5HHOD

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
195
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoD02
4HUWB 3SBWC 4DCQB 2C9AA 1RIVH 3KPSB 1L7TL 5DJ2B 5DLML 3ZDZF 3GB7B 2BX5A 1KCUH 3SPVB 3CDGA 1QBLL 2D9CA 3SKOB 5CZVH 2EE6A 3MSPA 5C6PB 2CRMA 1T83A 3WKNA 2BY1A 3UTQB 1VKXB 1FIGH 2ICES 3RL1B 3BW9B 2EKJA 5C0RL 4I77L 5DMIH 2APWA 2QQKH 4S2SA 1QO3A 4LSUH 3TV3H 4EN3B 3TVMB 3FO1B 3B5TA 3GRWA 4KI5D 3AY4C 1N6VA 1D5MA 3DVGA 3GRWL 5GRXG 1C7SA 4LARH 1UZ6F 2YD6A 4Z7NE 3PDGA 5IVNA 2BNUB 5A16A 2BHZA 5E99H 3PGDA 5F44A 2EXWD 2NMSA 2YSSB 1X5AA 3WJJA 3RDTC 4HW6A 1EA9C 4ORGB 4UAOC 3H2WA 3RWDB 1X5GA 2IJ0C 2KPNA 4NO2B 4HIXH 1OAQH 5J6HA 4LL9A 5DD1H 3UYRL 4MLIA 3GSUB 2BOCA 1X3DA 3AGVA 4JRYD 1TVHB 2FRGP 2C7UB 3BUTA 3KXFA 4LSPH 4C57C 2X4SA 4IIQB 1XF4B 4KKLC 4KK6C 4BUHA 1U8NB 3PUCA 4QYOB 4WGWB 4DW2H 3G04A 5E8NA 3FB6B 3BVNB 3JTSA 1MELA 3P9LA 2FL5A 3VU2A 4D9RE 4F7PB 3BAEH 4G9FE 2VDML 4YFEA 1ZGLP 5C0DB 4MXWL 2HTLC 2HTKC 3SE3C 3TZVC 2BP3A 4HFUL 5FYJU 3SE8H 2YBRA 1AC6A 1YPZB 3MREA 4NUJA 4CMMB 2YC1A 4P2QD 2DWDB 4LLMA 3LHPH 4PLNC 2HLAA 2HJFB 5T3ZH 5I8KL 5EOTB 5D1ZB 3TPUA 4NQCE 4PR5A 1LK3L 3DHMA 3O11A 4Q9RL 3BPOB 4L1DA 3UBXI 3FONA 3SQBA 4PLOB 1B0GB 4S1RH 4HG4K 1LEKB 1X5KA 3Q5TA 4MJ5B 1UJTA 2Z31B 4UNUA 1T7WA 3BGFC 1F8TL 3BYTA 3RX5A 4WU5A 5SX5H 1N4XL 1BEYH 1SJXA 2JJWA 4TVPD 4DVBB 5CZXC 1A4JA 1QA9B 5I2IA 4KUZL 5CSGA 4FABL 5DD6B 2N7BA 1SBBA 3O3DA 4OLWH 3H7BA 4PRNB 2EIDA 5I15H 2ZP0T 1MFNA 2XTJC 3VW3L 4XAWL 2P8PB 4YDJA 4P3WA 3V6OC 3ZKXB 3S3SA 4H25A 3RQ3A 1Z5LA 1A2YB 1XGTA 4YIQA 2VLRD 3O6FA 2WBJA 3AROA 1OSPH 5EBLA 1MF2L 5FK9B 4ZUSA 4JHWL 5BS0B 1U8MA 4YXHL 1FJ1A 4JJHA 3QT2A 1FH5H 1Q94B 3OR6A 4X7DC 3TF7C 4ELMA 4P5TC 4NWTL 4N0UA 5T1LA 1U93B 1MEXL 2WUCH 3NCJL 3T2PA 1YEIL 1ZEAL 2E6QA 4G6MH 4WW1B 3U7YL 4CJ0A 4F2MA 1L0YA 1EMTL 3QDJA 4UI2A 2BMKA 3TA3C 5JMRA 3P77A 4FXKA 1T0PB 1NPUA 1CICD 2Y36H 1MREL 4S1SL 5D2LA 3UCRA 3FT3B 2OTWA 4XTRC 2AV1B 5EO0B 3BPLB 1BQHG 3B9DA 2PCPA 5C1MB 3O2WL 2WLZA 3GBNL 3SBWA 1KXQE 1E4WL 1Z2KA 1QSEB 2CGRH 3DROB 4H20H 5CEZD 3FFCB 3O6ML 5HY9B 5MI0C 4JE4B 4X99A 5D2LE 2CK0H 4DKEH 4LSRL 4LBEB 1OW0C 5FUOL 1QR4A 1FNHA 4OSUH 5ESQA 2YEZA 2VLLA 2GIYA 3RVWD 3GSNH 4MAUL 3WO3B 3LV3A 3L5XH 2ZCLL 1YECH 1QRNA 2ZOKA 2OTPA 2FYYA 2AJSH 4GW5A 4M62L 4P23B 1I9IL 3A6OA 1IGJB 4HQQH 4DGVL 4XCCL 3DX8B 2FEDD 2V5MA 3G5ZB 5A40E 5AYUL 3FQTB 3WBDA 3RDTA 5IG7A 1RZFL 5IGXH 2Y07L 3IFPA 5TQ0L 1FRGL 4L3CB 4EVNA 2XKNA 4JO2L 1UWXK 1R3LB 4FP8H 2BVQA 3RGVC 5TE4H 4Y89A 4YE4L 2JB6B 1UB5A 3E8UL 3RBGA 2FHFA 5KSUA 2NCMA 1HIMH 3CAFA 4LLAA 1IEBB 4YHNA 5CD5C 5JXAL 4LHUB 1S7RB 3G6AA 2VDQL 4YLQT 2PTTB 2COQA 1H8NA 4KJPD 5I71B 5IB3B 2IBBA 4G5ZL 1M7DA 1IFHL 1HWHB 2VDLL 3FO9B 1I7UA 1MQKH 1N3NA 1A1OB 1CWVA 1HCFX 4HPYH 1T20A 4UUJB 3BZ4B 3MCKB 3IXTB 3ULVH 3RY6A 4U0RC 3NGBC 5C0NC 5J6GA 3ARGC 5GRJL 1BQHA 1VCAA 3TNMB 5L2JB 5JORA 1JYVA 1BD2B 4JFEB 3P11H 1FE8L 4U1HB 1Q9WA 5JNYA 4X6CB 1IM9D 5FKAB 2XFXA 3MCG1 5HGDA 2EDHA 4I5BB 4PBWD 4R7DB 5I1GH 1GGBL 5EZIH 4OF0A 2VQ1B 5IB1B 4HIEB 2ICWA 5CBEA 3Q5YA 2EDFA 1CFVL 4LKXA 5DK0B 1RZJH 4NKDA 1RK0A 3BGMA 3ILQC 4AEIL 4NNYA 5EB9A 4PJ7A 2P5WB 2EDQA 5JA9A 4XH2A 3HPJB 4FXGA 5F7WC 3B3IA 3L6FB 1Y18A 4JQXC 5C09B 2C3WA 4KVNH 3TFKD 2W65A 1R5IB 1YMHA 5JQ6H 4OV5B 5ID1B 1MJUL 4OFYA 3A6BL 1P1ZA 2WWKO 2F53E 4NZRL 5ANMB 4MWFB 1G7IA 1J88A 2BY2A 3LEXB 1CLCA 2ARWA 1IAIM 1UB6B 5LXGL 5EBGA 4LSVH 3QUYB 4N5UA 1I9RL 3V6OA 1N5AA 4XCEA 2H9GB 2R1WA 3VGBA 2B2XL 4NNPL 3ZTJG 1M7IB 1ORSA 2EIEA 1MCHA 3CFKB 1Y6KR 3FQUB 3BP4A 4RISL 3C5ZC 3P4NA 4M48H 1UVQB 2XTJE 2DQEH 3LKRB 3ARVA 3V6OE 3RIFF 1OGAB 4P5TA 4HWEH 4RA0C 3S37L 4ELKB 4XMKL 1I9JL 2FSEB 3LOWA 3QCVL 4U3XA 5F1SA 2D7TH 4Z76B 4YNYB 5E2WH 3CPLA 3P9MB 3OKYA 3Q5OA 3KPRA 1GGCL 4Q9CA 1LE5A 3QRGL 3PHOB 3W0WB 3BUYB 3KHOA 5HYIA 1NCCL 5JOEA 2V2TA 2ED9A 4YQXL 2A9ML 4W6XB 3GBML 2VIRA 3LRGA 4O2EA 3PWNA 2XXMB 3Q48A 1F13A 1Z3GH 1EFXA 3KPRE 5ESAA 4ZFGH 5ACZA 1AKJD 5FYJE 1YEKH 5JQHC 4PRAA 1J87A 1JGLH 4CVZA 4JVUA 5FM8A 1NKRA 1OW0A 4AYFA 2CIIB 1FSKB 2P8MB 2NY6D 2DTML 3EOAB 1D9KB 4J4PC 5IVXB 3TM6A 4BZ1L 5EUOA 2J8UB 1LGVA 1UWGL 3BX7C 4JO4H 3MNZB 3ZHDA 4A6YA 4F7EB 2AJ3A 3O0RL 3O2DL 4ETYA 4A6YL 4YO0B 5AZ2H 2VB5A 5BRZA 4GG6B 4ONFH 3ARZA 5MEOB 1MFEH 4YBQD 4U1NA 4LMQI 4IMLA 3CGTA 5AD0B 5J1AB 1KENL 4N0FB 3B6SB 1T04A 4TVPH 4JB9H 4QRPE 5ALCL 5EUOE 2QQNL 4U1GC 1UM6L 3I6LD 1D5XA 2VXSH 3JUYA 3HNVL 4NNXA 5BRZE 5C0FA 4M1GL 3R0MA 3SDDC 2ADFH 4OD3L 1F90L 3EGSB 3C8KB 1J1OH 1F6LL 1SVZA 1DBKL 4KI5F 3IXAA 3VXNB 3I6GB 4PP1D 1UWEH 3RGVA 4BQ8A 2FB4H 3MRMA 1FNSL 1KB9J 3VG0L 1P4LA 1YEDB 4NJ9L 5F71A 1WBZA 5DQ9B 2BJMH 1INEH 4C55A 3ARBB 2BVTA 1G7HA 2EKSB 2R4RH 2WSKA 3H9SB 4LCYB 1XZ0B 2IPKA 2VSDA 1CZ8L 3B2VL 5SWSB 1CD9B 2J4WH 4F9PA 4QGYA 1JP5A 3QFDA 4Z7UF 1HILA 1WV7T 3RWEB 4X0KA 2PXYC 5DUPL 1F4YH 5IW6A 2Y7QA 3ES6B 5E6IC 4G6AC 1HZHL 3HZVA 3EYFB 3WE6B 2DAVA 2X1XR 2IF7A 1QEWA 4GMSH 2LU4A 5DD3H 1KT2A 1YNTB 1RUAH 2UY6A 1JNJA 5MHSE 1ODAA 3KPOB 5EN2B 3CH8A 4Z7WA 4P2OB 3BKYL 3QUZC 1OWWA 1MPAH 2ZCHH 3VFUB 5ESVA 3BKCL 3RZWA 3O8XB 1YQVH 4EI5D 4G8IA 1NDGA 1ZHLA 3WXWL 5I1JH 4BSWB 3BD5A 4G9DA 1CLOH 1MWAB 2W60B 1FO0H 5EU5A 4LGPB 1IT9H 3VI4F 1NANH 2JJSA 3TCXA 3V0WL 4IRSB 4ALAL 4HJGB 2MHAA 3U1SH 4JKKA 3FQNB 2DIJA 3FL7A 1HSAB 4PJIE 4Y1AA 4OCRH 2MQ0A 4K7FB 2EYTA 2DLIA 2OK0H 3V6FB 3F7PC 4J8RA 4Z77B 5CIPA 3KXFD 5I1DA 1NEZB 1ZTXH 4KRMB 5I1KH 1MLBB 4KQ3H 3SKNB 1HH9A 3NFSL 4MGXA 4W6WB 1J11A 1I3GL 4Y1AE 3U9UB 3HE7A 1G9MH 3V0VB 5BXFA 1HXYB 4KY1L 4NO3A 1M71A 4JFYB 2PETA 1A14H 1G9NC 3GM8A 4QTHB 1FYTE 3T4AA 4K7PY 4G8EA 5DK2B 2DQFA 1KCVL 3L3IB 1X4YA 4YGVA 5JW4M 3QEUA 5TJWK 2H1PH 4IS6A 1QSZA 5BQ7B 4LCWA 4OIIL 3KGRA 1MRFL 3C5ZA 2R23A 1UKSA 2P48B 4QOKA 3WS6C 1UQSA 4POZD 5F72S 5FKPA 1Q0XH 5L88L 4KDTC 4PTUA 1VFAB 2WWKT 4CN1A 1FNGA 3DUUA 4PRBA 4OZIA 4U1MA 1H8SA 3ELAT 1XAUA 4JLRB 1ZT4A 3BDBA 4LIQH 5C0IB 1TJGH 3GMRB 4WW2F 4XVTH 3BPNB 2APFA 4MZ3A 4XPBL 3QULA 2D31A 4X9FA 5L8KB 2NY1D 4MD4B 4L5FL 3UPRB 4Q6YA 5MENA 2NY4D 5JDJA 3UROR 3QHZL 3VWKB 4DGIH 3TBSB 4OZIE 2F19H 3BQUB 1Q9KA 3WSQH 2CDFA 4N1EA 4Y5VC 2ADJA 4LSTL 2X7LB 2XZQH 1YEEH 4D3CH 2X4TA 1LNUA 5EORH 5T33H 3RU8H 3PE9A 3L7EB 4WY7L 4XBGA 2H32A 5DK3A 4UOJA 5HDQL 5FOBB 4J4PA 1I7RA 3BE1H 3QISA 2ZPKH 5DQDH 4G3YH 5DUMH 2X1OA 5IEHA 1MCPH 4OCXL 3MXVH 2OSLA 1QBMH 3EFFA 2NW3A 1GVIA 4F58L 5E8PB 5HI4D 5FDYA 3HS0A 4WUKH 4HIIB 1A6WL 1NC2A 3MA9H 3LD8B 2JELH 4OLZH 4WUUA 2X70B 2AW2A 1NBZB 1KJMA 4DN4L 4G6JH 4PJAE 5T1LD 4HKZB 4ZXBB 1RHFA 3SDDA 2DQDH 3MOBL 3NFNB 2JCCE 3G5VB 1YDPB 4BSVB 2KH2B 3PABA 2CLRA 1JVKA 1NL0L 5KSAA 3MNVA 1OAYL 1SBSH 4WUUE 1DBBH 1MIEL 3A6CL 4JDTH 1O5DT 1WWCA 3F7VB 32C2B 4YPGB 5F6IB 5M94B 3DIFA 1B6DA 2FBJH 2HMIC 3MZTA 2P43B 2XXCB 3VJ6B 1VEMA 3PXJA 3RA7H 2VLJB 5L2KA 5CP3H 3F12B 3UBXB 4LP5A 4X4YB 2O5YH 1U58B 1U8LA 5L6YL 1JGEB 4YHOL 1CR9H 3HG1B 3LB6C 4UV7H 3D25A 2XG4A 2R39A 4FQLL 4XGZA 5E6IA 4PV8A 2E6JA 3MRLB 1P7QB 5L2KE 4Z7VA 5FDWA 5CFHA 3FQRB 43C9A 2VZ3A 5D71L 2SEBA 3J7HA 3T2QA 4TQEL 3GUTA 5JLZA 2MPAH 4QLRA 5IVZA 4YDIH 5HPOA 1OP9A 3K4ZA 1RZKH 3JV6B 3TESA 1GSMA 2GYSA 2I9LB 3H9HB 1ZHKB 2VOTA 1R3HA 5JXEC 3RDTD 3LQMA 1FBIH 1DL7L 2VKXA 4I0PC 4NQEE 4AENA 3OXRA 2FGZA 5T3XL 4APQB 3VXRE 2NY3C 4NQUA 3M8OL 4Y8AA 4XBPB 4YDVA 4NBYB 5H35B 4DKFL 1DZBA 3CSYA 4F37K 4M43L 4R26H 1J5OL 1ZHBB 4XI5C 4LSQL 4UBDC 4GRMA 1U36A 4FS0A 3VG9B 5E5MA 2YD1A 1UENA 1CFNB 5I1IL 4JGUA 5ID0B 1S9VA 3BMWA 1QSVA 2VMFA 1VACB 3HPLB 1XF3B 1ES0A 2HTLD 2HTKD 3GHEL 4MHHI 1LO5A 3LKNA 4K2UL 1W8OA 2GJZA 4GSDL 3HMXH 4ODVH 4TNWF 1BAFL 1UCBL 3FFDB 5HI3D 3GSXA 4Z7QF 3WS6A 1SMAA 2YPVL 1NCDL 5LGJA 4K7PH 1U8JA 4WNQA 3MXWL 4OKVB 4JAMB 4KDTA 3BEWB 5DLMH 4BQ9A 5DUBB 5DJDB 3JV5A 1QBLH 1ZWIB 2QKIB 3FOMB 3K1DA 3QIBB 4PRIB 43CAA 2R0WL 3GMPB 1MI5A 2HVJB 3O3EA 5C0RH 4I77H 5IHLB 4JGMA 1WZ1L 2NY2B 1E27B 4XP1L 4JZNA 1HHGA 5D2NA 3IJHA 3TYGH 1F3RB 1AXSB 5IMLB 1JGUL 5D1XA 3GRWH 1K8IB 5D96C 5AEAA 3QI9A 1JPGA 1MI5E 4EDXB 4Y5VA 3B9VA 1QLFA 5CZXD 4CADA 1NCWL 4OFYD 5HGAA 3ET9F 5FUZL 1EEZA 4JO1L 1QZ1A 4MLSA 5EZOL 1K2DB 3VE0B 2P5EB 1CL7I 15C8H 4DOHE 1KCRL 4RFEB 3U48A 5ICYB 4G8GB 1NFDF 1KC5L 4GAFB 2ARJB 1U91A 2NXYD 4YAQB 5L9DL 2A6DB 4H1LG 3F65A 4NT6B 1R3JB 2MWCA 2UV3A 3QIUC 2IMMA 1U8IB 2DRUA 4J3OC 2OX5A 1KPVB 2IAMA 2E8ZA 3DYPA 5CJ8A 4M8VA 1OAXL 4P5TD 3UYPA 5D93C 1ACYH 4QO1A 5EPMA 5FFLA 1PLGH 4HH9B 3V6ZB 2EEDA 4TULH 5ACMA 5E5RB 5BVPL 1B2WH 3UTSA 2R15A 2WZPD 4P46A 1GHFH 1LMKA 3KPRD 3WFDL 1PQZB 2AEQL 1CCZA 1MRCL 1IAIL 1NGQL 3OHXA 5J9PA 1BZ9A 3LKPA 3QPQC 5IK3A 1A6ZA 3L3OB 4IMKC 1DQML 3PV6B 2HRLA 4K3EH 1EJOL 4UIMA 4XTRD 4XVSH 4RGMC 2APVA 4EDWH 1DQJB 4PJEA 3UTSE 5FOJA 3VFGL 5I8KH 3ILPA 1EFXD 3BOVA 4MA7L 2NZ9D 3LMJL 4NSKB 1JIBA 4KTDL 1MSPA 3EOTL 1LK3H 4Q9RH 3TBTA 3PWLA 3OAYK 5DJ0A 2UVEA 2GTZA 2WBKA 4PJEE 1TTUA 3UJJH 4WU7B 1PVHA 3FJTA 1H9VA 1XGRA 1K4CB 3R0NA 1B0WA 1XMWA 2PYEB 4CAGA 3GKZA 3QWOA 3CVIL 3VFRA 1VFBA 4RNRA 5BRZD 4CRPA 3VFWB 3REVA 1TZGL 4UU9B 1LHZA 5JUEL 3RPIA 1JNLL 3MRIA 5D7KE 4YDKL 4XZUB 1QUNA 3OKNA 2Q7NA 4JRXA 4UDTB 5TDNB 4FFVD 1A0QL 1IAOB 4Z7NF 1KIPB 1TZIA 2CUHA 4M5YL 3CNKA 3LS5L 5JXEA 4MYWB 4RIRB 3O6LL 4I0PA 5J06A 2I9TB 3TJEL 5B3JF 3EO0A 1INQA 2GAZB 3FAWA 4JRXE 2CUIA 2F9BT 1A1NB 4H1LA 3RGVD 1XF2B 4Y16A 3IDXH 2LE9A 4JHWH 3CFCL 4JFDA 4ZO7A 2HFEA 4YXHH 1PZ5B 3KNBA 1X5IA 1F42A 5SV3A 4Z5RA 2MFNA 1IAMA 3DV4B 5CD5D 3LIZH 4NWTH 5HYJE 1NCUA 3VXTB 1MEXH 4HF5H 3HZMA 1JN6A 1MAMH 3SDAB 1YEIH 1T0NB 2OTUA 2DDQL 4JFDE 4XXCC 3PHQB 3CX2A 2GK2A 4I1NB 5C0GB 2OI9B 2GY5A 1R6VA 5F1NA 3N1PC 5DS8B 3QQ4A 2FR4A 2CDEA 5I1HL 5CGYD 3VXMA 5C0ND 5C2BL 3VXUA 5E1AA 1R0AL 3GBNH 3H0TA 4NKMB 1E4WH 3MLRL 2Y72A 5I1CH 3I2CH 1WTGT 4WJ5A 4H8WC 3S8WA 3H3PL 1DUYB 5FUOH 4GKNA 5TE6L 4RAUB 3VXUE 4R0LC 1CIDA 5L7XL 1AGFA 4MAUH 5F3HB 1F58L 4JPVL 2IANB 3S88L 1FGVH 4OT1H 3EDEA 5EG6C 3SKJL 2PW2A 3DX7A 4Y1AD 4LOUC 3AB0C 1LP9A 2F54A 5BMFL 1JZ6A 4DVRH 4ZTPL 4PRDA 3VD3A 1FYTD 4M6NL 2DQUH 4HJJL 4NZJA 1I9IH 3GMNB 4L4VE 1H3PH 4DGVH 4XCCH 2AAVA 2NY0D 1TVBB 1UYWH 1P2CA 3QH3B 2V9QA 3W9EA 4TPRL 2Z8WC 5E4EC 1KLGA 4U6HA 5AYUH 4ZDHB 5JO5B 2F54E 4Z7UB 2C3XA 4MAYA 5C0BB 2Y07H 1MCDA 1VGKA 5FGCB 1JWSA 2FJHA 2B5IB 3ZE0E 4LNRB 4POUB 4Q9QH 4C56E 5GSRB 2DKSA 5DTFA 5HJ3B 3TJHD 4YE4H 3O3AA 5CINL 4WI8A 2D0HA 5EU4B 3TWCL 1YMMA 4CKVX 1B0RA 3E8UH 4LCWD 4X4XB 4CU8A 5KVEL 1FCCA 1B4RA 2FX7L 3C5ZD 1WIOA 4QOKD 4HS8L 5CKGA 2J7LA 3KR3L 3KPQA 5AUMB 2VN7A 3MJ7B 3ZDYF 4NRXB 4F33B 2JK5B 1BGXH 4XPHH 3T2OA 4BA8A 2VLKA 4WI4A 1PD6A 5I1AB 1YMME 4AIZB 3OTTA 4G5ZH 3T04D 1IFHH 2GITB 3C08L 3DUSA 1VADB 5HYSB 3O4LB 5I19L 4Z95L 5KG9A 2QHRL 3VFOB 1GH7A 1BIIB 1HQ4A 5JPMB 5HBBA 3P73A 1FZMB 4IMKA 3O41A 4AG4H 2EEAA 3QJHA 5H94B 4GXUM 5GRJH 4PBVC 5IWLC 1MHHB 4ELMF 3QUKB 12E8L 1FE8H 2AABH 4R3SB 3K2UL 4RQQA 1I1YB 2X4PB 1JE6A 2H2PC 4J3UA 4MDJB 3BZEA 5I16A 4GO6B 4ZUWB 1I4FB 5DSCA 5AZEH 1Z9LA 2DBLH 1SYVB 5I30L 3MUJA 4J4PD 3EO1A 3M17B 2DLGA 1HKLL 2IGFH 3U79A 5D2LF 1MIML 4U1SA 1BOYA 4ZPTA 4M1CC 4PG9B 3T0EB 2VDPL 4TUJA 3SO3B 3FCTB 4N90E 3T0XA 3UTZA 2MKLC 1NC2D 1MCNA 1GRWA 2CLZA 4O51A 5C71A 3DMMA 4XMLH 3Q0HA 2YPKA 5DQJA 3DI2B 4WUUD 1MJUH 3A6BH 4QHUA 3L3JB 4NZRH 3CUPB 5LGHH 4ODUB 4JR9L 3LKOA 4PJXE 1T21A 4GAGL 4WFEE 3SDDD 4KKCC 3X14A 2VXTL 1A6TA 4HIHA 2WUBL 1NFKA 5DI8B 2I07B 2VLRB 2R2BB 2DM7A 4PGDB 5I76B 4KDVA 4ZFOB 4WW2B 2ITCA 1OD9A 4YZFF 5KSAD 4OLVL 2CRIA 2OP4H 1WISA 3C5SB 5L8LB 4G42A 4UB0H 3KYOA 4D9QD 5I8EB 4DQOL 1J1XL 4RISH 1EVTC 4ODXB 4RGNC 3B9KC 2Y5TA 5EOQH 3UP1A 4PJ8C 4EZMA 2G2RB 2R9HD 1F4HA 4TSAH 3S37H 5EFIA 3QO0B 5GGQH 4XMKH 5L2KD 1ZT1A 2Q7YA 3QCVH 5IW1A 4XXCA 2PXYD 1UACH 2VQTA 4NHUA 4ODSH 2R1XB 3QRGH 5E6ID 2VZTA 4G6AD 1T0MA 1U8HA 4ZSOE 5FYJH 2A9MH 1EFQA 3IAGC 2C5DC 5ITFA 4MNQB 1MH5B 4XNUL 2X4QA 3G6DL 2CKNA 3S96B 4KZEL 1GGUA 2DTSA 3BP7A 1KLUB 2JIXB 1TQCB 3S7GA 3AAZB 1YNKL 2VUOA 1XGPA 2V17L 5FO9A 4HH8A 2GSIB 4U49A 4OCNC 4BUGA 1RHHA 2DTMH 4YXKL 5IBUG 2DQIL 4PJHA 3GSVA 5T3XD 3O2DH 4O2CA 3O9WC 3T08A 1FV1A 1T22B 2AJUL 4ZOEA 1SY6L 2Q3AA 4BZ2L 1NGZA 2VC2L 4OGYL 1ND0A 2QQLH 4JFXA 5BW7C 2YPLA 4G43B 1JF1A 5ENWB 3TO4C 4P2RE 5IJVB 2QQNH 2A73A 2XN9A 2NLJA 2AXFA 2NTFB 1UM6H 4PGCB 5F7DB 3L3GA 2MQCA 1K5NB 2AXGB 4YC2B 4HBCH 4LCIL 1F90H 1WJ3A 3O6KH 5IMOA 1JFQL 1JF6A 4PJ7F 3MRCA 1P53A 2F74B 3RZCC 4B7LA 1NBYA 4BK5A 4OF7A 1R24A 3GFUA 2E27L 2HKFH 1WICA 4XWOC 2C1OA 3ULSB 4W70A 3LY6A 1XEDA 3VG0H 3ZTJH 1VSCA 3S35X 4NJ9H 3TIDA 1KG0B 3AM8C 3BIKA 5IW3A 4L8SA 1FZKA 4PB9L 1BP3B 1IC5L 3DJ9A 1K4DB 4RWHA 3MYJA 3R06A 4MD5A 1KJ3L 4NQSB 4C4KO 3NMEA 5GXBB 4U4BA 4NC1C 4P5KB 3HC0A 1RK1B 3ROOA 3HNTH 1MI5D 5E4IA 4GKZB 4MXVE 4K3DL 4HWZB 5BZWA 4HGKC 4IDJL 1EBPA 3L3DA 2X4RA 4Q6IA 3H3KA 5D1XD 4P9ML 3MRQA 1IM9B 1TZHA 1AO7B 1MY5A 3QI9D 3BKCH 1KB5B 1YUHA 3SKMA 3VFPA 3QNXB 2UZIL 4L9LC 5GSVB 4HULB 4K3HA 5GJTH 2LAGB 2OYPA 3MJ9A 5FHBL 3MJ9L 4ODWA 1S7VB 3ESVF 4ALAH 1JUFB 3O45B 2C4FU 4QRTA 5HHMD 2FATL 1KN2L 5KSBA 4ZUVB 2R2CA 3PWVA 3LEVL 1A6AB 4M7LT 3QEQE 3B9EA 4E41A 4W4OC 4F8QA 3T1WA 4UOW0 4QRQA 3PWJA 2NY7H 2DQTL 5HHNA 5FGBC 4GFTB 1JJUA 1CDYA 3QAZB 4M8QA 1FG9C 2W1NA 1DSFL 4YEEA 1RIHL 2FJFB 2HRPL 2XNAA 5EUOF 2AXHA 4S11A 3UTSD 4P46D 4ZFFA 1NGWA 3MLWH 2FLBT 5C7XL 3CXDL 1CXFA 1EXUA 3DSNA 3LKSA 3FQWA 3VD4A 1DLHA 4OIIH 1BM3H 3HE6C 2BNRB 1SMOA 1OTUC 4I48B 3IKCA 4DEPB 4NQDA 4P99A 4Y4KB 1RZIB 5EZLA 1QFOA 4QRSA 5L88H 4M7LL 3HI5L 3NCFB 3CFIC 3KWWB 1W0WB 4LU5H 3MR9A 3QUXC 3CFDA 4RGNE 2Q87A 5KOMC 1SEBA 3VXSE 2LVCA 1JK8B 4NQDE 2D4DA 3THML 1NFDB 5E03A 4XPBH 1ETZA 5KN5B 2OMBA 1WITA 4ZMAT 1RU9L 2XY1A 3WLBA 2XG5A 4DZBA 2IG2H 2K3TA 3OBAA 3PGCB 4HCRH 1IZJA 5B38G 2ARJQ 1EX0A 2CUMA 1RUMH 1OTTC 1NLDH 4LSTH 3WNNA 1P4BL 1S7XB 4JRXD 4GRLC 1FVDB 3VCLB 1H5BB 4WY7H 5IF0B 5C07E 4M7KH 5JXED 3MFFB 4GQPH 5JIIA 3FO2B 2VDNL 4QF1B 4I0PD 2P47B 2CJUL 3BP6B 4UDUA 3DXAA 3HFMH 3RTQC 3O9WA 4JFFE 1RFDH 4F58H 3KS0H 2NY3D 4NFCA 4Z7WF 4GG8A 4Y16D 4U1KB 5CD3A 2G9HA 3EHBC 4JFDD 4CBPA 1QSFE 5BW7A 1MJ8L 1JTPA 5GS2D 3PDDA 4OTXH 2AEWA 1DFBL 2AXJA 4UBDD 2R29L 2BVPB 3FKUS 3NA4A 2DLTA 4Y4FB 3MV8A 3MGTA 1EK3A 4G80A 1A7NH 1VPOL 4KVCH 3QFJA 5SWZA 1GYAA 1IGYB 1INDL 3WFEL 1OAYH 4WCYH 5IFJB 2XWJB 4F15C 1AD0B 1K8DB 4QXTA 4YBHA 4M6ML 3VXMD 5EIIA 3VXUD 3AM8A 5SWZE 3RHWF 1WFOA 4R90L 4PJ5A 3QXAA 3CDGB 3BHBA 3HMWH 4WRLA 5FYKU 1ZT7A 5I1EL 2WQ8A 4E0RA 5D5MA 5L6YH 3OAUL 4YHOH 4QWWC 4YR6A 2APTA 4AY0A 2NPLX 4S2SB 2ZUQB 3RAJL 1IE5A 5GRWA 2BVYA 1I3RA 5FA3A 4ISVA 2J5LC 3DVGB 5IB4B 4X98B 3PQYE 1T1ZA 2F54D 4PJCA 3U0TA 5D5ME 5D7LA 2MCPL 4NC1E 5A16B 5I17A 1P5UA 4TQEH 2W59A 3PGDB 4EXPX 5FYLE 5B38A 1T4KA 4IJ3B 3X17A 4KFZC 1L9NA 1JZ4A 4K71B 1QYGL 4OZIF 3IDJA 1WBYA 1I1AC 2IPTH 3INUH 4MAYD 4C4KT 4LSSL 2BNQE 3C8HA 4LCCC 5J6HB 3CCHB 1NAKL 1CGUA 2VLME 4PJFA 3I3EA 3LRSB 3BN9C 4WWKC 2QADC 3KXFB 4L29A 3CDFA 1MFBL 3HR5A 3L3KA 4U1IA 2X4SB 3QDMA 1V7NL 1YMMD 3VI3E 4P49A 4OBRA 2CKBH 4OI9A 2V5SA 4FN0A 3G04B 5E8NB 4PJGF 3ARPA 1EO5A 5GGVY 4LRNL 5DO2C 3TNNA 4LSQH 1UCTA 5L0QB 3OKMA 4CU6A 4PJFE 3MRKA 3JTSB 1I7TA 3P9LB 2FL5B 2VLKD 4ZUUA 4LEOA 2EC9U 4NM8H 3QDME 4O00A 5I1IH 1XF5A 3WNKA 3UEZA 5HHPA 4M5ZL 1G9NH 2W0LA 3QIWC 1VFMA 3VFVA 3MLUH 4MJ4A 2YBRB 3MREB 3QPQD 2YC1B 1QFWL 1F5WA 4LLMB 2BRQA 4NN7B 4Y4HC 1RUPH 1CE1L 2HFGL 2HLAB 3UC0L 1N6QL 4XHJC 5FO7B 5I8OH 3HKFA 2YPVH 3TPUB 4CN4A 3KYNA 2C4FT 3MXWH 4PR5B 1AY1L 3O11B 2O61A 3LN5A 1RJZA 4ODTH 3ZKMC 4ETQA 2R0WH 4FFZL 2LTQB 2RFXA 4TNVF 5DGQA 4NYLB 4NM4L 5D7IA 2NY1B 4X8XA 4QT5A 4M93B 1WZ1H 1A9EA 4XP1H 2OL3A 1GZPB 2XKUA 2NTSP 2YWYA 3GZKA 4GBXB 1IJ9A 4WI9A 1JGUH 4BSJA 1BJ8A 3WNOA 3G6JA 1CBVH 4PUBL 1A4JB 2ED8A 3AREB 4J3WA 3IYLW 2P8LA 5E2TL 2ICWJ 3DMMD 3O3DB 3H7BB 1ZLVK 1NCWH 2DQHH 3MLXL 1ZA3A 3RJDA 4ZNEA 2PR4L 5EZOH 4MDIA 4YDJB 1I7ZB 3HCVA 3P30L 4H25B 3Q6FA 4KHTH 3BZFA 1Z5LB 5IHUH 1P6AB 4YIQB 4JY6A 1KC5H 2WBJB 3O6FB 5EBLB 3E2HC 4Z7VF 5HDOA 5L9DH 4ZUSB 4OKDA 1U8MB 3GMLA 4XNYL 3JWOC 5K33A 5GJSH 2MTPA 3OR6B 5I9QB 5T5FL 3ORJA 1UZ8A 4ELMB 3MV7E 4N0UB 1TENA 2DLFL 3AUVA 5DMGC 1U2HA 2A2QT 5T1LB 5IMMA 1OAXH 1CN4A 4FZ8L 5IB5A 4IRJC 5GZOC 3SDXE 1P7KA 2DKUA 2VR5A 1U6AL 3N0PB 4F2MB 3VWJA 1UEYA 4PGBB 3TO2A 3QDJB 2WBWB 4OCYH 5FB8B 1MVUA 5IB2B 3DX9A 5BVPH 2BMKB 1A3RL 2NNAB 3P77B 4X7SL 5CLWA 3W9DA 2Q8BH 4ZTOH 2OTWB 3GO1H 1J9CT 1DQMH 4Z7OE 2PCPB 3QPXL 3VXQB 3D85A 1EJOH 3OKDB 3E6FA 3MRFA 4ZPVA 3EJZD 3O4OB 1KFAL 4BZYA 3C60C 3OX8A 1F2QA 2V7NA 1DANT 2GEEA 4X99B 4ODHH 3MOAL 4GUPA 2PNDA 4R9HA 4IBLT 4R2GC 2C4XA 5IHZA 2YEZB 3T1FB 2VLLB 3BH8A 3O3BA 4Y19E 2FEEI 3VFNA 2A83A 2BSTB 3LV3B 1NUDA 5IBLD 4JFOB 3GJFK 5ICZA 3WXVL 2DQGL 1QRNB 3N1QC 3RI5F 4W4NA 2FYYB 3MBEB 2VN4A 4GW5B 4LOUD 4OM0L 4HKXB 5JUEH 3EIFA 1XIWA 2BXZA 2EIZA 4JM4L 1JNLH 3RX7A 2YPLD 5DRXB 5HVHC 4XPFL 2XN9D 1XT5A 5EWIL 4YHZL 5IG7B 2QL1A 4M5YH 3OQ3B 1TPXB 3LS5H 4M6AA 3QUMA 1I1AA 1LDPL 1K3IA 2WWMD 4EVNB 2XKNB 3QUML 1MHCB 1EH9A 3PWPA 4WWKA 2V9TA 1K6QH 5KSUB 3KPPA 4MQ7B 4OZGA 1WZKA 2BC4A 4H1LH 4CDGC 1UT9A 3A0OA 4Q2ZA 1T89C 1B3JA 3BRGC 5F8RC 2ZZUT 1KTDA 1D5BB 1MVFA 1JYNA 1MOEA 3WLWC 1M7DB 2FCBA 1IAII 4FQQA 1DEEA 2DDQH 4P5MA 5F8QC 2DMCA 1FNFA 3CFBA 1PY9A 2R69L 4N0RA 5EC1A 3T3PF 5GGVH 2D9QB 1RD6A 4JREC 2O5ZH 1WBXA 1IVLA 1BQHB 1TJHL 1U42A 1C5CL 5TF1L 5AG8A 1R0AH 1FNEA 3TN0C 1ZLSL 3NBNA 3E3QC 3MLRH 2XFXB 1UM4L 5HGDB 3EJYC 1NGXB 4XNXL 5DR5L 3BXNB 3MV01 2H2PD 3RKDC 1XGQB 4KRPD 5CBEB 4OZHA 3JWNC 5FYKL 3EYOA 1CK0L 3GK8L 4NKDB 3QEQD 3I3DA 1RK0B 4DKDC 5K9JL 3GGWB 4QEGA 4HAGA 5HHOA 5EC2A 5IT2L 1LEIA 4PJ7B 4PRPA 1A6VH 1CL7H 4WO4C 1IGMH 2J2ZA 4FXGB 4JPVH 5FYKE 1KELL 2NXZD 1Y18B 3TYFA 2B4CC 4XT1C 1TFHA 3C09C 3HC4H 1GOHA 4PJEF 2BVOA 1BX2A 5IFHH 1FORH 4LPWA 3T09A 4HBQA 4E41D 1O0VA 2W65B 3OJDA 1YMHB 4JM2C 4ZTPH 2D2OA 3G9VA 4HJJH 1P1ZB 4M7ZC 4NBXB 1H3TA 1HH6A 2QSCH 3NIDE 1M05A 2B1HL 5EDXA 4TPRH 1EUUA 4MD0B 5FA4A 4KKCD 1GL4B 2IH3A 2NXYB 3IF1A 2R1WB 1ORSB 1ZSDA 1ZGLM 3BP4B 1XCTA 4GW1A 3QDGA 1HQRA 1IGFH 3TWCH 4L8BA 4ZS6C 4U6XA 5CBAB 5KVFH 5KVEH 1GJIA 4GRWF 5I0ZA 1WAAF 3BSZL 4RGND 3P40A 4WI6A 4XCFH 3VXSD 3IJYB 4NQDD 1NUGA 3KR3H 5D6DC 2HJLB 3CPLB 3BD4A 3QXDA 4UTBL 1IRAY 5TQ2L 3QDGE 1KJ2H 3W11C 4FFYL 3C08H 3L9RA 3QHTC 4LHJB 5HGGS 4OZFG 4ZYKA 2V2TB 1DBML 5DVMA 2VIRB 4O2EB 3PWNB 1XH3A 3U46A 2XACC 3VRLF 5KS9A 5BVJA 4JG1L 1EFXB 1GPOL 2YZ1A 12E8H 2ENYA 1MCWW 1S5IH 2Q76A 1J7VR 4JFFD 5CZKA 4CVZB 1Q0YL 2ATPA 3SDCB 5KS9E 1V3LA 4OBSA 4QNPE 2D03H 4A6YB 1J8HA 5KZCB 5FHAL 2V5TA 1JHKL 5E94A 2AJ3B 5LWYH 4NRZA 2H41A 4HX1A 5BRZB 3LEYH 3VMNA 3DXAD 4JANA 1G0YR 5CWSB 3O9WD 3KPLA 4U1NB 1RIVL 4IMLB 5FM5O 5J1SC 3RNKA 1T3FA 1KPRA 1T04B 2VDPH 1CE6B 5GGSA 3AC0A 3LPWA 3RHWK 1AH1A 5CZVL 1XCQA 1D5XB 2HN7A 3NCMA 2CPCA 5H8DA 2ERJC 1W0VB 4NNXB 1FVEA 4JR9H 3KYKH 2DMBA 3OB0H 3GSWA 5C0AE 2QSTA 3KS0J 4AK1A 1IMHC 4LSUL 3TV3L 3ARDB 3I75A 3IXAB 4X80L 3QFJD 5SWZD 5HPMA 4LLVA 1KIQA 5C0CA 4L9DA 1LP9F 1BZ7B 3CVHH 5J3HD 4XWOD 3L5IA 1WBZB 3MJ6A 5E99L 4HZLB 4DQOH 1A3QA 2BOBA 3T0BA 4FTVA 1KBGH 2BCKA 3P0YL 5KAQG 4F57H 5DHYA 3PDOA 5JZ7C 2X6MA 5J11C 4M4PA 4K8RC 4AEFA 2IPKB 2DOCA 4MVBC 4PJ5D 1YY8A 4X6FA 5JW5B 1B88A 1HILB 4X0KB 1OAQL 5IW6B 1A8JH 1TXKA 4NP4H 5DD1L 4Z18A 4DZ8A 3DOSA 3S5LG 2ZCKH 3HZVB 4FTVE 1U8OA 2R8SH 3MCLL 1X6NA 4DUVA 1QEWB 1WWWX 3WO4C 4F7TA 2WW8A 1KT2B 4LSPL 4X8JA 3T65A 4HIJA 3EZ8A 1TNNA 4FNLH 4X6DA 3BH9A 1I1FB 4DW2L 4Z7WB 3IFOA 4XNUH 2LU3A 5ADOH 5MEPA 1PZUB 1FFRA 1WZLA 3KJ4B 3G6DH 5ESVB 2E7LC 4KKAC 5EU6E 5D7LD 2BNQD 2EE3A 1ZHLB 1ZS8A 1BECA 4G9DB 5KVGL 1E6OH 4FQCL 4F80A 2V17H 1E4KC 4H8WH 1SYSB 4ONOA 2VYRE 2WV3A 2MHAB 3SE8L 2DQIH 3E3QE 3BPCA 5TGBA 1C12B 4WO4A 2DI8A 3LHPL 1XGYH 4M03A 3VD9A 2RAMA 1FDLH 8FABB 1SY6H 4HMEA 1N8ZA 5I1DB 2EDKA 3QDMD 2WINB 4JM2A 4Q7DA 5EOCH 4PD4J 2NY0B 5ADPL 5F7EH 5F6HJ 4V1DE 3HE7B 2OM5A 1IEAB 4S1RL 2W0FA 1D6EB 4NO3B 1M71B 3T4AB 2A6JA 1JFQH 25C8L 1KTKE 3MA7A 2DQFB 3K7UA 5M7QA 4YGVB 3D18B 4IS6B 1C16A 1CDIA 2DM3A 4LCWB 3WNPA 3TEUA 1KEML 1N59B 1JYWA 4QXWA 1SJEA 3C5ZB 5CSZA 2R23B 4JO3L 4QOKB 4QHKI 1OTUD 4KXZI 1MCQA 5F7LB 5FKPB 1YYLH 5I15L 2D7QA 4ZAKB 3G5XA 1A7PL 2X9YA 4PTUB 3ECBA 5K9KA 3NPSC 3F58L 1IC5H 3X12A 3U9PH 1FNGB 4U1MB 1KJ3H 1DLFH 4Y2DC 1ZT4B 5IP4A 1OSPL 1IILE 4PFEA 3QUXD 3UPCA 1BWWA 1Q9LA 4KGLA 1T5WA 4K3DH 5CJOL 5MENB 2IADA 5C6TL 3PG2A 4N0YH 1DN2A 2CDFB 4P9MH 2Q3ZA 3PP3K 4GOSA 4IHOA 5DJYA 1WEJH 2X4TB 1LNUB 4PJGB 1I8KA 1IAKA 5C9JB 2UZIH 2ZSVA 4XBGB 2H32B 5INCB 5EIVA 2M2DA 1I7RB 3MYZA 2F5BL 2Y36L 3M1BA 1ZLVH 2NX5A 3MJ9H 4I2XE 5IEHB 3MV7D 4EN3C 3TVMC 3MRBB 2FATH 2V2XA 3EZJB 4KRLB 1SHMA 2NW3B 3FQXA 1HYRC 2K7QA 3BZDA 4ZFZA 3D3VA 3HS0B 4L4TB 4GS7B 2P24A 2HT4C 1NC2B 5JOPE 2D0FA 4HJ0C 1JZ8A 1M6OA 4HKBA 3D1MC 3EHBD 3KPMB 5TH2A 1KJMB 2NX5E 2Z9TA 4DKEL 4YFLF 3NACH 3GSNA 1CF8H 3U82B 5LG1A 1MCBA 2YD5A 1LO3L 2EH8H 4OSUL 1S5HB 3ZYZA 4U7KA 4YHYB 1DSFH 4JDVA 1RIHH 2HRPH 2LABA 3PABB 4PJHF 4X4MA 3RKPA 3MNVB 4MCYA 5KSAB 1YECL 3D2UD 4JG0H 1HSBA 1N2RA 3FMGH 4F7CA 1T2JA 4Y2OA 1L6XA 4MXQD 4R4NC 5F9DC 1AHWA 2EE9A 4FQXA 3DIFB 3BEVA 4N5EC 4IIQC 4HQQL 1EUTA 1ZOXA 3D85D 4ZQKA 4TTGA 4NO5A 3RY4A 3LVEA 1LD9A 3CLEH 2AEPL 4RFOL 3QXVA 5IGXL 3HI5H 3R8QA 3CH1A 1U8LB 4JHAH 4DKAA 1PAMA 2UZYB 4FP8L 3S4SG 4XGZB 5E6IB 1DE4A 4QWWD 4PV8B 3WEXA 2DI9A 1HIML 2D0GA 4Z7VB 1RU9H 1TTFA 3WS3A 43C9B 3PNWB 5K59E 1MUJB 1Z9SA 4CMHB 3GUTB 5JLZB 1EHLL 3OR7A 4MXVF 4MCZA 3REWA 3GJFH 3ARFA 5D1ZC 1SJHB 4FHBD 2IC2A 2Y6SC 1XIWD 3BPOC 1FC2D 2VE6A 4KKBD 4MNGA 5JW4N 2PW1B 1E4KA 1R3HB 1BVLA 1MCEA 4PV9B 3ARSA 3ULVL 4K07A 4UOW1 2G60H 1I1AD 2BDNL 3L7FA 4QHMA 4AENB 3OXRB 3NN8A 2Z31C 4FQHA 3DX6A 3MUY1 4LQFL 3P11L 1PKQE 4WWKD 1UH2A 2QADD 4XNQB 4U33A 2X1PA 1CIUA 4C83A 3B2UD 2ADIA 4GRMB 5LBSH 4GMTL 3VFMB 4OGZA 2AK4E 5E5MB 1CTNA 1UA6H 3QBTB 3ZYIA 3T77A 3SJVA 3ZKXC 1WTLA 3D39E 2YK1L 1ITCA 5ECJE 2BFVH 3I3BA 5KSBF 1ES0B 1INDH 3HUJA 3WFEH 2P7TA 3LKNB 2CO7B 5DT1L 3SOBL 1BPVA 4QHLA 2X2YA 5GGTH 1D5IL 2GJZB 3NZ8B 3ISWA 4BELD 2BHUA 1WFUA 3GSXB 3OGCB 3ROLB 3PL6A 3DETD 5LGJB 1MAKA 4NDMA 4WNQB 3UDWC 1HXMA 3D87B 5J13B 1T2XA 3HUJE 4R90H 4JVWA 5FYKD 2ESVB 4LSVL 3MROA 43CAB 1LEGA 3W39A 3RL2A 3EYVA 1XF1A 5IV2B 3RGHA 5DEFB 1IKFL 4JZNB 5B39B 1HHGB 4L3AA 5D2NB 5F89A 5FYLH 3RAJH 1QFUH 4KROD 5F9WB 2DQEL 3BPLC 4OFDA 4OLUH 4XMPH 2YR3A 5D1XB 4HWEL 3EYQD 3QI9B 1P69B 5CCKL 3TIEA 2D7TL 1I85C 5DDHA 5HGAB 2DJSA 4TVSa 3ZHLA 4R4FH 4U2ZA 1EEZB 2Z0BA 3KDMB 3UTQA 3GMQB 1DVFA 2FECL 2OLDA 2UY7A 5HHMB 3I02B 2L4OA 2G5BB 1U91B 3KPSE 5KSVA 5CGMA 4N0CC 3AMLA 5AYQA 4PG2A 4ONHB 2IAMB 2FH8A 4P23C 1YEKL 3QDGD 5DHVH 1U8PA 1NC4A 4GQ9L 1JGLL 4KGJA 1Q8MA 1N5YL 4CL7A 2FHCA 2VXVL 3GSQA 1C8PA 3NA9H 1NGYA 4FMKA 3NABL 4ORGA 4JO4L 4HT1H 5IFAL 3X11A 4P46B 2BVUA 3DVFA 4A2LA 5AZ2L 4NOBA 3I50H 4PJBA 1MFEL 3OHXB 4RMTA 5J9PB 1BZ9B 4M5ZH 5IK3B 2GSGA 3RWFA 3WD5L 1Q72L 3ZE2E 1ZGLA 1MNUL 1CE1H 2HFGH 2IMNA 2CIKA 3ARXA 4FMFA 3KLHD 2XZCH 3WFBL 1SEQH 2IPUK 5CS7A 3U0PA 1DBJH 2ADFL 2MMXA 5I71C 3TBVB 3KPNA 2DMKA 3TBTB 4E9LA 1J05A 4HUXA 4R2GD 5HXMA 2YRPA 1FL3B 2XI9A 4FFZH 2UUDH 3UPAA 2ICCA 4WEUD 1XGRB 1J8HD 1FGNL 3VFRB 1FC1A 4XP6L 1VFBB 2BJML 4RNRB 5I8CB 2DWDA 3ALXA 3REVB 4JFHD 1INEL 4U31A 5KTEH 3HHRB 2R4RL 2HJFA 3IT8D 5EOTA 1A7OL 3MRIB 5H37H 4PUBH 4GRWB 1ACZA 2J4WL 2YZ8A 1UC6A 1F4YL 4JHZA 4H88H 3FRUA 1YPZE 2FIKA 1TZIB 3MLXH 1B4JL 1FP5A 1B0GA 5D5MF 4HK3N 2BXYA 2PR4H 1E0OB 3P30H 4X5XA 5DD3L 1IC7H 5GS0C 3EO0B 5BV7B 5JTWA 1W8NA 3C9NB 2WK2A 3ZYJA 5J12B 1OM3H 4WHTB 1X7QB 5C0CD 4Y16B 1DDHA 1I1CA 1MPAL 4PJCF 2ZCHL 5AAWA 2HFEB 3T3ME 3AS1A 2Z93A 1FO0A 5I1JL 4Z5RB 4HUUA 2EH7H 4FTVD 1FO0L 1OQOA 2EICA 2DLFH 4FFWC 1IT9L 1BWMA 2P4AB 3HZMB 4FZ8H 1JN6B 4J3XA 4NOFA 2E9WA 5JIPA 2P8PA 3U1SL 2FGWH 3QUYC 2DI7A 4IOFC 2VDRH 3WLWD 4PY8J 4JDZB 4X7SH 5F1NB 4B53A 1LE9A 1F4XL 5ISZB 2OK0L 3QQ4B 2FR4B 4KAQL 2IFGA 2OR9L 2CDEB 3RWJB 1ZTXL 3VXMB 5I1KL 3OL2A 3GSOA 5CKAA 3QPXH 5E1AB 3KG5A 2AQ1A 4LHUG 1KV3A 2YRLA 3NIGE 1WCBA 4UV4L 3TN0D 4S1DC 4WJ5B 2YRZA 4NPYA 1A14L 3OG6B 4WW1A 2ATKB 5BS0E 5F9JA 1TQBC 3TBWA 4F9LA 1S3KH 4NQVA 4X6BB 2H1PL 4Y5XB 5J56B 1AGFB 4EQ3A 3H7LA 4P4KB 3OF6A 3K4DA 4YHKH 4NBZB 2AV1A 2B7DT 3DX7B 5EO0A 4WO4D 3WN5B 2DQGH 1LP9B 2F5AH 4Q9BA 1ZA6B 2X9WA 3D0LB 1U3HA 3IU3A 5F70A 1ZLWK 1Q0XL 3MJ8A 2Q6WB 1QSEA 4JM2D 1IL1B 2HJKA 2YD7A 5ELIA 1MFDH 3W9EB 3CSGA 3ZKQD 1KLGB 3Q1SL 4U6HB 5DMYA 1FSKC 4LIQL 5EWIH 1D9KC 1P9MC 4XVTL 5HDBF 4MAYB 3FRPG 4ENEC 5JHDB 5I18L 1JWSB 5D7IF 3KPTA 1IKNA 2EXYC 1QSEE 4ZUTA 4C59B 4WFFE 2NY5C 2YUXA 1H3XA 3FFCE 5EOCJ 4DGIL 5DTFB 1J0YA 4RBPH 3O3AB 3WSQL 5A3IC 2H6PA 1B0RB 1ONQA 5GGRA 3G6JF 2IQAA 2XZQL 1AGEA 1YEEL 4TSCL 4ZS6D 5GRVL 3RU8L 4LLUA 3GEWB 1G6RB 3KPQB 5GRUH 3MRHA 5DRZA 1NKOA 5CLTA 3FQTA 5DJZB 1GGIL 3VH8A 3SDYH 1L9MA 4J3VA 2VLKB 1CGVA 4KJYA 5DQDL 4G3YL 5DUML 1MCPL 3DUSB 1QBML 3VDAA 3IRZA 5DFVD 3W11D 4U7SA 3C6LA 5KG9B 1MCLA 2GJ6A 4AM0A 1NMBL 4ZOBA 1HQ4B 5IBTH 3W5MA 4WUKL 1GZQB 2XQYK 3MA9L 3P2TA 1RJYB 3O41B 3GHBH 1A5FH 2H8PA 4UQ2B 3QJHB 3RIAF 1IZKA 5D72H 3ARBC 4G6JL 4LHUA 1C5CH 4RQQB 2DQDL 2FO4A 1UM4H 3BZEB 4XNXH 5IB3A 5DSCB 5FYKH 1KIRB 3QA3A 3PP3H 1A1OA 2GQHA 4LRIC 3FTGB 2FWOB 5K9JH 4JDTL 3IXTA 1KPUB 4L3EA 2NX5D 3BFOA 3HZYB 4U1SB 3ABZA 3IFNH 4ZPTB 2X89A 2A38A 1RJCA 5TDPB 5L2JA 4TUJB 4P2OC 1BD2A 1G0XA 3D3VD 5CP3A 3UTZB 3BYYA 1HN1A 5A2FA 2CLZB 2X10A 3RA7L 3MO1B 2ADGB 1P5VA 3DMMB 2UYLB 3O8XC 2O5YL 2C3GA 1BIHA 4QHUB 3LH2H 1Z9MA 4HIEA 3LKOB 4UV7L 2CRZA 4J3SA 4S10A 1A6TB 3HR6A 4HIHB 4IRSC 3CXHK 1BD2E 4JFEE 3FRPA 2Z92B 1LO2H 4P2YA 4R96B 2GUOB 4X6CE 2ITCB 4HZAA 4OIAA 2QR0A 4HWUA 4OLEA 4JPKH 2WQRA 5FM4A 1G7LA 3MUHL 4N9GB 4G42B 5C09A 2EE2A 3KYOB 2MPAL 4D9LH 2YA0A 1NGPH 1F45A 2J88L 4YDIL 1R5IA 1UGNA 1S7UB 3MV9B 4M9OA 3JWOH 5EU3B 3BSZH 2EDYA 2P5WE 4JZJA 5JZ7D 5GS1A 4LLWA 1ZT1B 5IW1B 2Q7YB 1FBIL 5C09E 4MVBD 1D6VL 4YWGL 4LF3B 4R7NA 4NHUB 3MUZ1 3GI9H 4G6KL 4ODBD 3BP5B 1KYOK 3SQOH 1V7ML 1U8HB 3CFKA 2HAZA 3RWGB 3GJEA 2W07A 1I8MA 4RGOL 5B8CA 4OZGF 5ITFB 1OP5K 1HHIA 1UM5L 2X4QB 5DF0A 5HVFB 4JG1H 1GPOH 4XCNA 3BP7B 5D7JB 1T6VN 4ELKA 3ARFD 2VDKH 3S97C 1OVZA 5FO9B 1RHHB 3ULVD 3BWAA 3PHOA 3BUYA 5KW9L 3BPNC 3HMXA 4PJHB 4I3SH 1OGAE 1OAUH 3GSVB 2R0KL 4ODVL 1P84J 4O2CB 1A3LH 2EYSB 3CZFA 1FV1B 4QCIA 3VWKC 1X5JA 4K7PL 4BFEA 1ZV5A 3BQUC 4F3FA 3N9GL 4JFXB 2WIMA 2YPLB 4H5SB 2PO6A 1JF1B 5FECB 3UTPE 4FXLA 4TRPH 2A73B 2XN9B 2NLJB 2AXFB 4LLQA 5T5NG 3MQIA 2DQJH 4OZHF 1U2CA 3PP4L 3L3GB 2ZUTA 4X83A 3RVTC 2CIIA 3EOAA 1D9KA 5E8DH 5IMOB 4LEXH 3SJVD 1KTLA 4F7EA 3D0VB 1BLNA 3P4OA 4GXUN 2BK8A 5JIHA 3TYGL 3RWCA 3MRCB 4X80H 1NBYB 2VR9A 3ZTNH 3HLAA 1CGXA 2X09A 4CJ1A 1R24B 4M3KB 5MEOA 2NY5L 4P48A 2C1OB 4MMXC 3B6SA 3LD8C 1CXLA 2XA8H 3HNSH 5IVXE 3TIDB 4EI5A 1BOGA 1NEZG 4RZCA 2JTDA 2J8UE 1ADQA 3FO0H 3VFSA 2BZDA 3P0YH 2GK0A 3PL6D 1Q1JH 1ADQL 5DC9B 4L8SB 4ZXBC 1FLRH 4GG6E 1FZKB 1I75A 15C8L 3MMEA 4N8VA 5CJBA 4U2YA 3BDXA 3WCYA 4KU1A 5AAMA 3HC0B 3ROOB 4Y2DD 4DN3L 2ZNXA 4RMSA 3MCLH 1S9YA 5BZWB 1G7JB 2R0ZL 5F6IC 1CGSL 4G9FA 1I8LC 4OZFH 3L3DB 2AV7A 4Q6IB 1A9BB 3MRQB 3UJIL 3ARBA 1TZHB 1MCRA 1EJ6A 3OPZH 1H8OA 2EKSA 1ACYL 1I8IA 3H9SA 3PWUA 1PLGL 4GXVL 1YUHB 4NN5B 2X9XA 4KRPB 5DURD 4TULL 5SWSA 1B2WL 5KVGH 2IBGA 1GHFL 1NSNH 1YEGH 3BIBX 4FQCH 4NQCA 4ODWB 3SGKC 1DVFD 4QRTB 4BFIA 5HGHA 3H9SE 4OV6F 5B4MC 5KSBB 4PREB 4K3EL 3PWVB 2NXZB 4XVSL 5I75B 3V6BR 3TVMD 5SWSE 4EDWL 4PRHB 4X5WB 5LCVH 5DFWH 5KS9F 5EN2A 2XWBB 4L4JA 3PV7A 4E41B 1J0IA 4QRQB 2HT4D 3VFUA 2B4CH 5HHNB 4HJ0D 1NC4D 1KEGL 3QQ9C 4BSWA 4GAJH 5ADPH 3IB4A 4M8QB 2W60A 2FNBA 3HC3H 1QBBA 4UILH 3UJJL 4PS4L 3WJLC 4FQIH 3V9FA 4YHIB 3D48R 4HJGA 4NZUH 4ZFFB 1NGWB 25C8H 1QD0A 1HSAA 2HKHH 4APQC 3RWIB 2PN5A 3LKSB 2H3NB 5GRVK 3FQWB 4FQJH 5BOZG 1DLHB 2UWEF 1KEMH 1QACA 4N5ED 3IKCB 1MLBA 4JO3H 4NKOA 3SKNA 5F96H 4DK3A 2Q20A 4UMGA 5EZLB 5T1DL 3VG9C 3V0VA 1HK6A 1A7PH 3MODL 3U2SA 1IBGH 3F58H 1L6ZA 5ALBL 4M3JA 5ERWB 4Z0BH 1EZVY 4XP4L 5FIEA 2Y4SA 2KZWA 2ENSA 3IDXL 3ZDZE 4JFZL 5ILTH 1KULA 3QQ3A 4IRZH 5LJYH 3WLBB 3IDYB 1WLHA 5CJOH 3RVVD 3QEGL 4QRUA 1QVOB 3LIZL 5DJCA 5C6TH 1QR1B 4HF5L 4LHQB 1MAML 3WDIA 2EDTA 5C0EA 1VFAA 2VRAA 3F6LA 3UBXG 3QIBC 1A6PA 2YN5A 2BSRA 2NYYC 1BQLH 4HGWB 1S78D 1UZ6E 1IEHA 5C0IA 2DJUA 3FZUC 2F5BH 2NY2C 4UDUB 5KVMC 1NDMB 3DXAB 3X3GH 1C1EH 3UPRA 4FG6D 5GQBA 4PLJC 1AE6H 3SCMB 4X6DF 4GG8B 2LFGA 4NUGH 5I1CL 3I2CL 4QXUH 2G9HB 3UTOA 4HC1L 1BJ1H 3D69B 3V5HB 1YA5A 3G5YA 4KTEL 4HLZG 4BH8B 3LAFA 3G9AB 1LO3H 1CFBA 3MV8B 1HDMA 4KV5F 3MGTB 4WEMB 5FOBA 4G80B 4R97B 4NZTH 2R2HA 4EJ1C 3TGXA 3QFJB 1FGVL 4OT1L 3VMOA 4GAYA 3DHJA 3V4PH 3AY4A 1YC8A 1E4JA 4DVRL 1X9QA 5E8PA 2A1WH 2CLVA 4PLKC 3RUGB 2FIRT 2V2WB 4LAJH 4QXTB 4HIIA 2DQUL 5E8OB 4PJDB 4JM2F 5EIIB 1H3PL 2Z4QA 5TFSL 2W38A 1KJVA 1UYWL 3D6GA 3UXFA 3P3YA 3QXAB 2DYPB 4HKZA 2AEPH 4PJ5B 4RFOH 4ZXBA 3BHBB 1BMGA 3WHXB 4K8RH 2VWEC 3CIQA 5MEQB 5T1KB 4Q9QL 4YR6B 3MRNB 1JZ3A 1QQDA 2EDRA 3CK0L 1A7RH 1YZZA 2VABB 2VISA 1G84A 4YK4B 1I3RB 32C2A 3DTXB 3OF6D 5FA3B 3OJVC 1JV5A 3DI3B 3HTLX 4PJCB 2ZKHH 4HV8A 3U0TB 5D7LB 1U3HD 1HHKA 1EHLH 5B38B 1BGXL 3IDGA 2HVKB 4XPHL 3UAJC 5KBNC 1RZ8B 1T4KB 1QSED 4JQVC 1RURL 5BZDB 4N8CH 3UBXA 1WT5C 4AT6A 4X4YA 3RJQB 4LKCA 1CDCA 2W9EL 3IDJB 1WBYB 4MA1B 1MHPL 3SE3A 3TZVA 4W68A 1AQDA 5IHBA 1MJ7H 3SGKA 3F7YA 2HWZL 1PG7L 3ULUC 2BDNH 4AG4L 2VLJE 3OKKB 3DLQR 4AL8L 3BKMH 4LQFH 3L3KB 4U1IB 3HR5B 3RIAK 2AABL 3HG1E 5AWNH 2VH5L 4P23D 1G0DA 5E2JA 3TNNB 5AZEL 2DBLL 4IOIA 4GMTH 4OCLC 2I9LA 3MRKB 3UZEA 1I7TB 2CH8A 3BESR 4ZUUB 4NCC1 2IGFL 4E5XA 3EO9H 2F53A 5HHPB 2YK1H 5HYEA 1U95B 3VFVB 3C6LD 2GJ6D 1UH4A 2AJYL 5DT1H 4HXBH 3QJFA 3SOBH 5H35A 1D5IH 1T2QL 4XMLL 1CT8A 1PEZA 1FCGA 5ETUA 5KJRL 5LGHL 1ZHBA 2DJ4A 4LHUD 2JKXA 3KYNB 1CFNA 3LN5B 1RJZB 3SDAC 4I4WA 2X4UB 1FQ9C 2A74A 4KUCD 2DIBA 4Y0GA 1VACA 1J10A 2OI9C 2GTWA 2OP4L 5D7IB 4FQPA 4QT5B 4UB0L 4CDHA 1T7YA 4L3ED 1IKFH 3TT3H 4LAQL 2OL3B 5IMKA 2PYFA 2X89D 5HYQA 5EOQL 1MLCA 4DJMA 3G6JB 2X5PA 1BD2D 4TSAL 3PGFL 5GGQL 2P8LB 5CCKH 3BEWA 5DJDA 4UZGA 1R5WA 4XPAL 3MGOB 3W2DL 5HHXH 1UACL 3FOMA 4HEPG 4PRIA 4ODSL 3R8BB 2ZUVA 3TA3A 4LPCA 3GMPA 4MDIB 4P3DA 4AMKH 1V5JA 3RRQA 1W72B 3Q6FB 1GOGA 3BZFB 5FYJL 4KI5C 4JY6B 1A47A 2AJVH 2D7PA 1DQTA 4MQSB 4N8PA 3SN6N 1BHGA 5IESL 4PRIE 3GMLB 1ORQA 5C09D 1F00I 5GIRB 4RA3A 2EXWC 2I25N 2VTFA 3K1KC 3IDNB 4I9WE 4GQ9H 4XCYB 5IMMB 5JW4Q 1N5YH 1QFHA 5HHVL 2VXVH 5IB5B 5SX4H 3ULVF 4TUOB 1K2DA 3VE0A 1P7KB 2LAAA 4L8DA 3NABH 5FO8A 4QRPA 3O2DA 2IBZX 3VWJB 3TO2B 2E7CA 1MVUB 3DX9B 5JOFA 5IFAH 4NHCH 5ICYA 4IOFD 1ROWA 2B5IC 5FV2A 1BBDL 1DCLA 3W9DB 5E8EA 3BKJL 2Z91B 4NT6A 3Q2CA 1JHTA 2QQLL 3Q3GA 3WD5H 4DAGH 1Q72H 2P5EE 3X3FL 3E6FB 1AXIB 4BQBA 4ZPVB 1MNUH 3DO3A 4P3CH 2RCSH 4G8GE 3WFBH 1A1MA 4LVHB 1OP5H 2V7NB 3WFCL 5EBWA 4HBCL 3O6KL 1CFTA 4GUPB 4HH9A 4J12A 3MRRA 3V6ZA 3FB5A 4JPIA 4XB8A 3S34L 1EHNA 2B1AH 4BYHA 3BH8B 5CILL 5F3BA 3VFNB 5EA0H 2HLFC 2A83B 5D6CA 3HUJF 3L3HA 4NQTA 2O5XH 2HKFL 3UTPD 2FZ3A 1FGNH 5ICZB 3V2AR 1EEYA 2KDGA 5DVOA 4U6VH 5IVOA 3OV6A 4XP6H 1MCWM 2VWEE 1T1WA 5DJXB 1LK2B 3ESUF 2Y06H 1XIWB 2EIZB 1A7OH 3C6SA 4U1LA 2PO6D 4BK4A 4QHNA 4NSKA 4QRRB 4J3TA 2BRRL 1WT5A 3HNTL 1B4JH 3S36L 3QUMB 1D9KD 5EULV 4WFHE 4EUPB 3MC0A 1NMAH 1CXIA 2D7NA 2FX8L 3ARGA 3VRJA 1K3ZA 3ULUL 4DK6A 4WWKB 3LCYA 3PWPB 3VFWA 3T0EC 2Y5EA 3QO1A 3SO3C 4OZGB 2BC4B 3HAEB 4RMRA 2KQNA 4PJIA 1YQ2A 1ZKAA 4ZO6A 4Q2ZB 1G6VK 3OJMB 4WTXA 3QEHA 5GJTL 1S7WB 5TDNA 3FN3A 3ULUE 3VXOA 1KTDB 1NAMB 3QYCA 1P7HL 5DGRA 2A77H 4YHPB 4R4BB 3HRZA 3N50A 4FQQB 4MJ2A 1OLZA 3CFBB 3TPKA 2GAZA 2DKMA 4JQXA 4YBLB 5ACLA 1F4XH 4KAQH 5IQ9A 1WBXB 1FYTA 1QOKA 2NY7L 4D9RD 2OR9H 1U0QA 4G9FD 2RIKA 3U30B 3NIFE 1FNEB 4OCWH 2NZIA 3ARBD 2O26U 3H9SD 4UV4H 2EC8A 2E7BA 4X7TA 3SDAA 1MCJA 4OZHB 5SWSD 2CDGA 1DR9A 4I8DA 1FPTH 3MLWL 5HYSG 3U6RA 1PDKA 1A21A 5HHOB 3MNWA 4PJBF 5EC2B 4K3GA 4NQCD 2VSCA 3B9AA 1LEIB 1HHHB 4PRPB 4KROB 1OF2A 5A2JH 1BM3L 1JRHI 4LVOB 1OGTA 2CQVA 3TYFB 2C3VB 1BX2B 1EEQA 3F7QA 4P2OD 1R3IH 5FV1L 2ZUXA 4XP9H 1TQCC 5DJAA 3O8XD 2Q1EA 4MA8H 4LU5L 2L7UA 4MX7A 1R5VA 4OZ4A 3RVWC 1DUYA 5FA4B 3Q1SH 2AKRB 3ARUA 5FF6A 3WFZA 3UMTA 4IRSD 3BDYH 1PSKH 1DBAH 5EO9B 5F3HA 5I18H 2IANA 4HCRA 3IF1B 4X7CC 2IG2L 2ITDA 1J0KA 4HCRL 4NFBA 3K80A 4P59H 1ZSDB 2VERN 3M45A 1XCTB 4GW1B 1HQRB 4ZODA 1QFPA 4L8BB 1RUML 4U6XB 4AH2B 1NLDL 3OWEA 4TSCH 4NO0B 1NANI 3BT2L 4KI5E 2IANE 4K23L 4DFIA 4BJLA 4I18B 1BVKA 4XHQA 1TVDA 4M7KL 4YC2C 5CMAA 1GGIH 3QXDB 2A0LD 4LMQE 3BIAX 5B21A 3L9RB 3HFML 3EOBB 4PJAA 4HWBL 1J0ZA 4M7JH 1RFDL 4UT6L 4ZYKB 1NMBH 2JCCA 1C08A 3GNMH 5CJXC 5DWUH 3PIQB 3QWRD 4Z7UE 4UIKL 5TE7H 5C0BE 3L5HA 4OTXL 4NRYB 5I74B 5FGCE 4HEME 1TCRB 2J6EA 1KIUA 3MJ7A 3WUWG 1GOFA 2R0LH 1X4ZA 2J6EL 2Q76B 1A7NL 5E6ZA 1RZGB 4KVCL 3QR2A 3FB7B 2ATPB 4HXAL 1T5XA 4YHML 4HK0A 1VADA 4WCYL 3O4LA 5HYSA 3K8MA 1J8HB 4PJ9B 5F1IB 3RNQB 5E94B 4D0DA 1YYMH 2M1KA 4NRZB 4O5LH 3KPLB 2VITA 3RNKB 1T3FB 1KPRB 3AU1A 2UWEB 3CFJA 2ORBL 3O4LE 5JIKA 3C5JA 2X4PA 3HMWL 1XCQB 2HN7B 5I6XB 3SGJC 2OJEB 5MP6L 2PXYA 1FVEB 3ZE1E 1OPGH 2KZ1B 3GSWB 3RVTD 4EKXA 2A6KA 4LCUB 5SX5K 1DUZA 3AXLA 3HN3A 5K93A 2GT9B 3B43A 3I75B 5FGSA 5HPMB 4LLVB 2L7JA 2E9JA 1KIQB 1OB1A 5C0CB 2KBGA 1TJIL 1BJ1J 4PG9A 1HEZA 5GS0H 3T0EA 3FCTA 3QUZA 4CUCA 2J88H 4NQEA 2EYRB 2BCKB 1TITA 1BREA 4O02L 5DHYB 3VXRA 1BZQK 4PGEA 3QAZC 4B5EA 2K7PA 3KLAA 4ZXBD 3H42L 4X6FB 3EDDA 2IPTL 3INUL 3T0EE 4MJIB 1D6VH 4DZ8B 4YWGH 3ZZ1A 4PGDA 4G7YL 3H3BC 2MKWA 4G6KH 4OB5L 2N7AA 4F7TB 3LQAC 3S3JA 5I73C 4X8JB 1V7MH 2CKBA 1YEFH 2ED7A 1UWXH 4F8TA 3TCLA 1BQUA 4YUEL 2CKBL 4MB5A 4RGOH 4X6DB 1RUQH 3BH9B 1UXSA 3SHSA 4KKLD 4KK6D 3IFOB 1UM5H 5MEPB 4DEPC 2X42A 2Z35A 1CXEA 2VLRE 4Y4KC 1V3MA 1VDGA 5C3LD 1YY9C 3WUWA 3QO0A 3PF2A 1HCVA 4CNIA 5DRNA 4NM8L 2A6IA 2GFBA 4WTZG 2R4SL 1G9NL 3O2VL 3EW3B 2FH6A 3MLUL 3QNYA 3TZVD 5KW9H 3FB8B 5TGBB 3LN4A 1RV6X 2R0KH 5B4MD 1RUPL 1P7QD 4ZO8A 4KH2A 4MNQA 1MH5A 2CXGA 2W9DL 5I8OL 2MOVA 3DGGA 1N8ZB 1U8QA 4D0BA 1OQXA 4JM2B 3S96A 3N9GH 2JIXA 4ODTL 2ZG1A 4RRPG 3AAZA 3QQNA 2Q8AH 3QQ9D 2QSVA 5F88A 4Z0XA 1H5BC 2W0FB 3PP4H 4MNQE 2A6JB 3G08A 3VGAB 3MA7B 4UQ3A 2F53D 1RMFH 1CYGA 4X9BA 1C16B 4APQD 1C5BH 3WFHB 1T22A 3ZO0A 4F7MA 1CBVL 2DD8H 2NY5H 1BBJA 5JPNA 1SJEB 5CSZB 1DN0B 3GSRB 3RIFK 1S9XA 3EYUL 3LN9A 5IJKC 3QCUL 1G7QA 2DQHL 3BWUC 1FZJA 3G5XB 2AJZA 2YD8A 1ADQH 5BJTA 3ECBB 3W82A 2VAAA 4Y4FC 2I60H 3X12B 2XTJD 4JJ5A 4KHTL 4OD2A 4DTGH 3DV6A 5IHUL 4OQTH 2BHYA 1A02N 3T4YB 3RPKA 4LP4A 4E42A 4DN3H 4MHHG 4TUKL 1MCOL 3BRFA 5GJSL 2R0ZH 1RJLB 1A7BA 1CGSH 1HI6A 3BISA 2IADB 4YDLB 2NR6C 3F5WA 3QDAA 5EUKB 4N1HB 3BJLA 5DYOA 3UJIH 4IHOB 2YXMA 4HS3A 4RFNB 4EXKA 4GXVH 2XA3A 1IAKB 4X9HA 1K4DA 4OCYL 1T83C 2E9IA 3QIBD 4PRID 3S98A 2QQQA 2FD6L 2NYYD 1RK1A 3TA3D 2APBA 3M1BB 2Q8BL 5FYJD 2NX5B 4ZTOL 1MHEB 3FZUD 2ZUQC 4I9WD 4S1QH 3GO1L 4HWZA 2NY2D 2V2XB 4AIXA 3FQXB 2BERA 1AD9A 5E00A 1YEJH 4EUPH 4N68A 3D3VB 4PLJD 2P24B 1K9TA 1E4XH 2ILLA 1M6OB 5TH2B 4ODHL 3VGGA 1NQBA 4IJ3C 1KEGH 3WJJC 4K71C 4RRPA 1KB5L 3GSNB 2O93L 1JPFA 1MWAH 4PS4H 4QRPD 5TPWH 2FLRT 1JUFA 4TTDC 1AO7E 2V6HA 3JVGC 1HSBB 1FG2A 1N2RB 4MA3A 4F7CB 5L8JB 4OI8A 1AHWB 4WEBL 4FQXB 4PLKD 1HYSC 5E7BA 3ME0A 2B20A 1XGUA 4ZQKB 1VENA 1NEUA 3QNZA 1T6WA 2XPGB 4NO5B 1LD9B 1PX3A 5J11B 4L1HA 5L0QC 1D5ZA 5T1DH 3IKKA 2FJFA 3CH1B 3WL9A 3MODH 5DJ8B 2VZ1A 5ALBH 5HYJA 1DE4B 3B5GA 4Z7QE 4XP4H 1F11A 1KYOJ 1K6QL 5F9OL 3D9AH 4NGHH 3VXPA 4JFZH 3WS3B 4NN7C 2BNRA 5IOPA 3QEGH 2DQCL 4R6UA 3OR7B 4MCZB 3REWB 1MFAH 1RVFH 3ARFB 4BKLA 1X5XA 4WFHD 2VXQL 3UAJD 1P4IL 5D1QB 4Q74A 4JVPA 1X44A 2FJGA 3DRTA 3MLTA 3E6HA 2MSPA 4MNGB 5MHSD 2W0KA 1AI1H 3DBXB 1W0WA 3H8NA 1BVLB 1GGTA 2BNRE 3QG6A 4JKWA 2LTQC 1S7SA 5GGVL 5E56A 2NY1C 3L7FB 4QHMB 4M93C 2O5ZL 1W0YT 2VDOL 3ULUD 5LVEA 3ARGD 4GBXC 3VGFA 2Y23A 3AREC 1EDQA 4HC1H 3NZHH 1A22B 1IGIL 3FN0H 3IS1X 3OXSA 1NFDE 2ADIB 2AGJH 1OOAA 1X6LA 5C70A 4KTEH 1AP2A 1CQYA 1H5BA 2DLHA 5GISL 2ZOLB 3T77B 2IH1B 3DUHA 3SJVB 1IARB 4L4VA 3ARRA 3ILQD 1G7MA 1A6VL 1CL7L 1IGML 2K1MA 3CFEA 3O6FC 2WBJC 3U36A 4M1DL 5INDA 2P7TB 3HC4L 5HI4C 1HWGB 5IFHL 1FORL 1QG3A 2Z8VC 2R2EA 5I9QC 4C56A 3PL6B 5TFSH 4NDMB 3IJSA 4Q0XH 2QSCL 1ZK9A 5T5NF 1HXMB 1BFVH 1Q9OA 3MROB 3UO1H 1CD1B 3SDAD 1AIFB 3I6KA 1LEGB 2YUVA 3EUUA 2B39A 3EYVB 3STZA 1QFWM 2YKLL 4JRYB 1CDGA 1BFTA 3CK0H 5F89B 1IGFL 4MNHA 3QIUA 4FRWA 5KVFL 1EIBA 1RI8A 3N1FC 4XCFL 3O4OC 1H3GA 4OCMC 5LAXB 3TIEB 5DURB 1KJ2A 4LLYA 1AGBA 4PIRF 5DDHB 4JGJA 1RURH 5HTSA 1F3DH 1KJ2L 3I9GH 2EDJA 2FHBA 5D9SA 1B9ZA 1ZMYA 2M8XA 4FQ2L 1OAKH 5IUSA 1DVFB 2W9EH 2CMRH 1LDSA 2H26A 3IGAA 1MHPH 4AQ1B 4HUVA 5EH1A 4P2QB 2HWZH 1PG7H 5KSVB 3V4VH 2IAND 1IGTB 4AL8H 1N6UA 3MBEC 5IB4A 4X98A 3MPCA 2E7HA 4OCSH 4RAVA 3H9ZA 5IM7A 4UT9H 1WGOA 1U8PB 1S5IL 1NC4B 2VH5H 4Y5YB 3GSQB 5B3JE 1NGYB 4HG4J 4HPOL 1KXTB 3LSOA 2D03L 2DB8A 4MB3A 1TPXC 4HLZH 3TT1L 4X7EC 5LWYL 3X11B 3T8XA 5C0BD 5ITBH 5JR1L 3VDBA 3RVXC 1MJJA 3LEYL 3CCHA 3JVGA 4PJBB 4PJXA 3VFTA 2GSGB 5CEYA 2WAHA 3LRSA 3RWFB 2AJYH 1V3KA 4HWNA 1T2QH 1ZGLB 4ERSH 5MERA 2CIKB 5KJRH 2IALA 3U0PB 1JNHA 3KYKL 3P0VH 2XTLA 3KPNB 3IETA 3KXFE 1J05B 4HUXB 1UJ3B 3MUGB 5GHWH 4D8PA 3CVHA 3O4LD 4HKJB 3RY6C 3CVHL 3U4BH 2HLFD 5IIEA 3RP1A 5HI3C 3RWHA 4LAQH 1KBGL 4F57L 2XRAH 1FFQA 5FO7A 4ZSOA 4U7MA 3PGFH 4URTB 1KUMA 1IGCL 4NKQB 2F58H 3LDBB 3FRUB 2FIKB 4NP4L 4XPAH 3W2DH 3IDIB 1JMXA 2ZCKL 4J6RH 1JWMA 1CICB 2R8SL 2VAJA 1SVCP 1NBVL 4X5XB 1PG7W 2HH0L 4NYLA 2Y9RT 4PB0H 3P0GB 4XB7A 4FNLL 1GZPA 3DURA 1CGTA 2WMPA 3HZKA 1DDHB 1WF5A 5ADOL 4GBXA 3DWTA 4Q97A 5IESH 3T0ED 1AGDA 3QUZD 2Z93B 3AREA 1FO0B 4HUUB 2V5YA 3ETBF 4NQED 3QB7C 1L0QA 1CLZL 2XQBL 4S0SD 1E6OL 4HFWA 2ICWI 2VZVA 3VXRD 1HOCA 2M26A 3MRJA 3EKCA 4H8WL 2MQ3A 5HHVH 3U0WH 2YMXH 1I7ZA 4R0LA 4P2RA 2DN7A 4MQTB 2NXYC 3QXTA 4CW1A 5E5UB 2ZNWA 1EEUA 1FVCB 1Y0LA 3MRPA 1XGYL 4LQ1A 1BBDH 4PP2A 1SY6A 1LE9B 1E6JL 1QKZL 2B8OT 4TNWK 1FDLL 3ZDYE 3WIFA 3BKJH 5CP7B 2PUQT 2GW5A 5EOCL 3GSOB 8CGTA 3F62A 4ONGH 5F7EL 3X3FH 5KANI 1WCBB 1WZMA 2YD3A 2JF1A 1NMCB 4X7FC 3WFCH 4NPYB 4P57B 1QLEH 2AK1L 1GAFH 3C8DA 5F9JB 2VL4A 2X1QA 4PGBA 5DC0A 3TBWB 5FB8A 1N7MH 4JY4B 5IB2A 4NQVB 3S34H 2NNAA 3MLYH 3TBYA 1KN4H 5CILH 4ELME 2ZUWA 4N0UE 4O4YL 1RQ5A 1HHJB 2X4OA 1U9KA 1CVRA 4ZG1A 3VXQA 3OKDA 1QPPA 3IU3B 1U3HB 3QDJE 4MNQD 1YYLL 3MJ8B 1UKQA 2LVEA 3LZFL 2NZ9C 2JIXD 3U9PL 2HJKB 4HLJA 4UINH 1DLFL 5E2VL 2BRRH 3GIVA 3GMOA 3SE9L 3SDCC 2ZSWB 3T1FA 2VJXA 3S36H 5BOPA 4JFQA 4RMUA 1EHXA 1CQKA 1TNMA 1EAPA 2BSTA 3ZDXE 1T1YB 4ZUTB 1VFUA 4LPTA 2HG5A 2OMNA 4C54A 4JFOA 2FX8H 3MBEA 1NCBH 2VQUA 1BF2A 4N0YL 3NOIA 2H6PB 4DGYH 3ULUH 4D0CA 5IWLA 1NFIB 1ONQB 5GGRB 4OUUB 4EI6B 4HKXA 2IQAB 1AGEB 1WEJL 1JCKA 2ICEA 4LLUB 1U3JA 4FFVC 5KANG 3MRHB 1S8DA 5DRXA 4WV1B 5DRZB 4X6EA 1JF5A 4YZFE 3QEQA 2CXKA 3VH8B 1QRNE 4KJYB 1CXHA 1LO4H 2N4IA 1BJMA 3ARDC 4OLYH 3C6LB 2GJ6B 4LLDA 4AM0B 3GBLA 4XRCB 1HKFA 3VGEA 4JQIH 1UADC 4AEHH 1UH3A 1MHCA 4RX4A 1ZVHA 2H8PB 4MQ7A 3VD7A 1S9WA 2BSSA 1VEPA 3NACL 4AJ0A 1CF8L 2EH8L 2FO4B 2QEJA 1D5BA 5CEXA 4F9PC 4Q58C 1S7TA 4ORZC 3QA3B 3AMKA 4JG0L 3FMGL 2CD0A 1QPXA 4XVJL 3KJ6H 4K7PX 3UYOD 3L5WA 1I9EA 4L3EB 3EAKA 5CHNB 5CGYC 4NQXA 1S7QA 2FX9H 3EFDH 3WKML 1NH6A 3OAZK 2AJXL 2HMID 3B9KA 3VXSA 3MRGA 4JFPB 4KHXH 4F37F 3CLEL 4PJ8A 3KJ4C 1A4KA 3EYSL 3HI1A 3JWDH 1AO7D 1F6AB 4WDIB 1NGXA 3L1OL 3BXNA 4JHAL 1XGQA 2DWEB 4UTAL 1KNOA 3CC5A 3NCYS 2JJSC 3JV4A 3LB6D 3OKEA 4O58H 1JHLH 3GGWA 2I5YL 5D7KD 1DP0A 3OAYH 2QR0B 4G6FD 4HS6A 2WIIA 3GJFA 5I0DA 1ZVSA 1G7LB 5C07A 2OQJB 4OFPA 1AKJB 3O81A 3LRHA 4M00A 4ZO9A 2I26N 2NY0C 3QHFH 4JFFA 4HMCA 3WUZA 4PJ7E 4JZJB 3BT2H 2NY6B 3HE7C 4K23H 4RMWA 4LLWB 5GS1B 1IQDA 1QSFA 2G60L 4MD0A 1AXTL 3U4EB 4R7NB 5GS3A 4O9HH 4K94C 3ULUF 5HYJD 4HWBH 4NCDA 3TJHC 1IM3B 5DD0H 4GKOA 4UT6H 3CD4A 1T03H 3GJEB 1I8MB 5B8CB 1H0DA 1HHIB 5I1LA 3IDMB 2XWTA 5CBAA 4PJIF 2BNRD 4UIKH 3TO4A 1QRKA 5LBSL 1WWBX 3EDJA 4XCNB 3IJYA 4XI5D 4ZAKC 1UA6L 4Y4KD 3AS0A 2HJLA 1YY9D 2J6EH 3LKQB 1J8KA 3GI8L 3STLA 1TQBB 2BFVL 5I66A 3NIFF 3H9YA 4HXAH 4YHMH 1XR8A 3IU4L 5GGTA 3BWAB 9CGTA 3RZCA 5GGRY 5GGTL 2FDBP 3UJTH 1AC0A 3LPGA 2HP4A 3CZFB 4QCIB 5FCUH 1TTGA 4F3FB 4NWUH 4TSBH 2PO6B 2ORBH 2GJJA 2IQ9H 4GKSA 5FEBA 1S9KC 4LLQB 4WIQA 3PQYA 5LQBL 2P44B 5MP6H 3SDCA 1MQ8A 1XR9A 3NTCL 1KTLB 4L4VD 3P4OB 1BLNB 5FYLL 1QO3B 2VL5A 1QFUL 4EBQH 4ESKA 1N64L 3RWCB 4OLUL 4XMPL 1D5MB 3HLAB 5DVNA 4L8CA 5CWSA 5H37G 2RHEA 5JW3H 4ZNCD 1TJIH 7FABL 4GS7C 4KMTH 4OLXL 4EI5B 1ZANL 2BNQA 1CE6A 2X1WL 1BOGB 2MNUA 4RZCB 4XNZB 3VFSB 4DUWA 4C56D 2GK0B 4R4FL 1RZ7L 1NLBH 4O02H 4N9OB 4L9LA 5EZJA 1W0VA 3BD3A 4HDIA 2HFTA 3MMEB 4N8VB 3UTTA 4YHYC 4IOSD 1H15A 3H42H 4NN6B 4Y4FD 1OY3B 3KYMA 4RWYH 5KSAC 2YA2A 3ARDA 1AFVL 4G7YH 2BOCB 4KPHH 5DHVA 1S9YB 2XOTA 1BZ7A 4OB5H 2KQMA 1CVSC 1JL8A 4G9FB 4W4OA 4LPVA 3UZQA 3QIUD 3UTTE 4HZLA 2AV7B 4YUEH 4G7VL 4HHAA 3IFLL 2NR6D 2R9HC 3QG7H 5FGBA 1JRHH 2OBGA 3MBXL 3NA9L 1I8IB 3PWUB 3AVEA 1T1XA 3QCTL 2P49B 1FZOA 4HT1L 3W5NA 4OGAC 4HMDA 1OARH 1NUFA 2WM0A 3I50L 4NJAH 4PJAF