3GZPA

Human sod1 g93a metal-free variant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDAVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Structural and biophysical properties of metal-free pathogenic SOD1 mutants A4V and G93A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3gzpA00
1OAJA 1SPDA 2AEOA 3F7LA 4A7TA 3HFFA 4FF9A 4OJAA 4BCYA 1BA9A 1N19A 4B3EA 1SXBA 1N18A 1Z9PA 1E9PB 2WYTA 1AZVA 3QQDA 4U4IA 3ECUA 1DO5A 1SDYA 1TO5A 4BD4A 1XTMA 3RE0A 1KMGA 2VR8A 1JCVA 1YAZA 2VR7A 4BCZA 2JCWA 3HOGA 4N3UA 1ESOA 3T5WA 4A7GA 3GZPA 1IBDA 2GBTA 1B4TA 4A7UA 2WYZA 3K91A 1PU0A 2XJLA 1IB5A 3ECVA 2AQRA 1E9OB 1MFMA 2C9UA 1OALA 1XSOA 2Z7YA 2XJKA 1HL5A 3CQQA 1JK9B 2WKOA 3MNDA 1PTZA 1SXZA 2WKOF 1OZUA 3KH3A 1L3NA 4MCMA 1SXSA 1CB4A 3SODB 3MKGA 2WWNA 3KBEA 1F1GA 2E46A 1UXLA 2C9VA 3KH4A 1IBBA 3H2PA 2AQQA 1PZSA 3KBFA 1Q0EA 1EQWA 2E47A 1E9PA 2GBUA 1IBHA 3GTVA 2NNXA 1FUNA 1F1DA 3HW7A 1TO4A 3QQDB 1S4IA 4N3TA 3GZQA 1COBA 2ZOWA 1U3NA 4A7SA 2Z7ZA 2V0AA 1E9QB 1QUPA 2K4WA 3CE1A 2AQPA 1Z9NA 5CU9A 5KBKA 2WZ0A 1OZTG 2WZ6A 3S0PA 1SRDA 2ZKWA 3CQPA 1F1AA 3GTTA 2Z7UA 2VR6A 1OEZW 3GZOA 1IBFA 4MCNA 4A7VA 2Z7WA 1SXNA 2ZKYA 1JK9A 3PU7A 5KBLA 1SXCA 2AQTA 1YSOA 3ECWA 5KBMA 1P1VA 3F7KA 2R27A 1B4LA 2AF2A 4A7QA 3L9YA 1SXAA 1EJ8A 1RK7A 2JLPA 1F18A 2WZ5A 2ZKXA 3KM2A 1HL4A 2AQSA 2LU5A 2SODB 1SDAB 2APSA 1CBJA 2Q2LA 2AQNA 1E9OA 1UXMA 1XTLA 4L05A 1E9QA 4OH2A 1BZOA 1YAIA 1DSWA 2WWOA 3KM1A 1SOSA 3L9EA 3H2QA 3LTVA 2C9SA 3GQFA 4A7GF 2GBVA
chains in the Genus database with same CATH superfamily
1E65A 3V10A 3X1FA 4M43L 1WTLA 3RPIA 3BD3A 5AOLA 2DQCL 2KZBA 3BKCH 4GSDH 3BGMB 1S7QA 3UIZA 5ICZA 2MH4A 4NGHH 3JWNE 3T0DA 1CE6A 4MA3A 4JFDA 4FG2A 3ZE0F 4IGBA 3QJUB 1HIMH 4MMXA 4NHCH 2MQCA 4BRVA 4FQCL 1S9VB 2YUXA 4F7TA 4UCFA 2EYSB 3ZTCC 3ULVC 3C60D 4L0YA 1JV2B 3DVNA 1IC7H 2XIIA 4L37A 4NJ9L 4F33B 5ABZA 1A6WL 4MD5A 3C5ZC 2ENJA 4I9XA 1BJ8A 1MCPH 1ZXQA 4A7UA 3DHJA 3V0JA 2WYZA 5GRXG 5KSBB 4HCIA 1WS7A 4M61A 1QACA 4OUOA 4EN3B 2C9UA 3T6VA 3DJ9A 5LQBL 2ATAA 1CJYA 3MRLA 3TBCA 5AZEL 5CFAA 1YJDC 3NH7L 4JRLA 2XPGB 2FJUB 4HJIA 2HG5B 3MRBB 2VDLH 1P5UA 2D7NA 5DUBA 4D9QE 3B2DC 4I3SL 2VAAA 1JGVL 2E46A 1NIFA 4Y1TA 4Y9CA 2XXMB 3JV6A 4M8VA 1FG2A 1BF8A 3VQ2C 5CZXD 2OSLB 2CKBL 4Z8FH 1I8UA 4XB7A 2P48B 3F84A 1MVYA 2UUDH 4UM9B 2VH5L 4MAYA 3U0WL 1B0IA 1UJ3B 1V7NL 2FGWL 2IDSA 2Z91A 1XR9A 3OGCB 4IOIB 4KI5C 1DVFA 2MTPA 3VSTA 3AREB 1NFDB 3TBSB 1ZV2A 2V0AA 1HDMA 5E5UB 4KPHH 4HSQA 1I8KB 2MNJB 1WGOA 3VXUD 1T04B 4E9WA 3MREB 3P9LB 1V3LA 4GP5B 3VRIB 3WELA 1A7OH 2CIKB 1I8MB 3OSVA 4HIXH 3UC2A 3HNSH 1KCUH 2BWQA 4PJCE 1BXVA 1IBFA 2EO1A 4YHKH 2RGSA 3AUVA 2G3ZA 2X1XR 1FBIH 2VR3A 2IH9A 2E6PA 3VFWB 4PJ5A 5I73C 5GGSY 1K4CB 1RI8A 1TDQA 1G1OA 1AO7D 1OP4A 4XN4A 4RETB 4IDLA 2DD8H 1U8HA 4LRIA 5HYSG 1HH6B 4ZAKA 4M1GL 1MXDA 3KGTA 1ZVNA 4KHTL 2R0LL 3HFML 3NK4A 1BHGA 3HZVB 1TEGA 2DQTH 2W65B 3D0LB 3EOAB 5HSFA 1CPUA 3IXAA 4PREB 5I75B 2WWOA 4U6HA 5CUSL 2XX1A 4CU6A 5KN5B 3TNNA 2KMWA 3B8SA 1QBBA 2YWZA 2EXYD 2JB5H 1IC4L 5CS7A 2G0LA 1UD2A 3CFKB 1C7SA 1Z32X 2ITEA 3F7LA 4PJ9B 4X5QA 5D7IF 1VFBB 4NJAL 1XF5A 4PGCB 2L0DA 5C1MB 2JSFA 3TFKD 3QJZA 4MJ6A 3E9TA 2XHNA 2Q86B 1KB5A 4IKNA 2VM9A 2NY3D 1P9MC 2CRYA 2HLFD 2HUEA 4NPYA 1G0XA 5E9NA 2JKIS 2Y0SA 3D4ZA 4UQCA 3WE6B 4QHUB 2BZCA 1CQYA 2EDRA 4FZEH 4FFWC 1KGWA 2OA9A 3MNVA 2JCWA 3GHEL 3GLEA 4MYWB 3VXTB 2BWIA 15C8L 1A9BA 1F2QA 1UM4H 2GJJA 3INUH 3AU1B 1V27A 2H3KA 4LLMB 5HVHB 1HS6A 3VYNA 5EZPA 2V3EA 4FXGA 2VMJA 1ZLEA 2PWGA 3EGDB 5EO9B 4KKRA 4JMXA 1M9WA 4I89A 2K70A 1AS6A 3C60A 5GGQL 2E75C 5CJQH 4XMTA 3H53A 3U6XA 5DYOB 4G8FB 3RGHA 4UV4H 5IP4A 4NWUH 1UXLA 4LCYB 5L8LB 4KVCL 4CAGA 5C2UB 3FU7B 5D5MF 4D0CB 3VX1A 3P0VL 4N9GB 1INEL 4HJEA 1ZPLA 4P04A 2X1WL 5H94B 1B4JH 4PY7B 1D7DA 4Y16C 1VACB 4OCXL 3VFUA 1TT6A 3HW7A 5FFGA 5DJCA 5I1AA 5ID1B 2DW5A 4JFXB 3CDFA 1CFNB 1HVXA 4R26H 4MXQC 3HBQA 3O6KL 2XV0A 4JFFD 1RUKL 2V2WB 2BHFA 2HKFH 4YHZL 5E1HB 2Z8WC 3TN0C 1RZ8B 4WKXA 3GHBH 3QXAA 4R5XA 3FCSB 1FZJA 3GTTA 1UENA 2UXTA 2H45A 3DECA 4ZUWB 2Q6WB 5AWNH 4PHZA 3L5XL 4J8QA 1T4KB 2ESVD 3RGVB 5D5MA 1MWAH 1SBBA 4GMTH 5CEZL 5IMMA 4IHOB 4E9RA 3VXUA 4V1DD 5IJDC 1GPOH 4NO2B 2R4RL 1KEML 2V6HA 1ZEAH 2F9BT 1ACCA 2FX8L 3NZUA 3N41B 3ZJAA 1R24B 3PRZA 4I2XB 4G6AC 3WTYA 5HYQA 2X4PB 2VISB 3WEBA 3QNYB 5CMAB 4OCSH 3ABZA 1TKWB 1VADB 2AJUH 2CDGB 4G43A 4J6RH 5I8OH 5F6HI 2BDNH 1OL0A 3PXHA 4G7VL 3CFNA 1BBJB 1IGCH 5F7BA 1A9EB 2R69H 1UZ6F 3UP1A 3U2SA 3BP7A 1AO7A 3HB3B 4W4OA 2JKTM 1AHMA 3UACA 4RMSA 3QXDA 2JK5B 4QHKJ 5L8KB 4OCRL 3V7MA 2E4TA 3TBWB 1CYWA 2YUVA 2GG1A 5AVXB 1KBGL 2XVKA 1BFOB 4XC1L 4Q6IC 3IDYC 4JZJC 1EMTL 1RZJC 5AAMA 3QEGL 5BV7L 1CF8H 4J3OF 2DDQH 3NFNA 5KTEL 3TEXA 5CD3B 1SM3L 2F53E 3GI8L 4JG9A 4H88H 3QFDB 5IEHA 1OAZL 3ULVD 2R15A 1JRHH 3B9KA 3L16A 4WHDA 4ZYKA 3WL9A 4OM1L 5JOFA 5HHXH 3C5ZD 4GUOA 4MDRA 4N3UA 4W9IC 3UO1L 2HH0H 2Z93A 3ARPA 2O5XL 5AW4B 5I5JA 4DVRL 3MA9H 2WQRA 2APBA 3ARBC 5A6LA 5KYXA 1RIVL 3D69B 2K78A 3DVIA 1XVSA 2H9GB 3DX8B 4N6RB 4Z7NB 4RX4D 3L3GA 5KVGL 1KG0A 3SPVA 4OZGB 2YD2A 4N2MA 5C0CD 1I1FA 4JGUA 3PWPD 1KXTB 3MJWA 5DO2C 5BO1L 4GLRI 4H1LG 1WA0X 4AEIH 4I13B 4F58L 3ILDA 4WEMB 4WU5B 4ZTPL 1LO3H 3CLFL 1JXFA 1LWJA 3FFCE 5E6ZA 2VJXA 4E41E 1MAJA 1Q90A 4N3TA 2XN2A 4P8QA 1FN4A 5SWSA 2VLJD 5LG6A 5E08H 2R1WB 2P8PA 1N0XH 5HGHA 4KH9A 5IZ7A 1LO2H 1SN5A 3L5JA 5IIEB 3WCYA 1GYAA 3PV6A 2RALA 4GSXA 3SO3B 1LEKA 2L3BA 3B83A 2OL3L 3VXOA 1LVEA 5K1VA 2LU4A 1BM3L 3G6AB 1XZ0B 3FH7A 3GDCA 4K0OA 3KD4A 3PHQB 2WMPA 2UZIL 1ZA6A 4MNQD 4JFFA 3F2LA 3SDDC 4YVUA 1HQ4B 1RY7B 2BK8A 4OR1A 3ZLQC 4FP8H 4WI2A 4BHUI 3QNFA 2ADGB 2Y22A 1OF2B 4XO4A 1QFWL 4K3DL 3G6JF 5GRZA 1ORSB 3DGDA 1CS6A 1FL5B 35C8L 4M00A 2A77H 3SPJA 3CUPA 3WHE0 2JB6B 4PN6A 4IOFC 3A3YB 4YUEL 4L8SC 1EHXA 1MVFA 4E5XG 4CVXB 3DJZA 4OFQA 2ZG3A 4ICXA 2XA8L 4GQQA 1FL6A 3D3VB 3U0PA 3QUXC 3B5TA 3IVKA 4G7QB 5D2NA 5GRVL 5BRQA 3FHAA 2VQTA 1MCHA 3MRCA 5JHDE 3OR6A 1MCSA 2AQ1A 4NLHA 5FLUA 2CLZA 3OG6B 5CZVH 3G6JA 3L45A 3OHXC 3AWGA 3QQDA 2BNQD 3V6OC 3UPCA 1K85A 1UB5B 4Z3IA 3EF7A 3MJ9H 4C4KO 1M71B 4JPIA 4FFWD 5EULV 2FQGA 5B22A 2F53B 3BZFA 5DMGC 3HN3A 1NA8A 2ZAHA 4GXFA 2YS4A 5AD0A 4BZYA 4KUCD 4XNQA 3PGFH 5TQ2L 2D7PA 4CNIA 1CLOH 2OMXA 3GTNA 4HS3A 2DB8A 4Y5XC 2Y1ZA 4RAUA 4LVOB 3LN5B 1IO4C 4ODWA 3H9SD 3QCUH 4PJ8A 5E4IA 5TF1H 3K6FA 3H7BB 3LYRA 4POUB 5I5MA 6PAZA 1IAIL 4TNVF 43CAA 3TFBA 4JFYA 4NKMB 1FNGA 2ZYRA 3ESNA 1AGEB 3DX0A 3WSQL 5AVZB 3FQTA 5GGRA 5MERB 2EDNA 2FB4L 5C0DB 5D55A 1JG9A 2PXYB 2QPDB 4MD4A 3WJMB 3EYFB 1S7XA 1PLGL 3HI5L 4TXVB 1DBBL 4H5SA 1U30A 4Y16D 4C4UA 2GBUA 3GTVA 4LSRL 4RGMB 1VIWA 3GSWB 2E86A 3TYFB 2OCCB 1J87A 4JG0H 1ZCRA 4MS8C 4OJEH 3ATDA 5CSGA 2AEQL 4MXQD 2D3NA 4GLRH 4RGOL 5B8CC 3PWVA 3FFCB 4ETQB 1RP9A 4GXVL 3WIHA 2VIRB 3TN0D 3NK3A 1OZTG 4DPRA 2G9KA 2ZX5A 2HTKC 4LQFL 4R7XA 3CZLA 3MR9A 3J07A 4G9DB 2ERJB 3NIFB 4UQ9A 4FQJH 5KOVC 2VLJA 2FH8A 2DQHH 3JTSB 3TF4A 1RJYA 3OJDB 4WI5A 5C0AB 1I8IA 5HDRA 1G6RH 1DL7L 4U6YA 1XAKA 4W9KC 2OTWA 2FX9L 1AGFB 4RMUA 1E27A 3VGHA 4LLVA 3D9AH 3SE3C 2XY2A 4AX3A 2Z35A 4I18A 2JLPA 2H6PB 4G6AD 3IRCA 3SDXF 2GSIB 1WZKA 1XX9C 3U4KA 4UT9L 5LCVA 3ZL4L 3RX5A 4DUVA 3LRSA 2DKMA 5FYJE 1G4RA 5K9OB 2VWEC 3GIZL 4ZD3L 1QPXA 3DBSA 4H0GA 4L3CA 4PTUA 2FYYA 3S3BB 3MDJA 1C08A 1NL0H 1OAQL 3MRHA 3MNMA 4ANVA 1FZKB 4ONHB 5GS0C 3SBQA 5DRXB 3QP3A 4Y2OB 2VLRE 4XPFL 2VJ8A 4QXUH 5TE4L 3ARTA 5J12B 4F8NA 2OCJA 5JQ6L 1DP0A 3TZVB 1L0QA 3QXVA 2LVEA 1TMCB 4QAWA 1IQWH 3GSOA 5F6HJ 4AYFB 2GW5A 1J9SA 4JNXA 3SDXA 1A7RH 1UH2A 4OZ4A 5HGDA 2HRLA 1KGCD 4H0LC 4XX5A 2ZG1A 4FJ6A 4XPAH 2B3IA 1D2OA 1DO5A 1D6VL 3CFTA 2QSCH 1NLDL 1FYTE 1YPZB 1E4WH 1U4FA 1IEBA 4K23H 1WT5C 4UV7L 1MIML 4AKPA 4KTEH 5DS8A 3NJJA 5GRUL 5DT1H 3LEVL 4YC2B 1P9MA 2WBWB 4OAWB 2A9MH 2BNQA 5GRYA 4OT1H 2ZAIA 5IW6A 3BUYB 1AXTL 1EANA 4PJHF 2IFFH 2JE8A 1OTUC 2CK2A 4I1NB 2WKOF 4NO3A 4FYRA 4GG6F 3I2CH 5DO2D 3C08L 3S98A 4IJTA 1QR4A 2VXTL 2X28A 5MENE 1J05A 3KBEA 2G5BB 3DRQB 5LNGA 5ITFB 4PJXF 1OSYA 4P4RB 1FVCB 1F00I 1R19A 2D2CC 3AQYA 5EEXA 1YYLH 3T2NL 2OZ4L 4UUJA 5BUGA 4KHXH 4R96A 1JGEA 4O02L 5CEZE 4TVPH 4PRBB 5HVFB 4MHHG 2JQAA 1MLCA 2HWZL 2VQ1A 1JUFA 1N9PA 3CHRA 4ZNCD 4XPTH 4W6XB 3ZUCA 1F4YL 2DIAA 4PJHA 1CL7L 3T08A 4MA7H 2L7EA 3DIDA 3ISRA 3U4EA 5JPMB 3P2BA 5B39G 1BF2A 1OY3B 3Q1SL 4NHUB 4U1IB 4YHPB 4PQXA 1WP6A 1U0QA 3QDGE 2VZ3A 4AMWA 4P2RD 5L2JA 3LVTA 3FQ4A 1UCBL 4J3UA 4BQ6A 4XP6L 3MYJB 1FFOA 2AC0A 1JI1A 1YA5A 4OD2B 5FUCE 5KBMA 3OV6A 4ABVA 5E2WH 1S9WA 3SDDD 1KPUA 4JFPA 3VQLA 2BIPA 5ESAA 3MRKA 3TN0A 3KS0H 3WKML 3HLKA 4KTDL 4HKZA 1LK2A 2N1KA 3O0RH 3Q9PA 4Y19E 1W2KT 1TYRA 1XDTT 4XVSL 2PCFB 1HK6A 3SQRA 4PG9A 1E90A 3D48R 2ROXA 5A2LH 3LSOA 4KNQA 1NAML 3KXFD 4MZ2A 2FYVA 2WBKA 1CFQA 1K8IB 3S5LB 4PJEE 4ERSH 1RAMA 3LKNA 4IOFD 2Z9TA 1EO8L 2Y6SC 5JDSB 1HE7A 3MV11 4LZKA 2X9YA 1OB0A 4CVUA 1BQRA 1WISA 2Q3AA 4Z95H 2BRQA 3QUXD 3FO1A 4PB0L 4XGZA 1WTGT 3LZPA 4XXDB 2XIBA 2VLRB 4XMLL 3HPJA 1W8OA 4KITB 5KVGE 3RHWF 3IGAB 1J9TA 3DSNB 5HDQH 1H3PL 1GZQA 3QZWB 1F90L 1SDYA 1NDGA 3IJ9A 4Y1AE 5IVXF 2V5TA 4C56E 1XTMA 1U8JA 5DMGD 2VSKB 4JM4H 3F7PC 5L88H 4N6QA 3BWSA 4NZRH 4OLVH 5KSAB 4FULA 1IGYB 3ELQA 4J6IA 4JZJA 4Q6IA 4L4VD 1YCSA 3UTTA 5HPMB 1U91B 2HKHL 4P23B 3P11H 1QPPA 4ONGL 3FUDA 3HI6H 2Y72A 3FB6B 1CDYA 3S3DB 2WXOA 3N40P 2X4UA 2IANE 3ATEA 1ROWA 5DJ8A 3QPQC 4MCMA 3NDZE 4P2QD 3R4RA 3ARFC 2UXVA 3ARBA 3KYOB 5IVXA 1DBKH 1WFMA 3II3A 2IPUK 2Y36H 5E94B 5MENB 2BP3A 4QRTA 5HHPB 2NY5H 3VVWA 3RLSA 5IB2A 1KB9J 3QG7L 2ZXEB 4BXVA 2IDFA 2DJUA 2EIBA 2IAMB 3KPLB 4PRHA 1ORQA 4X8XA 3WO4B 3U83A 3L95B 5ALCL 1S7TA 1KB5H 4ZTOL 5BOPA 3Q05A 3DBXA 3CJJA 5EU4A 2HTKD 2YAQA 2YPLE 3KYMA 5HY9A 3UTPE 4U7SA 4U1SA 3K4DA 1NBQA 2NZ9C 3VXQB 4BUQA 3JSSA 2DQUL 1NMBH 4TUKL 3FAWA 5GSRB 1QUNA 1TEYA 1WBXB 1JHTB 5T1KA 3T0VA 3EJQA 1U6AH 1WAEA 2IGLA 4JFEE 3MGOB 3NZ8B 1TZIB 3O3EB 2FUQA 1R3JA 1Y1UA 2VW6A 4UTBA 4X8CA 2Z3FA 5HJDA 3TEWA 4U3SB 3H9HB 3D12B 3CHPA 4YJZL 5JOPD 3U36A 5C07D 1RXLA 1SZNA 4ZUVB 1HCZA 1EAPB 1YEFH 3ZZLA 3KPMA 4CRPA 1J0KA 3BO8B 2C3WA 1L0PA 2H1PL 2PCPA 1UZ8B 4GSDL 3SDDA 4ZMVA 2V2TB 4NGHL 3P9MA 3OSKA 2PPFA 3EFOA 3LN4A 4FLQA 1R1CA 3OKOA 5DURB 1RU9L 5GS0D 1BZ7A 1HIML 3C2AH 2CR0A 4PJEB 3D2UA 3NAAH 3ZMRA 4ZMLA 1AE6H 3LMJL 3CXHK 2ITCA 1HNGA 4ZPTB 3IJYA 1E3XA 1B88A 4G6MH 5MI0B 2FCBA 5CILL 4WHYG 3E2HB 4ODXB 2FWUA 4PD4K 1MLBA 1YRKA 3I6GA 2BP8A 2ZKHH 5CP3A 2PYFA 4YEFA 1T21A 2F8XC 4NAJA 2OW6A 1KN4H 5C09A 5I1DA 4HUNB 3IT8D 2WTRA 5GSVB 3FRPB 5L4MA 1U21A 1JGUH 4LCIH 4EIZC 3DJSA 1RIHH 2DKSA 2VDLL 1XGQA 2ZCLH 4A63A 1OCOB 1XFPA 5J1AB 1W8EA 3UTQB 3F7YB 4Y1AB 2BY3A 2DQMA 1S7WA 2XC8A 5I66A 2FQEA 4Z8FL 1JWSB 3OHXA 4M6AA 3V4UL 4FFTA 1FO0A 3SJVE 3KDMB 4J3WA 3V6OA 5HPOA 3C6EA 4LASL 4QRFA 1OTUD 2HXAA 4HIEA 3F7VA 3VI4F 3R8BB 4B0MM 4IIQC 4EN2A 3GRWL 1F5WA 2VN6A 3DKHA 4B53A 2F2HA 5IHUH 2OR8A 3IJEB 1EHNA 3BMVA 5CGMA 3ULUF 3Q06A 4Y5XA 3V0DA 4XBEH 3DUUB 4G8EB 3TT3L 5GXBB 4Z1PA 4HIXL 3HNSL 2CPUA 1IC1A 1KCUL 2WVSA 4JX0A 4NZFA 4WSKA 1B9ZA 4X6BB 3LKRB 5C08A 2H7WA 1CG9B 1JWUA 2E8ZA 3VXSE 1KJ3L 2MRYA 3MRJB 3DROA 3QC6X 1HNFA 2BNRB 2L7JA 5DJXB 4ZXBB 1FBIL 3ARVA 3QWQB 5LGYA 2CDFA 1BLIA 4R0LB 1SY6A 2ZP9A 3KLAB 4R7NA 4LLYA 3S37X 3D87B 3GMLB 4D9RE 4D0BA 4MWFA 2C1PB 3CIQA 4W1TA 3RWHB 1XF2A 5EU6D 1U8IB 1T22B 1M2OA 5JR1H 2PWHA 5FCSH 2D73A 5I8KL 3DTXA 4MCYA 3ZYJA 2YPLB 3BAJA 4ZK8A 1P6AB 4IBWA 1S3KL 4PRNB 5HYEA 2FJHA 2DQTL 2ZKMX 3IMWA 4PGJA 1I7ZA 2BFGA 1MN4A 1VLXA 4LEBA 4LEXH 1QBML 1SJMA 3QRBA 4J3OH 3FB7B 2FIRT 2JB5L 5I1IH 3SCMA 4TTDC 4AE1A 3S34L 1GS8A 5JO5B 4ES9A 1S3RA 2XSKA 2Y7OA 3K6SB 4IEFA 4I0CC 1WC7A 2QPSA 3N42F 4JG1L 4AQEB 2OMVB 3B2XA 2Y6SD 1MFCL 3BAWA 3SE3A 3TOPA 5C07A 3KPRE 5LBVA 3DTDA 2XWJB 3ZKXB 3ILPB 3S2CA 5SX5K 5ETUA 3GXPA 4TULH 1YY8A 1ET8A 3CZGA 3VTAA 2ADIA 2AEWA 1U92B 3VWJB 4ODSH 2BS71 1SMDA 1UM4L 3V4LA 4XOEA 4DGWC 3OKLA 4YZWA 2FJSA 3PUCA 1MCEA 1CXLA 3SD5A 5E1AB 1H15B 4O5LH 3K5RA 3QNZA 4X7FC 5CJQL 1E5UI 4EPSA 4ZMTA 1DFBH 2IWGA 1A7PL 4G8GE 1PCXA 2GUOB 1CFMA 4UV4L 4Y8DC 4YZFE 5EBLA 3M1CA 1M9SA 5E6RB 4TYUA 3VXMD 2RR3A 5HHOE 1G7QA 4PJDA 2V7NB 1IARB 2X3AA 4LSPH 4DKTA 2BVQA 4X5PA 1B4JL 3IETA 4TV3A 4ANXA 1IJ9A 3C8HA 5IMOB 5D1QE 4P2CG 3QPQD 1CT8B 2ATPA 4M5SA 2M2DA 4PVLA 3LH9A 5HP5A 4ZDHB 3RDTC 2H8PA 4IU3B 5KVFH 2FJFA 3ARFD 3RVUC 4K07A 1QO3A 1EUTA 3I75B 3Q8CA 3LKQA 2DWDA 5FYKE 3WFBH 3BPCB 1P4IL 3FF8A 3K80A 3U79A 3VM7A 1E4JA 3GHBL 1RJLA 2YQ3A 3V5KA 5DQJA 4LLDA 4OF5A 2EIZB 1HXKA 3V0VA 3RL1B 3TASA 4AG4L 2IQ9L 2CIIB 2YZ8A 3PNWB 1MWAL 4I48B 3HVNA 3V0WH 4Y2LA 1FZOA 3CCHB 3D4GA 2I9TA 1U8CA 1WZ1H 2G9HA 5GJTL 5IROA 1DQTA 2K3TA 2L7QA 4N28A 3VXSB 1OT2A 1HEJC 1ZEAL 3OKKA 2NZ9D 4GUCA 1CFSA 3CLEL 3LPPA 4PRPA 3GSNA 2F54E 3CC5B 5FO7A 1L9NA 3A6BH 1NBVL 1PZ5B 1NDTA 2AJUL 5I8OL 4HISA 1QFPA 2AANA 2HFGH 2VW4A 5HGBA 3FTGA 2LABA 3PY9A 1U95B 5CWSB 4AT6B 1JIBA 2R69L 5F1OB 1A4KB 5EPMB 2FK9A 3QA3B 3ULVH 1NUDA 3B5HA 5IVZA 3FU9A 5EU3B 1G7MA 4G1EB 4GXUN 4JDEB 4UTCA 1UOVA 2LU5A 2DM2A 4XCEB 5CINH 5TQ0L 2O6FA 1OGSA 2V37A 4Y5YB 2GSGA 2VXVH 1V7ML 2ZTBA 1YJDH 5LGJB 2DMKA 3BYYA 1YEWA 3MXVH 1UXMA 3P3UA 1L5GB 4QY8B 1AP2A 2AITA 2G75B 2AXWA 2JCCF 3M7OA 4KK8C 4XVUC 4HJJH 4MB4A 2CLVB 4H88L 1NCJA 1WQVT 2EIEA 2GBVA 3EYQC 2P5ED 5HHXL 4G9FB 4FXKA 4JM2B 3VJ6A 1I7RB 3WIHH 5E00A 1EBAA 4G80A 5KSUA 1S9YB 3O8XC 2HVJB 3MA9L 2KERA 1U3HB 4P59H 3IU3A 5GGTA 1AIFB 3IB4A 4X5XB 1U93A 3MV7A 3S37H 1VGKA 5GIRA 1HZLA 4Z7WF 4Z3TA 1IAOA 4FNLH 4HZ1A 1E3FA 2QKIC 3OAZK 3TJEL 1QWUA 4ZUTB 4AEIL 4JS7A 4YDNA 1X6LA 3APMA 4LSVH 3PWNA 1FFNB 3QSKB 1IEHA 5LCVH 4JDZA 1A6UH 1UWGL 2CA3A 3KVQA 4PJGF 2CM5A 2EEAA 4YHMH 5E08L 5IV2B 2HTLD 4FTVE 3VXMA 1I53A 5CR1A 3WE1A 3WHE1 3U7WH 3GUTA 4HEMA 4Z7WA 3HEIB 4AVIA 2UWEA 5K9QI 3GWJA 4WHTA 2WP3T 3F7RA 2G2RA 3DRTA 2EILB 2DKUA 1G5GA 4L8BA 1QP1A 1TTFA 2Y23A 4WU7A 4CW1A 5I17B 2WCGA 2VLME 1FHNA 2YA2A 5CBAA 4LLWA 3BKYH 4NO0B 5D2LF 4W9JC 1ZVSA 2MCG1 3KJ4C 3L3OB 5KYNA 1NGYB 2DLFH 3PF2A 5T33H 4HSCX 4CSSA 5DUJA 4F9LC 1MF2H 2GY7B 1ZJBA 2BH0A 1VCBC 5J11B 5LG1A 1KTJA 5L2KE 4WI3A 5IG7A 2ZXAA 2BFVL 4PJAE 1JNJA 2A77L 2F54B 5GHWH 2BOBA 1H8OA 1KCWA 1OP9A 2Z31C 4F24A 4HKXB 2GC4C 2HVBA 5I9QC 1JHLH 1OE1A 2XN0A 3K8MA 4RGNC 4XOAA 4PTTB 5JIPA 4NNYA 1PDKA 3BP6A 2XDHA 1JMZA 2I69A 5HHNB 4NKQB 1J9QA 3KPQA 2OXHA 3PWJB 4HK3J 1WE5A 4TTDD 4NKIL 1RPKA 4RBPH 5D2LA 5I6XC 2V33A 2FBJH 4UQDA 4M4RA 2YD7A 3BHBB 2H5UA 4KJWD 4KX7A 1RUQL 5AUMB 1QABA 2ZCKH 3ZL2A 2XPZA 2QKSA 2HFFA 1E8YA 3QHTC 3NN8B 1ZY9A 4JPVL 1FA4A 3RVVD 4NC0B 4AQ1B 2Y7LA 3F3HA 2E9GA 4NRYA 5ANHA 1GZHA 1UZGA 4GKOA 3MJ9L 3VXRE 4Q56A 3GB7A 2X4RB 4KZEH 1IL1B 4XC3H 3CDZA 12E8H 3KAAA 3TV3H 2EDOA 4M03A 5IUCA 3M1BA 4BK8A 2CU9A 2CJSA 3VO0A 1CLOL 3C6LC 1EJFA 1J5DA 3KWUA 3K0YA 5FUZH 1KIQA 1KYDA 3QCUL 1UXWB 2NXZB 3UYOD 4G7YH 5TF1L 5BVPH 3QDJD 2ZUWA 4KXBA 3OMAB 4JFQA 4NQCD 3EBHA 4JE4B 1H6FA 4OFYD 3RJQB 4BUHA 3VNZA 4EQ3A 3CH8A 1D6EB 4XPBH 3OWRA 2R2BA 1KC5H 3O3BB 3NCBB 3WNMA 4JRYD 3BAEH 1OPGH 1T7XA 1UADC 4JG0L 3V5DA 4HIHB 4W9HC 3RVUD 32C2B 4X2UA 3EHBB 5EHFA 1A65A 3KPSD 2DEWX 4TSBH 1ZT7B 5DC0A 5KYUB 3G5VB 1OVZA 3H2PA 3OLDA 5CP7A 1CXKA 1YMHB 3ZUNC 1A47A 4BBWA 1DBML 3QI9B 1BW8A 3FQRA 2AXGA 1MCWW 3TCLA 2ICEB 4H1LB 2XVGA 4IIQA 4P5KA 4PV8A 4RFOL 1LP9B 2K6WA 1UXSB 4IRZA 1G6RL 4QRQB 4EUPG 2H2PC 1QYGH 3MHZA 3D39E 1FC2D 2O6PA 3P3YA 4YDVB 1BGXH 1N8OE 3D9AL 4TVSa 5I74B 4HK0B 2IOOA 4AUJA 3APDA 4NQSB 3ASNB 5LB1A 3O2VH 1RZJH 2ROYA 2A99A 1LWRA 1HZKA 1PPIA 2Z92A 2APVA 5IB1A 4KGLA 1FZMB 2OTPA 4JDTL 1NL0L 1NCDH 2CLRB 3EFFB 3EJCA 1GGCH 4H26A 2WOBA 4PJAB 4CKVX 4EN3C 4ZMOA 4S1DC 1JV5A 3EFDL 1A8ZA 4N90D 4KK5C 1JN6B 3OXSA 1JXDA 1AD0B 4PUBH 1IQWL 2W59A 1A7RL 1WFIA 5D93B 1M7DA 2E7BA 2EC9T 3KL3A 3M6DA 4KK8D 2EEFA 4XVUD 4M3KB 1E9QA 1DN0A 1KIUB 1IAKB 4XPAL 1T03L 2YAFA 1E8XA 1S7VB 3EYQD 1TQUA 3SYCA 4BJLA 1BG9A 2WPGA 3W9DB 4K23L 4HC1A 3CDGA 1O6SB 4E5XB 4BH8A 3LKOA 4KTEL 3O8XD 3MI6A 3GSVB 2PPAA 2V7HA 2VKWA 1YEDB 4HUKB 4XVTL 4PS7A 1B0GB 4JRWA 1HJBC 4WNQB 4WI4A 2A9ML 4UINH 4ZQKB 4Z0XB 1KWGA 1R3KA 2NX5A 2DQDH 3GM8A 3UEQA 3ZT7A 4ZFGH 1Q9KB 2IFFL 4UTBH 4MBOA 5AYTA 1R46A 2HN7A 3HE7D 4FQXC 2NLJB 3BRGC 1HI6B 4I0PC 5TDOA 3HZKB 4MZIA 4NKOA 3WYRA 1CIUA 4R7LA 3MUGB 3IKCB 4RDBA 3ELAT 1ZTMA 4KXCA 4X7SL 4QAMB 4ZMYA 1ETZB 4HH8A 3MC0A 1G9NC 1D5ZA 2P7TB 1AR1C 4F7KA 2VDMH 3ZKSD 4NWTL 4PJBA 4MCZB 3MN8A 1C5DB 3HE6C 3SDAC 4D9LH 4WIQA 3SIKA 3SGEI 3MLUL 2NY1C 2WUBH 1JTOA 1W16A 2XTLA 4UDUB 3LPOA 4DVBA 2P5WD 4MA7L 2FZ3B 1IKNC 1MPAH 2VN3A 3MRQB 3LNDA 3ZHFA 2AQQA 5I75C 4HUVB 1NLBH 2VE6A 5DJ0A 2EKSA 1UATA 2ZUSA 3QEQE 4JREC 4NC1E 2FT6A 3VRJA 5JUEH 1JL8A 5DI8B 4MAUH 1E2VA 3RDTA 1Q0XL 2P8LB 2NR6C 1J1OH 2QLYA 1T1XB 4PJ9C 3ZDZE 5E2WL 4A7SA 5TDNA 5SWQB 1OKEA 3DYMA 3DNKA 2WZ0A 4B7IA 4BQ8A 1G7PA 2PF6A 5IJKC 4Y7OC 5CCKL 1NDMB 3T3PF 4LVNC 5HYJD 5F7KC 4JKPL 3UZVB 3WEOA 4DAGH 2HT4C 3JWNC 3M46A 1TSRA 3DMMC 3MBEB 3DPBA 3HPLB 3ZE1F 3W0WB 2Z31D 1SF3A 1JGDB 1FO0H 2YKKA 4OI9A 3WEXA 2H0EA 1KJ2A 4YPGB 1AQMA 1CC3A 4RGND 3K71A 5HVHC 1BAFH 3BSGA 1QTSA 2OP4L 4X4XA 2OX5A 4Z95L 3RRQA 3ZE2B 4M29A 1WSST 4BQCA 4B9PA 4OIIL 4MRCA 4AE0A 1HJCA 3MLWH 4S11A 4F37F 3RWJB 3BVUA 1WV7T 3WN6A 1NM9A 5HDQL 1USZA 4IOSA 1M53A 3L8QA 4GNKB 1OT4A 4N8PA 4LPUA 4BFIA 4AMKH 3STZB 4RWYH 4JM4L 1SY6H 1T1ZA 7FABH 5FO9B 3IGLA 4I87A 3T3ME 2H47C 4ODUB 2VAJA 3VI3A 3C6LD 4UQBA 3IWUA 2V9UA 4JKKA 1OCCB 2W9EH 1BYOA 4AK1A 4N2BA 4X99B 4KVPA 4JHAL 3HI6L 1EEZB 1QOKA 4FXTA 5A2JH 2C3XA 5F70A 3MV8A 3T0EE 4BD4A 1H6TA 3RGVC 3FSZA 4PMFA 1OGAD 2WWKT 5E23A 2J71A 3GPEA 1IGTB 1ESOA 2WK2A 3O3DA 1LDSA 4QWWC 4ELMF 3MLYL 1F3RB 1Z9MA 2NY5L 3EYOA 3ECVA 2OMTB 1VKXA 1DVSA 4LCUB 5EBWB 2ILLA 5T5NF 1A2YA 1Q9WB 2AVFA 2QR0B 4LHJB 2Z7YA 4POYA 5A2IH 3LXUX 1EZLA 1LQBC 4U1MB 5EOQH 4GP8B 2AABH 2QKIA 4J4PA 4XBGA 4PJFF 4QRUA 2HX8A 2QSTA 1KB5L 3IEAA 4HKBB 2FL5B 1CF1A 3BI9X 4FCAA 4OCLC 2E7DA 5DJAB 1ND0B 1R3LB 1JNLL 4Y4FC 2HB0A 2NYZA 1PYWA 1MXGA 1VA9A 3HB3C 1C9SA 3FU3A 3QG6B 2JJUA 3B43A 3KEHA 5IOPA 1MQKL 3SGEH 1E6JH 1U6AL 2IFGA 1PBYA 1KACB 2H2PD 4Q2ZB 3EH5B 3RNKB 1TJMA 3QEQB 2R7EA 3MACL 3QHFL 2C9QA 2AAVA 2PNDA 1PJ9A 1BOGA 2B08A 3WTUA 2R2EB 4PJFA 4Z76A 4FXLA 3JYBA 5DEFA 5E8NA 1Y6MR 5FB8A 1W72A 4A38A 1EEQA 3Q8AA 3HG1E 2NQ3A 1JFQH 2ORBH 3UTSE 4GRMA 4DP8X 2H3XC 5B39B 4Z23A 4WW2C 3N9GH 4RMWA 1F4AA 3V0AC 2K6ZA 5D7LA 4BFFA 3MROB 3C2AL 3MJGX 1HWHB 1TVHA 3BUBA 4DN4L 4S1DD 3NAAL 1DCEA 2GJ6D 3FRUA 3L81A 4GKSA 4KK5D 5M94B 3U46A 4X9FA 4L8CA 3JUYA 1NH6A 1NIBA 5GQBA 2Z31A 3FFDB 4XO5A 1D5RA 1PMYA 4AH2B 3FT4B 3PWUB 3VD7A 3G04A 4JRXE 2ZKHL 4XMWA 3BXNB 2ID5A 1BZOA 1KN4L 2J88L 3S4SG 3T09A 4ZO9A 2CBMA 5D1ZB 3K2IA 3N50A 4LCIL 3BUTA 5FECB 2DMCA 2P44B 4ABUA 3C09C 2W8CA 5JNYB 5IREA 3NJIA 2K7QA 3WG7B 2Y06H 2ZOOA 2C34A 3MODL 1PSKL 1RHHB 3T8VA 4HIJB 4F7MB 4XRCA 5EDXA 2MSPA 2VUYA 3CVDA 3NACH 3U0TB 1SDDA 1VZHA 3GSNH 1QBLL 2XG5B 3D08A 1KTBA 4WNJA 1WBYB 3SO3C 4L29B 5FAAA 1MFNA 1UH3A 2ADFL 3GBEA 2M26A 4FQXD 4M9OA 3KWWB 3DDFA 1RVFL 4W9LC 1ANUA 3TXAA 2BHYA 4I0PD 5IHUL 3A4DA 2VR7A 3T0EB 3V4VB 3C6LA 2O5ZH 3QW9A 3MNWA 4XBEL 2WLYA 5H37A 4NENB 1IGFH 2IALA 3ZKNC 4KJYA 1U2YA 1AR1D 1PZ3A 2ZCHH 1KEGH 5EOCH 1HXMB 5ILTH 3FUNA 2X4OB 3T6XA 3ZT5A 3HE6D 3PJNA 3SDAD 4N85A 2XZQH 2NY1D 1TOXA 5EDSA 3HC3L 3LZLA 2W0LA 4WWKC 3EJYC 1E5ZA 1FNEB 1C1EH 4P9MH 1YEJH 2DWEB 2X3BA 5LXVA 1NGXB 1Q9OB 2V2XA 5IQ7L 2UY6A 4TN9A 4EXPX 5GZOC 1CWVA 4GPVA 3CVHH 1BVKB 4AKQA 2NR6D 2AGJH 2YA0A 2KBGA 4NYLA 4TLKA 4NLAA 2WXKA 4LE8A 3FUEA 3CK0H 1N26A 1NUFA 2K4WA 2Q7AA 2ZX8A 5GGTH 2YQBA 4PBVC 2BS8A 3DX9B 3VA2C 4N2IA 5L9DH 4LEXL 3D25B 4NRXA 1XH1A 2W0FA 2FVNA 5BPPA 4TQIA 4OLWH 2HT4D 3WS6C 5I1IL 5KSBF 3DMMD 3AFLA 3AG2B 2GB2A 4JPKH 3KCPA 2NY2B 3ESOA 2BOLA 4Y9FA 1PEWA 3CXFA 1D9KB 3HG1B 2AI0H 1KLFB 2VB5A 4OFPA 3NCEB 3NABL 5B4MC 4JMNA 3I3EA 1S9VA 3LDBB 3HS8A 3TA3B 2EYSA 3U48A 3QWRD 2VKXA 1JV2A 3ARQA 5KAQG 2IBZY 1VENA 4F33A 5HDWA 2R4SH 1F13A 3FC8A 3FT2B 3GS7A 4UIKH 2QT6A 5KSBA 5D4QA 4KNUA 4OJFL 4GY4A 3TURA 3GMOA 4HIPA 2OK0H 4EN3A 2PXYC 4D9QD 1BOYA 2GC7C 1KBVA 3AITA 1OLLA 3DV4B 3CXDL 1DBJH 1T1YB 2XPGA 3QJQB 3O2WH 4O5LL 4OZHB 2GJ6A 3VQ1C 2AK4E 2HG5A 5C0BB 1DFBL 3MRBA 2DYPB 3H9ZA 3TP4A 1PNCA 3KEDA 1BXXA 5MEOA 3HFFA 3QIBB 1A5FL 5JIDA 2OSLA 4LSPL 1I7UB 2A6DB 3U6XS 3ZDYE 4FA6A 4G59C 3BX7C 3BEVB 2N4IA 4QXTB 4PU2A 5G2NA 4AV0A 2NXYD 4KJQC 4WENB 3OGCA 1MJ8H 4GG8B 2OJZH 3S3PA 1NFDA 3TBSA 5KVFL 5IMLA 5IM7B 4GI8A 1JF5A 2WLIB 5E51A 1TLMA 3B9DA 1TTBA 4XO9A 4Z5RB 4QWWD 2WJ7A 2FEEI 3GC3A 4NUMA 2W38A 2JJSC 2YD3A 4LU5H 1UFUA 2CIKA 5DDHB 3SY0A 3SYQA 4OLXH 4IDJL 5FFOA 1I8MA 5I0VA 4ADIA 5TE6L 3UPRB 3D8MA 3FPYA 1XSKA 4NUQA 4OGAC 5EOCJ 3H3PH 5I6PA 3V0WL 1TTGA 4I0PA 5J1SC 3FDWA 1PX4A 3HG5A 2A9CA 3VFWA 1WZ1L 4GW5B 4XX1E 1PNDA 5IVOA 2BVTA 4XBMA 4Y4FD 4WQOA 3DO7A 5TFSH 3ZE0E 5B3JF 1BLNB 2GHWB 3ET9F 1JOIA 4JY4A 1HH6A 2BIHA 4KO6A 4E68A 2CK0H 1EEUA 2A73B 2QFPA 5J12C 3LXAA 3L7FB 2J43A 3HZVA 1BQHA 1NBYB 2EDEA 2HFEA 3GZQA 1IKNA 2W65A 3D0LA 1CZ8H 3EOAA 4GQ9H 4PREA 3UGEA 4GAAA 3ULVL 1CFVH 4FDWA 5F9AC 1BWMA 3O11B 2BHZA 3NRFA 1URIA 3T0XA 2MMXA 3FO2A 3NSXA 3QRLA 2NR6A 2WIIB 1Q94B 1HNYA 5CINL 4KZDH 1FV1A 3D7PA 4PJ9A 1VFBA 4RRPA 5BRZB 2A5UA 4ONFL 4JANB 3POHA 4PGCA 4EXKA 1UVQB 1EJ6A 3SPHA 4HF5H 3VGAB 1NCAL 2Q86A 5I82A 1YSOA 2NNCA 1I82A 3DPDA 2BVOB 5IJCC 1W0VB 4HJJL 1PAMA 2C3HA 5K93A 1HHGB 3AG1B 4MB5A 2RQEA 4N2HA 3WE6A 4QHUA 1ZHBB 1NJ9B 3IXTA 3JVFC 2SODB 3DK2A 3B7UX 3HHSB 3WIHL 1QVOA 4NIYE 5T1DH 3QS2A 1AMYA 3AU1A 4K71B 5EIQA 3EYVB 2NQCA 4MJ5A 3GMQB 1EIBA 5EC1A 3OKMB 5BJTB 3RYMA 1PQZB 3LTVA 3S37L 5F6IB 3CPLB 5K9KA 4IRZH 1TTUA 4XNUH 3S8WA 2J4WL 4NZTH 2H0PA 1I3UA 4G8FA 4I3RH 3T2OA 4JFTA 3CBRA 5FYLL 1KV3A 3TEYA 4LCYA 4WV1C 3DVFA 4AJVA 1ZKAA 4PCSA 4LSVL 2NDGA 3N44B 4F8LA 4N9GA 4Q9CA 5H94A 3T2LA 4PY7A 4IQHA 2ALAA 1VACA 5JPMC 2A0LC 2BY1A 1A0QL 5ID1A 3QDME 4GIPD 4NB7A 4JFXA 4P5MB 2WINB 3N41F 4LPYA 3U7WL 2V2WA 2YZ1A 4F91B 1E7UA 1NPJA 1Q38A 3BP4B 3MUZ1 3ZKND 2QGCA 5E9DE 1ADQA 1FVEA 1WCBA 5DJYB 2Q6WA 3Q2CA 2O61B 1CBVL 1XSIA 4KQ3H 1B90A 1T4KA 4R9HA 3RGVA 1HHIB 4CN6A 5KS9F 3HG2A 3VFTA 3QQNA 1GS7A 5D7IE 5TH2B 1BREA 4JGNA 1XBDA 4WWKD 4M02A 5FV2A 1FHGA 4N24A 4IHOA 1L6ZA 2ZNXA 3NP4A 3BKYL 4U05A 4PGEB 4WNSA 3HC4H 1O7DE 1URZA 1MHEB 5KVEL 4JQIA 1LE5B 3CH1A 4NO2A 4AC2A 4DZ8B 5BW7A 3DOIA 1CGVA 3US0A 3I74A 3TONA 1MF2L 1R24A 4I2XA 4HC1H 4Q6YA 5HHVH 2DM3A 2Q8AL 2VISA 3D85B 3QNYA 2YRBA 3Q6GH 5HJGA 3KL0A 3CIAA 3BN9D 5JDJA 2CDEB 1JGLH 3PP4H 1NEZA 5GHWL 1BBJA 1JYNA 1A9EA 3WFHB 3IDMA 3W9EA 3DETD 2VDQL 1IVTA 4BQ9A 3MPCA 3E1ZA 4YDJB 2JK5A 3V8OA 3WN5C 4WUUB 5ISZB 4EQ2A 2FBJL 3TBWA 4Z7NF 4LGPB 2C1OA 4ZX4A 3W2DH 4JY5H 4Q6KA 2VUOA 3ZL1A 4I1RA 5KBDA 4HCRA 1ASQA 4KRNA 2M8XA 4OZGF 4ZRGA 5D5ME 1GYWA 4MB1A 2VXSH 1GTNA 5AW0B 5CD3A 5B4MD 5I1JH 4NCC2 3UJTL 1MEXH 4CMMB 5M7QA 3QFDA 5F0MB 1EJ8A 1ZA3B 4QCIB 4BFEA 2ALWA 4UT7H 1XEUA 4GIOA 4XWGL 2QHRL 1WEJH 3NCXA 1XB8A 1DQIA 4XC3L 3TV3L 1AXIB 1OSZB 2VRKA 4JL1A 5E9AA 1X5MA 1XZWA 3NJKA 3QO1B 3WGVB 1JZ4A 4QOKD 1D5XB 4LEOB 1Z3RA 3FQNB 4XP5H 3D69A 3RIFK 4TTGA 2H9GA 3BDXA 2XTJB 2YD9A 3DX8A 4HYTB 2BOCB 3GBNL 2QTEA 3L9EA 3TO2B 4ELKB 4QRAA 5J13B 1V10A 3AY4C 1EXUB 1I3RB 2W9LA 3ML8A 4G7YL 4OZGA 4WEBL 3FT3B 3K6NA 5BVPL 5TPWH 1XGUB 1KXTA 1W6WA 2Z6FA 2J20A 2BSDA 4E41D 3SGDH 2OMYA 1ZT1B 4XPBL 2AMUA 5AOJA 4WU5A 4YIQB 4W93A 1M3JA 1KC5L 2LHAA 3FF7A 3I6LE 4KJQD 5C86A 1OPGL 3J2PA 4NNXA 4CC1A 3L4UA 4HUWB 4Y8AA 5I1GH 2BSRB 1IM9B 2R1WA 3VFRB 2IV8A 4KVNH 3VFGL 1KJ2H 1QI3A 4RVBA 5AB0A 5IIEA 2C9RA 2R8SH 2W81C 1UZ6E 3BIBX 4MLSA 3NJVA 4DQOL 3X1NA 5C0JB 2B0SH 4AEHH 1A3QA 1F3JA 4QXGH 3G6AA 4BSJA 5FUCC 4PMEA 3VAEA 1KGJA 3PHQA 1BBDL 1GZPB 4OGAD 3M1OA 5EC2A 3WNKA 3D1MC 4KKLD 5DUPH 1WVZA 2J1ZA 3F6IA 5ABAA 4Z77B 2OJEB 4XMKH 4HDIB 4K8RL 1HQ4A 3OMNB 1YQVL 5D7IB 5IBUB 4CJ0A 4ZFFB 5BV7C 3UBXB 2ADGA 1OF2A 3RILA 3O2VL 1CXEA 2NNXA 2XRAH 4WWKA 1ORSA 4N0UE 2EDWA 4KX9A 1KXVC 2H3NB 3GHPA 5C3TA 4DPAX 3W1ZA 1HH9A 1RJZA 2JB6A 4NRZA 5GZOA 1Z9NA 3PE9A 3FSWA 4CVXA 4DJMA 5DWUL 4X5WB 3D3VA 5JHDD 2DS4A 1IUZA 4U1JA 4HZAA 1JHKH 2DN7A 3BQUB 3WOVA 4LCCB 4PUBL 1BZEA 4JQVA 4UQ3A 1A1OB 1X5IA 3SPCA 2AQ3A 3RVWC 5EIVA 3RWFB 1X4YA 2R27A 1Q8MA 1EDYA 3CSYA 4LOFA 4U6TA 3WS6A 3NIDF 5F7WC 3IKKA 4WO4B 3BW9B 1ITCA 5DHXB 3RIAF 1UB5A 5D7KE 3FQWB 3QDHA 4TLSA 1T0NB 1M71A 1RURL 4E0RB 2X2JA 2F53A 4L0ZA 2BW4A 4MA8H 1WYJA 5C8JB 1X9QA 2PABA 2J55A 3S96B 3MRFB 1N7MH 4UDTB 5BQDA 3VG0H 3A67L 4UINL 3AABA 4L4JA 5ERWB 4CMHC 5CFHA 3LN5A 1JPTL 2J6EA 1MI5E 4ZFGL 4JFHE 4ENZA 4UTBL 3CFDA 3H7BA 1H9VA 1YYCA 2F18A 4NKMA 4MNGE 1AD9B 4WJKB 1AGEA 4PEEA 3NIFF 5B1JC 5C0DA 3SBRA 3LS5L 5MERA 1AYRA 4AMXA 5TGBB 2PXYA 1W72H 2JFCA 5T5FA 3EYFA 4LDLB 2NT1A 1Z0NA 2NY4B 3K4AA 4W70A 4HMDA 3SKOB 5D2NE 2VDML 3GSWA 3TYFA 1BCIA 3NOIA 3VCLB 4X6FB 3FN0L 2YPKB 4UZSA 3QORC 1MCCA 2ZX9A 1ZLWK 4URKA 3L4VA 1JZ5A 3FFCA 4ETQA 1NC4B 1BEYH 4E41A 5E6IC 2VIRA 3BISA 3Q2VA 1PD1A 2X44D 1GMEA 3FB5B 2VABA 1B4TA 2YEZB 1XL6A 4JFOB 2ZOKB 3UROR 4ESKA 3GXNA 3MUY1 8FABB 4G9DA 4PIBA 3DXAB 2B16A 5IBTH 3OJDA 4LBAA 2H26B 5JQIB 3APFA 2F74A 3FHEA 3BRFA 4WJG3 3CFQA 1FNHA 3IBOA 1G6VK 3HG4A 3JTTA 3HRZB 5IFJB 2CBPA 1KGYE 3MCG1 2AJ3B 3O0LA 3I6SA 3ZKXC 3NPSB 3SQBB 3QARA 2GSIA 4B9IA 4RQQB 2WVTA 2MWCA 4L3AA 2Y7SA 1CI3M 4ODHH 3OZKA 2GFBB 2VLRD 4WK2B 5SX5H 1FO0L 5B38G 1YPZF 1F97A 5FGCE 4HJGA 1BAFL 4R7DB 4Y9EA 4N0UB 3TT1H 1FZKA 4ONHA 3UABA 5DRXA 3CXHJ 3ROOB 2G4GA 4XCYB 4LIQL 4DFHA 3WIAA 3TZVA 1NPUA 4JZNB 1NMAH 2WLLB 5H37H 1KY7A 4HIQA 3RP1A 1Z3GH 3B9AA 1A4AA 1FYTD 2A74B 2H6OA 3RNQB 2KDGA 1Q9LB 3BWAA 1OCWH 4XP9L 2J57A 3IMTA 1QMUA 3LQMA 4YFEA 5K9JH 4M5TA 5JHDA 1U2CA 2QVKA 5FYLE 1KFGA 3KVDD 4FHJA 7FABL 2ZXDA 3VWKB 2XX0A 1E5BA 4RA0C 4ZTEA 1A6AA 2J73A 2WP3O 1OP3K 3OPZH 4ZMPA 4OAWA 5MEND 4M48L 1PG7W 4UAOB 3BUYA 1AMXA 1OOWA 4NNPH 2VDNB 1MI5B 4JVUA 2XTSA 1KYUA 4Q89A 5CEZD 2W9DH 4P4RA 1CFTA 4XP4H 4MNGB 3UZEC 2F15A 3G5ZB 2EIDA 2Y3NA 2Z0UA 4N8CH 4IS6B 1RPQA 3HG0A 1M7IB 2HVKA 4PRBA 4XNMB 1XIWC 4L4TE 4C54A 3QQ4B 4YEEA 1FL3B 1V3JA 4YL9A 5AKTA 5KVEE 1SMAA 2YPVH 4WV1A 4XOCA 1JXGA 3QDGD 2GJZA 1DQLH 3ARGB 4GI6A 4J23A 4OLEA 2PCYA 4KRLB 4DKEL 5JPMA 2VLKB 4YSUA 1IGML 2CRIA 4NHUA 4U1IA 5KSVB 1ZHKB 3LEXB 2LV4A 4NQQA 4Y19D 3MYJA 1G9MH 3H1ZA 1PW3A 4OD2A 3WBDA 1S7SB 1XGZA 3A22A 3F04A 1SXSA 3O4LE 1R5VB 1CGTA 1RZIA 3SO5A 1BZQK 3L3HB 4AYSA 2BX5A 2PLTA 1DZ0A 3OAWA 5DURD 3IAGC 1OAUL 2PCFA 2WXFA 3K3QA 1QLFA 1E5YA 5FUOL 1JFQL 2ORBL 3ILQC 4JM2C 5F7MC 4ES8A 1K8IA 3S5LA 1TZ8A 1ZT4B 2VN4A 3QEHB 1BZ8A 5JDSA 4WWNA 2ZXQA 4P05A 2BM3A 2QADB 3AGVA 2ZXBA 2AZAA 4I8DA 3X3FL 1XF4B 4PJHE 5FGCB 3DURB 1IU1A 4MDIA 4GG6E 4UU9B 5AYUH 2DLIA 4E42B 2UUDK 1P7QB 4C59B 4OCNC 2VLRA 4ZT1A 3V6ZB 5E2TH 1QRNB 3PHAA 4PJXE 2GIMA 3DC0A 5DRNB 3ZZ1A 1GVIA 2QDWA 4C56D 4HAFA 2MQ0A 1Z2KA 3IGAA 3DSNA 3RURA 1DCLA 1L3WA 4AW4A 1BVNP 3QUYB 3QZWA 5EU5B 5F97E 3F65A 3O6FC 2RCSL 2XFGB 3P3SA 2ZKXA 5IWLC 4R5TA 1IGYA 4BK5A 1G9NH 2IAND 3WNJA 5DQDH 5HPMA 2ZUYA 5D1QC 1U91A 3NACL 3NYKA 4BDVB 3FNKA 4HFWA 1CBJA 4WK4B 3GSNL 4Z3GA 1OPOA 2ZWNA 3FB6A 4ANWA 4N2GA 4I4WB 3TWCH 3PREA 2OI9C 4X6DB 4YSSA 2OMUB 1DVTA 3TLRA 3WV0A 3B34A 4M3JA 5I76B 5D7JC 5I2IB 1H6EA 4XVJH 4JZOB 2O5ZL 1KBBA 3R1GH 1IGFL 4Q52A 4ZOCA 5E94A 4RRPM 5MENA 4U4BA 5HHPA 5T3ZH 5CN2A 1CGYA 3AY4A 3L3OC 1N12A 1KEGL 1RLBA 1VPOL 2IAMA 4FADA 3UTPD 4LVHB 2DJ4A 1TO5A 2E8YA 3L95A 3QORD 5FDYA 2WNKA 2Q8BH 3V5HB 5J11C 2EUXA 4F7EB 2IQAB 5E6ID 1UKTA 1C1EL 1INQB 2B5IB 4P9ML 4X0KB 4FQPA 1UB6B 3D06A 3VA6A 4JFED 1BF5A 3JWNH 5C0FA 2LU7A 1A6TB 2BCKB 1JYXA 3VXQA 1K5NB 1TZHB 1A6VH 1V3MA 2F8OA 3P77A 1DVQA 4JCMA 3TBTB 1JHTA 1MW3A 1OT1A 4R83A 2VL5B 5EZJA 5LNDA 2AGJL 1IGIH 1TZIA 3O3EA 5F7AA 5F0PB 4BM7A 2VDOB 4P5RA 4YQXH 3UBGA 5C9KA 2W92A 3QJFB 4PVMA 2XNAA 3QDGA 4WEUD 5KZCB 4FFZL 2WKLA 4RESB 1NIAA 1HFUA 4GAYA 2VDQB 1ACYL 1EAPA 2DM4A 1MFDL 4AQ1C 5IVXE 1JPFB 2DM7A 3V6BR 4EIBA 2MQ3A 4JPKL 1O5DT 1UZ8A 1ZIBA 3NFPB 1YMMB 1O9VA 2FATL 1YN7B 1T1WB 2YD0A 3Q2WA 1RIUL 1RULL 4PJEA 1JVKA 3TVMC 3FSVA 3BT2H 1PY4A 5DJDA 3TH3T 3ULSA 1C16B 4ZPTA 1KXVA 1PGRB 3E0GA 1J0JA 4Q7DA 4BV1A 3UBFA 4ODXA 2FSDA 1ADQH 3PU7A 4LL1A 2RJMA 2OK0L 2J5LC 3PQYD 3FRPA 1GOHA 4N22A 1DBJL 3V7AE 5BMFL 4W9CC 2XYCA 4LSTH 2WYHA 4JO2H 3NQIA 2YOCA 3FUHA 2PKDA 3UADA 1CFBA 1NTDA 3SJVD 3DLQR 5C0GB 1FIGH 5J1AA 2PPCA 3DV6A 4QYOB 1XB3A 2YMOA 4JQIH 5GS3A 1G43A 1N8ZB 3F7YA 4Y1AA 3UTQA 5F93C 1NGWB 4C56A 2OXGB 4TSAH 3C5JB 4NFDA 2EVJA 4PRID 1HILB 3O6MH 4XP1H 4AYBA 5C92A 5DQ9B 2I26N 2PO6B 3HCVB 3KDMA 2EDKA 4F2ME 3GXIA 1H3VA 3IBEA 3FYIB 3QI9C 4BA8A 2FWSA 5CNHA 1MJ8L 1P84K 5T1LD 2OJZL 4TNWK 2P49B 3KPPB 9PCYA 1RZFL 1TPXB 2IANA 2J56A 4LLUB 1U8OB 2O26U 3IFOA 4WTQA 4G42A 2EVIA 3DUUA 3QZLA 4G8EA 3ZPDA 4N2EA 2Y7QA 3BKJL 4HAGA 4Y1SA 5CSBA 1QTYT 3G08A 3VXSD 1GXEA 1J8RA 2MPAH 2IJ0C 4OLXL 3SDCC 4ODVH 3MV9D 4X6BA 4D9RD 1XIWD 2J8UB 5I5IA 3RVTC 1P6WA 3LKRA 3NIGF 1CG9A 3HNTH 4FMFA 4Q8BA 5C09E 1U4EA 1H3TA 3H3PL 3MRJA 1XXDC 4HCRH 4P2OB 5DJXA 3IMBA 5B1JA 4FL4B 1PY0A 2MFNA 2AJVH 2NSXA 4R0LA 4DO4A 3GMLA 3FTZA 1ID5I 3HOGA 3RTLA 1F11A 3H9YA 2BSTB 5TFSL 4OUUB 2J8OA 1U8IA 4DIXA 3QFJE 2IDTA 2YPLA 3QORA 4BE6A 1EK3A 4OCYH 4NQVB 1BVLB 1WS8A 1BQKA 1CZ8L 4GQ9L 4KY1H 4M9PA 1MJUH 4JFEA 4X6EB 3QJOA 3Q5TA 2I25N 1I8AA 4LHUD 3FB7A 4WDIB 2YD4A 4LIQE 5D1XB 3REWB 2EAEA 3ILQD 3M17B 3KPRD 4PV1C 4R4FH 5CGBA 5EG6C 4KZDL 5JO5A 1TO4A 1RZGB 3K6SA 4AUUA 4WI8A 4HF5L 4M93C 3LNIA 3NGBB 2OMVA 3DUHA 5C08E 1I9IH 5JW4R 3IGFA 1HCVA 1BXAA 2XWJA 1NICA 1EH9A 3BJLA 3ILPA 1SJVA 3BGFB 1DBAH 1ZIAA 3P54A 2ZKWA 4H8QA 3VI4E 4PM1A 1U92A 2I9LB 2P3YA 3VWJA 1T2QH 2BSED 2Y2WA 1H5BC 4LHQB 3BSZA 4WHYH 5E56A 2EXWD 1NGPH 1U36A 1VZIA 4H44C 4XT1C 4YNYB 5T1DL 3ULUE 3H3KA 2I27N 5GS1B 3KLHC 4V11A 3RX8A 1SXCA 5I18H 4G8GD 4OLUH 5E1AA 1H15A 2OAAA 3BJ91 3O6FD 4U1GB 4XNUL 5JA9A 4JO3H 2I60H 3EJRA 5HHOD 1SGKA 4J5VA 3QO0B 3HZMB 4NZTL 3FYEB 1CN4A 1N5AB 1C5CH 3C6SB 1BX2B 2GUOA 2OLDA 5EEUA 4M6OH 1AY1H 3T1FB 5D1QD 4GUPB 2BC4B 5JW4M 4X7TB 2V7NA 5F0LB 4PR5B 2XKNB 4IM8A 4GO6B 1H3UA 4J3OG 1I4FB 5IMOA 5I23A 3NJNA 1CT8A 3RB7A 3WXWH 4ZDHA 3SJVA 5D7JD 4F2MB 1ZS8A 4HVBA 5IW1B 1FC1A 3OZ9L 4ZUUB 3L1EA 3KYKH 4NP4H 4CVZB 3BPCA 3QUZD 1JVLA 4NUGH 1VRSA 2FSEB 2GI0A 3GKZA 4JGJA 5HHME 5ICUA 2JV6A 2EIZA 4KZ0A 3RL1A 1S7RA 4M7LH 5AVYB 1FI8C 2CIIA 4X80L 3PNWA 2MNWA 4I48A 4X7EC 3LD8B 1SYSB 3CCHA 2FEEL 2Z0BA 4YOKA 2W60A 1VCAA 2O5YL 1DQML 3UZEA 3VXSA 3ZQ9A 3ETTA 2IBGA 5GPRA 5IHBA 2XJLA 3AB0B 1XIWA 1XXFC 2YSSB 1WJ3A 3CC5A 4HC1L 4JUTA 4M6MH 5LAPA 1QSFE 4FQ2H 3TJPA 2ZP0T 3QFJB 5CWSA 4AT6A 1K72A 1NCOA 1A4KA 5EPMA 1ASPA 2VO8A 1CB4A 3QA3A 1RUMH 2WWNA 5MEPA 2J6EH 5IT2H 5D9SA 2EUVA 5EU3A 4BELD 3THMH 3FU8A 5B7FA 1IFRA 1RQ5A 1EJOL 4DZBA 1XMEB 3EJUA 2HRPH 2NNRA 2ZUXA 4XCEA 1WWCA 1WHPA 3L5HA 2WBJB 4UNUA 5DZJA 3W2DL 2IEPA 4JY5L 4OFVA 4Y5YA 3GGWB 5T5FH 3TIDB 3B6SA 3QCVL 1KTLB 1PG7L 4O58L 3IJ7A 1G7IB 4XCCL 3SDYH 3U1QA 4QY8A 2G75A 3ATFA 5I1JL 5EV7A 4LHUA 3TVMD 2CLVA 4BEIA 4J8RB 4I9WE 1D2PA 1N0LB 4UT7L 3KPRA 1LE9A 3CHOA 5ESQA 4G9FA 4ZMWA 1JERA 2IBZX 1M05A 4JM2A 3LKPB 4PRPE 4LFHG 5IESH 1KIPB 2HVJA 3VI4B 4HPYH 2F7OA 3PAVA 4YGAB 4XP5L 1U3HA 3JV4A 4JN1H 2XN9B 2FT8A 1AIFA 5C6WH 4X5XA 5DJ2B 2XWXA 1LO5B 2DWXA 3BPOC 3O9WB 4Y2DC 3T4YB 1RK7A 2E7MA 2JKRM 5CLWA 1MQ8A 1HSBB 2CJ3A 5FEBA 5GISL 2BSEA 5J6HB 3NRPA 3K2KA 5DLMH 1AOHA 3MVSA 1WO2A 2YOAA 8CGTA 4NQDE 4ZUTA 4JY6B 3ARDB 4WI7A 1H3XA 4X9HA 4G8GA 4GBXB 1P2CA 1FFNA 4FTVD 3ZTJH 3QI9D 3U9WA 3KM1A 5HHOA 4X8GA 5E95B 3PDOA 1A7QH 5I1GL 1EHKB 5IWLA 2NY7H 3QUMB 1TLKA 2C4XA 2DQCH 3HZYB 4Y4KB 4KVNL 3CZUB 4NKDB 3ML9A 1KJ2L 4NC1C 2R8SL 5E8DH 2WWMC 4OCMC 4RMTA 5ANME 1DLFH 4HS6A 2VDRL 1FSKB 2H6UA 2ZSWA 3BE1H 2VLMD 4R2GB 5D72L 3SDCD 4I1PA 2I07B 1LXMA 2DAVA 3QIWC 3RVTD 3ZY7A 4TNFA 3D18A 3CVCA 5IUSA 3NCMA 2GJRA 2K8QA 3FMGL 4LT7A 5HHMB 3RFRA 5D7JA 5FA4A 5K1JA 5DUPL 1FGNL 1KIRB 1N59B 2R0KL 3MV01 4XMKL 3RWEB 5L2KD 1HX0A 2JCCE 4MA1B 3ENEA 4P5TC 3L3OA 1NGYA 5JHBA 4GXUM 1HAUA 4KDVA 3U9UA 1MCLA 4W81A 1UGKA 3EOTL 5AW5B 2XRAL 3B2MA 3CFJB 5TF0A 1GGUA 4I77L 3RI5F 2X6VA 2F54A 1T0OA 3Q2LA 3G3LA 4UM8B 3KWTA 1U2HA 2HRGA 1LTXA 4HKXA 3LJ3A 4RMRA 4KMTH 4AIZB 3D4YA 1RZ7H 2VH5H 4IJ3C 1WFJA 4KFMA 3PWJA 1EQWA 2FGWH 4XE0A 5DHYB 3II2A 2XVBA 4JEGB 5E5MB 6FABL 3E6HB 1LM8V 1JHKL 5D1ZC 1KLUB 4YHLH 4CDGC 1G0YR 1TJXA 2PR9A 3BHBA 4ZW5A 2SEBB 2CA4A 3ECQA 4FI7A 3PL6B 5AUMA 3ALWA 1XF3B 3GRGA 3VXRD 1OO2A 2E59A 3GJFK 3NN8A 3QJHB 3RWDB 4DPCX 3T6ZA 1MRFH 1XGYL 4AQ1A 1F3DH 4KBPA 4PJGE 1Z6JT 3CZKA 4Z18A 3KLSA 1CYXA 2GEEA 3AT8A 1YLBB 5JW4Q 3MX0B 4MA8L 1CDHA 1EUUA 3P73B 2JTYA 1IL1A 1TJGL 4RCAA 5AZ2H 4AGMA 5FO2A 5KG9A 4AWJC 3RKPA 3KLHD 2DOCA 3RJDA 3SZ6A 4DGIH 4DCQB 2ZD0A 3VG0L 3TVMA 4DW2H 2PW1B 1UXWA 3UJIH 2E9IA 5IF0B 3F64A 4UNTA 3CSTA 3E1F1 5DC2A 1BAWA 2R0LH 4HJUA 4Z78B 3HFMH 3NSFA 2CHXA 3NJMA 1XR8A 5D2LE 1EFXB 2H0FA 4N2AA 3X13B 1YECL 1W72L 4IKIA 5KYWA 1LP9F 1D6EA 2WO3B 1FCCA 3GNML 2MHAA 5GZNC 2YFNA 3QISA 3N06B 3Q44A 1E0OB 5KJRH 1QFUL 3P30L 3TCXA 4WTXA 4HIHA 32C2A 3MXWH 3PHSA 3ETBF 1BEYL 5FYJH 3PNRB 4H20L 5KYUA 3G5VA 4J3XA 5EF1A 1WITA 2ICWB 3WNOA 4ABWA 3MCLH 5BQ7A 2TSBA 4FTVA 4ZX3A 3QI9A 4KTGA 3D39D 4L9LB 3V0FA 4DKFL 4DUXA 5J6GB 5IBTL 1AJ7L 1LP9A 2Y7NA 3GHEH 2DMHA 1MFEH 1UXSA 4QRQA 2AHIA 1KCBA 2EE0A 1I1AB 1REIA 3FU0A 4HJ1A 4YDVA 2DTML 3GSRA 1HINH 3SQOH 1OQXA 5DU7A 2EE9A 5GRWA 4YAQA 1EO7A 3S3SA 3QQ3B 4HJ0C 1DQDH 3VB8A 1YHPA 4CGUB 4HK0A 1LILA 4CJ1A 3OAUL 4NQSA 1OP5H 3V55A 1E7VA 4FTDA 4ODHL 1IE5A 1QSEE 4EZJA 4KVCH 2Y07H 5CIPB 5JW3H 4ACTA 1FZMA 4K15A 1KT2B 4MSWB 2CLRA 3EFFA 3E3QE 4PHXA 1WRFA 3NRQA 5E4EC 5HI3C 4PJAA 5FKAA 5JHAA 3HR6A 3RZCB 3FUFA 5AKVA 1J11A 1JPGB 3OKYA 1KTDB 2RACA 1IZJA 1E9PA 1JN6A 1AD0A 2VR5A 1TCMA 1KELL 2GKIA 3U1SL 4ZOBA 3U25A 3V4PB 3VXNB 3KYNB 2XWEA 1OCWL 2N7SA 1KIUA 5HBBA 1IAKA 4NAMA 3IN2A 3ZR5A 4UOW1 2ED8A 1JPSL 2XPYA 1S7VA 4FLSA 5CEYB 2YR3A 1UACH 1F58L 3W9DA 4AENB 5CEZH 1F3DJ 1M6OB 1PLCA 5E4AA 3BWUF 1O6SA 1IZKA 3GBLA 4ONOA 5K9QG 3GSVA 1KEMH 1YEDA 3LIZA 2FE0A 1OM9A 3OPZL 1B0GA 2FX8H 2EZ0D 2VJ0A 3KLKA 4WNQA 2ZUVA 3UP6A 4ZQKA 4Z0XA 1OHZA 3BD4A 1MZYA 4Y2DD 5DK2A 3MFGB 4F1ZA 5SX4I 1JJUA 1YN6A 2HJFB 4Z3JA 1F18A 4G7VH 3P0YH 4CU8A 1XCQB 3GRWA 1HI6A 1ZK5A 4D8OA 2W9DL 2O5NA 3HZKA 2VITB 3MUGA 4QMEA 3IKCA 2VUKA 1KJVB 1W6LA 4N8CL 3EAKA 3AM8C 3AXIA 3GM0A 4ETYA 4MCZA 5J9PB 4IRJB 4B95C 1MCRA 3OQRA 5I0XA 1M2VA 4QRRB 4CN1A 1KBGH 3DX2A 1BFSA 2PETA 4OZFB 1EMTH 5ACZB 2WWMD 2A4EA 2GK0B 3BMWA 5BV7H 5JXEA 4N25A 1N67A 3MRQA 3GI8H 3LX9A 3CNKA 4Z3EA 2YC1B 2X4TB 3QIWD 4HZLB 3ASOB 3ZQXA 5DI8A 5DRWB 3F6LA 4YSTA 5DZOA 4OM1H 4AVKA 4ILDA 2P8LA 2X53A 1G9ML 1T1XA 2NX5E 4OF0A 2DLHA 3QVAA 1AGBB 5SWQA 3ZE2F 4P5TD 1M7XA 3PWLA 1RIVH 3VGAC 3AXLB 1QQDB 2N3JA 3LHPH 3D39A 5KVGH 1NDMA 4Z0BL 4NPKA 1MSPA 3K7UA 2KPWA 4HKJB 4ZPVA 1HXYB 2R0ZH 3MBEA 2VLLB 3HPLA 4FMKA 3L3IA 5DZLA 3W39B 1HL5A 2KDYA 2GI7A 1PF3A 3GIVB 1JGDA 4FYQA 2GCYB 4K71C 4YPGA 3TH2T 3MGTB 4F58H 3I6KB 1QSEB 2Z8SA 5B1AB 4HUXA 3TV8A 1KBWA 1QTPA 3D09A 5D1ZD 2LFEA 1HKFA 3PS6A 1J12A 1OSPH 2ZYHA 3KJ6L 2DI9A 2JQZA 5DRZB 3DARA 5E2TL 2FECL 1L9QA 3KBHE 2IH1B 4PLNC 1J8HD 1K4DA 1J0YA 3ATBA 5F21B 1JDCA 3T2QA 2E56A 3LZNA 4G5AA 3KPOA 4TPRH 4B9CA 5DMKB 2BW5A 5DXWA 3STZA 3L54A 3BESR 4JB9L 3KZ8A 1N68A 3SE8H 5DR5H 5FO9A 3OF6D 3WKPA 3QUKA 5FDWB 1G9NL 4ODUA 1AG0A 1OE2A 5DQDL 4R97B 1SUJA 3EDKA 2EDJA 5KBLA 2VOTA 1QFWM 3VD4A 4X99A 3L4CA 1EEZA 1VGEL 2ZUQC 3RPKA 3VH8A 3VD5A 3P0GB 4LCWB 1O75A 2F68X 3HBGA 4K3DH 2X3CA 4AI7A 4U1NA 35C8H 1UC6A 1OGTB 6PCYA 4GRWE 3PDGA 4XVJL 3GO1L 3DWTA 5F72S 1IKFL 3B9EA 5AVUB 2JJTC 3FKUS 4WFGE 2FBRA 2XBDA 2PTTB 4N1CA 5T3ZL 3T3PE 2XA8H 3B1TA 4NPJA 5EBWA 5GZND 1Q9WA 2QR0A 3WLBB 5SX4H 3ES6B 5I1LB 5JYMA 4U1MA 3UOAB 2Q8BL 5F71A 3N91A 4RMQA 3EXLA 3HBPA 1MUJB 2AV1B 1BD2E 3ZE1E 4OF7A 3GMRB 2FL5A 5DK0B 2FX7H 3NT0A 1ND0A 3WTWA 1HEHC 1QG3A 1M3IA 3LHAA 3VGDA 1FNSH 4RFEB 1BQLL 4WI6A 1JGIA 2E76C 4PIRF 1A6VL 3I84A 2CHWA 3QG6A 3VG9B 4RLDA 2W5PA 3ESVF 1IGIL 3JT2A 4Q2ZA 1Z5LB 4Y88A 2WIMA 3RNKA 3QEQA 1QASA 4FFYA 2OW7A 2Q7YA 3NCWA 1SHMA 3GF8A 1HHKB 2WVUA 2XLLA 1HU8A 2R2EA 5C7ZA 3UTSD 2RHEA 1IAIM 3GZPA 2DPKA 4NQEB 5SWZD 2ZCZA 1EX0A 3QIUB 2EDLA 2FWOB 3OMIB 4E9TA 4M7LT 1EEYB 3VGGA 4P5TA 5HI3D 4GAJH 2D31B 3MLTA 3L9RB 3FAXA 4XMXA 1DANU 1XH0A 2J25A 4F15B 3BT2L 4PLOB 4ZAKC 3ARWA 4JRXD 2AEIT 2J1WA 3E8VA 5D7HA 5DVOA 5HI4D 1UGNA 3O45A 4NZDA 2Z4QB 3FFDA 5B1BB 1ADQL 2PP8A 2J7LA 3FT4A 1KBKA 3PWUA 4EMZA 4ZZFA 5J1TC 3QZBA 3PAZA 3BXNA 4HALA 4LQFH 4ELME 1TYJA 3TEUA 2V5YA 3FQXB 3JXAA 2B7DT 1KJMB 1EDQA 5D1ZA 2NY5C 5FECA 2CNYA 4PJFE 1VZGA 5AW3B 1FIGL 4JPQA 4JQIL 4DGUA 1ZSDB 3GZOA 5DJZA 2FX9H 1D5IL 1RHHA 4HIJA 4F7MA 5E6YA 3RGBA 4GS7B 3U0TA 2BINA 5ICZB 2XG5A 2X05A 5IVNA 2OQJB 4JFDB 2D9QB 3OTTA 3OJVC 4IGBB 1UQSB 3ECBA 2NYYC 3MLSL 1O9WA 3KWWA 3L4YA 5D7LE 3GIZH 2DLTA 3B2VL 4WTZA 4PP2B 3T0EA 3V4VA 2IPKA 4MD5B 2C7UB 4HD5A 4PGBB 4NENA 3OJ2C 1NIDA 4GRWB 1WA2X 4PJ7B 1U3JA 3BZ4B 1JZ6A 1HXMA 1MY5A 2FRGP 4XPFH 2X4OA 1DSWA 3RWCA 3TJHC 1XQ4A 2YAPA 1O7DC 1NSNL 5JQ6H 2VTFA 1RKRA 2G3MA 4BGDA 3ZOAA 4AGQA 4DP9X 2ZYSA 4QHNB 3DOHA 4UZUA 2QZ5A 1FNEA 1KLGB 2BWDA 7CGTA 2DWEA 1P5UB 2KPNA 4NZUL 4FGMA 4GH7B 4GT7A 5HXMA 1D5MB 1NGXA 4IYKA 3WNPA 1Q9OA 2K3HA 3BC9A 5EN2B 3UEZA 1D6VH 2EC8A 1NLDH 3QHZH 2FUTA 3FPXA 4QUOA 4FEMA 1BVKA 1DJZA 2PP9A 1SLVA 4OCYL 3VFMB 5DSCB 2CQVA 2EH8H 3RE0A 5TDPB 1MJUL 3DX9A 2EDXA 2Q76B 4TNVK 3D25A 4OGYH 1H19A 4PY8I 5C6TL 1AXTH 1MW2A 2MIZA 4HH9A 2F08A 2XA3A 2ZAGA 1UYWL 4LMQE 2ED7A 4H8VA 4OZHF 1D9KA 3HG1A 3LH8A 5D7EA 1I9IL 1KLFA 3T2NH 4B97A 5F9WB 3ZSTA 4PJ5B 4Y5VC 4U1LA 3C75A 4P3DA 1J48A 4AIOA 1DBAL 3L17A 1IAMA 3TA3A 1MAML 1NC2B 1JP5A 2QGEA 5IBLC 3OC5A 1T2QL 1AHWB 3L13A 4XTRC 4XXCC 3TGXA 1NGPL 3FT2A 5I8CA 2AK4D 3VD0A 4K7PY 2D0HA 1JK8B 1MDTA 5FYKH 2XQ0A 4Q9BA 1TQCB 3IXAB 3MCKA 3NDYE 4U6HB 1T1YA 3BPNB 1XD0A 4JRXA 3TNNB 5DMIH 4K3JL 5T1JA 2ZOLB 4ELMB 4P4KB 4HX1B 4BWWA 3C5SA 1C5CL 3HIZA 3FO9A 2VR6A 4M6OL 1AY1L 4YO0A 4NT6A 1CGXA 1CE1L 5EH1A 5FR3A 2VQ4A 3WKMH 2JMRA 5AAMC 3CSPA 1HKLH 1I7UA 2A6DA 1UA3A 2AQTA 2NY0B 2G3NA 4FQHA 3BEVA 4TSCL 1ZLWH 4QXTA 1WFTA 4NPYB 4I3GA 3WXWL 4GG8A 4ORGA 5IGXH 2R2CA 5IM7A 2WLIA 4PI0A 1HL4A 3M86A 3KYKL 3MNVB 4KXAA 4TM9A 2W80C 1A9BB 4NUGL 2NQDA 3RBGA 2YAOA 1G9HA 3OVUB 4N8VB 1UUSA 2V5SA 3TNMB 5DDHA 2XUWA 5KSBE 1S9KC 4PB0H 3EO0B 3WUWA 3NPSC 4J3OC 3KGSA 3QWOA 1TFPA 3C60B 2H2SC 4XMLH 1F2XK 2F8IA 3OKDB 1DJYA 1OW0A 2GVYA 3RUGB 2X4NB 3AM8A 1H3PH 1BLNA 4TKWA 4LSSL 3UMTA 1A3RL 1B0RB 4FQ2L 5KANI 3I02B 2A73A 2HA1A 3KLDA 5I1AB 4ZW8A 3AS3A 3H42H 4OB5L 4RA3A 3BVNA 1MHHB 4K73A 3UC0L 1PKQE 1NBYA 4MAZA 3DUSB 3VSUA 2CO2A 2HKHH 5DYFA 4OQ1A 1RUML 3AMKA 2J6EL 4ONGH 4XB8A 2A74C 1SF5A 3O11A 5HYFA 1ODUA 3THML 1MFUA 2BNUB 3QXAB 1FZJB 2WIIA 3QXWA 2HRPL 1QEWA 4MASA 5BRZA 5AW7B 1DVZA 1UVQA 2MCPH 2DYSB 3L3JB 3VWKC 2J1XA 4DH2A 5HGAB 3B3BA 2BVOA 1G7JB 1W0VA 4PV9B 1NKOA 2ESVE 1W91A 2ZSVB 5FGSA 4ZAKD 5C0IB 3VTMA 4UAOC 5L7XL 4HHAB 5ALCH 4D8PB 1NJ9A 3N44F 4ZTOH 1OP3H 4V1DE 4AGPA 3HHSA 4DEPB 4S1QH 1QR1B 4KKPA 4L5FH 2WTPA 4UTAL 2R29A 3EYVA 3AQDA 3GMQA 3QQXA 5KEZA 3CFUA 1N64H 4HEPG 2CCLA 5IKCB 4FHBD 1NAKL 3IJHB 4TUKH 1PQZA 5HDOA 3B9VA 4QF1B 4ZI8A 2YIHA 3SKNB 4YHYC 5I71C 2KYIA 1E6OH 1RL1A 3ESMA 5DLML 2UYLA 3GJFA 5D2NC 3X3GL 3QDMD 1AQDA 1R75A 3SPGA 4HGWB 1KF9B 3OB0K 2VMFA 2H1PH 2NYYD 1A7QL 2NY7L 4EZLA 3KHOA 3HRPA 4XZ4A 4P5MA 5E9DD 1A21A 2AW2A 4ZYKB 2WINA 1O7VA 5JOFB 1D5BB 4U7MA 3VB9A 2IWKA 5E8DL 1L7TH 4YE4H 3BP4A 1DLFL 1RU9H 4J2QA 2PWFA 3BE1L 3MQIA 4DTGL 2FTAA 3BUPA 1MVUA 2NY3B 5DJYA 2ZJSH 5G4NA 1MREH 5KYXB 4PJ8C 2DL2A 3X1EA 4Z7UF 3LMJH 1HHIA 2P45B 1IIKA 5TH2A 1JAEA 3AROA 4G8IB 3RHWK 5L0QC 2ZOUA 5CILH 3WFDH 1IC5L 1I1FB 2BERA 1HSAB 4PGEA 4DETA 2JJTA 2EQDA 1MHEA 4DZ8A 4PCTA 3RG1C 2EDYA 3D0VB 3ETSA 4AC4A 3PWPE 4OM0H 4N0CD 3FU6A 2CDEA 3ZDXB 2CG9X 3LIZH 4M7ZC 1QRKA 4Q58C 5BCAA 3ESUF 2WQWA 5J89A 3V4UH 1J88A 3KW7A 3W56A 4GMSL 1JZEA 3OLGA 2IG2L 1PKQB 4KMTL 4YDJA 4DN3H 1RZ7L 3PFQA 3A23A 4LASH 2EH7H 2WAHA 4V33A 5E99H 5BZDB 4NXSA 4YHLL 3GRWH 3RU8L 4MVBC 2X9ZA 2NW2B 4MJ4A 5F1IB 3TT3H 4JFFB 4YFLI 5I30L 3HI1B 1TZOA 1MRFL 3GFUA 4KROC 2DWSA 2Z1PA 4YGVB 4I18C 4CMMA 2NT0A 2E3VA 4PY8J 4QCIA 1G7HA 3SYPA 3QR0A 3FSOA 1KJ3H 4MNQE 4XTRD 2E47A 2ESVB 3CHSA 5H4ZA 5FGRA 3HKZA 5AZ2L 1OSZA 4I2XE 3ZRFC 1MOEA 2YGPA 3HJEA 4LEOA 4DGIL 3FQNA 4V1DB 3CUPB 2ENSA 2Z7ZA 3LZFL 5HJ3B 1GJWA 1JZGA 4P5SA 3TBVB 5ID0B 4DW2L 2BOCA 3LRGA 3NUKA 1DE4B 1F0LA 2JF1A 1ADWA 4ELKA 5I8KH 3UJIL 1EXUA 4EE2A 5KS9E 4Z7QF 4Z3HA 1C7TA 1S3KH 1T83C 2CJUL 3FT3A 1XGUA 1FL6B 2PCXA 3H0TB 1SRDA 1XH3B 4M1DH 3WD5H 1FNAA 2A9BA 2O4EA 3NCCB 3I6LD 4L3FA 4QYAA 4HULB 3PUUA 2WW8A 5ACLA 3Q1EA 1QBMH 3MRCB 1CR9H 3OR6B 4M62L 4YIQA 3ETBJ 3B9KD 3D07A 1F02I 3S34H 5KJRL 4NEHB 2BSRA 1URLA 2C26A 3P40A 2Y9RT 3VFRA 3MXWL 5IHZB 5A43C 4BXSV 3L2LA 5FYJL 1MHCB 4JG1H 2PW2B 1MFCH 3QDMA 1UWFA 3CPUA 3K0WA 4MQ7B 2A6KA 3MCLL 4K4KA 2XXCB 3CSBA 4CNIB 5C0JA 3GMMA 1T0PB 5D1ZI 3UMNA 1AC0A 1QSZA 3L5WB 4N26A 4J3OD 3TO4C 5LN8A 4HETA 5DMYA 5E9DA 2QQQA 4OVVA 1MFEL 4Z7NE 2H2SD 4WLCA 2DQEL 4X4ME 2AFNA