5HHOD

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
195
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoD02
5IEKA 2X44D 3HZYA 4MA8H 1ZSDA 2H3NB 5IW6B 3HZMA 4JRYB 1CL7L 2YD8A 4GQ9H 4YO0A 4L8SB 5T3ZH 2OL3A 1QSFD 3HNSL 2LU3A 5ITBL 3BUTA 5JW5B 2I9TA 2XRAH 5B39G 5TPWL 3V6OA 4DK6A 3SDCC 5FYKH 3VCLA 3C5ZB 4PRIE 3TT1H 4NCDA 3EDKA 4MDIB 4XNQA 5HGAB 4U0RB 5IMKA 4X7FC 2YPKB 1N4XL 3O6KL 4PJDA 5GS1A 4KI1A 4YUEL 1IKFL 2FB4L 1FZJB 3OMZA 1X4ZA 5A2FA 3TA3D 4K94L 2RFXB 2X4NB 4CUCA 3D0LB 4FQIL 5DD0L 1RPQA 3FB7B 3FT2B 3QEQE 3MRNA 3VFTA 3U30C 4TRPL 1NFIA 4UDUB 4MLIA 3C6LA 1YUHB 4KDVA 4WWID 1KCLA 4OB5L 1PSKH 1IBGH 2ICEB 1KULA 3RP1A 4XTRD 5CHNA 3I2CH 2OK0H 4LF3A 1NGXB 5CJOH 4M3JA 5TFSL 1SM3L 4LPUA 3IT8D 3MLRL 4LHUD 3DSNA 4GKZB 4LCCA 3TIEA 1R3HB 2FJFB 5EZLB 2EYRB 2Z91B 4LAJH 2IAND 1A6WH 15C8L 4K71B 1OF2A 5C0ND 4BH8B 1VGEL 3WFCL 5C07E 4Z5RB 2X7LB 5SX4I 4NRYB 2ESVE 1O7SA 4PRIB 4ZFOL 1NCBL 3GKZA 3V5DA 1X6LA 4Y4FA 4X98B 4C57C 4RA3A 2JTDA 2NY6B 2C3VB 4Y5YB 1AJ7L 3SE9H 3QG7L 1VEPA 4I4WB 3T77A 3QEQB 4JO1L 5ERWB 4NKDA 3SJVA 3DVFA 4N5EC 3ZKXB 2G9HA 4R26H 2PYFA 4PYGA 4X9HA 1CD0A 3QCTL 2XKNB 4NN6B 1YQVH 5A43C 2VSDA 1EK3A 3DROB 4OLVL 5EZOL 3PL6B 4OCXH 5HYJE 3HAEG 4H5SB 3R8QA 2V5YA 1J0YA 4S0SD 3CSYB 4QYOA 4RIRB 5IW1A 1HHIA 1CGUA 5I71B 4UU9A 2ZCKL 3EZJB 1HE7A 4BKLB 5ECJE 1TFHA 4H25A 1YY8B 5KN5B 1GGIL 2GUOA 1FRGL 2NYYC 5FGBA 3VGAB 4P57B 1EFXB 2XOTA 3GMLB 5D1XC 1HOCA 2NTSP 1UXWA 1FG2B 1NBYA 2ESVB 5ALBL 5IMMB 3OKDB 4S1RL 3BYYA 1UT9A 3MXWL 1QBML 4LGSB 5J4MA 4R4ND 1I9IL 1A7QL 2BVQA 1HQRA 3V6FA 4DGYH 5KANI 5E6ID 3SKJH 1ZVSA 3L1OL 5IBUB 1ZLVK 5C0FA 2D31B 2BVOB 4U6XB 3FHQA 2DQDL 2H2SC 3I6LE 2FX9L 5DEGB 4LSPL 1HILA 1MFEL 3U0TB 5JPNA 3O6ML 3E6HA 3LQMA 2E7LA 2XZZA 1FVCB 5IGXL 1VHPA 5TQ2L 1BPVA 1IFHL 3MA7A 4J3VA 1B4RA 1T0MB 5C0EB 3X3GL 3L3IB 2J88H 2HRLA 5I16B 3OXRB 4M48H 5GGSY 5I19H 4ZQKB 4HZLA 2AJUL 4BUHA 5FV1L 5IKCB 2FO4A 2VLMD 4WHTA 1FBIH 4ZG1A 1I1AB 4YIQA 3MQIA 4X83A 2NW2A 2CMRL 4NQDB 1KYOJ 5F7KC 4J3XA 3V52H 5E2TH 1CCZA 1B6DA 1MCWW 1MFDH 3JWDL 1BM3H 5HDQL 3RWJB 3WKML 3RUGA 2EDKA 4ZS7L 5I75B 4H88L 1HZHL 5CP7A 2IH3B 1ES0A 1VA9A 3KLDA 1NBVL 4P5MA 4LCYB 3AVEA 1E4JA 1QYGL 5J3HC 5CWSA 4R97B 1SBSH 4K7FB 1XGYH 3MROA 1CFQB 3H42L 1FC2D 1KCSH 3GSWA 4IS6B 1OCWL 4PD4K 4YBLC 5E94A 3RZCB 3TGXA 5JXEC 3GMRB 3GIVB 4QWWD 5CZVL 2ZUWA 3SOBH 4NO3B 3AREA 5DMIL 3IAQA 1NGPH 4X80L 2A6KA 1Q9KA 3AFLA 4ACPA 2WWMD 1UENA 2X4PB 2W07A 4YFLF 4F8TA 1OGTA 4I18A 4FZEL 3RHWK 2EIZB 4I3RL 1NANI 4PJCE 1T0PB 5EO1B 3LHPL 1G9NL 3QUXC 4DN4L 2IANE 2CKNA 2FHFA 1IT9L 5F9OL 3SDCA 1D5MA 4U1LB 5E08L 4KRPC 2CKBL 3QRGH 3O8XC 5T1KD 3ZDYE 3VXMD 1UEMA 3CLFL 5SX5H 1FYHB 2JF1A 1NAML 1UCBH 3VXNB 2BSRA 5JNYA 1MCDA 3TBWA 3WSQL 4PYHA 3FZUC 3HB3D 3LMJH 3L7EB 3G04B 5GJSH 3VWJB 3MJ6A 3O41A 4KJYB 1BAFH 5BV7L 1QLFA 4U0QB 3WJLA 1EVTC 1CT8B 4GG6B 2G60L 3OB0K 4H0GA 1WZKA 3WCYA 1R3LB 3WXVH 4ZTOH 1NEZG 2YSSB 5L88H 1MELA 3FQRB 3MV8E 1N0XH 2FD6H 4NGHH 3ZTJG 5GGQL 3C2SA 4W4NA 2BNQD 3TZVB 5IB3A 1TITA 1TJHL 3TVMB 3GM8A 5I1IL 2GI7A 2VXVH 4ORGA 5F72S 2X1PA 1XGRB 1A6AB 1UEYA 1X6NA 4PJCB 3FJTA 3UTSD 4JVPA 4KI5C 3CC5B 1G6VK 1KIQA 2VIRA 2VTFA 3P40A 4HT1H 1Y18B 3N9GL 4QLRA 4AM0A 5SWSE 5FOBA 4QT5B 4ENED 5F7FA 1I7UA 2R0WL 1FL6A 2M1KA 1URLA 4WHYG 4P5TD 1T2QH 2V2XB 3IDUA 3LPFA 2IG2H 2BVYA 4HAFA 4LRNL 4Y16C 4UB0H 1OGAD 1AFVH 4KY1H 2H41A 2B4CH 5D7LA 1CD8A 4MD5B 4OUUB 4U33A 5C6TH 4POZC 3RNKA 1P7KA 4R4FH 2ARJB 2CRMA 4U1IB 4U1MA 3SGKC 1QR4A 3MV8B 1HXYA 3QFJB 4QRRA 3OGCA 2CDGA 4HWZA 2QQQA 2YBRA 4NQCB 4F33B 1HDMB 3MGAA 1RIHH 3U36A 4P4KD 2EDLA 1CFSB 1RD6A 1K8DB 3FCTB 1CBVH 3CUPA 2WLYA 1J0ZA 3FRPA 5HHVL 4HIIB 2B0SH 3BIKA 5T1MB 1E0OB 1NDMB 3HPLB 2QR0A 4MQTB 1NGQH 4FRWA 4F15C 4DFHA 1CLYH 2GIYA 1U91A 2DQCH 5F9AC 1YA5A 3RGVD 2LABA 2PETA 3SGEI 2C4FT 3ULSB 4PJ9B 5DO2C 5SWSB 5JW4Q 3M45A 4PJIA 3WNOA 1K85A 3QHFL 1WZMA 2W59A 2YZ8A 4HXAH 5EZIL 2MCPL 3U82B 5I73B 2ATKB 4CN4A 5IVXE 1V7ML 4PRPE 1BJ8A 3IFOB 3MGOB 3R1GH 4R8WL 2OL3L 4X6EB 1IARB 3U48A 5B38B 5I17B 3QIUA 1FFNA 4KK8C 5D2LF 4L4VA 3RVTC 5C7XL 3ALXA 1AKJA 1VFAA 5A2JH 4P46C 4MQXD 3MRGA 4UV7H 2V5SA 1IZKA 3TM6A 1RIVL 4L8DB 2UZXB 3CPLB 5GGRB 3KWWB 3SDXE 1YEJH 4W6YB 2GSIB 3KAAA 3IF1A 3Q6GH 4JY5L 2HT2C 2EKSA 4HIEB 4YHIB 1CN4A 3FB5B 4RFEA 2YPVL 2KQNA 4D0BB 3BGFB 5T5FL 2BC4B 2FSEA 2IPUG 3RY4A 4UOW0 3LY6A 3TYFA 5D7IB 4FQLH 4B7IA 3QH3A 1FFOA 3QDJA 4KROD 7FABH 4ZUWB 4J1UA 4UUJB 2BDNL 2J4WL 5DJAA 1I8KA 5DC0A 4YHYB 1XIWB 3RDTD 5CD5C 4LLDA 1TQCC 4WFHE 1OAQH 3PE9A 1U8IB 4ZO8A 4BH7A 3LKNA 2RAMA 1CF8L 5HGBB 4MJ6B 4OKVB 5IVXB 4PRPB 1INDL 3D9AL 3FQWB 4G6KH 1PVHA 1BGXL 4LLQB 5J11C 4RBPK 3IJYB 5JHLH 1JN6B 1U3YA 4OF8A 2GJZB 1QFHA 2QKIB 3VXME 2Y36H 4XVSL 2EZ0C 2FZ3A 3BGMB 1DBML 5CEZD 3LS4L 4MJ5B 3B9KB 4I3GA 3KPLB 4NQED 3VD7A 3SDXB 3TNMA 2EE2A 5K59F 3QNZA 2WWKO 3O4LD 5I8KH 4PP1D 3BW9B 5GIRA 2HT4D 1Q0YH 4YXKL 3H3PL 3D69A 5F7HA 1QBLH 5JXEA 4PGCA 4NDMB 5IJVB 4MVBC 4JZNB 2MHAA 3IGAA 4NCC2 2WP3O 2FX7H 1AC6A 1F3RB 5D7JD 4Y2DC 3QUXA 4M43H 4IRSB 3G5YA 4FQHB 4HBQA 4LVOB 3GO1H 5CMAA 4FXKB 2Q86B 2EE9A 5TF1H 4PV9A 4MXVF 4R6UA 1KPRA 5A1AA 1UM4L 4FXLA 4NWUL 4NZUL 5ANME 3GMQA 1JWMA 2ARWA 5FCUH 3O8XA 2BY2A 2IQAB 1KTLA 3ZL4H 5FECA 1MHCA 1RIUH 2QV2A 2OZ4H 4CGTA 1FNEA 4Y1AB 4CDGC 4O2EB 4D3CH 4R3SA 4OT1L 4MNHB 1GGBL 2VAJA 1YPZE 4XBEL 5AZ2L 1VADA 1MCRA 2HG5A 3ARBA 4WI7A 3U0WH 3Q3GA 1FAKT 1OGAE 2X4SB 3IAGC 5ABDE 1YMHA 3M17B 5EZJB 5J1AB 3W82A 1NLDL 4IRJB 4EI5D 1MAKA 3ZYZA 1F90L 1FZKB 2WIMA 4BSWA 1A2YA 1MLCA 1CU4L 2ILLA 4YH6A 1SEQH 4K9EH 3ULVC 1IQWL 4U2YA 4BFBD 1N6VA 5J0BA 5DEZA 3UTPD 2W9EH 3MLZH 2P42B 2AVGA 3MLXH 1NL0H 1JPST 3C5SA 2F54D 3WDJA 2CUIA 2WQRA 3FFDA 5DD6A 4L4TD 2H26A 1RUQH 1X5FA 4PJDF 4WW2C 3WHXB 1HHGA 3FQNB 3QRFM 4JANB 5KZCD 4BQ8A 5HI4D 3WFHB 2X70B 3RWDA 1SQ2N 2CIKB 3NOIA 3CZFA 5ANMB 3CVIH 4JY4B 5IROC 3P4NB 1K2DB 1L4IA 1U36A 3CFJA 2BX5A 3WS6A 5E8OA 1MCCA 1IGYA 5E8EB 1QLEH 3KYAA 1U8MA 4Y16A 3WDHA 3PQYD 3O0RL 5FDYA 2PW1B 3BPOB 1A1OA 2R2BA 5HGGS 2VL4A 2XZAL 4IIQC 2Q8BL 1S5HA 4GKOA 1UCTA 3ABZA 5MP6H 2BMKA 1MWAL 1QSEA 2ZOLA 4IBLT 3NACH 3GSQB 4XP9H 4GUPA 4YDKL 1QRNE 1CDYA 4KJQD 3GK8L 3QUMB 5FYKD 3PWUA 4LEOB 5C0IB 1V5JA 2CRZA 3NFSL 4OIAA 4JHAL 2HJLB 3FTGA 4LSSL 3EGSB 4KTEH 4X0KB 1AXTH 5DR5H 4LVHB 4L3CA 4XHQA 3WFBH 3BRFA 3UYRH 1HKLH 4KMLB 3Q1SH 3WD5H 1ED3B 3IB4A 2BVPA 1RUAL 5ILTH 1OOAA 2HT3D 5GRJL 3C08L 1B4JL 2BOCA 5I1HH 1ZLSH 4X5LA 1BZQK 5A2IH 5ID1A 3KXFA 4YX2H 1KJ3H 1LO2H 3QPQD 1H8OA 5KSAB 1R5WB 3RWHA 1DUYB 4OD3H 1JGDB 1OTTC 2XIDA 3A6OA 4XCNB 2DMKA 3HA0A 4U1NB 5HYSG 3DX7A 1MNUH 3ZT5A 1D9KD 3TJEL 2C1OA 3S35X 4OAWB 4H1LH 5FYJU 1J1PL 1CD9B 4OLYH 2WM0A 4YHMH 2BFVH 4HW6A 3CFCH 4P9HH 5KW9L 1D5IH 2XACC 2YD3A 5DUPH 5CEZE 4YQXL 3K81A 1QRNB 5EIVA 2QQNL 4HFUH 3TEUA 4PGEA 5EO9A 1JUFB 5C09E 4PUBH 2IAMB 1I75A 4G8FA 3O3BB 1UXSB 1DVFC 3QIWB 4K3DH 4A6YA 1NMBH 2EDBA 4HEME 4R0LC 3GMPB 3SBWC 3DYOA 1AP2A 4P2CG 4OZGB 4QRSA 4XZUB 3SCMA 2VDKH 1OAXL 1T22B 2A6JB 5C70A 3AS2A 2DDQH 1C5CH 3VI3F 3BZEA 4UBDD 3DARA 3L5JA 1KNOA 5DMGD 4ALAL 5F9JA 2Y6SC 1RUML 4PLNC 1GXEA 4HS3A 5EC2A 2DJUA 4JR9H 5L6YH 3UTTA 3OKEB 5IMOA 4WV1B 3S88H 1FYTE 1G7MA 2PXYB 3TO4A 3MRLA 2W1NA 4OZFA 1U41A 1NQBA 4JFFB 3WO4C 3OZ9H 1S5IL 3N85L 1PZ5B 5GGUA 1GIGH 1W0VB 3AS3A 4I0PC 1X7QB 4Y4KA 3U7WH 5DMKB 1AHWC 1QHOA 1T0NB 3BDYH 2AXHA 2NY4D 1J12A 1ZHKB 1UM6H 1I7ZA 5CAYB 2PO6C 5C09B 8FABA 1WWWX 1H3PH 5E99L 5E56A 4C4KT 1GGYA 1A9EB 3OKNB 3C9NA 2YUXA 1MCHA 3F7VA 2FIKB 1QQDA 5IIEA 4PR5B 4KXZH 4Y2DA 5BRZD 4LDEB 5EBWA 3RUGF 1KXQE 4M1CD 1Y0LB 2Y06L 4JRXB 1J5OL 2O5YL 4E5XA 1I4FB 3QO0B 4PRHA 2OR7A 4MGXA 4DVBB 5FFLA 1YEKL 5GS2D 5H2BA 2A77H 4AENB 1YNKL 3MV7B 1A7PL 1CS6A 3BN9C 4XPAL 1I1YB 1FE8L 5FKAA 4JO4L 3TN0B 3OJMB 5EDXA 4D9QD 3RWEA 4JN1H 1FYTB 4MB4A 3LD8C 4LBEA 3QISA 1W0WB 5SWZB 1JVKA 2Q76B 1RI8A 3J8F7 1MEXL 1F42A 3JUYA 2XKSA 4Y5XC 1IGTB 2IBGA 2VLJA 3DV6A 5C0AD 5I1EH 5CP3H 5GGVY 5D96B 3H9SA 4TSAH 3QEHA 4LOUC 3SPVA 2B39A 4GBXB 1T83C 4Y88A 4XC1L 4M8QB 3ZSSA 4EUPH 2HFEA 3V0VB 1JGUL 1WIUA 3EYOA 4HC1H 2AEPH 4LEXL 5L0QC 4L4JA 1GGTA 4WW2A 1MCKA 3MOBH 2ARJQ 2JIXA 2YKLH 1IC7L 3GSNH 3PHQA 1KENH 4LAQH 4R2GB 4Y19E 2V5MA 2R1YB 5EU7C 3HC0B 2FJGA 4JQVC 2FL5B 5IROA 5DT1L 1DJSA 4UQ3B 3O6LL 2UZIH 4PRNA 3C8HA 3QEUA 3W39A 4K3EL 1EAPA 4YHOL 3OX8B 3HE6C 5BW7C 5I1JL 4UV4L 3P9LA 5FYJH 1U8PB 2VXUH 2W65A 1T7VA 3MTRA 4QCIB 3G5XB 5DTFA 4D0DA 2FWOA 3O2WH 1FV1B 5DJ0B 4PJ8B 3C09C 4PD4J 3KYOA 3ZTNL 4AJ0A 5F7WC 4LSQH 3RX7A 4GQPH 1VGKA 1R5VA 1SMOA 2VH5L 1C1EL 1B2WH 2ZPKH 3I84A 1C5BH 4MA7H 2ZSWA 5E00B 6FABH 2JKXA 5EN2B 4OCNC 3LB6D 5CZXC 4HD9A 3EOYG 4S1QL 5JW3L 1LO4L 3KPSD 2M26A 4N1HB 1FVEB 1VDGA 3FONB 4Y19B 2GCYA 5FDWA 2IH1A 4HKJB 1U8HA 1JHLH 3O3DA 3MRMA 2F53A 2NY2B 3BZDA 3VA6A 1SEBB 3X3FL 3SDDB 2BSSA 3WNKA 4I5BB 4QTHA 5CGTA 2K7QA 5E2WL 2P47B 2VDNH 1HINL 5F71A 4XNMA 2G5BB 2UUDH 3VH8G 4U6VL 4JDZB 4JFXA 1BX2B 1T5XB 1LK2A 4MNGB 2VLKA 4HV8A 4AYFA 3MYZA 3NFNB 1GPOH 1U2HA 2DS4A 4NC1E 2XG4A 4QF1B 1PLGH 4YNYA 4MJ4A 1TTFA 4FQPA 2ICWJ 3RHWF 2JELH 3MGTB 4JO3L 3A6BH 3NMEA 4P2OB 1T20B 1N6QL 2DBLH 3HRZB 1JHTB 3ES6A 4PJIF 3SBWA 2QHRL 4PB9H 5CJBA 1JWUA 2RBLA 4NC0B 1DL7H 3RPIA 1I9RH 1KTDB 1T21A 3OXSA 4JGUA 3KNBB 4JPWH 4GT7A 3VMOA 1BQHG 3MACH 5IB1B 1E6JL 2IALA 4J3UA 2EEAA 2EIDA 1O5DT 5ESQA 1YJDC 5FA4B 2R0ZH 1EUTA 3ZYIA 3BZFA 4FTVA 4MCZA 4JCLA 3VWKA 3B2UC 4Z95L 1MAML 4B53A 2JJSC 1N8ZB 4PGJA 4LLWB 1S7QA 2FCBA 1I7RB 4HK3N 1MVFA 1JIBA 5INDA 4N0UA 2VNCA 5DJXA 3RVWC 2HWZL 5E4EB 4F7EA 3L3HA 4EIGB 4D9QE 3UTQA 1AO7A 3VXTA 4GFTB 2BOBA 4GW5B 1RAMA 1PAMA 1SBBA 4I0PA 3VDAA 1H8NA 3C6LD 2CRIA 3ILQD 5IEHB 5LGJA 2DYPD 1FZMB 2XFXB 3ILPB 1OAYH 4Q7DA 5HY9B 5I0DA 1LNUB 1X5KA 3U6RB 5D2LE 3CFEB 3PHOB 2A9MH 5C0AE 2PO6A 5DRWB 1SY6A 3VXPA 4PG9A 3VI4F 5HD8C 4M8VA 3VGFA 1T3FB 4R9HA 4JFQB 5F7UA 1YYLH 4DKEH 2N4IA 3I6GA 1WV7T 1YEFH 2A0LC 4M1DH 4JAMB 5F1IA 2EICA 2ERJC 4DW2H 3WN5A 1QNZL 1QFPA 4JPKL 4QHNA 1XGQB 2Q3AA 4OZHA 1S9VB 1C7SA 2R23B 2XTJC 2HTLC 1XGUA 3LEVL 5SWQA 4HBCH 2DIJA 4P23A 1DE4A 3BMVA 3DXAD 4Y4FD 3FO2B 4MNQA 2F5AH 3KLHC 4F2MB 1RY7B 4BZ1H 5FGCE 2QEJA 5ICYB 4TSCL 4JKPL 4YXLH 2I60L 2DM2A 4G9FE 4K9EC 3CSPA 5FUZL 3KPQA 4X4XA 1NH6A 1IAII 5D1ZB 4ONFL 4YHLL 3T4AB 5I8OH 5IOPA 3V5HB 4HZAA 4WHDA 1KJVA 4G9DB 4QXGH 4RGOL 2YRLA 4PP2B 3LZFH 5D2LB 5HVWA 4LHJB 3TO2A 4YWGH 3IRPX 1OL0A 4QXTA 1FL3A 3L3OA 3PG2A 4TQEH 1NGZA 3QHZH 1IGCH 1JPSH 1DQQA 4OQTA 5E8PA 5IK3A 4DQOL 1UJTA 3FRUB 4FFZH 3MO1B 4FABH 5I1GL 1TNNA 3MRKB 4QRTB 4HLZG 1NAMB 3V2AR 4HXBL 4JQVA 4A6YL 3QPXL 1VFBB 3MODH 3VW3L 1MLBA 2FECI 1RK1B 3NTCH 2W0PA 1NC2A 3Q5YA 2WBJB 5GRZA 1F45A 3QXAA 2W9LA 1J18A 1WISA 3NGBC 2NY0B 3JV4B 4GRWH 4NN7B 3UROR 5FGCB 4DGIH 4YHNB 4JREC 1A21A 3BP6A 1J88A 4D9RD 3KPOA 4G9FB 1R24B 3ZE1F 5BO1L 5I9QB 4I9WE 4LVNC 4CADA 2AJYH 5C0RH 1FPTH 2GTWB 3OKLB 1S7UB 2YWZA 2VXSH 1A22B 2CK0H 2DQTL 3T65B 3MRRB 3G5ZB 1DBJH 1P84K 3FOLB 1F4YL 3L3GA 4KI5F 5F1SA 1MJJB 2OJZL 4NKQB 1C08B 4POYA 5F7MC 5IFAL 4OZIA 3AC0A 2Q6WB 2CUHA 5AZEH 5J13B 5LQBL 1UC6A 1Z2KA 3QJFB 4GQ9L 3HUJB 5J12C 3G6DL 5T3ZL 4ZUTB 3P4OA 1K5NA 3IXTB 3TBVA 3GJEB 2K3TA 3NN8B 2N7BA 3OKOB 3HAEH 5FM4A 3RWCB 1X5AA 2CK2A 3WLBA 4X4YA 2VE6B 3PWLB 3V4UH 4UNVA 3TT1L 1KJ2H 4QRQA 1MJ7L 4WW1A 1I1CA 2P8MB 3ECBB 1XCQB 4P9HC 2B8OT 4WGWB 3MCLL 2VDMH 3BESR 5I1KL 4IJ3B 3V6OE 5FKPB 1DQLL 1CDCA 1XF4B 3HNVH 3DBXB 3T2NH 4Q9BA 4UAOC 1MFAH 4TULL 2EXWC 5E5MB 1AXSA 5I1LB 1RFDH 1KB5A 1BQHB 1YYML 1HSAB 4I8DA 2ZUQB 4O02L 1PSKL 1RZ8B 4JN2A 5DHXB 4MA3B 4LHUG 2VZTA 4KU1A 1RK0B 1JK8B 2O5ZL 1G9EA 2XPGA 4HUWA 4K23L 4WUKL 3QI9A 3MBEA 3ARED 3TBSB 2GEEA 4Q6IC 2DQHH 3HZYB 1ZSDB 3DUSA 2UWEE 4XXDB 5T1DL 3W0WD 1FNSH 4YO0B 4ISVA 3ULVL 5L8JB 1MPAL 5BMFH 4X9IA 3F12A 1TENA 1A3LH 1NCWL 5JO5A 2CXGA 4M93C 3BXNB 4XNQB 1Z0NA 5IMKB 4JZJB 5L8KB 3S35H 2F9BT 4XMPH 3JV6A 4IDJH 5JQ6L 3HTLX 2OR9H 4Z78A 3GHBH 1MIEL 1YQVL 2XQBH 5DGQA 4G6JH 4KKAD 3NPSC 4QHKJ 4HX1B 3X17A 3MRNB 3A6CL 3SJVE 1S9XB 1QACA 5DGRA 3H3KA 2F8OA 5TE7H 4APQC 2ZNXA 3LS5H 4XWOC 3KGRA 1CICC 2L4OA 2JK5A 3BKMH 5FM5M 3V7AE 2HRPH 4CW1A 4GS7B 2ZSVA 4P4RA 5ALCH 2R0KH 2UWEB 3PGCB 2EO1A 3TIEB 3I3DA 5JPMB 2EDTA 3H9ZA 4D2NA 4LPTA 4GKNA 3SDAB 3MLVH 4WI8A 3PABA 4X7CC 2QSCH 3CIQA 4JHZA 1VACA 5CGYC 4HCRA 4UNTA 3LRGA 3AM8C 3WNPA 1Q9LA 3V5DB 1I85C 3DTXA 5INCA 5KJRL 2NY5C 1H3VA 4XP6H 1KCRH 2NY1B 5D7LD 1XR9B 2FJHB 3VI3E 1LE5A 3VRJB 3V0WL 3HMXA 3QCUL 3QUZD 2ADJB 3SJVB 3MRCA 3FN0L 3M8OL 5B4MD 4RFOH 2IMNA 2VDRH 4M62L 4N5UA 4ZTPL 4WWKB 3DO3A 1CD1B 4OFYD 5B22A 2IADA 2MSPA 4OBRA 4M7JL 4MA1B 3EJYD 5C0JA 3TV3H 2WSKA 4X5WB 5IW1B 3ZTJH 2PKDA 4FQXA 4DKFL 1L0XA 3UPCA 1RUPH 3MREA 4N8CH 1UJ3B 3MYJA 2GUOB 2H32H 5EC1A 1MCNA 3U7AA 5GJTH 4ZXBA 5BOZG 3FB8B 3LKOA 1NBYB 5L7XH 1TPXB 4BA8A 3QIUD 2VLRA 2YEZA 4IHOB 4XPTL 4P2RA 2R8SH 1FN4B 5TH2A 1AKJD 4PGDA 2DM7A 1G7JA 1TZHB 3OSKA 4K71C 2ZOKB 4M1GL 5IR1A 1JZ6A 4KVNH 1L7IH 1A6ZA 3NCFB 4ZDHA 3D85A 3ULVF 4WHYH 3BO8B 5LBSH 1U0QA 1ZVSB 5TDOB 5E8NB 4Z6AT 3BP7A 4QHLB 3FQUB 1XGYL 5HHMB 4ZUVA 1UFUA 3VXSD 4AMKL 3P73A 3ARWA 4OLUL 1DANT 3VE0B 4WW2F 25C8L 5DJYB 3H8NA 2XNAB 2VC2H 5C0CA 4H0HB 3QULA 2DD8H 3NAAH 5HDOA 4NKIH 1EEZB 2YRPA 4LPXA 1S78D 1P7QA 3JWNC 3B6SB 5FHAL 1SY6L 1S9YA 3GUTB 2FO4B 4WHTB 5AAWA 1WVZA 1T66C 3L5XH 4YDIL 3QRGL 2FEDD 4PJHA 2Y7QA 4NHCH 1G7PA 1RHHB 1MWAB 2X4TA 1CVSC 3D25A 2X5PA 1CFVH 3O9WC 3MBXH 4RGNC 1X5YA 4KK6D 1FJ1A 4J2XA 2H1PH 3VGAC 4EVNB 3ZMRA 3DNKA 2MPAL 1JNNL 5EB9A 3D39D 1A0QH 4OFKA 3KJ6H 4KDTC 4NGHL 3BP4A 2GFBA 1W72A 5GRWA 4P5MB 5TQ0H 5K9JH 2HKHL 2KUTA 4YGAB 5CWSB 5JXED 3CVHH 1HWGB 5GPRA 1NMAH 2NR6D 5DRXA 3CDCA 5TDPB 1MRDH 2VXVL 1ORSA 3GSWB 3KPRA 4Q6IA 3MRJA 2XZCH 4HS8H 1JGVL 3TPKA 4KHTL 4M00A 3C60B 3RTQC 1CLOH 1NFDB 3Q0HA 4LSDA 4XCEB 4HT1L 5I30L 5GSRB 1FNGB 4RMWA 3QXVA 4JFHE 1ZGLM 1E4WH 5IHBA 2OMBA 2NPLX 1BZ9A 1HQ4A 4LNRB 3G6JB 5BXFA 5E70A 4KRPD 4M6NH 5DJ2B 5EG6C 4DK3A 4OQTL 3X11A 3SDCB 3VG0H 2VZOA 3PXJA 2Y23A 2YK1L 3GSUB 2D7TL 4M7ZC 1ITBB 2Z4QA 2DQJL 1ZTXL 5DWUH 3MZTA 3FZUD 1U58A 3JV0A 3LDBB 5JOPE 3D5OF 5DK3A 3ARFC 5DLML 4XPBL 4G7VL 2BSRB 3ULUH 5E9DA 3ARBD 5CIPH 1XGTA 5CEYA 2QSQA 4LPYA 4ZD3L 1MQKH 2E7MA 4GRMB 3IDNA 1IEBA 2C26A 2AQ1A 3U30B 2I24N 1Y6KR 2HLAA 4JGMA 4QY8B 1FFRA 4W6XB 1MCOL 1RIHL 1AGBA 2W0LA 3UTZA 4APQA 4QRRE 2WLZA 1CBVL 1CICA 1CIUA 1J8HE 2B0SL 4QRUB 5EOQH 2GAZA 2GKIA 3WEXB 4XPFH 1CLYL 4JRWA 4QOKE 3WHE1 2IFFH 3PJSA 1QO3A 1UM5L 4KQ3L 2X4UA 4ORGB 3BT2H 2D03L 3VGGA 3LSOA 2XWJA 1VPOH 3MUHL 4WU7A 1YDPB 1LDPH 4EXKA 1KIQB 2VIRB 4KKBC 3NZHH 5BVPL 5IW6A 2H3NA 5C0GA 4K07A 5GS3A 1MHPH 4JRYA 1F3DH 1GZPA 2FEEL 3ARDC 5FOBB 4HF5H 1GL4B 4Y16D 1DQDH 4I1NB 4L8SA 1FL6B 1FNHA 4XAKD 4LPWA 3C5JB 1C5DA 4UV7L 5JW4M 4QHMB 4L4VE 3O81A 3OAZK 1U3HC 5EA0H 4C83A 5ADPH 5JW5A 3S37X 1QSED 3ARQA 1OD9A 1WUNT 3Q6GL 3EO0B 4MDIA 4MAYC 3S96B 5HGAA 4WUUB 4X8JA 1IGJB 2MKWA 1A7OL 1FZJA 4QRRB 1HXYB 1JMXA 3OGCB 3QCVL 4HWZB 1T80A 2RFXA 1J8HB 1KB5L 3MV11 3D0LA 2AKRB 4OZHF 3BAEH 3FB7A 3HG1D 1MCJA 5FIEA 2P5EB 3PWNB 5J1TC 3SKUD 2WQ8A 4QOKB 1LHZA 4UINH 3CUPB 1T7WA 4XNZC 1I3GL 1YUHA 3BIKB 3EO9H 4I2XB 2BVEA 3KPNB 1UWXK 4RMRA 4RMTA 3T3PF 3QDJE 3HNTL 4O00A 4YZFF 1EXUB 1DBAH 3R06B 1JFQL 1GC1H 3KXFD 1NGXA 4XNYH 1ULVA 1MF2L 5D1XB 5F8QC 4CDHA 2M2DA 4GKZA 1R3HA 2FJFA 5DDHA 2EYRA 5EUOE 2Z91A 2BNRE 5FCSH 2XA8H 2Y36L 3HI5H 3SE3C 1FFNB 4BH8A 1YJDL 4ODBD 4L4VB 2DLEA 2UVEA 2X1OA 3EJZC 1G1YA 2DN7A 2ITCA 2X7LA 2KBGA 3KYMA 3T4YB 4YE4H 5LGHL 4NRYA 4NZJA 1ORQB 4OI7A 1EJ6A 1A02N 2AI0H 5I8KL 3ZE2E 2XQYG 4X98A 1GGCH 4IM8A 2ORBH 1G0DA 4ZAKC 1JZ4A 3NVQA 3QUYD 2C3VA 5KVEL 3H9YA 4ONHA 4RFEB 4PFEA 1V7NL 4DEPC 3QEQA 5ERWA 4M7KL 2FSEB 1HYSC 5I76B 1H3XA 3TYFB 2XKNA 2CDFB 1RJCA 3DROA 4L9DA 3SCMD 4CBPA 4W81A 1EFQA 2WBWB 1FFOB 4Z7OF 3W9EB 4I13B 1TJIL 5CD5D 1FSKC 2C5DC 4J1UB 1OTUC 5EWIH 4L8BA 5F3HA 5DJAB 2YA1A 4H5SA 1JYNA 1I8KB 4I77L 3ZHKA 3AU1B 3CSYA 4RIRA 2X6MA 1KN2H 4L3EB 3PWPE 2VERN 1RIUL 3UTTD 5EUOB 1RULL 3O3EB 2IQ9H 2KKQA 3CDYA 3TO4D 1SVZA 2BNRB 2AJVH 4JVWA 5KN5A 1FQ9C 4P57A 5KVDL 2OQJA 1LQSR 2WMPA 3GMLA 5D72H 1FVDA 1Z3GL 4Y4KD 4OZIF 2ESVA 3BKJH 5E5UB 1JI2A 1NANH 3QDMD 1IRAY 5AUMB 1WBZB 3CMOL 1MCEA 4K9EL 2FBJH 3QNZB 4JG0H 5HPOA 5MI0C 4MYWB 5DEFB 5GIRB 1CGSL 3CXDH 1F3JA 3VGBA 4LIQL 3ZE1E 4M6OH 2PR4H 1MIML 3MLXL 4OLZH 3HMXL 4PGCB 1W8NA 2D31A 2BVOA 4U6XA 3KR3L 1X5GA 3EZ8A 1GYAA 1N3NB 5DEGA 3NCCB 5DRNB 3U0TA 3UBXA 1J0JA 4KI5E 4K3JH 1RZKH 3W11C 4JQIH 3QBTB 1T0MA 3BGFC 5C0EA 3C87A 4PV9B 1S3KH 5E95B 3L3IA 5A2KH 3PWPB 1AD9B 1QKZL 4YEFA 3GGWA 5I16A 3REWB 4ZQKA 1KTRL 4MXQD 5E6ZA 2YUZA 4XCFH 5IKCA 3PDGA 1QR1B 3KYKH 1MHCB 2MJWA 3ARFA 4KKCC 3EDFA 4L29B 3MLUL 5I74B 1K6QH 4B5EA 1P84J 4NQDA 1KN4H 2RCSL 4UT9H 5DZLA 2O26U 1C16B 1PY4A 1PEWA 4OTXH 3RU8H 3RWJA 2XZQH 1QSEE 4NQVB 4PJEA 5DVOA 4UT6L 1CDUA 5BQ7A 2C3WA 1H15A 2IH3A 4QRPA 1KCUH 4FHBD 1FORH 4KZDH 1BF8A 2E9WA 1D5XA 4GAYA 4LSRH 3UYRL 4FXGA 5CSBA 1HKLL 3WD5L 5BCAA 1TJGL 1AGFA 4AEFA 2XV6B 4BZYA 3S4SG 4OGXL 1I8LC 3U46A 2JIXD 3FFDB 5DD6B 1ZS8B 2DWDA 3RZCA 4IS6A 4WO4C 2YUVA 5D2NC 3Q6FA 3IJSB 1MCSA 4NO3A 4ERSH 2E27H 3CX5K 1KLUA 4LQFH 8CGTA 2ZP0T 2EIZA 4RCAA 4Z7VA 3QT2A 5T33L 4OLYL 1HHHB 4QHUA 1U8MB 2XWTB 3S5LG 4LVOC 4YHML 3ZDZF 4NHUB 1WTGT 3VXQB 1NC4B 4ONGH 4P9HL 5DD1H 3S97C 2WUBH 1S5HB 5DUPL 4OD1L 2DLFH 5TE4L 4MAYA 2VUYA 4HFUL 3WIIH 2D0GA 1ZHNB 4OCWL 1HH9B 4DTGL 2AJXL 4GUPB 1RURL 3VXNA 5A3IC 3S3PA 1P4IH 3L7EA 3G04A 3VWJA 4KJYA 1NMBL 4HK3J 3BP5B 1CT8A 4ZO9A 4GG6A 1U95B 1SYSB 1W72L 1J7VR 5D1QC 5FUOH 5C0BD 1FO0B 3K2MC 2YSSA 5F6HJ 3FQRA 4JFZH 4F15B 2L0DA 2OS7A 4WY7H 4RISH 2EXYC 1AE6H 4M7LL 3TVMA 2QADD 3RI5K 4DOHE 1ERNA 2F53D 3HC3L 2CLVA 5A40E 3HPJA 1A6AA 4K2UL 5K9OA 4PJCA 1EO8L 1A6UH 3CC5A 2VN7A 3OZ9L 3UTTE 4X99B 3DX7B 1Q94B 4K8RC 4P46B 5LWYH 1BD2B 2C1OB 1UWGL 1E6OH 1WT5A 1NCAH 2D0FA 2R1WB 1P7HL 1WSST 4MHHG 1MRCH 3HAEA 4GAJL 4TTDD 4RSVA 1ZLUK 1CK0L 1UM6L 4ZAKA 4CN1A 5BZDB 2VR4A 5T3ZE 2WANA 2X1WL 3U9UA 1Q8MA 4MD5A 5ICXA 2AK1L 3GNML 4OUUA 1UYWH 4D9LL 1LD9B 1ZEAL 3QZWB 3D87B 5IF0B 1IC4H 1LGVA 4A6YB 3TJHD 1UWEL 2EIEA 3QFJA 1BHGA 3SE8L 4NQCA 1FDLH 1HDMA 4QRSB 5FOJA 3AY4C 1CFSA 2ENSA 2F54B 4PRHE 4FTVD 2DAVA 2Y6SD 3RVUD 3VWKD 3DVNA 4JN1L 5T1MA 1NDMA 5HVHC 3HPLA 5IHUH 3BKCL 4ODHL 1YECL 5F9JB 3AB0C 4MXWH 4XVJL 1EHLH 4MWFB 1FGVH 1BVLB 4NN5B 3OAUH 3U1SH 5IMOB 5J11B 5EU5B 3MRLB 1PEZA 4N9GB 3EHBC 4PJ9A 1FFPA 1F4WH 4UOJA 3JZ7A 1TLKA 4XWGH 2DQUH 2MQCA 2ED9A 3LKQB 4HIXH 5CKAA 5DD5L 5JUEH 2NY5L 4TSAL 5I17A 3LRHA 3T2OA 2VLJE 5HYFA 2PO6D 4OM0H 4P3CL 2F74A 2DRUA 3H9SE 4G7YH 3HZVB 4X7TA 1BOGA 2JJTC 3ULVE 1NUFA 1FNFA 2AEPL 2G2RA 3CPLA 5GGRA 1NCCH 4PJHF 1MFBH 3BJ91 4J3SA 3MOBL 5LG1A 1QFUL 2Z31C 1QQDB 1AQKH 4GRLD 5IIEB 4HIEA 4TYUA 5IFHH 4WFFE 3PWVB 4LAQL 3FB5A 4Y2DB 4ETQB 4D0BA 4E5XB 1FGNH 4PRHB 1D6EB 2BC4A 4P23D 5D7IA 4WI2A 4JKWA 4MNQD 3LPWA 3IXAB 2HN7B 3CXHK 3UEZA 1CXIA 4NYLA 1TTGA 2X09A 1MHEA 1QFWL 4ZUWA 3B5GA 4GSDH 4LSVL 4UUJA 5FYJL 4Z7NE 1XIWA 5D7KE 3T3ME 1U8IA 2X9WA 3EYVA 1PKOA 3BQUB 3E6FA 5HGBA 4MJIA 4OKVA 5IVXA 5GGVH 4LSQL 3FQWA 3STLB 2VLJB 1YEGH 1RUKL 3DV6B 3G9AB 2AV7B 4LLQA 1JN6A 3GIZL 2QKIA 3H9SB 2Y5TB 5J6HB 4ZOEA 4MJ5A 3B9KA 5L8LB 2ATPB 3WUZA 3SDXA 3NCMA 3OAZH 5DJ6B 2HFEB 1I8LA 4RGMC 5F8RC 3EYOB 3VG9C 1BBDH 3ROOB 1H3TA 2IC2A 3DV4B 4WW2B 1RJLB 4N0FB 5IJVA 4OD2A 3T0EC 1JHLL 4JZNA 5IG7B 1MCLA 4KMTH 5A16B 5CS7A 3F5WB 2BZDA 4MDJA 2F58H 2A74A 5I18L 1DEEA 5FYLD 2VDNL 4W70A 3UJJH 3QDGA 1RJZA 4IRSA 1YEIL 2Q86A 3QEUB 4TVPL 1EAPB 2XY2A 1OPGL 4B41A 4EIZC 5FHBL 3B9EA 4IIQB 5F97E 4PY8J 2XXCB 4ZUSB 1LMKA 3P9LB 1UWXH 1ZHLB 1FIGH 1D6VL 1GHFH 1YN7A 1JMZA 3TN0C 2VLKE 3FHAA 5GISL 2FO1A 3P0GB 5D8JH 4PJFB 4Y1AA 5KVFL 4O2EA 4KMQA 2HH0H 4PLJC 2DBLL 1GC1C 2R2EB 3EOBB 5F7DB 4MNHA 3UXFA 4KXZI 1L0YA 4ZFZB 1DL7L 4AL8H 2R1XB 3E0GA 2X4SA 4OZ4B 4RAHA 4EBQL 1Q72H 4FQCH 2ZSWB 5EZJA 4HPOH 3WIHH 5ADOH 3MACL 2X42A 4IRJA 3ULUD 1LO3H 3GRWH 3RGHA 1FZKA 5KTEL 2EDOA 1IILE 4LMQE 4Z0BH 4ZUUA 2V17H 3WNLA 4Y4HC 1JHKL 2Y25A 1U8QB 3OWEA 1BOYA 2A6DA 2A38A 2J6EA 1XZ0A 4BSVB 2AQ3A 2IH1B 2CUMA 3MUJA 4FTVE 3F7PC 2ICWI 1U8HB 2PYED 3O3DB 5DURD 5DQDH 4HLZH 3BSZH 3ARSA 1TVHA 3OAYH 3PV7A 5ELIA 2BSSB 3S37H 3WHXA 4QTHB 1F58H 3FQNA 4N0UE 1N0LA 5C08D 2APVA 2ZUYA 3G5VA 3WUWB 3P9MA 2FGWH 2X70A 2CIKA 3HE7C 1AO7E 5ANMA 4JY4A 4NNPL 3P4NA 1UH4A 4JFXB 1I3RB 1K2DA 2YD2A 1LO0L 2X05A 2VLKB 4OFIA 3ZKMD 5E8EA 4FMKA 1X5IA 5EPMA 2KPNA 3BGAA 4X6CB 2PW1A 5H37H 3DRTA 3QI9D 4OM1L 3MBED 3I85A 3SQOH 2YR3A 4DKEL 1AGEB 1BEYL 1YEFL 3CFKB 3GSQA 4M1DL 1DVFB 5DHVH 3ZKNC 4DVRH 4J6RH 4R0LB 1LK3H 2VDOH 3TPUA 5DFVD 3QUMA 3RPIB 4G8GE 1T4KB 1T21B 1QG3A 4PJXB 1U8NB 3OPZH 1IKNA 2JCCE 5DYOB 3VFVA 4ZMAT 5ESQB 1PY9A 2HJLA 3EGSA 2F5AL 4N1CA 3CCHB 4BZ1L 3BZFB 3G9VA 4YXLL 3VXRA 3RVWD 3MRDA 4C56D 3QWRA 3S36L 2DM3A 4AG4L 1ED3A 1HNFA 2LVEA 3T3PE 1WF5A 4YZFE 3V7AG 3ARGC 4XX1E 4RWYH 1AIFB 1PX3A 3WO4B 1AO7B 5KVGH 1JJUA 4MMXC 1N5YL 5H35A 5KSAA 4MX7B 3IRZA 5FO7B 1R5WA 3RA7H 3DX6A 2NY2C 5F96H 4ELKA 4E0RB 4K7PL 4U1NA 4JJ5A 1AHWB 2EH8L 1RZKC 3EIFA 3PP4H 3KVQA 4TQEL 1WAAA 3QHZL 2BERA 2P8PB 4P49A 3NCBB 4NM8H 4DAGH 3BDXA 4PG9B 3DETC 4NPYB 1JPGB 3ZYJA 1BF2A 4Z8FL 3P0YH 4FFZL 3L6FB 1QRNA 1KLFA 3K7UA 3I6GB 4G8GB 1DLFH 1EJOH 3HI1B 5CJQL 4Z76B 4OV5A 5F88B 3RKDC 4RMQA 2IAMA 2JCCB 4YHKH 4KZEH 4LCIH 5JORB 3DO7A 3IDJA 3GSOB 3KYNA 4DGIL 4TUOB 4NO5B 3GMPA 4O5LH 5EU7E 3VFOB 1IGIL 4CRPA 4OZGA 1U3ZA 3MLTB 4MAUH 4Z7OE 3LV3A 2A6JA 3RY5A 4CJ0A 3T0DA 3LD8B 5C0RL 1CDHA 3NCYS 4DZBA 3RZWA 2CK0L 4OSUL 4HIHB 2R2CA 4Y5XB 2NW3B 3OKEA 4HWEH 4WV1A 1KJVB 2X9XA 2ZCLH 5AZEL 4JFFA 2J1KA 1QHPA 1PZ5A 4BFGA 1W0VA 4OZIE 4XXCA 1FL3B 1R3IH 3L3OB 4FQXD 1NGZB 5B8CB 5DMKA 3H7BB 1T0NA 2D7NA 1XT5A 4DGVH 1EGJH 5L0QB 2CH8A 5IK3B 1ZHKA 2HYMA 5ENWB 4OCLC 2WIIB 5C09A 2VDML 4ZXBD 4DCQB 2B1HL 1A9EA 3OKNA 5HDLA 5DK2B 4EI6B 2FIKA 3EOTH 1ONQB 3BH8A 1U42A 3MNZB 1ZANH 4PR5A 1NC2B 1ZVHA 3IJHB 3QXAB 4PJEF 1MREH 1Y0LA 4JRXA 1X5ZA 3DLQR 1I4FA 1T03H 3D85D 3ARTA 3MFGB 35C8L 4DVBA 3HE6B 3D2UB 3U2SB 3E1F1 3LIZH 2EC8A 5F7YC 5L2JB 3T1FA 3MV7A 4CADB 4HSQA 1A9BB 1MCIA 2D3VA 2Q3ZA 1I1YA 1WLHA 2AABH 1J1XH 3TN0A 5EOTA 3HLAB 3C09B 2YN3A 1FYTA 2VDPH 4U3XA 5CINL 1W0WA 2AEWA 3L3GB 5SWZA 5C0CD 1WQVT 3I9GL 2Q76A 1JF1A 1B90A 2DYPB 2VZ3A 1IM9A 5C3LD 1IGTA 3ZE0F 1A8JH 4GAFB 1IC1A 3P77B 4O9HH 2QSTA 2AEIT 3P4OB 4Y89A 5BMFL 5JHDB 2YHGA 1JZ5A 4Z7VF 3DIFB 1DBKL 1IEAB 1HHKA 2ZUVA 3PNWB 3MLSH 3WLBB 4X4YB 1PZUB 1E4XL 2YZ1A 4WW1B 1KXVC 3V0VA 4F7TB 1MHHB 1IL1B 4HDIB 4JFDD 4JDTH 5HHXH 2IBZY 3UO1L 3KPPA 3FN9A 4IDJL 4QXUL 2OR9L 3GHBL 4N8VB 2VQ1B 1U93A 1HIMH 1T1ZB 3PXHA 3D3VD 2OI9B 4ODVL 2JB5L 1ZE3C 1WFNA 1WC7B 2FL5A 2VR9A 4LGRB 3RBSA 4ZFFB 5BJTB 2Z0BA 4GG6F 5F89A 2RGSA 3OJVC 4TNWK 1DFBH 5TE7L 4JHBA 1K3IA 3DMMC 4G3YL 3OX8A 1REIA 1WFUA 5F7EL 2D2OA 2EDYA 3ZDZE 4EN3D 2XPGB 4GOSA 4HUWB 4YLQT 1U8PA 3WLWC 4QCIA 4P3WA 2IPKB 4G80B 5DJ0A 4PJ8A 3INUH 5FM8A 1C7TA 3S98A 5EULV 2YD6A 5LCVH 4F7CA 1JRHL 4PJCF 1OHQA 4O2CB 3CX5J 4QHKI 1A4JB 1Z6JT 5DSCB 1KEGH 3F12B 4P2QB 3ZO0A 1KJMA 3TT3H 3MMEB 3BRDA 1KELH 4P48A 1FH5H 5J8OA 4MLSA 4PB0L 3ARGA 3A67L 1LVEA 1UQSA 2FX8H 3QIBD 1UZ6F 1FLTX 4M6MH 2DMBA 3H7LA 4CVZA 4Z78B 2D4FA 4HKJA 4HH9A 2MWCA 2B1AL 3CGTA 4TPRL 1SEBA 2YPLD 3SDDA 2E8YA 1DCLA 1T2JA 1BQLH 1CICD 1R0AL 3S3SA 3U83A 4IRZL 2DLTA 3HMWH 3EYUL 1YQ2A 1T5XA 3O6FB 4MNGA 4K3GA 2ZUQC 4MJ2A 4CW1B 4QF1A 2MCG1 4NOBA 2YRZA 3PGFH 4XI5C 3FQTA 4GMTL 4OIIL 3CU1A 3DX9B 5GJTL 3MGTA 1QUNA 4P2OA 5L7XL 2XTJB 4JRYD 4FOMA 3QEGH 2BRRL 3PABB 4LCUB 1VACB 3PGDB 5JMOC 1KTDA 5FF6A 3OHXA 4JM2C 1CVRA 2XWBA 3KNBA 4KVNL 3QAZC 4TUJB 2VLRE 2HFGH 4P2RE 5IB1A 3VFUA 3DTXB 2XN9B 2VXTH 2J6EL 4XAWH 5DJZB 5FA4A 3C5ZD 2WUCL 1LE5B 2NY3C 4N90E 5F21B 4GG8B 5IESH 3K3QA 3IDXH 3EDEA 4LLWA 1I7RA 2VL5A 1XCTB 4K8RL 4XNUH 3P0VH 1NKOA 2VC2L 3RIFK 1P1ZB 1M7XA 3OG4B 2AXJA 2B2XH 4XCCH 3F7YB 4MS8D 3SKOB 5EORH 4JPVH 3O3UN 4PJ7E 5DRZA 2YD7A 1RVFL 5IEHA 3L95B 5D7IF 2XFXA 3RI5F 2VWEC 3U6RA 3FKUS 3L5XL 3MA9L 1A3RL 3IFLH 5DRWA 3IKCA 1SHMA 3FT4B 1BIHA 4GAGL 4S1SH 1ZA6B 3MREB 3TFKD 3W0WB 1T04B 4OCSH 1T3FA 1CFVL 4JFQA 4OF7A 4XMLH 3UJIH 1OARL 3NA9H 2NXYC 1GZQB 2QJDA 3VGEA 5J7CC 3MBXL 4PJHE 5IVXF 3WFEH 3QUML 1Q0XH 2VLRB 3NGBB 1JNLH 5DJCB 5LXGH 4JREB 5TH2B 1UA6H 5K9KA 1P2CB 1XF2B 1DDHB 1A0QL 3SDAC 4YPJA 2BCKA 1S9VA 1XAUA 2R23A 3KJ6L 1MJUL 4PRID 1DN0A 4LVNB 4ZDHB 2DI7A 4NM4H 1E28B 5FYKU 5CBAA 2ADIB 5B3JF 3HS0A 3SDXF 4F2MA 4HQQL 4WNQB 3DURB 5JIKA 2NY6D 5ICYA 1MRDL 3U4BH 5EBMB 1LO5B 1RZJH 1EO7A 4H20H 1BJ1H 2D9CA 3QEQD 2APTA 2NY1C 4HS8L 1INEH 4PJ7B 4OI9A 5D1ZA 3QULB 3T4AA 1N64H 3KPRE 3SDYH 5J12B 2HA1A 1E4WL 2G5RA 3PL6D 3UDWC 5CEXB 5IP4A 4WFGE 4G9DA 4WENB 4GMSH 4PP2A 3ZHDA 4NQXB 4V1DA 1P7QB 4OLXH 4G6AD 4TVPD 3F62A 1S9YB 1UZ8A 5DXWA 3CXHJ 3RRQA 4WI3A 4H1LB 2ITDB 1CDBA 1YMMA 3N1MC 2AEQL 5E8DL 2P5WA 1NAKH 3LRSB 3PP3H 4FFWC 5GXBB 4H8WL 1QPPA 2K9UA 3D25B 3FRUA 5CEZH 1EFXD 4L8CB 4UAOB 3MRKA 4QRTA 1QPXA 2ESVD 5MHSE 1NAMA 1VFBA 1CTNA 4TOYL 5E9DE 1RK1A 2VJXA 1RZFH 3F58L 3GI8L 2WBJA 3TWCH 4RMSA 3JV4A 4I3SL 4O4YH 4YHNA 3W2DL 1MJ8H 3BP4B 1DEDA 4G9FA 1R24A 4JPIB 3P30H 4OBSA 2PUQT 1KIUA 1KUMA 5F1OB 3RAJH 2GTWA 1OSPL 1ORSB 5IB2B 4FZ8H 4Q6IB 3KPRB 4DN3H 1R3KB 3MRRA 3FOLA 2DQIH 3TA3C 1N6UA 4YBQD 2R4SL 3LQAH 3LH2H 1PD6A 3NZHL 3B9AA 1TETH 3UC0H 2ZJSL 1C08A 4M9OA 2DB8A 3O45A 2Q6WA 4GXVH 1K4CA 4YK4C 3QJFA 3HUJA 5AG9A 1KIRA 3L3JB 4ZUTA 2E9IA 3VH8A 4XTRC 1YEHH 3GJEA 3NN8A 5GZND 1I1AD 3S34L 1YY9C 3MV01 1L7TH 5E2VH 3RWCA 5GHWL 3RWGA 4NQDD 4RZCA 1U58B 1J86A 1DQTA 2VE6A 4UI2A 3QXDB 4UNUA 2P8MA 1CL7H 3ECBA 5IUSA 1XCQA 5E9DB 5T1LA 2GY7B 1D5BA 1VERA 2QQKH 3HNSH 5FKPA 5C0NC 3NPSB 3OTTA 4DUXA 2CSPA 2CLZB 5ITBH 2HLAB 4WCYH 3BAEL 3QWQB 1AGBB 1FHGA 5TPWH 3UTZB 5E5MA 5JOEA 5I1LA 4APQB 2OTPA 3NIGF 1BQHA 3I6LD 1N4XH 3O6KH 3DSFL 1HSAA 5IBLD 1IKFH 3ZHLA 3JUZA 3BOVA 3J7HA 2FB4H 1RK0A 1DBBL 1JK8A 1QO3B 4OFVA 5D6CB 1GC1L 5DD0H 4FQIH 3RZCD 2X40A 3BEVB 3LSOB 2ICWB 4WU7B 4WU5A 5FYJE 4JFPA 4OB5H 2Q7NA 3BKYL 3LEXB 4EOWL 1BLNA 5C0GB 4XXDA 3C60C 1GZPB 4JM2A 5CILL 2ZCHL 3BPCB 4NBZB 4HULB 5M7QA 1X3DA 3SO5A 1SM3H 1Q1JL 1LEKB 4X7SL 1C5DB 4JO2L 3MLRH 2J7LA 2PW2B 5IT2L 1N7ML 1WAAF 5EOCJ 4C83B 5ETUB 6CGTA 1IC5L 4EUPB 15C8H 3BFOA 3WO3B 5HYQB 3BXNA 5BVJB 1VGEH 3WFCH 1WICA 4J23A 4JZJA 1PG7L 4MZ2A 1ODAA 1A14L 4X8JB 4KK9C 3VWJD 3LDBC 4F58L 4OGYL 3MRQB 1NCBH 2D9QB 5IHZA 1KCKA 4C58B 3X13B 4R4NC 4HX1A 5HVGB 1S9XA 1CGVA 5EWIL 5TGBA 5E6IC 1AJ7H 2LU4A 5JA8B 4PJ5A 5D71L 4OZFG 1A47A 1IGML 4OZGF 4XT1C 3TZVD 5EH1A 3TVMD 1T89C 1IGFH 4ELMB 4K55A 3QCTH 4TVPE 4Z7QF 4UILL 2D0HA 4OLVH 5EU6A 2UWEA 5EZOH 3PGCA 1FP5A 3JSSA 4Q2ZB 5DDHB 5JPMA 1CDJA 1UB5B 2AJSH 1S7RA 5DZOA 1K9TA 5D72L 3EJZD 3P11L 3SDAA 3QO1A 4RGNE 5D9SB 5HPMB 5DUML 4KK5D 2ZCKH 1UKTA 4NC2B 2ITCB 3KYMB 2GTZA 5KOMC 2P24A 1M7DB 1GGIH 3QG6B 2X89A 5EBLA 2VDQL 3WL9B 3RWIB 3V9FA 5ALBH 4RQQB 3FQXA 1XR9A 4JFOB 4S1RH 2FJHA 3MXWH 2B7DT 3VRJA 4ONHB 5EIIA 4U6HB 1QBMH 4NJAL 3N06B 1CFNB 4KUZL 3DVIA 2ADJA 5GS0C 3QFJD 3MV8D 2COQA 3UDWA 1I9IH 1A7QH 2FH8A 1RZKL 2R4RH 1XF3A 4NQCD 4WDIB 2ZG1A 4JQIL 3L1OH 4WWKA 1DP0A 1UH2A 1CD1A 2MFNA 4CN6A 2XY1A 2DQDH 4L8BB 5F3HB 3G08B 4M5YL 4WIQA 2R56L 4XCFL 1M1SA 1MFEH 2FDBP 4X5WA 3O6MH 5F9DC 3C2AL 4WI4A 5IGXH 4G42A 1K6QL 3O9WB 5TQ2H 3I02B 1IFHH 4QWWC 1KPVB 1U6AL 4RGNB 4HUUB 4PJ9D 4UT9L 1UJ3A 5SWSD 1KXTB 4EDWL 2WWMC 2XZQL 2OQJB 4J12A 1KC5H 1FVDB 4FQQA 4NQDE 1QSFA 2AJUH 2NTFB 3FB8A 3WXWL 2EO9A 4IHOA 4EEEA 1FN4A 1KCUL 2CMRH 4U7SA 1TZHA 4KJPD 2ZOKA 3U7YL 4PJEE 3WYRA 2B5IC 3JWDH 5HDQH 2H6PB 3MNWB 1P5VA 4QRPE 3BO8A 2DKUA 1F3JB 3JV5A 4H26B 5TDOA 2W91A 4HUNB 5E8NA 4ZS7H 3FFCB 4NO0B 4WHCA 4H88H 1HZHH 4QHLA 3TA3A 3FQUA 2P4AB 3K2UL 3RTQB 3HB3C 4BFIB 1NBVH 1CFBA 5GS2H 3VE0A 5DJYA 3QDHA 3UBXB 3EYFB 2XNAA 3VXUB 1YZZA 3HC4L 4PREB 1QYGH 1MH5A 4LQFL 3QUKB 3ZE0E 4D0CB 3LKSB 1EEZA 2JLLA 3GGWB 4KKCD 1TTUA 3H42H 4M7ZB 3B6SA 1OCWH 4ODSL 1YEEL 1XIWD 3GUTA 1IQDA 5CZVH 2WUBL 2BSED 2BJML 2EYSB 5K9QI 4Z7VE 3ARFB 1W8OA 3N1QC 4X80H 1P4BL 4XPHL 4ODUA 5CJ8A 2W0KA 4PRPD 4FZEH 1RHHA 3O2DA 4I3RH 4JFEE 3LHPH 4GO6B 1MWAA 1G9NH 4DN4H 2OXHA 1KG0B 4URTB 2Z8SA 4Z77B 4PJEB 4PGBB 1GOHA 5F9OH 2AGJL 5BQ7B 4ENEC 2HKFL 3B9KD 5E08H 1H15B 4QRPB 4EVNA 1M05B 2CKBH 3T04D 5FUOL 3B5TA 5GGTA 2X4OB 4P5TC 4NT6A 5CFHA 3CLFH 1CE1H 1D5XB 4GAYB 1CXFA 4FXGB 3WSQH 4GG6E 2LVCA 3MPCA 4PG2C 5EUKB 1EPFA 1AGFB 5B39B 1IM3B 1WITA 3BWAA 4HHAA 3U46B 5BV7H 4D8PB 5HHOB 2FHBA 5TDPA 2DWDB 2EDJA 3JTTB 1MUJA 5MERB 3RKPA 1RMFL 3Q6FB 4Q9RL 3C60A 1NFDA 3ARDB 4IRSD 4FG6D 4XCEA 5GSRA 2IBZX 1KLUB 3CNKA 4P4KC 1FNGA 5GGQH 5CGMA 1A4KB 4AEHL 1TJHH 4WFHD 4Z7VB 5I1IH 4LNRA 2D7OA 3QXWA 3NIFF 1G7LB 2UVFA 3G6JA 4QHUB 1NCAL 1Q38A 4S1DD 1U3HB 5DJ2A 3H0TB 5I1AA 5F6HI 4JFEB 4PLKD 3RGVC 4GW4A 4MAYB 3GSUA 4CMHC 5A2LH 5FK9B 3B4NA 4Y1AD 2EDFA 1S7XB 4KQ4L 4PRDB 5AWNL 5TF0A 5I74C 4P59L 5FGRA 2ICES 2R0WH 1UZ6E 1IC4L 1OAZL 4GRMA 2HFFB 3IKKA 4IRJD 4XNZB 5GZOD 2VUOA 4QY8A 4G8IB 1FDLL 4GRWB 2OJEB 1GH7A 5ICZB 3IDGB 3WMSA 3QFJE 4ZFGL 3DVGB 3QYCA 4NQCE 4QRUA 2CJUH 2R0LL 4Z9KB 1Z5LA 2HFTA 3WEXA 1EHLL 4ZSOE 2DQFA 1KFAL 2Z8WC 2CLVB 3LN4B 4PJAA 1B3JA 3OKYA 3HPJB 4EQ3A 5K9OB 2AJZA 1RZJC 1YDPA 4TNWF 1T2XA 2CGRL 5HHVH 4LKXB 2VABB 4CVXB 1NLBL 2LQRA 4HIXL 4KROC 2F19L 2ZKHL 4OM0L 2D7MA 1MSPA 2GK0B 1JTTA 3LN5A 3RDTC 4HPYL 3HAEB 1YC7A 1KV3A 3C5JA 4ZAKB 2A9NL 4QHMA 1WJ3A 3RL2A 5F93C 1MFCH 2MCPH 4N68A 1V7MH 1MFBL 4R8WH 2OL3H 3U9UB 4DEPB 4CU6A 3I50L 3EO0A 1SJXA 3S96A 4HAGA 5ICXB 5C7XH 2NNAA 4WUUA 3HHRB 1K8IB 4QTIL 2GITB 3GHEL 1IGJA 1OSZB 1NUGA 3VFRA 4LLUB 4XX1G 2W9DH 4YXHH 4GXUM 5ISZE 1FSKB 1J8HA 1RIVH 4M61A 2VDLL 1CZ8L 5E7FA 2AKRA 4U05A 2P5EA 3PWNA 4ZSOB 4PP1C 4XC3L 4LK4A 4QOKA 1BQUA 4MB3A 2HT4C 3DVNB 5D7IE 2UYLB 1WK0A 4I2XA 1ZLWK 3KPNA 1MFNA 2LE9A 4J3TA 4UOW1 2FR4B 3C6SB 4BZ2H 1EXUA 1PQZB 4HK0A 5CKGA 3R06A 4GW1B 2CIIB 5D1XA 5KSAD 5E1AB 3D6GA 1FFPB 7CGTA 4U3HA 1RV6X 5KSBB 5D4QA 3M1BB 2BDNH 4MJIE 1DLHA 1IAOB 4YPGB 2J8OA 2NZ9D 1F11B 3SGDH 1T1YB 5MI0B 2Z35B 1CF8H 2F74B 4UIKL 1SJHA 5T1KA 3T4YA 1INDH 3D9AH 3GJFA 5LAXA 5LGKA 4X7TB 1ORQA 1BOGB 4FFYL 2E9BA 1BGXH 3MJ9A 1QRND 2G2RB 5B3JE 3I3EA 4XVSH 1F02I 5ISZB 5HI5D 4KMTL 3MUY1 1J11A 2IAMD 4NRZA 1KT2B 2GT9A 3MRHB 2HJFB 2F58L 1AC0A 3QIWD 4EI5C 5D2NE 3S6CA 3F7RA 5I76A 4KVCH 1ZT7A 2CDFA 4N0CD 3L5WB 4YXKH 3H3PH 3BPNC 4PS4L 4NZRH 4MB5A 3W9EA 4NYLB 3EO1A 1EIBA 1UH3A 1MHEB 1DSFH 4UTBH 3V4PL 3LEYL 3ZKQD 5TDNB 43CAA 1OAUL 3QDGE 2EEBA 3UX9B 4OKDA 3RIFF 3AU1A 5T3XL 3UTSA 4L3EA 4X8XA 4IOIB 1JE6A 3B3IB 4MQ7B 5EUOA 3EYVB 3O3EA 3E6FB 2PXYD 4MJIB 2AXGB 2BNRA 1BFVL 1G9MC 1M7IB 2C7UB 4AH2A 5HI4C 4JFFD 4HMDA 4KPHL 4NN5C 4O51B 1LP9E 1UM4H 4NZUH 4Y1AE 4P5TA 4UQ2B 5ADOL 5AUMA 3HUJF 1WBZA 4Z0BL 3E8UL 1NSNL 2DIAA 1T7ZA 4PGZA 4PG2A 4WI6A 2I5YH 3HFML 1GGBH 5C09D 4JEGB 4XBEH 5AZ2H 5DEFA 2E3VA 2VISB 3AXLB 5IB5B 4WO4B 2DBJA 3WNMA 1A3QA 1XH3B 1NLDH 4OD2B 5D2NB 3MR9A 4KJQC 1F90H 1NGWA 1WWAX 3BSZL 4MDJB 1N3NA 4P4KA 4Z7WB 1CU4H 1F58L 2QQLH 4JRXD 2A74B 5DRNA 1DEEB 32C2A 1IQWH 4IOFC 2C3HA 4JHWH 4BQ6A 5HTSA 4OJFH 3QDGB 4JY6B 1RJZB 4KAQL 3L9RA 3QWOA 3MV7D 1F4AA 4XB8A 1I3VA 1BBJB 1T1WB 1NEZB 3PWPA 1AD9A 3RGVA 3REWA 1FYTD 3EFDL 2AJ3B 2HT3C 1J1OL 1FL5B 2F5BL 1YN7B 1QR1A 5SWZD 4G43A 2BP3A 1LP9B 2P8LB 4N1EA 4L29A 2NX5E 4KGJA 1UACL 2H32B 4DVRL 1C16A 3WKNA 5DJDB 1B0RB 3BQUC 1CGWA 4NP4H 4LGPB 4OV6F 1D9KC 5FA3A 3NIDF 5D1QB 4NQVA 2R9HD 2XZAH 3OPZL 2Q8BH 5C2BL 4FFVD 4JM2F 4NZTH 4GBXD 3BRGC 4ZUUB 1OP5K 4AK1A 2OSLB 3N0PB 4JG1L 2A6DB 3IVKB 4YDKH 3NIGE 1EEYA 2ZG3A 1XZ0B 4V2CB 5MEPB 4XVTL 3VXOB 2P45B 4HWBH 5HGDB 1VFUA 3VXRE 1ZS8A 3NFSH 1TVHB 4R2GD 4IMKC 2FRGP 1I9JL 5JDSB 1HSBB 1LWRA 4NSKB 4U7KA 3IJSA 3G5VB 3P9MB 5GGSB 5E2UL 1UKSA 2ID5A 1I1FA 1RUAH 3PP4L 3RDTA 5GRJH 1P6AB 5D5MB 1ADQA 1HHHA 2A6IB 3B2VL 4DAGL 2OTUB 2NX5B 1MCWM 2XWTA 5EPMB 5DMGC 4NHUA 1A6TB 5K9QG 2VAAB 3VXQA 1NC4A 3DRTB 1A7NL 1CLZL 4RA0C 4W4OC 4WEMB 2R29H 1WAAE 3O2DL 4PJ8D 5B21A 1LILA 5TE6H 1ACYL 1ZHNA 3SEPA 2UWEF 3TJEH 1HH9A 3P4MB 3MNVB 3SGKA 1KCVL 3TPUB 1J1PH 4OF3A 5IBTH 3GBNH 5JXAL 5KW9H 5GGTL 3O4OB 5CUSL 5CD3B 2DQEL 4KRMB 4PBXA 4YQXH 3RY6C 1AR1D 3BP5A 3RX8A 3VFVB 1U95A 1F4XL 1SYSA 2QQNH 3P9WB 5HVHB 1FO0A 2AQ2A 2AK4E 3QA3B 3AB0B 4QGTA 4NKMB 3VXRB 4OGAC 3MRDB 4LARL 3CVHB 1CR9L 4OZGE 4Y19D 1ZLVH 1NCDH 3U0PB 2Z93A 4G5ZL 4X6FB 4OCRH 1N59B 3EYQD 4HFWB 3PDOA 5HHNB 1QOKA 4M1CC 4Z7QE 5JOFB 3SDDD 3SY0B 3QQNA 4Z7UB 1MCPL 2V9TA 5H35B 3T8XB 2XXMB 1NBZA 4YDVB 1ZT4B 3DX6B 4ELKB 4WEUD 2VB5A 4JJ5B 4X99A 1Q94A 5DD3H 4JFYB 4P46A 4ALAH 1FNAA 2QL1A 1BD2A 1RUMH 3QNYB 4JFFE 2SEBB 2R1WA 4LLAA 4HWNA 3SE4C 4FP8L 1HHJB 2Q1EA 2YA2A 2Z31B 2DQGL 5BZDA 1TMCB 1S5IH 3N85H 1L9MA 4P2OD 1QFOA 4OV5B 4XPGL 5CIPB 2C1PA 2IMMA 3OB8A 3T0EE 5I2IB 4JM4L 1LD9A 3MLYL 3NH7L 3QZWA 5IF0A 1WTLA 3DO7B 3IDJB 3KYNB 2AK4B 2VKWA 3L5HA 3DRQB 4OUOA 1H5BC 3MLWH 3LV3B 4JRXE 2F54A 3RQ3A 1P4LB 2C4FU 4DZBB 4QGYA 5CCKL 4Q9QH 1TCMA 2H8PB 2E6PA 3O2VH 3CDGB 3MV7E 2Y06H 2O5YH 4F7MB 4OIBA 2YA0A 3WS3B 4MWFA 4DKDC 1YEKH 2IEPA 4N8PA 1BVLA 3DYMA 4YGVB 5EU5A 2QSVA 1YNKH 4ZOBA 1MCBA 3EDJA 5GRVL 1A7PH 4N9GA 4XPAH 5C9JB 4HH8A 5SWZE 1FE8H 4O2FB 5E2JA 4O9HL 3H3BC 4UDTB 4KJWD 2DLHA 4K3HA 5DC9B 5CJXC 1NCTA 2C9AA 5KSUB 3LKQA 4CAGA 4ZPVA 1ZA3B 1A7RH 1LDSA 1A6PA 4RGMB 1G6RH 3VG9B 2IGFL 2HLFD 4M6AA 3UAJD 1MEXH 3SKMA 2EC9T 2GYSA 3HZVA 12E8H 4HJ0C 1TCRB 3T0EB 5GS0L 4E41E 3IDIA 3IETA 4HKXA 4LPVA 1RU9L 4Z18A 3GBML 1WBXB 3BH8B 1HIML 4QO1A 4XP1L 3PWVA 4XC1H 5LJYH 4ETQA 4AEEA 3GI9L 2V9QA 1D6EA 2NQCA 3FMGL 3OB0H 1JGUH 1QSVA 4KKLD 1V3JA 2J8UB 4KTDL 3L3DB 3LB6C 2AP2A 1DFBL 3T1FB 1Q9WA 1RZIB 3IXAA 3MXVH 2OTWA 2HN7A 3RL1B 2G75A 1IC7H 5EOTB 2DI8A 5ID0B 4X6DE 5DT1H 3HCVA 5D1ZD 3S4SA 4FA8A 2BHYA 3O6LH 3WJJC 1JF1B 3BQUA 2VSCA 2DKSA 4K3EH 1IM9B 4G6FB 3ROLB 3TYGH 3STLA 1BFTA 4WTZG 1NFDF 2AV7A 5I1JH 1JYVA 5DJ8A 4LDOB 3K4DA 1N2RA 4Y4HB 2Y5TA 5J6HA 1HHKB 3G6JF 1FLRL 1OTSD 2ATPA 3MJ9L 3NCJL 4FQ1L 3U9PL 1J05B 3I3BA 3S5LA 3X12B 4E41B 1A1MB 1KELL 3ZTNH 1GAFL 3E3QC 4AZ8A 1JZ3A 2HJKB 5DJ6A 5B8CC 2JJWA 1VFOA 3ROOA 2FX8L 4XHJD 4FQ2L 4BSJA 4R96B 4HUXA 3SHSA 4XB7A 1C1EH 3DV4A 1RJLA 4IMKA 3KPPB 4N0FA 1VSCA 4L3AA 1CLCA 1U93B 5A16A 5IG7A 3MJGX 2W60A 2J5LB 3F5WA 1S9KC 2B4CC 2WBJD 3HE7B 2BY3A 3BEWA 4S1QH 2NY0D 5JW3H 1LO4H 4KHXL 5FUCC 4V2BA 4G9FD 3F8UB 4G6ML 3TC9A 1S7TB 5F89B 4U4BA 4X6DB 1OM3L 3U4EB 1AGCA 3NBNA 1YN6B 1B0GB 4U1GC 1T7YA 1X5XA 4IIQA 4W4OA 3NIFE 4MD4B 4JB9L 5GS1C 4ZUSA 1I8IB 2GQHA 2YMXL 1ZLWH 3X3FH 1H0DB 1ZHLA 1WFOA 1YNTB 1IAIL 1DQML 2I26N 4C4KO 4MNGE 5I15L 1HINH 4BYHA 4PJAF 4U6VH 4YAQA 4PJFA 4HKBB 5JW4R 5IQ7L 2FLBT 5EFIB 4F7CB 5GRUL 2R2EA 3C6LC 3EOBA 5F7DA 3ILQC 2FATL 2AXFA 3BD5A 3KS0J 1U8KB 3HRPA 4ZFZA 2R1XA 3U79A 4OZ4A 4AIOA 4F7PB 5HYSB 4XVUD 2WK2A 3W9DB 1CQKA 5SX5K 1KJMB 3JVGC 4JO3H 5IB4A 3V4VL 4LCCC 3RVXD 1N6QH 1U8QA 1XR8B 4AEIL 3H9HB 5DUBB 1QRKA 4NFDA 2QHRH 3ARGB 4C54A 5BS0E 1UQSB 4BSVA 4CVZB 1HXMB 2NLJB 5C8JB 1ETZA 4HH9B 2ZUSA 5EU4A 3SKNB 4O58L 2FECL 2B2XL 1A6VL 1OAKL 4I9WD 1BIIB 2E9JA 2WINB 5DQ9B 1T5WB 2VZVA 3WUWA 4Y4FC 2OI9C 4Z95H 1MAMH 1NCUA 4PV8A 1I3RA 5JMRA 3AUVA 3BE1L 4X6CA 3GBLA 1X9QA 3FQTB 4LLMB 2NY7L 3UJIL 1AGEA 3V5KB 1BVZA 3CFKA 1KIPB 1Q0XL 1DVFA 1JNLL 4R0LA 4RBPH 5LXGL 1UA6L 2VOTA 5IM7B 4K7PY 4R90H 2J8HA 1S8DB 1FAIL 5FF6B 1T4KA 3OHXB 2XWBB 4PJXA 1U8NA 1MRFL 3MJ8B 3NFPB 3HR6A 3RVVD 3VFUB 5DYOA 4J7RA 5BS0B 3R0MA 1MOEA 2R39A 2O5XL 3CCHA 1QNZH 4JPKH 3D3VB 3TBYB 1JZ8A 1X5JA 1RZJL 2V2WA 1INEL 2VL5B 3LEVH 5I1DA 1AIFA 4P9ML 3SDYL 1D7FA 2WAHA 1CE6B 3HI6L 4MX7A 5FO7A 3RNQB 4TSCH 5DRZB 4JKPH 4LHQB 4OLXL 3DUUB 4E0RA 4EN3B 1AHWA 1ADQL 3GB7B 4U31A 5FUZH 5ITFB 4M02A 2R2HA 1RZ7L 4V1DE 4ONFH 2P8PA 3IKCB 5C71A 1CWVA 4NPYA 1JPGA 5TJWK 3O6FC 4RGOH 1CTOA 1CYGA 1YMME 4OFDA 3L6FA 5EUOF 3SDAD 4G8GA 1JTPA 3NZ8A 4N0YL 4N0RA 2P5WE 3HI1A 4Z76A 5HVFB 1KF9B 5F88A 5K9KB 4A2LA 4S2SA 2H2PD 5JZ7D 2JCCA 3ARPA 5IBUG 5CBEB 2BCKB 2EH7L 5JORA 5FAAA 3GSOA 4DQOH 1DN0B 4TUOA 3KPSA 4NO5A 1FO0L 2AERT 1RZGA 3ZE2F 1F6LL 3VFOA 1UADC 5CBAB 4LCWE 4XP5L 5I1GH 3MLTA 3HS0B 4ODTL 4LSUL 4CU7A 3RAJL 4HXBH 4A6YH 3QPXH 3VW3H 2DIBA 5MENE 3VFNB 4U7MA 5HYEA 2HMID 2HTKD 3L3KB 3MCKB 2GHWB 4DN3L 1MI5B 4OCMC 5ACZB 2DQIL 4HIHA 3SJVD 4MSWB 4Y5XA 5J6GB 3LH2L 2NW3A 1KSRA 1GOGA 2IF7A 4WWKD 5BO1H 3CFDB 4LLYB 2X2YA 4GXVL 4V1DB 4XH2B 1T83A 2DQTH 1UZ8B 3MLPA 2VLLB 1X5HA 1F4YH 1YMMB 1AY1L 4OZFH 5B8CA 1LE9B 1L7TL 3H7BA 3HUJE 2OJZH 4OLWL 1EMTL 2MOVA 4YHZL 3ISWA 5IFAH 2X4QA 2P5WB 1PW3A 3AREC 2Z8RA 5ENWA 5DI8A 4RAUB 2WIIA 5LQBH 3G6DH 4I18C 4DCQA 1JL8A 2QQKL 5D70L 4EI6A 5DK2A 2NXZB 1ONQA 1VENA 3LKPB 2V7NB 3NABL 4WCYL 3MNZA 4LCWB 1Q9OA 1KEMH 3IJHA 2UZYB 3MV9E 4AT6A 3KDMA 1MJ7H 4LU5L 5MENB 1HH6B 3DMMB 5K33A 1JF6A 3HE6A 4NQTA 3D2UA 3MCLH 3U2SA 2C4XA 5BW7A 5I1KH 5L2JA 5GGRY 3O3AA 1DQLH 1DTUA 1A9BA 4XP4L 5H37G 4UTAH 5HHMD 3HLAA 1G9ML 4TULH 1MCFA 5AYUL 1ZMYA 3WJLC 5FM5O 5L2KE 1YYMH 2DYPA 4KKAC 4MA8L 2QLVB 4O02H 2VQUA 2ADGB 2LU7A 3O45B 3QP3A 2A83B 2CLRA 3BPLC 3P77A 1K4CB 1OQXA 1YY9D 1WZ1H 2O5ZH 1KIRB 4XCYA 2CO7B 3NIDE 4K23H 1ZV5A 3PV6B 3VH8B 2BHUA 3JVGA 4HS6B 4WUKH 1S7VA 5JHDA 4BK5A 4NWTH 1G7IB 1XF5B 3DIFA 1F5WA 1IEAA 1FIEA 2XRAL 1Y6NR 3PNWA 3RWGB 4RZCB 5FYKL 5T1DH 1KLGB 5HJ3B 5DQJA 4F7TA 3T0AA 3ULVH 5T1LB 2ED8A 1MHHA 1IL1A 3OR6B 1D5BB 4HDIA 4RAVB 1MPAH 1WGOA 3MV9B 2VITB 4N8VA 9CGTA 2VQ1A 4ZNCD 5KOVC 1T1ZA 3DXAA 3VFGH 2DLGA 1NCWH 3BZ4B 1WC7A 2GSGA 4ZFFA 5BJTA 2BXYA 2E8ZA 2FYYA 4MZ3A 1IBGL 5JQ6H 3I2CL 2VWEE 2OK0L 5L2KB 1IGFL 1MIEH 2DICA 3MRBB 3IYLW 2DOCA 3QUZC 4PJ5E 5CJOL 2XKUA 3A6CH 5B4MC 2IPKA 2DTMH 3C60D 3UPRB 4WU5B 4G80A 2AJSL 3MRPA 4JFPB 2APFA 1A6WL 3BX7C 5T3XE 5EU6E 1BLNB 5C6WH 1LEGA 5C92A 4JM2B 3T0XA 5ESVA 3QAZB 4JLRB 4O2CA 4Y7MA 5HYIA 1JV5B 3EYSH 3O11B 1VKXB 3NCEB 3EJYC 1R3JB 1A4JA 1JGLH 3SDCD 1QA9B 5DSCA 5C07B 1OVZA 2H9GB 4P2QA 2NY3B 2JJSA 4KK9D 3MMEA 5BZWB 2VQTA 3OR7A 2GJ6E 3LAFA 4LVEA 3SE9L 1ZWIB 3GKWH 3QIUC 1G0YR 1TVBA 2JJVA 4R26L 2R4RL 5KJRH 1BREA 5IHZB 4ZPTB 1R5IB 5IQ9B 4OCXL 5TGBB 3OL2A 4WRLA 1EVUA 2CQVA 3BJLA 4PJ5B 3V0WH 3AAZB 4FNLH 3QCUH 3V7MA 3O6FA 3FN0H 3M8OH 5HYJB 2Y9RT 4M62H 2NXYB 3FT3B 3WE6B 4ZTPH 4JFHD 5B38G 3W5MA 5EU6B 5HBBA 1AR2A 2OZ4A 1EEUA 1CL7I 2CDEA 4XBGB 5T5NF 2PTVA 3DX9A 1AGDB 3KG5A 1S7RB 3Q5TA 1KC5L 4M7JH 3QO1B 2DF3A 1S78C 4J4PC 3MRIB 1H3WM 4DKFH 4LCUA 4P5KB 3PGDA 3IDMA 1QSFE 2GTZB 4PRBB 2P24B 5JOPD 5J89A 2VZUA 4TUJA 2GJ6B 5D93C 4ZYKB 4DGYL 3JXAA 5EBLB 4M7LT 2FEDC 3SKJL 2Q20A 2XN9A 5DJZA 5HXMA 2WZPD 4XPTH 2EEDA 5GS0D 3FQXB 5DMJB 4N5ED 3QFDB 4WUUD 5EIIB 4KK6C 4GG8A 5HSFA 1YC8A 3QQ4B 4M1GH 4HWBA 4RRPA 1XCTA 4QRRD 2K7PA 5HHME 1P1ZA 1J8HD 1XF3B 2MNUA 3EBAA 1NFKA 4LNVA 3F7YA 3SKOA 1QSZA 2P5ED 2J88L 4QOKD 3L95A 4IMLA 4AMKH 4M48L 3VD4A 5I19L 1OT1A 4OLUH 2NR6C 1CXKA 25C8H 1FBIL 3OG6B 3Q5OA 2EDNA 2NYYD 4G42B 4UMGA 3FT4A 5D1XD 3V52L 5E2TL 1ZA6A 5E7BA 2P49B 3W0WA 1MFDL 1XF1A 1T04A 4R7DA 1BM3L 2HVKB 3Q2CA 1GZQA 4FQQB 5FHAH 1QSFB 1SY6H 5DHVB 2EE3A 3RIAK 4CJ1A 5DJCA 4L4VD 4PTTB 1P2CA 4YDIH 1XF2A 1DDHA 4P2YA 3EKCA 4X6BA 1CE1L 2BK8A 2VKXA 3MJ7B 3ZYOA 1SVCP 3HR5B 2H2SD 1E28A 2ADIA 2EDQA 3MSPA 4YFLI 4P99A 1SJEA 4WNQA 3DURA 1SBSL 3TA3B 3ARBC 2MPAH 3ZT6A 5EBMA 1JNNH 1LO5A 4WTXA 1KCSL 2P48B 3S7GA 5F7NC 4PJ7A 4YR6A 3SOBL 1NGPL 1E4KC 2HKHH 4YK4B 4Y0GA 1MH5B 2YC1A 5C9KA 2AV1A 5CEXA 3QDJD 4NQXA 2KZ1B 1NFDE 3B9VA 5F6IB 3OKMA 4TNVK 1BWMA 1IQDB 4Z7NF 1JGVH 1BVKB 4H1LA 4L3ED 2C3XA 2ITDA 4LHUB 4KHTH 4OCYH 3T3MF 2N1KA 3G6JE 2IANB 4ODUB 5I30H 5DFWH 2BNRD 3MC0A 4LASH 1J0IA 3LRSA 1UCBL 3CJJA 2DJ4A 3K4AA 2X41A 3LMJL 5GJSL 4L8CA 4PJFF 3WS6C 1BAFL 1UB6B 4OQTH 1WBYB 2W92A 1C8PA 2P7TB 2YK1H 1KPUB 2D7TH 5M94B 2DQJH 1ZTXH 3HZKB 4NT6B 5J3HD 3WXVL 4ZTOL 5KS9E 5L88L 3ZZ1A 1N0XL 5DLMH 4JKLA 4XPBH 4G7VH 2APBA 2FD6L 3FB6A 3JBG7 1E27A 3X14B 4YJZL 4JPIA 4WEBH 2CJUL 3QUZA 3OKKA 2P46B 3BWAB 3KHQA 4ZD3H 4HHAB 2C3GA 4LPCA 5FYLH 3IFPA 2I9LA 5IB2A 1M6OA 1MUJB 1MCOH 1R3KA 1J0KA 3K8LA 1NMCC 4NNYB 4OFYA 2DM4A 3FN3A 1PGRB 5I0ZA 3H6JA 3QUXD 1B9ZA 4PJAE 2WWKT 2ADFH 1UGNA 2OM5A 1S7WB 4HUKB 3PWPD 1S7SB 1UM5H 3BHBB 2A2QT 4Z0XB 4KQ3H 3VRLF 2D03H 3L3JA 4L9LC 1KBGH 3O8XD 5I1AB 2VLME 1T2QL 5JLZB 5J1SC 2WP3T 1G6RA 2IG2L 4J8RA 4GW4B 4MHHI 1MFCL 1GSMA 1TIUA 5I8EA 4UB0L 2V5TA 5BVPH 5DHYB 1AFVL 4X6CF 4KY1L 3QXDA 2B4CL 5C6TL 4R4FL 3IDYC 4U1JB 5KS9B 2PTTB 2W9DL 1BFOB 4P0DA 4YXHL 4LFHD 2CLZA 1I7TB 4WUUE 5FO8A 5E6IB 1CG9B 4PJXF 1D5ZA 4G8EA 2GY5A 3PUCA 5F7LB 3VXSA 4ZS6C 1NGQL 1A7OH 1Z5LB 2P5EE 3QUYC 4BZ2L 2DQFB 2DQCL 3QCVH 1F00I 3BUYB 4KI5D 2IPTH 5D6CA 1KB5H 1U92A 4PJAB 3ZLQC 2OP4H 4I2XE 2UUDK 3BEVA 4HGWB 1XEDA 1AI1H 3OF6A 2AJZB 2ICWA 3CMGA 4PLOB 4J4PA 1I3GH 3ZKSD 4HXAL 3SCMC 3LEXA 2OYPA 3R1GL 3KJ4C 3HNTH 3BPCA 3AM8A 5CP3A 1JFQH 1I85A 1HYRC 1MF2H 1NC4D 3LN5B 4WI5A 1LEKA 4AIZB 2PNDA 3CSGA 2PW2A 3RL2B