5HHOD

Crystal structure of the jm22 tcr in complex with hla-a*0201 in complex with m1-g4e
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
195
structure length
195
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hhoD02
4H25A 1J0IA 4J4PA 3PV6B 1E4WH 3EKCA 4BELD 2D9QB 3HI6H 4LSVL 3VXMD 5E9DD 1MCWM 5GS0D 3QIUA 3LIZH 2FB4H 3G5VA 3PWNA 3QDJB 5I15H 1DE4A 4O2FB 3MPCA 2P24A 1NGQH 3SE9H 2XPGB 1GHFH 4E5XB 3AU1B 1A6VL 4XRCB 4ZXBB 4Q58C 1MVUA 4R4BA 1TVBA 4QRTB 4YFDB 3SKMA 2QSVA 4Q0XL 5ADPL 5DEGB 5IQ9B 3S88L 4JN1L 2KH2B 1DQDH 1MFCH 1OAUL 4HH9A 5TQ2L 2ADJB 5TDPA 1KTDB 2FO4A 1EEZA 1V3KA 1WCBA 1RHHA 2I07B 4BUGA 3FOMB 3I6KA 1HNFA 4NPYB 1IAKB 1UM6H 2DM7A 5KVGL 1JPGA 3TZVC 4DFIA 2Z91B 5ID1A 1PX4A 4FTVD 4ELMB 4PJGF 1IQDB 3FN3A 3NGBB 1IEAB 1HYSD 5L8LB 2X4OB 3VWKB 2CDFB 2BVUA 3RWFB 4XPFH 1OAZH 5DC0A 1HKLH 2C3VA 3QEGH 4JG0L 3INUL 4G9FD 1BEYH 5D1ZC 4DKFL 1ZT4B 1QSVA 5ILTL 3THMH 3U36B 3V8OA 1G7IB 3NCMA 4XTRC 3K74B 4NKDB 5HVHC 4XNMB 4ETQB 4I3RH 3IT8D 3RU8L 3RIAF 4KJPC 3C9NA 5E24E 1KLFA 2IC2A 3KPRA 5EC2B 4TUJB 5C70A 4PJ9C 5IMOA 3HRZB 1T6WA 4ZUSA 4WCYL 1LO0L 43C9A 4H8WC 2F58H 1RJLB 4ZQKB 3UZEA 1CXHA 1ND0A 1WICA 5SWSB 4IOIB 2HRPH 1MWAH 2YPVL 2XXMB 5A2JH 3WNLA 4KY1L 3D2UB 2ICCA 4ZFZA 1Z9SA 3CU1A 1Q9WA 4UV7L 5ENWA 3G6DL 5IB5B 3UTQA 3B5GA 4FQQA 5MENE 2EZ0D 4NZTL 5HI3D 2XWJA 1RD6A 5C07D 5L88L 1YNLH 4IBLT 2X4TA 1AIFB 4XCFH 2P8MB 1B4JL 5GS2H 4GAGH 4ONFH 4OZ4B 4I4WA 2A73B 4Q7DA 1UACL 4I13B 4NFBA 5F9WB 3MRMB 3UPRA 1SHMA 4PS4L 5MHSE 4QRSB 1HI6B 3O4OC 4ZPTA 4XWGL 3MLUL 3FQRB 3IDGB 5D70L 2QADD 4MQXC 5C6PB 4YHMH 3QQ3B 5DEFB 3I9GL 5T3ZH 5C0EB 5E7FA 4OTXL 4MDJA 3D0LB 1OP9A 1U3JA 1W2KT 4JFFE 4CDHA 1N6QL 2AQ2A 3HE7C 4G3YH 1UZ6F 3MFFA 2VOTA 4MJ6B 3CVHL 4PRAA 5IFJB 1NC2D 3MRRA 5I1JL 4PJ5E 4RIRB 3JVGC 4AIZA 5E4EB 5C9JB 1D5ZA 3BRGC 2BHZA 4M5YH 4OLYL 2H8PA 4YBLC 3PWPB 3ZTJH 5KSBF 1FNFA 1VEOA 3OJMB 4C56A 1YYML 4ERSL 3T3PE 3AC0A 4QCIA 1Y6KR 5AYUL 2LVEA 3O3AB 2FEDC 1WLHA 2FECL 35C8H 4L4TA 4DN3H 4M8QA 5KOVC 3BN9C 2VR9A 4EQ2A 1ONQB 3KPLA 4F7TB 3BD3A 5J0BA 4FQCH 5DJCA 1DBKH 2Y6SC 3S37L 1FVCA 4NCDA 2HFFA 2CKBA 2VDOH 1IM9B 2RHEA 2VLJD 2X4PA 1AGEB 3VCLB 3RWIB 3QEQE 2X40A 1I3GL 1FZJB 3QPXH 4K2UL 4F2MA 4DVBA 4FQJH 4M48L 5JXAL 3CFEB 2XZCL 4R7DA 3SDCA 4P46D 4L4VE 4BFGA 1EAJA 4NKOB 1P2CA 1VGEL 3LDBB 4HLZG 2NQCA 4PJEA 4H25B 2CMRL 4JN2A 5M7QA 1W8OA 2GJ6E 1K5NB 1HOCB 3MRJB 2A38A 4W4NA 4OGXL 3PWNB 1DE4B 2VSCA 5EOTA 5L2JA 3MLVH 1A7OL 3N1QC 3WN5C 1R3JB 2KZ1B 2FX8H 2X2YA 1G0YR 4OCWL 2W65B 2WM0A 3AS0A 3WJLC 1MVUB 1MFDL 1MEXH 3FN0L 4KZEH 4G6MH 1KOAA 3SKMB 4JRXE 4P3CH 3EHBC 4YXKH 3GMRA 3QXUA 5F1OB 2VZ1A 4XCNA 2E5EA 5HI4D 1TJHH 5TDPB 3S3JA 1NCCH 4WFHE 2FO4B 5I9QB 1WCBB 3FFCA 1RHHB 2V7HA 1A3LH 2WUCH 2FBJL 3L3KA 5T3XL 4M5ZH 1YNKL 2CGRH 3A6OA 5ID1B 1FBIL 2VERN 1HQ4B 4LVNB 1EHLL 3MNVA 5D8JL 5ITBH 3H7BA 3EJYD 2WLYA 5IBTH 5KW9H 1CGVA 4LK4A 5ACMA 4A2MA 2EDKA 2YA2A 4PREB 1XF5A 5JXEC 3OKYA 4GXVH 2C3VB 2VLME 2XKSA 1ZHKB 4J8RA 4LLYB 3E0GA 4XB8A 1I8IB 3TCXA 4PRPA 5FM8A 4EN3A 3Q1SL 1RUKH 4R7NA 1A6TA 4E41D 3BXNA 1UVQA 1QEWA 1A6AA 5IMOB 1ZV5A 1L7TL 4NHUA 4ZUSB 1GGCL 3DSNA 4DQOH 4GUPA 5ABDE 2D7TL 1ND0B 2E8YA 3K0WA 5GXBB 4JJHA 4KQ4H 1FAKT 2A9NL 4JQVC 5GZND 1MNUL 1OGTB 4YHNB 1M6OA 1GZQB 1Q9WB 5C1MB 4P3DA 5A3IC 5D7JC 2A6IA 4MXVF 2CUMA 3RWHB 5E2WH 3B8YA 3RA7H 4R97C 2H45A 3QFJB 2C3WA 2X4TB 3KJ4C 4R8WH 1HIML 2GW5A 3QDMB 4PJ8A 3IU3A 2XY1A 3BH8A 3RVVC 1DUYA 2M1KA 3T2OA 4PGJA 5C0BA 1T7YA 1OVZA 4OIIH 3GBNL 3BO8A 1U8MB 3TBSB 2Z4QB 3MRBB 3UPRB 5SV3A 3EYQD 5LWYL 1I7RB 1JMZA 4PRHD 3EOAB 5CLTA 4ZPTB 1AI1H 1X5HA 2Y36L 3W9EA 3GGWB 1H3PH 1U2CA 1NLBH 1KXTB 1PD6A 3RJDA 1C7SA 1T04A 3C8DA 3VXSA 3K1DA 4MDJB 3ULUD 2Y5TA 5EA0L 4NQDE 3NCCB 1KJ2L 4FXKB 4PRAB 2W07A 3MRRB 1IEBA 4DUVA 2FJHA 3HS0A 2B4CH 3BKYL 4JO2L 5FYKU 2ERJC 2QLVB 3V6OC 4LSTL 4YAQA 3MRFB 3I6GA 3ARDA 1D5ZB 4ODSH 5DSCA 4P2RD 4JE4B 2H8PB 2JIXD 2AEQL 1T3FA 3DRQA 1AXSA 2FR4A 1J8HD 5KSBA 2YS4A 4FQ2L 2YC1A 2PETA 4TYUA 4QCIB 3FMGH 1QVOA 4ZSOE 5LGJA 3HG1D 4PPTA 3SKUD 3JV6A 4M8QB 1KPRA 2X89D 3KPLB 1YQVL 2PW1A 4Z7UA 2X44D 3LKSB 1SJEA 1FVCB 3MRCA 3NACL 3AB0C 2CKBB 2XA8L 2EC9U 2X4PB 1I8MA 2NY5C 2KZWA 4Q2ZA 2QQNH 4WW2B 3BE1H 5T5FL 3O11B 4R7DB 4WENB 1EBAA 3QG6A 3QDGB 3A6BH 4JZOA 1NAKL 4MCZB 3P0VL 4GXUM 5GRJH 1IM3B 3H42L 9CGTA 2O5YH 1QG3A 4PJEB 2IANE 1U8HB 1TZGH 1BLNB 2YPLE 3FB7A 1M71A 5F1IA 1MHCB 3EYVA 1C12A 3CMOL 1CGSH 3F65A 3RHWF 3G6JB 1F6AB 3DYPA 4JHWL 1XIWD 2NY0B 5L2JB 3UTTD 1Q1JH 3EO9L 4GRWH 1MCRA 1KCUH 3KLSA 1EO8H 1YA5A 1MAKA 1PQZA 5E8NA 4ZS7L 4MMXC 2XG5A 3MO1A 4Y2DB 4K3DH 1VFBA 4YHKL 3GMRB 1F3DJ 1U3YA 2YR3A 4OCXH 5CKGA 3BYYA 4UIKL 4J3TA 4YFLF 5HYIA 3BSZL 3LSOA 4U7SA 4WEBL 2FECI 1YN6A 3FFCB 2XFXA 5TDNA 3L3KB 4W4OC 1LP9E 5DURD 3GHBL 3U82B 4UNVA 3C08L 5FDWA 3T0ED 4I77L 4JR9L 4NQSB 4LQ1A 5IVXA 1D5BA 5H37G 2W0KA 3BD4A 4UAOC 4NZUL 1YMMB 1WWBX 2X4NB 3CDGA 4DUWA 2DI8A 3BPOC 3QUZC 3NVQA 1QBBA 3DV4A 1G9NH 3S96A 4J8RB 2KDGA 2YK1H 1PKQA 5IB3B 2OQJB 4G6FB 1KIRA 2ZUYA 4Z7VB 1XF3A 4R7NB 1A6TB 4N9OB 3H9HA 5SWZD 1P7QD 1QEWB 1UT9A 1C1EH 1AFVH 5L2KB 4OKVA 4DAGL 1S3KH 4D2NA 3BQUB 4XNZC 3VI3F 4YK4C 1FFPA 4LLDA 1KEGL 3MOQA 1LO3L 4M6OL 2Q7NA 3KLHD 3TEUA 4WFFD 1HSAA 1CF8H 3UYPA 5GS1A 5JMOC 1YEEH 3ZE2E 2OXGA 4Y16A 3CZFB 2HA1A 1IBGL 2NY7L 4KXZH 4Y4KC 1SEQL 1NC4A 4TUOB 4KKBD 4M02A 1JNLL 4MD0A 3BH8B 3IKKA 1DUYB 1NPUA 4PJIB 4YDJB 1HCVA 5C71A 1QSFA 1YEKL 2DJSA 5D7IF 4APQC 4P99A 3TBWB 4NO5A 5K9KA 1QFWH 3VXNA 4MWFB 4P2OA 3W9EB 5CP7A 1QPPA 1F2QA 2JLLA 3VRLE 4BFEA 5EFIA 4XI5D 4POUB 2H32A 4GJTB 2BFVL 5FYJU 3VXSB 1TTGA 1DQLH 1X5GA 1JPSL 5I8KL 1BJ1H 2YRPA 4YFLI 4ZAKD 3CVIH 3EO1B 3GO1H 5C0AD 4LLMA 2F74A 5C0CD 3SY0B 3ZE0F 4OZGE 2FJHB 3VXUD 2ICWI 3ARED 5HI5D 4Q9CA 4YHZL 4YAQB 2IG2H 4F58H 5FHBL 5E08L 1I85A 4PD4K 1GXEA 5DMIL 5DSCB 1CDIA 1FAIH 5E8OB 1T3FB 5FO9A 5FV1L 1AKJA 2EECA 5DUBA 5CHNA 4JO1H 2YC1B 3SKNB 3BP4A 3A6CH 5E8PB 1BAFH 1MPAL 4OZHA 2ARJA 5C09A 1KPRB 4LSRL 5K9OA 1R3LB 1BOGB 1QYGL 4Z7UB 4NJ9L 1XEDA 2DQEL 2IMMA 1S7XB 3W0WA 5I6XB 2AAVA 1HINL 5EU6A 1KBGL 3RVUD 1UKSA 3VH8A 3ULVL 3DNKA 4BZ2L 1IGTA 5DJXA 2CR3A 5KSUA 4MJID 4JFYA 4IRSA 2Z92A 3TZVD 4N0FA 3OPZH 5LGHH 3V2AR 2HT3D 3LY6A 5E94B 3PL6A 1RMFH 4KZDL 3UO1H 1CD1B 2F9BT 3EYVB 1C12B 4F7PB 4P2QB 4P49A 3H6JA 1FNLA 5GRVK 4IMLA 1V7NL 2XN9A 1MCSA 4NOBA 4JY6B 3R06A 3IFPB 5E2JA 5T1DH 1AD0A 4XTRD 2ICEB 3D39A 2GY5A 1EJOH 4K7PH 4JPWH 2ESVA 3IDYB 1VFBB 4MXQC 5F6IB 5DHVB 4KMLB 4DEPB 4PJ9D 3LV3A 1JFQL 4MZ3A 5A2KH 5TFSH 3IRZA 1XMWA 5J57B 4HAFA 3UJTH 4U1KB 5TDNB 1HSBA 5INDB 2ICWA 3ZMRA 3O45A 1MJ8H 1W8NA 2ZKHH 4LLWA 4RFNB 2J7LA 1BFOA 4WV1A 1KC5L 1L9MA 1MQKL 2XZZA 1D5BB 1J1PH 2BK8A 3QUMH 5J9PB 3I84A 1F4HA 4NHCH 5IW1A 3MMEA 4KUZH 2PO6A 3GSOA 4Y19A 1OF2A 3T77A 1A1OB 2R29H 4PJ7B 4JVWA 5DUML 3G5YB 5JW5B 1A47A 5ITFB 1J5OL 4GG6E 4NUGH 2XA3A 3EOTH 3S96B 3KPOB 3O2WL 4BUHA 3O2DL 4IEFB 1KIRB 3ZKXC 1JN6A 5HSFA 3B8SA 4JFED 4GRWE 4R0LA 1RZKH 5CBAB 4P4KC 4XNQB 2D2OA 2Z31B 5ACZA 1CXLA 4ELMF 3RGVC 3H9HB 2VISA 2B5IC 1UH4A 5DD1L 3FQUA 3VGHA 4OKVB 5EOQH 5HHXL 2FL5A 2L0DA 4HUKB 5CZVH 5I1GH 3QJHA 4TSAH 1FFPB 4UDUB 3TJEH 4AEEA 4KHXL 4GLRI 4NO0A 5DO2D 2BDNH 4U1IA 4QF1A 1LDPL 2XIDA 2UZIH 3NCBB 5ICYA 5C6TL 5I76A 4XH2A 1VFMA 1ZXQA 4HV8A 4MCYB 1IAIM 5F9DC 5KS9B 2XZQL 3PQYA 1NC4B 4EIZC 1FYTE 1MI5E 4PRBA 2DQTH 3IKCA 1FFOA 3MGAA 3MRGB 5D5ME 3FQTB 4LLVA 1TTFA 1QSFB 3TBVB 5IWLA 7FABL 2IPUK 4K55A 1Z2KA 2ED9A 4LHUG 3OSKA 4NZRL 4LARL 4PR5B 1T03H 1TIUA 3EFFB 3JTSB 3P4MB 3VXNB 5EZIH 1JI2A 1X44A 2F53E 3RKPA 3BN9D 3C60A 4ODTH 5FYLH 4P59L 2Y6SD 2H32B 3VH8G 1MY7A 2MPAH 2N56A 5GGRY 4KROB 1SEBA 2I5YH 3HMXL 4P57A 4KU1A 3O3EA 3OQ3B 3ARGA 3M07A 3QCTL 3H3KA 4R3SB 4LLMB 4K3JL 4F57L 2DDQL 2GTZA 3JZ7A 5FA4A 3QIBD 1ZA6A 4V1DA 4UT7L 5AWNL 3O4LB 4Y5XC 4RAUB 3BMWA 4O9HH 1E4XL 1IKFH 4PTUB 1AY1L 5CCKL 5JMRA 3BKMH 5DD0H 1T1WB 1LGVA 2FSEA 2UWEE 1U42A 1AKJB 5MERA 2RFXA 3K4ZA 4HLZH 1XGYL 3BP4B 4ORZC 2O93L 1TNMA 2WIIB 1VA9A 4OZHB 5C09B 2UVEA 4PRIB 2Y7QA 3EHBD 1A3RL 4H1LA 3TT1H 2VLRA 3ZKMC 5GJSL 2ADIA 2PYED 3QIWD 2UZYB 1BGXH 2XRAH 2ENYA 1IGTB 5DJXB 4ZUUA 1JTTA 1P53A 2R9HC 4Q74A 3BZFB 3EFDH 4NQXB 4QHKJ 1DQMH 2Z92B 4NGHL 4N0FB 5C0DB 4PJDE 4PLJC 5J12B 3PL6B 3UJIL 4NUJB 4NFCA 3P9MB 5LBSH 4G7YH 1N2RA 5GJTL 3EYOA 3SDYH 1R24A 5FYKH 1CQKA 3U0TB 3OR7B 3WHXA 3ALXA 1R3KA 4KI1A 3BZEA 5JXED 4ONGL 3ES6B 5F44A 2X1OA 5SWQB 1YY8A 3MV8E 5DJYA 4RMRA 4BSVA 1AD0B 4Q6IB 2ATPB 3PABA 3UTSE 3D39B 2P44B 4MJ5B 4UT6H 2H1PH 3VU2A 3OKNA 4MA1B 5H2BA 4XBPA 1WSST 4NQCA 4IOFD 1F3DH 1CR9L 2NTFA 3TM6A 1UJTA 4GAJL 5BVPL 2WSKA 3V52L 5J1TC 3VGAB 3IVKB 4M4RA 5E5RB 3ZKQD 5MEQA 4YHOL 4XMPL 5CD5C 5MEPA 4K7PX 3O45B 4LLWB 4M43L 4WI5A 3CC5B 1BFOB 4OM0H 3WXWL 5DFVC 1AJ7L 1U92B 4WO4B 5L9DL 4Y7MA 1I7UB 2DQDH 3ROOA 1LO2H 1DVFC 2YRLA 2F8VA 1UWXH 3GSOB 3MCLL 2ID5A 4Y19B 1U8LB 3T77B 5A3ID 5D7JD 3HR6A 2IADA 1QSEA 5ANME 1V7ML 5I74B 1OPGH 4CW1A 1U8IB 2CKBL 2HKHL 2E3VA 4YR6B 1E4KC 1XH3A 2WAHA 4R0LB 1NSNH 4FQXB 2ADFH 3LEVH 4JHAL 5GSRA 3MGTB 3ZDXE 1BQLH 5ACZB 4PB0L 5JQ6H 1CICA 5LXGL 5AZEL 3I3DA 3D3VE 2MQCA 1XR9A 4D9RD 4QRPB 2FL5B 2OJZL 4HWBL 2NY6D 1EPFA 1F42A 3WUWA 5E99L 4BKLB 3MCKB 4ORGB 2VZ3A 1RUQL 3OAYH 4MDIA 1A7NH 1DQQA 4WI6A 3VFWB 1BVZA 4YDKH 5KG9B 4Y4HD 3EZJB 2NY2C 3O8XC 4ISVA 1Q94A 2V9QA 1HHKA 3C5ZA 5IEHA 4MVBC 4QF1B 3PHQB 4M1CC 4YDLC 4HV8B 5E5MB 3QUXB 3JWOL 1Y0LA 4D3CH 4MA7L 4OCRL 4PRBB 2R69H 3JWDL 3KXFE 2E9BA 3SDAB 2IBZX 4N1HB 3NZ8A 1SBSH 1HH6A 2E6PA 4LLVB 3H3BC 1CCZA 2E27H 4AENA 4Y2OA 1YPZA 3QO1A 1Q0XH 3AS2A 4QEGA 5E2VH 3O2VH 2GT9A 3QFDA 5AAMA 2R0KL 3PWPE 2CK0H 3BKJL 5DD3H 1ES0A 4LU5L 4WTWA 5DJ0A 5KSVB 3QNZA 3ZE1F 1JRHI 3FQXA 1F4YL 3I3EA 4TSCL 2W59A 1FQ9C 2B7DT 3V4VL 4G9DA 4OSUL 5DJ8A 5AUMB 1Q9OB 1F4XH 4HD9A 5H35A 3GSNA 1QKZL 2HFTA 2NY1B 5FA4B 4I5BB 1ZA6B 2QTEA 3EYSH 5DWUH 2DOCA 3FT4B 2ICWJ 5FYJL 5C7XL 4LBEB 4LCCB 4HK0B 1T83C 3IJSA 1G0XA 4OV5A 1OM3L 3P4NB 1G6VK 2FSEB 1DBML 1I8KA 5MERB 1CI5A 1GGUA 3OX8B 4EI6A 4R4FL 3G6AB 1N3NA 3N9GL 3TP4A 2BRRH 1TNNA 4OLWH 1QA9B 1NQBA 2IH3A 4OCLC 4I2XB 1QNZL 5TF1L 4WWKC 1KTLA 3OGCB 5IEKA 3C2AH 4WY7H 2V5TA 3KYNA 2IAMC 4YDIL 1CLZL 1RZIA 2Y7QB 3ORJA 1FL6A 4HZAA 5EWIL 4H1LB 5DMYA 1KTRL 4OZFB 2MCG1 4AEHL 1Y18A 3HPLA 4MHHI 2ADIB 3VXOB 2JTDA 2YKLH 1JGVH 5HVWA 1MF2H 3LQZA 3GJEA 4MQSB 4YHPA 4PBXA 4YE4H 3TT3H 3U0WL 2JB6B 4JFHE 4A6YB 1FFNA 1U8JB 3E3QC 1N2RB 4OFPA 3EYOB 4GAFB 1XF2A 1HXMA 1IC4L 5E00A 3HFMH 3BZEB 4BK5A 3G5ZA 1YY8B 3GMQB 4WW2F 1E4XI 4EDXA 4GFTB 5H37H 3H8NA 3HMWH 4PJBA 3C5SA 1OW0C 6CGTA 3U46A 4AJ0A 1VDGA 1CXIA 4NQCB 3FO0H 3SE3C 3WUWG 4BQ9A 4PP1C 3CFJA 1Q72H 4ELKA 2G5BA 1KT2A 3MXVL 3PWLB 4QHUA 3G6JF 1T66D 3MBEC 4GXUN 5MEPB 3KPRE 1H15A 1V3MA 1MRDH 5ESQB 5FCUH 1QSZA 1UWEH 1K4CB 4RQQA 2VXVL 4JFZH 3ROOB 2WINA 1OCWL 4UQ2B 4X9BA 1GGBH 3PWUB 4P5TA 1HKFA 2Q8BL 2VXQH 1UADC 1HEZB 2IADB 1X6LA 3BT2L 1QSEB 5JHDD 1GGIH 5FYKE 5I8CA 2W60B 4CW1B 5JHLL 2IFGA 3DUSA 3V5HA 3BFOA 4PY8I 3TPUA 1XH3B 1XCQA 1K2DB 1BD2D 3QO0A 3D5OF 4NC0B 1ETZA 2PUQT 5GSRB 3NFSL 3LKNA 4JRYE 1CICB 1UXWA 1IL1B 5I71B 4MAYA 1U8KA 3LN9A 4APQD 5KANI 5D93B 4HMCA 1J0KA 2CJUL 5TPWH 2X5PA 1A6VH 1A0QL 3EDEA 2AVGA 4X4YA 3N06B 1DEEA 1R5VA 2YD6A 4MDIB 1DQQB 4U1LA 4R4NC 5J4MA 1AD9A 1RZ7L 1SYVA 4QHLA 2OX5A 4HCRH 5ADPH 3RTQA 1P1ZB 1J11A 1N4XH 1S9YB 2F54D 2VITA 4ISVB 4Z7VF 2I27N 1B0RB 4G5ZH 1I9IL 3TESA 5EBWB 3CH1A 1OAYH 1FGVH 4MS8D 4OM1L 3UZVB 2V17H 5EULV 3GJFH 2EKSA 3QZWB 2FX7H 3TN0B 1RULL 1HH6B 4PGEA 3TIDB 2OP4L 1NFIA 2ZSWB 3BJLA 1G9NC 3NCJL 1YPZB 4FQHA 3QO1B 4ZTPH 3PHOA 4OJFL 3WEXA 4YGVB 3L9RB 4I0PA 4KK8C 2GK0A 5DTFB 3WIIL 3MGOB 2DQCL 5JA8B 3MV01 1S7TA 1J9CT 3HZMB 1ES0B 4DKFH 5DJ0B 4C56E 4PGCA 1PY4A 3D87B 3QNZB 4XNYL 3P30L 1CU4L 3RFZC 3T3MF 4GSDH 4JFDB 5EZJA 4K71B 1T5WB 1UC6A 4BJLA 5CJOL 5I75C 1AXIB 4HK3N 4L4TE 5MEOA 3WNPA 2NX5B 2Q1EA 2IQAA 4G9DB 1G7PB 4KUCF 3QUYA 5DJ8B 5H35B 3GSNB 3QNXA 5HPOA 5J89A 3PG2A 4MLIA 4HH8A 3FRUA 5BZDA 4L4VD 2DLFL 2YPVH 1R5IB 2AXGB 4QOKA 2W92A 2XG4A 1FH5H 4HUWA 1KTKE 4NC2B 1AGDA 5BS0B 4NKMA 5DRWB 4LCWB 1JYNA 1EEYA 1N3NB 4LCUB 5LJYH 5JW4Q 4Y5VC 3VFTA 3BIBX 4JY5H 3RGHA 4V2BA 3G9AB 4HWZB 1DBAL 3DUHA 5IEKB 4ODXA 4YO0A 5I1CH 4PV9A 5D7SL 4YGAB 4IIQB 1UB6A 2BNRA 4EBQH 4JEGB 1QR1A 1UACH 3O6LH 4WI3A 3NTCL 2Y06L 3QEUA 5HGDA 2KQMA 1Y18B 2CRYA 5IB4B 2ICES 2V2XA 3HNVL 4JKPH 1H3GA 3MA7A 4ZXBC 4U1HB 2IALA 3LQZB 4L8BA 4XZUA 1CVRA 3N85L 1U36A 2EDFA 3J7HA 4KKCC 4IMKC 4NN5B 2NNAA 5F21B 4AH2A 4H88H 3I50L 5FOBB 2VDKH 1FFNB 3L3OA 4ODVL 5F6HI 1OSZA 3ARFB 4G8GD 1NBZA 3NH7H 2VZOA 1IT9H 1HXMB 1RIVH 4GW5B 5E00B 1FORL 3EDKA 5MP6H 1N6VA 2VIRA 3U9PL 3PGFH 2FCBA 1RZ8B 5C0GA 1BHGA 3TYFB 1BBDL 4PJGE 5C08A 5D2LF 1R3IH 3QR2A 4PJXA 3EO0A 3C5SB 4ETYA 3BAEL 3DMMA 4CDGC 3V5DA 1LEKA 4Y8AA 5JIIA 4JM2F 5TGBB 4RGOL 4ELKB 4ZYKA 3TV3L 4QHUB 4PRPE 3D48R 4X4XA 2HN7B 3MLTA 4BFIA 5BV7H 3I02A 1RJZA 1P4LA 2FD6H 3WKML 1XAUA 1MUJA 3P2TA 1HDMB 4HGKC 1F8TL 2WBJD 3IAQA 2IQ9L 4HF5L 3LS4H 5J6HA 4E0RA 3BISA 3HUJB 4ZFGL 3OAUH 2A0LC 1IE5A 1NCAH 2B1HL 1U95A 5DQ9A 1AXTL 5D1QA 4Z7QF 1MHPL 3TPUB 1YDPA 3WIHA 2D9CA 2P46B 5LAXA 5IF0A 4QRRA 4GRLA 1NFDF 3L3HA 4FNLH 1SMOA 2VDLL 3QDHA 1U91A 4LCIH 1D6EA 3KPQA 4Z7WB 4NWUL 2R39A 4OQTA 5EU3B 3TLRA 5C0BE 4EIGB 3ULVC 2OR8A 4YHLL 3PE9A 5D7KD 1JNJA 1U58B 3NA9H 5ESAA 1OP5K 2LAGB 3P73B 5EO1A 2VITB 5F72S 3AROA 2EH8L 3F5WB 5EU7E 4JPIB 4N68A 4EVNB 5F7MC 1V3JA 2AJSL 4LL9A 3S36H 5BMFL 2GJZA 5EZOH 4HKJB 4HIJB 5GSVA 1SVZA 2GCYA 1YNKH 2LAAA 3BZ4A 3HZVB 1BF2A 4H5SA 1UZ6E 1N7MH 2ZCKL 5D8JH 1UWGH 1CG9B 1WQVT 1L0QA 4QYOB 5IESH 1X5FA 5A2LH 4XP5L 5FM4A 2VE6B 3QT2A 3MA9L 4IS6A 5CZXD 5E4EC 1EO7A 1QBLH 1RZKC 3BPLB 1S7TB 2Q7YA 1FIGL 4PJAB 4MLSA 3S3SA 1MLCB 4KJYA 3TCLB 3OXSB 5KSBE 3KPNA 1EFXA 5JA9A 2P5WA 4A2LA 3OJDB 2CO6B 4TUKH 5EZJB 1E6OL 2H41A 5EZLA 5MEOB 1P6FA 2IQAB 2HT4C 1L7TH 3SQOH 3X3GH 3VWJB 4AEFA 1FJ1B 4Z7UE 5JW4M 5F1NB 4HWEH 1VFAB 3QNXB 2EO1A 4PGZA 2YMXL 2D7TH 5BZDB 5IVOA 3VFRB 4PLJD 1MCHA 4PTTA 4KTYA 2VL4A 2WIMA 2HVJA 1D5MA 1WFNA 3M8OH 2OYPA 4Q9RL 1X5ZA 4TULL 1ZVSA 4FA8A 1JTOA 4NKMB 1A7PH 1GGYA 4O2EA 3IGAA 3LDBC 1X4ZA 4R2GC 2OR9L 4J4PC 1INDL 2EE6A 3GSRB 1ORQA 3MRDB 3EDFA 4G42A 1KENH 3IETA 3QEUB 2MHAA 2WBKA 3C5JA 4LGSB 5EBGA 2WP3T 4N0UE 2J8OA 2V2XB 1IAII 2ZZUT 3WHE1 1P9MA 5CD5D 1XGQB 2AI0H 2IALB 4DCQB 3RY6A 4XZUB 5JIPA 1TETL 4D0DA 1QACA 5DFVD 2NNAB 4K8RH 3QQ9C 1KCKA 1DVFD 5E6YA 3V6BR 1OSZB 5I9QC 4WUUA 5DJAA 2IPTH 3DIFB 2O61A 1BZ9A 1PYWA 2WWMC 4X7TA 5IVXE 3STZB 1JYVA 4PRDA 3MRKB 1FV1B 3RY4A 3ZYOA 1OY3B 1CFNA 3O6FB 5EBLB 4LVNC 3RBGA 5C08B 3SCMB 1VB9A 3ME0A 4PJXB 2W38A 3EO0B 3VXPA 4HULB 5D1XA 4MQ7A 1FVEB 3V5DB 1PKQE 4F37K 5JO5A 3GB7A 1EO5A 2VABB 5JQHC 4JM2A 3O0RH 4LKXB 4BFIB 1RJZB 4KI5F 4LRIA 3R1GH 2VC2H 4CMMA 1ZHNB 2SEBB 1JHLL 4HJJL 1DJSA 5DVOA 1MSPA 5E1AA 5FUZH 3SE8L 3UJJH 4X5LA 5J6HB 4E0RB 1BBJA 3O8XD 2NY2D 4MVBD 5DFWH 1Z3GL 3F7VA 4M1CD 1U95B 2DD8H 5D6CA 2UYLA 2PCPB 5DC9B 2VMFA 1RIHL 1QFHA 5LAXB 4QRRB 2P5EA 3VDAA 4GRLB 2EEAA 2B39A 3CUPB 3L3HB 4MXVE 5D7LA 5AZ2L 1NFDA 3E6FA 4LPUA 5ICZB 5DRXB 3OHXB 5E6IB 3W9DA 4HPOL 4A6YL 5DMJB 5F70A 2AK4B 3QHFL 5BXFA 4BSWA 4UTAL 3MODH 3WE6A 2AEWA 5T3XD 5D6DA 4LSPL 1MCPH 2JELH 2XQBH 4GLRH 5EO1B 4KGLA 3B5TA 3DX9B 2OR7A 5CIPA 3MLYL 1I3UA 4OD1H 1CIUA 2ZG3A 5D1ZB 4GAYA 3ZHDA 5GSVB 2E7CA 5CEYB 4WEMB 4LQFL 5GRWA 2V2WA 4OT1H 3BZ4B 1L6ZA 3MLRL 4H5SB 1JGUH 1E6JH 2C4XA 3DRTA 2PXYA 1ZGLA 1RAMA 3HE6A 4LCYB 5DFTA 1C08B 1Y6MR 3S36X 1QFPA 2E7HA 1EGJL 4PJHF 5KJRL 2CQVA 4G8FA 4O51B 2Q7YB 1JF1B 5IJVB 3KPNB 2IAMD 2P5WB 4U1JB 1EERB 3VFMB 4UV4L 1T1XA 1I1YA 3AVEA 4OZHE 5EZLB 2ZJSL 4K94H 5C09E 2AS5M 3T4YA 4XNUL 4Z7NE 4FQLH 2AGJH 2E7LA 1RU9H 1ZEAL 3PP3H 4WFEE 1AE6H 4C4KO 4M93C 4U6TA 1I9RH 1D5XA 3W0WE 4ZFFB 5EU6E 2BOCA 4PTTB 2BXZA 5IQ7H 3FB5B 2DM2A 4LASH 4X6DB 1D5MB 3IB4A 2F19L 4N0RA 4RGNE 2XTJE 2YRZA 1K8IB 1ZVSB 3GHEH 3TFKC 1NMBL 3SDCC 3WHE0 2IGFH 2A74A 1CBVH 4O2EB 3MYZA 1FVDA 2XNAB 1LEGB 4IRZL 4UMGA 1A7RL 3SOBL 1UJ3A 5I8EB 1I1FA 4NWTH 4CVZA 2XN9E 1B2WL 4PP1D 3NABH 2NY0C 4JDZA 3HE7B 3IETB 4RISH 2MHAB 2FEEI 3BUYA 3D39E 3FT2B 2ESVE 1JVKA 2ZUVA 4N8CH 3MBED 4FP8H 3RUGB 4BZYA 3LD8B 2I60H 4Q9BA 4IJ3B 1QFOA 1W0YT 2ZOKB 3FFDA 3JWOC 3BW9A 1KUMA 3MNZB 4YBLB 2CD0A 3QEHB 4ZFOB 4NQEB 4X7CC 4XPHL 1E27A 4HQQL 3JWDC 3MLSL 3ULSA 1FCCA 1WC7A 5DJAB 5DK2A 5J6GA 5ADOL 5DEZA 5DGRA 1BZ9B 1PYWB 1DN0A 1HK6A 2QKIA 1XF4B 1N8ZA 1CFNB 1OAQL 1YZZA 3V79C 3VXPB 4F9LA 3BVNB 3GSNL 4MQ7B 1WZMA 5HYSA 2A77L 5B4MC 5I1DB 4XP4L 1HHGA 5JO5B 1NBYA 4ZD3L 2J4WH 2WLZA 1WFOA 3TYGL 4YEFA 1KCRL 4G8EB 1GL4B 1I7ZA 1ZT7A 1B3JA 4CMMB 1PVHA 5K33A 3W39A 4OD2A 3BIAX 3MRQA 4EN3C 4KFZC 1S9XB 1QRNB 4R4ND 5JZ7C 2CIKA 4CN4A 3MV7A 3HC0A 1CLOL 3IFLL 5SX4I 4GQ9L 3VI3E 1KCVL 1KBGH 4PG2A 4XBEL 5I8OH 3OWEA 4Q6YA 3RWJB 1MCOL 2FJGB 1U8OB 3X13B 5IW3A 1FYTD 2HTKC 4MNQA 3PQYE 4PJCF 1IFHL 1AP2A 4HXAL 1KYOJ 5EU4B 2DQGL 1ZE3C 3QH3A 4GQPH 1F3RB 3HZKB 4G8IA 3WCYA 4S2SB 4HC1H 3SJVB 5ICXB 5AAWA 1TVHA 3BPCA 1EXUA 3V5KA 3D85D 4RMQA 1IC7L 1TPXC 1C16A 4YWGL 2ADGB 2JJSA 5K9JH 5DZOA 5I30L 2QHRH 4HLJA 5CIPB 1C5CL 1A2YA 1PG7W 1OL0A 2NZIA 1LO4H 5EU7C 3H9SD 4GAYB 4N9GB 2EDRA 4BH8B 1KB5B 5TE4L 3GIZL 4Z0XA 1KLUB 1KC5H 2V2WB 1E4JA 1NGPL 4OIBA 5T1KB 4X80L 2GJJA 3B2VH 4OLVL 4V1DE 3ZE0E 1ZGLB 3DURA 4U1SA 4LSSL 3GUTB 2IFFH 1S7UA 1WBXB 4F3FA 3VXMA 3BDXA 1J5OH 3ARDC 4G8FB 1JNNH 1IAOA 2R23A 3QDAA 3U4BH 3MOBH 1OQXA 2Q6WA 2AV7B 3QDJD 3REWB 1I1YB 1JRHH 4IRJA 4YLQT 4V2CB 3LN4A 3U4EB 4HS8L 4D9LH 3T4YB 5GISL 3QXAB 1Q0YH 5HHME 5IVZA 3PGDA 3VRIB 4ZXBD 5HDQL 1LEIA 5MENA 1DFBH 3KAAA 1KIQB 5I66A 2VLRE 3MLWL 1INQB 5F9OL 1JZ4A 1KFAH 1ROWA 1NKRA 2BOCB 4KHXH 1N5AA 5I6XC 2EDNA 1ITBB 1UYWL 1XGUA 5IHLB 2HFGL 4FTVA 4MD4B 4N0CC 5C2BL 3MCG1 1I7TB 2A74B 4Y1AE 1TJIL 1TCRA 2XOTA 4PP2B 3CLFH 5HYSG 2J6EA 4G9FA 1NFKA 1T7ZA 4DK6A 4NNYB 3DUUB 5HY9B 4CVZB 3VWKD 1TFHA 3C6LA 2A1WL 5GGUB 3WFHA 5ETUB 4JGUA 5INCA 1NGZB 4X7SH 2VL5B 2QQLH 4N1CA 1DSFH 2LU3A 1T20B 3DGGA 3SDXB 3SPVA 1DQJA 4NQCE 2ERJB 3UC0H 1A6WL 1YEHH 2K7PA 1ADQA 3FFDB 4JDTL 4TTDC 3WLBA 3JV0A 2UUDK 5ALCL 1E27B 4JAMB 5F7HA 3ULSB 2A0LD 1TQBC 5J6GB 5JOPD 1DN0B 2QKIB 5SWSD 4K7FB 4F8QA 3D2UD 4UT7H 5AWNH 2YUXA 5L0QB 5HYJB 4GMTH 3MJ8B 2F5BL 1QSEE 2R1WA 5IR1B 3AM8A 2NCMA 1NDGA 3AB0B 3IXAA 4KJQC 2XKUA 3BZDA 4F7CA 1QD0A 1YC8A 1NBYB 4KRPC 1NAMA 4GBXB 2DQHL 4H0GA 3V0AC 3KPSB 3FB8B 4RWYH 3ULVD 1ZT7B 4UTBH 1N64L 3W39B 3QHZL 1F4WH 3WNMA 4PV8A 3VDCA 2BNQE 1GC1L 3MR9B 2CIKB 2FHCA 2DWEA 5EPMB 2YD8A 3HC0B 3WBDA 3WKNA 3ZHKA 1Z0MA 2GJ6A 3ULUF 4GKZB 2X6MA 5GJSH 1J0YA 1EH9A 4MD5A 3NAAL 1IGYA 1S5IL 1NC2A 5KVEL 4XPTH 1HNGA 1RIUL 4KDTA 3QRGL 3SGDI 2HKFL 1I1CA 4KRLB 3HB3D 1QRKA 4OCMC 1YNTA 2VO5A 2CDGA 4HGWA 3GK8H 3HUJF 2VXSL 2AKRA 4EUPA 3GSXB 4DGVH 4XVTL 3F58L 1U9KA 2JKXA 3VD7A 3U7AA 1X5LA 3MRNA 5F96L 4RFOL 2DBJA 3DJ9A 1EXUB 5CWSA 3QJFA 1YPZE 3V5KB 4MA3A 1ZSDA 3PWPD 1VACA 1A9EA 3HAEA 2NR6D 1JK8B 2N4IA 5BVPH 2HT4D 1YEIH 1JF5A 3JV5A 3QQNA 5CJXC 3OAZK 4P2OC 4Z7WF 3QUZB 2R56H 4YHOH 5F7EH 1AQDA 1PZ5B 5K59E 3LKRA 2XACC 2R2EA 2X09A 4O02H 4P46A 2BVOA 1DL7L 2NXZC 3UZQA 1IM9D 2XZAL 5L7XH 4FHBD 4LMQE 4P23A 2RB8A 4OCYL 3AS3A 5IKCB 4NT6B 2ZCHH 3ILQC 5IHZA 5JR1H 3FO1B 2Z9TA 3DI3B 4YK4B 2PTTA 3RPIA 5EOCJ 1I85C 5CSZB 5BRZA 5LQBL 2YUWA 3NPZB 1IAOB 1BM3L 2R23B 3LVEA 2W91A 4JZNA 5HHPA 4UB0L 1IILE 2Q6WB 2I9LA 4UOJA 4IRJB 5KTEL 3HPJA 1TZHA 1ZLWH 3CGTA 3WIHL 1U8PA 4O58H 5IVZB 3PGDB 1LEIB 4RFEB 3I2CH 4Y4KB 5MENB 1DLHB 1R5WA 3LMJH 3MOAL 5GRUL 2WK2A 5I66B 1MAML 3TF7C 3I75A 2C7UB 4HIXL 4HIIB 3FO9A 1I3RB 1MJUH 1WCQA 4N90D 2XKNA 3QQ9D 1CXFA 4OQTL 5ID0B 4MXWH 1OB1B 2ZG1A 5CEZL 5CUSL 3MYJB 2WWMD 3MUGA 4RGNC 5EBMA 2XTJC 4IRSC 1CZ8H 4XVJL 4Z0BH 5J12C 3MLZH 3PL6C 5FF6B 3RVXC 1B0GA 3U2SA 1G6RA 3DROB 1LNUB 3O6KH 2GFBA 4HIEA 3C6LB 5K9QI 3WFHB 2GEEA 3DO3A 5JW4N 4MMZC 5HDBF 1BJ8A 4PJBE 4JFFB 1ZLVH 1X5YA 1IGML 3DGGB 2DKSA 3AAZB 4MA1C 1MRFL 4DZ8B 4PJ5B 4M7LT 1QOKA 1T4KA 5F7FA 3VGAC 4X6FA 1TZIA 3Q6FA 4KJWC 5DR5L 3V0WL 4GT7A 5T5NF 1FE8L 1X9QA 1YEDA 4M6ML 2CH8A 2E9WA 3RI5K 2ZNXA 4WO4C 3T0BA 4JM4L 2EDHA 5CFHA 3CXHJ 5H94B 2R1WB 4EUPG 5F9JA 2PO6C 1J8KA 1Q9KB 5HTSA 4ODWB 5HJ3B 3GNMH 3IXAB 1YEJL 5JW3H 4HX1B 1IARB 3GFUA 4M7KH 3MJ9A 1II4E 1WZLA 5I74C 3RWGB 3SO3B 4S1DC 3QFJD 3S35L 3NIFF 1RFDL 5HHOE 4B53A 5FAAA 3QEQB 2BNUB 4F7EA 3QDMD 1WGOA 5DDHA 4OF6A 2HFEA 4R0LC 3HAEG 1QNZH 4PRHA 4L9LA 1JF6A 4M1GH 2RAMA 4YDIH 3TH2T 1K4DA 1KSRA 4X98B 3MNWB 5IMLA 5EWIH 2EC9T 2IANA 2ATKA 2GJ6B 1UM4H 2Z93A 1M7IA 4JO4L 1ACZA 2J88H 1K6QL 4JGMA 4NC1C 1WIPA 1YECH 4MD5B 1A9BA 1BFVL 3STLA 2XTLA 1BREA 4BH7B 2QR0A 2OXHA 5E2UL 4P5KB 3BEWB 3DTXA 3WXVL 5DRZB 4WVRA 4JRXB 3P4LA 4P2RA 1OAXH 1A4JA 2ZCLL 4KPHL 3NCEB 2B0SL 2DQUL 1SY6L 5L6YL 1J8HA 1FNEA 4ZFOL 4F9PA 3SDAC 5CWSB 1MFEH 3L3GB 3N50A 5IWLC 1UEYA 3OKMA 4TQEL 1YJDC 3RNKB 3OXRA 3ZE1E 3TH3T 1UM5H 1KJ3H 3C60C 2X4UA 3LKRB 3TH4T 1I75A 1FNSL 4XCCL 5I1KL 1M1SA 2BVOB 5GHWL 4P4KB 4JFXB 2H9GA 5EORL 1WBYA 4P23B 4KTDH 1EMTL 1JUFA 3ARGC 3RGVB 5KSAA 3TFKD 3WJJC 1KB9J 1EAPA 3WO3B 3QDGD 1F02I 4QOKE 3NFNA 2CDEA 3T65A 3RPIB 1XIWA 2IPKA 2PR4H 3UTTA 5BRZB 3VGDA 4XCEA 1YY9D 4L29B 4M1DL 4D9QE 2R0WL 4J3VA 1XZ0B 1D5IH 2NY0D 3BDBA 1F45A 3ARBA 2W9DL 4YH6A 4B50A 5J1AB 4AEIH 4CBPA 2BVQA 2VKWA 4CJ0A 2OZ4A 5KVDH 4KVNH 3CFBA 4UDTB 1R5WB 2BNRE 4Y2DD 3OBAA 3ZDZE 3W2DL 3FO9B 3FQNA 1H8SA 1LK3L 2YWYA 2AJYH 4CADA 4XHJC 3T0EA 1KNOA 2DBLH 1U8NB 3FFCD 4YX2H 1WZ1L 4QY8B 5BW7A 2VAAA 4K9EH 1LK2A 2AJZB 5EBMB 5DQJB 3QSKB 4LRNL 4HHAA 4Y4FA 2EE2A 1KPUA 1B0GB 2BMKB 3T2PA 1J0JA 3ETBF 4ZUVA 3ZSTA 1IRAY 4DZBB 3BWUC 4U6XB 1KPVA 5C3TA 1YMMD 3M17A 1YYLL 5B4MD 1EVUA 3CK0L 1KB5L 1PG7H 5C08E 5CILH 1MWAB 4UNUA 3UBXI 2APWA 4NQDB 5SWZA 4G6FD 5AD0A 1P7QA 3WIIH 4FFWD 4DVRH 1IAIH 3VMPA 4YUEH 4RGMC 1KGCD 1WFTA 4K94C 3VRJB 1QFUH 5JPMA 4IM8A 1CU4H 5JZ7D 2HJFB 3AXLA 2Z8WC 2FIKB 5FYJD 5L2KD 4X6FB 2GKIA 4GW4B 2J3SA 1J1XL 2J5LB 3Q6FB 3C8KA 3BQUD 1S7QA 5KVFH 4KMQA 3IDJB 5EN2B 5CZKA 3P77A 2DI7A 1MREH 3GBMH 1CDGA 2AABL 4ZSOB 5K9QG 3VFNA 2VDNH 3ZT6A 1RZGB 1A1MB 2VJXA 5JPNA 5DLML 1T0PB 3DVGB 4XX1G 4DJMA 4QRRE 2NLJB 4LEOA 2HH0H 1M05A 3BMVA 5DDHB 4XPGL 5HVFB 2HFEB 2DQIL 4JPKL 2ZUQC 4LNRA 4XCYB 2V9TA 5GQBA 1CICC 4G80B 1K4DB 2FGWL 5I71C 4HDIA 5D7SH 5IMLB 2IANB 4HW6A 2ATKB 3U9UA 3KHQA 4Y89A 2YPLB 4AIXA 2Z93B 2Y06H 3PGCB 2CLVA 3HNTL 4OGYH 3I3BA 3S34H 5CBEA 1AGBB 1KEMH 4KDWA 4ZAKA 5C0AA 3VFSB 1A9BB 3VXSD 4LF3B 3STLB 5TQ0L 4GKNA 3VXUA 2QR0B 3VW3L 3RZCA 3KPMA 3KPPA 2H2SC 4XC1H 3VFGH 1I1AA 2Y72A 3B3IA 3OF6D 5DZLA 2YEZB 5I17A 3TN0C 5FCSH 3TNMA 3OMZA 5DRNA 1B9ZA 4ODHL 2AP2A 1LP9B 4LFHD 1N5YH 4PLKC 3IDXL 1EZVY 3PDGA 1D9KB 4JLRA 1X5IA 3OKMB 1BF8A 3ABZA 2HVKA 5SV4A 2P5WE 2MTPA 4DTGH 4JO3H 3AUVA 4X99B 4CVWA 4PJFF 2V7NA 3T3ME 4IDJH 2X4UB 3QA3A 5K93A 4HFUH 2NY5L 2GUOA 2OL3A 1ZLUH 2GTWA 1OTUD 2AV1A 1JPTH 4J6RL 3IFNH 2AEPH 3KYKL 3FCTB 3DSFL 1JUFB 1BZQK 1AH1A 5KSAB 5GGVL 3MV9A 3CX5J 2RCSH 5BO1H 5JIHA 1RPQA 5DA0B 5I19L 4WDIB 5GPRA 1U6AL 5EOCH 4H0HB 5I16A 3AMKA 3PWJB 3UP1A 1NCTA 4FMKA 1G1CA 4P2QD 3MLXH 1A7QL 4OD3H 2R4SH 2AJ3B 5D71H 5TF0A 4G6KL 4OCSL 2FZ3B 3ARBB 4M7JH 4D0BB 4YDLB 1D6VH 3DO7A 3FKUS 4PJ9A 4FZ8H 3CFBB 3NIGF 3L3JA 4JHZA 1E28A 1ZVHA 2VXTH 2VWEC 2HLAA 43CAA 2BOBB 3C09C 3ZTNL 25C8L 5IW6B 1T22A 2FIRT 3EGSA 3QCVH 5T5NG 4CADB 2VQ1A 3DVNA 4N0YL 2DLGA 1KNOB 2VQTA 3UPCA 2EXWD 1EEQA 2Y07H 5CINH 1XR8A 2VAAB 1UA6H 5FUCC 3BH9A 4GRMA 2G60H 5CJ5A 1FNHA 3STBA 1F58L 1X4YA 4HHAB 4Y4FB 4I48A 3VI4E 2XWTB 4WUUE 1KPUB 3DV6A 3X12B 3FHQA 3NN8B 1CLYL 4DKEL 4ZUVB 2WWKO 3ARFC 3ZL4L 1KN4H 1KPVB 3M17B 4KJQD 4G6JL 4JG1H 4JFEA 3TWCL 1FL5A 5HBBA 3A67H 2FATL 4XNXL 3MA9H 4NM8H 3X14A 5AD0B 5DJ2A 1QBMH 3DX7A 1XFPA 4OZGB 4WEUD 4GMSH 4RX4A 2Z31D 4TOYH 3F6IA 2BVEA 3AY4A 4YIQA 4K23L 2P4AB 3MLPA 2QHLA 1E6OH 4NQVA 4KVCH 1CXEA 4M6NL 2UWEA 3L1OH 4TVPL 1KG0A 4UINH 1CN4A 5IMKA 5IBUG 1ZGLP 4X5XA 3P77B 2YMXH 4P4RA 1S9VA 4LOUC 4WWKB 5IFHH 3SDXF 3AGVA 4KQ3H 2B1AL 5D4QA 3VFNB 3TC9A 2XQYK 2MNUA 5HGHA 4LKCA 4P5TC 2EDJA 4HKBB 3UBXG 5F3BA 3MUJA 2VDQH 5JPNB 5C8JA 5EO9A 3OB0K 4L3CA 3OB8A 5ALBL 4J1UA 3VG0L 5E56A 2P5EE 1NC4D 2OTWB 1DQTA 5D7LE 1Z9MA 1M05B 1T2QL 1NFDE 3C6SB 4S1RH 3T8XA 5GS0H 2G2RA 1UENA 2O5XH 1JGLL 1J1OL 4LNRB 3IJYB 1QSFD 1X7QA 1MJ7L 4OZIA 3BGMA 4MAYC 1NEZB 3P40A 4QRUA 3U9UB 3LZFL 1R3HA 2YD4A 2ITDA 5FGBC 3OKOB 4C83A 3WL9A 5J11B 3QBTB 1VPOH 3ROLA 1RUML 4JJ5A 4YBQC 1VESA 5B39B 1JBJA 1OD9A 3QIBA 4GKNB 4KROD 1RURL 5GIRB 3RZCB 3PP4H 3UTSA 3KJ6L 4RNRA 4OBSA 3KPPB 2DJ4A 1FIEA 3V8CA 4OGAC 4POZD 2GI7A 4QTIH 1HN1A 2A2QT 4B0MM 5D9SB 1I1AB 1GAFL 4Q97A 5I1HH 2VN4A 3O4LD 4XAWH 4PUBL 3NZHL 5FHAH 1NCUA 2VB5A 1OARL 3FN9A 2H6PA 2HWZL 5HHNA 5DRNB 2OJEB 2AXJA 2GIYA 1AKJD 3CDFA 1OSPL 3L5XL 2VTFA 4JLRB 4I0PC 3WDHA 2VH5H 1U93A 5C86A 2BSTB 2O26U 4UBDD 1EV2E 5C09D 1FZMA 2V7NB 3U6RA 1OLLA 3QIWA 4PRID 2H3NA 2ZSVA 4LSQL 2VSDA 4GG6B 5HHVL 2GUOB 3ZDYE 3TO2A 4XMKL 2BJMH 1NMAL 2GTWB 2OS7A 3PF2A 4X6CF 1ADQH 2AV1B 2GAZA 4MA8L 1CFTA 2X4QB 4GRWB 1EVTC 2VDRL 4WNQA 1IGFH 4NM4L 5J3HC 2QSQA 3MV9B 1CE1L 3OKLB 4UT9H 4XPAL 5LKNA 4OZFH 3PL6D 3DETC 4XWOC 1IC5L 5HXMA 4LIQH 2EDWA 3K80A 4RAVB 5CD3A 3BP5A 1B90A 4OF5A 4FQIH 4L9DA 3SGKA 1NCDL 4LSUH 1MCQA 4KI5D 4XPBH 4J3OC 3A0OA 4FABL 1GC1C 4P9HH 5GS3A 4CNIA 2R8SL 1NAMH 1WV7T 5GGTL 3L3JB 3D39D 5C9KA 2HLAB 4LEXL 1MFAH 43CAB 1KLGA 4NNPL 2FWOA 2XY2A 4OB5L 2DTMH 3WFEL 4TSBL 1NGYA 2AJXL 1MI5B 4LSPH 5GRZA 3DVNB 2JCCF 1J10A 1EUTA 1XGPA 5I1LA 4KJWD 3EOBA 1XR8B 2YBRA 3H3PL 1YN7A 4GRMB 5D7JA 4AG4H 4RAHA 4WO4D 1WVZA 3S5LB 4AIOA 4I48B 4WHYG 4BSJA 1PX3A 2F53B 4UU9A 4Y19D 1E4WL 3ZT7A 1XGRB 3HI6L 4KK6D 4L3AA 3K2MC 3LIZL 2FB4L 5I15L 3X14B 3EJZC 3SE9L 1NL0H 3O6MH 5DJ2B 1GHFL 2HG5A 4I18A 4FQXD 3GI9H 1K3IA 3X11B 2FDBP 3F7RA 2APXA 5C0NC 2JF1A 5ISZE 1UCTA 5DHYA 4QRPD 3LHPH 1MFCL 1YMHB 32C2A 4XNUH 2UWEB 3HAEH 4U6HA 4Y4HA 1KG0B 4Y5VB 5IMKB 3MV7E 5ERWA 4PB9L 4HBQA 1MQ8A 1IKNA 1UM6L 2Q8AH 3WD5H 2OTUA 5DQDH 2GSIA 1MH5A 5HGHB 4LKCB 2A83A 2IPUG 3V6OA 2YSSA 4U1NA 5F3BB 4HS6A 4QLRA 1KCLA 5D1QC 1JHKH 3QUXD 4OLUH 4J1UB 4YPGB 1OAZL 1HKLL 2Y5EA 1PY9A 3QEGL 2A9MH 4IRZH 4MNQE 2YXFA 2HJKA 3SDAD 2F8OA 4GRLC 2G2RB 4ACPA 4U1MB 5FGSA 3THML 5C0RH 4X9FA 2FHBA 4DW2H 4JY4A 3Q5YA 4I3RL 5LGKA 4ODBD 1A6PA 3PV7A 4PJDB 1BQUA 5E6IC 2DL9A 3UTPD 3BUTA 1O5DT 2UZXB 2ITDB 1BFTA 4C83B 5J7CC 3EAKA 2DICA 2J8UA 4HXBH 5I1IH 4L1HA 2F58L 3DLQR 3ROLB 5F88B 4QHNA 4JJ5B 1HWGB 1K85A 1FRGH 2HRPL 1MWAL 1CFSA 3MV8B 5F3HA 4KKAD 1W0VA 3RBSA 4HJGA 3UTSB 3SGDH 1ED3B 3F7YA 1RSFA 2NY1D 2CK2A 4GKSA 2D3VA 1YNLL 4PLOB 3CXDH 3NCFB 4NCC1 1OAQH 3Q6GL 1WBZB 4XCFL 1PJ9A 4GAGL 5HHNB 1OOAA 3VXME 1G6RH 5DJZA 1UB5A 4ONFL 3K3QA 3LS5H 4NDMA 1CS6A 1G9MH 2BHYA 1G7HB 5CMAA 3RAJH 1AR1C 1U93B 5J56B 4QRQA 4TVPE 2R4RH 5DUPH 4M62H 4XP9H 5ANMB 5I0ZA 1YEGH 4ONHB 1T1ZB 3U6RB 1MIMH 5DVLA 3SQBA 3QXDB 4NRZA 4Z5RA 1URLA 3TO2B 3VGFA 4YHML 2OSLA 4IOSD 2VLRD 5T3ZL 5JORA 3IJHA 4WW1B 3P9LA 4XHJD 1CFTB 2P8PA 3IFLH 3O9WB 3ARTA 1SBBA 4G3YL 4JRYA 3E6HA 12E8H 5IBLC 3D3VB 4XBEH 1CGTA 3RL2B 5GRYA 2ED8A 4JQIH 4URTB 4FTVE 5EU5B 5IROC 5IHBA 3D69B 4X8JA 3V95A 3BP5B 4M5YL 3NOIA 2BY2A 2I24N 5CJQH 3DYOA 4CNIB 1RJYA 3MJ9H 4G9FE 3ARVA 3IU4H 4JZJB 1K8DB 3B9KB 3QUMB 2NZ9C 4D0CA 4DN3L 35C8L 1KLGB 1JWSA 4KK9C 1BJ1J 4NQCD 1DBKL 1NGYB 1HZHH 1JNHA 1OP3K 3KXFB 2VDOL 1TLKA 1SQ2N 1P9MC 2JCCA 1BQHA 1C8PA 1GOHA 2AQ1A 3QPXL 2YBRB 3RY6C 4FQJL 3LD8C 1YN7B 3ULUH 4JREB 4IJ3C 1T0NA 4R26H 3PXHA 1HXYB 1JP5A 1K3ZA 3MJ6A 5JHDA 3BWAB 1FLRH 3KYOA 4CGTA 4O4YL 2R2HA 1M7DB 4YZFF 4X80H 1QSED 4R96B 1BD2A 1CD0A 4LIQE 2Z35B 5DK0A 2YUZA 1JTPA 1C5DA 1SYSB 2EIBA 5B3JE 2QL1A 3RX8A 4AM0A 4MZ2A 3MLVL 2EEBA 1W72A 3TIEA 1TMCB 1MFNA 2FX8L 2EYSB 2HG5B 4U3XA 4Z77B 5D1XC 1GPOH 3RDTA 2BZDA 1X5AA 1MEXL 4KZEL 1CICD 1LD9B 3BJ91 4G6ML 3UAJD 3S9DB 4JGJA 1ORSA 4P3CL 4YXKL 4JM2C 5DHYB 1JMXA 1NLDH 1M4KA 1N6UA 3S4SG 1TJHL 1NCCL 4LRIC 2OMNA 2F54A 5E5UB 2WUCL 3MV11 2R1XB 1JPST 4R2GB 2CUHA 5EUOA 1NCWH 5ERWB 1N26A 3TJHD 3MLWH 4Q9QH 4M5ZL 2CGRL 1LQSR 3E2HB 4YXHH 1MH5B 3QIUB 2A83B 3G5VB 4K9EC 5CAYB 2OK0H 5ITBL 2YXMA 2H2SD 1FO0A 4HS6B 3IYLW 5IBTL 2P24B 5KW9L 1VADA 2HFGH 2MQ3A 1U8QA 2XICA 5GGSA 2LV4A 3ZZ1A 1RK0A 3G5XA 4GXVL 4R4BB 1TVBB 3U4AA 1UXSA 4JFPA 3TN0D 4L8CA 1N59A 1BJMA 4PJCE 1OAKH 2G9HA 4HH9B 4HSQA 3P0YH 4PLKD 5BVJA 4DKDC 5IHUL 1EEZB 1RUKL 1H5BA 4DN4L 4B7IA 3VDBA 1MVFA 4AMKH 3I6KB 1FZOA 4N5EC 1JPGB 1T7WA 4GH7B 2J8UB 4DGYH 2OZ4H 2X7LA 4DQOL 4C55A 4EOWH 4JFDD 5D6DC 3VA2C 4QXGH 5HD8C 1CFSB 4PJGA 2NX5D 4KQ4L 2L7UA 3VFVA 5JDJA 5I2IA 1T80A 3HNSH 1IQWL 3LPFA 3WFBH 5SX5K 4G7VH 5AYQA 5E2WL 3KHOA 3RA7L 4PGBA 4R8WL 3C9NB 3GDBA 4NKQB 3KPRB 3MJGX 3VG9B 2PXYC 5TH2A 5BS0D 3B2UC 4LAQH 4P9MH 1QO3A 4NDMB 4LCWD 43C9B 3SEPA 4LP4A 5CMAB 4OIIL 2B2XH 5BRZE 5HPMA 4QRQB 1EFQA 3GRWH 3MBXH 5DI8A 2D7MA 1P4IH 2GY7B 4ZFZB 1AI1L 1FN4A 1H3PL 4S11A 1ZHLA 1NLBL 1BQHG 1N64H 4TRPH 3QHZH 1MFBH 5ENWB 3UTQB 3IJHB 4FQQB 4ZOBA 2FYYA 2ZUUA 4EQ3A 3ARYA 1F97A 2XWJB 2E7LC 4U2YA 1RUPH 4JRYB 4OLXL 5TE6L 1CD9B 5DD6A 3RL1A 4G8GA 3SKOA 4Z6AT 5DJ6A 2B4CL 3LQAH 3NAAH 2NW2A 1L7IH 4P5MA 4I4WB 4JPVH 1H3TA 3T0DA 1FG9C 3ARFD 4X8JB 4HBCH 2X1PA 4NP4H 3B5HA 3V6FA 4G43A 3F58H 5E2TH 1UJ3C 5F96H 4HZLA 1H9VA 4U6VH 4ODUA 4ALAH 4HT1H 2DWDA 1LO5A 1NGXA 3MFFB 2BC4A 2WBJA 1FG2A 4Y0GA 1KULA 1UCBH 4AIZB 3QHTC 2QQNL 3BE1L 2VLLA 3FONA 1T0NB 3FZUC 3A6BL 4LOUD 3T2QA 3ZE2F 4MJ2A 1NDMA 5GRJL 4OFIA 1J88A 2O5YL 3C8HA 2QQKH 3KYOB 3SKJH 4C56B 1TZGL 2R2HB 4S10A 3HC3H 1CGSL 4OCYH 4HEPG 5DK0B 2KKQA 1C5DB 4F37F 1W0WA 3DX8A 5IT2H 4L4TB 4BZ1L 4FG6C 1I9EA 3VFUA 5L0QC 1CDYA 1Q1JL 1RUAH 4M93B 4HCRA 5DJCB 1KCUL 5DS8A 3WNKA 1EO8L 5J1SC 1Y6NR 3RDTB 1JWUA 2HFFB 3N1PC 4L5FH 1C5BH 4K3DL 5T3ZE 4F2MB 4DVBB 2YD2A 4GBXC 4OCXL 1T1YA 3SDCB 5GZOC 3EYFA 3O3BA 4PRHE 4WIQA 5TDOA 3GJFA 4ENED 1P2CB 3OKDA 4RMWA 5EUOB 1DUZA 3K7UA 3CD4A 1WK0A 4ZG1A 4JN2B 2J8HA 3LKOA 3TBYA 3ULUE 2OL3H 4OZGF 4Y5XA 1A8JH 3JUYA 5HHQA 2LU4A 5EOTB 1A7BA 3BEVA 4OGAD 3BX7C 4PG2C 4PG9A 5IGXH 3WS3A 1H3VA 4R90H 4WFGD 3QCUH 3G5XB 3VE0A 1CYGA 4N0UA 4ONOA 1G9NL 4JFPB 4H20H 2YK1L 1N59B 2Q86A 4P2RE 1VEPA 4HS3A 2NY3B 2GQHA 1RZFH 1J8HE 4XCNB 5BVJB 2EDTA 1H5BB 2V7HB 2K7QA 1C1EL 1AFVL 4XX1E 3PUCA 1S3KL 1WIOA 2NXYC 1I9JH 2FX9H 3MNVB 1MRFH 2IWGA 2C1PA 3H7BB 2X4SA 3IDIA 5DYOA 2VDMH 2W9EH 4H8WH 4OAWA 4PJGB 3DBXA 2JJSC 1S7WA 1S9KC 8FABA 4YHIA 3VFVB 3P11H 1XF5B 3B6SA 1CF8L 3VWJD 5J3HD 1YEEL 1TJGH 2A6KA 4RZCA 2X10A 5ESVA 4OUUA 4JCMA 4M6MH 2GSGA 4ZTOH 4PRPB 4CN1A 3DETD 1PEWA 4XWOD 5EUKA 4EN3B 3LH2H 1UH3A 3BXNB 1UVQB 5F7YC 5TH2B 1P4BH 1A6AB 3GEWB 1MCBA 4S0SD 4XVSH 1QO3B 4NHUB 3UTTE 5DJDA 5IV2A 4GUPB 5A16A 1OWRM 4ZPVA 2X4RA 1QFWL 1ZHLB 4ZUTA 2DQFA 1WFUA 5IB1A 4IRJC 1M6OB 3WSQH 4P3DB 1P7KA 2A6IB 2FYYB 4LPCA 3D9AH 1DQLL 2PNDA 2K9UA 4YXLH 4I3SH 2R0LH 2X1QA 3CVIL 3GO1L 3LEYH 5DD6B 3SKOB 4PJ8B 5DJ6B 2E7MA 3HRPA 2NW2B 3T0EE 1DBJH 3IU3B 4P5MB 5C0BB 2IG2L 1A5FH 3GI8H 4X0KA 1TPXB 3BO8B 3GIVA 5B8CA 1E4KA 1GZPA 5LCVH 1VCAA 3CIQA 1FAIL 3QWRD 4DOHE 3WXVH 5C0JA 3V6FB 1TDQA 4KPHH 4WHYH 4JO1L 3O6FD 4FQ1H 4BM7A 3A6CL 4WTXA 5C08D 3SCMD 1KJVA 1BAFL 2QSCH 1T04B 4FZEH 3OGOE 2A6JA 1WWWX 2Y5TB 4HAGA 3MXWH 3C6LC 5HDBE 5SWZE 5C0ND 1LO5B 3VMNA 1NUGA 1JZ7A 4XAKD 4LPWA 3TA3A 1AO7A 2AXHA 1IEBB 5D72H 3HS0B 3KR3H 1WT5A 4NOFA 4M9PA 2ZOLA 5CGTA 3O8XA 4WU7A 1B4RA 3I6GB 2VLLB 3FONB 3LRSA 3ARDB 5F7WC 1S7SA 3LN5A 1DDHA 1NDMB 2IH1A 2IBBA 3DRQB 1AXSB 2PTVA 3OPZL 4FFZL 5FUOH 5LGHL 2FR4B 1AQKH 1PSKH 1RMFL 5KSBB 5C0FA 1CGYA 4HKXA 4NBXB 7CGTA 2WUBH 1QVOB 3K46A 2XWBA 5LGJB 1W0WB 5BJTA 4NKIH 2YUVA 1MIEH 2EZ0C 3JV6B 5D5MF 1ZLSH 4LHUA 5HI3C 2PW1B 4YNYA 4PGDA 4QRRD 5DS8B 4GRLD 4WI4A 4XMLH 3AM8C 3K8LA 1SJEB 5T1DL 3MRCB 1JWUB 3RJQB 1EJOL 1I8MB 1SM3H 4Q2ZB 3SO3C 4XXCA 5E6ID 3GMNA 1T1YB 2E6JA 3EYFB 3O3BB 2X41A 3QG6B 2AK4D 4JZOB 5TDOB 4JRWA 3GJFB 5TFSL 5CEZD 3OKDB 3UJTL 4YC2B 1WEJH 4KTEH 1MJ8L 1M71B 2ZG2A 2ZKHL 3FB7B 2QADC 5F1IB 4KHTH 3TBYB 1T0MA 5HHQB 3QUML 2QSTA 4OKDA 4OQ1A 4NHCL 5C0AE 1T83A 4FMFA 1ZHBA 3IFOA 1WZ1H 2R29L 5D1ZD 3WS3B 3VXUE 4KAQH 5F8RC 1PQZB 3V4UL 4BK4A 3F62A 5E8NB 4HUXA 4KDTC 4NUGL 4N0UB 3MO1B 4RDQF 2DF3A 4RBPK 5T1LA 3REVA 1HQRA 4KJPD 4NRYA 2Q86B 4U49A 3WIFA 1QHPA 1RZKL 3LSOB 2VLKA 4W70A 3P9WB 3DX6A 1YN6B 1ITCA 1TQBB 2XFXB 1T2XA 1I3VA 3CK0H 1CFVH 1JYXA 2J12B 5EOQL 5FDWB 5DMGC 5CZVL 2PYFA 2P5WD 5IVXB 3CFDA 1MHHA 4TSAL 3QWOA 1GH7A 2VDPL 2ARJQ 3F8UB 3IDIB 4S1QH 2AK1H 4OAWB 2YZ1A 4NJAH 3WFDH 3R8QA 3CDGB 2C26A 4P2CG 2BDNL 1XGTA 2A6DA 1LE5A 4KRPB 4PJDF 3DV4B 3AFLA 2A6KB 4QXUH 2UZIL 4MJIE 5IBLD 1PKQB 3ALPA 4OUUB 1NBVH 2YA0A 5GGQL 4P23C 3MV9E 1XF3B 2AEIT 1MRCH 3ELAT 3L5JA 1NMCC 4TN9A 4MX7A 5JUEH 4X83A 5T33H 4YQXH 5A16B 3SE3A 4LLDB 3D25A 4MQXD 1EK3A 2ITCA 1S78C 3U1SH 3CLEH 1MOEA 4ZPVB 2ILLA 2X4RB 3PJSA 1T03L 2NZ9D 3VD5A 1I4FA 5EZIL 1INEL 1AC0A 4OLEA 2DQIH 1HSAB 4KK9D 4B7LA 1KELH 4ODTL 1SVCP 5IB1B 5GS1B 3HE7D 4Y5YA 4Y16B 1CK0H 1IGCH 4LVEA 1Q9LA 2I5YL 2CIIA 2YA1A 3SBWC 3FTGA 4XP1H 1T6VN 2O5ZH 4MD0B 2D03H 3L95A 4RA0C 1ZWIA 1HH9A 4O9HL 4NQED 1IKFL 4X0KB 5EB9A 1WTLA 5B8CB 1GZPB 5DD0L 1CVSC 5D7IA 3KGRA 3K8KA 3QQ4A 5BV7B 5C0JB 1CDBA 3EJYC 2PN5A 4NO5B 5K9KB 2FEDD 4CVXA 4P2OB 4ZOCA 4KXZI 1NANI 5CP7B 3DXAA 5EFIB 1KJVB 3V7AE 4WU5A 4XP6H 4JFEE 3UDWA 1F90H 2NXZB 3VJ6A 3ULVF 4YDVA 3G04A 3V0VA 3TT1L 2F74B 3TA3B 5KN5A 3DGCR 1AO7B 3WFCH 3RY5A 4HJ0C 3I6LE 2ZOLB 3BHBA 1QFWI 1BGXL 4MAUH 3EFDL 2XV6B 1QRND 4QT5A 3LN5B 1BMGA 4N8VA 1UQSA 1DDHB 1DQML 2IH1B 5FO9B 1IMHC 1WAAF 4WUKH 2LTQC 5DUBB 4KH2A 2J5LC 4J6RH 5EO0A 3MACL 5CHNB 5LBSL 3LPGA 4G7YL 4WTZG 2Q3ZA 1RZJH 5FYKL 3IF1A 4LLAA 2XWBB 3DVIA 4EKXA 2ARJB 5DMKA 3GKWH 5K9OB 5I19H 4LHUB 4YNYB 1RK1A 4JB9H 2YPKA 5IG7A 15C8H 4X6EA 3W0WB 4JFQA 4UT6L 2H1PL 1MCKA 3QNYA 2YHGA 5E03A 5EU6B 4M7LH 3VH8B 2E6QA 3SJVD 5KSUB 4XXDA 4QTHA 4RGNB 5D96B 2XTJB 4JFYB 4IRSB 4TNVK 4Z8FH 4N5ED 4J12A 3QXTA 3HCVA 4OZIE 4Y1AA 4L9LC 4AQ1B 1DLFH 3K4DA 1IEHA 5HD8D 3ZTNH 25C8H 4NRXA 5KZCB 1T0MB 4OM0L 4WJ5A 3H9SA 2DQDL 4IMLB 1LO2L 3ULUC 4FFYH 1P84J 3R4DA 2XN9B 5H8DA 3K2UL 2BP3A 3U7YH 4DWHA 3R06B 2VYRE 3RRQA 4EJ1C 3GZKA 4HUXB 1OPGL 1F58H 2ESVB 3MJ7A 4NO3A 5T1LB 4JANA 5T1KD 4HWNA 4NRYB 3BDYH 4AY0A 3WIFB 1NSNL 2ZPKH 3B2UD 3PV6A 2ADFL 3LEVL 2VLKB 3LV3B 1YEFH 4NIKB 4MYWB 1CLCA 1FPTH 1HSBB 2ICWB 4O2FA 4F9PC 5I1EH 4WV1B 3E8UL 3SDDA 2XPGA 4E5XA 3AU1A 1RHFA 2Z0BA 3NPSC 5DC4B 5IW1B 3OG4B 4MB3A 2AJVH 2F15A 2CPCA 1CXKA 1ZMYA 1A7NL 2PO6B 1OF2B 3MMEB 4K23H 4QRTA 1D9KC 4YDKL 3M45A 5IQ9A 4L3EA 1TCMA 4PJFE 3JXAA 4S0TD 4UQ3A 4JQXC 1KTDA 3GMMA 3CFCH 1JN6B 4OLZH 3FOMA 4DFHA 3RKDC 3CDYA 4NPYA 3RVVD 4D3CL 1IAKA 3KVQA 1JHTA 3KLDA 2WW8A 2Z91A 5E8DH 2DYPA 5KSAC 2R69L 2VISB 3PIQA 2MQ0A 5JOFA 4ELMA 3WO4B 2JB5H 1SBSL 3FQUB 4MX7B 1IQDA 4F7MA 2BNQA 2E27L 3QJHB 1Q0XL 5ECJE 2X4OA 4RA3A 5E2VL 3O2VL 3R0NA 3VWKA 2CDFA 3BGFB 3RWFA 3DOSA 2EKJA 1I4FB 4NO0B 1W72H 2CK0L 2J2ZA 2WBWB 5DD3L 3CU7A 1ZT4A 4U1IB 3U36A 3GMLA 4KGJA 4NKDA 1MJ7H 4I3GA 4XNMA 4Y5YB 4ETQA 3ARBC 5FKAA 5ICYB 1FDLH 5I76B 3NIGE 4XH2B 4U0RB 4TUJA 4N8VG 4LDLB 3PQYB 2CIIB 4ZO9A 2IEPA 3HRZA 3KWWA 1F4XL 4S1SH 4XC3H 4Z7OE 3NBNA 3IKCB 1FFOB 3EYSL 5SWSA 5DWUL 1KCSL 4IOIA 1HH9B 3ARXA 4PLNC 1IGJA 4HMEA 3D2UA 4X9GA 3T0EC 5D7IB 3IDNA 1BX2A 1FO0H 5IB5A 1N0XH 5E0QA 2MOVA 4Y4FC 5HYJD 3C60B 3DXAB 3NZHH 2BRRL 4WU5B 5B38G 1OARH 3SHSA 1AIFA 2P8MA 5FXCH 5TE7H 3C2AL 4WY7L 1SEBB 2VXUH 4P57B 3U79A 3VFPA 3O3EB 4IDLA 4GBXD 3ARGB 3DARA 3G04B 3V0VB 2A73A 1CQYA 3OJVC 3OZ9H 2HAZA 4D9RE 6FABH 3L5XH 2GTZB 3MRMA 4V1DB 1GSMA 3KPSD 1PLGH 4QRSA 2YKLL 5FGCE 1JGVL 3P3YA 3FQRA 3IDGA 1EZVX 3RI5F 1JIBA 1UQSB 4YE4L 5IFAH 3TT3L 1CDJA 4M3JA 3QQ3A 4PBWD 5EO0B 4HC1A 2RFXB 4WI2A 5EIIA 3LQAC 5DGQA 5BOZG 4OFYA 4WHTA 3IF1B 3QG7H 4RDQG 3HFML 4MJ6A 4BQ8A 5IFJA 3CXHK 3V6OE 3ARWA 5HHMB 1CDCA 3EDJA 2YPKB 1X3DA 3HMWL 3ARRA 4X6EB 5FYLE 4JFQB 2VLRB 2E9JA 3QI9A 2MCPH 3QPQC 3FO0L 5MI0B 4ZUUB 2DAVA 1Q72L 4QTHB 4K3EH 3QXWA 2BVTA 1JL8A 3TVMA 1B0WA 4Y1AB 1DEDA 3VA6A 4UILH 1MRDL 4NQUA 4OB5H 1ONQA 1R24B 4F7TA 2B4CC 3WHXB 1UWEL 3GKZA 3QB7C 2J8UE 1R3KB 1G9EA 4ZNEA 1ACYH 1GGBL 1IM9A 1MCWW 3QUZD 5JOEA 1OGAA 5J11C 2VXQL 1AGEA 2CUIA 3B9VA 3RWIA 3O2DA 1FZJA 4ZAKC 5DJYB 4BSVB 3BKCH 3PABB 1GGIL 4PYHA 5DVMA 4NBYB 3OG6B 3MJ7B 3OKNB 4RGMB 5H2BB 4NKOA 3LEXA 4XBPB 4JANB 3RZCC 4PJEF 4LLQA 1R0AH 3LRHA 2NTFB 3T2NH 2WQ8A 1K5NA 1QLRA 1I1AC 5MEQB 1HOCA 2BY3A 3MRJA 4XVUC 4B41A 4Z9KB 4MNGA 3MUZ1 2HLFC 3V4PH 1R3JA 1J18A 5TPWL 3SDDB 4TVPD 4W81A 2QV2A 2W65A 4MNHA 4IRJD 5DF0A 4WHCA 3MTRA 2QEJA 4N5UA 4HCRL 1ERNA 1N4XL 4L3EB 3KLAA 4Y4KD 3LCYA 3EZ8A 5MEND 3H7LA 4UQ3B 4NN6B 3RVUC 3GMMB 4G5ZL 3VFOA 1OAYL 4X6CE 1FGVL 4RMSA 4PB9H 5HHOA 4OI7A 2HT2C 2EXYC 2ZUQB 5IVNA 1JHTB 2V17L 3X3FL 4LSVH 2DYPB 2HT3C 2FX7L 3PIQB 1HQ4A 1KB9K 1OT2A 5JOFB 3BPNB 1XR9B 3W81A 1TQCB 4PRNA 4F7MB 3MRLA 2BNQB 3WUWB 5MHSD 4ZTPL 4PREA 1F3JA 5GGRA 1ZHKA 4LLYA 1VFOA 4Q0XH 1QLFA 1I8IA 1OTTC 4X9IA 3HMXA 3S88H 3GMLB 4JN1H 1Q94B 1HHKB 3C5ZB 5IEHB 4HUNB 1OAUH 3C6LD 5TQ2H 4GSDL 4LDOB 5FKAB 5HGAA 4JFFD 1MLBA 4P3WA 1Y0LB 3KWWB 4PJ5D 5KVGH 3GMPA 4QNPE 3NZ8B 2JCCE 4X6BA 5B3NA 4AENB 1IGJB 1M7XA 2M2DA 2Y1VA 2ZP0T 1FH5L 3D0VA 2GT9B 3QFDB 3IDNB 1OGTA 1BX2B 4YHNA 1GZQA 4JG0H 5JHDE 3INUH 4ZO8A 3UMTA 1O7VA 3RWHA 5ILTH 4J7RA 3FQXB 4ZS6C 3QFJA 1BD2E 4JY5L 3RU8H 1F13A 3Q6GH 3HKFA 3ARUA 3QDMA 4PJIF 5D2NA 3VFPB 5I1CL 1ZK9A 4WCYH 1LO0H 3T09A 4EBQL 3QEQD 3O6LL 1U8MA 3TBSA 2Z4QA 4ZOEA 3MRBA 3PNWA 1RQ5A 1I7RA 4JKPL 1OP5H 2APTA 3EOAA 4KY1H 3O3DA 2EH7L 3IJSB 3AY4C 3GGWA 4OV5B 3ESUF 3J8F7 2FGZA 1I8KB 1CWVA 2GJ6D 4YFEA 4UV7H 4H88L 2F54E 3G6DH 1ZS8A 4EI6B 2VDKL 5DO2C 4NYLA 5EUOE 4NZTH 5EIIB 3NH7L 4WHTB 5L88H 1IT9L 1RIVL 2IH3B 2BSSA 4FXKA 5MP6L 1KTLB 1B4JH 3PGFL 4QXTA 4UUJA 3KYNB 1NCBL 1RZIB 3LKQA 4MXQD 2NPLX 3C09B 4HG4J 1FL6B 3JWNC 3MRFA 1R3IL 1GIGL 5EIQA 4JRXD 1L0YA 3HPLB 4YHYB 5DHXB 3QI9B 4PS4H 3VGGA 3L5HA 1S9WA 3VMOA 3BIKA 4XWGH 3WUZA 3MLUH 3ZHLA 4WFHD 3GJEB 5D70H 3HC4L 4OF7A 4YHPB 3TVMB 2V5RA 3GSQA 2HTLC 1V5JA 5DMGD 5BV7L 2FD6L 3I9GH 1CTOA 4OTXH 1XF2B 4Z7UF 4Y8DC 1FHGA 1N6QH 4LVHC 3LS4L 3LKSA 3CVHH 5I1JH 3OAUL 3G5ZB 1OGAB 1BIIA 1NCAL 4EDXB 2E8ZA 4ZOAA 4WW2A 3RP1A 4EI5A 2VLMD 2APFA 3O11A 4PJBB 4MHHG 3QDGA 3TGXA 4P4KD 3U46B 3QIBC 4OLYH 1J05A 3LEXB 2BY0A 2Y23A 4MCZA 4P23D 1IM3A 2C3HA 4LLQB 3RGVD 3CFJB 3CX2A 4O4YH 1U8HA 2G5BB 1BLNA 2KUTA 1KT2B 1YYMH 4HWBA 4ERSH 1HHHA 1MHCA 1QLRB 4FNLL 5AYUH 4LCIL 1T7XA 3G6JA 1F6AA 3VXQA 1H15B 1S78D 4MNGB 3QXVA 5BRZD 3OKKA 1PAMA 4RQQB 3S37H 4X9HA 2WINB 4MNHB 4P5TB 4Y2DA 1V3LA 3ISWA 1I3GH 4K2UH 4M48H 3NA9L 5JXAH 2XZCH 3UX9B 5F1SA 5I8CB 3KLAB 1QZ1A 3DUSB 4XBGA 3V5HB 3QIWC 3NIDF 1VGEH 1MELA 5HGBA 3VFOB 1XCQB 5HHOB 1J0HA 2DM4A 1L0XA 2CMRH 3QO0B 3S36L 1ETZB 5EZOL 2GITA 4LVOB 3LKNB 5IVXF 1VERA 1UXWB 3O9WC 4NQSA 4MAYB 2AW2A 4G8GE 4OGXH 1N7ML 1U8KB 1UWGL 4PRNB 5IESL 3MRLB 3CX5K 1A7OH 5I1AA 2FH6A 4PJ7F 1YMMA 4GG8A 2X4NA 4OCWH 4X4YB 1DZBA 1DEEB 1F3JB 5GGRB 1MFDH 1R5VB 3FN0H 2WMPA 1QBLL 1H3WM 4U1LB 3QAZB 1MCNA 1AD9B 1SYVB 1CFQA 4QHLB 5IB3A 2OQJA 3RTQB 1QLFB 4KRMB 3SGKC 3VXRA 4BQ6A 4W6YB 4Z7VA 4TUKL 5J13C 5HGAB 5IHUH 4IOFC 4U0QB 4NQDD 4DN4H 3CH1B 1MLBB 2FBJH 3VD4A 4HJ0D 3B9KC 4JZJC 1T89A 1LMKA 5T3XH 5L2KA 3SQOL 3O81A 3X3GL 4OI8A 4Z18A 3CZJA 3BQUA 2EKSB 3GMPB 4HWEL 1FBIH 3DI2B 5FA3A 5KANG 1EHLH 2YD5A 4J3XA 4PGEB 4X6BB 1DTUA 5F89A 3EIFA 1NFIB 3I85A 4FQHB 3TO4A 3PHOB 3WEXB 3D0VB 3M8OL 3EYUL 5GS2D 4I0PB 1IQWH 2DMCA 2GK0B 3SN6N 4JREC 3CZFA 1A7PL 5KS9F 4PGCB 3PDOA 3GBLA 4X8XA 5CLWA 4YZFE 4TUOA 2W9LA 2DLIA 3Q1SH 5C6WH 3ZKMD 2Y9RT 3RX5A 5D2NB 2GK2A 4PJIA 4YDJA 3QUYB 1GGCH 3CSYA 4ZNCD 1KENL 2G5RA 2R9HD 3MROA 5T3ZD 3PNWB 4D94A 3FRUB 4I18C 3TBWA 2AI0L 2NY6C 3O3DB 3U7WL 4PY7A 4MWFA 4QOKB 2A9NH 3R0MA 5D7KE 2FLBT 1MNUH 1HILA 2IAND 4HUWB 4K8RL 2YPLD 1AGDB 1ZS8B 4NYLB 1EEYB 4Y4HC 3VFTB 1S7RA 2IPTL 3RIFK 4OLXH 5TE6H 3EO1A 2BSSB 5E95B 1HIMH 1IKNC 3SY0A 4ODXB 4QXTB 4UUJB 4YO0B 3E2HC 3LKQB 3OF6A 4PV9B 3QIUC 1UB6B 2BNRB 1QR1B 3GBNH 5HGDB 5LWYH 2WZPD 5E8OA 5F7DA 1FFQA 3MA7B 3ZSSA 1EA9C 1S9WB 3BIKB 2Y36H 4L8BB 2AERT 3O0RL 2OLDA 3SKNA 2QJDA 3GSQB 5E8PA 4OZHF 4AH2B 3R1GL 5FIEA 4Z7NF 2VC2L 3L3OB 1YJDL 3BGAA 1R3LA 1BOGA 1NBZB 4CMHB 5EA0H 1D9KD 5FUZL 3UJJL 1KJ2H 2NY4B 1S7XA 2VIRB 2VZTA 1UKTA 5F7LB 3BKYH 1BIIB 4JO2H 4WGVB 5C0GB 4H26A 2DD8L 4W68A 4LSTH 4EI5B 1HHIA 4QHKI 3JBG7 3RKDD 3T4AA 5D2LA 1AR2A 1J05B 1CGWA 1RZJC 2AEQH 3DMMB 1LEKB 5KSAD 5E94A 2JK5A 4KKLC 2DL2A 2DLTA 4ZYKB 4FQ2H 1QTYT 1HHHB 1CD1A 4HMDA 4JVUA 4X4XB 4F7PA 2ZUTA 3MLTB 4P2QA 3I02B 1P4LB 2RR3A 1MUJB 3VXQB 4BZ1H 4U05A 3OKKB 1YQVH 3VG9C 1JZ3A 4X7DC 4JY6A 3IFPA 3ZYIA 3NACH 2ICEA 3MODL 2XA8H 5CJ8A 4CJ1A 2N7BA 5IB2A 3ARBD 1MCPL 2JELL 5DQ9B 4U31A 5DHVA 2XQBL 5HDLA 5D1QB 5T5FH 5I73B 4KRNA 4LPVA 3BN3B 4U4BA 4XBGB 4J2XA 1NAKH 1U3HA 2MSPA 1YDPB 3P0VH 1QPXA 5HGBB 3S37X 1I1RA 3H42H 4PY8J 5IF0B 1HE7A 4OD1L 4LDEB 4U1KA 5INDA 3FQWA 2GITB 3CFIC 3VGEA 3CMOH