3GZPA

Human sod1 g93a metal-free variant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzpA00
2K4WA 2JLPA 1CBJA 1Q0EA 1F18A 1E9QA 1N18A 3SODB 4BCYA 3ECUA 1B4TA 3MKGA 2SODB 2WKOA 3HW7A 1E9PB 2LU5A 5KBKA 2WWOA 1B4LA 3GQFA 3H2PA 2C9UA 1IBBA 2Z7WA 4FF9A 5KBMA 1SXCA 1COBA 1JK9B 1OALA 2AQPA 2E46A 4MCNA 2Z7UA 1BZOA 3RE0A 1PTZA 1ESOA 2WYTA 3KBEA 1PZSA 3GZQA 3GZPA 3KBFA 4A7VA 1OZUA 3PU7A 4A7UA 2VR7A 1HL4A 2AF2A 1UXLA 1AZVA 2WZ0A 4BCZA 1CB4A 3CQPA 3KH3A 1PU0A 1EJ8A 3KM2A 1E9OA 3F7KA 1IBDA 1SDAB 1E9QB 4B3EA 3H2QA 1JCVA 3HFFA 1N19A 3QQDB 1TO4A 1SOSA 1YAZA 3GZOA 2XJKA 2ZOWA 3KM1A 5CU9A 2VR8A 1SXAA 4OJAA 1DSWA 2AQRA 3L9YA 1IB5A 3CE1A 2R27A 2AQNA 2GBUA 1SXNA 2NNXA 2AEOA 2Z7YA 3L9EA 1UXMA 2APSA 1MFMA 1FUNA 3CQQA 2WKOF 2AQSA 2XJLA 1KMGA 2WWNA 2AQQA 3T5WA 3ECVA 1SXZA 1SXBA 1SXSA 3LTVA 1RK7A 1IBHA 3ECWA 1SDYA 1XSOA 2JCWA 1IBFA 2WZ6A 2GBTA 1OEZW 2GBVA 5KBLA 4A7QA 4A7GA 1E9PA 3F7LA 1QUPA 1U3NA 1JK9A 1F1GA 1P1VA 4A7TA 4BD4A 3MNDA 2ZKXA 1SPDA 4MCMA 3GTTA 2WZ5A 1EQWA 2WYZA 1HL5A 2Q2LA 3S0PA 1E9OB 4N3UA 1F1DA 1BA9A 1F1AA 4N3TA 3KH4A 3GTVA 3QQDA 2Z7ZA 1XTLA 2AQTA 1SRDA 4U4IA 1YAIA 1OAJA 2C9SA 1Z9PA 2ZKYA 4A7SA 1DO5A 1XTMA 1YSOA 1TO5A 1Z9NA 2V0AA 3HOGA 1L3NA 4A7GF 1S4IA 2C9VA 2E47A 4OH2A 2ZKWA 3K91A 2VR6A 1OZTG 4L05A
chains in the Genus database with same CATH superfamily
1KXQA 3N0AA 1J88A 1VFBB 1X4ZA 3C60C 2CUAA 2Q8AL 3ZPDA 3A6CH 3WKNA 3D39E 2UVFA 4GXVH 3HS0C 5TE7H 4YHOH 1O0VA 3T0EC 2VDKL 1XCQA 1XIWD 3SQOH 4PJGF 1PZ5A 4I7ZC 4UF7C 2F19L 3X1NA 3BAEL 3X12A 2RB8A 1TJGH 4JREB 4KX7A 3VSUA 2ZSWA 1EEUA 4PVNA 3QPQC 2QPFA 3T0WA 2YZ1A 3TU6A 4F7MA 1ZLSL 2WO2B 3VO0A 5DR5L 5EOTB 3KYNA 3KPLB 4FQJH 3MREA 4XVSL 3PIQA 5CJXC 5HI5C 4P2OC 4DN4H 1OP9A 5JOFA 4M1CC 4OM1H 4AEIL 3ZE2E 5EEXA 4FEMA 4OLYH 1ZCRA 2NY4B 2E7BA 2X0WA 1DSWA 4QR7A 3F7YB 4FFWC 1ADQH 1M05A 2NDFA 1WHPA 2XZCL 1HJCA 2DQFA 3BVNB 5T3ZL 1B0GA 2DLFL 3MBEB 4Q14A 3U46A 3L3JA 2IDUA 4H26A 2YR3A 1UWYA 1NM9A 2F53B 4S1DD 2BY0A 2Z4QB 5EFIB 2BS8A 3DXAE 4OKDA 5LXGH 3V0HA 1Q9WA 3T6VA 5K9JH 1DCEA 3D48R 2EDRA 3UAJD 3BISA 1UFUA 2X4OB 4R2GB 3U7AA 1D2OA 4POZC 4U2YA 2CDFA 1MCRA 3QJXA 3O2WH 1ETZA 4A63A 3CDZA 3G7TA 1E5CA 3NFPA 4Y1AD 3RL1A 4OV6F 4ZPTB 2WZPA 1BVNP 3T65A 2O6PA 5D1ZI 3SQRA 3X1FA 5GJSL 4D0DA 1KIQA 2X6MA 5BUGA 1TEYA 4DH2A 3L95A 1K8DA 2KS0A 1SBSL 5GIRB 4YSUA 5C2BL 1BQHG 2BHZA 4N20A 1WYJA 1T0NB 3IF1B 2MTAA 1F02I 4GKZA 2NY1D 4QUOA 1JFQL 4JHWH 2IADA 2CK0L 1DJXA 3JVGA 1MY5A 2KKQA 1E28A 2PCFA 2EIBA 5IVXA 5DC9B 5GJTL 2VDLH 3QWOB 2FBOJ 3SYQA 3SE9L 1KY6A 1R19A 1B6UA 1G7IB 1HC1A 1T1YB 4RGOL 4HKJB 5C9JA 3M1CA 2VDMH 2PPCA 3CZJA 3AU1A 5MERB 3RDTC 4OFIA 4KAQH 4QMEA 4B53A 4D8OA 1F0LA 2V5MA 1V3KA 2WO4A 3AB0C 1ADWA 1CF1A 1OZTG 5FUOL 4LXFA 3HIZA 4UT9L 3WS6A 2ZX6A 4PJ8D 1A7PH 1OOWA 1YJDL 2V17L 4OZGF 2J5WA 3FO1B 1R46A 5KUMA 2OJZH 2Q76A 4IS6A 1F3JA 4YDKH 3D34A 4W6WB 3HC4H 1OP5K 4AQ1B 1N9PA 4XN9A 4PCKA 3BUQA 3IPFA 3H3PH 5FGCB 4GW5B 2EYSA 2ESVE 4C4UA 3OR6B 1BQKA 2Y06H 2IFGA 2MNJB 3CCHA 3LYRA 4M1DH 4XAWL 2K9UA 1JZEA 3LS5L 3HE7C 1R4XA 4H8VA 4JO5A 3ARBD 1MFVA 4HZLA 3PWVA 4JO1H 4IHOA 3D0VB 4X7TB 4MQXD 4ACPA 3QDHA 3C09C 4HBQA 2LE9A 2VDLB 3FRUB 1LEGB 4RFEB 1T6BX 9PCYA 4OD1H 2RFXB 1EPFA 1WFNA 3DLQR 5CWSA 3MFFA 4P2QE 1AVAA 4U1KA 5D2NC 1ZE3C 1MHEA 4XHQA 5F8QC 4Z7UF 4ODUA 2AQNA 4PJBE 2W0FA 3EG9A 5LWYL 2EE6A 2HPTA 2X4QA 2WKOF 5CN1A 4OCXH 4S1QL 2LV4A 5JXEA 4XCNB 3FDWA 2IGFH 4QHPA 1M2OA 1J5OH 3BYYA 2C8NA 1OAYH 3KW7A 2YK1L 5D5MB 3QNXB 2MOVA 2IVFC 1KCKA 4KGLA 1OIOA 5HVWA 4XCEA 4HCRH 4XZUB 3TJEL 3P2TA 4C56E 4UQ3B 5T1KB 1UM5L 4MA8H 4EXPX 4AXWB 5A40E 4PW4A 1TTGA 3ZX1A 1UCBL 3GIZH 4GUPA 1USQA 2D7QA 2Z64C 1FJ1B 4HWEL 2FBRA 2HG0A 2IANA 4TQIA 3CGTA 3MOAL 3FQRB 4O51B 4ADIA 5DVLA 2EXYD 4UOW0 3EJPA 3PXJA 4ATWA 5BMFH 3P0VL 3FUIA 5D7IF 5CCHE 5IBLD 3S88H 3VYNA 2C9PA 4UNIA 4F1SA 4OF8A 5BRZA 4LARL 1U3HD 2VLLA 3AS2A 5IB1A 3MC0A 1EZSA 2Y5QA 1CGWA 3V0EA 2NNRA 4ONFH 3L4VA 2CA4A 4M7ZC 1UT1A 1XTLA 1EFXA 4OJYA 3TBYA 3TF4A 2R23B 5K9OB 4QRTB 6FABH 4CU7A 3HS9A 5EEUA 1VFMA 3HG3A 2GK0A 3L4TA 4I18A 2AJSL 4L0ZA 5A43C 2EIEA 3HZMB 3M1OA 1ZLWH 1D9KD 4BZ2L 1VLXA 1HOEA 3RIAK 4JO2H 4LSRH 1ZEAL 5EEYA 3MUHL 3MNMA 4OLZL 3SODB 5J0BA 3MO1A 3SOBL 5I1GH 3BP6A 1XXDC 2XETA 5HI4D 5I73C 1EJ6A 2WIIB 5K93A 12E8H 4N2MA 4R7VA 1QI5A 5GGUB 1V5JA 3CZEA 4GEIA 2H4EA 2XYBA 1HHKA 4NQEE 5EF2A 3E38A 3VXNB 4L5FH 5EEZA 2R69L 4PJCE 1XX9C 1Z32X 4X99B 1JGDA 3IFLL 1NMCB 3FO0L 4G70B 3V0VB 3H4HA 4HPOL 3PV7A 4LQ1A 3MKKA 1J5HA 3I02A 4GP8B 1PCSA 2F08A 2R7EA 2BSED 4ODSL 3FF7A 2WLKA 1VZGA 4FYRA 2GTWB 3QJFA 4M7KH 1HDMA 3ES6A 2LAAA 3DSNA 1VPOH 4OCWH 3DO3A 4R7DB 1NFDF 3NRFA 4JE0A 4FA6A 1HINL 2RMNA 2AV1A 2XVKA 4MAYA 5EN2A 4UOW1 4YPGA 4LOUC 4N28A 1B9ZA 3ISWA 3STZB 4PSRA 5DJCB 2DI7A 1WWCA 3UGXA 5CR1A 2WWNA 4AV0A 1AE6L 1E4JA 2B39A 2N1TE 5F96H 3NEEA 4BRJA 4IOSD 4IRJA 3FQTA 1V3MA 4HAKA 5L4MA 1GZHC 4Y8DC 4QLWA 1TKWA 4HIEA 2NY7L 4W6YB 2VDPH 4GT0A 5KSUB 5A2LH 4QOKD 5T5FA 4N1HB 4OFPA 4JFPA 1NCWH 5JW5B 2CR6A 3MV01 1RK1A 5AVZB 1M6OA 4KJPC 4NQXA 1OE2A 3AQYA 1K3IA 4X5PA 3UYPB 1LP9A 1CG9A 1RJYA 4MB4A 4WI9A 3DUUA 2A6DA 3B7UX 2FH8A 1HL9A 3BWAA 1KC5H 4OZHA 1MJ7L 3MV7D 3AXLB 3V4LA 5KYWA 2HT3C 3Q13A 2BVOA 1M1XA 5LHDA 3FPXA 4Q6IC 3BZEB 4AQEA 2F9BT 4R4NC 2JB6A 4D3CL 4P2RB 2FO4B 3OKLA 3U1QA 4OGQC 4Y2DB 3Q8AA 1NPUA 2J1XA 3IETB 3I2CL 3QULB 4QD2E 4O2FB 3V6OA 2AERT 5MEQA 2VMDA 4HT1H 4ZUSA 2ZICA 2P5PA 3F58L 5I18L 1T4KA 3WNLA 5MEOA 1OHZA 1LDPL 5H37H 5I8EA 3MXVH 2FDBP 1QOKA 4A67A 5F9JB 4PJHE 5FYJE 2XXMB 2MCG1 1D3CA 4ZMLA 3TV3H 1N59A 2CKBA 2QMJA 4H88L 4HH9B 7TAAA 4Q52A 4EQ3A 1RUAL 1RH8A 5JHMA 4TSAH 2BFGA 3NSCA 1F3DH 3TWCH 3F5WA 3BQUA 3GTNA 4YLQT 2CNYA 1H3XA 2FD6L 1NBVH 2F15A 3UBXG 4GW4B 1JK8B 1KIRA 3H8NA 1M7XA 2WPGA 4UM8B 2C9UA 1R3LA 1ASQA 1M57B 4FXGA 4L2YA 3X3GL 2Y3NA 3N1QC 4NI6A 2WXRA 4ZD3L 4L9LB 5HJBA 1P6AB 2R56H 4APQD 3ARGC 3D3VB 5E6UB 4ZUVB 1WEJL 5AYQA 4PRIA 4HG4K 4OIIH 2VXVH 3GMMA 5GISH 5B4MD 2ZUUA 5CD3A 4C83A 2HT4C 3CXHK 4KDVA 4AIEA 5I16A 1SYVB 4B3EA 4PV8B 4OCRL 4AI7A 4RDQG 2X89A 2Z91B 1K4CA 2VRKA 4Y5VB 1H8LA 4JHAH 1RZKC 3OLIA 3MRIA 5DUPH 5EG6C 4P05A 1UH2A 3SYPA 2D9CA 3KXFD 4RRPG 1A7QL 4QXTA 1GOGA 3DYMA 5I1DA 1ZTXE 4OD3H 3PXHA 4RZCB 3ZO9A 3DBXB 3LSOB 3G9AB 1MCSA 5CLZA 5FK9A 4P2QA 1WIPA 2DIEA 3IT8D 2WQXA 3HE6B 4E42A 3S8FB 3IGKA 4L18A 3MRGA 3V6ZB 3ZE1B 3A4AA 1N2RB 4G43B 2PO6C 4TRPL 2LHAA 4PJBA 4I85A 4JFUA 2VIRA 3WHXB 3O3EB 4YSSA 1L0PA 5I66A 2WLIA 2A6KB 4L4JA 2E8YA 5SX5K 4ORGB 4QY8A 2XRAL 1XBDA 1E9PA 1U8PB 3FQXA 1TU2B 1JGLL 4XXDA 2D73A 1K85A 3BT2H 2PPEA 3MJ8A 2X6BA 5T3XL 3RX5A 3VVWA 1I3RA 1BMWA 3BYTA 4PJIE 4TUJB 2WXJA 3GMNA 2UZYB 1TYEB 5KYYA 4QPEA 3OPUA 1RZ8A 5C0DA 2WQRA 1Z0MA 5D1ZD 3W2DL 2VITA 1PQZB 1P2CA 1KULA 3FB5A 3TYGH 1YEHL 2B1HH 2QPSA 3OZ9H 1WDAA 4GP5B 1DQQA 5B8CC 3BFWA 3BIAX 2DMBA 3Q2CA 2D8KA 3ZT6A 1XZ0A 3F64A 5DVNA 3FFCD 2BS9A 2CKBL 4BKLB 1HKLL 3GM8A 4Z7QF 1ILSA 1HWWA 1NMBH 3MLZL 4N2HA 3CSGA 1XIWA 3EO1B 5E4OA 3S34H 4FTDA 3ZZ1A 4ZX3A 3OV6A 1IGJB 4N6QA 5DI8A 2OQJA 1IKNC 1HHJA 2B9BA 2MPAL 4MZ3A 3DPDA 5I0ZA 2NRDA 2AJZB 2CM6A 1HXMA 4X0KB 3NJJA 3ARFC 3QUZA 2VTFA 1DFBH 2VO5A 4RMRA 1MN4A 1OAXH 4I8DA 4V2CB 3SE3A 2ZAGA 3QQ3A 5KVEL 2H6PA 4M1GH 1AI1H 3II2A 1YEEL 1CFVH 5GS1A 4AVKA 3GS0A 4MD4A 4XNZB 5E03A 3VSQA 1TXKA 4NN5B 4BSJA 3L16A 4PSPA 4QTHA 2WZ0A 1RIVH 4NQEA 3SY0A 2X4PA 5DD3H 3TH3T 1ES0B 1KBKA 2DQCL 4XO3A 3SKJL 4JY4A 4PRDB 3QH3B 1RK0A 3US0A 1I8KA 2FIKB 2LT9A 4JJ5A 3O3DB 3RQ3A 3IXAB 5FM5O 2A9CA 3T3PF 5C0FB 2EINB 4GAJH 3QDGB 3DUSA 3EDDA 3TNMB 3GSNL 1XZWA 2A74A 3Q6FA 5FV2A 3W5MA 3EIFA 3MRNB 5LGHH 3ZRSA 4FQLL 4TL4A 1PD6A 3UAJA 4TYUA 1FUNA 3AWFA 3JWDL 3O0RH 3VA6A 1UH3A 2ZYRA 3E1F1 2YFOA 4JN2A 5FWRA 1CLZL 5ICYB 3C5ZD 3ENEA 2BMKA 1WBZB 4N90D 2A9ML 3JTSA 4PYHA 4DQAA 3QWNA 5AVYB 3WEXB 5ESVB 4UU9A 2BCMA 3KE0A 3PL6C 2WWMC 2W5PA 5ID1B 2BZDA 3JV6A 4GUCA 2V37A 3F7LA 4JB9L 3VXMD 4OKVA 2J8UE 2H3NA 5IY5B 1XGPB 1AZNA 5DJ6B 1YECH 5E2TL 4EUPA 3FULA 2OPCA 1KPRA 1D5ZA 2XC8A 2WM0A 1I1AA 3L6FA 3R8QA 3IMSA 3VXPA 2OJEB 3WD5L 3ZUCA 3ZYJA 2BVPA 1BP3B 4UAOC 5AYUL 4XNXL 1I85A 2OI9B 2PW1A 3O4LB 3TCLA 2E9JA 3BPNB 3FTVA 4JQVC 2ED8A 3TBWA 5GSVB 2X44D 3RNKA 1H6TA 4Y4HD 2V6HA 3QQDA 3C5JA 4NAMA 5DMGC 5F1SA 5ABDE 2XKUA 5ETUB 3VFOB 2MQCA 2BSTB 5C6TL 2G75B 4MMZB 4PJ8A 1X5KA 1NEZB 3H3BC 3A21A 4GAYA 3QAZB 4I0CC 3SPHA 5HGAB 3DURA 5KANI 5C0EA 1IBGH 4EJ1C 3VXSB 3IMUA 1W9XA 2RGSA 3VFMA 1PG7X 4BYHA 2WGNB 3INOA 4K23H 5IROD 3BH4A 5F89B 3ZDYB 4HSQA 5J57B 3D05A 5CZRA 1HI6A 5JHDB 1LNUA 5FA4B 4PJHA 1FYTD 5H35A 4ABQA 1NQBA 5ENWA 3D1MC 1HKFA 1NIBA 3ARBA 4J4PC 5JIDA 4G8GE 4K5OA 5KVFL 3HNSH 4CW1B 3UDWC 1UWEL 1OB0A 5E51A 3AY4C 4A38A 1LE9B 4HF5L 4Y16C 4LDOB 4LPYA 2YKLH 3TM6A 2CMRL 3T3MF 2Y1YA 2J6EL 2RIKA 3H9SD 2NYYD 1XGUB 4G8IA 1PKQE 4N5ED 2F7OA 2BVEA 3D85B 4G7QB 2C3VA 1AGDB 1BECA 4GSQA 4IU2A 5FUCC 1T5XB 1NGXA 4S2SB 3C2SA 1ZAGA 5DSCB 1DBAH 1ZWIB 4GRLA 3U36A 3W0WB 3WLWC 1YYLH 3HFFA 4JDTH 4DGWC 4R3SA 1I4FA 2YEZB 5DUMH 4HXBH 5D1XD 2VSKB 2ADJB 3GZOA 1AD0B 1CICC 2WXIA 4PJFB 1E8YA 3OHXB 4LPTA 3SDDC 3VD3A 2JQAA 5J7CC 4Q9RH 5BXFB 3O2DA 4J3TA 3KWWA 3P4LA 2B3RA 2FSEA 4D0CB 1OTSD 4HJUA 4ZFZA 4IBLT 5KW9L 4TNWF 5AW2B 1B2YA 1WAAE 2Q5BA 5TQ2H 3E2HB 1TZHA 5ICXB 5FYKH 3LKPB 4OFDA 4PY7B 4LEXL 3IDUA 1A9EA 4ZUTB 1XL6A 3T71A 4Z0XB 2WXPA 3AS3A 5GGQL 4FFYL 4E41B 3TGXA 4X6FB 5J56B 3X13B 1FAIL 1XH3A 2E8ZA 4ODVH 4PW3A 3M7OA 5KVDE 2BINA 4JFXA 3PP3H 5AG8A 3U0WL 1TMCB 5I0WA 1LO4L 5K9KA 4HS8H 4O02H 4PWFA 3GGWB 1YEJL 1E4XL 3INUH 4A6YB 4C55A 1VESA 3IRPX 1PFOA 4JL1A 5HHME 1ED3A 3APCA 3DUHA 4QHNA 3NJFA 2B14A 1AP2A 3D9AH 4PJIA 2WLMA 2QADC 1AR1B 3FUDA 3NZHL 5J12C 3A0OA 1A5FH 2WP3O 3DETD 4RGNB 2VE6B 1IKOP 3Q8FA 3FH5A 2H5UA 5F44A 4NSKA 5KSAD 4ZTOL 4MX7A 4KY1H 4Y9FA 5TE4L 1D6VH 1LK2A 3L3OC 1NCTA 2A7BA 4IBQA 4NZTL 2E7DA 2M1KA 1BEXA 2E74C 2Y6SC 4MDJB 3OVUB 1XF5A 4AV4A 5BS0D 4M3JA 3MDJA 5IG7B 1I7ZA 3CFEB 4PJXF 3GXIA 2DLEA 4Z0BL 3DOSA 4J1UA 5HGBA 5F6IC 1IEAA 1N5AB 4WFHD 1EEYA 4HV8A 1KCUH 3N43B 4PRHB 1FQ9C 1URLA 3TJHC 3I3DA 2AK4D 4HKBA 4JFZH 2DLTA 1FH2A 4Q9BA 1UQSB 3GBNL 1SOXA 4HUMB 3C5SB 4LKXA 4O02B 4WCYH 2OZ4A 4UQBA 3GSRA 1KJ2L 2XQYK 3K2IA 7CGTA 4HWNA 1J0JA 1JWUB 2OR7A 3ARUA 3T4YB 1QLEB 1IMHC 1XAKA 3ATAA 2EEDA 1F3RB 3AG1B 5TGBA 3BPCB 4NQCD 5INCA 4EO5A 3OQRA 4ZPVB 5BO1L 2UXFA 3NVQA 4Z5RA 3GZPA 3BAWA 5CO1A 3ARYA 5LG1A 3HBPA 1TQCC 4NRYA 2AABH 4ELME 1KJVB 4FXTA 1FGNH 1FNAA 5IW6B 3M1BA 4ZMNA 3O2DL 5HYQB 2GJZB 3I75B 4ODTH 4NRZB 4MS8C 4R90L 2YJLA 1SLXA 3BWZA 4WWKB 3E8UH 4I3SL 2AAVA 4XPGH 1G1KA 2E7MA 3MRDB 4UM9B 5E99L 1O6SA 5A2CA 5FO8B 2I7OA 4ICWA 3TBTA 1G4MA 3RY6A 1TZOA 2NY3B 5HD8D 2D03L 4CUCA 4QOKA 3TO4A 1OWRM 3U4EA 8FABB 4NM8H 5CEYA 2K4AA 4DEPC 5CGBA 4GP4B 4L4VB 4WV1B 4YZFE 5FYJU 4FQIH 3V79C 3BWSA 5LLIC 3HZ3A 3F00A 2NW3B 1V3JA 3MNWB 1YEGL 4YFDB 3MLYL 4MXVE 4ERSL 3I74A 1UZ8B 1CTMA 1QTSA 5FIEA 1FO0B 3AQDA 3OL2A 5F7BA 1IAMA 1MLBA 1CT8B 3V5KB 4H13C 2PKDA 1XGQB 2J8UA 4LVOC 5E9DE 5H2BB 3TEXA 3DX1A 3IMVA 5D7LE 5EZOH 1T6VN 4ADGA 3KGRA 3CLFL 1DSYA 4KDTA 3ZR5A 3FQUA 3WO3B 4XNQA 4ZW6A 4YFEA 1JV5A 4MNHA 3W39B 4N3UA 4LPCA 1IFRA 1JD7A 4B6ZA 1R5WB 4HSCX 5ANME 3HHRB 2IPTL 3QO0A 3EYUH 1Q8MA 4E36A 3UYOD 1CDGA 3WIAA 1CLYH 3MOBL 1Z2KA 3NYKA 1GZPB 1Z5LB 2EP6A 5CP7B 3N0PB 5I2IA 4B9CA 4F20A 3M6DA 4OZ4B 5H37G 1FHGA 2OZ4L 3GD1C 4JKPH 2F7IA 1MHPH 2GI7A 3TVMD 2ZWNA 5SWSE 1KIPB 5AD0A 2Y36L 3P11L 1L3WA 3B8SA 3O6KH 2KHAA 3FSVA 5K39A 5DJDA 1JZ2A 4V2BA 2DBLH 1QEWB 3QVAA 4FQ1H 4Y9GA 2MPVA 2H26A 3OAZK 4BHUA 2VLJE 1T4WA 3ET9F 3WKQA 2NSMA 1E67A 2LVEA 4ZW7A 4Q9CA 5IQ7H 1SY6H 4NO5A 2FEEI 4IQHA 3CFKA 1DSFH 2BC4A 3DECA 3WL9A 2FLBT 1IIIA 3S37L 4KI5F 2FCBA 4U6XA 4WW2A 5J1AA 3BFQG 1A3RH 2IV9A 3KXFA 5B39G 1GGBH 5D7JC 1Y6KR 4AE0A 1ACYH 3H9ZA 4GW1A 1QZ1A 2XA8H 2XX0A 3EJTA 4OU3A 2Y5TA 4Y2OA 4BV1A 4DKTA 1PCXA 3MV9E 1ZXKA 2A83B 1E9QB 3R0NA 4TUOA 4BH8B 1JUFA 2JVUA 5HPMB 1INQB 1U3YA 3RZCD 2DI8A 1Z5YD 4XP5L 4U1JB 2ZCKH 1RERA 1A65A 1FN4B 2EYTB 5DJ8A 5HTSA 3AC0A 4Y1TA 3QFDB 5JPMA 4WFEE 4OZIE 4C57C 4ZS7L 5F9WC 4JLRB 5EU5B 4OBSA 4WWOA 2WBXA 4HHAA 1ZHKB 4X9BA 1X9QA 3TT3L 1S7UA 3MNVA 4N9OB 4ZFGL 1PDKA 1CGSH 1QUNA 1DP0A 4FS0A 2WUBL 4KRPB 1NGZA 1OAQL 2IALA 3ECWA 4KJQC 1FLRH 3HHSB 3SDXF 3DGGB 1NGWB 4ALAH 4XXCC 1BZDA 1WAAA 4NDMA 1DVQA 3VD5A 4NAQA 1EMTL 4X4XB 1BFSA 1GYUA 1UD3A 5E6IB 4X5WB 3S35X 3OKEA 1EDHA 1OLZA 1VIWA 1YN7B 4PP2B 4LEEA 4HIJB 4RFNB 1CDCA 3CZFB 2BP3A 4HIHB 4IEFB 2A4ZA 4Q2ZB 1WQVT 5F3BB 2BIPA 1JZIA 3LVEA 1ONQA 1WTLA 1IGIH 3WNNA 1MW0A 5JO5B 5TF1H 4W9LC 1RZQA 1XD1A 1AAJA 4TLTA 2FGZA 4QNPF 5GRWA 2FH6A 4ZMTA 5GQBA 5IB3A 3PAZA 3UMTA 2LLNA 3ASWA 3GTVA 1E4KA 2PABA 3WTSA 3IVKA 2EVFA 2NY0D 5I5MA 1XCTA 3CN3A 2E9GA 3Q2LA 4KKAC 3LN4A 4P5TC 1E5AA 3WIHA 1UTDA 1C5BH 4PJ7E 5IQNA 3MLPA 4JM2F 1MXGA 3KVPA 3GSQA 4YVUA 2H3KA 1T22A 2FB4L 2L3BA 3CC1A 3LS4L 4HIIB 4PIRF 4YHLL 5GZOC 1I9RH 3VRLE 4DZ8A 1MFEL 2O6DA 1XAUA 4NPJA 4ZFQA 3NK3A 2O72A 2VXTH 3EO0A 4LSQL 2GB2A 5I1IL 4A2LA 1JNHB 2OL3L 1J1XH 3DJTA 1D6EA 5AALA 3ETBF 5TQ0H 5T5NG 4IRZL 4KY2A 2R59A 3X1EA 3ZKMC 5CP3A 1YMME 1KYAA 4LGPB 2IDCA 3WEAA 3ZYIA 4FERA 2WXLA 1KGIA 2YAEA 5AENA 4JVUA 5HJDA 3JVFC 4NFDA 3FU7A 4KVCL 4N2CA 4NGHH 3DV4B 4F7KA 2AKRA 1HHIA 3HCVB 3WFDL 3L3IB 5C09B 3MV8B 4KI5D 4RNRA 3NPSB 1UD2A 3DROA 4OUOA 4A2DA 1OD7A 2DQDH 5GGRB 3CSYB 4WSGA 3ZMEA 4GKSB 4ZT1A 2IV8A 1T1XA 3WN5C 4H8PA 3EF7A 3WLBA 4LCCB 1DVFB 4J6RH 4HZ1A 4ZX5A 3KWTA 2QPUA 3TZVA 2X4NA 3LZLA 5IMLB 3FH7A 5CU9A 5FDWB 4HJJL 3ARVA 3HC0B 4HLZG 4DF9A 1L9MA 2P5EB 3O6ML 1JWSB 4C58B 4BWTA 2HKHL 1RZJC 5HDQH 4PGEA 2VXSH 3VGHA 4QIRA 3LV3A 2IOOA 3EFOA 3QJZA 1NEZG 4G80B 5D1QB 1SJEA 4JHZA 3O45A 4LLDB 3EAKA 4OB5L 3K81A 4PJAF 4DSYA 5C0IA 4KH9A 2YPLE 5F2FA 3TIDB 2VZOA 3N41F 3NOIA 1EZLA 1ML0A 2NZ9C 4NT6A 2OYLA 5AB0A 4JFED 3P9MA 5IHWA 4HWBA 4HBCH 4KO7A 1JF5A 3OAYH 1J9TA 1JF6A 1O9WA 1U33A 4F7EA 2IC2A 1RLWA 5I1CL 2O61A 3CHQA 5IVNA 3VNYA 3BN3B 3IKCA 3TA3C 3MTRA 4LLMB 4GQZA 5GRYA 3D07A 3E6HB 2YBRA 1SNRA 3U1SL 3VXOB 5E9DA 3GMRA 5D7LA 4NC1C 3PDGA 4XVJH 5I6MA 5IMOB 3TS8A 5DRWB 3FN3A 2Z65C 1ETA1 5CR8A 3A22A 2X5PA 4ZUWB 4NO2B 5IVZB 4YZWA 3IDGA 5JW4M 5ANMA 3BSGA 4ZRGA 1U8CA 1Z9NA 4X6CE 3RWHB 2WLLB 4M7LH 3ZKNC 4JM2D 3PWPD 1V7ML 3KWXA 1FLTX 1U8HA 3MJ9L 5C7XH 1A4AA 1X5HA 2HJFB 2WXHA 4RA0C 3OZLA 2VDNB 3BW9A 1A1NB 4XNYH 1CU4L 4J3VA 3H9SA 3ESVF 5GRUH 5SWSA 1BG9A 3OXSB 3W9EA 3CIQA 3MCKA 3U6RA 4AVHA 2NY6B 1MCPL 2I60H 3A67H 4FX5A 1T2JA 4ENEC 3N42B 1EAJA 3WFCH 5BV7L 4PFEA 4DHLA 4FTVD 2QELA 4UINL 3IGAA 1E4WL 3KJ6L 5JMRA 5E00B 1SYSA 3K46A 1UFGA 4O2EA 3VGEA 3DMMB 1DUYA 4IYKA 2DWDA 2Q7NA 5D96B 1M2VA 2QGEA 1G6VK 3F7KA 2Q8AH 3RWGB 1IM3D 4FQXB 4Z9KB 2VDKH 3B5TA 4YDNA 4YIQB 1B4JH 1U91A 4ZFOA 1BVKA 3FRPB 4LLYA 3MRFA 3AM8A 3MV9A 1EUTA 2CGZA 1DDTA 1DBML 2YD4A 1CFSB 3CMOH 1BEYL 1CF8L 4U6YB 4OIAA 2GITB 4MZ2A 4Z7VB 2P45B 3IFPA 3VFWA 3O8XC 4FYQA 1M7DA 1OGTA 2RACA 2BSRA 3NACH 4OZIA 1AHMA 4XVSH 4X7SL 4MGXA 2IBGA 2D3NA 5E4IA 3VI3E 5K1NA 4GBXC 3QIUD 4NFCA 2ADFL 5E94B 1IGFH 1JXJA 3EJJX 1S7QB 1R75A 3DDFA 4LBEA 2NNAB 4QGYA 2VR5A 5F70A 1LLAA 4Z76A 4HIPA 4IMLA 4MMYB 4ELKB 1EX0A 5JUEH 3MUGB 1ID5I 4MQ7B 3GJFA 5IHUL 1U3NA 4ZXBD 3FOLB 1A9VA 3VWJD 2JK5B 1OAKL 3H9HA 2X09A 3TCTA 1GSKA 5IB5B 4X5QA 4XPAL 2KZ1B 3U79A 1KJMB 4D0BB 1T1WB 2Y6TE 3ILQD 3VD0A 3AT0A 4G6MH 4JQIH 3RIKA 5BS0A 4HWUA 3UTSB 2JSFA 1BVZA 4BGDA 2HJLA 2XV2A 1NOLA 2DTSA 3AREC 1E3ZA 4TSBL 4WJ5A 5LVEA 4XNBA 1TCMA 1H3VA 1GGIL 3ZT5A 4EDWH 5KYNA 4XAKD 1BQLL 4QRPD 4XXWC 4B7IA 4EVNA 5IOPB 3K0YA 1KBGH 1NCGA 1TIUA 3JZYA 3B1TA 4BFJA 5GJSH 3BP7A 2OSXA 2DBJA 4JVPA 1SBSH 2DEYX 4HA1A 4WDIA 2FQFA 2WINB 5C2BH 4GB9A 3FZUD 5KSVB 4HGMA 2OX5B 1QA9A 1U36A 2DJ4A 4NQCA 4KMQA 3UEZA 1JFQH 1QLFB 1LTXA 4QRRB 5D6DC 2CK0H 3KVQA 4NO0D 4HX1B 1P5UB 1F2QA 4TOYH 4AEHL 4AKQA 2XZQL 1AACA 3MRJA 1H5BB 4Z77A 5IV2B 3BCDA 3GPSA 1EAOA 2WO3B 2Y9RT 2GC7C 3OR7A 4JO4H 3RWFA 3SE9H 4PLKC 4YEEA 1ITCA 4RGOH 5GRJL 3HB3D 1OLLA 5E2WL 3QJTB 2DQUL 4Q97A 4S0HA 2P43B 4JPWH 4EN3C 1KN2L 5I6NA 3PHOA 3K3QA 4ZFOL 4TTGA 3QIBB 4LIQH 3BP4B 3SPIA 2V17H 1HAUA 3MGTA 3V10A 1QSFD 3FSWA 1XQ4A 4F9PA 2AXHA 3U4KA 1QRNE 4O00A 3P3TA 4JZOA 1JNNL 5FGBA 1KXHA 2YAMA 4IIQA 1J9CT 4LEBA 4YHIA 2X2YA 1FL5A 2NY2B 3KDMB 2X42A 5DEFB 3UTTB 4P57B 3VWKA 3VUAA 3FMGH 5CEZE 1IC7H 3V4VB 2GBUA 4BBWA 3LS5H 1MXDA 4GG8A 2GY5A 2QEJA 4AL8L 1QFHA 3TYFA 3U7YH 3RI5K 3P2DA 1G9HA 2F2HA 3B2DC 4I5BA 1IGTB 4M5ZL 4GSRA 2YQBA 3BVTA 5I23A 3L3KB 1DJZA 5E8OA 1NM4A 4Z7OB 4NQDD 1XCQB 4IBVA 1KB9J 2FE0A 2NY5C 3CFCL 1TF4A 1PZ5B 1L7TH 1EGJA 2ICEA 5LWYH 4N0CC 2R0ZL 4Y19E 3ROOA 1RI8A 1RURL 1Z6JT 2ZUSA 3LD8B 2F7PA 1RZFH 2ZSWB 3H6AA 1J8SA 5ITFA 2V8MA 4F7MB 2YK1H 4QRSA 4GO6B 3ZZQA 2E9WA 3MREB 4D9RE 2G9HA 3US9A 3PIQB 3KLQA 4HK0A 4IOIA 2CGRH 5AB1A 3FT2A 3TJEH 5JOFB 2JKRM 3TVMA 2R0LH 2VISA 1UM5H 3NIFB 4F58L 1UCBH 3NFNA 3EGXA 4L8SA 2JJTA 1TEFA 3IDIA 3MOAH 1DO5A 4Z3IA 1KT2A 1M05B 1YSOA 2DQFB 1B0GB 2DM4A 3U46B 3L3JB 2BW5A 5KZCD 5F7NC 4H26B 2VZTA 4JGNA 1TYJA 1TNNA 3MLRL 5AW1B 4CSZA 3LEYL 2PPFA 1S7SA 1FIGL 1MIMH 4AT6A 2ZKMX 3AWGA 5EWIH 1GGTA 3SB3A 3BN9D 5EBMA 1A6VH 5LGKA 4K5NA 2NXYC 4HP5A 3BEWA 4AQ8C 5KBKA 3WU1A 3QEHA 4OZFH 4LF3A 3LKNA 2Z93A 2CDFB 2W60A 3T9WA 5C0CD 2AJSH 3LQAL 2VRQA 1ETZB 3IE4A 3CDZB 4EEEA 1YYML 4LPXA 3HRZB 4AM0A 3T65B 3WFEL 1N68A 1KIQB 2HG5A 2WBJD 1QW8A 4RMWA 1XSJA 1K8DB 3DX8A 1G1CA 2PYEB 4ETYA 5ACZA 1T0MA 1G7QB 4GKZB 5CKGA 1J1PL 2LTQB 2GW5A 3KL0A 4K3DH 4DVRH 3G5YA 3KLHD 1E28B 3VYPA 5HYJE 3BGFB 3ECQA 5CSBA 3VXUD 1IGML 5IVXB 4ZZKA 4QKTA 3RP1A 4PLJC 3ZSSA 3F84A 3IFLH 2ICWJ 4KTEL 3C60D 5C9JB 3FO0H 3DDGA 4HPOH 1WBXB 3T0ED 2B08A 3DRTA 4PV1C 4UZUA 3BVUA 4ODSH 5IJDC 3E9TA 3WUZA 5KYUA 1RVFL 4CNIA 2I32A 1BIHA 2G9KA 2OMYB 4CDHA 4MMXA 2JKNA 1HINH 4HJIA 3T6ZA 3IDYC 5AB9A 3FUNA 1R5IA 2Q76B 4IS6B 3VI3A 1F3JB 3BUYA 4JHVA 3QPQD 1PLGL 3V5HA 3ERXA 4QCIA 3EYOA 3U9WA 4J3WA 4QYOA 4FULA 1N6UA 4B9YA 2EYSB 2P3YA 5J1TC 2F54D 3CLEL 2R29A 3GHEL 5HI5D 3CCHB 4JREC 3O6LH 4P2OD 5H8DA 4M1CD 2OAAA 3I6LD 3JT2A 4N0UE 1Q1PA 5TE6L 4X7FC 3VMPA 3EOTL 4IHOB 1Q90A 4OCYL 1F4XL 2QQKH 4FFWD 4DP0X 2NY7H 3SGKA 3UO1H 1Y6MR 1JVLA 4N86A 3OB8A 3SBWA 4BKTC 4UDTA 4U7SA 5CWSB 1S78C 2ATAA 4U1KB 1CR9H 2I9TA 1T80A 5AAMA 2Z9TA 1XTMA 2NY4C 3EOBA 2FQGA 3OLGA 2W0FB 3EG9B 1P7QD 5DYOA 5EZIL 4W9DC 5KJ7E 2F1BA 3SYCA 1IO4C 1MJ7H 3BAJA 2X4QB 3ZYOA 2FECI 3MBEC 4KX8A 5L2KB 3NA9L 2DD8H 2Q6WA 1PZ2A 3UERA 2VR4A 4GSXA 5CJ5A 5IMKB 3HFML 4POZD 4D3CH 2QPDB 5EO9A 4MJIE 1DQLH 3MJ7A 4HZAA 1GS8A 1I7UA 2K70A 3ELAT 1HH6A 3I2CH 2N1KA 2D7TL 1BD2D 4XCEB 2MMXA 2DS4A 3X14A 2RR3A 3HC3L 4R2GC 4HIXH 3EYVA 4LZKA 5C08D 4UQEA 4WUKL 2Z7UA 5ABAA 1J48A 2FK9A 2IANB 3U2IA 1MI5D 5C0GA 6CGTA 3T1FA 1XR8A 3OKDB 3QDJE 4G6JL 1F58L 3I9GH 4NP4L 1PSKH 2WLHA 2XACC 5IGXL 5EUOB 4R5TA 3BLKA 2PR4H 5BRZB 4O58H 2VLLB 1WH0A 1RHHA 4CN4A 4WUUD 4R26H 5I17A 1CD0A 1MH5A 4JMXA 1J0KA 1S9XA 1ZA3B 4FI7A 3O2VL 3R06A 3X3GH 1EFXB 3RPBA 3TBYB 3QRGH 5DK0A 4ZD3H 1KCWA 4RSYA 1QRNA 1K4DA 2EC8A 3NIGE 4Q74A 1FC2D 2ICWA 3S3SA 1WEJH 4NKMA 5A3IC 4KOBA 1SXNA 2I07A 3VGFA 5BOJA 4JFEA 1VCAA 2IPUK 3EYFA 4DCQB 5F1NA 1YEIH 1SXBA 1IAII 3PJSA 1GMIA 4OCRH 1FG2B 2GT9B 5C0AD 2O30A 2ED7A 1E30A 3K71A 3QPXH 4PBDA 2G4EA 3GEFA 4F57L 1P1ZA 2X9ZA 3MO1B 1A7QH 2D31B 3BP6B 3P4OA 4MJJA 1V3LA 5C07E 3KEDA 4FLSA 2I69A 3HE7D 2I24N 2XN9D 4AQ1C 4R83A 3L7FA 2ARJA 3D39B 5C6WH 3EADA 1HHKB 1ITBB 3PNWB 4GKOA 4M00A 4TRPH 3MNDA 5L6YL 4LLWB 5T5FH 4OUUB 2WGXA 1JGDB 2YEQA 4Y19A 1NDGB 4ZTPL 1UD6A 2O6FA 3HKZA 1QBAA 1ZLUK 4CADA 3W81A 3I02B 3UAAA 2XRAH 3BAKA 4XNAA 4F7PA 4JM2A 1JGLH 3QJFB 1HDMB 1VDGA 1UGNA 3DSNB 4QJ4B 8PAZA 3BUPA 5T3XH 2UY7A 4X8JB 1XHHA 2Z31B 5CGTA 5PCYA 2AV1B 4XODA 3L5IA 3LNIA 3SPGA 4RWYH 2PUQT 1KPVA 1JL8A 3QJVB 3D09A 4YPGB 3FRPG 3ZE2B 4MHHI 4IBUA 2VDOL 4GQQA 1SM3L 4MD0A 4Y7OC 2EDHA 5B22A 3U9UA 5DRXA 3RA7L 3ABLB 2EE0A 5EV7A 4BCXA 1ZD6A 3ULVC 4IRJB 5ADOL 3FQTB 3VGDA 3CHPA 4FTVA 1I1CA 2DN7A 4UQAA 4OLVL 1AYRA 4HIEB 4TNEA 5AG9A 4NNYB 3JT0A 2CKBH 5DO8A 5MEND 1HKLH 4JFPB 2ARJQ 2BHYA 4LL4A 1IM3A 2AQ1A 1HXKA 3QZBA 1RK1B 3MLZH 1M6OB 4WIQA 4NQXB 2H9GA 1BBJA 1HESA 4G72B 4IOFC 4F2FA 4H0LC 1CG9B 1RJYB 3GZKA 2DDQH 1LJMA 1UA6L 2A6DB 3DUUB 4RFOL 1OF2A 3GMOA 3LKRA 3BWAB 4W9GC 5FGSA 4OZHB 5KYWB 4PUBL 1IQWL 2FHBA 2BVOB 3K74B 1M1XB 5CZKA 3N1FC 1EUUA 4WEMB 5C6PB 3CXFA 2JB6B 2XICA 1NGPL 5IJVA 3OKLB 1WZLA 1FFNA 4WTQA 5EEWA 1RIHL 3KR3L 1QYGL 3K6SB 5T1MA 4DP8X 4YO0A 4YN3A 3QIUA 4LL1A 1OANA 1SFHA 1YEEH 1X5XA 4XCFH 4F3FA 4IGBB 3CE1A 1UYWH 5MEQB 4X5XA 1PNCA 1R3KA 1QNZL 2WKLA 1P4LA 1T4KB 2EDEA 1UZ6F 1R3IH 3NCYS 1ZLDA 5E9NA 4ENZA 5HYJA 1FRGL 3SOTA 4WI7A 5FHAH 3ETSA 3FTZA 5EN3A 3VWJA 1N59B 2JCWA 2HA1A 5TH2A 1JGUH 4POYA 1VA9A 1NMAL 2YPKA 1OEZW 5DFVC 3MA9H 3BQUB 4JFTA 1QVOA 1JGIA 1AZZC 5DK2B 3HKFA 3NRPA 5KOMC 1KIRB 3ARPA 1W8OA 4FQLH 2VW7A 4FXGB 3GIVA 1PS3A 4GOSA 1F1GA 2GIMA 2E6QA 1KCLA 3MRMA 3BESR 4P49A 5AAPA 1HIMH 4X80L 3DIFA 1XSIA 3GMMB 3S97C 1YPZE 3Q5TA 1T83C 4C83B 5I30H 3AAZB 1G7MA 1NMCC 2ESVB 4X6DE 4JKKA 2ZUTA 4MCYA 1CL7H 1YNTF 2OP4L 5HGDA 1U8MA 4G5ZH 4LOUD 2QZ5A 4M48L 1QSEE 3P0GB 1K4CB 1JGEA 1KGYE 3GXTA 1EV2E 3W5NA 4HULB 3LMJL 4HHWA 5E2TH 3TC9A 2A1WH 4EDXA 3QJHA 1H15A 1YLBB 3PNRB 3QEQD 4HEPG 4QXTB 3ZE0F 5I1DB 3ZZLA 1NC2D 7FABL 1VAHA 4OW6A 3KEHA 1I1FA 4P2QB 4A7GF 4P9HH 4E42B 5AYUH 2AJYL 3MMEA 3IJHA 2C9VA 4PJBB 4U0RB 5CKAA 5L9DH 5I66B 2WLIB 3CFNA 4FZ8H 4KJPD 4U3CA 3QEGL 4A04A 4WY7H 2OW6A 4QY8B 1IT9L 5C6TH 4XWOC 1E9PB 3QXVA 1KYDA 1M56B 2BVQA 5GGSA 3FQXB 1ECYA 4MJIA 2WWOA 4XXDB 2UUDK 1N64H 2HT3D 5KBMA 3MJ8B 3ZDXE 4GXUN 3OJDA 4N22A 4BWWA 4R4ND 3GMNB 5KYYB 1U3JA 4C56B 4PBWD 4ABUA 4PY8I 5CSZA 5IHBA 1D2PA 5C0DB 4YZFF 4B95C 2VITB 2YKKA 5AW7B 3SKUD 1FI8C 1PEZA 2YD7A 1JD9A 4KJYA 4ZQKA 1T7VA 3ZRCC 2KDGA 4M43L 4KK9C 5SWQA 1XH0A 3HG0A 3L9RA 1DQQB 1T5WB 2APTA 4UB0L 1GL4B 3KG5A 4M6MH 4Y2DC 4HF5H 3KL5A 1XZ0B 4HOWA 4D9QD 4LAQL 3FQ1A 1QFUL 2ZG1A 3V7MA 4LFHG 3CXHJ 4HLJA 2CDGB 1RUMH 4AEEA 2ZUYA 3AXIA 4A2HA 2VL5A 1D7CA 1W80A 1Z9SA 5DQJA 5K1JA 4Q9QL 4MASA 3CJJA 4W4OA 1Z9MA 4WO0A 1HZHL 5DI8B 3SZKC 3T77A 3KPNA 1HHJB 3C08H 4OT1H 1HYSC 1KEGL 2X1PA 4PWEA 4HQQL 3NQIA 3A6BH 3UAFA 3ARGD 1DJHA 1HXMB 4S0SD 5DDHA 2DH2A 4F8NA 1G84A 1N0XL 3QUZB 4L8BA 4TUUA 3TIEA 5KW9H 3WFBL 2HT4D 4R0LA 4WK0B 2H6PB 2ENSA 5DWPA 3Q9PA 4L9LC 5GS1B 4LSTL 4A7TA 3G6JE 3SIKA 4RGMB 4MD4B 5JW3H 4OQTL 3C8DA 4QTHB 3SY0B 4NQEB 2X4PB 3N85L 5AVUB 4EUPH 2GCYA 4ZMVA 4PJCB 1FNEA 1HEZA 1CLOH 3QW9A 4JY4B 1IGCL 1RK0B 1RZ7H 1I8KB 4EQ2A 4JJ5B 3A23A 4TULL 3U0WH 5DJYA 3BKYH 4Y5VC 5EOCL 4FNUA 1NCDL 2B4CL 2H1PL 2APVA 3CXDH 2PO6D 3DUSB 4WI0A 4FKKA 5E95B 5DZJA 4PGCA 3ALPA 5DZPA 3Q6FB 2A74B 3VXRE 1LILA 4LDCA 2FEEL 5JHLL 4J5VA 3UPRA 3GMQA 1BCIA 2AXJA 2J6WA 3FC8A 3NZHH 3AADB 3HE6C 2Y7SA 3ZL2A 1ASPA 1HHGA 3ARQA 4ZODA 4TN9A 1LD9A 3DTUB 1MWAL 4OAWA 2BMKB 5ID0A 2X6UA 3QAQA 1GVIA 2UX6A 4U1SA 2P28B 5LN4A 1U8IA 2EE2A 5TE4H 1A1OA 1F4WH 3CFJA 1DL7H 4UU9B 2ENPA 2CPCA 2WBJA 4FLRA 2H2PC 3JV6B 2W9LA 2OMVA 4OKVB 3N5AA 1EO7A 4PVLA 1DBKL 4NM4H 2H3NB 3HG1E 1VGEL 1N12A 2H8PB 2WCPA 5CD5D 5HYSA 5DEJA 1PPIA 4W6XB 4Z0BH 1DJGA 1U2YA 4JFFD 4EUPB 4DK3A 5T33L 4E0RA 4YXKL 1KPRB 4FG6C 5KSBE 1EO8L 1E43A 3RGBA 1I1AB 5J6GB 1IL1B 1MELA 2VSCA 2KT6A 1NJ9B 1AIFB 2FJGA 3BH8A 3VXPB 4AITA 3VFUA 3QUMA 3GBNH 5DUJA 2PW1B 1KJ2H 1JS4A 2OFQA 3TCLB 3TBWB 2DAVA 1QHPA 4ZMOA 3TLRA 5D72H 1E27A 2R4SL 2HT2C 3LN5B 5I74B 3QQDB 3C5JB 4XN7A 4YSTA 3SN6N 5IR1B 1UM4H 3QQ9C 1X9UA 3OKKA 1PJ9A 2DQ6A 1JPFB 4PJ8B 2DQHL 2QBWA 4NENA 4UOJA 2JKLA 3DX9A 4GAYB 3CX5K 5IBTH 4ESKA 1C8QA 3DURB 2KLRA 5C0EB 3IJSA 4IRSB 3VG0H 4O2CA 3RVWC 3N6YA 1NUDA 3RX7A 1NIAA 3ARFD 4LSSH 3VFMB 3O2DH 4HS3A 5LJYH 5I19L 6PCYA 1MJ8L 4R90H 3KNBA 1WA2X 2F54A 2ZXWB 4I3SH 5CJXA 2Z8SA 4KKBC 1HI6B 5E99H 1LNUB 2OSLA 4PJHB 1ZTXH 2KPNA 2VWEE 4IIZA 2EH8H 5ENWB 5EPMA 3ARBB 2QDVA 4MXQC 1JPTL 1FV1A 4KK6D 4R96B 4LNRA 2JMRA 3RNQA 4R6UA 1IVTA 2R2BA 3ELQA 5D5ME 3D69A 2IBZX 1U8OA 4XB8A 4XNZC 5D7KE 2V3FA 4GRWE 1LO5A 2XZAH 2C3VB 4NN5C 1U95A 2PYFA 1LE5A 3T4AB 4IU2B 1F90L 1P7QA 3F12A 5E2JA 1NGXB 3H42L 1YEGH 3CDGA 1OP3K 3MLYH 4GRLB 3U36B 4M62L 1E2ZA 1YPZA 1NCIA 1I7TA 2XN0A 3NDZE 4KVPA 1J8RA 1I4FB 4R3SB 2ZOOA 4JNXA 1YHPA 2VQTA 2MCMA 1ZY9A 3GBML 3H1ZA 1QSEA 3JWNG 3QARA 5I24A 2DYPD 3KWWB 4YDMA 2FSEB 1SBBA 2VQ1A 1V8HA 4ZFZB 4ZJ9A 2FR4A 1XF4A 3IN0A 3PL6D 1TZHB 1DO6A 3MR9B 3IPBA 4GH7B 1BLIA 2FX8L 2Z8RA 3ABGA 1A9EB 2VH5L 1GYCA 1NKGA 1U8QA 1XMWA 2R1XA 1S7TB 2E6JA 1KDJA 1XH3B 2R9HC 5I0YA 4JFXB 2MWCA 5K9KB 2P5WE 2OZ4H 3HAEA 3S96A 1T3FA 2CXGA 2P24A 4YLCA 2TRHA 3O4OB 4PJ9C 3RVXC 3U48A 1U92A 4FHJA 3LPWA 5DMGD 4QHNB 1AP2B 3DARA 2O4EA 1T6WA 4N1EA 1K3ZA 3EH2A 4LHUD 1BZQK 2ZWSA 4PJIB 2ERJB 4NC0B 3ZHFA 1QHQA 1PAMA 1OE3A 5HY9B 4NPYA 2ZAHA 5EIIA 2OI9C 2VAAA 2XI9A 1AH1A 3U1PA 3BPNC 2EEBA 4DP6X 1F6AB 4ZDHA 4J3OG 4NSKB 4AZ8A 1T20A 1KB5A 5C0AA 3LPFA 4RQQA 4AY0A 5FPIA 1XF5B 1OCZB 4G9DA 1KSRA 1V7NL 3NCYP 4MMZC 4UUJB 1I7ZB 1C1EH 2XA3A 4FABL 2OYKA 3QAZC 5DHDA 3DOSB 4J1UB 5HGBB 1IEAB 4KZCA 2NUPB 4MQTB 1EEYB 2IH3A 1YVLA 4HV8B 2XN9A 3IMTA 5FYJL 4J4PD 4HKBB 3VX1A 4KI1A 5BZWA 5IK3A 3T6WA 4XP5H 4EKXA 3CSTA 4LKXB 4Y16D 1QFPA 3GSRB 2EYRA 2VXQL 2I5YL 3OGOE 1IARB 3KL3A 4TUKL 4FZEH 3RIFF 1M6UA 5DS1A 4Q8BA 1IKFH 1WBYA 3FT0A 1MAKA 4X6CF 5TGBB 4WI8A 4GI8A 4X42A 5INCB 3QRFM 4H1LA 4U6HB 1OAQH 4TS6A 1G0YR 3WLWD 1FVCB 4CAGA 2VR9A 4DT2A 3MRCA 1AXTL 4NWTL 4NRYB 1I82A 1EMTH 3IDNA 5E8DH 1CICD 1QBBA 4NOBA 3SDDD 1T2QL 3IEAA 3MRPA 3M1BB 2YGNA 1G94A 1P6WA 4X6BA 3US1A 2ZWYA 1QFWH 2AJXL 2M83A 3PDOA 1QBML 1O6SB 2CG9X 3EZJB 1A7RL 3OHXC 3TBTB 2CRZA 5SX4H 2ITEA 5JORA 1QR1A 5J4MA 5AW5B 3TO4B 3U4EB 1AGBB 2J1ZA 3E2HC 4X98A 3VXRA 1B9KA 2J88L 2Y1ZA 5FKPA 5CEYB 4E9SA 3FJTA 1OGAE 4ZMPA 3U25A 5BNXD 1RFDH 1CXEA 1RPKA 4X8GA 4X9HA 1ORQA 1FH5H 4OIBA 2BSSA 3ESNA 3Q1SL 2VC2B 3MZGB 1SEQL 3W11C 2QADD 3R1GL 5AB2A 5TFSL 1FGVH 1JYNA 4NXKA 2X4RA 3ULAB 2O5XH 3VM5A 2QGBA 2J8UB 3UYRL 2CNZA 2JLLA 3SGDH 1R24A 2B2XL 2QJDA 3AT9A 3FQUB 1MJJA 3CFBA 2MCPL 5KSBA 1JV5B 5DHYA 1UXSA 1AR1C 3BGMA 1RCYA 3F6IA 1Z5HA 2H32A 3D4ZA 4WTZG 3IGLA 4RGNC 3H2QA 3FOMB 1Z3RA 5LBGA 1XD0A 3QO0B 4JM4L 5E8PA 3D3VE 3VU2A 1MCBA 4PTUB 3MLWH 3TJHD 4LDLB 3QFJE 4MJ2A 3CFDA 4KVCH 5EBWA 1KCRL 3QZLA 4LSVL 5I2IB 3DX3A 1U4FA 4YLBA 3UEQA 4PTTA 1T89C 2ITDA 4F33A 1RK7A 5J6HA 5DCCA 3BIKA 4LLQB 4R4BA 1XT5A 5AD0B 2WZ6A 1FDLL 4I3RL 3H7BA 4K94C 5K39B 1RIUH 4CVZB 3KJ4B 4A2MA 4LVNB 4KKNA 5DS8A 1EEZA 3IDMA 2H26B 4K5MA 5A6IA 3O6MH 1LEIA 4S0TD 5I82A 5D7HA 5A16A 3MYZA 4NO5B 2ATPB 3WL9B 3CFKB 2BC4B 4BFEA 3DNKA 4WW2B 1R17A 1AJ7L 4MS8D 1VZIA 2W0KA 4RCAA 3LQMA 3CFTA 3TBBA 5EZLA 3UJJL 1VKXA 4CVWA 3QEQA 4H20L 4GW1B 1ZS2A 4Y2OB 3CBRA 1NC2A 4N85A 5LNDA 1OB1B 4ZQTA 2P8LA 2IO5A 3B2UC 3S2AA 4K3JL 4E9YA 2NW2B 1JUFB 4JRYD 4NIKB 1JXKA 1LYQA 2BDNL 4NNPL 1EXUA 1YO4A 1KLUA 4WWKC 2ZE0A 5DJ8B 2B5IB 4XX5A 5JPMB 1CDJA 4GG6E 4J2QA 5IFHL 3LZPA 4HHAB 3JWOC 1JF1A 2NY3C 1ZANL 3MNVB 3S36H 3BZ4B 3RL2A 3WIHH 1QUNB 1WD9A 2RQEA 1NGZB 2IALB 2XLLA 1QHOA 3PS6A 3SDYL 4Q6IA 5FECA 4NDMB 4FI6A 1JPSH 1AO7E 3L5JA 3PCYA 1A25A 4WV1C 4FRWA 2ZUXA 1OPOA 4XHJC 4XE0A 2Z8VC 3V6BR 3OKEB 1BVLA 1A14L 3BPLB 3A4FA 3LHPL 3NZSA 2GUOA 5A2KH 1MUJA 4QRBA 2YRZA 1HCFX 4BDVA 5CLYA 1NEPA 3CVHA 3F6LA 4MCNA 1G9EA 1UKQA 3IGFA 1V7MH 3QPKA 5JW4N 3NBNA 2XQYA 5DJXA 2E56A 4JG1L 5CP3H 2P5WA 3CN4A 3GXDA 3JBG7 4P8QA 5DQ9A 5I9QB 1MRDL 4BCZA 5ADPL 1ECZA 2GJ6E 2P49B 3ILEA 4U6VH 1E9OA 4M29A 5DZNA 5HHMB 3BAYA 5IB3B 2QQQA 5DC4B 1MCPH 2VDQL 3IVKB 1A64A 1UWGH 4HUVA 3MXWL 1XCTB 1JDDA 3LN4B 5BV7H 1XF3A 3BDBA 2WVUA 1TR7A 1TYRA 3ZXAC 2YMTA 1UACH 3GSQB 3ARGA 4HC1A 4O4YL 1ZLVH 2CJTA 2E7HA 1T22B 3BFOA 1G9NH 2FQDA 4OGAC 4OSUH 5D71L 3T5WA 4RRPM 4Y0GA 3VW3L 3RGVA 2XBDA 3UROR 3NG5A 1R34A 4PLOB 1UA7A 2E6PA 2FVNA 5DD5L 1UATA 2PETA 3IAGC 2CBOA 5IMMB 1D6EB 1MW3A 2YAFA 3J2PA 4UQCA 4Y2NA 1P9MC 4W9HC 43C9A 1BEYH 1KBWA 5D7JD 3CFMA 1DEDA 2EE3A 3F2LA 3FO2B 1KY7A 4KITB 4Y4FA 3FU7B 4X7SH 3SDCA 1U8KA 1HHIB 4HWBH 5FHBL 4GUQA 1UD5A 3GS4A 4M02A 4OIFA 2ZP0T 4EUPG 1F3DJ 2ADFH 4OCSL 1M9SA 2ORBH 3DROB 1WICA 3RWEA 1T1XB 2OZNA 4RZKA 3KPQA 4N3TA 2V2TB 1KOAA 3WLBB 2MOGA 4ELMB 5BVJA 4G9FD 2COVD 3TZVB 1CDBA 3QK0A 2X4NB 4S10A 2XIIA 5IHUH 1OAKH 2VDRL 1U8NA 3EZ8A 1YZZA 2R39A 4KJQD 2DLIA 4XPAH 1CYWA 3VFSA 1NCOA 4XPFL 3QXUA 4CVXA 3UZEC 2LFEA 3BUTA 4ECNA 2QHRL 4ZSOE 5IIEA 3WHE0 3LV3B 2OCJA 4KV5E 2O1AA 3O45B 4UTAL 4KRPC 2FWUA 1BM3H 4TSBH 3UO8B 1MOEA 2ATKB 5C0IB 3V2AR 4JKNA 3VI4F 1CDIA 1KWKA 1K5WA 2R15A 1BQLH 1UB5A 4NT6B 1KCBA 4L3ED 4MJ4A 5B8CA 2SODB 2VL4A 1FFRA 1UT9A 3P9MB 3IS1X 4KRLB 4MB3A 4W9IC 5E6IC 5I1AA 1M3IA 1OGAA 4F37F 2HKFH 1Q0XL 2VLMD 4RFNC 3SE4C 2O61B 3V52H 3E1ZA 4FMKA 4UMSA 1FCCA 2DQEL 4EI5A 5KBNC 2PWDA 5GZNC 2DQMA 2ICES 3I6GA 3OAUL 2YBRB 3PQYD 4I77L 4KKAD 4P5TD 1BQSA 2A6IA 1TSRA 3ZDZE 4AEHH 2FATH 3GYRA 5E9DB 5DURB 3GMRB 4ES8A 5D2LE 2C1PA 5D7LB 3HR5A 3U2JA 2VN3A 3WG7B 1KYOK 8CGTA 5GZOD 2DWXA 4B0MB 3IDGB 5E2WH 1TUPA 1C5CH 2DQUH 5ANMB 2UX7A 2OSYA 1P7KA 3MJ6A 3UBXI 1GMEA 2WVTA 2Q86A 3G5XA 3L9EA 4ZO8A 3SGEI 4ALAC 5C0JB 1BXAA 3QXDB 3W0WE 1BZ7B 1RZKL 1U6AL 1L6PA 1U8HB 4FMFA 4PCYA 5BCAA 4NCC2 3ZKMD 5FA3A 3ZYZA 4JY6A 1U58A 2YPVA 4JDEA 3BW9B 1IAKA 4JPVL 4PBXA 3N1GC 2L7QA 1A2YA 2W1NA 3WUWG 1ZLEA 4HMDA 2VKXA 4V1DE 5SWSB 4FFZL 3SGJC 4I9WE 4NBYB 3MCKB 3U6RB 4YSAA 2ZOKA 3LKSA 2I25N 2Y7QA 1MCOL 4HOXA 2WQAA 5BQ7A 1KFAL 1P4BH 3O11A 4YQXL 2BRRL 3CFQA 1T2XA 1KIUA 1QASA 3RUGE 1SYSB 4U4BA 2EUWA 4XP6L 3GJFH 3U2SA 5A1AA 2PTTA 2DWDB 3NPSC 2DYPA 4YWGL 1L0QA 3SO3B 1OCRB 3HMWL 1BGXH 3QEUA 1GGUA 4D9LL 2YLKA 2DJMA 2YXWA 1KDIA 2AITA 3PL6A 2XTJE 2C4XA 4LCCC 1DVFC 4U05A 3KLSA 3MRFB 1RURH 3MV9B 2JXMA 1ET7A 5E4EB 4LCWE 5I8OL 4QWWC 1HEHC 2AP2A 1RU9L 2IAAC 3IFPB 3HOGA 2CR0A 4M5TA 3VFWB 2NZ9D 1M7DB 1OGTB 4CMMB 2BSRB 2BWQA 1MFDL 1SVBA 4OZIB 4GG6A 5DC2A 1LWJA 1XGYL 1U3ZA 1NZRA 2CDEA 2E47A 3O3AA 3F83A 5D1QC 1K8IA 4FQHA 4JQVA 3WIIH 1M4KA 1Z9LA 1UENA 2J7LA 3MLUL 3VRIB 4LBEB 3GLAA 4JQXC 3U4BH 5C1MB 4IMLB 3CU1A 1UOVA 4LHUA 2XBTA 5L88L 1J5DA 3HRPA 1AO7A 3UH8A 3GJFB 1H3UA 1N4XL 1PG7L 2Z0BA 4RAUA 4RDBA 3H9HB 1JHLL 3MAWA 2N7AA 1HQRA 4P5KA 4UBDC 1S8DA 1ROCA 3LEYH 3KBFA 4FQ2L 1FIGH 2HLEB 2WUCL 4R7NA 5BVPL 4MQSB 4NFBA 3QO1A 1EJFA 5BS0B 1IAIL 1Q72H 4DKEL 3WTXA 1DEEA 1NBCA 2BNRD 3E3QE 4PAZA 2E75C 1I8MA 4WJ5B 4P99A 3VH8A 1ORSA 2EQDA 1DBJH 5K9QG 2GJ6A 1YC7A 5AZ2L 3LQAH 3BH9A 1AGFA 3UDWA 1L4IA 5AVSB 1UM6L 1NGYB 4Z7NE 5KVGL 1DQML 1YYMH 2W0LA 3E7JA 4KQ4L 4EVNB 3EXLA 3D06A 1CFNA 1S7RA 3IBEA 4KVNL 4X4ME 3JSSA 3BP7B 5CXPA 3NN8A 1JXGA 3SBRA 4WDIB 1OAUL 4N26A 3LH2L 2D2OA 4NQCB 2G0LA 4ENED 3NSFA 5DD1H 4YAQA 5T1DL 5K59E 4YXHL 1A7NH 3L81A 2AV7B 4HUNB 5IQLA 1J0ZA 3HTLX 2E4TA 3MRJB 2X38A 1G7PA 1H3PL 1NANH 4JE4B 1MCFA 4Q4IA 2OMUA 2BY3A 3OR7B 2NY6C 3RWFB 4LMQE 3SDDA 3OPZH 4XC3L 3L13A 3ZK0A 3VD4A 3RPIA 3ZRFC 3M88A 3I9PA 4MNQD 5KN5B 1YMMB 1NCBL 1ETB1 3PHOB 2WZ5A 5DA4A 1EGJH 2I7SA 1RVFH 1NWOA 3GK8L 3NCFB 4DO6A 2XWCA 4YHMH 3DMMC 5D96C 4QHKJ 4XOAA 2K6YA 3X17A 1IV8A 1QD0A 4OGXH 4FQXC 3RWDA 4I1RA 4JZOB 4G7VL 3FU8A 3O8XD 4M7JL 3TXAA 4YHIB 1FL5B 2VMJA 1YAIA 1DBBL 5TK4A 1MFNA 2AXFA 3VWKB 1QWNA 5IT2H 4GBXD 3GF8A 1B3IA 1BPLB 3ZUNC 3GJEB 3BVXA 5DZOA 1LO0L 2V0AA 1FE8H 4AGMA 5TE6H 3TYFB 3WKPA 1V55B 3EOTH 1YEFH 4AMKL 5FO9A 3C6SA 4I5BB 2DL2A 4ZSOA 1CBJA 4LP5A 2JCCE 1AY1L 5DZVA 5ALBH 2IDQA 4WQOA 5E8OB 1IM9D 3QCTH 4HMCA 2YPLB 1W0VA 5EZIH 4WNJA 3ROOB 1AFVL 2AEPL 2CHXA 4K7FA 3WN6A 3NA9H 1WPCA 2ZX5A 3CBKB 3ARED 3HPJA 5LQBL 2PPAA 4NZ8A 1CZ8H 5ITFB 2ZUWA 1OK0A 4Y5YA 1W0WA 3HZKA 2EDXA 1YEKL 5IWLC 2G9HB 1OD9A 3FKUS 1KJ3L 2D7TH 4NQSB 4PRPD 4HK0B 4IOIB 5F8RC 3FT2B 3E6FB 3HC3H 4JAMA 2CUIA 5C0BD 1MVUA 5FX3A 2VISB 4PR5A 5FV1L 1BZ8A 3PGCA 3NFNB 4LPUA 2PW2A 5D2LA 3EGXB 1J0IA 1QP1A 3B9AA 4HGWA 4WUKH 5TDNA 2LABA 3IDIB 2WC7A 3IU3A 4LEOB 1KT2B 1F6LL 4R4FL 3FB6A 5EUKA 2FX7H 2X2HA 4OGYL 4R8WL 1Q9OB 4DN3L 1GYVA 1UWXK 5CZXD 4L9DA 2OTWB 2BS71 4P5SA 2RTTA 3QUYB 3TPKA 4NZUL 4UANA 1S7SB 4JX0A 1KEML 2FBJH 4JPIA 4AT6B 4B41A 4ODXA 3DOHA 4PLKD 5KJRH 1INDL 1SF3A 1F56A 3SJVE 4X0NA 5EBMB 1TQSA 3VFTA 5FEBA 1P5UC 2OCCB 3QI9A 3BEWB 3LZNA 2QKIA 2QVIA 3HN8A 3MRQA 3P0YH 4RDQF 4AJVA 4EN3D 1H5BC 4Z7AA 4UTBA 1MCKA 3K8KA 4FLQA 4TNVF 4LF3B 1P7HL 1MEXL 2Z93B 3LKNB 4HEME 4XI5D 2XZZA 5GSRA 3FF8A 1M3JA 1MIEH 1SF5A 4WHDA 4JRYA 3K8LA 4BQ6A 4WK4B 2V2XA 4JFYA 2MQ0A 3W57A 5CBEA 3L7EA 3VE0A 1U2CA 4P23A 2HG5B 1UB6A 1HTYA 1DANU 3QIBC 2QMKA 4K7PH 3DX8B 3P4NA 1D5IL 2XWTA 4F57H 1T0MB 2X12A 2YXMA 2R29H 3KPSE 1UASA 1X5JA 1IGYA 3ISYA 2GTZA 2XVLA 2J1KA 1TZGL 5CILL 5FAAA 4WWID 4XPHL 2NY2C 3SCMA 3ARRA 1AKJB 3TEUA 5EU6E 5L6YH 2AK1H 5HHOE 5FCUL 1R47A 2H7WA 4KMLB 3FQNB 5BQDA 4LCWA 1NL0L 4IDJH 1DTUA 4HKZA 4LSPL 1EDYA 1SN0A 2DQTL 2J55A 3NCEB 1YDPB 5KYUB 1KXVA 3C6LA 4N0CD 5FF6A 9CGTA 4ZMWA 2F5BL 2HRPL 4MMXB 4FJ6A 4M8QB 4Y9BA 2EVHA 1I9IL 5FLVA 1IBYA 3IDXL 1R5IB 3TPUA 3VI3B 1I9JL 4WKZB 3BUYB 3K2MC 2QSCH 1ZVHA 2LW3A 3V5HB 4KHXL 4F2MA 2VDOH 3EYOB 5AZEH 2HVKA 2EXTA 2V3EA 3MU3A 3UABA 5DZ9A 3LD8C 5GRXG 2D4FA 3C8KA 3K5SA 2VSDA 4GNKB 4WI3A 4AQAA 4N24A 2P47B 2AF2A 4W9ZA 1CGVA 1UADC 3Q1EA 2R1YB 3GI8L 5IEKA 3FUJA 4PQXA 3PWLA 5KTEL 1JI1A 2B1AH 1QBLL 2W0PA 3UP6A 5EA0L 1BVNT 1N19A 3LXUX 4UDTB 5F6HI 2BVUA 2OK0H 1JSYA 3LY6A 5HI3C 1KPUA 3EHBB 4PRBA 4AG4H 1ZT7A 3EOBB 5T3ZD 1TITA 5DYOB 1JYXA 2NPLX 4RFOH 2ED6A 4Z3HA 2GSIA 2BIQA 3NCJH 5DT1L 5IFAL 5CN3A 2NXYD 4PUBH 1IQWH 3QNFA 2Q6WB 5D7JA 3RPKA 3UBFA 5F7UA 5JTWA 3BUDA 1BLNB 4X4MA 3D2UA 4PS8A 3GNMH 1NGPH 1K5NB 5EO9B 4OLXL 3RILA 3WELA 4QHUA 1TVBA 2VAJA 2QGDA 1I7UB 3DIVA 3KR3H 1QYGH 1HH6B 4RISL 4X5RA 2LU4A 3OLEA 5KS9E 2ZOLA 4RA3A 1RD6A 5DYFA 1MCQA 3X14B 2BSBA 3IK2A 2X3AA 4KMTL 2JIXA 2XG5A 2GHZA 2UXGA 1JRHL 3EYVB 1FRGH 4JRXD 1S9KC 4F5CE 4UT7H 2HP4A 5C0GB 1GAFL 3T1FB 1XR8B 3FONB 2FT6A 3HRZC 2G4GA 1TTCA 3S35L 5DFWH 1WTGT 4JG0H 3B2VH 3EJZC 3GBLA 4DGVL 1NMAH 1A4CA 2ARWA 3UPCA 1GHFL 4J23A 4HOMA 1F1DA 2NLJA 1RHHB 3IB4A 2NYZA 3DI3B 4XO4A 1X4YA 5I17B 1SLVA 1BSIA 5FYLD 5EF1A 5JW4R 1IEHA 4OLUL 4JFOA 4W1TA 2LTQC 1B88A 2IH8A 1S9XB 5C3TA 3R06B 3K8MA 4C54A 3EGSA 3JVGC 5DK0B 4AMXA 3BGFC 1QRNB 2XIBA 1OARH 4E5XB 2ICWB 4NKMB 2YD1A 3ULUE 3GHPA 2I07B 2OMWA 4X50A 1ZLVK 1ZPLA 3EYFB 4ZNCD 1G7JA 3UTZA 1IE4A 1ZJAA 4PWHA 4ZOBA 2IAMD 5F1NB 3UCRA 1Z0NA 3HG5A 1EZVX 3QG7L 3RVTC 5DVKA 3PJSB 3K91A 2B15A 4DQOL 3ZW3A 4P4KB 2QV2A 4G2AA 1KTLA 1JOIA 2V7NA 2E0PA 3WS6C 4M61A 1P1ZB 1YUHA 2K1MA 4PI0A 2BXZA 3S9DB 2VMCA 3PQYA 3ZTNH 4QF1A 1BWMA 5ERWA 7FABH 1TZ8A 3L7FB 2ARJB 4GAGL 1MREL 1MPAL 2DH3A 4NJAH 5I75B 1WWWX 4Y19B 1ZT1A 2D3JA 1ZS8A 5E2UL 2WOYA 3P30L 1S78D 1KLGA 1V05A 3QEGH 4UQ9A 4CADB 3WO4B 4W70A 1IT9H 1QSZA 1XCWA 2NY4D 4Y7MA 3ML8A 3KGTA 4F7PB 4HKXA 3RAJL 1OP5H 4AJ0A 1QZNA 3MODL 5CFAA 3ULVF 3MBED 2HMIC 1HNFA 1SFDA 4QT5A 2DMHA 1E8ZA 3EDEA 2F53D 1EBAA 5D5MF 3EO9H 3HZVA 2FJSA 1E2WA 5ITBL 1KPVB 2YA1A 2R4RL 2OMZA 4XC1H 3N40P 3U9UB 5DRXB 4AYMC 1L0XA 3MBXL 1NAML 3JUZA 4XMKL 4R2GD 1ZV5A 1D5XA 3DVGA 5LDUA 4UB0H 1BZ9A 2G2NA 2KYIA 4YEFA 5KBLA 3DX6A 4Z7VE 3NJLA 1XBRA 4AGOA 5FYKU 4BK5A 5C0RH 3SJVA 1QFUH 4JPQA 5E2VH 3RFZB 3K80A 4YUEL 1FA4A 1JZ5A 1IM3B 4LOEA 3MUUA 1XEDA 5DVMA 3GSXA 1KXTA 2H9GB 2W9EL 3UZQB 4ONHA 2NQ3A 4CVUA 4WNSA 3B9EA 5EN2B 1HZHH 1OF2B 1TJHH 3LKRB 2G60L 4E68A 2QQNL 5TK2A 3S0PA 3LZFL 3WJLC 4LLUA 1RUKH 3EUDA 4NXSA 1JNLL 4LKCB 5A3ID 1WFTA 1N0XH 4AK1A 5IJVB 1HILB 3AQZA 3PJNA 1IJ9A 1FFNB 3G6AA 3JWNC 2HLFC 2HN7A 1S9WA 2VABA 3S5ZA 5I0DA 3JZ7A 2J72A 2OBGA 4YO0B 1CJYA 3FB8B 4I2XA 4CRPA 4F3FB 1N3NA 2EKJA 2MIZA 5IEHA 2JQMA 3GSUA 5CJQL 5I8KL 4X5XB 1R3KB 1NBYB 1P4LB 2ZXCA 4OQTH 3VI4A 5HYJB 2ROXA 3NJHA 3DPBA 5E08L 1G6RA 3N85H 4HMEA 4I0PA 1S4IA 2FYYA 4NJ9H 4EI6A 2YXVA 3ARDA 5EU6A 1RJLA 1IGCH 2V9QA 5HHOA 3CAFA 4URTB 3VTTA 3DO4A 3Q9QA 4TULH 5TH2B 4DVBA 1Y18A 5EOCH 2ODIA 2H1PH 1B4TA 3NCBB 4AIOA 1A7OH 1FFTB 2OULB 4GAFB 5IQ9A 3HMXA 3Q5YA 2IH1B 5LCVL 2R2EA 5E8NA 3BSZA 1PX3A 4LB8A 3GIVB 5JIQA 1MQKH 1JZGA 2I26N 3KYMA 4WHCA 3MRMB 1A21A 4NUPA 1JZ7A 4QRRE 5EBLA 3QCUL 5A2FA 1MWAH 2LQRA 4G3YH 5F7DA 3PU7A 3DIFB 4XBMA 3WDIA 1R6VA 2Y1AA 5I15H 1Y7VA 5CZVL 3L5HA 4J3OC 1LXMA 2X41A 4MCYB 3PLYA 1JCVA 1U8MB 4HFWA 3L54A 4B60A 4ZNEE 5ISZE 4OFKA 1DBKH 3NP3A 1TSHA 4NKIL 1VGEH 3FTGA 1IC1A 3KM1A 4EDXB 2VR8A 3KPRE 1H15B 4YXKH 1NDMB 2VLKE 1DN0B 1EO8H 2Z31C 3ULVD 1HZLA 2BIOA 3BLPX 3POHA 3MLTA 2EZ0C 1R3JB 1BIIA 2X0VA 3PAYA 3QDME 2EDBA 4LBAA 3MMEB 4N2OA 3IJHB 3QS2A 2NX5E 1BJ1H 1AYOA 4QXGL 4BUGA 5E1AA 4IRJC 3GI9L 4MNQA 5T1KD 4K5PA 3B7TA 4B97A 3SHSA 2KQMA 4PB9L 1WHOA 3CN0A 1RZJL 1KGCE 2QT6A 4IOFD 3WI9A 1LO3H 2OMTB 3OBAA 4HYTB 1D5RA 3Q05A 5FUZL 4Z7IA 2AQ3A 5K5YA 2BVQB 5GGSB 4MJIB 3Q8BA 3UC0H 5JPNA 2BNQD 2E9IA 2ZUVA 3K4AA 3KPPA 1HU8A 3JXAA 1KXQE 1E6JL 3BUBA 3FN9A 3O8XA 3VRJA 1DE4B 3MCG1 3LZOA 2VR3A 1U41A 5D9SA 1RUPH 3VGGA 1W72L 4CBZA 1GZQA 2DIAA 2FEDC 1JZ3A 4I48A 4NKQB 4F5CA 4XBEH 4F93B 5EO0A 1THCA 3RG1C 3QDJB 4UYQA 1BA9A 4KJYB 5I1HL 4ZQKB 2P80D 2DTML 5SWQB 4Q0XL 2UZIH 2J8HA 3L9RB 2CHNA 1YY9C 4MRBA 1WFJA 1G6RL 1QFOA 3FHEA 4HCFA 2CALA 3DRQA 4NUGL 2DQGL 4KH2A 1DVTA 1I8AA 1OT2A 3R4DA 1D7DA 4IGBC 1IM9A 3N3EA 1XV8A 3BO8A 4TNWK 5HDBE 1FVEA 1ZTMA 5SWZE 2VL5B 4Z8FL 2MEJB 3NIGB 3KCPB 2N7SA 1DFXA 1FFOA 3NIFE 5DQJB 5EOQL 2F74A 4KKCC 5IB4A 1WK0A 1DDHA 4EZMA 4M62H 2K4WA 3KPNB 4LPVA 3S5YA 4C8XA 5EEVA 4W9CC 3AREA 3AROA 2DRUA 3B5GA 2QPEB 3R18A 3KLAB 3BQUC 2Y72A 1NCAL 1FC1A 3G04B 3GBMH 3RU8H 4L3CA 2W07A 3BOVA 3VX0A 4JFHE 2WHVA 3M8OH 4YE4H 5LGYA 4R0LB 3V4PB 3L1OL 4F7CB 4FXGC 5C07B 5C0BA 1P84K 1PFCA 2P8MA 3N2JA 4MB5A 3GRWL 3TO2A 3VCLA 3DV6A 4LNVA 4HUWA 3IWVA 4M6NL 4ABVA 2VH5H 2O5YL 5DTFA 1TQWA 3AY2A 1ACXA 4H0GA 4KDWA 2GCYB 5EZPA 1FNEB 1HEZB 1MVYA 1EXGA 5KZCB 4QAWA 4WI5A 1MCJA 1VJSA 3ATBA 3ZE1F 5DJYB 2VQUA 3QR1A 2FYVA 4BK4A 1F45A 4DZBA 2C9XA 2XHNA 4LK4A 5CMAA 4N0FA 2CJUH 3V9FA 3OXRA 3QQ4A 4PGCB 1IFGA 2PP9A 5INDA 4YHNB 4TSCL 3UPRB 4TVPD 2A3TA 2AQSA 3VQMA 3AABA 4XMPH 4A2EA 2D0GA 2BJML 4XWOD 1HHGB 3UFIA 1LD9B 4U0RC 4QYAA 2LLGA 1OQXA 5I0XA 5GS0C 3VA2C 4ZO6A 1U8IB 1CBVL 4UYPA 1A1OB 5CLXA 1B6DA 1PZCA 3IFOA 5J3HC 3ROLA 4XNMA 1EZUA 4ILDA 5I76B 3PWUA 2YOCA 3TV8A 4FABH 1F5WA 4QRUB 3ZVVA 3PV6B 1P7BA 1RMFL 1CO1A 2JE8A 4CJ1A 4LHQB 3NSDA 4ABWA 2FJGB 4KK9D 4P2RD 4Z7WE 3VFUB 1HL5A 3HI5L 3QUMB 4Y2DD 2ZUQB 2E27L 5SX5H 2Y7LA 1NLDL 1YEWA 2I5YH 2MHAA 3GFUA 3UC2A 3R0MA 4BFIA 3O6FA 1KV3A 1G7LB 2CPUA 4OFVA 5IBUB 3QZWA 4KFZC 2PWHA 1NOFA 2AQTA 3II1A 4P9HC 3CPUA 3OKKB 3OX8A 1YRKA 2OW7A 4HK3N 4LU5L 4NENB 4AIZA 1J8HE 3DX9B 4L4TD 1TO5A 2HTLC 4N8VA 1OY3B 4PS4H 4CILA 1HYSD 1AXTH 1ANUA 3LNFA 4NWTH 5IREA 3IJSB 3REWB 3VNZA 4XMTA 1CFTB 1EHNA 4MA3A 1LWRA 1NCCL 2Z34A 2F54B 3KNBB 5DFTA 5DVOA 1D5BB 2AJXH 3V4UL 5F7MC 2EDDA 2V5RA 2N0KA 5EPMB 1A7RH 1I75A 5ACMA 3QUZC 1FV1B 3GQFA 4ANXA 4UQ2A 3RNQB 4LNRB 2UYLA 4G6KL 2WP3T 1MNUL 2R2BB 2FLRT 3SE3C 5I6OA 1JXDA 3WS3B 4OF7A 3OKNA 5GS1C 4HFUL 3TESA 3D69B 5DHVB 1F4HA 1KN4L 4RGMC 4XMLL 4CC4C 3UTPE 3LN9A 3HAEH 1U95B 1WFOA 2PYFB 15C8L 2A0LC 3AS0A 1P7QB 2Z4TA 4JKMA 4KUZL 4YL9A 3NCXA 3CDGB 2MNWA 3WSQL 1QKZL 1YPZB 1KZYA 3Q1SH 1I7TB 3HBQA 4H0HB 3P77A 2IANE 2SEBA 1SEQH 4X6DB 3R1GH 4W81A 5J9PB 1AS8A 5TFSH 2ZCHL 3HE6D 1K6QL 5T5NF 3QG6A 1ACCA 2CLVA 5ISZA 1DJYA 1QSEB 1A8JH 4DP4X 1ZSHA 2X9YA 2VQ1B 5BRZE 2B2XH 2A74C 2FR4B 3QUXA 5I1LB 1SJMA 1XF4B 3TEWA 2BHUA 2VLKA 4E5XG 2H2PD 1PIGA 2FJHA 2BVTA 4ONGH 5SV3A 3QDMA 2APWA 3F7PC 4EOWH 5KG9A 1BPVA 1U8QB 4FG6D 5CJ8A 2R1XB 4P46B 1JXFA 3KYAA 3CX5J 1AMYA 3FHQA 4IJTA 3S3JA 3SPVA 1KLFA 3LJ3A 4LSVH 1PGRB 4KXBA 3ZKXB 2P8PB 2D0HA 4UAHA 3HAEB 3S96B 1DQJA 1T3FB 3WJJC 2VW4A 4P3CL 4DTGL 5HHPA 4S1RH 3EFDL 4NAJA 2AC0A 1U92B 1I1AC 1ZE3H 3ZDXB 4OI8A 2NY5L 1DANT 1FDLH 4I3RH 4NUMA 2FO1A 4LP4A 4H1LH 3EFFA 3F7QA 3QQ9D 4CDGC 4NPYB 1DQKA 1I85C 5EIIB 2VAAB 4J39A 2Y3AA 1PYWA 2X6AA 2IAMA 1BFOB 3QZMA 4K8RH 5I74C 1T20B 4AZ8B 4MVBC 1FZJA 4U4IA 3RVWD 1KB5B 4P5MA 4UT9A 3RVUC 2W88A 3BP5A 4QO1B 2J4WL 2YD5A 4RQQB 4M5SA 1AJ7H 3ZDYF 3EBGA 4NBZB 4KROB 4PJ8C 3RURA 3WTYA 5LAXB 4KKBD 4WFFE 2ZOUA 3G6DH 4H20H 4FP8L 1A3QA 3ZOAA 2IH3B 1ZIBA 4IRSC 2XN9B 2XV3A 3KAAA 1A3LL 5ICZB 1DJWA 4MXQD 3AMLA 1Y07A 1OGPA 3EDFA 5EOTA 5BZWB 5IK3B 1VZHA 3KBPA 3HUJE 5SWZA 4HSAC 2IPKB 1YQVL 3IJ8A 1A6UL 3BHBA 3PYCA 4X7DC 4XO5A 4JM0A 1NIEA 1TVDA 3HBZA 1GGYA 3ARBC 5IFHH 4OJFL 1ZA6A 1ZSDA 2GJRA 1COBA 1ZANH 2MKLC 3LXCA 3RKDC 4ZTEA 3GO1L 3BVNA 4ZK8A 4MDIA 5TJWK 3T1WA 4E9WA 5MEPA 1CK0H 4XH2A 4YOKA 4JDZA 3MRCB 3SDYH 1WFIA 4PJFF 5FR3A 2Z4QA 3BD3A 3H7LA 4IKKA 3KHOA 3T4AC 3G6JB 3B7YA 3QDGD 4RMTA 25C8L 4X6BB 4L0YA 4GRLC 1R0AL 1A14H 1Z3GL 2CBPA 4MNGE 1ROWA 1LP9E 3QJSB 3FFOA 5F7LB 3PDOB 3QZNA 2H32H 2QLYA 4OZHE 4KXZI 3T2PA 1J05A 4D94A 5T3XE 1QQDA 2HLAA 4JG1H 5L2JA 3ETTA 2VN4A 5JORB 4O5LL 5ADPH 2R9HD 5F1KC 3MACL 4X98B 3NTCH 3VXRB 4NOFA 5FKPB 4BSWA 2IXQB 2CO6A 4KKLC 4YPJA