3PWVB 2E6QA 2HFEB 5TF1H 4YEFA 4Z7OE 1U2HA 1GGUA 3WIIH 2FEEI 4XBEL 1QG3A 1QR4A 4M5ZH 2DM3A 2M26A 2G2RB 4U1IB 1FVEB 4XP5L 4Z0XB 43C9A 2IH3A 3BPLB 1FQ9C 2NTSP 1UGNA 4PJIF 3V8OA 2NLJA 4QRRB 1JGVH 2ED9A 4JFQB 2CMRL 2WBWB 4FFYH 5E9DE 3S35X 3U4BH 3P4NB 5FO8B 3DO3A 4R90H 4G80A 5MERB 5GS2H 4EDXA 1I8KA 2AEQL 5DJ0A 4F15C 1S9WB 2HN7A 3ETBF 1JWMA 5C7XH 1CGVA 5E6ZA 2AJYH 2HYMA 4UIKL 2VLRA 2R0KL 4CKVX 2V5SA 1MIML 2AJUH 1RAMA 1T1XB 2X41A 5TDPA 5ICZB 2BNQE 4OI9A 4E5XB 3IAGC 1CLOL 1HH9A 2NNAA 3T0ED 1FFNA 3PWPE 2WIIA 3NFNB 3A67H 5DMYA 3GMMA 3C60B 3O2VL 1ZXQA 3SHSA 4HWEH 4E42B 1IILE 5D93C 4HIXL 4MAUL 1MWAH 3MREB 2H32A 1JK8B 4J8RB 4EEEA 3BSZH 4W81A 5D7SH 1N4XL 5DJYA 1KPUB 1IZJA 3OG6B 3ARDB 3ZDXF 1U92B 1PKQA 4DW2L 3KJ4B 4D0CA 4Q6YA 2VIRB 2EYTA 1XT5A 3BPNB 4ZS6C 5IR1A 1WT5C 1CL7L 1RFDH 4M1GH 1A0QL 2G60H 4CU8A 1RU9L 1T3FA 1IKFL 4FXGB 4YHKL 4YK4B 1XH3A 1NAMH 1YC8A 2VE6A 1N2RA 1CXHA 2CO6B 2AEPH 4JM2B 5E94B 1CG9A 5FKPB 5C1MB 3LY6A 5FYKD 4D9RE 1XGYH 2DBLL 4LCCB 4S1DC 3UBXI 4I5BA 3TESA 2BSTA 3VWKD 3P4OB 5EO0B 1NGQH 1T21A 5HVHB 4LBEB 1MSPA 3EYFA 1MLCA 4U1GC 1CT8B 3WEXA 5E9DA 5DEZA 3B5HA 3RFZC 5FHAL 2AK4D 5E95B 2HFTA 2JK5B 1I1AC 4F7PB 1VESA 1CF8L 1YEFL 5I6XB 4XMPH 4P23A 4N9GB 1F58H 1ZHKA 2YD2A 4NKMA 3VGGA 2IMMA 4P2OB 5EZOL 3JWDL 3W11C 4PJ8B 4YHNA 5EZLA 1P9MC 4B5EA 2BNQA 2IH1B 4D0BB 5AG9A 4L1HA 4NC1E 3EJYD 2VDMH 4MAYB 3PWPA 1WBZB 4YHML 2F8XC 5F1NA 4ZNEE 4FQQB 3DROA 4J3VA 1MQ8A 1UFUA 2MSPA 5AUMA 1YDPA 1UWXK 1MCRA 3ARBC 3QFJD 3IF1A 4XCCH 4QF1B 4BFBD 4X4XB 1A6AB 3O4OB 4HF5L 2W9EH 4LKXA 3ABZA 4LRIA 1NBVH 2E5EA 4WW2F 3OJDA 1GGBH 5D2LB 4M6AA 4H20H 3VFUA 2C1OA 1U8QB 5J1SC 5JHLH 1AIFB 3NABL 2EDXA 4ELMB 1ZANH 5E4IA 3C5ZD 2PR4L 3PUCA 1H9VA 4PR5A 2PXYD 4WTZG 5A16B 2XQBL 4HKBA 4X4ME 1AJ7H 4RNRA 3SN6N 2FO4A 5LGHL 1JI1A 1MHHB 2VZSA 4F9LC 3PXJA 2NY3D 4G43A 3L3IA 3K1DA 1S7UA 4AENB 2FHFA 1IC7L 4AQ1B 4GBXB 3VWJB 4P57B 3LKSA 3W5NA 1U8PB 1D9KA 3LH2H 5I1AA 1QVOB 4XPGH 2QHRH 1BZQK 4KJPD 1JIBA 4WU7A 3ZKXB 1J86A 3UCRA 1XF1A 3BH8B 4R97C 1T6WA 5DC0A 4NBZB 1SEQL 1UWXH 5CCKL 3AMKA 4F80A 4XNQA 3SQOH 3DJ9A 5ISZE 3IAPA 1X5KA 4F33B 1P1ZA 3O11B 3TNNB 1A7QH 4ONOA 3PF2A 2BSED 7FABH 3LDBB 3OKOA 1I8MA 3ROOB 3ULUE 3MFGB 1BBJA 3T2NL 5C0ND 4IDJH 1NFIB 2YPLB 4Z95H 3PV6A 3UXFA 4YR6B 4HS8L 4UV7L 4ZNEA 2BZDA 4ODXB 1RVFL 1PY4A 4X9IA 4FABH 2A0LD 1AGDB 3BO8B 3C2AH 2IFFH 4L3EB 5C0GB 4YUEL 3IDYC 1I8IA 2AV7B 3I9GL 4WUUD 1BVLA 4QRTB 4MNGE 4XC3L 5DMGD 2FH6A 1D5MA 2Y6SC 2Y4SA 2J8UF 1HWHB 3GJEA 3B9VA 1DR9A 3KNBA 3VD9A 3VI3E 3MMEB 1T03L 4J3WA 1CDIA 2P8LA 1QEWA 5DR5H 3RY6A 4MYWB 3I84A 1KB5A 5DD3H 4Z7NE 4G9FB 5EORH 2A1WH 1JP5A 3EOAA 1GGYA 1QSED 2HJKB 3MV9B 4ODWB 1TNNA 4X4MA 4O2EB 4MJ2A 2DM2A 2J3SA 3UBXG 2V7HA 5CJOL 5CBEA 1CD1B 1LEGB 2DL2A 1V05A 3SKMA 3RJDA 3VE0B 4S2SB 1U42A 3TBYB 3MO1A 2NMSA 5F1SA 1DN0A 3R1GL 1T0MB 1N5YL 3TF7C 3VXME 4IOIB 5CINH 2E27H 3QO1A 5GISL 4MCYA 4YXLL 1ZA6B 2J4WL 4ZD3H 1MH5B 3C8DA 5KZCD 1P6AB 1OAZH 4G6AD 4KDVA 1KTDA 4JQXC 4JRYE 4Q0XH 3EYUL 4LSRH 5ISZA 3STLA 1WLHA 1MHPH 1BIHA 2EC8A 4LHQB 2R29L 1K8DB 3CIQA 1PX4A 6FABL 2C26A 4ONHB 3T2OA 2WWMD 2A9NL 3S96A 2A6KB 5E2UL 4M6OL 1AD9A 2EDJA 3C8HA 3ZKND 5TDNA 1TQBC 4ZUSB 5DHVB 3RHWF 3T3PF 1WICA 1A7RL 1CFQB 2Z92A 1WEJH 4PLKC 2DI8A 5TQ2H 2BY2A 1BJ8A 1T66D 3ECBA 3U0WH 5ACZB 2C4XA 1P53A 4MNGA 2F5AH 2IQ9H 1MAML 1YEIL 1Q0XH 5JNYA 5HHME 3QAZC 5C6TH 4QHMA 3IJSB 5GRXG 3PWNB 1KBGH 3WKML 4JJ5B 4MXWH 1TJIH 1VFOA 3KJ6L 1SJXA 1F11A 3QWOA 5T3XE 2IALA 1MCJA 4LNVA 1AO7B 4WDIA 1NL0L 5M95B 2ITCA 2BY3A 3EUUA 4Y4KC 1ED3B 2WWKO 4LDEB 2G5BB 1INQB 4GW1B 1WTGT 3MPCA 4JFHD 1HI6A 3MRBB 3VXMA 1P7QA 1R5IA 3C09B 3RIFF 2WLYA 2X4TB 5IM7A 3TN0A 3NGBB 4M61B 3WFEL 1HXYB 5D7IE 1CK0L 1W72H 2YD3A 4JRYA 1I3UA 4QXGH 1T22B 3QUMA 3FFCB 3VGHA 4OFDA 2GK0B 4YHYB 3WNOA 4MDJA 5F97E 4LEOA 1YY8A 4K2UH 3H42H 4YDKL 3QCUH 1IEBB 3D0LB 1EO7A 2BOCA 3P2TA 1P6FA 3DPBA 4RX4A 1C1EL 4EBQH 5I1DB 5K59F 3QUKA 4PJIB 3IFPB 3DUSB 1IKNC 5GGTH 2IAMB 5HVFB 5DHXB 5LCVL 3FQWB 1PZ5A 4GRMA 3KDMA 1W0VA 3L7FA 4QHNA 5KW9H 4CJ0A 4JFOB 4EDWL 3H0TA 3QDMD 2VC2L 2B0SH 1KB5L 4EUPB 2FGWL 4IRJA 1Q9LB 1JRHH 3LD8B 4P3CL 1BM3L 1FIGH 1JWSB 4GQPH 1G7JA 5IHUL 5HGAB 4Y5VB 4D9QD 1R3HA 1VFAA 1ONQA 2VRAA 3BZEA 4PRNA 4HT1L 5FHBL 5DRZB 4P2RE 4OI8A 4BQBA 3NH7H 4RBPK 4U0QB 3MROA 4B0MM 4WCYH 1V3MA 4TTDD 4JKWA 2QQKH 1SBSL 1PJ9A 3OKDB 1X7QA 1RHHB 1YQ2A 5FFLA 5L88L 2X6MA 4PRIB 3LKNB 3L9RB 1ACZA 4JFDB 1OM3H 2EIEA 1DE4A 1A3RL 4G3YL 1FVCA 1RJLB 3FO0H 4LVNB 5D7IA 5I2IA 5IUSA 1KJVA 4R96A 4TOYH 3HE7B 4UT7H 2DQJH 2Z8WC 1F3RB 3EJJX 5EU5A 4NFCA 3U7AA 4KK9C 1V7NH 3G5VB 4LP4A 5IBLC 3MRJA 5DDHA 4JZOA 3KPRE 4U1SA 4YBQC 3H9SE 4K23L 2NQCA 1A6WH 3JWDC 3WL9A 3MUY1 1X6NA 4P5TA 5DMKA 5DD5L 2CUMA 2R0LH 4NUGH 3PQYE 1D3CA 1CDYA 5FM4A 1K9TA 4DJMA 4G8EB 2FR4B 3WCYA 3RVUD 5JIIA 1HHIA 2FJGA 4FMFA 4JDVB 3OGOE 2HFGH 4M8QA 3R06A 4RBPH 2QBWA 4OM1L 4LSUL 5SWQB 4M3JA 3GBLA 5MEND 2F19H 1KFAL 3WE6A 4GW5B 3HZYA 2K1MA 3AU1B 5E7BA 2JCCB 4CVXB 2XPGA 5SX5K 3ZSSA 4NUJA 4RGNC 3BGMA 2AV1A 1AQKL 4P2RA 1J0IA 1N6QH 5DA0B 1MVFA 2OTPA 2F53B 2YEZB 4NCC1 4XVJL 3O9WB 4FFVC 2RCSH 4WW2B 5DD0H 1MEXH 4Y2OA 5ANMB 2PETA 5E1AA 1MCNA 1RIUH 3QUML 2XTJE 4R0LB 4TPRH 1KJ2A 3TYGL 4X9HA 1PY9A 3RNQA 1XGTA 2Q6WA 2ZUUA 4HBCL 4LRNL 2YD7A 3IFLH 3SKOA 3KPRA 5E99L 2Z31C 1QBLL 3PXHA 2XACC 3IXAB 3FJTA 1QLEH 4NHUB 3H9SA 1BECA 4K3EL 2NCMA 3F62A 1MRCH 4L8BB 1XF5B 4LCIL 3OXSB 1NSNL 3KR3L 2EYSB 3HMXH 1UACH 5IVXF 3PQYA 1YNKL 4LPXA 2WV3A 2ZNXA 3TJEL 1RZGB 2YRZA 1GPOH 4OLUL 3A0OA 4FNLH 5DHYA 5FECB 4NT6B 4NWTH 1BFVH 5SX5H 3EW3B 4OFIA 2X4RA 1V3KA 5MEOA 1CS6A 5F3BA 4R7DA 2BJML 3W9DB 1GHFH 4HXAH 5ENWB 4PP2A 5FUZH 4R2GD 5GRVK 3MXWL 4OV5B 5SWSE 1ZHNB 1B0RA 1JGLH 3BKYL 4ODBD 4HK0B 1BOYA 5BVJA 5GHWL 2HRPH 5C0DA 2KBGA 3KPPA 3HMWH 5EN2A 3SBWA 5KSUB 4XNXL 4Z7WF 2A74A 3CUPB 4PJBF 4K7FA 4W6YB 4X6FA 3S4SA 1OOAA 3KWWA 2P48B 5DI8A 1DLHB 1A6TB 4XWGL 3RL1A 5JZ7D 3RI5K 1OGAD 2I5YH 4KK5C 5CGMA 2H26B 5JXAL 4K8RL 4X80H 4PREB 2HTLD 4JB9H 4XCYA 2J8UB 4WNQB 1HKLL 5B38A 4F2MA 1RUPH 4WGVB 3RX7A 4MB5A 5C0RL 1IC1A 1CGSL 4OJFH 3E6FA 5LXGH 1XIWD 3ZYZA 2HJLB 3RWCA 5IVZA 3VFRA 2A77H 1I7ZA 3UTPD 4RMQA 4PRPD 2DQEH 2FL5B 3QG7L 5DRNA 5LWYL 3BVNB 3ULSB 4I3SH 2XTLA 2IPTL 3FT4B 2NR6D 1FYTD 2JIXD 1N3NB 3C08L 4C4KO 4DVRL 3HLAA 3QJFB 3VFWA 2GSGA 1FNLA 1EO8H 1JGUH 4JKMA 1CR9L 4XVTL 3QUYD 4KKCD 1KJMA 3DXAE 4MZ2A 4OCRL 4UAOB 4PRDA 4LRIC 3GNMH 4AMKL 3QULA 5AZEH 2XQYG 4WHYH 2EDKA 4X8JB 3FQUA 5SWSA 3G5YB 2QQNH 3S37H 2FATL 4QGYA 5KS9E 4HEME 2NYYD 4LQ1A 4I18B 5BOZG 3UC0L 2XZQH 3PABB 3QDJD 5FUOL 1NMAL 4P4RA 1HIMH 2BVEA 1IT9L 1HKFA 1GYAA 3C5JA 1DUZB 3D2UA 4GG8B 1LEKA 4HWBL 4YDIL 3D9AH 2FB4H 1NGYB 2UV3A 4QHUA 5MEPA 2GITB 1K5NA 2R0ZH 2Z35A 3HPLB 4H5SA 4L9LB 3TA3B 4PJHE 4D0DB 3WBDA 4IRSC 1KJ2L 3DWTA 1OQOA 3D39E 1REIA 5C8JB 1J87A 1GGCL 3QWQB 3MV7B 3OJVC 4RGOH 1FNAA 5FAAA 4LKCA 1U3ZA 1I7TB 2VKWA 1HNGA 3GKZA 3OHXB 5CZVL 2WBJA 3VDCA 2B39A 4UB0H 1NCTA 2BSRB 1E4XI 5ALBH 2GJ6D 4XHQA 5DT1L 5FUCE 2R69L 4FOMA 2HWZH 1Q9WB 1A1MB 2NXYB 4KDWA 3CFJB 4QRQB 4Z7VF 3MCLL 2EE3A 5CZXC 3G08A 2FYYB 1A7OH 1U8MA 3GB7A 1IBGL 4XX1E 3DXAA 5IB3B 3FFDB 3BOVA 3MBEB 4I77H 1WK0A 3QIUA 4U7MA 5DQDH 1F4XH 2QKIB 4JVPA 3JUYA 4EVNA 4GT7A 1TMCB 4KTEH 5D2NB 2G9HB 1A6VH 3VMPA 1IQDB 4HIEA 3OBAA 3P30L 1VA9A 3BEVA 4UDTB 5BJTB 4JQIH 5KS9A 2G75A 4LSSH 3RTQB 1CE6B 4LPTA 5T1LB 4OCYH 1XGRB 2XA3A 4ERSL 2VDOH 4ZODA 1EEUA 2I9TA 4S1RH 4CL7A 3BIAX 2PCPB 1JYWA 5GSRA 5DLML 3TPKA 3CH8A 5EUOF 2ADFH 2IBGA 3DX6B 2P5WD 3VMOA 3IDJB 3WNNA 4QTHB 1U93B 4PJHA 2ZUQC 4U1MA 4GSDL 5TQ0H 2ZG1A 4KI5E 4OKVB 4PB0L 2EXYD 1IGTA 4X9FA 1ORQA 5JLZA 5DJ2B 5TE4L 2VXQL 3A6BH 3D39A 1DUYA 4QXTB 3HRZA 3NCJH 1KG0B 3TZVC 1KEMH 1A1NB 2FX8L 5GRWA 2VH5H 5CUSH 3TVMB 3GMPB 4XI5D 5HGBA 5GRZA 3B4NA 3MUGA 3QIWD 2R56L 3CFDA 1G7IA 1C08A 3DRTA 2Q87A 2NY0B 3CXHJ 4NFDA 3GUTB 2AJSH 4MLIA 3TIEB 5BV7H 4OGYL 3ULUC 4JFFB 3UAJD 2O5ZH 2OJEB 4G5ZH 5GGRB 4LSTH 1KNOA 4QKXB 5IGXH 5E6ID 2L7JA 4Y19E 4EN3B 1SYSB 2GTWB 1LO2L 1FGVH 1A8JH 3VXTB 4JG1H 4W68A 1GVIA 3DBXA 1CVRA 1D5BA 4LEXL 4KUCD 2A38A 1NCDL 2VQUA 4LLMA 3O81A 4WV1B 5JPNB 3EYQC 4AT6B 1G6RB 3JV0A 3T0BA 3SO5A 1MCIA 1FIEA 4I48A 3CSGA 2LU4A 1RUKH 5E08H 3NTCL 5ACLA 5EA0L 1NCCL 4TUKH 4K94L 3TT1H 1A2YA 5I1JL 4NGHL 3P0GB 4Y0GA 5CFHA 1LE5B 1XF4B 5FYJU 5FK9A 4HFUH 2EDRA 3BZFB 4A2MA 1RZ7L 3SJVB 4HUXB 1OPGL 2X1XR 4M1CC 2OL3B 4PJEE 1QNZL 3GMQB 4KJWC 3VRLE 1I7RB 1PEZA 43CAB 2FDBP 1V3JA 1CGYA 4MA8L 4AG4L 1DSFH 1JNLL 3PJSB 2DQDH 5CSBA 4KK6D 1KENH 1A3LL 1IGCH 5BS0E 2R23B 2UY7A 35C8L 3GEWB 3MLWH 2A9ML 5C3LD 3BUTA 4XBGB 2NY2B 4Y19A 4YZFE 4EUPG 2BNUA 3HR6A 1DQDH 1JF1A 2H9GB 1MUJB 3BP7A 2VLMD 4MHHI 2OK0L 3AMLA 5T1MA 2LVCA 4LASH 5F72S 3RPIB 4YC2C 3KPSB 3B2UC 4NN5B 5J11B 5BMFL 4M7ZC 3DRQB 1U6AL 2DLFH 3PWUB 4XNMB 5FOBA 3T0EB 2DQGL 2EC9T 1FORL 3RVWD 5IG7A 4MNQE 5D1QD 4GXVH 3JTTB 4L9DA 3CVHH 3RVVD 4IRJC 1RIVH 4R8WL 3SDAD 4DK6A 1HEZA 1L0QA 4BH7A 4WO4D 4D94A 4Y4FC 3QHZL 1TCRA 4HUVB 3NFPB 1RZ8A 4UINL 4FP8H 5IVXB 1JZ6A 3MA7A 3HB3D 3CH1B 3PHSA 5IB4A 2HFFB 3P9MB 4FXLA 3V4VH 5SWZE 1XZ0A 2X10A 4OLYH 3C8KB 4TRPL 3PWJB 1T1YA 4PJEA 3AC0A 1P69B 1TZIB 2FEDD 3S5LB 3MLUH 4LF3B 2PTVA 4OF7A 4K8RC 1CFTA 4URTB 1OGTA 3LN5A 2E9WA 2OXGA 3BD3A 1U58B 1NKRA 4YHPA 2BNRA 1LK3L 4WW1B 4P5MA 2UVEA 5BS0A 3MOAL 3V5DA 4AK1A 3FTGB 3W9EA 4AEEA 3QIBA 4Z7WB 1HSBB 3WN5B 4O4YH 4PJBB 2J12B 4M43L 2R1YA 3PGFL 3C6LD 1QSVA 4WFFE 4N5ED 4P5TC 4DAGH 4ZSOE 1F97A 1QBAA 4GKZB 2GCYB 1KIQB 1CE1L 2HT3C 5DJDB 4ENEC 3MRMB 3FB6A 4APQD 1Q1JL 3N9GL 3BT2L 4JZJB 4MNQA 1MFBL 4HV8B 5DJ8A 1MWAA 3QFJB 2FIKA 5D1XA 4Y5XB 4L8CA 2WWKT 1YY9D 1BX2B 3QQ4B 1XR8A 3FN9A 3KHOA 1NGWB 4DKEL 4GMTL 1T1ZB 2XOTA 2BOBA 3SO3C 1NCWL 2EIZA 2ZCHH 5E8OB 4F57L 3DYOA 5INCB 3RDTB 1PYWB 5FGSA 5SWZA 3C5ZB 1T04B 1NAMA 1JV5A 2RR3A 4UTBL 1SJVA 5A2JH 5LGJA 1FNSH 1Q9OB 2P7TA 4YHOL 5LAXB 3TBVA 2QQLL 7CGTA 4BSVA 1HDMA 1BEYL 1JNHA 5HDQH 4YDVB 4CMHC 4RAHA 2OP4L 3QO0A 3MRCB 4WFGD 5F7LB 5L2JB 1XCTA 4HH9B 1RUMH 4HIJA 5GRUH 4PLOB 1PZUB 4G42B 3V8CA 1OB1A 4RRPG 5E1HB 2GIYA 1ZSDB 3FB5B 3PGCB 4KTDH 1YEHL 5ID1A 1NEUA 3LIZH 5C71A 1AY1H 1AR1D 3AVEA 1JGEB 1S78D 3RGHA 3GMNA 4L8SB 3U7WH 5KG9A 1NPUA 1X5GA 3CSYB 3AREC 3PL6B 3NIFF 4Z18A 1FZJB 4FTVB 4XAKD 4MHHG 4ZSOA 1D6EA 1H8OA 4OBRA 1RURL 1UM5L 3L3JA 5IV2A 2IGFL 1CGWA 4NCC2 5CJXA 1MHCA 4OLWH 5CEZH 5LBSH 5FA3A 5F93C 3VDAA 4YIQB 3NA9H 1WIUA 2B20A 2VDNL 3DVNA 1VACB 1I1FA 5H37H 3FN0L 5FM8A 3I2CH 1CWVA 2HAZA 2I07A 4IHOA 4Q9RL 4NYLB 5I1EH 4G8GE 1W8NA 4WUUB 1GGIH 3FMGL 4FHBD 4YX2L 2ZKHH 3Q6FB 5TE7H 1U8KB 5DQJB 4H0GA 4XP4L 2VLJB 3LKQA 1OAUL 1K8IB 1LO3H 2VLKB 4N0FB 4P4KB 1O7VA 1FRGH 3KYAA 4P46A 5TF1L 1LNUB 1FL6A 1FL3B 4GRWF 3WIIL 5IP4A 4Z7NF 2C7UB 4M5ZL 3MRHA 5EU7C 4KMTL 3REWB 2VZVA 2D0FA 1ACYL 2Y7QA 5IQ9B 4N1CA 3KYKH 4OUUA 3TH2T 1JGVL 2XTJC 2FJFB 2AABL 1VADA 5F9WB 5JW4M 3UTTD 4NIKB 3WJJA 1YMHB 3HCVB 5BO1H 4XPBH 1OT1A 3Q5OA 5KSBA 4EIGB 1T2QH 3WUZA 4I0PB 3J8F7 1LO5A 4PGEB 5IEHA 2C3GA 2AJYL 5IW6A 4CVZA 5EUOB 4O02L 3FOLA 3FN3A 4GS7C 2AJUL 2CIIA 5E00B 5L0QC 5JUEH 4PIRF 4UILL 1NAKH 2X05A 5I8OH 3N1QC 5F71A 2OQJA 3LQMA 2B2XH 3D3VB 1H3TA 3IFNH 5BRZB 2APXA 4HIHB 4HWEL 3I50L 1MWAL 3L3GB 2ESVD 3H8NA 2AXGB 5D7SL 3GGWA 4ODHH 5FOJA 3EDJA 1A9BA 43C9B 5FDWA 5I66A 1VGEH 2B4CH 2I60H 3NZHH 4G8GA 3S7GA 1MIEH 5C0IA 3BISA 4S1QL 1JCKA 4ZAKC 4G80B 1RFDL 3FQXA 4M1GL 1I8KB 2G60L 4WHTB 1FSKC 3DNKA 4NQSB 1NAML 2HN7B 1ZOXA 2AEPL 3O3DA 3SY0A 3NCFB 3NCYS 3ISWA 5MENE 1XGYL 4ZXBB 1M71B 3JV4A 1Y0LA 1LO0H 3KXFE 3MRQA 1ZVYA 4OLEA 1NGQL 3VGAC 4ZO9A 5I15H 4JY5H 3KHQA 1NANI 3B5TA 4L1DA 3ALPA 1CFNB 3GMMB 5A2IH 2ICES 2X89D 3HE6A 1H3GA 4BSWA 2WBJC 5SX4I 4PJCE 4BH8B 4Y8AA 4LNRB 2DB8A 1CQYA 2ZSVA 4MX7A 1NC4D 1PKQB 3MLVH 3LKPA 5D7IF 3C6SA 1CICD 4EN3C 2QR0B 2BVUA 2BHYA 5IR1B 3FCTB 3N1MC 4LSQL 4LARH 2VSDA 2ADIB 1T3FB 2N1KA 1T20A 3QIUC 5HHQB 4KROD 2YSSA 4UQ2A 2BSSB 2B1AL 1GGBL 5TPWL 4C57C 3TWCH 3ZE0F 4KQ3L 4QHLB 1ZGLM 4H20L 4QT5A 3TPUA 1DANU 5HI5C 5I8KH 3EYFB 4RDQF 3ARRA 3WEXB 5B8CA 1DL7H 5T3ZH 3CPLA 1ZANL 1CFSB 1WCQA 12E8H 4JVUA 5IK3A 4H25A 1QZ1A 1E6JH 4Y2DC 3TYFB 4NKMB 1AJ7L 1CGXA 3EHBC 4NWUH 3W0WB 4FXKB 3KXFA 5I74B 1N59A 4PJ9C 1A6PA 4YHNB 3SDYH 1MAJA 4DN3H 1U95A 3I02A 2W92A 3S88L 1S7TA 3PWPB 2ZSWA 5GQBA 3GSWA 3ZYJA 2QHRL 1W8OA 3A6CH 5AUMB 4ZFOL 1G1CA 1YDPB 2Z91B 4X7SL 1UM4L 3LS5H 1CVSC 3ZKSD 5C0AD 4KUCF 2KDGA 1W72A 3AB0C 4AEHH 5J57B 3QUZD 1A7QL 2P45B 2Y5TB 5I9QC 3VFUB 7FABL 2PN5A 2C1OB 3CU1A 3CFBA 4JCLA 4NN6C 2BVOB 1KCVL 3X12A 5DQ9B 1O0VA 4ZO8A 1HYRC 4PR5B 4NQXB 2IFFL 4YO0B 3K80A 2UUDK 5J13B 3E6HA 4RNRB 3K3QA 3IFOB 1JUFA 3EO1A 3ARGA 4JEGB 5GGTA 3F6IA 4KUZH 3G6JE 4G43B 3L3IB 1S7UB 2P43B 3RNKB 4ZOAA 2ZPKH 4B7LA 5IOPA 3TBTA 5DR5L 3OQ3B 3Q48A 1TZGL 1KPVB 1D9KB 4QEGA 2VN4A 5DD3L 4WU7B 1BIIA 4KRLB 4HAGA 5EORL 1I3RB 4XNQB 3R4DA 1TIUA 4NN7C 2NZ9C 2XNAB 4OTXL 3OZ9L 3IAQA 1C5DB 3IXTA 3PE9A 4NQCD 1J1XH 3IDNA 1FZKB 4R26H 1WWCA 5CINL 2VDKL 2E27L 1ZHLA 3VWKC 4DKDC 1CQKA 4HCRH 3Q0HA 3INUH 2CH8A 1UKSA 3F5WA 2JELL 4Q0XL 4AM0B 4LSRL 2UUDH 1VDGA 5HBBA 3DIFA 2Q8BH 1PX3A 4AEIH 3NACH 1CL7I 4HS3B 1AP2A 1XIWA 2V2TB 4UUJA 3EGSA 5ID0A 3VXNA 2FZ3A 4Z8FL 3OV6A 3FQRB 1FJ1A 4KZDL 4IOFD 5JQHC 3H7BA 5EU3B 1H8NA 2BRQA 4KKNA 4U1LB 2PF6A 3DECA 5FO9A 2FSEB 3EJYC 5TQ2L 2P8MB 1OARH 1P5VA 3MLXL 5F96H 2V7HB 2N7AA 1MCFA 1M05B 4KZEH 5CBEB 2F5AL 2IQ9L 1EGJH 4LCYA 1UWGH 1MCWW 3G6JA 1GOHA 3LN4B 5I75C 4H8WC 1LEIA 4NRXB 3MO1B 1Q0XL 4L29A 4DEPB 4PJXA 1DN0B 1CD0A 3M1BA 3LRGA 4L3CA 4CN4A 2CLZB 2FBOJ 4MCYB 1HQRA 1J0YA 2ATPA 3FAXA 3S5LG 3ZKMC 1ZT4B 4R2GB 1TJIL 4EOWH 4JCMA 5L2KD 3E2HB 3STLB 2EH7L 3B6SA 3HI5L 1INDH 2NY4D 1B0WA 3EOTH 2PXYC 4MWFA 4EXPX 5EO1A 3IDMB 1H3UA 1U91A 2XWTA 4HK3N 3S96B 4ZQKA 5DURD 2KL6A 1NJ9B 2NY3C 5TDNB 3HRPA 1FGNH 2J88H 3O3BA 4J12A 1W72L 3BRGC 4PRAB 3BHBA 3ECBB 4PJGF 5C92A 2CKBH 1XMWA 4MNGB 4QXGL 3LQZA 3HG1B 2AW2A 2D9CA 5ITBH 3QIBC 3QQ3B 1AKJA 2D3VA 4TSBL 4YPGA 5D7LB 5F7FA 5HGDA 1R3IH 3IDXH 4MJ4A 2XI9A 4QHMB 1QRNE 1VGKA 3H42L 2BDNL 5D6CA 4GRWB 3DO7A 5FF6A 5E2VH 1YQVH 3GHBL 3O6LH 4PRPB 5AEAA 4LLYA 1ZE3C 2ITDA 1F11B 3U2SA 3QWOB 4BQCA 5C0NC 3HMXA 2P5EE 2F54E 1EK3A 5E8NA 3MGAA 4X98A 1FYTB 2JIXB 4UNUA 3HS0A 2WZPD 3IB4A 2Z4QB 5EU4B 5JQ6L 5KW9L 1FL5A 1L6ZA 1JPTH 2B0SL 2WAHA 3QR2A 3QUYB 1HH6B 3OF6A 1HCFX 5E4EC 5C09D 3MA9H 3LRSA 1P7QB 4R6UA 3SDDD 3AXLB 1T2JA 1JRHL 4G6MH 5CP3H 1B0GA 3MLYL 32C2A 5IM7B 4BFIB 3TN0B 1G9NC 4ZO6A 4JRYB 4NQDD 4PY7A 3QUMB 4KY1H 5IESL 4HUUA 4OD1H 5KS9F 3QDJB 3U9UA 1MELA 1DQTA 2NY5H 3NH7L 3LVEA 1XGPA 4WCYL 1YA5A 4LSVH 2QQKL 3ARQA 2BOCB 1OLLA 3QNXB 4L4TB 4S10A 3EO9L 3VXRD 3CFKB 1OM3L 5E8DL 5F88A 3QUKB 2XZCH 3L7EA 5GGUA 4XWOD 2YS4A 3FO0L 4OLZL 5I76A 5I71B 3UTSB 4TOYL 5FYLD 3ES6A 3KYOB 1NGPL 4OD3L 5H35A 4HC1H 3VD5A 1GC1H 1II4E 4GRMB 3KDMB 1W0VB 1V7NL 3C9NB 3L7FB 3L3DA 4QHNB 3H0TB 3WMSA 5HHMB 1LILA 4YAQB 1QRNA 5IF0A 2XKNA 1KIRA 1A6WL 4Z78A 1EXUB 4PJ5D 2X4QA 5IW1A 3BWAB 5DZOA 5KSAD 1G7JB 2GJ6B 4U3CA 2WWMC 4GXUM 4LL9A 2EKJA 4NUGL 5CJXC 5E6IA 3I6GA 2P5EA 3BZEB 2F54A 3O8XD 2HRLA 4I4WA 1MJUL 5GRYA 1PG7X 3DVIA 4M3KB 4BZ2L 3MROB 2HFGL 1MFCH 5IWLA 1A1OA 1JVKA 4UOJA 1JYNA 1VEPA 1NMBH 1X7QB 2EDHA 2CIKA 4P3DA 4OZIE 3BGFC 5DFVD 1DE4B 3GMLA 3JWOH 1FVCB 2F19L 4NKDB 5D7IB 3U9PH 5I2IB 4R96B 5GGRY 4HGMA 4YBHA 3U1SH 1MRDH 2HG5B 4DGYH 3BZ4A 4M02A 1N6QL 1Q0YH 2COQA 3MRJB 5DDHB 4F7CA 3B5GA 3H9HA 5DZLA 3UYOD 4U1SB 5FM5O 3TIDA 5C2UB 1QFWL 1WSST 3NAAH 1NEZA 1QQDB 3TCLA 3WL9B 1Q8MA 2OM5A 3RZCD 3MYJA 5DMKB 2P5WB 1RIUL 3MLRH 5JW4N 2QSVA 1X5AA 4TPRL 2C1PA 2GT9B 4MSWA 1YECL 1RJCA 4KI5F 1NUGA 3W39A 2LTQC 5E0QA 2XN9D 3QP3A 3EKCA 3R06B 3E8UH 3IFLL 3PDOA 4K9EL 5DWUH 3HNSL 4HKZA 2ZJSL 3QIWB 5K9QI 3UJJH 1F5WA 3VFSA 3WE6B 4Y4HD 1I3VA 3HMXL 4IEFB 4YDJA 3VFPB 1UACL 1H0DA 3BXNA 2DQFA 5E5UB 2BHZA 1F4WL 3SGDI 5CP7A 2XPGB 4GMSH 2AV1B 2ID5A 1P4IL 2VZTA 4QRPE 1DJSA 1MRFH 4NWTL 5E5MA 3SPVB 2BFVL 3S3PA 1Z3GL 5F9OL 1IARB 5IMLB 1GHFL 1Y18B 1AHWA 2EKSB 2XWJA 5D7JD 4OZIA 4Z9KB 3ULVH 2R2CA 3MRFB 4WGWB 5F1KC 4C56D 2HRPL 1YYLL 3WYRA 2C5DC 5I1LB 4PRBB 1KJ2B 5C0CD 3KAAA 1FZOA 3HUJE 4JN1H 3RNQB 5HYJE 2VZOA 5DJCA 1XGTB 4ETQA 2XY2A 4IDLA 5DD6A 3T4YA 1KB9J 2BY1A 2QTEA 3SKOB 5IB1B 5JO5A 1VFUA 4B50A 3L1OH 3FO2B 1QSFD 2DD8H 4YGVA 2I5YL 1AH1A 3HZKB 1G84A 8FABA 1H3PH 4DOHB 2EDNA 1J9CT 3PQYB 1QYGH 3VXSD 3H7LA 2APFA 1KYOK 3T8XA 1RUPL 1FLRH 5ADOH 4POZC 3MFFA 1YNLH 1TZHB 4RAUA 3LQAL 1L7IH 4WEUD 2X4RB 4LVOB 3DV6A 3QI9D 1D5XA 5F3BB 1KCSH 4J1UA 4N8VA 1EA9C 3D5OF 4PP2B 3LV3A 2DQEL 1RPQA 1ZA3A 3RWFB 3LS4H 5GRVL 3QT2A 2UWEE 5BVJB 1HHJA 3B9KB 2ENSA 4B41A 4I3SL 1K4DA 5D9SA 5EU6E 5EN2B 1TVHA 1TENA 3PWLA 2IBBA 1MVUA 4QRPA 4H26A 1JGUL 2AJVH 3C6LA 3O4LA 4X7EC 4X6FB 3KWWB 3GNML 1QLFA 4HDIB 4P48A 2CLVA 5C9JA 4M48H 5AZEL 5DEGB 4Q2ZA 1S7WA 2HKFL 1AXTH 4JR9H 5JR1L 3S37L 3L95A 3SDXE 4NC2B 4ETYA 4F7TA 2EEAA 2XZQL 3LKOA 3QEQD 3HUJA 3V6ZA 3LN9A 3KPOA 1BFSA 5HYJA 5D1QB 4IMKA 3BDYL 1U8OA 3S36X 3E6FB 3OKEA 3D9AL 1JWUB 3PHQB 3GHEH 3SDAB 1OD9A 1ZWIA 4QXWA 3T1FB 4GH7B 1I7ZB 4HX1B 3V6FB 3G9AB 2DYPD 2R0ZL 2FBJH 1V7ML 4MJIE 4UIMA 1T4KA 4FQJH 4X6DA 4OGZA 4FQXD 1HHKB 3BDBA 3D0VA 1I8LA 1S8DA 3PG2A 4Y5YA 1N6VA 4RISH 4RGMC 5JOEA 4NO5A 3HLAB 2XQYK 4RGOL 2C3WA 1IC5H 5HPOA 1KJMB 2AK1L 4M93B 4NQED 5TF0A 3SE8L 3QDGE 3QULB 1OLZA 2YA2A 4NDMA 1RJYA 3RUGF 4G6KL 1S5IH 4UB0L 5K9QG 5GJSL 2ARJA 4CNIA 2BMKB 1F8TH 1WITA 2UWEA 3WUWB 5KVMC 1J8HD 2MKWA 3TO4D 4HKJA 1G7HA 2XWBA 1MJJB 5EU6A 1CTNA 2WK2A 1FFRA 2ERJC 3MTRA 1U3HD 5I8CA 4G9DA 2X44D 5MEPB 2CO7B 5DQDL 1F4XL 2MHAB 1K5NB 5C0EA 2HKHH 3ARGC 4PJGB 1A6VL 1IM9A 1GAFH 4KV5E 4JZNA 3SDXA 4JQIL 1JGDA 4LSSL 3GI9H 4WWKA 5ESQB 5CIPB 2GI7A 4OCYL 3WLBB 1EJOL 3L3OA 2VDOL 2D7QA 3CVHA 4S1RL 3I6LD 4LKCB 2AI0H 2GKIA 2VQ1A 2BK8A 2H2SD 4BQ9A 3B9DA 4MJIA 4M6ML 4QRRD 3GRWL 5I1CH 5TQ0L 5J6GA 1P7HL 2DICA 3RAJH 3A6BL 3G08B 3RIAK 3ZDYE 4Z0BL 3NCJL 1ITBB 1U8MB 2XZAH 1AGFB 3BP6A 4OM0H 1JMXA 4PBVC 2VH5L 5JZ7C 3AROA 4EKXA 2EDLA 1D5ZA 2HTLC 3FRPA 1EHLH 3QDGA 1G7MB 1LO4L 2RFXA 1T83A 4CBPA 5EUKB 4JO2H 3KLAA 5DJXA 4HIEB 2AJSL 1SJHA 4FQHA 4PB9L 1UADC 4PGJA 2OJZL 4Z76B 1S3KH 5B3JE 1XIWC 2MPAL 4HS6A 4PRHE 1U8LA 4YDLC 2G75B 5KS9B 1FN4A 4PLJD 4IMLA 2A6IB 3C60D 1NCUA 1KULA 3O6FA 4JREC 3T08A 3CDCA 5KSBF 2HTKD 5IHZA 4ELKB 1B90A 2Q20A 2PW1A 3UZEA 3U36A 3ARDD 3L3HB 1DQLL 1VSCA 2BVPA 2NR6C 3O6KL 1XGQA 5DK0A 4UOW0 3BKJL 4F7EA 3MNZA 4KKCC 5CEZE 1IGTB 4W70A 5JLZB 5A40E 2Q7YA 3TJHD 4WI3A 3V6OE 3FONA 4JPWH 4FQPA 2EYRA 3HRZB 1RUKL 5E08L 4ONGL 1VEMA 2FX7H 3VJ6A 2YHGA 4HFWA 5JPMA 4BQ8A 2JB6B 1G7IB 1C08B 4HJJH 5AD0A 3H9ZA 4GJTB 1ZLWK 4PTUA 1DVFD 4GQ9L 3CXDL 4GAJH 1PLGH 2B8OT 4RIRB 3BPOB 2A2QT 3MRKB 2LAAA 1KNOB 5IIEB 2IPUK 1IGJB 3QXUA 4HIIA 1KLUA 4MQ7B 1A6UH 1M4KA 3BUYB 1FZMA 1ES0A 3WO3B 1CD8A 3DSFL 1ZV5A 3AM8A 1QA9A 1IAOA 4X99A 5I19H 3QUXA 1D5BB 3F8UB 5HYQA 4L4VA 3DVGA 3T0XA 3L5WA 4JKPH 1RZKH 1FNEA 1B9ZA 1P4BH 3T0WA 4MAYD 4PRHA 3GIZL 1DP0A 1T80A 3DETD 3MLWL 3G04B 5DHVH 3FOMA 2I27N 5D1ZA 1NLBL 2XKUA 4OF3A 4MCZB 1DQDL 1A6ZB 2EDYA 3W82A 5CEYA 3OAYK 2PO6A 2FCBA 2WINA 4HAFA 3F12A 1HZHL 4NNXA 5EG6C 1S7VB 4PTTB 4IRZL 4U2YA 3MYZA 1YNTA 1FFQA 1ZLWH 3BZDA 1F45A 3DLQR 5J1TC 4HPOH 5INDA 3V6OA 3DTXA 4R4NC 1T0PB 1MFNA 5C08D 2J8OA 4XNUH 3MGOA 5MHSD 4RZCA 5I30H 2YN5A 1RSFA 2ESVB 4PJFE 4W4NA 5JXEA 1A7BA 3VXQB 2GYSA 5T5FH 1FO0H 5BXFA 5GS0H 3WS6A 1X5LA 4FP8L 3V0AC 1KT2A 1UJ3C 5FCUH 3EFDL 1CDBA 1F4HA 4XCFH 4ONFH 5MP6H 4G6FB 3V4VL 4GBXD 3VWJD 5BZDA 4OLYL 4ZUUA 2UZIH 4DGVH 1FYHB 5I0DA 5HSFA 5KTEH 1JF1B 1AD0B 3MLUL 1CYGA 1QACA 3BP7B 3RWIA 3T65B 3VRIB 4YHLL 2ZG3A 3OAYH 3V5KA 4BKLA 1HCVA 1KELL 5JORA 1UYWH 4JFZH 3OPZL 3KS0H 2IAND 1Y6MR 2ICWB 4HUKB 4XCEA 2HH0H 4XI5C 3WHE1 4K3DH 5IG7B 3QIWC 3BQUD 1OP9A 3GMRA 1KACB 4QY8B 5IQ7L 3DX7A 4JRXE 5T33H 1S7RA 4TUJA 4BH7B 1IGFL 4DAGL 1TCRB 1MFAL 5F1IA 1RZ8B 1NC4B 1UB5A 5E6IC 1JYVA 2VB5A 4MMXC 4E0RB 1AGCA 3MA7B 1FBIH 3U0TA 4OGAD 3WO4B 5B3NA 5F7UA 4EUPH 1XF2B 4NKQB 3U4EA 3SDCD 1RZJL 4KROB 4PJFA 1YN7A 3BP4B 1KLGA 2V2WA 4MB3A 5DS8A 1MI5D 4X6BB 5IEKB 1AFVH 1CFTB 5DJ6A 3QPQD 3LN5B 4XHJD 4JY6A 4P2QD 3V0WL 1CDHA 4YHPB 2BNRB 3WFBH 3HNVH 4RDQG 5BS0B 3V5DB 1UVQA 3W9EB 5T3ZE 4KVNH 5MEQB 4GRLA 1FAKT 1GZQA 3GIVB 3NPSC 4X7FC 5KSVB 2NXZD 1FNSL 3DMMA 4PD4K 5J3HD 3VDBA 3MNVB 2FH8A 3OWEA 3HZVB 4PPTA 3L5HA 4OQTH 2PTTA 2OYPA 2VR5A 2E7BA 3MJ7B 4LLWB 3N85H 5I0ZA 3EYOA 4GLRH 5IMOA 2H6PA 1FG2B 5GRUL 1NCAH 3NMEA 5KVFL 4AL8H 4JFYB 3GMOA 4MD4A 1NFDF 4MNQB 5LGKA 4OZGA 1BJ1H 4KTDL 4NJAH 4UQ3A 3STZA 3LIZL 3UDWC 1MWAB 4KK6C 5D1XB 2QADC 1CFBA 4JRXA 5IB5B 4Q6IA 1SYVA 3JV6A 3L5XL 4HKXA 5C0AB 1E28A 2D7TH 4L8CB 2AJZA 2I25N 3V52H 1XR8B 4ZFFA 3QUZB 3MRIA 3BGAA 1NMCC 9CGTA 4BUHA 2BOBB 4ODTH 4OLVH 4N90E 5CEZL 4B7IA 5GS1B 2VYRE 1X5IA 1WIOA 3X3GH 3ZT7A 3NA9L 5F9JA 4AIXA 4U6YA 1NAMB 4EI5D 5LGJB 3I2CL 3RUGB 3VG0L 1JHLH 3TBVB 5E7FA 5I1EL 4BSVB 2PUQT 3VXUD 1GGIL 3SCMD 1YEDA 3OKMA 4NNYA 3QO0B 2ZKHL 3U6RA 5TE7L 5HY9B 4WEBH 5ELIA 3G6JF 1TITA 4HIJB 2N56A 5J1AA 1L6XA 1OB1B 1JN6B 4WO4C 4NRZA 4BUGA 2Z8SA 2CRYA 4PJXF 5B39A 1HILA 5J6HA 4RMRA 4KXZI 5ID1B 2EH8H 1FFOB 1G6VK 3FHQA 4M9PA 3MUHL 3ZZ1A 4FQIH 5KG9B 4NQDE 3HB3C 1AGBB 4RAVA 2W0FA 3UPRA 3B2VL 4OUOA 2V7NA 3VGBA 3FFCD 5F6IC 4RWYH 4EXKA 4NO3B 1MHCB 3V0VA 2VO5A 1R3JA 2FEDC 2LVEA 1MJ8L 1YN6A 1I3GH 5BO1L 4LVHC 3DVNB 4XPBL 4JO4H 4NNPH 1EBPA 3VRJB 4OFYA 4OCWH 2I07B 5ICXA 4U1KB 1DQQA 1YEKH 3PNWA 4RSVA 4HLJA 5BV7C 3K81A 5C07D 3RWHA 1NAKL 4HSQA 1TPXC 4JN2B 4MJ5A 5I8OL 4OAWA 1ORSA 2WBKA 4GKNA 4NQUA 1LK2B 2B2XL 3LKQB 3A6OA 1ULVA 3C6LC 4N5EC 4QO1A 4XMKH 4UT9H 4PJDF 5LQBL 4PJ5E 4A6YL 3IRZA 3VGDA 2DTMH 4P46B 2NX5E 1ETZB 2MOVA 3EIFA 2V2XA 4LHUB 3MRHB 1X9QA 2Z93A 3QZWA 2B4CL 4DGIH 4APQC 3HFMH 2Y36H 4OUUB 1QHPA 3GSNB 4FG6C 3UEZA 3WDIA 4WI6A 4IMKC 4PS4L 3BD5A 1XR9A 1WT5A 4XXDB 2FECL 3ILQD 5AZ2H 3T3ME 4TULH 1F6FB 2DLIA 5CHNA 4ZFOB 5KSBB 3ZTJG 1KCRH 1QSZA 1OTUD 4PRID 5IW6B 3BJLA 4JFDD 2OZ4L 2QV2A 3FOLB 4N0RA 5L2KB 4FQ1H 4JHWH 3VFOA 1ZHBB 2OTUA 3WJLA 3DHJA 3EOYG 3HE7D 5IMMB 1I8LC 3WUWG 1H8SA 3L5JA 5I15L 2NY4B 2UZYB 2OQJB 4JY5L 2VDLH 2FWOA 1WF5A 4WTZA 3EYVA 4MLSA 5T1DL 3P73A 2H3NA 4JAMA 1MFEH 3NIGE 3K4AA 4HCRA 1C12A 1I1AA 1FFPA 3CX5J 4U6XA 3GJFB 3THML 5I66B 5KN5A 3VD4A 1SMAA 3V95A 3I75A 1LD9A 3SQBA 4LARL 2F15A 2A6JB 1QLRA 4ZOEA 1AI1L 1YEJH 3O3DB 4PJ5A 5GGVL 4Y16A 2NX5A 1ADQH 1QFUL 1XFPA 3QQ9D 3CFEA 3JV4B 1Y0LB 2YZ8A 4X5XA 3MRQB 3NA4A 4U49A 3TWCL 4OCXL 4KQ4H 1EGJA 1U2CA 2VDQH 5I8KL 3QHFH 4U6TA 4WWKC 4YLQT 1SY6H 1SEBA 1DL7L 5FYJD 5T3ZL 2D4FA 5GIRB 5H8DA 1ZLUK 3HE6B 1IRAY 4PYGA 12E8L 1G9MH 3X3FH 1WISA 1KIPA 4XRCA 3O9WD 3BIBX 1CZ8H 1KJ3H 4NWUL 1BOGA 3NZ8A 5FV2A 3RPKA 3HTLX 5SV3A 4S0SD 3DX9A 4F9LA 1EEYA 2ICWI 3RI5F 1E4JA 2CDFA 3WXWH 5ILTL 4JHAH 2IFGA 4F58L 4BZ1H 2YMXL 2ORBH 4NO0D 3A6CL 5DMIL 3VU2A 1HK6A 3TC9A 3RZCA 2VSCA 4WVRA 4PP1D 3UBXA 5IT2H 1CLZH 4PJ7E 3VXSE 2FJHB 4XVUD 3IU3A 2CKBA 4QT5B 3WIFB 1HHGB 1I4FA 5CKAA 2RQ8A 1OSPH 2XICA 5EIIA 3W5MA 3BD4A 3CPLB 3E0GA 1NCBH 3PGDA 5EPMA 4LSPH 5DXWA 4YXHH 1ZLUH 2OI9B 4G7VH 1HXMA 3VFTB 4QXUH 1WUNT 5FB8A 1N8ZA 4ODUA 3QFDA 1D6VH 2DWDA 4KJQC 3KXFB 4F8QA 1N59B 1NDGA 3JTSA 5IFAL 1F3DJ 1UH2A 4RFOH 4MXVE 1NKOA 4JGMA 1TTGA 3CSBA 4JQVC 4M62H 2MCPL 1MLBB 1BZ9A 2ZPKL 3O8XB 3G5ZA 5SV4A 2BY0A 1MAKA 5HJ3A 2ZSWB 5IHBA 2BX5A 4R3SA 1ZT1A 3S6CA 5HHOD 1X5FA 4NO2A 5CJ5A 3QCTH 5J12B 4XMLH 4PGCA 4K7PH 5CP3A 2O5YH 4HWZA 3ZHKA 4JPIA 5GZND 1W72B 1IAIH 3I6KB 3MR9A 5I73B 3AAZA 4YXKH 2AEIT 3ESVF 3UTQA 5HHPA 3CFBB 2CLRB 1KCLA 4LQFH 4TVPH 1T5XB 1IMHC 3X12B 1J1XL 4WFHE 4R26L 1FP5A 3AM8C 2PNDA 1H3XA 4OSUH 3CC5B 5ECJE 3QUXC 4HCRL 3INUL 5EBWA 4XC1H 2Y1VA 4ZTPH 5D72L 3LB6D 4NZTH 3ZLQC 2IADA 5EOQH 4PJ7A 3VXSA 4M4RA 1JBJA 5BQ7B 1QR1A 2D0GA 3WV0A 2Q8BL 4AEIL 4HC1A 5H94A 3BFOA 5JOPE 5IOPB 2GTZA 3TBTB 3BW9B 3PP3K 2ATKA 1WFOA 1WFUA 5FEBA 2AQ1A 2XYCA 15C8L 1MCCA 1CICC 3HPJA 1MFDH 1TJGL 1DQJA 2VITA 1G6RH 3MRRA 5HPMB 5F1OB 3C5SB 1WGOA 1OARL 5F96L 4KZEL 4G8FA 4WFED 1JHTA 1EGJL 1F6AB 3O41A 5I1IH 4U1NB 4JG0H 1GGTA 3OAUH 3IXTB 4HUWA 4RFEB 4LCWD 3GO1H 2RAMA 1NFDB 1L0XA 4XP9H 1TQCC 4HGWA 2SEBA 4I0KA 2BC4A 5JXEC 1ZGLA 2DQIL 5J9PA 3MRLA 4OLXH 2HLAA 3F5WB 3ULVE 4EOWL 2YD8A 4S1SH 3TA3D 3D48R 3B9AA 1ZVSA 2F58H 2ARWA 5FGCE 5C0CB 4OZHE 3EOTL 4OCSH 4Y88A 1AP2B 5CEXB 4F8TA 3H7BB 2ZOLA 3OKLA 3PP3H 3QA3B 1Q9KA 2P46B 3D85A 4JO1H 3TV3L 3RWEB 4OT1H 5FO9B 4QRRE 3HC4H 1FGNL 2J88L 3Q6GL 4X6DF 4ODSH 4J3SA 1NANH 1QKZL 5D8JH 5ITBL 4LCYB 2VWEE 2NXYD 3QJHA 4ORGA 2I26N 1R3IL 1OAKL 3IDXL 4PJXB 4JANA 2QSQA 3M1BB 4L3CB 2B1HH 4O9HH 3H3PH 5E2VL 1YQVL 1RMFH 2ATPB 3MBED 3O6LL 1X4ZA 4JDZB 4KDTC 4TUOB 4NSKB 2AS5M 1KF9B 1KN2H 3O3AB 1WJ3A 2IPKB 5EOCH 1FCGA 3CFIC 4MWFB 5IVOA 2AKRA 2GQHA 5T1LD 2EE9A 4ZQKB 1JPTL 5FKAB 1OVZA 3MA9L 5EZJA 5JIPA 5JDSB 1FH5H 4XGZA 4G6ML 1EJ6A 1EAPA 2B4CC 1J0JA 3ILPA 4I2XB 3VA6A 4X0KA 1A7PL 1U8NB 5J06A 4NZDA 4PV9A 5TE6L 3LQZB 3W11D 4QRSA 2WP3T 3SDXF 4KY1L 5IMKB 3GSUA 4OD1L 4OZHA 1AKJB 3QEQB 4GRLC 2HFEA 2W38A 4RGNE 4PJDB 4ISVB 5EBLB 5FYKH 1VGKB 5IBTH 4U1IA 4Z0XA 3DO7B 3AFLA 1ITCA 4JFPB 4QRRA 2DYPB 4LLYB 2XZCL 1CDGA 4JFQA 2ITDB 3WXVL 2NY0D 5E6YA 3QH3B 3G5XB 3S35H 4TSCH 4FQXB 3P4MB 1L7TH 4HC1L 1IFHL 5E8NB 5HYSA 1C7TA 4X98B 5KVDH 2R39A 1S9WA 4OZFH 3O3EA 2RB8A 2YPVH 4U0RC 2IQAA 4X6CB 3QBTB 2FX9H 2WQ8A 4Q6IC 3O2DH 1S9VA 3K2MC 4M7JH 1T1XA 2EDTA 4WI9A 5ICZA 5HGHA 5JW3H 4E5XA 2CK2A 1WWAX 3NFNA 1A7NH 4IOFC 1J8HB 4HUUB 1OQXA 3RWGA 4Y1AA 2DJSA 1IQWH 1CDCA 4AYFA 4TTGA 2HVKB 2V17H 4E42A 5IBUB 1XGPB 3MREA 4H88H 4C59B 1JK8A 4H8WH 1N6UA 4XBEH 4JKKA 3RWDA 1L4IA 5IFJA 1KPUA 4XP5H 1NMBL 1U3HB 4O2FB 3I3EA 1NGZB 1J88A 2C4FT 5D2LE 5DSCB 1U92A 2X09A 4OIBA 2Y25A 1DBAH 1UM6L 4E41E 5F88B 1A64A 5GGUB 3KPQB 4K71B 5I76B 1BFTA 1GSMA 3ES6B 1SVCP 1LWRA 2Z0BA 3U1SL 1MRDL 2JTDA 2P8PB 2BCKB 4HG4K 4FXGA 1UJTA 1X5ZA 2V9TA 4JM2A 5CLTA 5FKPA 4XP1H 2VAAA 2GAZA 1P84J 1YMMB 5AYQA 4UIKH 5ICYA 5C0BD 3F6LA 2R0KH 4LCCA 2QEJA 1MIMH 1OTTD 2NY4C 3AGVA 2X4QB 5EO0A 5TGBA 1WC7A 3MLRL 4LSDA 2CRMA 2HT4D 2N4IA 3RKDD 4I4WB 1IC4H 5GGSA 2JK5A 4HIXH 2VXUL 4MAUH 5F9DC 3VCLB 1A1OB 2NY2D 3ZDYF 5EZIH 1N4XH 5CLWA 4P2OA 1SBBA 4LHUG 1E27A 4YBLB 1NBYB 2P4AB 4PJ8A 2Z31A 2CIKB 3CFCH 3UJJL 4POYA 3D1MC 4D0BA 2EO1A 3D69B 3KPSD 4ESKA 1VFBB 1KSRA 1JPSH 3RY5A 2YPLE 4NPYB 1WBZA 3U48A 5K9JL 2HMID 4L3AA 1RU9H 3FT2A 4YHKH 4GMSL 4D3CL 4I1NB 1MRFL 3STBA 1CBVH 4L3EE 4X4XA 3X11B 1HSAB 3ZMRA 2JLLA 1A6AA 3TIDB 3OSKA 2DBLH 1WZLA 2QHLA 1NEZB 3LEYL 1S7XB 2R1WB 4JDTH 5D2LA 4R4BA 5IB2A 3ULVL 3NOIA 4E41A 1U8QA 1MQKH 3NIDF 1G9NH 2V5RA 2C1PB 5FHAH 4MSWB 2NY6D 4JE4B 4L8DB 3PHOB 4G9FE 3SDDC 1UCBH 3W39B 3ROLB 4X7TB 1YEFH 1AQDA 3UMTA 3PDOB 3MV9E 1UZ6E 5EZOH 1IVLA 1MHHA 1Z6JT 5EWIL 4M1DL 5CJQH 3SE3A 1T7WA 3WJLC 4CN1A 4YFDB 5AAMA 3KLHD 1IAMA 4PLKD 1CIDA 4KRNA 3GM8A 4AENA 1DVFB 25C8H 1UEYA 1CXKA 4YHMH 1QYGL 3BXNB 1L9NA 1BVZA 1V3LA 3EFFA 2ZOKA 5CP7B 1FLRL 4PGBA 2EDDA 1OF2B 5I17B 1YNLL 1N64H 3GKWL 1L7IL 1OCWH 5DK2B 4XWOC 4HF5H 1DBBL 1KCSL 1JRHI 2OSLB 5ERWB 5C0FB 1AHWB 3O11A 2VLLA 3LS4L 1JF5A 4LLDA 1U8JB 5IROC 3HC3L 4OF5A 4JY4A 1FPTL 1BAFL 3NABH 2O93L 1NFIA 2YPLA 4O2CB 2PR4H 3QWRD 4ODXA 1X5XA 4ETQB 1UT9A 3BO8A 2AJVL 4Y4KD 5KSAC 3G6DL 4Y16C 4L3EA 5C0GA 5HHXH 2ZP0T 2VXSH 2AV7A 2J2ZA 5JO5B 1Y6NR 1Z5LB 5C0JA 1AGEB 3T1WA 1AXTL 4YGVB 4IIQB 4GG6E 8FABB 2NY1B 3ESUF 1YEEH 3MLTB 1C8PA 1ZT7B 2RGSA 5T1KD 3LCYA 5DK3A 3T8XB 2H1PL 4G9FA 4KPHH 4LGPB 4U1JA 4QOKB 3RDTD 3OJ2C 5C08B 3RA7H 3VMNA 4RAUB 2B5IC 3TO2B 5DFVC 1SEQH 3GHEL 3DV6B 3LPWA 5CCKH 3MV9A 2OX5A 4N8VB 5D5MF 2FBJL 3LV3B 4ODVL 1AO7E 4OF0A 1B3JA 3VE0A 4I0CC 4S2SA 1EUTA 3TBYA 4Q9QH 4RFNB 5H2BA 3T2NH 4ZMAT 1PVHA 2VABB 3R8BB 4IRSA 4IS6B 5D9SB 4RISL 4FZ8L 4IOIA 1RVFH 1TVHB 3V4UH 1ZKAA 1ZA6A 1IC5L 5JHDD 3RZCC 3O4LB 4V1DB 2Q3ZA 4YUEH 2HVJB 1DZBA 3IRPX 4EQ3A 2CLVB 1UH4A 3ZL4L 5C9JB 3PL6D 4FTVD 2NW2A 4Q2ZB 3EBAA 5DUBB 1S7WB 3VXPA 1K8DA 4KRPC 4F7TB 4E9LA 1F2XK 1LP9E 1OW0C 2A6KA 5IFHH 2IANB 4PBXA 4ZUWA 2IG2H 3V6ZB 4NZRH 5HYJB 4LOUC 2DQTH 4ZUSA 5DHVA 1U8OB 3BQUB 2W07A 3ZHLA 3JSSA 4XPAL 4OZGF 1QFWI 2A83A 4PJIE 4Y4HC 3H3KA 1ZWIB 4J3XA 4DWHA 5ACZA 1IEAA 3OB0K 2HKHL 2GUOA 2P49B 3OKNA 1T4KB 4X6DB 1GAFL 3FB8B 4GG6A 2VL4A 5FV1L 2BVQA 3R1GH 5EBMA 3GI9L 5HHVH 2VLJD 3CMOH 3SGKC 4Y5YB 2KQNA 4YHZH 4X9GA 3CD4A 4KK8C 3IJSA 5GISH 1S7SB 2VLKD 2W59A 4P4KD 3PWNA 3D87B 5D7JC 5IBLD 3SDCB 1BQSA 4I9WE 4JJ5A 3BP5B 3P11L 3U30C 2AI0L 3EYUH 4U6VL 1MI5B 3HAEH 1FO0A 1ZEAL 2ARJB 2R29H 1AO7A 5D7KE 3WNMA 4P2QB 5I1CL 4M7KH 1ED3A 1S9YB 2NY5C 1EFXD 2G5BA 2A9NH 4GW1A 4HKJB 1G7HB 3RAJL 1YZZA 3GI8H 2X4OA 4PRIE 3UYRH 5C9KA 4OM0L 1A7RH 2YD1A 2NXZB 3TZVA 3CDGA 4M61A 2OR8A 4G9DB 4I0PD 3VG9B 3GBMH 3SGJC 3VFMA 4GFTB 4PUBL 1KUMA 3F58H 4L5FH 4JO2L 3WFHA 1IE5A 3OB0H 1GC1C 2GK0A 1BQHB 3SDXB 5L9DH 2X4NA 1DQML 1LP9A 3QI9C 3BPCB 3DOSA 1TCMA 3D3VD 3D25B 3CCHB 4XTRD 5BRZD 3QG6A 3L3OB 3SOBH 2CDGA 5GRJH 1EUUA 1N0LA 4PJIA 3IFPA 3KJ6H 1Q38A 1SJEB 3CVIH 2IAMA 2VQ1B 2X9XA 1KXVC 4FS0A 1NL0H 1BFOA 2J5LB 5J6GB 2YA0A 4MA3B 1YJDC 4EUPA 1KGCD 3UTZA 2EO9A 2Y9RT 2FX7L 3BP6B 5F7EH 4EI5B 2WNGA 1GOFA 4JFEE 4XVSH 3WFEH 1CK0H 4ZXBD 5DVLA 3OXRB 2VLRD 3JWOC 3QDGB 4M7LH 3VXUB 3SCMB 2JCCE 5DJXB 3KLAB 5DRZA 1R3KB 1SJHB 5J89A 1KTKE 1U8LB 4TNWF 3RGVB 2MQ0A 1J5OH 3BMVA 4YDKH 2F53E 1GXEA 3X13B 4Z7UF 1JZ8A 1HNFA 2YXFA 2O61A 1A6UL 1QP1A 3O6FB 1C1EH 2CGRH 4Y8DC 4P9HC 3OR6A 4FRWA 1RJLA 5I19L 3H9YA 3U36B 1BVKB 5LCVH 4MA1C 2BVPB 4OQTA 1S9XB 5IJKC 2JJSC 4JKPL 4F7EB 3G5VA 2CJUL 4LCUA 4U2ZA 5JMRA 1KPRB 3MJ8A 4XP6L 2FGWH 2KUTA 4JPKH 1F2QA 2HT2C 2CK0L 4F3FB 5GJTH 5IHUH 3CDYA 5GSVA 5JPMB 4Y89A 4P5KA 3TO4C 2E6PA 4BM7A 3AY4C 2FR4A 2ADJB 3MRNA 4HT1H 5FHBH 5C07B 3S8WA 1J8KA 2UVFA 4KK5D 4JDVA 5DRWA 3FRUB 3V7AE 1U8IA 1U3HC 5MI0B 4DKFL 1RZFH 4HPOL 5E9DD 3OG4B 1SBSH 2NTFA 1X4XA 4J3OC 2XRAH 5SWQA 1BWMA 4F37K 4XNUL 1ZTXH 4M03A 2OS7A 5C6WH 5I30L 4RMTA 4P23D 1QA9B 1A3RH 2ILLA 4JFEA 4OKDA 1URLA 5FGBC 3BEWB 2J1KA 3TBWA 5L8LB 3ULVC 4GW5A 4U4BA 1PSKH 1ZLSH 3TLRA 1FO0L 3W0WD 5HYQB 4Y4FA 3AU1A 4WHDA 2JCCA 4CVXA 1VPOL 4L4VB 4QWWC 4IJ3B 3L5WB 2BNQD 5FCUL 5F7YC 1FNEB 1QBML 3RWJA 3PWPD 4MNHA 2F53A 3FOMB 4LIQH 1SVZA 2C4FU 3BPLC 5D1ZB 2H2SC 4DGVL 3O9WA 2VAJA 4PGDB 2CDEB 5DD5H 2PO6B 2J8UE 3F12B 4R0LA 4NNXB 4GOSA 5ITFA 1MJ7H 2VWEC 2AXJA 1JNJA 1WTLA 4JFZL 2HH0L 3ULUL 4YHIB 5IBUG 4K3DL 4LSUH 3QEHA 2AGJL 1UA6H 4GRWH 3BKCH 2Y06H 4NHUA 1BLNB 4RZCB 5EFIB 3RVTD 1J1PH 4L8BA 4CADB 3BIKB 3OXSA 3NIGF 4D9RD 2EYSA 4PLJC 4I3RL 2DQCH 4UDUB 3C60C 4EI6A 1RZGA 1MCBA 1FBIL 3FO9A 1AQKH 4ACPA 4UU9A 1PFCA 4O58L 3WSQH 1R3LB 3O0RL 5FDYA 3TFKC 2HTKC 4ZS7L 4TNVK 4WI4A 5ENWA 5IHLB 1D9KD 3IU4H 4ZUUB 3ARDC 4TSAL 4XAWL 3KJ4C 3P0YH 1ZHNA 1B2WL 2OBGA 2JB5L 4HWNA 4WEMB 1DN2A 3BPNC 3WFCH 4HK0A 1ZMYA 1INEH 1AFVL 4M9OA 3TJHC 3BRFA 4AH2B 2EEDA 4HXBL 5JORB 5DF0A 5FGRA 1FNFA 4YK4C 4HD9A 3HNVL 1H5BB 2XKSA 4JM2C 5ESVB 2AJXH 3EOBB 2ZUSA 3CUPA 3T3PE 4KVNL 5HVGB 5L7XH 2PYEE 5C70A 4LCCC 3GMRB 1DLHA 4ZYKB 5GPRA 1A6TA 4NP4L 4Z6AT 1H3VA 5HVHC 4TUJB 5HI3D 4WHYG 5EU7E 3MODH 5JTWA 5F1IB 4N0UB 3N85L 4MJ6B 1GL4B 1D7FA 5F9AC 3MV7E 4HQQL 1A02N 4UBDD 1LDPH 1NCAL 5I6XC 2MKLC 2X1PA 5CGYC 4JFXA 1TVDA 1BD2E 4NO0B 4P2OC 2GSIB 2OMBA 4OF8A 4A6YB 2XA8L 5D96B 3MV8B 4PJ8C 1CFVH 2Q8AL 1DLFH 2FL5A 1NEZG 3TH4T 4NJ9L 5D5MB 4DKAA 1YN7B 2OCFD 5EDXA 4MAYC 5GHWH 4YQXL 3AREA 5DJ6B 3ULSA 3V52L 4KAQL 4PJ7F 3FT4A 3QEGL 3VFVB 1N3NA 1VKXB 4OLVL 1EZVY 3QJFA 3X3GL 3LAFA 1K4CB 3O4OC 1ZGLP 1U36A 4Z5RB 4JM4L 4OBSA 2ICEA 5E2WL 5I18H 4XWGH 1WFNA 1KCUL 1BF8A 4X8JA 1ADQA 3G5YA 2X4PA 2NZIA 5JXAH 2JJTC 3HNTH 2PTTB 3EDFA 2CXGA 1M7DB 2Q1EA 3PABA 1HKLH 1CLCA 1HQ4A 4IOSD 5T3XL 1G0YR 3ZYIA 2WQRA 1NUNB 1DUZA 2W0LA 2E7LA 5E5RB 4GG8A 1SY6A 3MLSH 1DBJH 1NGYA 3GMOB 4MD4B 2DI7A 4FA8A 3IDIA 4OZGB 3S34L 2PYEA 4UNTA 2EH8L 5HHOB 1WZKA 4XBPB 3SE3C 3STZB 1JTTA 4FQIL 3HPLA 4L9LA 5I16B 4JRXB 1SYVB 1MF2L 3JV6B 4J4PA 4HPYL 3PP4H 4K07A 3KYMB 4ZFFB 4GBXC 3VWJC 2O5XH 1XF3A 3MRIB 4XNZB 5C8JA 3HG1D 2VDRH 3C08H 3ARFB 2DQHL 4RWYL 5CD5D 3MV7A 1UB6A 5TDOB 2IWGA 3ZKXC 4XVTH 2D31B 4TVPE 5D7LD 4CW1B 4OCRH 5F9JB 1I3GL 1IL1B 4U6YB 4NNPL 3MRPB 1BD2A 2BSRA 4OCWL 3WLWC 3BMWA 1WIPA 3U82B 4P59L 2FATH 3LDBC 2EDEA 4JFFE 5DUPL 3GSVB 1YEDB 1Q9WA 1A1MA 2X4UA 3UC0H 3CFJA 1FLTX 1NMAH 1I85A 5DVMA 4YFEA 3BQUC 1IT9H 4HWBH 1RIHH 3MNWA 4XMKL 5IB3A 2D2OA 5B39B 1HILB 1XGUA 2DTML 4YJZL 3VXMD 4M1CD 1P7QD 5L6YH 4ORZC 3HI1B 4N8VG 2G9HA 2HJFB 5TH2B 1E6OL 1Z2KA 4OGAC 4RAVB 3QNYA 3TN0D 3QYCA 4DGIL 4KJWD 4UDTA 2X9YA 3HFML 4JRYD 1FDLH 2R2BB 3DGCR 5CZKA 3RTQA 1GGCH 1F6LL 4N0YH 3HZMA 1XGRA 4P2YA 4U7SA 4LCWB 4ZAKA 2MMXA 3IJYA 3HKFA 4TULL 2F74B 4WY7H 1HOCA 1KTRL 2GFBA 3QPQC 4XHJC 5DT1H 4F15B 3QCVL 2R69H 4L4TD 4QTHA 4RX4D 4X7CC 5ICXB 3ZTNH 1GIGH 5DJZB 3ULVF 3UTSD 4MD5B 3SJVE 3HI6H 4IBLT 1QFOA 4QXTA 3B2UD 1ORSB 1KG0A 1A1NA 3GK8L 4RMVA 1X44A 4OZHF 5J3HC 1IBGH 3VGEA 3N0PB 3TVMA 3AS3A 5C3TA 5HHMD 4ZUVA 4W6XB 1MFEL 4OB5H 2V2XB 4BQ6A 4IRJD 5DO2D 4LGRB 1NDMB 5D93B 1LE9B 1H3WM 1KEGL 1QO3B 2VNCA 3BN9D 2BERA 3P30H 3QZWB 1UWEL 3TIEA 4JFFA 3UJTH 5EOTB 1NGXB 1MCPL 1RZKC 1UH3A 5GGRA 3UROR 1CTOA 1SYSA 4EN3A 2GTWA 1NC2B 2OR9H 3MCKB 3F7RA 3VXTA 4Z7UB 3BJ91 4PV8B 3BESR 4OD2A 3T2PA 1YEJL 4GUPB 1U8HB 3CLEH 1ADQL 1I1YA 3KPSE 3R0NA 4WV1A 3WKNA 4AIZA 5JPNA 1G6RA 1OAYH 1G7PA 4WUKL 4PB0H 3T0EE 1EX0A 4KMQA 4KHXL 4K8RD 4KQ4L 3M17B 3V5HA 2VDQL 3QHFL 2VERN 2M2DA 1SY6L 1M6OB 2FX8H 1KN4L 2EICA 3LRHA 4U1GB 4OZ4A 3P73B 4LGSB 5F7DB 5BCAA 2YUWA 2R56H 3VXOB 5A2KH 4UTAL 2VZ3A 1C12B 1I1AB 4U6XB 1LE5A 5IVXE 1I9JH 4L4JA 5GS0C 1LDSA 1R0AL 5I1GL 4Y2DA 2YD4A 3I75B 4OGYH 4P5TD 1BQLL 1EMTL 2VISA 1BQHG 1RK1A 3BZFA 3HC0A 1W0WA 1UXSA 3SJVA 5C86A 4PJ9A 1WV7T 4ENED 3C09C 1JPFA 1T5WB 4JHAL 2MJWA 1SM3H 4DCQB 3DI3B 5FYKE 4BZ1L 2ORBL 3ZTJH 3GMQA 4JO3L 1FC2D 3NGBC 43CAA 1I7RA 2NX5B 3ZE2E 3H6JA 3PJSA 1VHPA 3ARBB 1WBXB 3UP1A 1CLZL 3F7YB 3LSOB 4YHYC 1P7KB 3MCG1 3VFNA 4Z7WE 2AK4E 3BAEH 4PJBE 1NCCH 3SKNB 1SEBB 1DANT 2DAVA 4K94H 2H9GA 5B4MC 5DUMH 3ZHDA 4YXHL 5I1JH 4LLVB 1FC1A 3SKJH 1UEMA 2IAMC 3IETB 1KIPB 4XRCB 3P9LB 5E2TH 2R8SL 3FRPG 1N0XL 4GKSA 4KFZC 5DVNA 2WMPA 3ZSTA 5DZNA 1BOGB 3BKML 1QD0A 3NZ8B 3PWUA 4XNMA 3T0EA 4RFOL 4G7YL 1RJZA 5CIPH 1RZ7H 4M62L 4DQOH 3JTTA 3QFJE 3LD8C 2VDPL 4ZFZA 4O00A 4RCAA 3KPRD 4HUVA 3QCTL 4Y5VC 4AG4H 4XMLL 2C3VA 4IJ3C 3NFPA 4K7PL 2R9HD 1UKTA 2YPKA 3H9SD 4R97B 5IVXA 2O5YL 4GO6B 1UZ8B 4KC3B 4FFZL 3CH1A 2LAGB 1IAIL 3MJGX 2X2YA 2HFFA 1I7UA 3SKUD 3P9MA 4X5LA 3PQYD 4YXKL 3HHRB 2A9MH 1I4FB 3QNZB 4J6RH 5EIIB 1OTUC 2DLGA 3ALWA 3C8KA 2QQQA 4LQFL 4MQXD 4KXZH 4TVPL 5GGQL 3PGDB 5EPMB 2OTWB 2R4RL 1TZIA 3S5LA 3O45A 4OSUL 5C0BB 4LF3A 4LVNC 4LPCA 4ALAH 2OK0H 3GSOA 1T7XA 1HXMB 3HE7C 4XB8A 1F00I 3GSXA 3OX8B 4Z7OF 4LLQA 3VWKA 2R4SL 1U58A 4ODUB 4ZTPL 5EOQL 4PG9B 4WW1A 2PKDA 3IDYB 1GJIA 5J0BA 4ZPTA 2W1NA 2DQGH 1FORH 3ARZA 3UO1L 3B9KD 4Z7WA 2AK4A 1HSBA 3WN5A 4Q58C 2A6DA 5E8EB 4OZFA 4PJBA 1OT2A 3WD5L 2ICWJ 3OKKB 4R8WH 2FECI 2DMCA 3CXHK 1RI8A 3S98A 4R3SB 1ZT1B 4HW6A 3ZT6A 3QHZH 4NO2B 3O2DA 1MCEA 4PGCB 4K7PX 2GCYA 1KIQA 1YUHA 4HWZB 4JPIB 3MRMA 3MR9B 2DMBA 4V2CB 4HLZG 5CD3A 3RL2B 4JZJA 4NM8L 4JG0L 2XTJD 5HHPB 4HV8A 4TRPH 3QFJA 2XFXB 3MXVH 3QXAB 4LLUB 4Y5XA 4WUUE 3JUZA 3O6MH 1BX2A 4QCIA 4XPFL 2W9LA 1J05B 1VERA 4S1SL 2IADB 1IGYB 2VLJE 4PJ7B 1QR1B 3MOAH 4MA7H 5IKCB 1OAXL 5INCA 4OCSL 5CMAB 3RDTA 2NY6B 4UV4L 1T04A 3C5ZA 2J6EH 3O9WC 4M43H 2PXYA 2ATKB 4WW2C 5JA8B 2ZCLL 1QSEE 3QRGL 5H37G 3Q1SH 4K3GA 3RIAF 4JO1L 4YDVA 4JGJA 3HPJB 3HC4L 4R0LC 3MRRB 3UZQA 5F70A 3FQTB 5EC1B 5ABDE 2W91A 3GSRA 5SWSD 4R9HA 4ODSL 2GK2A 3BT2H 3FB5A 3PGCA 3V79C 5DRXA 3D2UD 1AE6H 4PP1C 1JGEA 3DGGA 2VL5A 5D70L 3RZWA 3CSYA 3PL6A 3QAZB 4O9HL 4XVUC 1RMFL 2YXMA 4CU7A 1RZIA 5J9PB 4TYUA 3AS1A 4DKEH 3QEUA 3DV4A 1LMKA 1ZVSB 2E6JA 1OL0A 3L6FB 3QXWA 4U6HB 1MREH 5BRZE 4F57H 3IKCA 3CU7A 5EOCL 4UTBH 1VACA 4WU5B 2AVGA 3KYNB 4YE4H 5A1AA 2PYFB 4Y4KB 3WIHH 1U3JA 3RU8H 3LEVH 3OKLB 1RK0A 1KXQE 4ZO7A 1K3IA 4WUUA 4ZUTA 1RUAL 2WBJD 1K6QH 2OP4H 4ZPVB 4DTGH 4JLRA 5D6DA 3MLZL 1R5VA 5EO9B 5FO7B 4C83B 2EDQA 4FN0A 4GG6F 4HHAA 1K8IA 3MJ9H 4JJHA 3NFSL 1DFBL 4N0FA 4NCDA 5T1KB 2W60A 4ORGB 2RJMA 1LNUA 4R4FL 2CRIA 5E8PB 1FL3A 4JANB 4KH2A 5CSZB 5HDOA 4RMWA 5GZNC 1QSEA 3REWA 3DXAD 2AXFB 2HLFD 1EEZB 2UYLA 4YNYA 3QIUD 1UENA 1M7IB 1JPGB 2FJFA 4H1LB 3MGTA 1U9KA 3DURA 3B3IB 4TSCL 1J0ZA 1L7TL 1MPAH 1YMHA 1F3JA 3OR7A 4JFHE 3EO0B 4U33A 2VDNH 2J8HA 5HI5D 3KPNA 5KVDL 1MNUH 1FCCA 4I0PA 4TQEH 4PGEA 5JHDB 3LB6C 3X14B 1DDHA 4Q9RH 2FX9L 1BGXL 1PKQE 4XGZB 2BRRL 3O2DL 3QDAA 4PJAE 4M7JL 4I8DA 1T0NA 3K0WA 5E00A 3ILPB 1PAMA 5DFTA 2DKSA 3BE1L 4AZ8A 4NM4H 4PV9B 1A7NL 5JOFB 1F90H 1LP9F 1E4KC 3G9VA 3FT3A 1IQWL 5FGCB 4OZHB 4UAOC 4V2BA 2CSPA 4HIHA 4X5WB 2V17L 3D39D 3ULUF 3S9DB 4H88L 3L3GA 4H8WL 2AXGA 1QHOA 1QPPA 4KMTH 1X5HA 3OGCA 1ACYH 4M6NL 1J11A 4RA3A 4I18C 1DBAL 4Y7MA 1Y6KR 2AABH 4JKLA 1TVBA 3K2UH 1OSZB 4M5YL 2Q86B 2E7LC 3Q5TA 1WWBX