2EEAA

Solution structure of the 17th filamin domain from human filamin-b
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
115
structure length
115
Chain Sequence
GSSGSSGPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Filamin-B
publication title Solution structure of the 17th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 8
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eeaA01
1VCAA 2X4UA 3VDCA 1CXLA 2AV1A 4IRJC 1TIUA 1H15A 3HI6L 3QFJD 1OGAB 3EOBA 1OY3B 1AGCB 3BMWA 1RHHA 1VKXA 2AJUH 4KTDH 1HIML 2HKFL 1JWUA 3H8NA 1IAOB 2BCKB 4JJHA 1CDUA 1HHHB 1NAML 2AI0L 3IFOA 1MHHB 4KKCC 1QNZL 4HWNA 5IHLB 2CRIA 4K3EL 1T1WB 1RZ7H 1C1EH 3MV9A 2ZUYA 5E2VH 2BVYA 4K94H 3GRWL 2ZNXA 3NCJL 1QO3B 3FO1A 2XTLA 3OBAA 2P5EE 4OSUH 4XCYA 5K9OB 4MS8C 1R5IA 3DMMC 2VZ3A 1Y6KR 3KHQA 2DLTA 3V5HA 5FKAB 1C7SA 2YRPA 4JQIL 4ZFZA 4UTAH 5FO9B 5FUZH 3ARXA 4JFFB 4J8RA 3CCHB 3PL6B 1JZ2A 3REVA 4RX4D 3MLRH 5IB5A 1IGYA 4K3DH 2QSQA 1AFVL 1G7MB 3NH7H 1CICB 4JFED 4ONOA 5C08D 5B22A 4XP5L 3ZDYE 1NBQA 2FD6H 4GT7A 3ZTNH 3U7WH 3VXMA 2VLLA 1LEIA 1P5UA 1MIML 4Z7VB 1OTTC 3U4BH 1NMBH 5ENWA 4EBQL 1FFPA 4Y5VC 3SKMA 1M1SA 4F33B 3SGKA 5KS9F 5LGHH 2R2HA 4MYWB 1BOGB 1I3GH 2QSVA 2F53A 2UUDK 1J8HB 2V2XB 4OV5B 4RZCB 2PNDA 3PWLA 1ZGLA 1I4FB 1UA6L 1F3DH 4LLUB 1YEJH 5EIIA 5HDQH 3TC9A 2ED8A 2YD1A 4KJQC 3L3KB 4LPUA 1WZKA 4Y4HD 3RHWF 2AXFB 1G9NH 2F58H 5DEZA 3I3DA 3GSNH 4U4BA 2BVOB 4OQ1A 3MACH 4KKBC 4QTIL 2XTJC 5DJCB 4LLMA 2FO4A 2VLJE 1I7ZB 2Y72A 3MJ9L 1XAUA 2HT2C 1RAMA 4JM2A 1YZZA 3F12B 1CFTA 2H2SC 3EFDH 1J10A 1QBBA 3KPRA 3SCMA 4KC3B 5KVGH 32C2A 3FAWA 4JPIB 4UIMB 4MCZA 5HVHB 4G3YH 4F7MB 2A77L 5DJ2A 4LVOB 1UJTA 1IAIM 4M02A 3O4LA 2EH7L 3PDGA 2EYSA 5E8DH 4U1GB 1Z0NA 1ZT7A 1B2WH 2BHZA 3EYSL 5IQ9A 5E6IA 2CRYA 3O3DB 4M6NH 4F7PB 1UWGL 2YPVH 5E8PB 4JKPL 5BXFA 2HLFD 2QADB 3MXVL 2EIEA 1QOKA 3KXFE 1F3JB 2Z4QB 7FABH 3O3BB 3WNKA 3MREA 3W82A 3K2MC 3QQNA 5J12C 4L9LB 3GSOA 1OP5H 1U8IB 4OI9A 1F8TL 1RIHL 4M8QA 4R90L 5DD1L 1MCBA 4G6ML 5HGBA 3MRNB 4QRQB 2ITCA 4KDVA 4HMDA 3QJFB 5IMOB 5I1LA 4U6TA 3VXOB 2X4QA 2PO6A 1YY8B 1A2YA 2YUXA 3LEYH 3MNVB 2BJMH 3MROA 5GS0C 1BOYA 3DX7A 5HGDA 3TNMA 2XFXB 5FHAL 5D1XB 4M7LL 2XPGA 3AB0C 3IDGB 1XZ0A 3JZ7A 3ES6B 5TQ0L 4NWTH 1N2RA 3RHWK 2X4TB 2GFBB 4AH2B 4NQVB 1DBMH 3HZKA 1GGIH 1LEGB 3IF1B 3FT4A 4RFOH 4UDUA 1SYVB 2D2OA 3BEWA 3MX0A 3EFFB 2SEBA 2HJFA 3CXDH 1OQXA 5MI0C 1SY6H 4GMSL 5IK3B 1G6RL 2PTUA 4PBWD 2EXYD 4YQXH 1I1RA 1MFNA 3L3JB 1WC7A 4K71B 2Q8AH 1H5BC 3ARRA 3V5KB 4JPWL 2Y6SC 1A6ZA 2VDQL 1PKQE 1QR1A 5DRXA 1WJ3A 3VDBA 4WENB 1MF2L 3AREA 4G42A 6FABL 5MEOA 3EZ8A 1NEUA 2FEDD 1TTFA 4HKXB 2OZ4A 5HTSA 3L3GB 5SX5H 3EJYD 5HHNB 1FYTE 4JFHE 1BZ7B 1RJYA 4X80L 5EPMB 5IR1B 4IRZH 4OLXL 4PV8B 1IAKB 1KN4L 4ZUVA 5GRUH 2DLHA 3MRLB 2FO1A 2DMBA 1V8HA 2FJHB 3H0TA 4WNQA 2R2BA 3BQUA 5BS0A 1MFDH 2WUBH 4C55A 1NEZA 1JNNL 1YMMB 1ULVA 4NO2A 1RJCA 4ZG1A 1LGVA 5D70L 3QUXC 2Z35B 1OAKL 4KHXH 1YNLH 2UZYB 1PKOA 3EJZD 3INUH 5BVJB 4I13B 4W68A 3MA9L 1INDH 1EJOH 1H8NA 4R0LB 4GOSA 4MMZC 3RUGA 4CN1A 4LSQL 1QUNA 2BRQA 4OLUL 4K94C 1H8OA 3C2AL 3IKKA 5FCUH 2VAAA 3HZMA 4ZFOB 5I1KH 3GSUA 2VXQL 4KK5D 4MDIA 3RVTD 2I07A 5E2WL 2QHRL 2OTUA 1KCLA 5GRWA 3X3FL 4Y19D 1YUHA 3TBTA 3WFDL 4Z7UB 1MHEA 5DQJA 2DQUL 3UBXI 3LS4L 4E41B 3BJ91 4Z7WF 3KPSE 5IIEA 3BI9X 4KI5D 1RK1A 1CGSH 5HYQA 4PRAA 3ARVA 5KAQF 3FQUB 3IDUA 2UY7A 5A43C 1WFOA 3MRRA 5I75C 1YPZF 1B4RA 4ZO9A 4JHWL 5AWNL 2AJZB 5DMIL 5CJXC 1PX4A 1X5FA 3C60A 3PXJA 2DKMA 3D3VE 3DV4A 4JANB 4YAQB 1T03H 3V0VA 3T0EE 2CK0H 1LO4L 1MAJA 2F74A 2XA8L 5GJTL 5HPOA 5F9JA 2DKSA 3GI9L 2W38A 2GUOB 3B2VH 4PJDA 2YOCA 3KPMA 3PWJA 4QF1B 4HBCH 3WL9A 5GGQL 1OCWH 1YEHH 4JQVA 2VC2L 4NRYB 5GQBA 3QUML 5EUOE 4LCCB 2B1AH 3FB8B 5FK9A 3W81A 2G75B 4HZLB 2Q6WB 2Z91B 5JNYA 1F45A 1ZLUH 1FFQA 5T5NG 3FB5A 1Z3GL 3FOMB 4QYOA 4I77H 5FYJE 4HKZB 1JPSH 3ZE2F 3BX7C 1CWVA 1XCTA 3OAYK 1X6LA 4KKLD 5DD3H 4LU5H 1LK3H 1FRGL 4XWGL 1FH5H 1BD2E 1IM9B 3P0VH 4H0IA 4MAYD 4MB3A 3WDIA 1G9NC 2ZCKH 4QGTA 2B4CL 4P3CH 4Q74A 1DBKL 5E5RB 2X09A 4Y8AA 1DJSA 5CP3A 1NGPL 3ARFD 5C6WH 1H0DA 1R5WA 1BVKA 3QRFM 2J8UE 1UM4L 3FRPA 2JIXA 1CT8B 3R4DA 4M61B 2J5LB 4M5ZH 3VXRA 3C87A 4DKFH 1YN6B 4JO2L 5EU6B 1XF1A 3G08A 4RMQA 3HN3A 5D1QB 4CVXB 3KYKH 4OGYL 4TSAH 2BDNL 4ALAH 2JB5L 1QEWB 1X9QA 3WDHA 4HWBA 4PGEB 4YK4B 4Z7NF 2BNQE 4MLIA 3X13A 4ISVB 4XNZC 4UQ2A 2OQJA 4NRZA 5FYLL 1FDLH 1U42A 5CSGA 3OR6A 5BZDA 1KPVA 1ZGLM 3P77B 1BZ9A 3EYUL 3ARDA 2OP4L 5FYJD 1U92B 4LDOB 3VD7A 3O9WD 4M6MH 1UCTA 3AS0A 5E5MB 4LASL 2DIBA 1X44A 2Q87A 3ZYZA 3GIVA 4EDWL 5JW5A 1QA9B 5FM5O 4XPBL 4ODTL 5DC4B 4C56E 3KLAB 2EICA 4GQPH 3IDJA 2ZSWB 4DZBA 4KJWD 5I8KH 1XF5B 1D6VH 4JRYB 2VUOA 1HEZA 3QQ4A 2CUIA 3H9SA 3QRGL 4UZGA 4FQHB 4E42A 2O5YH 3WXWL 3AMLA 1KIQB 3HAEA 3GZKA 4UV7L 4ZXBB 2RB8A 5C0IA 1FO0L 2E9WA 4JGJA 4IM8A 4GKZA 4WHDA 4Y4HC 3SO5A 4KVCL 3QUKB 5E7BA 2GTZB 2FGWL 1DEDA 2HRLA 5ETUA 3CFBB 4NZRH 1KPUB 4JN2B 1IGIH 4L8SA 3OHXB 3QJHB 1XGQB 3E6FB 4L3EB 3ZHDA 2BNQD 4XC3L 3MXWH 5E8OB 4MDJA 3CFKB 4K7PH 1V3MA 1J05B 1DBJL 1AC0A 2VDNL 1U3JA 2NTFA 3U1SH 4K8RD 1JPGB 5KS9A 3V6FA 1U91B 3BPLC 1A7RL 2GY5A 1BX2B 3GBML 4NKMB 4ODHL 3RWEA 4MNQA 1KB5H 2YKLH 3CVHB 3VG0L 4Q97A 2C9AA 3QG7L 4ONGH 3CZJA 3CMOH 1MPAL 5HY9A 4O51B 2EDBA 5F97E 1SMAA 1FC1A 4OLYH 2GEEA 3K2UH 5L0QB 1CXKA 4RIRB 4XNUH 2HLFC 3BOVA 4XP9L 2WIMA 1A47A 2F8XC 4OZHE 5E00B 5FYJH 4PREB 4N8CH 2BSSA 1JF1B 3UC0H 4MHHI 4JB9H 1FVCA 2RQ8A 5LQBH 1FSKB 4KRPD 4QEGA 1LE9A 5I66B 1L4IA 4PJEF 4NZDA 3DGGB 5D96C 3MV7D 1PDKA 3IDYC 5F1IB 1JHLH 3ULUL 2GHWB 1T3FB 2A74A 5ADOL 4L4VB 4YHNB 3MRKA 2R1YB 4NHUB 3O6FD 3I02B 1Z0MA 3P4NB 1A4JA 3SDXE 1ERNA 1UQSA 4NOFA 1MAML 5D5MB 4G7VH 2H41A 1QLEH 1BWWA 4HKJB 1WAAE 4Y2DD 1V3JA 4JFOA 3RL2B 5DJZB 1KBGL 2YN5A 3FO9A 3HNVL 3VWKA 3D85A 3IJHA 1NLBL 1IKFH 2DQIH 2C5DC 2DLIA 5AEAA 1TZIA 2EXYC 4NN5C 1CU4L 1ORQA 2FWOB 4F9PC 4FOMA 4K8RH 3L1OH 3SDCA 1P4LA 5IFAH 1I8MA 1MIEH 4FQIL 5T5FL 2FEDC 3KYMA 1VSCA 1HSBB 1DLFH 3PWVB 2PYFB 1P6AB 3HCVB 2BFVL 3EJYC 1FE8L 1K8IB 4D0CA 4KMQA 4DKAA 1N4XH 4CJ1A 4RDQG 2OK0L 4RAVA 3UJIL 5FUCE 1N0XH 2XWTA 2UVEA 5J3HD 2FATL 5HGHA 4R2GD 1RUMH 2PW2A 5C1MB 3DOSA 3S5LG 1AGBA 2CH8A 3GSWA 3S37H 1HSAB 3MA7B 4V1DA 5CIPH 1R24B 3BT2L 4LLDB 1TTGA 2AJ3A 1AP2A 1D7FA 2IAND 3EJZC 2BY2A 1TJGH 5IOPA 4FZEH 2R56H 5FF6B 1P7KB 3Q5TA 2W9DH 4LP5A 3QIBD 2J8OA 3EDKA 5CBAB 3T2OA 3C8HA 5IBTH 2PYEE 1CI5A 4QRTA 3P4LA 5FYKE 1C8PA 1T21B 1UVQA 4KK5C 2DRUA 3RVTC 1JPTL 4LIQE 4CADB 5I8CA 2ZUQC 4ZNCD 3VXUA 1KENH 5LCVL 5IFHL 5JXED 4RISL 4X83A 3KPPB 4H25B 3VI3E 4M7ZB 3ZDXF 1EGJH 1HZHL 1UADC 5E4IA 2G2RA 4KI5C 3WDJA 2AXJA 4P4KC 1BQHG 2BXYA 1VFUA 3DVIA 3QXDA 5D7JA 3EO1B 2B7DT 3ZE1E 1FLRH 5CEZE 3BRFA 2HKHL 4U1NA 5C09E 4JFDE 4OQTL 1WTGT 3VRLF 3EOYG 4U6XB 5EWIL 4XCEB 2JB6A 3NCBB 3ULVF 3MV9D 1UB6A 2GJZB 1I8LC 1HINH 1FZOB 1ORSA 3HLAB 1U8JB 2D9QB 1I7UB 3JVGC 5ISZA 3DX9A 1AXSB 1GGCL 4RRPG 1SM3H 2R0ZL 3ECBA 5I17A 1RZFH 3BIKA 4YPGB 1KJ2A 5JIIA 2O61B 2R0LL 4FFYL 5FYKD 5JW4N 4H1LB 4BZ1H 1NAKL 4X7SH 4Z7WA 2NY1D 4ZODA 4IMKC 4KKLC 1J9CT 3DXAB 5EBGA 3BAEH 4F3FB 1NGWB 1ZHBA 3MJ6A 4LEOB 3BKCL 3GMRB 1XF4B 4WFGD 4MAYC 3VFMB 3OKLB 1OD9A 1YPZA 2VXUH 4W6XB 1MSPA 1UB5B 2X7LB 4NQDD 4WI5A 2BVQA 2BRRL 4HPYH 5F1KC 3ARFC 1RIVL 2YPKA 4W81A 3OJ2C 3FRUB 3MNZB 4CU8A 1KLGA 5SWZE 4N0FA 1T5WA 1A6PA 2IPUK 3E2HB 3KJ4C 3EW3B 1KV3A 2HJKB 5E8EA 3LKPB 3EGSA 4LOUC 3T0EC 5J56B 1N0LA 4L5FH 2EH8L 4JO1L 4EUPH 4WO4B 2F53D 2A38A 3TN0B 3IGAA 3FFCA 4AM0B 3RY6A 5GGRB 1ACZA 3GJEA 4H88L 3O6KH 2P8LB 3TBYB 5DR5H 4L8BA 2KBGA 4ESKA 5GGTA 3BPOC 1OD7A 4NWUH 2EDOA 3TFKD 1S9VA 1FNSH 2VLRB 2PR4H 4KFZC 2IPTH 2VZUA 3QEHA 2VZVA 5EBLB 1F90L 5CP7B 3C2SA 2ZUVA 1BVZA 1SJEA 3O9WC 5F9WB 5FA4A 2DQTH 2W9LA 3C5ZB 3O3UN 1U6AH 4ZNEE 5MEPB 5FGCB 3WUWA 3NZ8A 4WIQA 2ZUXA 2X4UB 1GH7A 3F5WB 4JM2D 2H9GB 3W39A 4LGPB 3BISA 1QRNE 2AGJH 4PUBH 2DQJH 2JF1A 4LGRB 4ZSOE 1ZLWH 3SCMD 2ICCA 3EOBB 3GMLB 4RFNC 4KJWC 3L6FB 2R0WL 5FYKH 3B8YA 1B0WA 4EKXA 5DQ9A 3BSZL 2YA2A 3TJHD 5DA0B 3IFOB 5BV7L 4OSUL 3QZWB 3X14A 5DMYA 4LDEB 5JDSA 4WGWB 3DO7A 1U3ZA 4YLQT 1GZPB 3H6JA 2J7LA 1PZ5A 1CZ8L 2E9BA 1X4XA 3HPLB 4XP4H 2D0HA 1MI5A 4F15B 2IH3B 1RY7B 1WT5A 1CK0L 3GBLA 4XCYB 4M43H 5F7FA 4QCIB 3MLRL 3V5HB 3JXAA 4ZFZB 3NH7L 4XHJD 4K8RC 5EU4B 1X7QA 3SOBH 2DJUA 5DJ8A 1JHKL 4J8RB 3KPOA 5EFIB 4HUVB 3ZTNL 2EDJA 3U7WL 2V2TA 2FCBA 1NMBL 3GHEH 1BAFL 5IT2H 2NY7L 4AEIL 1IEHA 5IB1B 2CK2A 3HI1B 2IAMA 4TYUA 2BC4A 3HMXH 1R3LA 3VXMB 1QRND 4AENB 1T2JA 4QRPA 3E8UH 3V95A 3DYOA 4P23D 5JIKA 1FFPB 4KUCF 3Q6GH 3ROOA 3IB4A 2GJ6D 3SKMB 1JNHA 3TZVD 3IXAA 4I18B 5IMMA 4TRPH 2CUHA 5DLMH 5JZ7D 1JRHH 1VDGA 2R2HB 4BKLB 3LMJH 4LEXL 4KRPC 5HYJE 2YPLE 3PWLB 1HDMA 1UH3A 4NQTA 1E6JL 2DM4A 4KJPD 1PAMA 4Y16A 2HH0L 1HXMB 2W60B 4PLJD 4PJHE 1F4WL 2VE6B 1MCWW 2DICA 5TQ2H 3O6FC 4ELME 4PJIF 4NKDB 3QIWD 4QOKB 1U8MA 3O3AB 3IFNL 4QRRA 2EDRA 1QYGH 4Y2DC 5KVGL 4LPYA 5FOBB 1EFXA 1WIOA 3C09B 4ODBD 5IF0B 1BECA 1CFTB 4FQXA 2VDRL 3VJ6A 1ND0A 2Y4SA 1XEDA 5AUMA 1OQOA 5BS0D 1LE5B 5E8DL 1FBIL 4NN6C 3I6LE 32C2B 4G7YH 5CCKL 1KTRL 4XC1H 4MCZB 2YPVL 3LCYA 5DJ2B 4JQXC 3O4LB 2BSED 3IJSB 1OGAE 1NBVH 4PJEA 2EYSB 4FTVB 1DVFA 7FABL 1ZT7B 1RFDL 5IQ9B 4KXZH 4QHNB 4UB0H 5MERB 3NN8B 5HYJD 4MD4A 1YEDA 5I71B 4ZFFB 1WBXB 4U2YA 1LDSA 2R29H 5JXAH 1F4YH 5ACLA 3MREB 4DW2H 3FFDB 3LEYL 2VH5L 2FZ3A 4M8QB 4I8DA 3H42H 5DJXA 5EC1B 2RGSA 1CGTA 4G9FB 5EORL 3HFML 3SBWC 3RJQB 4MNGA 2CGRH 2PO6B 1RI8A 4HMEA 1DQLH 3ZKQD 1DBML 1JN6A 3C6LA 4JFFE 2WM0A 3EO0A 2DWEA 3VGBA 3QIBC 4F8TA 2FGZA 1I8KB 3CXDL 1MWAH 2UWEF 1B0GB 3HZKB 2Q8AL 3SDAB 3AY4C 1CDJA 2ADFL 3FT4B 3MLYH 4NIKB 4XMPL 3DYPA 3DUUB 1HNFA 1RSFA 3BEWB 4X4YA 4Z7VE 3O6ML 4C4KT 1E4WH 1OGAD 2HJFB 3L5JA 5JXEC 3N0PB 1BREA 4IJ3C 5IESL 4E0RB 1QFOA 3MR9A 1WC7B 4HKBA 4XRCA 1P6FA 5HHXL 1A14H 1KJVA 3IU3B 1A6ZB 1UWEL 1QR1B 5DRXB 3PV7A 3BFOA 3RGHA 2J6EA 5CJQH 1J8HE 4G42B 4ZPVB 4MLSA 5EN2A 4YIQB 5MEOB 4YDKL 1CL7H 3PDOB 4TTGA 3C8KB 5DGQA 3LB6D 4M5YL 4W6WB 3V0WH 1F58L 4HJGB 3S9DB 1KG0A 1INQA 1ZMYA 1FQ9C 3UEZA 4G8FA 2OSLB 2WUBL 2DM7A 4YXHL 3MUGA 2DLGA 4YXKL 4ZUVB 2CKBL 3S88H 4KHXL 4OCMC 4KZDH 5J9PB 1AE6H 2AERT 3OL2A 4Z7QE 2EYRA 3S98A 2C1PA 4HIHA 4CMMA 5I1DA 1CICD 4XPAH 4RCAA 2FJFA 4LFHD 2NY1C 3AUVA 1VPOH 5JR1L 4HUUA 4R97C 1IT9H 4R8WH 4HGMA 5I16A 2CIKB 5FHBH 2YRZA 4EIZC 3BDXA 1KLUA 2DQGH 3PGCB 1E4XH 3UZQA 3QDJA 3OMZA 1OB1A 5DVKA 2OR7A 2CXGA 1AQKH 3GSUB 1KJMA 4PB0H 1P1ZB 3F6IA 3O4OC 3ARDD 4JFPA 4ZPTB 1J8HD 2DQEH 4MDIB 1F11A 4UAOB 1U8NA 2PCPB 2GJJA 3HG1A 4HSQA 1DR9A 5C8JA 4HS6A 5GZND 4PJ9B 3VGGA 3OJDB 5DQJB 1CLOL 1DQDH 1KT2B 4LNRA 1RJZA 4LAQH 1EMTL 1RK1B 2NY5H 2NY6B 4WI6A 1YNKH 3QFDA 2V7HB 1JGUH 3MRRB 1T7YA 1AJ7H 4G6AD 4BH8B 4OD2A 3C60B 3H9SD 1DZBA 3WJLC 5ECJE 4JR9H 1YEHL 3TFKC 4O58H 2R1WA 3RKDD 1TQCC 5I1GH 3UTQA 1FCGA 4YBHA 3MLZL 1CD1A 3KPMB 3R06A 4HS3A 3WL9B 2NLJA 4IOSD 2EE6A 2Z31D 4H26A 5I18H 4I77L 5CP3H 4Z7OF 4U6YA 1MY5A 1FYHB 3B5TA 5JA9A 2DIAA 2OM5A 4HJ0D 1FGNL 4AJ0A 4LU5L 3SCMC 1ZT4A 1MFCH 2CIIA 5DHVB 5LWYL 1T1ZA 4I3SL 2X1XR 4WV1A 5J6HA 4MNQD 4PRIB 4HK3N 5KOVC 3RWDA 4P2CG 5F96L 4JJ5A 4IOFD 5FKPB 4Q2ZB 3HC3H 3KAAA 2DMCA 4HH9A 3FONB 3GB7A 4KAQL 1NC4A 2QL1A 5GHWL 5I2IB 1B90A 2EE3A 3QHTC 5DDHB 3NIGF 3O2VH 5E9DA 2HFFB 1H0DB 1R5WB 4GS7B 4J12A 5D93C 3T2PA 2JIXB 1KCSH 1IC5H 1SHMA 3VXRB 5C2BH 3CSPA 1ZHLA 4JG0H 2F5BH 1CLCA 4XHJC 3G08B 5EU3A 3CSBA 4FNLL 1W0WA 4JFZH 1JTOA 1KXQE 3MLXH 3OGOE 4LKCA 1G0DA 1YMME 1XCQB 4K55A 1CLYH 1VFBB 1KNOA 1N64H 3X13B 4NQCA 3TBVA 1M71A 2XRAH 3EYOA 5I1HL 5BZDB 2GITA 3P73A 4X4MA 2DL9A 3PWPA 3B83A 4WFED 1BPVA 1LWRA 4OUOA 4P23C 2EEDA 1QQDA 3TZVC 5CWSA 4NQUA 1TVHB 5DUPH 2F54A 3UZVB 1OAYL 1UJ3A 5I8KL 2CDFA 5JZ7C 2VMFA 1R5VB 1GZQA 1BF8A 3BWAA 3GIVB 4UOW0 4YHOL 2O5YL 4DCQA 5B4MD 4FQJL 3B9KA 3Q48A 4CUCA 3IDJB 5GGSY 5DA4A 4DZBB 4KJPC 4Z7UE 5EC2A 4E41E 5GRVL 4P48A 3BP6B 4LSUH 3T0VA 1K5NA 1HEZB 3WHE0 3HNTH 1RJLB 5EO0B 2HRPL 4PLJC 5IGXH 4MAUH 3HAEB 4DAGL 5DUMH 2X4OB 5F3HA 3QIWC 1JWMA 3BPCA 5K33A 5GSRA 5D7LB 3IDIB 5TGBB 3NIDF 3ZTJG 5CEYB 3TCXA 1UM6H 3MRCA 3P30L 2P46B 4JAMB 4JZJC 4XT1C 2UVFA 1YMMD 5HI3D 3KLSA 2DM3A 5DO2C 5BCAA 5H94B 5C07A 1G7HA 1KB5L 3L3OA 4ONFH 2LTQC 1FAIH 1C16A 3CMOL 1B0RB 4D0BB 5KS9B 3V6FB 2FLBT 1NC2B 4V1DD 5EG6C 1IGCL 1Y6NR 1NDGA 5A2LH 4HDIA 2A6IA 2IEPA 3TLRA 2E27H 1IGFL 5CEXA 1DBBH 5JTWA 4G6FD 4MXWL 3TVMB 1A21A 4I48A 4XVSH 3KYNA 5EU5B 5IV2A 4PJIA 2BSSB 2ZCHL 4RGMB 3MGTB 3BGAA 1A5FL 2XNAA 1JGEB 1LO2L 2W65A 3A67H 3QDMD 2NXYB 3VXUD 2VN7A 4OCRH 1FVCB 5ITBH 2E6QA 1V3LA 4ZAKB 3FTGB 2UZIH 4P5MB 4X4XA 4RMRA 4OCNC 5EU6E 4HEME 3CSYA 3CU7A 4M3KB 4XAKE 1UZ8A 4NUJB 4JFQA 5A3IC 4QXTB 4DZ8B 2QQLL 4KV5F 4OZGB 3GMPA 2XACC 2VDPL 5GRYA 4ZDHA 2DQIL 3ISWA 1A4JB 8FABB 3QUMB 3TH3T 1UQSB 4OIIH 1XH3A 1YECL 4W70A 3TA3D 4EI6B 3T0XA 4OBRA 1U8QA 2VLME 3FO9B 5JO5A 3VWKB 1M4KA 3IJHB 5ISZD 5IFAL 3BP7A 1MIEL 3PP3K 4YZFE 3K46A 1TZIB 3GRWA 4UT6H 1BMGA 1DLFL 1CGYA 4F8QA 1FG2A 5F7DA 2NY5C 2PF6A 3JUZA 1II4E 5JOPD 1I1AA 3K1KC 1RU9L 1T1YB 3TJEH 1IM9D 5JQHC 4N0UA 3S34H 3LB6C 4LAJH 3HE6D 1CVRA 1FJ1A 5CZXD 4JRYE 4C57C 3LIZH 1JNLH 1LQSR 4HS8L 4LSDA 3BHBA 4NPYA 3UROR 4PRBB 1BQHA 4YO0B 4XAKD 5D1QD 1T0MB 3EOTH 5DUBA 4GRMA 2PW2B 2UWEA 3ET9F 4MMXC 5ANME 4L3EE 3GSWB 3WN5B 4LPWA 4OZFB 5HHQA 5K59F 1XFPA 4JPVL 4X6CB 4TPRH 1CICC 1EXUB 3D6GA 3S36H 3RVXD 4LSVH 3Q3GA 1KFAH 1V7NL 2AJ3B 3RGVD 4QXGL 1FN4B 5C0CA 3C6SB 3OKEB 3FFCD 5IOPB 1PY9A 4OFYA 2BNRB 4RBPK 2BVPA 3HKFA 1GC1H 4ODSL 2MHAB 1YEKH 4PYGA 1L0XA 1YYML 5EBWB 4EI5D 3CPLB 1EGJL 3OAYH 3EUUA 1UVQB 1IGTB 3OPZH 3QXWA 2VL5A 3QULA 1PLGL 3EYFA 3QDGB 2R8SL 5GZNC 3FQWB 1YEFH 5ITFB 5DFTA 1INEH 5C7XH 3CFCL 12E8H 2HFEA 4RNRA 2L4OA 3D48R 4X7EC 3N1QC 5ICXA 3MJ9A 3QXDB 5D7JB 5D2NA 3LKSA 4M9OA 2NY3B 2VDLL 1T04B 3HRZB 1A3LL 4LCWA 1CDIA 3OAZH 2PW1B 4Q0XH 1SM3L 4L3ED 5EBMB 1D5IL 3NFPA 4JFXA 4L4VE 2JB6B 1AIFA 5HYSG 4PTUB 4CN4A 1QFUL 1UB6B 2APXA 4MCYA 4ZQKA 4LCUB 2Z31C 3DX9B 4M48L 4P2QB 2ARJQ 1F4XL 2FNBA 4YNYA 4AEFA 1QSEA 5HHPB 2CDEA 4XX1G 1WEJL 3ARBB 5I17B 5IW1A 3TWCL 4HJ0C 3ABZA 3BAEL 3BIKB 5T3XE 4LVOC 1KJ2B 2JTDA 4LCYB 4LVNB 3D9AH 4U1GC 4PG9A 2MCG1 2YSSA 3CAFA 1KN2H 1QR4A 2N7AA 4FQ1H 2X9WA 1VHPA 1A7NH 4UDTB 1F6AA 2QADC 2CD0A 4I9WD 3DWTA 4UILL 3LKNB 1K3ZA 3MNWB 5K9JL 3SE8H 5KANG 2R15A 5CFHA 2V7NA 4L5FL 5E99H 3MRQB 3VWJA 2AJVH 5SV3A 1KLGB 4OGZA 3RVWD 4N0FB 1T5WB 4G9DA 1NANH 3UBXA 5DR5L 3OKMB 1P5VA 1FNGB 4GRLA 2YEZB 4L4VD 1H3PH 5ERWA 2B0SH 3T08A 2IPTL 3GJEB 5AYUH 4L8BB 4HQQH 1KCUL 5HDOA 1G6RA 2X4SA 5TF0A 2DQTL 4S1DD 5J11C 1XGTB 3MV01 4HXAL 3HUJF 4Y1AB 2ILLA 2GI7A 4Y5XB 2ZCLL 3QEHB 2HTLD 2AGJL 4Y4FD 1MJ7L 1S7UA 5FA4B 4K71C 2IMMA 4N9GB 4KRLB 2PTTA 2P5WA 2A1WH 5MENA 1UG9A 3SPVB 2HT3D 1KIRA 4LIQL 5B4MC 4FQXD 1M05B 3W39B 2O5XH 3MV11 4WHCA 1T22A 4W4OC 4M1CD 3ZT6A 4RSVA 2C26A 4PP1C 3QEUB 3VDAA 3H7LA 3U9PL 4YFEA 3CX2A 4Y7MA 5DGRA 4BFIA 4XP4L 2BMKA 1OT1A 1C5BL 2EDFA 5BVPH 1I75A 4QTHA 4WU7B 1I8IA 3FN0L 2LE9A 5GS1A 5A2FA 4NQXA 4ODUB 5JDSB 5KSAB 5CEZL 2OJEB 4U0RB 3RVVD 1D6EB 3DO7B 1NKOA 1U8LA 4ZS7H 2A0LD 3NA9H 4GAJH 1NMCC 2AJXH 4KQ3L 5HI3C 3SOBL 3SKNA 1MFBH 4GQ9H 4UINH 3EAKA 4TVPE 1LO5A 1N6VA 2GW5A 1KCRH 5D2LB 3TCLA 5GSVB 2K7PA 5ALBH 3SE3A 3D39D 4R0LC 1Z9OA 2V5RA 1ADQH 4WW2B 4Z5RA 4X8JA 3MYZA 4G8GB 4APQA 4GRWB 3E8UL 4XNYL 4WEBH 2YD4A 4NNPH 4YX2L 5J13B 2ADJA 5FFLA 3W2DL 3GMQB 1QPPA 5BMFH 5LVEA 4TRPL 4YDVB 5T3XH 1R3LB 3DXAE 4QRPB 1I3RB 4P2RA 4Z0XA 2ESVE 4QXWA 4OLZH 1JNHB 4GSDH 3WMSA 5L8JB 1D5XB 3ME0A 3TT3L 5D6DA 1LVEA 1MLBA 4PR5B 1WBYA 2ZOLA 3MJ8B 4CU6A 1FL5B 1HDMB 1IGJA 3SO3B 3BO8A 1SJHB 1A02N 4Y16B 5L8LB 3VD3A 3RFZC 4TVPD 5I30L 1F5WA 5DRZB 4PS4H 3O8XA 1S5HB 1MCPH 1NMAH 2X89A 5JW4Q 3DX8A 1U8MB 1GC1C 1JYNA 3SKJH 3TA3C 4QRRB 3PHQA 2VUYA 4XNMA 4RGOL 2R69L 2VLRE 1EFXB 4PLKD 3ZKXB 1AD9B 2JJWA 3DO3A 2J2ZA 3CIQA 4N0YL 3SDYL 3E1F1 4YWGH 5AG8A 5JPNA 2VR4A 3REWA 3SEPA 4WWKB 3DXAD 5FGCE 3G5VA 4XPTH 4UB0L 1GVIA 3UPRA 2ESVD 4AIOA 4OIBA 2DN7A 1HWHB 3I6GB 3C5JA 3VFWB 1CFSB 5CAYB 1HE7A 5D72H 4KDTA 3HE6C 4EDXA 1DVFB 5JXAL 2VQ1B 5CZXC 2EDDA 2MCPL 3H9HB 4JO3L 1ZSDB 3QDJD 2A6JA 2E5EA 3H42L 1J0YA 2AEWA 3C5SA 5C6TH 5D1QC 1P9MC 3CFEB 1FCCA 3BVNA 3PWUB 1EEZB 3TN0D 4BFBD 2CSPA 2FZ3B 1B9ZA 3NFNA 1K4DA 3GSXA 3T0DA 5E8NA 4U6VL 5DJ0B 3RGVC 1QBLH 4BELD 3O2DL 4KQ4L 5HHVH 1JN6B 5F6IC 4UOJA 3C6LB 5KVFH 4TVPH 1J1XH 2AQ3A 1XF3A 3W5MA 2XG5A 2IQ9H 3G6JF 3CXHJ 3C5ZD 1EPFA 4BM7A 4EI5C 3FQXA 3QUZD 1CIDA 1A1MB 4MSWA 1A14L 1RUKH 1OSZA 1IGML 2IFFH 3ULSA 1YEEH 3VXME 5CJOH 1CLZH 1KYOK 1I7RA 3C9NA 4X4YB 3ARGD 4N9OB 3BKMH 1FO0A 4OFVA 3N85H 1P4BH 3MR9B 3W9DB 3U2SA 1DSFH 2HN7A 1JWSA 1QKZH 3BUTA 3TBSA 3QI9A 1YA5A 3GBNH 3L3IB 2X70A 2KZ1B 4I3RH 3T3PF 1OF2B 4I0KA 3FZUD 4GW4B 2AP2A 4G8EB 4KHTL 1WZLA 4WHTB 4P5KA 4PRDA 3N9GH 3THMH 4DOHB 1KG0B 3HZVA 2XOTA 4G8FB 4QXUH 4DJMA 3MUGB 2FX8H 1NC4D 2XWBB 4QOKE 2A6KA 4L29A 5E9DD 4HHAA 1NSNH 1W8OA 3FO0H 3L5WB 4P59H 5J6GB 1VPOL 5KSBB 5DEFA 1DE4B 5DJAA 2EIDA 5JDJA 2DQGL 4HIHB 4LQ1A 4CMMB 4IRJA 2V17H 3HR5A 5KZCD 4M7KH 4QNPE 1RMFH 3ZKMD 4MJ4A 2FJFB 2B2XH 4H20L 1RQ5A 4X6BA 1JTPA 2AK4A 5L0QC 1OP9A 3WFZA 3OX8A 2GTWA 3MLTB 4HUUB 4ZUWA 4ELKA 5I16B 4PJBB 4EIGB 4J2XA 4NQCD 4ZTOH 1MCLA 4CW1B 2AS5M 1I9EA 4FQCL 2NYYD 1MUJA 3O4LE 1I1FA 3MBXH 4FTVE 2DWDA 3L3DA 3IJYA 1Z2KA 1KJMB 3FCTB 4CJ0A 4H5SA 1FSKC 3DTXB 4HC1H 1F11B 1KB9K 4XCNB 3RVWC 5C0AA 3DMMA 3WFCL 4HS6B 5C8JB 4DK6A 2I24N 2ICEB 4WFFD 4DN4H 1L7IL 1KYOJ 3JV6A 4LNRB 4FABL 3CLEH 3OSKA 4O58L 4P3DB 5DWUH 3B9KD 3O11B 1HWGB 3QFDB 4TUKL 4G9FE 4QOKD 5I1GL 2VITB 4LLWB 1EEQA 1NGQL 2DIJA 3PGFH 5H35A 4KMTH 4S1DC 4ETQA 4TSBH 5I18L 2ZUWA 2R1WB 1T0PB 1UXSA 3HHRB 1QFWL 2HTLC 3EO9L 3I6KB 4O02H 4DGYH 1PG7L 2QSTA 4Y4FC 3WUZA 2AKRA 3ZDYF 2P43B 1JGDA 4GG8B 1EUTA 4Y5VA 1RZGA 5JHDB 4UBDC 2HT3C 4U6YB 2LVCA 3D5OF 4P4RB 3MO1A 5C07D 4EZMA 5HPMA 1VB9A 3BZ4A 2PUQT 3T1FA 3LQZB 2ITDA 4KUCD 4M1CC 3SE9H 5H2BA 4GBXD 3W0WA 3H3PH 5HJ3B 4FTVD 4XNXH 3HC3L 5I76B 2CIIB 3EOAA 3BIAX 4HIJA 4WV1B 5J6HB 3O2VL 3HC4H 3WE6A 1XR8A 2XN9D 4HAGA 3GMOA 4OF3A 2VZOA 3RVVC 2E7MA 1KCSL 4WCYH 5JIHA 4HH9B 2A0LC 3GB7B 4JG0L 4MNHA 1IEAB 2F5BL 3NACH 4N68A 1I7TB 2UYLA 4HLZH 2C7UB 1SJVA 3MLXL 3HUJA 3E6HA 4G9FD 2QQKH 3SJVA 1CFNB 5C0GA 1WITA 2KZWA 1P84K 1ZHLB 1PG7X 2NY4B 5DD5H 4CMHB 5EU3B 3LS5L 3AS2A 2CJUH 2ICES 1KB9J 4KY1H 1NUNB 1LDPH 5ESVB 4NNXB 5CD3A 5DTFA 4WUUB 3GUTB 1KNOB 4O5LL 1EDQA 2VABB 4AG4H 2NQCA 3EYOB 2JJTC 1V7ML 2A6DA 2I9LB 2P8MB 2COQA 3FHAA 5L6YL 3QB7C 2C3GA 2GITB 5D7KD 4IIQC 4ENED 1BQSA 2G60H 1CDYA 1YYLH 2D4DA 2DBLL 4M7ZC 4PIRF 4OB5L 1QBML 3DARA 4PPTA 2F54B 4OQTA 1KELL 2CDFB 2X4RA 5ACMA 4PJ5E 1BBJA 1QFWI 1UYWL 1TZGL 4P2OD 3CUPB 5F8QC 3MRFB 1GHFL 3GSVA 4BZ2H 2PXYB 5SX5K 1K5NB 1YEGH 1I1AD 3LRSB 5ESAA 1AGFA 4GAYA 5DK3A 1BBDH 4LVHC 4XMLL 5T1DL 1S9XA 4ZUUA 2HVJA 5F3HB 4G80A 2CKBB 2QQNH 3BPCB 3V6OE 3LV3B 2LABA 4PD4K 1DN0A 2VYRE 4L8DA 5L9DL 3VH8G 3MRCB 3B4NA 4RAUB 5CBEB 4PLKC 5I73C 4NQEA 4DKEH 4PGCB 1G0YR 4WI8A 1UENA 2AJSH 2YK1H 1D9KA 3JV4A 4NJAL 3TIEB 1KTLA 2F15A 5E2JA 2FX9L 1G7PA 3DROB 4G5ZH 3R0MA 4HD9A 1H5BA 3GMMB 4L4TB 3RL1B 1MH5B 5GJSL 3AC0A 4NJ9L 1EZVX 4PJAF 4XVSL 4RQQA 2W0FA 5IVZB 1DQJA 3KS0J 3CZFA 5C0CD 2IBGA 2YZ1A 4H8WH 3IFLH 5SX4I 2QEJA 4PJ5D 2QSCL 1F2QA 3KWWA 4LCIL 3F7VB 3OG4B 4PRIE 5I8EA 3HI6H 1VACA 4I48B 5F89A 1KEGH 4PJ9D 4JFYA 1DUYA 3M1BA 1HIMH 2OLDA 2HKFH 4PJIB 4EXKA 2FR4A 2XKSA 5TDOB 4FMFA 5IM7B 4PV9A 3I3BA 3TIDA 3TN0C 1NAMH 2AI0H 2NY6D 2W65B 1OM3H 3RIAF 4EEEA 1P7QD 4K3EH 1T4KA 1GGYA 2EEBA 3OKNA 4ZO8A 3GRWH 1V5JA 1N8ZA 3NCJH 3STLA 3VXRE 3QUXA 5F70A 4I4WA 1WCBB 3V2AR 4FMKA 3N1FC 3MODL 4X9FA 1FC2D 4GAGH 1QLFB 5K9QI 1QPXA 3QNZB 3RVUD 4DFHA 3QO0A 4F9LC 3PUCA 1HOCA 4LCWD 3QEQB 4ZDHB 3IDNA 3S5LB 3C5ZC 1BFVL 2DL2A 2IMNA 2FEEL 3KNBA 2DDQL 3QUZC 3MFFB 4UT6L 3AGVA 5I19L 1TETL 3DNKA 3IYLW 1U8QB 4P5TB 3BN9D 5JO5B 5L2KB 4OGXH 3ARGC 3QXAB 4KTYA 3TJEL 3I9GL 4PD4J 4UT7L 4XP5H 1OAQH 4LSTL 2H1PL 4ZFOL 2EIZA 3MRMA 3QCTL 1VESA 4AT6A 1FG2B 1JNLL 1XGUB 4F57L 4EBQH 3PJSA 2VOTA 3P9LA 3FZUC 3SDDB 3Q2CA 3UTZA 2MKLC 5BJTA 2BNUB 5CJXA 1Q94B 3IETB 1ROWA 1MCEA 1T2QL 3BHBB 4PYHA 1EEUA 2W0LA 3DX6A 4PRPD 1XIWB 1CFVL 1UA6H 4NPYB 3MZGB 4JY5L 2FL5A 3V6ZA 1BQHB 5D7LE 1KFAL 3G6JA 5DUBB 3UTSD 3NPSB 4JDZB 2UWEB 3RIAK 1HHGB 2HFGL 2Q7YA 4MGXA 4P0DA 2RCSL 4RMWA 1T5XB 2VDML 3T4YA 2I26N 2ATKA 3O0RH 1AH1A 2KL6A 4AMKL 3ZKMC 5EUOF 3QFJA 3MV8A 1PJ9A 4QTIH 5CSZB 5HYSA 1HHJA 4X9GA 1YEKL 3S96A 5KS9E 15C8L 4OD3L 1TJHH 4C4KO 1ETZA 3O6LL 4I18C 2NYYC 4M62L 3GSNA 4HV8B 1SQ2N 2A73A 4D3CL 4BQBA 3HE7D 2A77H 4X5WB 5IVXB 2VL5B 3UJJH 1A7OL 3V6BR 3VXTB 3EYFB 2EH7H 1KACB 3MLWH 3EYSH 3U82B 2P5WD 2FEEI 2KUTA 4NZUL 1ACYL 1FNEA 1MVUA 2J8UF 4JKPH 5KVMC 3B9KC 4Z76A 3MXVH 4RNRB 3G04B 3QG6B 4B7IA 4GUPB 2GYSA 5D2NB 3B5GA 3LKSB 4DVRL 4RX4A 4MA3A 5D7LD 3QA3B 3PV6A 5GRVK 4QHKI 1F8TH 1LP9F 5DD1H 4JFEA 4G6MH 5C08A 5HHOA 1X5HA 4UQ3A 2P24A 1WGOA 3C09C 2MSPA 4HW6A 4OZGE 5EDXA 2M26A 2GSGB 1AI1L 1NFIA 3D9AL 5C0JA 2MQ0A 3RWIA 3IFPA 3LOWA 4WW1B 1FLTX 4YGVB 2CKNA 4MD5A 4YNYB 1NC2D 5FHAH 3R8QA 2CDEB 3DGCR 3TO4B 5JW3L 4LHQB 1AGEB 3KR3H 3UJTL 4GBXC 4X99B 1ES0A 5C0BB 3UO1L 2ICWI 1HCVA 5I1EH 1NL0L 5FUOL 5I71C 2P5EA 4APQD 3OWEA 1H3UA 1LEKB 1G0XA 3JWNC 4GMSH 1KTDA 1G6RH 4S11A 4Y4HA 1KGCD 3RI5F 5FM4A 4X7TB 2NXYD 3OB8A 4P2RD 3TM6A 1JYWA 4ZUSB 1MF2H 2NXZB 6FABH 3VWJB 1NGZA 4P46A 4ZAKD 3VFNB 2DB8A 2B0SL 2NY0B 4G9DB 1SY6A 2J4WL 1OTUD 4OD1L 4GRLB 4QHLA 4POUB 4X80H 1S78D 1OAUL 5I9QB 1KN4H 4Z0BH 2YD8A 3OR7B 4X6CE 1P2CA 3FQRB 4LLVB 1AQDA 4H8WC 3SDAC 1OT2A 2X4SB 2XKNA 1G7IB 1JNNH 4D9LL 2X4NA 5ID0B 2A1WL 3EZJB 5D70H 3O8XD 1X5IA 4ENEC 4OM0H 1OAKH 2BNRE 3CVHL 2I9TB 2P8PA 3QNYB 4AQ1B 3F7PC 3MA9H 1S8DA 3NIFE 1PY4A 5MENB 4UV4H 4Q6IC 5JUEL 4OZHF 1QFPA 4LSQH 2KKQA 4OLUH 4P2OC 3C2AH 3QDGE 4PJXB 3RWFB 1BIHA 1YDPA 1M7IB 2VXQH 2FB4H 5C0DB 1I1AC 3JV0A 1FFOA 4X5XA 3DV6A 4PTTA 1DQQA 1QSFE 4GAJL 4ODVL 5E2WH 4S10A 3X3FH 1A4KA 2BMKB 3V8CA 4LKXB 4N0CD 3WFDH 2Y25A 3K74B 4K7PY 5J0BA 1NEZG 4NQXB 2NMSA 4RGNB 4FXLA 2D4FA 1EVTC 2AVGA 3SGDH 4PFEA 2CLZA 4O2FA 1BWMA 3RI5K 4Y4KD 2YD3A 35C8H 4JGUA 4RWHA 5AWNH 2ENSA 4NO0B 5DMIH 4HWEL 3SDXF 1VERA 1LO5B 2H6PB 4X6FA 4GH7B 2C3XA 4FFZL 3RPIA 4M4PA 3VFPA 3GFUA 4R7NB 1WAAF 1NANI 4P2QE 1U8HB 3PQYB 1LO4H 5GJTH 4F9PA 4Z5RB 3W9EB 4PJ8D 3KJ6H 5BMFL 5T3XL 1GGBL 3JTTB 4X8JB 2BNRD 3CX5K 4XP6H 2VC2H 1W0VB 3DETD 3IKCA 3QUMH 1RVFH 4OLZL 2HAZA 3T09A 1HYRC 3F7QA 5HI5D 4GJTB 3T77B 3WS6C 5JQ6L 1U3HB 4UAOC 3QDGD 4KJYB 5A2IH 4HG4K 4PJ9C 1Z3GH 4Z0XB 5C0EA 1A6AA 4PGBB 3QCUL 3GGWA 4OI8A 1G1CA 1QSFD 5B3JE 1T89C 2NY6C 3GO1L 4LNVA 4K2UL 5BQ7A 1FRGH 1G9ML 3PP4L 5DZLA 3VA2C 1WBZA 2NZIA 2ZOLB 3V6OC 2QQQA 3U4EA 1N26A 2VWEE 1IGJB 3TF7C 2B4CH 1DBKH 2BXZA 2VR9A 3BO8B 4Z18A 3ULUE 4PRNA 3QI9D 1IAIL 1UM4H 4X6DB 4NO5A 4HGWB 4GLRI 2FHFA 4NBZB 3QEGL 5HHMB 2GY7B 4OGYH 4PJAA 1HNGA 2EDTA 5DS8A 2BDNH 2JB5H 4R4BB 5E1AA 4OFDA 4NRXA 1SEBA 1PKQA 2LAGB 4Y1AE 4DEPB 3BN9C 4O2CA 4OZFH 4XPTL 5DJYB 1U8PA 3BPNC 1EAPA 3V7AE 4Y19A 1RZIA 5D72L 5JPNB 3WIHH 4I2XA 1GYAA 3ARQA 3QISA 3EYUH 1FYTA 3G5VB 2ZP0T 5CHNA 4JKLA 2BSRB 1F6FB 1URLA 2I60L 2OP4H 4GG6B 4P4KA 4HX1A 2IALA 5KSUA 3UMTA 3VI3F 4UU9A 4Y8DC 1HYSD 5T1KB 2AK4D 2MFNA 4A6YB 4FQ2H 4EDWH 3T04D 4MA7L 2APBA 4P57B 3QPXL 4RMVA 1LK2B 3CX5J 4XPBH 4AIZA 3LDBB 4ODTH 2A6JB 3PIQA 4WGVB 3ZE1F 4LFHG 2XA3A 2M2DA 1I8LA 3ULUD 4ZOAA 5IBLD 3QRGH 3MZTA 3G5ZB 4M93C 3BVNB 1OHQA 2EO9A 5SWQA 1ZVSA 3WXWH 2H2PD 1G7JA 4MJ5A 4XGZB 2EECA 5DHYA 2XWJA 3MGOA 4NOBA 5C0AD 1K4DB 3CMGA 3GSXB 5DRWA 1J1XL 3ZMRA 1KLFA 1U93A 5D2LE 1AKJB 3EYQC 3RTQA 2PETA 1I1CA 4Y1AD 2VZTA 3PE9A 5D9SB 2WNGA 3IT8D 1LO3L 4MX7B 4ZFGH 4HF5H 1E6OL 3KPNB 1RUKL 4IMKA 4G8GE 1DBJH 1UM5H 3LQMA 4GRWE 2VDNH 5EIQA 3N1GC 2FJGA 2XZAL 4OCXL 4MAYA 4WRLA 4LF3A 1ZWIA 2CDGB 1MHCA 5E7FA 2DQFA 3KPSA 3MRGB 3FQXB 3GBMH 1AR1D 3HE7C 1IAII 1QKZL 3ULSB 1SYSA 1OTTD 3VG0H 4QRPE 3ARFA 5I74B 4NO3A 3QG7H 5DK0A 2Z0BA 1CE1L 1ZLWK 2VTFA 4I3RL 1BM3L 4IS6B 4HIEA 5KBNC 3UTTE 1NCBL 3GKZA 3U2SB 1WICA 3T0EA 3U46A 1JWSB 2KH2B 4PJ7B 4XP9H 3TBSB 4KK6D 3W0WD 2AV7A 1A6WH 2X70B 1QFHA 5KSAD 3FOLB 1KB5A 2FX8L 4F7EB 2C4FT 4AL8H 5F3BA 5HI4C 1U8OA 5EUOA 5KVDL 1R6VA 1N59A 1NSNL 5GS1C 3RAJL 1Z9SA 2FX7L 2YD2A 1P7HL 1RURL 3UPAA 3FO2A 3ULUH 1A9EB 2VAJA 3FT3B 3O9WA 4KKBD 2DYPA 4QRRE 2OL3B 4HHAB 5TE7H 3FAXA 2EDEA 4G8GD 1H3VA 5DJAB 4PGJA 3G6DL 1BD2A 4ZTOL 2XQYG 3QIUB 1PFCA 3DVGA 4Z9KB 5ICYA 5EOTB 3TO2B 4XH2A 3MBXL 3TVMC 1KBGH 4X6BB 3HNVH 5DYOA 3E3QC 1M7DB 2Z92A 4UI2A 1NLBH 2J8UA 1W72B 4M8VA 4HC1L 1CU4H 5DI8B 3UTTD 2ARWA 4YHPA 1AHWB 2FBJL 4U1SB 5TDPA 3OXSA 1LP9A 2NXYC 3IJYB 4F2MB 4EN3D 4QO1A 4I0PA 4YGAB 5HYEA 3MC0A 4ZAKC 4FQIH 5T5FH 5L8KB 5DWUL 1H9VA 2BNQA 2C3VA 1TVBA 3DMMB 4Q9BA 3L9RA 2BFVH 1MHPL 1OTUC 2X4PA 5D7IF 5J4MA 4TSBL 4TUJB 1S78C 2F19L 3UJIH 1YNTB 1U58A 4KPHH 4O02L 2M8XA 1T20B 2FATH 3DBXA 5EH1A 4DGYL 4QRUA 1IQDA 4CGTA 2Q86A 4R3SA 1ZA3A 4P9HL 2VLKB 4ETQB 1NCDL 3FB6A 4HULB 3U0TB 3O8XC 4U1MA 4FFVD 1UXSB 4TOYL 4X6EA 3BT2H 3BXNA 1QBAA 1SBBA 4C56A 5GXBB 4XPFL 4WUKL 1EHXA 4YBLC 4NP4L 4WWKD 1IEBB 3STZB 5B8CC 1IZKA 1HH9A 3HC4L 1OTSD 4GRWH 1D9KD 1G6VK 3UTPD 2B4CC 1V3KA 2ITDB 5H2BB 5CIPA 5T1MB 2C1OA 3MV7A 1KC5H 3EYVB 5BRZB 1R3HA 2Y6SD 1JPTH 1A9BA 4NFDA 3EHBD 4OUUA 4N0CC 3KPTA 5LCVH 5IFHH 2QQKL 3B8SA 3MOQA 2Q76A 3RDTD 3GMOB 4YHIB 4MJIB 1HZHH 3O6FA 4Z95L 1OW0C 4QKXB 2H32A 2X44D 3FQNA 3LHPH 4Y4KC 3C08H 4NSKB 2HLAA 3VXPA 4PJHF 3WN5C 4DOHE 3CH1A 4Y2DA 4ELMF 3LKQA 4DWHA 3HUJB 2BY0A 1LDPL 2HKHH 3DRTB 3QNXA 4F7TA 4OQTH 2VZSA 5FA3A 4MB5A 4OBSA 4G43A 1AO7B 3FB7A 4NCC2 1EHLL 2L0DA 3NCYS 1EGJA 3LY6A 4NUGL 4PJ8C 4AEEA 1L0QA 5KSBE 1FFRA 4X0KA 5CD3B 4OZHA 3DETC 5ICZB 4HUWA 5DTFB 1GGCH 1Q0XH 2G60L 3MLSL 2R0ZH 5HI5C 1FORH 1GOHA 2A6DB 2GK0A 4FXKB 4IHOA 2GK2A 2E9IA 2E6PA 3RNKA 2R0LH 4OJFL 5IROC 4PJBE 4WU5B 1J0JA 3MLUL 5L7XL 3TYFA 1NAKH 3DURB 5GS3A 1J11A 2KPNA 5EOQL 3BKCH 5J12B 1YEGL 3FJTA 1X5YA 1BBJB 4YC2B 2YHGA 3VRLE 2BHUA 3P0GB 1D5ZB 5F7UA 3SDXA 3DI2B 3SBWA 1FZKA 2NW3A 2WIIA 3QI9C 4U1JA 5SWSD 1WAAA 1RIVH 5E94A 4BA8A 3MUJA 5ESAB 5IB2A 4IOIB 4GAYB 4DGVL 4LGSB 4ZUUB 3EDJA 3U9UB 3QIBA 2AJSL 4NFCA 2EH8H 4K23L 4NT6B 1DN0B 3BP5A 3VW3L 4NM4L 3F7RA 3AY4A 2YC1B 4Z8FL 2NX5B 4NQEB 1CE6B 2ADGA 4JKMA 2FSEB 4GXUN 1KTLB 5MI0B 2WW8A 4N90E 1OWWA 5JHDE 3G9AB 3F7YA 5DK2B 2R0KL 4L3CA 4CDGC 1G7PB 4Z7VF 4EUPA 1H5BB 1F90H 4GW5A 4I1NB 4K3HA 1UCBL 3MV8D 1HYSC 4RQQB 1KEGL 4LL9A 1NCUA 3T4AA 1DQJB 3RWGA 4M9PA 4WY7H 3RWCA 3LVEA 1HHKA 1KJ3L 5IQ7L 4HUXA 5I8EB 1OM3L 5JHLL 4XXCC 4PBVC 4X7DC 3JV5A 2R0WH 4JFYB 1DUYB 3TT1L 3ULUC 1FZMA 5IBLC 1CN4A 4MWFA 3TP4A 3AFLA 5C0FB 5GZOD 2H2PC 1IQWL 4RFEA 2I5YL 3ZE0E 4PV9B 4OM1L 3BP4B 3BSZH 4YFDB 3WXVH 5DURD 5BV7H 4LPVA 4GAGL 4Z78A 1BIIA 3IDMA 4I5BA 1A1NA 4XPHL 5F7LB 1CZ8H 4Z7QF 4ONHB 4Y5XC 2YMXL 1CK0H 3KG5A 3BGFB 3P4MA 2W07A 4HIIA 4OZ4B 2CO7B 3MOBL 3WNMA 5J1SC 1IE5A 3QO0B 3WUWG 1HOCB 4OGXL 3WEXB 5C86A 4WUUE 3D69B 1EERB 1JIBA 5JHDD 1QRKA 2VISA 4JG1H 5HHOD 1OAQL 1JHKH 1YQVH 1JTTA 3TBWA 1AR1C 4NQDA 3TPKA 4YHML 1BJ1J 4LARL 3ZT7A 3VD9A 3O81A 5DF0A 3LD8B 1BAFH 2CLRA 4D8PA 3B9VA 2NY7H 4AEIH 5B39A 2VZ1A 2Y9RT 1X5LA 2F54E 2EIZB 3MRMB 5ILTH 3RP1A 4KK6C 5IMLA 4PJFB 5GGUB 5FDWA 5JQ6H 3PJSB 5E1HB 3W11D 2WBJB 4PRHB 1LILA 5KSAC 4O4YL 1JNJA 2LAAA 5I75B 1TNNA 1S9WA 3VFRB 4PP2B 3PDDA 4NYLB 1Z9MA 5T1LB 2VL4A 2P5ED 3MCLH 4ZUTB 3WJLA 4LEXH 3L7FB 5IW6A 3M8OL 2QKIA 3LKRA 4KZEL 3HMXA 3O3EB 3MUHL 1U36A 1E6JH 2Y06L 2D31A 2NY4D 3O0RL 4W4NA 1FL3A 2FL5B 4M1GL 3V6ZB 4BSVA 4TTDD 3NFSH 2HH0H 3G6JB 1T1XA 4WW2C 3F65A 4P46D 3FMGL 1F4WH 4XBGA 3CLFH 5JLZA 1TJHL 4WUUD 5D1ZD 3T4YB 1H8SA 2BOCA 2K9UA 1F6LL 3IFNH 5J13C 2X41A 3QFJB 3F62A 1S7QA 5HYSB 2GAZA 5D6CB 1S7TA 3WYRA 4L4TE 3I75A 3B6SA 5SWZA 2VDRH 1JF5A 1X5XA 5C2UB 3UJJL 1UT9A 2CPCA 1IM3B 3MLWL 4URTB 4TULL 1FBIH 5LJYH 1ZLVH 4DN3L 5CCKH 1NDMA 2GT9A 3GK8L 3GSNB 4DVBA 4EN3C 4FS0A 4TUOA 3OGCA 5F7EH 2YBRA 2KQNA 4LHUD 3NPZB 4Y88A 4YEFA 2HJLA 5DRNB 3CVIH 1UWXH 1RFDH 2BOBA 4PJIE 3HA0A 1MVUB 4L8CB 1C08B 1NGXB 4Z77A 1NCAL 5ALCL 2VDOL 5DJDA 4EVNA 4WFHE 3CDGA 3V7MA 4MA3B 3LN5A 3MLVH 4XAWH 3PABA 3PV6B 4QT5A 1NBYB 1NGYA 4GKNA 4U1IA 2VH5H 4ZNEA 3T8XA 2VLJD 4XNZB 1BGXL 2XQYK 3LPGA 5C08B 3MCKB 3KS0H 4KKNA 2OR9L 4FFVC 5EORH 3HFMH 4RMUA 5LBSL 1QRNA 1HK6A 4HWBL 3BH8B 3D2UD 2EKSA 3KR3L 3QEQE 3O45B 5IHUL 4P23A 3D0VA 4S2SB 2GJ6A 3TZVA 2EC9U 4WWKC 1IKNC 1FL6B 3GMNA 2ERJB 5I1EL 2WQ8A 1OTSC 1JL8A 4HK0B 1D9KC 4YEEA 2GSIB 3LEVH 5L2KE 3VXSB 1DANT 3VG9C 2ED9A 3QT2A 1N6UA 2Y5TA 1HQ4B 1LO0H 1RZ8A 2JCCB 2ADFH 2VKWA 4XMPH 4NDMA 5D7IA 1YC7A 3EHBC 3O6MH 4AQOA 3KXFD 3NTCH 5E24E 3RDTC 4Z7UF 5DZNA 1KTDB 3FT2B 5IESH 1WFUA 3QIWA 2NPLX 4U6HB 5HHXH 3O2DA 1MWAA 4Y4HB 1UWEH 4YR6B 3FN3A 4JLRA 4IRSD 2CMRL 1A6TA 5I1AA 3X12B 4X5LA 3BMVA 4WFHD 1HHIB 4JZJA 4POZD 3WD5L 4YDKH 3PHSA 2Q20A 1LMKA 4Z0BL 3M17B 4M5YH 3TYGL 1EX0A 1F58H 1ZT1B 5CKGA 2VB5A 3A6CL 2YUVA 4YXHH 2NNAA 1I1YA 2UWEE 5KN5A 1TFHA 4YXKH 5F7MC 1FG9C 3BPLB 2E7LC 2G5BB 1N7ML 3QEQD 3JUYA 4OM0L 2CKBH 4F7CA 5C3TA 1P2CB 2K7QA 4CN6A 1JZ3A 3B3IA 4OAWB 5BZWB 1U8KB 4P5TD 4IDJH 5HGAB 3QCVH 4PJCB 4J3VA 4UV4L 5ACZA 5HYJA 1RUPL 2ZZUT 3DRQA 4OTXL 1TLKA 4G6KL 4BZYA 3AVEA 3BZEA 4CVWA 1LD9A 3ROLB 2AEQH 2P8PB 4PY7B 5JR1H 4UUJA 5E2TH 5KOMC 4E5XA 2FB4L 4Q9CA 1EZVY 1MLCA 4YE4L 5BV7C 2R23A 3MRPA 1UKTA 1WIPA 2J88L 4PJHA 1FZJA 5IVXE 3MBED 4ELMA 4WJ5B 1A6UL 5KVEH 1VGKB 5E6ZA 3V4VL 3P0YL 3L95A 1Q0YL 1YDPB 1RZJL 4BSWB 1GIGH 5D96B 1FYTD 4TQEL 1CD8A 3D25B 4JFHD 3PXHA 4LLYB 1JPFB 4PTTB 4P4KD 2YRLA 4CVUA 5LAXB 35C8L 5F1SA 5IMKB 3HPJA 2ZPKH 1XIWD 4ZOCA 1EV2E 1CLOH 4HFWB 4JDVA 1A1OA 3NCEB 1W2KT 2ICWB 2Y7QA 2VXVH 1EMTH 4L1DA 2VIRA 3SE4C 5IG7A 2IH1A 1RULH 2IPUG 2R4SL 3KJ6L 4X6FB 1NJ9B 4U1LA 1OGAA 4XP6L 5TF1L 3RPIB 3VFPB 1T83C 1AGCA 1RVFL 4BFEA 4FZ8H 3HNSH 3AXLB 2YWYA 2BCKA 3U0PB 4XCCH 5BOPA 4Y89A 4NNYB 3MLZH 2R2CA 3L3HA 1MHHA 4XZUB 4YZFF 3BEVB 3RTQD 3IKCB 4LLAA 5C0BE 1MNUL 1QO3A 1FGNH 1WVZA 2HMID 3RWHB 5K9OA 5LWYH 5FKAA 1A6AB 3KPSD 1H3WM 5IEHA 3ZT5A 4I3SH 5GZOC 5M94B 1XGPB 1D3CA 1TCRB 3P3YA 5FO9A 2F5AL 5F96H 3PHOA 4PJGB 1WBZB 3U4EB 3D3VD 4KAQH 1XGYL 1T2XA 5GHWH 2Y07L 3OAZK 1G7MA 1CICA 4LOUD 3T0ED 2X40A 3EDDA 4KROB 4QHKJ 4R96B 4TNVF 4ODWB 4Z7VA 1BVLA 4YDIH 5TH2B 4PJAB 5DS8B 4F33A 3QQ9D 4FNLH 5E1AB 1WWAX 4HCRL 2XZCL 3S6CA 3SGDI 3WIHL 1QACA 3KLHD 3RWJB 1YJDL 4DGIL 3ESVF 1OAZL 3AM8C 1J8HA 1HXYA 4HEPG 4OV5A 4RZCA 1EAPB 2E7HA 3GJFH 2ZUQB 3FN9A 3M07A 1I4FA 4Y19B 2DYPD 5F88A 3VI4F 5I1HH 4XVJL 4LLUA 4I2XB 5T3ZL 2P45B 4FQ2L 4PGDA 2O26U 1C7TA 4HT1L 2ZSVA 1BD2D 4YUEL 5FGSA 2ICWJ 3W11C 4HX1B 2ED7A 5IJVB 5KSUB 1JMZA 4X98B 1OAYH 4TSCL 4PJXE 3WNOA 2A9MH 2AXFA 3K80A 2BVOA 5FO8B 4YHOH 2E3VA 2NXZD 5DJCA 2JK5A 4JCMA 4MQTB 4FQJH 1TZHA 3PIQB 4ZS6D 5E2UH 4U1HB 2JELL 2NY4C 3F12A 4TTDC 4CMHC 4RGNE 1ZVSB 1ZHKB 2HRPH 2Z31A 4I0PD 2YXFA 4P46C 2XZQL 4DAGH 4HK3J 4J4PD 4MJ5B 5DHYB 4JPIA 4ZFGL 4HF5L 5DZOA 5D1ZC 5E5UB 4F7MA 3P11H 1U93B 2AXGA 3DI3B 1UM5L 1JZ7A 1UEMA 4BJLA 3P30H 4ZO6A 3U7AA 4OLVL 3PQYE 43C9A 2AABL 3U7YL 1JYXA 1T0NA 1ZXQA 3O3DA 5D7SH 4F7PA 3G6AB 4TNVK 4DKDC 1KJ2L 2DQHL 2R1XB 3GM8A 4F80A 3BD4A 5GIRB 2Z4QA 3RA7L 5BO1L 3A6BH 1ZWIB 3O3BA 4U05A 1K2DA 1MHCB 2RFXA 2DQFB 4L9LA 2VSCA 1YMHA 3GHBL 1IGCH 4HGKC 2EYTB 3MPCA 1ZS8B 4C56D 4QRQA 5H37H 1BQUA 2F9BT 4FG6D 5DD6B 3ARFB 3QJFA 2ID5A 5IMOA 1A6WL 3VXOA 2PXYC 3BKJH 1IGFH 3LEXA 4GW1B 4MZ2A 3KJ4B 4AL8L 3MNVA 2JE8A 4MXWH 4ZYKB 2H8PA 2O93L 3NIDE 3QUYB 1XGRB 3Q6FB 1EHNA 3MOAL 4UIKH 3IDGA 1NUGA 2ZCHH 4RGND 1MCQA 1A5FH 2AQ1A 3ES6A 1LO2H 2X4TA 4AH2A 4NQVA 3LN4A 1LEGA 3IF1A 3BPOB 1N59B 5TE7L 1SYVA 5F1NB 4X6DE 25C8L 4XVUD 3EFFA 3WLBB 3WFHB 4XNQA 1UGNA 5HHME 4FQLL 5IK3A 3PQYD 2UV3A 3L3JA 3ARTA 2QQLH 2VDPH 1MJJB 2P44B 2HYMA 1A6VL 3Q1SH 4B5EA 1TITA 5CJ8A 1ZK9A 2VJXA 3K81A 3OKKB 5JPMB 1YECH 5ICYB 4W4OA 4HKXA 1FVEA 4RFNB 4WI2A 5DYOB 2Z92B 1Y0LA 1BZ7A 4GG6E 5EPMA 3WIFB 5IR1A 3LAFA 1IAKA 3GIZH 3MRLA 1HKFA 3CDCA 2FJHA 4YHPB 2FBOJ 5J1TC 4C83B 2FHBA 3OXSB 2IGFL 3I3EA 1LP9B 4IRSC 1RU9H 2WLYA 3T65A 4POZC 3VRIB 4CL7A 1QP1A 1YMMA 1RZKL 1FNHA 4KPHL 1ZHNB 4Z6AT 2Z35A 4JRXB 1G7QB 3STBA 2ZNWA 1K6QL 1ONQB 2Z93A 4HS8H 3OKOB 5BVJA 3QO1B 2A83B 2ADIB 5ELIA 4R0LA 1TENA 1R3JA 4D94A 3F58L 4S0SD 5GS2D 3QH3A 4QRUB 2YN3A 1ZA3B 3ZHKA 5EZLA 2V9TA 3RBSA 4D9QE 1F42A 1OWRM 4P5TC 4G6JL 3FB6B 5ADPL 2P4AB 4JPVH 3J7HA 4X6EB 3BXNB 1J0KA 1WK0A 4JKWA 1J0ZA 1V7NH 2H32H 4QXGH 3BZFB 2HT4D 4Z7UA 5IB4A 43CAB 3RNQA 1MJ8L 4BUHA 2RJMA 4UTBL 4H0HB 3ZLQC 1KC5L 3VE0A 2B8OT 5A2KH 3FL7A 1HH9B 5F7WC 3QDMA 3FQUA 3MBEC 4WTWA 3JTSA 5MP6L 1KXTB 3Q5OA 4KRPB 2IC2A 5EUKA 2DOCA 4ODSH 5CIPB 1YYMH 3MV7B 3LHPL 1R3HB 4JANA 3C08L 3BDYH 1PLGH 1DUZA 2MOVA 1GPOL 4PJ7E 4U7KA 4OUUB 2R8SH 1XIWC 3ZYOA 1F00I 2GUOA 2Q76B 4QF1A 3BRDA 3O6FB 3NPSC 3CFCH 4NRYA 4QHMB 3VFTB 2HLAB 3VXPB 3TA3A 3FB8A 3RZCB 4XCFL 2G75A 4HZLA 2Q6WA 4Y2DB 2Z91A 3J8F7 2VDLH 1A0QL 4K7FA 1A3LH 4XBPA 5FA3B 4MD0A 1KF9B 1Q0XL 2EE2A 4D9QD 3FB7B 4HKZA 1C5DB 1D5IH 2HWZH 4LSPH 1MCOL 1FORL 5CUSL 5I1JL 1L6ZA 1QFUH 1Q38A 2PYED 1Q9KB 5D8JH 4X0KB 4M48H 3AAZB 4OZHB 3RTQC 1IM9A 3OXRB 4HUWB 3VH8B 5GS2H 1F4XH 3DIFA 4HWZA 3HE6A 1WEJH 3TWCH 2HMIC 3RNKB 3CFJB 2NW2B 4M61A 2YD9A 2WWKT 3TYFB 5D1QA 1P9MA 4CVXA 1EEYB 2IG2L 4R2GB 3MRIA 4NM8L 1QEWA 2D3VA 2HG5A 4UILH 3MGAA 5DQDL 5F9AC 5CEZD 5K9JH 1U3YA 5C09D 4JFDD 4ISVA 4A6YH 1BLNB 3RGVA 2IANB 3QWOB 5IB2B 3RY4A 1CCZA 3P77A 3HC0B 4YDLB 2JKXA 5CLWA 3QQ9C 4M00A 5EOCL 1IFHL 1U2CA 2VLKE 3EJJX 3KLHC 5E5MA 3TO4C 4EI5A 1IZJA 1QA9A 1ZEAL 4UNUA 1KCUH 3QIUD 3KLAA 3WNNA 4HXAH 4BQCA 1XF5A 3BH9B 1YN7B 5TDNB 5IKCB 4M7LT 4WY7L 4IJ3B 4FQHA 2ZCLH 2AV1B 3R1GL 1H15B 1KIQA 4GW5B 5AZEL 5FXCH 1MJ7H 4QY8A 4ZXBA 1RHHB 4ZOEA 5GISL 1VKXB 3QUKA 4YHLL 2GTZA 3RWCB 1KOAA 1JWUB 2NXZC 5ANMA 4LIQH 3UBXG 1WUNT 1KPUA 5BRZE 3ALPA 3QJHA 2R2EA 5SWZD 4L3EA 3WXVL 5F8RC 4ZS6C 2J6EL 4KDWA 1O5DT 3MV9B 4MJIE 2VERN 4I0PC 3U9PH 3KHOA 1JPGA 3FO1B 1C5BH 3NABL 4J4PC 5MEQA 3BYTA 3FN0H 4NKMA 1R5IB 3HUJE 5CEZH 1BIIB 1GGUA 4I5BB 4OT1H 1A1NB 3UDWC 4NKIH 2VLKD 4KQ3H 4Q58C 1AO7E 4JG1L 4W6YB 4O51A 1ZV5A 1GCFA 1YQVL 3P4MB 3V0AC 4YH6A 2NY1B 4RIRA 3REVB 3X3GL 5MHSE 5DT1L 4R97B 4QNPF 5IB5B 5HXMA 1IGYB 5E00A 2H26A 1IC7H 2VISB 3K1DA 1J0IA 2D0GA 4NQDB 2VLLB 5ILTL 3JWOL 1QTYT 5HD8C 1LEIB 4FG6C 4XNYH 3O4OB 5ENWB 4YX2H 1T7WA 5I66A 3DGGA 4NCC1 4G8IA 4JHAL 5BRZD 1B4JH 3W2DH 5F1IA 4PGZA 1ZTXL 4GMTL 3MCLL 1T3FA 1IL1A 4L4VA 2F53B 1W72H 5IMLB 1ADQA 1PQZA 1DQTA 4NHUA 4L9DA 4RGNC 4MJID 1ZGLB 1DQMH 3ULVL 3R8BB 3I02A 4I0CC 4R9HA 3P4NA 3TT3H 1AXTL 3MUZ1 4KGJA 2IQAA 3NFSL 4ERSH 5EIIB 4HKJA 5GGRY 5DJZA 3LKRB 1NCNA 4XVUC 5GRXG 3CLFL 2WP3O 1TQCB 4HUMB 2D31B 1HQRA 4BSVB 4Y4FA 1PVHA 2FWOA 4WHYG 5I30H 4LLMB 5FCSH 2FO4B 4Y5YC 5MHSD 2BVEA 5DO2D 1DP0A 4JM2B 4LLQA 2DQCH 4CVZA 2NX5E 4NQEE 1C5CL 3MRBA 3RPKA 3P2TA 3KPRB 3SCMB 3PWVA 2AEIT 4RGOH 1GAFL 1S7QB 2R69H 2GAZB 1K8IA 3F8UB 1PEWA 1NPUA 4N1HB 5F7EL 2J3SA 3I75B 4D9RE 2XKUA 3B6SB 4N0YH 3KLDA 2Y23A 5FYJU 1VEOA 3SDYH 3K8LA 3CVIL 5E6IB 2GT9B 5J57B 3HR6A 4DVBB 2YPLD 3A0OA 1BQLL 2DQDL 5BXFB 5DVNA 1CQYA 4I3GA 2MCPH 4MVBD 2DTSA 3MLVL 2BOBB 3I50L 1B3JA 4JO3H 4XAWL 3GSOB 1H3GA 3OKDA 4YFLI 3D39A 5J1AA 3OZ9H 5HGBB 5FF6A 2NY2B 2ITCB 1P7KA 4N5ED 4EVNB 5LGJA 5I1LB 2X4QB 5CLTA 5CBAA 3CDGB 4U7SA 1A2YB 2W0PA 1NGYB 2DI7A 3MROB 4GKNB 4K9EL 3NCMA 3LSOA 5DD0L 1OPGL 1W8NA 3X11A 5EU7E 3BRGC 5TPWL 4DEPC 5A3ID 1T21A 2JJTA 3DX7B 5HGDB 3TNMB 1CG9A 3VGHA 2WZPD 1VFMA 2XPGB 3AMKA 4CADA 4U6VH 1I9RH 1XZ0B 4IIQA 3LEVL 3O2DH 4KQ4H 5FIEA 2HT4C 1N2RB 2GKIA 2B1HL 3I6LD 3D0VB 4P23B 3V8OA 2GJ6B 3TZVB 1EVUA 4H25A 3DSFL 1LO0L 3BYYA 1MCNA 4UDUB 2W91A 4D9RD 1MJUL 3ZTJH 2SEBB 3NTCL 4WI4A 3ARWA 1MCSA 2Y5TB 1RZ8B 1IGMH 5FUCC 1FV1A 4WEMB 5D7IB 3K0WA 3IDXL 4U6XA 4MHHG 4PJFE 5EZIL 3AREB 1SVZA 2GJZA 4PRHE 5IB3A 1FZOA 1TPXC 3HLAA 1I7UA 2DLFH 3IXTA 3KPQA 1AXSA 3G9VA 5B38G 5HYFA 5LKNA 4KVNL 4JLRB 1KEML 1RJYB 3SQOL 3AROA 1A7PL 4JZJB 4MXVE 1YY9D 1BJ1H 4KHTH 4PG2C 1P4IL 3L5XL 3H0TB 2LTQB 2VN4A 4H1LA 4JFFD 4WNQB 2R2BB 3BQUB 5BS0B 3PL6D 1JGVH 1NEZB 2WV3A 3DXAA 4C54A 1NGWA 4IDJL 4NO2B 4LEOA 2AJYH 3GMRA 3QCVL 1XF4A 2LU7A 1ZKAA 2ESVA 2Z9TA 1TTUA 3S7GA 3VMPA 1UKQA 4BQ9A 3B3IB 3QFJE 3GDBA 2AEQL 5E2TL 1IC4H 5TE4H 1UH4A 3FRUA 3MNZA 3RUGB 3UAJD 2AEPL 3MQIA 3BZEB 4H20H 2VAAB 3HZMB 3UP1A 1LD9B 5KVEL 2HJKA 4XX1E 3LKPA 3D87B 5DJ6A 1GIGL 3WHXA 3MRPB 3TN0A 1AGDA 2I07B 2WBJD 4PRHD 2Q8BH 2OTUB 4AM0A 1FZJB 4FQCH 5GGRA 2OJZL 1YUHB 2ZPKL 3HB3D 3TBTB 3TBYA 1MHEB 1EFQA 3L95B 2MWCA 4Q7DA 5IIEB 2VXVL 1E4KC 1OLZA 5HYQB 4PRAB 1RULL 1BEYH 2VLRA 4JEGB 1DLHA 3WKMH 3WFCH 2Q3ZA 4LRNL 5I1CH 3U0WL 5CP7A 4JDVB 4F9LA 3W5NA 1ZVHA 1L7IH 2VXSL 1I9JH 3OB0H 4FABH 2Y7QB 3C5ZA 3DV4B 3D0LA 5IG7B 2IH1B 5MEPA 3V0VB 2MPAH 5C08E 4FZ8L 3HNSL 3QUZA 2F74B 4TUKH 3F5WA 5F9JB 2H9GA 3VFOA 4PJDB 4XCCL 1NGQH 4HC1A 3QIUC 3PWJB 3GKWH 4U1LB 3ARGA 3GMLA 3L6FA 4AK1A 4TNWF 1VA9A 4OKVA 5FK9B 3WNLA 1QFWH 3KVQA 3EO9H 1I85C 5JNYB 3SGJA 1PG7H 1ZLSL 3L3HB 4RMSA 3FB5B 3QZWA 3I2CL 3VXSE 1AHWC 4QYOB 2A2QT 2EC9T 2X1OA 2JCCE 1GZPA 5AZ2L 1XCTB 2NTSP 5GRJL 3HPLA 5CZVL 2Q1EA 2QADD 2IH3A 3DVNA 4JE4B 4OCWL 1J1PL 1DDHA 4XTRC 4QCIA 1M6OA 5IEHB 1X5AA 5CSBA 1J7VR 3V7AG 5EU4A 5EFIA 1BVKB 3NOIA 5JIPA 3QP3A 3PHOB 4HUVA 1Q1JL 1UACH 1BHGA 3BJLA 4YDIL 5DXWA 5F9OH 5IB1A 3HI1A 4HXBL 4NFBA 5D1XD 5L2JA 4LSSL 4AENA 2W59A 4HBQA 4J3UA 1DEEA 1BVLB 4J3WA 5SX4H 5GGVL 4UQ2B 2OQJB 3LS5H 4NRZB 4I18A 1OARL 3M45A 5L88L 3GI8L 3OR6B 2OXGA 1KPVB 2EC8A 4JVUA 2IFGA 3MJ7A 4BKLA 3JWDL 1BZ9B 1CBVH 3LZFL 4PJCE 5B21A 4O5LH 4S1QH 3ARDB 3VXSD 5JMOC 1HXYB 4YBQD 5FYKU 1V7MH 4LPXA 5F88B 2IPKA 5F7HA 5L6YH 1F02I 3CD4A 4TNWK 3QPQC 2A9ML 2EDQA 5JW5B 4PGDB 1HXMA 2ZSVB 2W60A 4B7LA 6CGTA 2FH8A 2DBLH 2XQBL 2VE6A 4OB5H 1QBMH 1TMCB 4NKDA 5E2UL 4QOKA 5D71L 3MCG1 1KELH 3O3AA 5CKAA 3QQ4B 3H9SB 4PP1D 4E42B 4O00A 1UYWH 4GO6B 2JK5B 1TZGH 5FOBA 1TZHB 5IF0A 5C0IB 1GHFH 2OS7A 4HJJL 4GKZB 3VGAB 3P11L 3RIFF 1TQBB 5ETUB 2Z31B 1LE5A 1NCCH 4L8SB 4MZ3A 4XMLH 5T1DH 5J8OA 4OZGF 4AIXA 4L3AA 5D7SL 1SEQL 4LQFL 4MDJB 1S3KL 1Z5LA 2AXGB 2D03H 5AYQA 2G5RA 2XV6B 3IJSA 4GBXA 1PBYA 5L9DH 2NTFB 4FTVA 3A6BL 4R26L 1DTUA 4QHNA 1F4AA 43C9B 5MERA 2VQTA 1T0NB 3NN8A 4OF5A 3RWEB 4MNQB 4ZFFA 5C9JA 1WBXA 4NCDA 4NJAH 2XN9A 1EO8H 3BKJL 2FX9H 5HY9B 1K2DB 2RFXB 1UFUA 4F58L 3FFDA 3SY0A 1YMHB 4YC2C 4LHJB 5GJSH 4NJ9H 4XVTH 4NHCL 5EC1A 4U3XA 4WTZG 1VEPA 4G9FA 3WKNA 4UIKL 3V52L 4E41D 3AU1A 1AD0A 4MVBC 2B5IB 5CD5C 3LEXB 1KCVL 2QSCH 3QSKB 3H7BA 4LCIH 1MQKL 1J5OL 2H8PB 3ALXA 4N5EC 5I0ZA 1J88A 4PJGE 1LE9B 2EXWD 2DD8L 1I8KA 5IVOA 4GFTB 1JGLL 4O2EA 3DHJA 1YC8A 4EXPX 3LQAL 1B0GA 3LN4B 3SDAA 2A74B 5J11B 2YUWA 4JY6A 4N8VG 3MRKB 3DUUA 3Q1SL 4X6CF 2JJSC 4ZD3L 4DQOH 4XNQB 5A40E 5F7NC 3RIFK 3MODH 4PJAE 4E0RA 2VRAA 1PYWA 3IU3A 4JFOB 4BUGA 3LH2H 1NAMA 2OMNA 3H9YA 3D85B 1E27A 4Q6IA 4YXLL 1BFVH 4ZPVA 1WF5A 2APTA 4YIQA 2DDQH 3PDOA 1SBSH 4P2OA 2KQMA 3C8KA 3GIZL 1OSPL 3NIFF 2IBBA 1TETH 4Y19E 1ORQB 5I19H 2EDWA 1FVEB 4HJGA 5LXGH 4I2XE 3SDCB 4D0DA 1N5YL 1P4LB 1Y0LB 1A7QH 1L7TL 2OSLA 5E95B 3S3SA 2Q3AA 4KI5E 1I8MB 3I9GH 3WSQL 4UT7H 5I15L 3KYMB 4LSTH 3WFBH 2H1PH 1UH2A 3ZZ1A 1ZOXA 3QCTH 1JZ4A 5J9PA 3ARSA 4F57H 4D0CB 3T65B 1NMCB 4RAVB 1YY9C 5EU6D 3ETBF 2XWTB 3HMWL 4MQSB 5EU7C 5HGHB 2Z93B 1T2QH 4KROD 3PL6C 3BGFC 1AGBB 3S35H 5HSFA 2CIKA 1JUFA 1L9NA 1CFVH 3PGCA 4V1DB 4JY5H 4N1CA 1E28A 1R3JB 3RQ3A 5KTEH 3QH3B 1AP2B 2VLMD 2HFGH 5EZLB 3NZHH 2RCSH 3N06B 3ZSTA 2VDMH 1P1ZA 3LD8C 4PJ5A 5FM5M 3WS6A 4ZPTA 4G6FB 1EUUA 3UAJC 4AMKH 2PCPA 1FIGH 1IARB 4PJ9A 4QRTB 3OJDA 5IB4B 5I6XB 5GGSA 3RNQB 15C8H 1KT2A 4OD3H 3RX7A 3VE0B 3VD4A 2NZ9D 4U2ZA 1T89A 2WBJC 3BDYL 3VMOA 4XHQA 5I8CB 3QDMB 1SMOA 3O6LH 3VXUB 1Q72L 3JTSB 1P7QA 2V7HA 4M62H 3HB3C 3H9ZA 5KW9L 4BH8A 3V6OA 1GSMA 5EUKB 1RUQL 4JRYD 5B3JF 4GAFB 4AEHL 2G2RB 3NGBB 4D3CH 1A7OH 1DUZB 1OAXH 4ZXBD 3NCYP 1T80A 4NBYB 4EQ3A 2D7PA 3EIFA 1O7VA 3WBDA 4NZUH 1ACYH 3ULUF 4U1NB 2X5PA 4YDJA 1U9KA 4IMLA 1BFOA 4UT9L 3TA3B 2HWZL 4LSPL 2W92A 3BESR 1ITCA 4DVRH 1RHFA 1ORSB 5D8JL 4K7FB 5ISZB 4XBPB 4R4FL 4MD0B 5IJKC 5DHVA 5D5ME 4EOWL 1K8DA 3ECBB 4K3JH 5HVHC 1QG3A 2J1KA 4PRIA 1PG7W 4JREB 1N3NA 1AI1H 1NUFA 2DJSA 2YA1A 2HTKD 1CDHA 5FKPA 4Q2ZA 4LMQE 3SKOA 3FONA 3DIFB 4Z7WB 5I2IA 4HWZB 3HE6B 1S5IL 5DDHA 5JW3H 4CNIA 2R9HD 2HFFA 1ZHBB 3UJTH 3V4UL 1CTOA 2V5YA 1MEXH 2L7JA 2OI9B 3UO1H 1YPZB 4PRPA 4L9LC 4B50A 1PX3A 1IILE 2W9EL 1NL0H 5FUOH 4A6YL 2BVQB 3QUYD 1ODAA 3UTSA 1LP9E 2BHYA 3QWRA 2YPKB 3MRIB 2HG5B 1CR9L 1ZE3C 4OF8A 1XCQA 1VFBA 5EZOL 5E8EB 3EGSB 2K3TA 4JRXE 1MCHA 3ORJA 4RAHA 3RGVB 5KG9A 2DM2A 5D1XC 4XB8A 3O41A 3IGAB 1NLDL 3FFCB 2FYYA 4XMKH 3ZKND 5D2LF 5F6IB 1H3XA 2J4WH 2R4RL 1TVHA 4OD1H 4OCLC 2ERJC 5E08L 5T33L 1OAUH 4WW2F 1S9VB 1JK8A 5T3XD 1R5VA 3B9AA 4EI5B 4CRPA 4OKDA 1CTNA 4GRWF 1TCMA 2C3HA 3HE7A 5DMJB 4YBQC 1SJEB 1W0YT 4OZIF 2EIBA 2N1KA 4D9LH 3BP6A 4UBDD 3NZ8B 3WUWB 2HFTA 1RJLA 3DYMA 5EO0A 1SJXA 4WVRA 2FIKA 3HS0A 3CVHH 1G1YA 4GKSA 4X9BA 5C92A 3GNML 1MREH 2X4OA 4QY8B 2GQHA 3IRPX 1MFAH 1S7RA 5D7LA 3IDIA 5TGBA 2WUCL 1MY7A 3MV7E 5CEYA 4GLRH 1D5BA 3N50A 5ANMB 5JUEH 4JAMA 3T0AA 5DQ9B