1E9OA

Crystal structure of bovine sod - 1 of 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
ATSAVCVLSGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADSNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oA00
4A7QA 3GZOA 1EQWA 2R27A 4A7VA 1E9OB 3H2PA 4B3EA 2GBTA 2APSA 1XTMA 2Q2LA 1SXSA 2AQNA 3GTVA 1SPDA 2E46A 1Z9PA 1OALA 1SRDA 1HL4A 5KBLA 1YAZA 1JK9B 2K4WA 1AZVA 1P1VA 3QQDA 2WWNA 1SXAA 2C9VA 4BCZA 3K91A 2ZOWA 2WYTA 2WZ6A 1E9OA 4A7UA 3GTTA 1XSOA 2NNXA 2ZKXA 1BZOA 1DO5A 3SODB 3PU7A 1SXZA 1ESOA 1PZSA 1OAJA 3KH3A 1F1AA 1JK9A 3ECVA 2JCWA 5KBKA 1CB4A 3QQDB 1OEZW 2AQSA 1UXMA 2AQTA 2WWOA 2VR8A 2AEOA 4MCNA 2AF2A 3MKGA 3KBEA 1OZTG 2V0AA 1IB5A 3HW7A 2GBUA 4OH2A 1SDYA 1DSWA 1MFMA 2GBVA 2SODB 1Z9NA 2WKOF 2WZ5A 3L9EA 1PU0A 3GQFA 3F7LA 3RE0A 1E9PA 1F1DA 1JCVA 1SOSA 1TO4A 1EJ8A 3S0PA 1E9PB 1PTZA 2C9SA 4A7TA 1E9QB 2JLPA 2Z7UA 2VR7A 1IBHA 1IBFA 1F18A 3KBFA 1COBA 1YSOA 2XJKA 2Z7YA 4MCMA 1OZUA 4N3TA 1TO5A 3GZPA 1B4TA 1KMGA 5KBMA 1XTLA 1QUPA 2WZ0A 3GZQA 1SXNA 3KM1A 4A7GF 1S4IA 1CBJA 1SXCA 5CU9A 1E9QA 2VR6A 3CE1A 1FUNA 1U3NA 3HFFA 3ECUA 3ECWA 3H2QA 4BD4A 3KH4A 4OJAA 4A7GA 1F1GA 2ZKYA 4N3UA 1Q0EA 1IBBA 2Z7WA 3LTVA 1HL5A 1BA9A 4L05A 2LU5A 3HOGA 2AQRA 3CQPA 2WKOA 2AQQA 2ZKWA 3CQQA 3T5WA 1N19A 3F7KA 1N18A 2WYZA 1UXLA 4U4IA 2Z7ZA 4BCYA 2E47A 1L3NA 3L9YA 4FF9A 1IBDA 1SXBA 4A7SA 3MNDA 1RK7A 1B4LA 1YAIA 2XJLA 3KM2A 2C9UA 2AQPA 1SDAB
chains in the Genus database with same CATH superfamily
5A3IC 4HJJH 1ZGLB 4WNQB 1HI6A 1ZK9A 1LK2B 1UB6B 1WTGT 2H45A 3CPUA 3TURA 5J4MA 2X4QB 3OM3B 4PRAB 4KKCD 3M46A 1CO1A 2ED6A 5INCB 2ZCLH 2ADYA 3AQZA 3VSVA 1AOHA 4NN7C 2B5IB 4U0RB 5C0NC 2D73A 4G59C 1NJ9B 3TU6A 3L16A 1P2CA 4YSRA 1BEYH 4WUKH 5HJGA 1L7IL 4Y4FA 5CR1A 1L6XA 1ZKAA 1J5DA 2VRQA 3O2DA 3NK3A 2ESVA 1RULH 2F18A 3B9KA 4OGYL 2EDWA 3I6LD 4CVXA 4MNQA 5AD0A 2ITDA 3FCBA 4J4PD 4JRYD 1TTRA 1MI5E 5LAXA 4M5SA 1OAKL 3VAEA 3MKGA 4FFTA 3MODH 5GJTH 3GMOB 2W59A 5CCGE 3EH3B 3KYNA 3P9MA 4Y2LA 5GQBA 4HBCL 5HY9B 1NFKA 1JI2A 3GKZA 4M3HA 1F6AB 2WTOA 3BAJA 5K33A 1U3ZA 2WQAA 1FYHB 1KSRA 5DWUH 3BH8A 2HLAB 4OI7A 4DP9X 5C71A 2UVEA 4LCWE 3TJPA 1EHLL 3QDHA 4LQFH 2YC1B 3MROB 3E1ZA 4MB4A 5F89B 5CCKL 3AB0C 4QHKI 2GJ6E 1X4XA 1Z5LA 1HQ4B 1IGML 5D7SH 3KJ6H 3FRPB 4X4YA 1NEUA 1NCJA 1R3LA 2J25A 3O2DL 4ZMAT 5BOJA 2FNBA 4FZEL 1F11B 4WJ5B 3X17A 1CU4L 3C2AL 2DWSA 4GAGL 3VE0A 3TTSA 3VWJA 4E42A 3ARYA 1IAOA 1JZ4A 3NJKA 5CBEA 5C0CE 2BPBA 1JNNL 4F1ZA 3BVVA 1ZHBB 4POZC 3VWJD 5HYQA 3L3HA 2BVQB 1UWGH 5JHBA 2ZWZA 5DJ6A 2MEJB 1B4JH 4NNXB 4OB5L 4DH2A 2EDDA 1CIUA 3K81A 5JO5B 1QR1A 4H8WL 3WTYA 4MS8C 1SBBA 1RK1B 3BE1H 5HYFA 3G6JF 2Z31B 1UXWB 2ZX5A 5DT1L 4FA6A 4LEXL 4X9FA 5IHHA 1SUHA 3QUXB 1P5UC 5DJYA 4LF3B 4TSCL 1IILE 1L3NA 5I15H 5HYEA 3WBDA 4J2QA 4QOKE 1SLUA 5HJ3B 3QRGL 1AGEB 1SDAB 4P2RE 3CK0L 4P9HL 4I18B 4AMXA 3H2PA 4HUNB 4X9IA 2HUHA 4M93B 1H3PH 2M1KA 3CX5J 4AEEA 2FECL 4MA8L 1IT9L 3MTRA 1ILUA 2E46A 1H15A 3ZQ9A 4WTXA 2I9TA 5CN1A 5E99H 2H3XC 1NC4A 4GG6A 4X4MA 2XWJA 1EZVX 1S9YA 5C0GA 2IH9A 4PLKD 4QAWA 4HEPG 3QIBB 4TNVF 3IFLH 3L3GB 2IWGA 4JY6B 3RGVB 5EZIL 2WTRB 4Y1TA 4X6CB 3U83A 2YUXA 3WNJA 1WP6A 3ZTEA 1PZSA 5J1AA 5E2UL 4F7CA 2IWEA 2GIYA 4JFQA 5HYJE 4B9PA 3O3AB 4HDIB 3RAJL 4HG4J 3GS4A 4XC1H 4D94A 1JHTA 2AK4A 4YDZA 4OQ1A 3MACH 2LU3A 4Y8DC 4C54A 3VD4A 2H6PA 1A3RH 4QKXB 2OMWA 3MV11 4OLVH 5E56A 4R26H 1AGFB 3NJJA 2F0CA 5I1LA 1G7JA 3DLQR 4NQTA 3AROA 2VC2H 1OSZA 4JO4H 2CR0A 3T04D 4KXAA 3L5IA 2N3JA 4Q0XL 2GI0A 4PJHA 3FTZA 1UD4A 1LP9E 2IDTA 2BSCA 2DM3A 1IKOP 2OW6A 1GGCL 4QRRD 1KGYE 4QJ4B 5B39B 5TQ0H 4JRXD 2X1PA 1D3CA 1FFQA 1L9NA 2HVKA 3IRPX 3WL9A 2DQUL 5IM7B 4DQOH 4RVBA 4LLVA 3VD1A 3S3SA 3L7FA 3WXVL 3O6MH 4NRXB 1TENA 1WA0X 1S8DA 2CBOA 1YN7B 2HMID 4KK6C 4C56B 2IPUG 2QHRL 4Q9RH 3HNVH 4IMKA 2OMYB 2CXKA 3X1EA 5IOPA 3T2NH 3OSKA 1DVYA 3S37H 1TDQA 1PW3A 3WS6A 4U1JA 4LHUG 1M6OA 3WKMH 1DDHA 5FFOA 1EMTL 1FH5L 1T7ZA 2CGRL 2NX5A 4NWUL 4MJ2A 5B39G 4K3HA 2QJDA 3MRHB 3MRBB 5KVDE 3K0WA 3GXTA 4K9EC 3B34A 3PHAA 4K2UH 3R06B 4ZT1A 3L1EA 4LRNH 4DN3L 1YC7A 2A4EA 3OAUL 4HIQA 5C0IA 1GAFL 3UJJL 2CDFA 2VSCA 4XPFH 4UQ9A 3U9UB 1PMYA 2OULB 3QZWG 3K2UH 5GISL 1WFTA 1B2YA 5GRYA 3UAJD 2IGFL 1IM9A 1H3GA 3UYPB 4B6ZA 5ICYB 4V1DB 1ET5A 2AEPL 3ARDA 2W65A 1EXUA 3MYJB 2AANA 3O8XA 1FFPA 4ISVA 4WUUE 2F53B 3RNQA 3JUZA 4LU5H 4O02A 5AFAA 5K93A 2WO2B 1WF5A 1CG9B 3AWFA 4OCRL 4WFFD 4CNIB 5J13C 5AAMC 4AG4H 4E9QA 5F93C 3RX7A 1FO0A 2BVEA 2NXZB 1QX1A 2X2JA 4KQ3H 1U2YA 3V5DB 1SY6A 1OO2A 5KVEL 1U6AL 2QPUA 1TTAA 1FZMA 1MUJB 3BP7B 1BEXA 1S7UA 3V7AG 5I19H 3ABMB 3QXAB 1RP9A 3V7AE 4WHYG 2VISA 4KGJA 1HWWA 1C5BH 1MRDH 1J18A 2ZKMX 5MENB 3ME0B 1UEYA 2H9GB 1BXXA 1SY6L 2VXSL 3QPQC 3ZRSA 2Q76B 4FP8L 4QOKB 2JH2A 3PP3H 5KSAB 1RIVL 1A8ZA 2YUZA 3NOIA 5CSGA 2M83A 3NK4A 3V10A 1VACA 5D7IB 3V0AC 2NY7L 4FXGC 3ZDYB 1JNLL 3LPFA 1G6RH 5E0FA 3BQUA 4MQXC 3MXVL 2DF3A 1CICA 3GSXA 1C8PA 4H0GA 1MNNA 3TIEB 1J05B 4MX7B 2IOOA 4XP4H 1Y6NR 1LWHA 2W9DL 4ZO7A 5I19L 2WO3B 1CI5A 1MRFL 4Y4HA 3C5XA 3LKOA 5I17A 5JA9A 4ZZKA 1NL0H 4KH9A 1NGPH 2Y06H 1W9XA 4XRCA 4YIQB 2X3BA 4UMGA 2HRGA 4JO2H 1T80A 5GRJL 3INUL 2OX5B 2Z8RA 5KN5B 3SYPA 2FJUB 4J4PC 5KUMA 4P9HC 4DF9A 1C7TA 3EIFA 4CMHC 2WYHA 1OWWA 1K4CA 2QHRH 3VI4F 5GZND 1ZGLM 4G72B 3UBXA 4TRPL 4F2FA 1F58L 1FL3A 1LEKB 4XPGH 1TU2B 4TTDD 2BIPA 4O51A 3BIKB 25C8H 5DTFB 4R7XA 1KLGA 1GPOH 3V52L 4FD0A 5EUOB 2J73A 2YXFA 4NWUH 5G5DB 5I1EL 5E7FA 4FXGA 1ITBB 3ARQA 2R7EA 5CEXA 1CXHA 2EVIA 3ROOA 5D1ZB 5CGBA 5B1JC 2FEJA 1WG3A 2JB5H 2WBJB 2X3CA 5CMAA 3RVTC 4P2AA 2VMEA 1DLFL 1EMTH 1FH5H 2CGRH 5D7JC 4BKLB 3S48A 5EOTB 3IN2A 3V0VB 2VDML 2VXVH 2ZF8A 4NUGL 1S6NA 4ZFOB 1HEZA 3D12B 1NDGA 1BFTA 1C5DA 1N8ZB 4M43H 3VNYA 2DI8A 2Q7NA 3DV4A 4I7ZC 4WI0B 2ZIDA 5GSRB 1NCDH 4I77H 1AGBB 2QPFA 3LEXA 1I3RB 4R2GB 4L3EA 1OALA 1A9EA 1MFDL 1UA6H 1S7SA 4Y4KB 3WKYA 4Z7NE 5A40E 1KELL 3B7UX 2IAMB 4WEMB 3ZYJA 4MNQB 5CN2A 4JG1H 5C0DB 1CDIA 1E30A 3QARA 1GKEA 1HHKA 4JO4L 1SJEB 4ONHA 1UFUA 3EOBB 1T21B 1KY7A 4OGXL 3TVMC 1W6LA 2ZOTA 1MCEA 2YFNA 1Q8MA 3L48A 4EQ3A 5IB3A 1EX0A 5DFTA 3LPGA 4OLUH 4QRQB 4K94L 4JN1H 3V6OE 3FFCA 3OB8A 2NQDA 5CEZE 1JWUB 3PE9A 1FNSH 1WVZA 3VQ2C 1JZ7A 3LQZA 2V3FA 3AB0B 3RDJA 1E9PA 3OPZL 5DVKA 4I4WA 2JJSA 4WEBL 2FK9A 2J6WA 2ZXBA 2JSFA 3ZE1B 3VFTA 1Z66A 2IWKA 4MCYA 4Y9BA 4G8IB 3TVMB 2C3XA 1T22B 2CJ3A 3O45A 3GSNB 3QNYA 3M7FB 5J12B 1NINA 5IWLC 5E8OA 1K9TA 4ZK8A 3SBQA 1N5YL 1SF3A 5LB1A 1UQSB 3NQKA 3MGTB 1ONQB 2RD0A 2WSPA 2DKUA 1HS6A 1NCTA 1PL3A 2GSIB 3FTWA 2KDGA 3LAFA 4NBZB 4F5CA 4KY1L 5HDBF 4QXTA 4CGTA 1XGRB 2DWDB 1TT6A 2FYVA 4H8HA 3WOVA 2EXSA 1KUMA 1KJMB 1A0QL 3KYOA 3MX0A 1LO4L 3UBFA 5FGBC 1M53A 1NCAH 3ULSA 5L2KD 4JGMA 2XN9E 4UINL 1CLOH 1A6WL 4N5EC 1SMDA 3BHBA 2AMUA 2CK0H 3VXRB 2OR9L 3VFNA 2QVIA 1X4ZA 4FNLH 4L8DA 5IB2B 1NCCL 5I26A 2Q2EB 1YEGH 2DTML 4APQA 1GJIA 2WXOA 9PCYA 2MHAB 1NM9A 1GS7A 1XGUA 3CSYA 3QUKA 4NQEE 2NDFA 3CFDB 1DQDH 3QPQD 3GC3A 1V7NL 3UJIL 3VXUE 1N18A 1CFTB 3HN8A 5FUOH 1C7SA 2V3DA 1O5DT 1YEKL 1GY2A 1XAUA 3EYVB 3N44F 1J8RA 1XXDC 3E80A 3ETBF 1XR9B 3HI1B 3ZN6A 4PJ9C 1N67A 2AVGA 2F9BT 4K3JH 4PWFA 4D7BA 2KHAA 3P4NA 4WGVB 3S34L 1MHPH 4HFUL 1JF1B 3H56A 3N3EA 5B22A 3VVWA 3EJZC 5AZEL 4PAZA 2FR4A 3QDJA 1JPST 1IEBB 5MI0B 4FG2A 3V0HA 3C60B 2E7BA 3UABA 3ZDZF 3EOTL 4KO9A 4NKMB 3RKDD 3LEVL 3DX6A 3OJDB 3KJ6L 1QW8A 2AP2A 3WMPA 1LP9B 1W8OA 2YXWA 3VXMD 3HE7C 4F2EA 4FS0A 3HG4A 4N24A 4ABVA 3TT1H 5D9SA 2LVEA 1KPUB 1XQ4A 3FU7A 4KQ4L 3PWJB 1AKJA 2Y2TA 4JREC 4MBOA 1H8LA 3QUZD 4AV4A 1PBYA 4HOZA 2X1QA 4MAUL 1TJIL 3UG3A 3BOVA 3NFNB 2FX9H 4PJEF 5FO2A 1IGCH 1PG7L 1FJ1B 1K3ZA 2DS4A 5L4IA 2Q6WB 4L3CA 4QRRE 2BS8A 3DPBA 5IGXL 4KK8C 1Z0NA 1TEFA 3G6AB 4JRYE 3MRFA 4MHHG 4UTCA 3TTYA 5FR3A 4MQ7B 3QDGB 4ELKB 4FHBD 3JXAA 1JFHA 1F4HA 4HGKC 2OMTA 2JKWA 5EV7A 4YAQB 4JRFA 1QMUA 1IL1B 1DJGA 1NA8A 1RLWA 4IBYA 2ZP9A 1MDAA 4U1MB 3TT3H 1INDH 1KCLA 4WI8A 3NG5A 3TA3B 4ZOAA 3BGFB 1XD1A 4GW4B 1UD5A 1DN0B 1AVAA 2EXYC 2WM0A 4JAMB 3IETA 3QUYA 1UCBH 3WGUB 2DY2A 3OMZA 3TEYA 2F54D 1UASA 1BDYA 3QXWA 5EWIL 4CN1A 4JFZH 2WQVA 5J57B 3K6NA 2RQEA 2BSTA 3E8UL 5F44A 3LXBA 3EO9L 3NJFA 2ATPA 2NY3D 2VQUA 1TTFA 1E4XI 3CVHH 1YY8B 4YR6A 1F3DH 4F3FA 5DVMA 3UEZA 1FIGL 1I7RB 3GS0A 5EH1A 2GJ6A 3V0DA 2GC4C 3T5WA 4B95C 4CW1B 3L3OB 4O00A 3SBRA 1EEYA 4U1NB 3V0WH 1EJOH 4IEFB 2K9FB 1CFBA 2E47A 2EYTB 4JDTH 3VMNA 3WFEH 1E5ZA 3GSQA 5KOMC 1ECZA 3P40A 2FNWA 3HZYA 3WAKA 5GS2D 3LHPH 4DP0X 1G7JB 2AJXL 2J7LA 3FTXA 3SCMC 3RL1A 4K3JL 2DKMA 3INUH 3WJMA 1DDTA 2R2CA 1A64A 1E5YA 1AP2B 2VE6A 1Q9KB 2BERA 1UB5B 1MIEL 1LP9F 1HH9A 2ZQKA 1AS7A 3JVGA 1A6TB 4YDLC 1CMOA 1A6UL 5LWYL 4F80A 1F4AA 1AKJD 3NCJL 2YFOA 5EFIB 1A9BB 3U6XA 1M7XA 1TJGL 5HHVH 3WFBH 1S7VB 5CZVH 2VM9A 4HOXA 3EJTA 3WY4A 4XHQA 2QLVB 3Q1SL 2FBOJ 3SODB 4TULH 4H7VA 3RWCB 3PP4H 3H9HB 5LAPA 1WUZA 4TL4A 3ZX1A 1WEJH 4L5FE 3UTTB 4OCYH 4ZMXA 5IIEB 2LQRA 5EU4B 5G4MA 1UHVA 4KZEL 4OLZL 1SUJA 5I8CB 3CPLB 3CFCL 1NDMB 4XWOD 2CG9X 2IV8A 3MO1A 5CD5C 4HHWA 3EJQA 4YK4B 2A77L 1FO0L 5AVYB 4WQOA 4OU3A 4Q4IA 4YHPA 1I3GL 2APXA 1WAEA 3C6LB 2BY3A 4J6RL 4BQ6A 4M61A 3QRFM 2OMZB 1PQZB 4QO1A 3G5XA 3BP5B 4OKVB 1KYDA 5FOBA 3VFMA 1FNGA 3QULB 2NXYC 2XWBB 4ZW8A 1JXFA 4LLMB 3H6AA 5AOLA 3SDAC 5CJQH 1HNGA 1LO5B 2HKFH 4P5TA 2YA0A 3MRLB 3RDTB 2WY3B 5ABZA 1B4TA 3BVNB 4J1UB 3SBWA 4JANB 4XCNA 2DQTH 2GCYA 2B1HL 5T3XE 4Y89A 2WBJC 4XR8C 1G9ML 1OF0A 4FFZL 5I2IA 2DBLH 3UEQA 1UA7A 4EN3B 1R0AH 4IIQC 4L1DA 1FGVH 1KGUA 2JB5L 3FTVA 5L9DH 2Q8AH 3SDAD 1T5WA 1FLTX 1FO0B 1ZAGA 4Z7QE 2XX0A 2DQDH 2Q0ZX 4I87A 5L4FA 1IGFH 1U8KB 2BOCB 2FQDA 2PCPA 5I18H 5JYMA 2F8IA 3UROR 3LQAH 4KITB 5LVEA 3AFLA 3KPNB 4Z0BL 5FW8A 1IBBA 4QPEA 5BS0A 5KSVB 1MJUL 5MERA 5J3HD 4GRWB 1TEGA 3GXIA 4FFWD 2OBGA 2KLRA 5L88H 2J12B 2W0FB 2FWLB 2QTVA 5B1AB 1I3RA 3U4KA 5C0AE 3EGSA 4CMHB 3TNMA 4ANKA 4H8QA 2AW2A 1X5ZA 2XFGB 4NFCA 4GI8A 4YDIL 2WQWA 4A7SA 4DEUA 1E8XA 5SWZD 4IJ3C 1XCTB 4WEUD 4X6CA 4YDJA 3VW3H 2VSKB 2AQPA 7PAZA 5F7NC 4XP9H 1JK8A 4JFED 3NEEA 1H9VA 4WCYL 5F1IA 1J9QA 3WENA 2EIKB 4ALAL 2Y06L 2Z3FA 3DHMA 5HP5A 4KOBA 4KTDL 1ADQA 5A16A 2OK0H 1URLA 3IVKB 1IC5H 4M02A 4Y16B 1D5XA 2J6EA 1KTDA 3IDJA 1JOIA 2BC4A 4W4OC 4QRQA 3SKNB 1MG2C 1U93A 4AENB 3D18B 1WT5C 3ARFD 3F7VA 3MVSA 1S5HB 4NZTH 4M6OH 1EZUA 1RH8A 2KQNA 4UT7H 4ORGB 3T77B 3GSWA 5I18L 1YECL 2DJSA 2X2IA 4ZUWA 5D2NB 2FEDC 2GQHA 1S9WA 3BD5A 2W9LA 4TUKH 1II4E 4UTAL 3FU5A 1RP8A 4NQEA 5B3SB 3VRIA 4EI5C 5FYKL 4JFHD 3RVUC 5ICXA 1S78D 8PAZA 1ZD6A 1AZCA 4D0BA 4NENA 5I1AB 4WK2B 3SQBA 1MXDA 2VLMD 3LV3A 1PJWA 2VDLH 4Y2DC 1GTFA 1UZ8B 4HSQA 2GIMA 4F58H 3CVHB 4HISA 1L9RA 2NUPB 1U6AH 1XO8A 3JV5A 4GFTB 2WZ5A 1PZCA 2QT6A 3OKDB 4PIRF 1OM3H 2EILB 1D7FA 3VFGL 5E5MA 1I1AC 5SWSE 2B14A 2Y72A 3MZTA 4TUKL 4YO0B 1HCZA 3ZE0B 1E3ZA 5EMYA 3TCLB 2BW5A 2WBJD 4FKKA 2Y36H 2OZNA 4P3DA 1KT2B 1I8KB 2GBAA 4FQXA 1SJMA 3ARUA 3Q2NA 2P45B 4KJWC 5FM4A 5C0BE 2DMGA 2AQ1A 4KKZA 4FG6C 3TO2B 4P9ML 4LLUA 1V27A 4LIQH 3MRCB 4PV1C 4S1SL 4TSCH 2K1MA 4HYTB 4DERA 5KSBB 5ISZE 3UYPA 4K2UL 3BQUD 5IR1A 4JB9L 5LQBH 4Q9QH 3BKML 4UDTB 3EHBD 3DI3B 3DUHA 2BRRH 3L5WA 5FYJE 4F7MA 2BZDA 2CO6B 3GBNH 1DVTA 2B1AL 2HRLA 4KK9C 3LKSA 1R17A 3UZVA 1KFAL 3Q43A 5F9OH 3QDGD 1A3LL 4N90D 4N28A 3KDMB 3Q9PA 1OAZH 1R3HB 4EI5B 1N19A 1VGEL 4DK6A 2HWZL 5J6GB 1QZ1A 4IU3B 3I9PA 3EOAB 5EU5B 5B8CC 4P46B 4PFEA 2Y6TE 4HETA 1MWAA 1UM5L 3NCXA 1GCFA 3GSVB 2Q8BH 4Q6IC 1NC2D 3JZ7A 1PKQE 2SEBA 2G60L 1RZ8A 3C09B 4GAGH 4UQ2B 3RJOA 1VFBA 2TAAA 3FAXA 3NFSL 3VRJB 4IBVA 2G75B 4XO3A 2AJVL 15C8L 3QNZA 3LKRA 1TJHH 2YSTA 4K7FB 3VXSE 1KEML 3AJ7A 1ROCA 5AOKA 2VLLB 4Z5RA 3DIVA 4AYFA 5GRXG 3KCPB 1X5AA 2BY0A 4J12A 4AZ8A 2E7LA 3DX7A 2O5ZH 3TC9A 5DA0B 2H1PL 4GG6F 1K6QL 2ZCKH 3U36B 4UZUA 1AYOA 4XPAL 4PLOB 4DNLA 3VACA 4IHOB 2MJWA 2XIDA 2C9QA 2NUTB 3UTZB 4A6YH 1U91A 2ZKXA 4OZHB 4P2QE 1VENA 3KYOB 4L9LC 3G6AA 4IDJL 1X7QB 4ZUVA 1BHGA 4MA7H 3B43A 4G82A 2NYZA 3FTYA 3TS8A 1I8AA 2V9UA 3TH3T 1AGFA 3SPVA 1YNLH 5IHLB 4BWUA 1JNHB 1MHCA 3I02B 1FC2D 4BKSC 1RZIB 5EPMA 2P5PA 2HPTA 4CL7A 5J11B 5A2IH 4JY5H 4RAHA 1UJ3C 2EH8H 1IC1A 5FS5A 4PRHE 1U8CB 2B3IA 1Q90A 1YRKA 3EYOB 4TPRH 2CPUA 3Q9QA 4IJTA 5CJBA 3ZL4L 4N4YB 4KI5D 4AE0A 3MLWL 1T1ZA 3X2QB 5DEFA 4EZKA 3WD5L 4FNUA 4OCLC 3ESPA 3DMMC 4MDIB 4QRBA 2NY0D 4IKJA 4RMTA 3B2VL 4OFPA 4FTVD 1KPRA 2OXHA 3D48R 4OZGA 5JPMB 5CZVL 3DV6B 4E9RA 3CDZB 2A0LD 2LAAA 4YR6B 2VC2B 4LVEA 1TLMA 2CJTA 4WU5B 2X2HA 4RMSA 2LTQC 4QXWA 4QRAA 3COOA 3S36L 3LKPA 1YDPB 3V6ZA 1QI4A 1DP0A 1UZGA 1FC1A 1RIHL 1N7MH 1JZHA 2BP0A 2CDEA 5IOKA 2DQCL 4YHZL 3F85A 3FT2A 4KNSA 5BVPH 3WFEL 1G84A 4LHJB 1EFXD 1JMXA 2B16A 5C6TH 4CC4C 1XBRA 1YYMH 4DOHB 4JRXE 2YLHA 3OKLA 3ZHNA 4JJ5A 1VEOA 2P8MB 3QIUC 2ZUXA 1I1AB 1I85A 2QFPA 3ALPA 2ENQA 3ALXA 2AJZB 3V0GA 1A66A 5I73B 3QNXA 4UM8B 4BZ1H 3TH2T 4AKOA 3ROLA 1OGTA 3ARDD 2EXWD 3MPCA 2NCMA 3BFWA 3BGAA 3QXTA 4EAEA 4HEME 3RKDC 3GSOA 2P7TB 1XTMA 3LRLA 4XAWH 3LZNA 3TJHC 3VE0B 2CA3A 3V4PL 2GK0A 3P9LB 5K69A 5GSVB 5EZOH 2X5PA 1LWJA 5IIEA 4OM1H 4PJ8B 4U05A 5C07A 4RFOL 4AW7A 1CDJA 5FB8B 5A2LH 2Q3AA 4MAYD 5AVSB 5AZ2L 3MGOB 4JFDE 4S1QH 3VI4A 4QXUH 3L9BA 2C4XA 1J8KA 2JJVA 1AMXA 3S3DB 1QZNA 2Z35B 2GYSA 1GCYA 4L3ED 1DQJB 4WWID 3FF8A 4HG4K 3U0PA 2OI9B 3R0NA 4JN1L 4FQCL 5FKPA 4KTGA 2EYSA 1AQKH 2O1AA 2RAMA 3FOMA 4GB9A 5HGDB 1HWHB 4Z3JA 1CYGA 4YX2L 1TMQA 1GVIA 4P2RA 4RGOL 2A2QT 5SWQA 4GKSB 4XN4A 4DP7X 2ZNXA 4YN3A 5J9PB 2Y5TB 1MY7A 3Q2WA 4RBPH 4AQAB 1HYSC 5F89A 3FMGL 3UC2A 4CU8A 5JDJA 7FABH 2HFFA 1EZLA 3MUZ1 4PD4J 5IW6B 4OM1L 4K8RC 2FYYB 4QY8A 2EYRA 2E7HA 1IBHA 4NI3A 2HVJB 2Y9RT 1XGPB 1WBYA 5F1KC 1KULA 3BAEH 1DBAH 3MJ8A 4HBCH 1I8IA 4FNLL 4LSRH 4NZRL 1CDHA 3ZMEA 4MJHA 5K9JH 2P5EE 1GA2A 2D3JA 4UQCA 4J3OD 1OT1A 5HDOA 1H5BC 1UWFA 2CWRA 3D4ZA 5IVZA 1AR1B 3NSYA 3RA7L 2VDRB 1QFHA 1CGUA 3QHFL 3IGLA 3WO3B 2DMCA 3PGFL 3VB8A 4PP2A 1H6TA 1CXEA 2A6DB 1QSED 3BRFA 5IHBA 4AGQA 5JZ7C 1Q1JL 4UYQA 1HJCA 1UZ6F 4JREB 2O26U 2YK1H 4JPWH 3DPDA 3BAWA 3K74B 1QSEA 2G3XA 4F9PA 3QHTC 4X5XB 1AHWC 3RWEA 3N40F 3L3HB 1AG6A 1C5DB 3PQYE 6FABH 2AABL 2KLTA 4NIYE 4NWTH 2OSLB 5C07D 4NHCH 2YPLD 2CIKB 5D72H 4ACTA 5F7EL 2WW8A 2V5MA 4JFZL 1R3KB 1IU1A 1EQWA 4G42B 4N9GA 5DQ9A 4JO2L 3SPHA 2ENSA 4R3SA 2R1WA 1OD9A 5AW7B 4F92B 3HE6A 2ED9A 3IDXL 1SRDA 1YCSA 3UIYA 3RJDA 1PLGH 3EHBB 3TIDB 1VZIA 4GY4A 4Y5VC 4QT5B 4XODA 2F5BH 5GRUL 5F88B 3QZPA 1T0OA 4IIQA 3WUWB 2EH8L 2ZG3A 5DZAA 3JTSB 4M7ZB 5IQLA 3FB7A 2FJGA 1LE9B 1FORH 4M1GL 4N1CA 4NGHH 3D09A 2K8QA 4X6DF 5HJBA 3F7RA 4YHYB 1F1AA 4XN8A 4ODXA 4AXWA 5ILTH 5IMMA 3QWOA 3LS5L 4ZSOE 2JXMB 4UNUA 1CFSA 1HL9A 1P7KA 2AEOA 2APBA 3A4FA 4NNYB 1NFDB 5ESQA 3AY4A 1J8SA 4KO5A 1I7UB 4DN4H 2VDMH 2B0SH 3ARFC 3BT2H 3F83A 3AG3B 4HUMB 2CSPA 5F9AC 4HU8A 4AC4A 1UD8A 1YVLA 4OKDA 1F6FB 4Y5YA 2I32A 3KVPA 1UXSA 2BNUB 2VB5A 4KFMA 5IB5A 4NP9A 2XUWA 2YD4A 1OB1B 3UYRL 4A7TA 1IGYB 4FEIA 1ADQL 5TF1L 2XV0A 4N85A 4Z7OE 4NKIH 2R69H 4M62L 3ZY7A 4JY5L 4F2MA 1QRNE 1CXKA 5ERWB 4BBWA 4GXVL 1AIFA 3SGDH 3VXRA 2BZ7A 1Z32X 1E28A 4AL8C 3AGVA 1CL7I 3NA4A 3QFDB 5DS1A 4BGLA 5BJTB 5ID1B 1KGWA 4Z7WB 1JG9A 4FFWC 4ZUTB 3SGJC 2KI6A 1T6WA 3QWQB 5D7KE 5F8RC 1SYVB 3KPLA 1NUNB 4U6XA 5CGTA 2B3RA 3BZEB 1OP3H 3IF1A 3OBAA 2F74B 1MFBH 3N9GL 3EHBC 1A6TA 4D9RD 3AXHA 1UJ3A 3BXNB 1MCQA 1QNIA 2OMNA 4PIBA 1JDDA 3RI5K 1GC1C 2R0WH 1OGAA 2IH8A 1MHEA 3HMWH 4JL1A 5DK3A 5KYWB 1ND0B 1LHZA 4TSBL 3D05A 3AZUA 2FEEI 4PG2C 2C4FU 2UUDK 4GBXD 1X9RA 4ONFL 1BD2A 1QG3A 5CIPB 5TGBA 2PCYA 3FUJA 2WXMA 4JEGB 2VW4A 4GXVH 1DO5A 2C9UA 5FO7A 1FZOA 3T1FA 2FDBP 5ACMA 4JM2D 3MUY1 5DJYB 4XPFL 1KXQA 1CGSL 3UJTH 5AYQA 4DEPB 2P8LA 3MNMA 3IJ9A 5E1GA 5T5NF 4Y4KC 3M7OA 3ZOAA 3CMGA 4UT6L 3RP1A 3MBEB 4B9FA 4I18A 1MAJA 4NUJA 3K8MA 4F33A 2GJPA 2I5YH 2W0PA 5BS0E 3UTSB 1FVEA 3ZLQC 2OMVB 4YSSA 1BZQK 3FTGB 2B15A 3F5WA 1OIOA 3NSXA 1NUFA 4X5LA 1KCWA 3BH4A 3WSQL 4R26L 3SB3A 1KV3A 1REIA 1K5NB 1XGZA 1FL6A 1K8IA 3SY6A 2P24A 3X13A 4C4KO 4D8PB 1ET7A 4IK6A 4HIEB 5HBBA 1EEZB 3MV7D 1A7OH 4U1GC 5I82A 5JXAL 1A65A 2CO6A 1KBGL 1P6WA 4KRLB 3QZOA 1KN4H 1V7MH 4KMQA 3OXRB 1W8EA 4DQOL 1MUJA 4P2CG 2DEWX 3SKMA 2X12A 3O3AA 1G9NL 1GMEA 3TPKA 3CD4A 2BSRA 1F00I 1FHGA 2UWEA 4TQ8A 4LSPH 4AUJA 2ERJC 3IJHB 2XVGA 1J0ZA 2XYCA 3PFQA 3JWNH 3DOSB 1WIOA 4G11A 2X10A 1DBKH 2QDWA 3BPLB 5JUEL 3US9A 1CWVA 3I75B 4DKEL 5KZCD 1BLNA 3KYMB 5IVNA 4K71B 2W0FA 3LXAA 5AD0B 4PB0H 3IYLW 5CZKA 3UIZA 4NPJA 1MN4A 2DDQL 4WFHE 4F7CB 3HPLA 1WWCA 4HS6A 4G7VH 3JV4B 5MP6H 4YE4H 4Z7IA 3MRPB 2CO1A 4L18A 1JGEB 3QJSB 1AO7D 2MPAH 3PF2A 5DQDL 4PJIE 4HGWB 3T6WA 1O6SA 1W80A 3IB4A 3N43F 5J3HC 5C9JB 4PS3A 5F8QC 1ADWA 1RURL 4XCCH 3UJJH 5A1AA 2JI2A 1WS7A 2X6UA 4JM2A 4G5ZL 5J12C 3D85B 4BUQA 3OMAB 4FXTA 4LVNC 4WI4A 2LR4A 4HXAL 3JYBA 3NZUA 2PWGA 2OM5A 4JFOB 4Y9GA 3TA4D 1B0GA 1HXYB 3T77A 3L9YA 5JR1L 1U8IB 3O4LE 4P49A 1S9WB 2F54B 2GSMB 1S8DB 5CP7B 3UPCA 1CU4H 3C2AH 3EDDA 5HYQB 3OZKA 4UV4H 2JJSC 2ICCA 1SM3L 4NQVB 1T0NA 2AJ3B 4C4BA 1L7TH 2NY3B 3CWGA 1PIFA 4OV6F 1T2QL 5I76B 2B2XH 1FYTA 3D06A 4KXZH 3BIBX 4QD2E 1NBVL 5JO5A 3SKJL 4EEEA 4N0YL 3FO9B 1D6EA 3H9SB 1KN2L 1RFDH 2Y2WA 2VLKD 3FNKA 1BYOA 2W65B 3RGBA 1A6AB 2Z64C 4MNGB 2DQFA 4OQTL 2OYMA 4ODTL 5IFAH 1UOLA 4YX2H 1CURA 1NCGA 2DWTA 5CN3A 2VLJE 3CPLA 2W38A 3ARTA 5BRZA 4JVPA 4PTTA 3PWPA 1IT9H 1OCRB 3ZQWA 3TA3C 3VI3E 1E2WA 1MFCH 2AQSA 2YQBA 4FQXB 4H5SA 5HHPB 2BSED 1BOGA 5E0QA 4RMQA 4FDWA 1N5AA 3VD7A 3QRGH 3ZE2B 4XAKE 4FYRA 4M7LT 3MBWA 3QXDB 2IG2L 4UQIM 1R3IL 1NCBH 1C16B 2H0EA 2WKOF 3Q5TA 4G8IA 4JM0A 1M9WA 5I5RA 9CGTA 1QLEB 2EDYA 2FZ3B 4J3OF 3SD5A 1MLCB 5D1ZC 3EZ8A 3U1SL 5GGVL 4GEIA 1PEWA 3NP3A 5J5EA 3LYRA 4H8UA 1MSPA 4Q89A 1JGVH 5DHVA 2YS4A 3MJGX 5LGYA 3ECQA 4LAQH 1XB8A 2P46B 2P5WD 3MFFA 3NIFF 1BMZA 4H0IA 1IKFH 1KGXA 3B2UD 1DLHA 2KUTA 2ZUTA 4BSWA 3D0VB 1P7QD 1I8LC 1P69B 3HEIB 3QZWA 2OCCB 3NN8B 3VYPA 2PTTB 2CD0A 4Z3EA 2BDNH 5MENA 2EC9U 4RIRB 4ALAC 2AJYL 5I6XC 2IH1A 4G9FD 1NLBL 5ITFB 4YBLC 1R5VA 3IPFA 5E8EB 3I2CH 3TVMD 1DEDA 3SYCA 4ZJ9A 2XTJC 2DYRB 1U3HB 4PP1D 4LCVA 1HJBC 3QUXD 5EUKA 5GRWA 3O6KH 1R9FA 4Y19D 1Q4NX 5C0RH 3KW8A 1W15A 2W95A 1L3WA 5KS9B 4JUTA 5CU5A 2EP6A 2F61A 3N41F 4K7PL 3WL9B 2LFEA 2Y5QA 5EG6C 2DWEB 2I07B 3VD9A 4PBXA 4WHTB 3QEUA 3VWKC 2WVVB 1IM3D 3FCTB 4FGMA 4UBDC 4NZ8A 1INQB 1VEMA 2DW5A 3DUUB 4HCIA 4Y4HC 1IBDA 4ZUSA 4HJ1A 2WANA 4I48B 3BN9D 4R9HA 4LHUB 1M2OA 5BPPA 1G7PA 4XXDB 1CICC 2PWEA 3WNMA 3K4AA 1ORSB 3BQUC 4NQCB 2NR6D 2E9WA 5EU6E 1DQQB 1NGQH 4HKJA 4RNRB 1KNOB 3APCA 3OSVA 4L2YA 5KBLA 3ARDC 3PV6B 5C86A 3I50H 4NYLB 4WO4A 2NR6A 3WIIL 1AOZA 1UEMA 3BIKA 3BPOC 3FKUS 2YMXL 5IT2L 4NXKA 1HOCB 3BWUF 4KO7A 3FRUB 3OF6A 3PABA 4OI9A 4WO4D 1ZT1A 5D7SL 2Y7MA 4XVTL 4A55A 5LGJA 1HNYA 3MUJA 2VDQH 1P1ZA 3IPEA 2O6FA 1QPXA 2FB4H 4YXHL 2OI9C 4PP1C 3KLLA 2FX7L 3I9IA 3NJVA 5AYTA 3IJSA 1G1CA 3DOHA 4U3XA 5KJ4A 4YMPA 4GBXB 4L0PB 5INCA 3UBXG 4XMLL 1SFDA 2B9BA 1AR1D 4AVIA 4JDZB 3WGVB 2J4WH 3DIFB 3TBSB 4F7PB 1MVUA 3FS9A 4LCYA 5CP3H 4RDQG 4NWTL 4QLWA 4DPCX 2DIAA 4BXVA 5GXBB 4HUVA 3D69A 3V4PA 2XVKA 1AGEA 1XH2A 5FM8A 3NCMA 3UP6A 1EO5A 3HAEH 3QPXL 2IAND 1WA2X 2EIEA 3BZFB 5FYJH 4HH9B 5IKCA 4BFIB 1YJDL 5HHNA 2ZONA 1PLCA 5AOZA 1I8LA 1X6LA 1SJEA 1UOWA 3DRQB 5KYNA 3TZVC 3K6DA 4IK7A 5TE4L 3Q6GH 1NMAL 1QSFD 5CR8A 1QHPA 4X6FB 5GGSB 2FEEL 3QZBA 4EDXA 1UB6A 5SX4I 4Y2DB 3MBXH 5I1DA 3V9FA 3WXWL 5GGTL 3GJFH 4PRPD 2Y25A 2H5UA 1QSFA 4FADA 4EKJA 2FT8A 3KPRA 5E2VL 3G5WA 1RZKC 7CGTA 4RSVA 2WINA 3ARWA 3C5ZB 3QJQB 1KCKA 4L3FA 5JZ7D 1LLAA 1IE5A 2JFCA 2XY1A 4N8CL 3R8QA 1HE7A 1QR4A 4RWYL 1QWNA 3GKWL 4F93B 1J86A 4PTUA 1GKOA 3B9AA 3MLXH 1M1SA 4HD9A 5DJDA 4HOWA 2H9GA 4Y4HD 2PTUA 1EJFA 1S7RA 4HH8A 2DAVA 2OW7A 3JV6A 5IB2A 3TA3D 2IPKB 1HQRB 3AQDA 1FE8H 5LAXB 1CFSB 2PP8A 4PGBA 1UQSA 3U79A 4WI5A 1WAAF 3S5LG 4H8WH 4LIQL 4S1SH 2ZYSA 2HN7B 2XBTA 3Q3GA 2OTWB 1BYPA 3A4AA 2CDFB 2ZWYA 3P02A 5LUMA 5BOZG 2BVOA 2DWDA 4K55A 4JDVA 1J0JA 1ZVYA 1J5HA 1ZOXA 3D2UB 3CZJA 3MRLA 3J07A 1PKQA 1MFCL 5AAWC 1YLBB 1AD0A 3LQMA 4HT1L 4WI3A 1UXWA 5HHOD 3QUGA 3FFOA 1JHKL 4KKAC 3HNSL 3ML9A 3C5JA 1NMCB 5A2AA 5KOVC 4XN5A 1HTYA 2R15A 4U31A 4EQ2A 5B38G 2WIIB 1WSST 3SYAA 4PRHB 12E8L 5AZ2H 2FR4B 1ZLVK 4MMYA 4BZ2H 4G80A 3GSUB 3VFWA 1ZS8B 2ZX6A 4D9RE 1ETA1 2CCLA 2FGWH 3GSRA 2MQGA 3FSZA 1NIEA 4FJYA 3GBML 3TBCA 3V4VB 1CFTA 2K7QA 2WLZA 2R4SL 2UX7A 4HZAA 4X98A 3HVDA 4UIMB 4AJVA 3W5MA 1A6ZB 3S36H 5FYKH 4I5BA 3ME0A 3R1GL 4NNXA 2ETWA 2DB8A 1MFAL 2RMNA 2ZCHH 5DXWA 1VFMA 3HZKA 3FTSA 4G6KH 2B1OA 4FHKA 1G1OA 4PR5B 1DL7H 4WTZG 2IH3B 2IQ9H 2Q86A 3FQYA 1IGIH 3IGKA 2RB8A 4LPWA 2AAVA 1ZWIA 3AABA 3FHEA 4Z7VF 4DK3A 1F41A 3K71A 4R8WH 2F58H 2G0KA 1I3VA 5BVPL 2UXTA 5KSAC 3CMOL 3IDYC 3L2NA 2E7CA 3DBSA 5E08H 4DT2A 4PW4A 4C55A 4YSEA 3W37A 2PXYA 3G5VA 3VXUA 1YYLH 2PR4L 4R0LC 3W39A 1DVXA 3VFRB 3A6CL 4KU1A 5ESAB 4OZFB 5HGHA 3BUDA 2BY1A 2HKAA 5KYYA 4ADJA 1N59A 1QO3B 4XXCA 3CH1A 3CX5K 1FHNA 1FUNA 1AGDB 3F5WB 2FJSA 4HWZB 5EO9B 3NSFA 4JJ5B 1PEZA 1XL6A 1Y0LA 3D4CA 2EABA 1KGIA 3ABLB 3U30B 1BW8A 3NEOA 1DLFH 5A7EA 1HNFA 4NZUL 2GITA 1BAFH 2Z7WA 6PAZA 3HOGA 3Q2VA 1UFGA 4JFQB 1EEZA 3MLZH 2JWYA 2BSTB 1UKQA 1PG7X 3L95B 1CF1A 2I26N 4FQIL 4I13B 2O93L 3KPPB 4FI7A 5LO7A 1Q0XH 1NH6A 4MHHI 4CILA 3D0AA 3V6FB 4I1RA 4HHAB 3ERXA 2DPKA 3ZHFA 3S3CB 1KN4L 4HV8B 4GMTL 4MNQD 1CXFA 2FHFA 1J11A 5IFJA 5HYIA 4TMPA 5EIIB 1OTTD 2F7PA 3ULUD 4AENA 3O4OB 1FCCA 3HCVB 5D4JA 5AKTA 5L7XH 4N6RA 3PWPB 1XGUB 3CSYB 3ARBD 1HL8A 1CT8A 1YJDC 5FW7A 1QUNA 3HVNA 1UB5A 3IGAA 3U1PA 5A2JH 5IHWA 4PRNA 1MFBL 5EZJB 3AGWA 3FH5A 5TJWK 3H7BB 2FBJL 3GBNL 4A7UA 2NY2D 5D6DC 4V1DA 1KJMA 3FT9A 5H37G 3KPQB 3X3GH 2XXMB 2VL5B 3VWJC 3G9VA 3CQFA 2DQEL 3P77A 5CSBA 3ET9F 2JJWA 4V1DD 4DJMA 1RUKL 5I1GH 3UACA 2VQTA 4PS4L 4DP6X 3AMLA 3T0XA 2EEBA 1F11A 5D2NE 1Y6MR 2GVYA 4OF6A 5C09E 1EEUA 3H9HA 1AP2A 1IB5A 3GI9L 3Q13A 4OI8A 4LSDA 2HKFL 1HT6A 3QDAA 1GOFA 2J6EL 3B7YA 4YO0A 4NQCD 2QTEA 4D9LH 4YSUA 1BQKA 3EW3B 2DWYA 3EYFA 2EVHA 3STLB 3PCYA 1FFOA 4KKLD 3ASNB 1K8DA 2EDNA 5T1KA 4P04A 2V8MA 3IKCA 3P0YL 1WC7A 1E90A 2X1OA 4K3GA 4MD4A 4XOAA 3GGWA 1ZT4B 3CVHA 3VQMA 3DC0A 5JQ6L 1JF6A 2PABA 3BEVB 1K6QH 1PYWA 2ZCKL 2Z31A 1HSBA 2YN3A 4P0DA 2Y7QA 4OCSL 3WIFB 3QJOA 2G3NA 2DJ4A 4P8QA 5LDSA 3HPJA 3D4GA 4JQIH 2QPDB 1DUYA 3X12A 1T7YA 5KVEE 5CLWA 2YD2A 5GPRA 4YHLL 3KLDA 2AEPH 1FNAA 4LRNL 1N8OE 4ZMQA 3RGVC 4UM9A 2LTQB 4P23A 3L3KB 1I9RL 1PFOA 2XSKA 1KGCE 3CCHB 4N0CD 3C5SA 1AIZA 4XZUA 1VKXA 3C8HA 2FWOA 3KWVA 4LPUA 4J28A 4ONFH 5JQ6H 2QPEB 3UYOD 1NC4D 2BO0A 4BQ9A 2WXPA 4PJXA 4KH2A 1E5BA 3LDBB 3H0TB 4PRPB 5TF0A 1HYSD 1JVLA 2COQA 4EBQH 4H5SB 4YVNA 3QR1A 3IEAA 1NGZB 3AS2A 4YHMH 3KPNA 1RZ8B 2XKUA 1QFPA 4Y5VA 3OKEA 4AVKA 5AENA 3ULUE 3DGGB 1DN0A 4O51B 1MCKA 4P5RA 2PF6A 3BKMH 3C60D 2UV3A 1SHMA 4XP9L 3ARGC 1G6RB 2Y0SA 3FK3A 2R0ZH 1HESA 1R75A 4L48A 5ELIA 4OLWH 5LGKA 1AO7A 3IMBA 1EPFA 3TV3H 4EN3A 2F7QA 3CV5A 1EK3A 3NCWA 4LRIA 3UCQA 2ZXQA 2OCJA 5BZZA 1ZSHA 2WC7A 5CZXC 1PSKH 5ALBL 1IRAY 3MLVH 4NI6A 4HC1H 3O6ML 5F1IB 1P1VA 5I1JH 2WKGA 3V0VA 2ESVB 2ZOLA 4HJSA 3CVHL 2YJQA 3U48A 4FL4C 2C1OB 3WKML 2EYTA 2VWEC 4QF1A 1LP9A 2BIOA 1IGFL 1XF4B 4JRXA 5CZRA 3QP3A 5FFGA 1TQUA 1LDPH 3HZYB 1R5VB 1YEFH 3QJHB 4Q2ZB 1Z5HA 3CFMA 4AL8L 2NY3C 5T1KD 1DYZA 4G6ML 1KOAA 5K39A 1F6AA 4DAGL 2EXWC 4KDWA 1XD0A 1N2RA 2YEVB 3GO1L 5DTFA 5CBAB 5EUKB 1QWUA 2VMJA 4A38A 3QSKB 4U3CA 4TUOA 4X6FA 2IAMD 3QISA 4YBHA 1OB1A 2EACA 3EJYC 4XC1L 5DS8B 4HCRH 4A2EA 3HI1A 2HFGH 2YAHA 1XGQB 4O2FA 2XG5A 2VLKA 4E9SA 3OLGA 3D87B 1FORL 4M1GH 2KERA 3PQYD 2NUPA 1T3FB 2C9SA 2E6PA 2ZXDA 1CD1B 3EGDA 3SOTA 5BMFL 5DDHA 5TQ2H 3DK0A 3VWJB 3M8OH 1WWAX 2PWDA 3B2MA 2DI7A 1DBJH 2R23B 3SDCA 3HC2A 3H9YA 4QCIB 3MACL 1E8ZA 3FU9A 3VD3A 1A9EB 1MJ8L 1KNOA 2GJZA 3ARED 4PJ5E 1NAML 3KPSD 1D5ZA 2EIDA 1NGWB 1KC5H 5ECJE 2F19H 3O45B 3P0GB 1E6OH 2JI1A 3OLEA 3KXFB 4JFDA 1JF5A 5C08A 3VI4E 1A1MA 5J06A 5FYLE 5JW4Q 3KR3L 1N6QL 1FFNA 5DJXA 1PF3A 2GSIA 4N3UA 4E9LA 2OJZH 1OAUL 1RUAH 2X6CA 3CLEH 2X4SB 3F6LA 4NKDA 5HD8C 2WKOA 2AQQA 2BVPA 4J6RH 3HHSA 4UDTA 1CF8L 3ZZLA 3BUIA 5F7BA 3HNSH 3DURA 4IS6A 4XBEL 3BGFC 4IQHA 1QEWA 1KXHA 1PNCA 4MNGA 3L9RB 4KKQA 2Z91B 4UQDA 5JW4R 3ULUL 3HG5A 4OCNC 4OD3L 1TVHB 2D7QA 4LPVA 2M26A 1S2EA 1G7LB 2XBZA 3IXTA 4BSVA 3FQ1A 3GZOA 3LHPL 3LHAA 1MZYA 5JIKA 5DC2A 1EGJA 4WW1B 3TFKC 3F01A 2P8MA 1BX2A 4R97C 2JQZA 4V1DE 5A7BA 5KANG 1OAQH 4HALA 5F7DB 5K9JL 5MERB 3DRQA 3TN0B 5BV7B 1RXLA 1ZK5A 2F1EA 1CF8H 4HJTA 1DQDL 3VXQA 1EBPA 1GR7A 1WE5A 1OSPL 4I5BB 4X9BA 1FVDA 3AREC 4HAKA 3O2DH 1XR9A 1AQHA 2IBBA 4G2AA 2ALAA 5I71C 3FUDA 3P4NB 4EKXA 3JVFC 3PUUA 1DUZB 1RU9H 4AEIL 1XMWA 3H42L 2X1XR 1I7RA 3ATFA 4MCZB 4B27A 3LEYL 3D0VA 1GZPA 5I1HH 4C8XA 4G71B 3FW6A 5A16B 2VKXA 5HI3C 5GJSL 4QRRB 3GNMH 1X5GA 1XGYH 4ODHH 4Y5XA 5D5MA 1XF2B 4G7YL 3Q1EA 2NNRA 3R7RA 3JZYA 1XIWD 1TZIB 3N41B 3EKCA 3N44B 4OZFG 2DQHH 3DOSA 3D39E 3WKQA 3CN1A 5CO1A 3GM0A 5KVGL 4PJEA 4N9GB 3RE0A 5IROD 4OAWB 1XIWA 2Z4QB 5IB4A 1LXMA 1JZGA 1H3WM 5AVZB 2XY2A 3LPOA 1F3RB 3EJJX 3NDYE 5FO8B 5CEZL 3GBLA 5IGXH 3JWOC 1RQ5A 4LPTA 4U0QB 3VXNA 4CUCA 2R29A 4TNFA 3V4LA 4POZD 4M6MH 2C26A 4QRPB 3QCUH 2UZPA 4YQXH 3W3BA 4YGAB 5D2LA 1RIHH 2QSCH 1LO5A 4HS8H 2YQGA 1LE5A 1KTKE 3MI6A 2N0KA 5B8CB 1AGCA 4ZUSB 5GGRA 1TNMA 1TZGL 2ZUQB 3EFFA 5JHDE 4BDVA 3QO1B 1JNJA 1MW3A 3ZK0A 1RZFH 4DP4X 2Q5BA 3VFWB 3GMNA 3WE6B 2NXZC 4WI2A 1BXVA 4I2XB 5E1AA 4S1RL 5TE4H 4HULB 3H85A 2QGEA 1I82A 3NSCA 3CZNA 3PXJA 4RFEA 5C0FB 5EIIA 3T0VA 5I1JL 4L9LA 4FNQA 3WLWD 3X3FL 4JFEB 2EIMB 2ITDB 1LEGA 4G8GE 3K4DA 1M6UA 2PWHA 1Z9OA 2DLIA 4OGQC 2BJMH 2YEZB 1NM4A 2X6MA 1KXVA 4MMXA 4YHIB 4J8QA 4OCSH 5I1KL 2FBRA 4HWUA 5DF0A 4FTDA 4Z6AT 4YWGL 1GW0A 5CINL 4BHUA 1NKRA 2AZAA 2DQGH 4BZ2A 4JDZA 3GZKA 1Z9SB 2NY1B 4EBQL 5D4IA 2XFXB 1Q72H 1AZVA 3TF4A 4NHUB 4PJ5B 4U3SA 1F4WH 4X4YB 3QXAA 2O72A 3D5OF 1SYVA 3KPLB 3L3JB 5C7XH 1JGUL 5CXPA 3QUZC 3D2TA 4KXDA 1CE1H 4KX7A 2CK0L 4E42B 3ULVC 5C0CD 3L3DB 2L04A 4TVPD 2G5BA 4NUPA 4QGYA 2E8ZA 1QLFB 1OAXL 1HCVA 2VDKB 2Y5EA 4YHOH 2VLJA 3W57A 4DGUA 1PZBA 3LH2L 1GH7A 3QEQE 4ATTA 5LXGH 2QGCA 3CC5B 4YLBA 2VDRH 2ARWA 3B5GA 1QI3A 2H6UA 4AITA 5HD8D 4U1IB 1XCTA 1DDHB 3D3VE 3JWOH 2YKLL 4WK0B 2ZJSH 2NDGA 3OKDA 5LBGA 4GW5B 1CGXA 4NAQA 2NUTA 3UTZA 1IEAB 2BFVH 2IIJA 2D31A 1T2XA 4MD5B 4JZJA 4I1NB 4HF5H 1P9MC 4XNZB 4IRSA 5I1IL 2ED8A 1QAWA 3BAKA 1S7WA 3KR3H 1KB9J 1Q9KA 3QVAA 5AUMA 5IFJB 5G4NA 3FB8A 1KB5H 4Q9QL 5FCSH 4MZ2A 1JPSL 4J3XA 1H5BB 3BSHA 4LGSB 1NMBL 1EZSA 1RIUH 3TLRA 5IB1B 2BNUA 3BKCH 3DMMB 1U3HA 2VZUA 3X13B 4FJ6A 1GYUA 4JJHA 4O02H 4IHOA 4PRPE 5FK9A 3QUXA 2A9NL 4M7JH 3WV0A 2Y07H 4TVPE 3WMQA 1DSFH 3DO7A 3LS4L 4LSVL 1G4RA 1DJYA 4LEOB 4RMUA 3PAZA 1GJWA 2ZAHA 5AKSA 4OD3H 4BE5A 3T0WA 1DBJL 3SQBB 3V5KA 3FH7A 1J12A 2BNRB 3LTVA 4L1TA 1MHEB 5F1OB 1X5MA 2FHCA 2NYYD 5IZ7A 5JPMA 1M6OB 2HWZH 1IM3A 5TDNA 1LO2H 4AQ1B 4WO4C 1U4EA 2EKSB 2HUEA 2EE2A 1UC6A 2BINA 2YARA 4HA1A 3DROB 5DZOA 4WI0A 5GSRA 2RH0A 3CDFA 4L4TE 4MVBD 1DCLA 3KWTA 2NPLX 5CAYB 1J1PL 1WAAE 1GZQB 1HX0A 1WHPA 3GI9H 5AVTB 3WHXB 3UZEC 4A7QA 2PWFA 4B50A 2ED7A 4IOSD 2RBLA 1BAWA 1J5OL 3EBGA 3VO0A 2DIEA 3WUZA 1HXMA 3G08A 3SDXB 4X9YA 3MRJB 4CAGA 5K5YA 3RY5A 2VLRD 1JPEA 4ELMF 4OGAD 3K1DA 4ODVH 4HFWA 1IEHA 5E6IC 4G42A 5DQ9B 3EBHA 3OX8B 4NFDA 1QQDA 3QHZH 1EXGA 5CGYC 2D0GA 2A9DA 3APFA 3L1FA 3ZDYE 5EO1A 4F9LA 3DRTA 2BMKB 3LKOB 2Q86B 2DM2A 2P24B 4NZTL 3M88A 1RURH 4OJFH 1IAIM 3BCFA 2L7QA 3TZVD 1N64H 2YPVH 2G2RA 1SXZA 3D34A 1JWUA 2XG5B 1CTMA 1ZLSL 3EH2A 2OR8A 3GMLB 1ODUA 5D1XB 3WLBA 1FP5A 5AWNL 2GTZA 4P2OA 4KTDH 2OK0L 4DVBB 3ZU8A 5JIPA 3REVA 4XPHL 1BVKB 1G9MH 1RSYA 3FUNA 4FFZH 1ASOA 3U6RA 1YQ2A 4Y16D 2WSKA 4P06A 3LH9A 3BUBA 1T22A 4JG0L 1QVOA 5CP7A 3GJFB 5A2KH 3VH8B 5F7LB 1I8MA 2V33A 3MRNA 3QNXB 4UUJA 5D2LE 4FQ2H 1IMHC 5HHMD 3Q01A 5KVFE 5T1LD 5JYLA 1S7QA 2GUYA 5IJKA 3GPSA 1H3UA 5E6YA 2QSVA 4LDCA 5AW6B 4OF8A 4S2SA 5L2KB 2B39A 3LV3B 2BIHA 1WD8A 2R0LH 4L1HA 1YSOA 1SJXA 1OZUA 1NEZG 4JG1L 1NOAA 1EDQA 1NDGB 4L8DB 1IC7L 3WEMA 1A4KA 1PZ5B 3QFJE 4K3DL 4HWBL 2AK4E 1JAEA 3V6FA 1XH0A 4IRZA 1EFXB 2V5SA 4WFGE 4YGVB 1VCBC 2GI7A 3BKYH 2F53E 2GUOB 2ZOLB 4WNJA 3NIFE 3FU8A 4ORGA 4AZUA 1KB5L 4J23A 2EH7L 3JV6B 1QPPA 4YDIH 3EYSH 2ZNWA 3V6OA 3ULVD 4YPGA 4HS6B 4TTGA 2P42B 4OB5H 1LEIA 1BIIB 4MVBC 1PG7W 3FFDA 1P4BH 4NP4H 4KAQH 2HTKC 3ARDB 4X6BA 4PJ8C 5H35B 1ZIBA 4JN2A 4M6NH 2O6DA 5KSBA 1FO0H 4BFOA 3ILQD 4X5RA 1NBZB 1MAKA 2GY5A 1TCRA 2XN2A 2C9PA 3II2A 3CSTA 2N7AA 1DVSA 1WGVA 4LSSH 4ZTPH 4FXKA 5HPMA 4GSDH 1M71A 3HBPA 2NY2C 3OKKB 4PGEB 4NZJA 3EFDH 1C9SA 4RZKA 2P8PB 2A83A 2JIXB 3QUYD 3AADB 1BLIA 2F54A 4WKZA 2B77A 2X42A 1CBVL 2FBJH 3FSWA 2A6KA 4RZCA 2BW4A 3GXDA 3WLWC 3KZ8A 3VMOA 1W91A 5DK2A 1E9OA 4YDVA 1U8QA 2G75A 4M61B 3IKCB 5JHLH 4HIXH 1RZ7L 5IQNA 2G30A 4WFGD 3LD8C 3D3VA 4CVWA 3FO2B 3FO1A 2HJLB 1CB4A 4MLIA 1HSBB 1MF2H 3VH8G 3PHSA 4XPTL 1SYSB 2AF2A 5ICZB 2QVFB 3QIBC 1ITCA 4AIZB 3EGXB 3H9SD 3Q8FA 3T8VA 3N91A 4YAQA 3PHQB 5EBGA 4NBYB 2H0JA 4FXKC 4KI5F 1IGMH 1FZJA 2OZ4A 1KBVA 2EE6A 3B56A 3ILQC 1AR1C 1F3JB 3HMWL 5KBNC 4IGBA 3VG9B 2YAEA 3ENEA 5CMAB 5B38A 2WMPA 1TQBC 2Z91A 4TULL 3RUGF 4BEIA 2ZAGA 1L0QA 3NN8A 3CHRA 3HKZA 1N5AB 2GTWB 2HTKD 4X6CE 1NGQL 1MHCB 3I02A 2WD0A 1Y7VA 5EPMB 1Z3RA 4Z7VB 2ZOUA 1OHZA 4L8BA 1X5FA 1DHKA 2DH2A 2LAGB 3NRQA 5D7JD 3QR0A 3AS3A 5CEZD 2VXUL 3RFZA 35C8L 4QR7A 1BVOA 1BECA 1QI5A 5ILTL 1OARL 3S3BB 3WEXB 1ASPA 2ZXEB 4LCWB 4DEPC 1MLBB 1NOFA 4NC2B 4YK4C 4KJYA 4N2OA 1KEGL 3LKNB 5E6ZA 2VJ0A 4IEFA 1OF2A 1E3FA 3BN9C 5FOJA 4X8GA 4XN1A 3BWZA 4OCWL 2XQBL 2LT9A 3JWNC 5SX5H 1JGDB 3KWWA 4Y1AD 2ZUUA 4PJGE 4A39A 4XP5L 4IRZH 4HH9A 1NIAA 2WYIA 4Z7UE 3QA3B 4GP4B 1QASA 4P23D 5I6LA 4XPBL 3S4SB 5JOEA 4BE6A 2EAEA 4HKBB 2H3NA 4CSZA 1ZANH 5DFAA 3LQZB 5FM5O 4XNUL 4OZ4A 2WB1A 4PY7A 3QI9D 3DKHA 1G9MC 1O7DC 2WJ7A 4KJQD 4OGZA 4Q6IB 4PG2A 2X4OA 1L6PA 4D3CL 5JHDD 4P46C 4NGHL 1XR8A 4LEEA 1OT4A 1J1OL 4L5FL 3WDHA 4LSUH 4BCZA 1MCIA 2A73A 4HZ1A 2HH0L 3B2DC 1YQVL 5BQ7B 1IBGL 3BDYH 2IG2H 1TMCB 2BHYA 2HX8A 4FI8A 2CJSA 3MNWB 2WN3A 4Z7WA 5ITBL 2EZ0C 5BS0D 3VXTA 4E5XG 1AC0A 2D0FA 2LU7A 1YEWA 3EOYG 4Q0XH 3GRGA 3Q6FB 2FIRT 4NCDA 1UM4L 3DSFH 4NQDA 3VA6A 3BT0A 3NTCL 3O4OC 3OPUA 1WBZA 2AQTA 4FQCH 3S5ZA 3TBBA 4UT9H 4OZGF 1IFHH 3C08H 1PGRB 3D39D 2HLFC 3ARBB 5D4HA 2E9IA 3G6JB 3DVFA 3E1F1 4XO9A 4JJOA 3MSPA 2HH0H 4DFIA 3QJXA 2GFBA 3MRRA 5I8KH 4LBEA 4RGND 4R5VA 3HAEA 3T08A 5KJ7E 5KYUA 2H47C 5DT1H 2QHLA 1A4BA 4R2GC 4FAAB 4M8RA 5KAQF 3SDCC 4CW1A 4Q74A 4MJID 3BFOA 3PPEA 4GRMA 2E4TA 3ABKB 5DWUL 3FMGH 2RFXB 4IYKA 5I1DB 5MHSD 5I2IB 3IT8D 7PCYA 3TEZA 2EUVA 3UDWA 4RGNE 3KPRB 4MAZA 3ARFA 4XNYL 3GSOB 5H37A 4Z9KB 2CLRB 4P2QA 2OR9H 2NX5D 4G8GA 5KBMA 2TRHA 1ILSA 2BSBA 4XCFH 1KC5L 2RACA 5HYSA 3HB3D 3GUTB 4L4JA 1A25A 3DX9B 1G7LA 3IXTB 4G6FD 3S34H 1KJ2A 5HSFA 2E56A 4PJ5D 4RIRA 3RRQA 2UWEE 2X9ZA 3SJVA 2MMXA 2BP8A 4N0FB 3I6KA 2R1YB 1XCWA 3WE1A 2MTPA 4QHKJ 1HL5A 1N6QH 4CU6A 4AZ8B 5HHMB 3PIQA 4AH2B 3MV9D 4I2XE 4Z7AA 1NLDH 4LL4A 3U46A 2JQAA 4KK6D 4BYHA 1AY1L 1X5HA 2BVOB 5C09B 5DVLA 3DTXA 1BWMA 1CDUA 1JZFA 1USQA 2N0MA 5EA0L 3MBED 2Z4TA 1WAPA 3ZDXB 4PJBE 4HLEA 3QK0A 3MODL 2N4IA 5GJTL 3DA0A 4NPKA 5CCHE 3OAZK 2ADIA 3LN5A 4G6MH 1QSEB 4Y88A 2FX7H 4PYGA 1YAZA 1NIFA 3QYNA 1DZBA 5DUPH 3KJ4B 4XCYA 2DYPD 4JFWA 2ARJB 4GAYA 4JFVA 1XVSA 4AQ1C 2C9AA 4PUBL 4EZMA 4OFDA 1WIUA 1E6JH 2P47B 1C08B 3NIGB 1WWWX 3FQNA 3M8OL 1R19A 4OAWA 4HCRL 3BSZL 3W5NA 3HC0A 3HUJE 4PJDE 2CBTA 2I25N 3RX9A 1N7ML 1VB9A 3JV0A 1MDTA 1ESOA 2ADGB 3NH7H 3US0A 2WO4A 3MRIB 2C7UB 2IGLA 3F58H 1JSYA 4CADA 1B9KA 2G3ZA 4DKFH 2JVUA 5H94B 1N0LB 2F2HA 3HC4L 3KMDA 4AT6A 3M1BA 3P4MB 4UBDD 5FF6B 1IJNA 1DQIA 1NZRA 2YA2A 1T7VA 3IDIB 4LEBA 3D07A 4WGKA 3AC0A 5GGVY 4HV8A 1ZLDA 1RUML 2C4FT 2ZTBA 1A7PL 3DBXA 3ELAT 3PDGA 4N0UE 4OLUL 3E6FA 4XPAH 1BFVH 2DRUA 3NIFB 5KTEL 4H13C 5HHXL 2IDCA 2JKIS 1A4KB 1CFVH 4N25A 5IHZB 5E2TL 4FTVE 1LDPL 1QPKA 2GAZA 2WXGA 4MNHB 3PWUB 2DLHA 1PTZA 4K7PH 4ENED 5C6WH 4PJCE 3QUYB 3MLVL 3ZL2A 1F4XH 2A6JA 4IOIA 2O5XL 5CUSH 1XHHA 2HFEA 1HIML 3W39B 3TL5A 1BQHB 1JWMB 4OKVA 4ZPVB 2QV2A 3FU6A 5HHNB 1BWWA 3H54A 3ZVVA 5K9KB 2VM3A 5HYJD 3EO1A 4ZX3A 1E67A 1DJXA 4KKPA 2DMBA 2BMKA 3NJIA 1JGEA 1T66D 1S7VA 4XNUH 3ZPDA 1MW0A 4WHCA 2PMZA 2VDNL 3CHXA 3GHBH 3VXUB 2XXFA 1Z9MA 3NP4A 4Z3GA 1YY9C 4DP5X 4NO5B 3JWDH 4F27A 5I73C 1JRHI 4HPHA 1O7DE 2ZUYA 1BOGB 4W1TA 4MAYC 5I5JA 1ZVSA 3M1CA 1C8QA 2MNUA 4BK5A 4MMXC 2V2XB 1ZHBA 3MV9E 3T2QA 4BSVB 1VLXA 3MGOA 1XB6A 3OKOA 4GSDL 5C0AA 1SXBA 5D7IF 2F1AA 4U6XB 1TTUA 1ZEAL 1U3YA 5IF0B 4X4XB 5L8KB 3TNNB 3NBNA 2IVFC 2NTFA 4B5ZA 4KX8A 4MWFA 2FT7A 4U7MA 5IK3A 5IVXE 5HI3D 3RGVD 4BFGA 3U36A 1NLBH 2DMHA 1AXTH 4B3VA 3K6OA 1ZSDA 4BH8B 2UZXB 3KHQA 1BJ8A 3DI2B 1FNHA 3NABL 2DD8H 3B2XA 3FO2A 2X89D 3MDJA 1RZ7H 1KJ2H 3DGDA 3L3OC 2QR0B 4LCCA 4QDGA 5CEYA 4HSCX 4JE0A 2BH0A 5DLMH 4P23B 1X7QA 1NL0L 2UYLA 2YA1A 3SQRA 4GIPD 2O30A 3MRMA 2WZ6A 5I5MA 3CG8A 1WJ3A 2D2CC 2VDNH 3GHBL 1OK8A 3K0YA 4XI5D 4DN4L 3ZMNA 5F1NA 3KPTA 3K6IA 4DGIL 3PRZA 3L08A 1EFXA 3ZZQA 3BAIA 1OAJA 4LU5L 2J5LC 1AQDB 3H0TA 1OGPA 1SF5A 2XWEA 1MFEH 2AI0H 4PHZA 5EORL 1UXMA 1S7WB 1CUOA 1BMWA 3UH8A 2AXFB 2NNCA 3CDGB 2EVGA 3VFMB 3WXVH 1UJ3B 3O41A 3X1FA 1ZEAH 1KJVA 4PV8B 4BIKA 2R69L 4M62H 3ARGB 5C0BD 2EE3A 4YXLL 1HILA 1WC7B 4NO3B 2QBWA 3MLYH 2FZ3A 1A1NA 3OF6D 1E4WL 4HXAH 5AEAA 2B59A 4LOFA 5EF3A 1JE6A 4AKPA 1TQBB 2BHZA 4UILH 5LGHL 3MMEA 4IU3A 3GRWH 1WO2A 2VM4A 4PYHA 4D0DB 4E41E 1ZPLA 1RUMH 4H25A 5FDWA 3MFFB 5IBTL 4FXKB 3SDAB 4XVUD 3D9AH 3VW3L 5BS0B 4P57A 5E6SB 3NFPA 1K8DB 2N59A 1P84K 2UY6B 3IJHA 5HTSA 4O2CA 3FL7A 4YBLB 2F08A 3QEGH 3TNMB 4LLUB 3QQ4B 3VD2A 1J1XL 3LXUX 1UOVA 4NZUH 1UGKA 2AJZA 1LMKA 2FJHB 3T4YA 4ZX5A 1E27A 1SN2A 3P9WB 1VPOH 1EBAA 1UKTA 1TJMA 4FQPA 4HFWB 5EBMB 1ZTXH 4S11A 4XNMA 4B9KC 2I85A 1MREL 5D1ZI 4A67A 3ULVL 4PLKC 2X4OB 3WIAA 2XPZA 4XXWA 1KF9B 1TSHA 4WWKA 3D30A 5I24A 1J0KA 1HXKA 3THMH 1T3FA 4W9EC 1GW6A 3DNKA 5JORB 1FV1B 1BQSA 4J39A 5C9JA 3BI9X 4B96A 4LSQH 3IDNA 4JQVA 3RVVC 2VDLL 1ZVNA 1AS8A 1J1PH 5LCVA 3QJVB 4JFUA 4JL2A 2JJUA 4HIPA 4XVSL 1T1XB 2EIJB 4DKFL 4KKRA 2AXWA 3EAKA 4NNYA 1R5IA 4YSTA 5GGQH 1WT5A 1Y18A 2IGTA 3SDDA 4UOQA 3H55A 4ETQB 5EULV 5E6IA 3PV6A 5IBUG 3T8MA 3N50A 4TM9A 3WELA 1CQYA 5E23A 4G7RB 1K3IA 4F2ME 3U0PB 4HLZH 1IX2A 1OT2A 4AQZA 2TSBA 4QWWD 5DJCB 1U0QA 4BFRA 1TQTA 4KRNA 4XMXA 4AQEA 3QZNA 2F8XC 4R7LA 3O11B 3MRPA 3QR2A 5EU6B 2Z1KA 3L95A 4KPHH 4NM4L 3N85H 3HAEB 5EOCH 1JV2A 4HK0B 3T6VA 2IQAB 1OTUD 2JKTM 4MA8H 3FSVA 3IXAA 4CNIA 5EF0A 2QEJA 2J88H 1I7TA 3RHWK 1BGXH 3LKNA 1P5VA 2RFXA 3CN3A 3PP4L 2X70B 3UGXA 2VH5L 4BFNA 5JPMC 1XF4A 3AU1B 3HN3A 4BV1A 1VZGA 2A9AA 3FQWB 3PAVA 1MH5A 1G7PB 1OGAE 1XH3B 4YHKH 3OQ3B 4K9EL 3ESMA 1LO2L 5EIQA 2VOTA 4LKXB 1U8PB 4BUGA 4FRWA 5EZJA 1NBYB 5DC9B 4PMEA 1DVZA 1DQLH 4XT1C 4NQVA 4NC0B 2XBDA 2FSEA 3GKWH 4K5MA 4PWJA 3C5JB 5LXGL 4Y2DA 1YNKH 2WWMD 1M4KA 1UD3A 3FSAA 3GS7A 4E9YA 2A4CA 1SBSL 1ZT4A 4QAMB 5KUKA 2MQ0A 1ACYL 3R19A 2Z93B 1F2QA 1RULL 3FH8A 3GB7B 4GIOA 1ZS8A 4GQQA 3V0WL 1E4JA 2I9LA 1A7RL 3H2QA 3QDJE 3EYFB 1WUNT 2FQFA 3PWLB 4QCIA 4TF4A 3DTUB 5KN5A 3T0BA 5FIEA 2B20A 5TF1H 5F0JB 4CMMA 1JWSB 4MTMA 4BSJA 2P8PA 4KZ0A 5D93B 4PGJA 2XZAH 3RIAF 2IXQA 4ZUVB 2BFVL 1FAIH 1W16A 4W4OA 1TETH 2IAMC 2LW3A 3OAYH 2NY5C 3DXAA 2DQGL 1IAIH 3MRGA 5DK2B 2HT3C 4MS8D 5D7JA 3V4UH 1A4JB 4I0PB 1DSFL 1U95B 4MB1A 4ABUA 2P43B 3P11L 3R4DA 4FKEA 5E2WL 3KL0A 4GKSA 5EEVA 1CGYA 5J1TC 1CCZA 3DJTA 3ROOB 1QRKA 3BKCL 1E4KC 2VDOH 1Z3GL 2D7TH 4GRMB 2Z34A 4LP8A 3H8NA 4XP6H 5D7LE 2X4TB 2WUBH 3DV6A 2WLJA 3OHMB 4UZSA 4I48A 3VFPB 5SV3A 1HHHB 1ZPUA 2F5BL 2ZOWA 4L4TA 5F3HA 2QPSA 2KPWA 3AT0A 2NTSP 1GHFH 3GK8H 3OLDA 3E8UH 4RRPA 4Z7UF 5B38B 1QABA 4JDEA 5IT2H 1AE6H 1KXVC 4PEEA 5D6DA 2KZBA 2ZXCA 2IMMA 3LH8A 1KDJA 4G9DA 2ZJSL 1BV8A 1XSIA 1S7RB 4ZW5A 1LDSA 3GIZH 4Z7VA 1YEDA 4KKBD 4L8BB 4N2IA 2WAHA 1KTLA 4EUPG 4MASA 1TZ8A 2J5LB 1TFPA 4UB0H 3HCVA 3TP4A 4GG8A 1WFOA 1LTXA 2BJML 2NY0B 3AS0A 4NQQA 1DJWA 1OW0A 1ZRUA 3ALWA 2XIBA 4GUCA 4PP2B 3KXFE 4HMEA 4KROB 2QGDA 3U9PL 2IH3A 2MQ3A 3EO1B 3RX5A 4UU9B 1IQDB 4HHAA 3AMKA 3WJLA 3KDPB 4BFBD 5FYLL 4ACPA 2D7TL 4KMLB 1HSAA 4YFDB 5D5MB 2CNZA 5IEHB 1DJIA 2VMDA 3DIFA 5IJBC 3U4AA 2FX9L 4ZX6A 1P9MA 4C83A 5T3ZE 5CWSB 2V6HA 3N1MC 4ODSH 3BEWA 4AY0A 4AI7A 1WBYB 1SLWA 2R4RH 3WS3A 4HHGA 4JHVA 3GMNB 5DRNB 2EDBA 1FA4A 4NFBA 1F02I 1R6VA 3NIDB 4HQQL 2NLJA 3GXUB 3JTBA 3TONA 1U8NB 4B7IA 2AKRB 3CH1B 5T1LB 4AGPA 5BV7H 1EFQA 1CLYH 4YLCA 1ZLWH 1YEIL 2PYFA 4P59H 1G9NC 4LLVB 2ZX8A 1KYOJ 4JN2B 1XBDA 2QQQA 3VXME 3WFCH 4L05A 4LPYA 3UGEA 3C12A 2R1XA 3VNZA 4FABH 1S3KH 3G5ZA 1JMZA 1ZSDB 3OTTA 3BFQG 3OR7A 4X7SL 1RAMA 4ZS7L 2RA1A 2R51A 4GT7A 3U4EB 2NY1C 1YUHB 3NDZE 1OLLA 4G43B 3UTQA 1M7DA 2XV6B 3IBOA 3SQOL 1DE4B 2CR6A 5IQ9B 2H32A 1EEQA 3PWPD 3WEAA 3W0WB 2P5WE 4F8QA 4FQ1H 1PDKA 1NGWA 3CFTA 3ZXAC 3UTSA 3M17A 3VU1A 3VDBA 3M6DA 1IAIL 4FLSA 3ZHLA 1YN6B 4PJ7B 5LN4A 3S88L 4NSKA 4LNVA 3KE0A 1X9UA 2UZYB 1BZ7A 3K2KA 4H26A 4PJXB 4HUXA 3V79C 3IMSA 1OAYH 1WPCA 1B2WH 1H8OA 4N8VB 3NCYS 4N2CA 5CJXC 2MFNA 2AC0A 3AAZB 4LEOA 2ZUVA 3FB5B 4KUZL 4NM8H 3QJUB 3VA2C 4G6JH 2WINB 1J8HD 2RR3A 3QC5X 2O5YL 2CGYA 4Z78A 3VGDA 3ATDA 3R0MA 1TVBB 2AK4D 2F19L 4W6WB 3LKQA 5LNDA 1L9QA 3C60A 4M93C 3KVQA 4U3SB 3VG9C 4JNXA 3CJJA 4WDIB 4OZHE 3B8YA 4P2QB 4UTAA 4UNVA 3SPJA 1UWEL 3FBQA 1IBZA 4WW1A 1KIPB 1P6AB 1Z0MA 3TCXA 1DN2A 4AK2A 1G5AA 1QRND 5FV2A 2J2ZB 4APQC 4O9HH 1MHHA 4N8VG 3SE8L 4M48H 4FEMA 3NGBB 3VI3A 1BOYA 2GPZA 4A68A 3ZJAA 1ZXQA 5DJZB 5J7CC 3VWKB 1JYWA 4YNYB 1NGXB 3GMRA 4AM0Q 2R83A 2H8PB 1UM6H 4GRLA 5K9QI 2X0VA 5KSBF 5BUAA 4F7EB 1HDMB 4JMNA 4GPVA 3WN5A 1E5CA 2E7DA 5J0BA 3RUGB 4XC3L 2EH7H 3Q8BA 3L17A 3OHXC 4DUWA 1N2RB 1Z1WA 4UF7C 2Z0UA 1W2KT 4DEWA 1CS6A 3PREA 4PI0A 3T1FB 4UINH 5J1AB 4YHNB 3FCSA 4RH4A 1RJZB 3MLRL 2CMRH 1AKPA 3QDGA 2VT0A 4ZFZB 4DAGH 4HWBH 2VN5A 4QMEA 4XXDA 4QF1B 4OVVA 1BQLL 3FO0H 1KB5A 4B9JA 2OSLA 2YWYA 4DP1X 1VRSA 4Y5XC 2GEQA 1CE6A 3QYMA 1DJZA 1MQ8A 2OX5A 2ZKYA 3FN3A 1FVCA 2DLTA 4G1MB 4JFOA 3STBA 4AMKH 1BA9A 2A74A 1UT1A 4N68A 4GRLC 5CHNB 2IAAC 2Q7YA 4JFFE 5FUCE 1N70A 1RERA 1FL3B 2D9CA 4DGYL 1RK0B 2EQDA 2PW2B 1XGQA 2X44D 4O2FB 2B4CH 1V7ML 2NYYC 3K2IA 1B0IA 2DQCH 2VLKB 3NESA 4NO3A 4H1LH 1QFUH 1A02N 4P48A 4FZ8L 4NKOA 4KVPA 2EDEA 4H4NA 4K94H 1OARH 1MCPH 4W9FC 3VFUA 5J13B 2EKSA 1RJLA 2PCXA 2XA8H 3MV9A 2HLFD 4JO1H 2VJXA 4MA7L 2NMSA 2R9HD 3ESNA 3MV7E 1YEFL 4AXWB 3ZKXB 4U1JB 3LXCA 4O58L 4Y1AB 4AEFA 3QZLA 4WFHD 3BVTA 1PZ2A 2A77H 1X7SA 1K2DB 4JLRA 1QSEE 3B2VH 2Q1EA 1WDAA 2DEYX 3UO1H 1KIUB 1N59B 1TVHA 3FQXB 4HX1A 1FNLA 3O6LL 4R4FH 2AAAA 3U6RB 3MA9H 2EADA 1OAXH 3A4EA 1UOKA 4HK3N 4JZOB 3DYPA 1MJ7L 2DL2A 3VJ6A 3PDOB 4BH7A 4P3WA 5JLZA 3SPGA 2VN6A 1OZTG 2R9HC 4LKCA 1NBYA 4NJ9H 4PB9H 1B4RA 5E24E 3KVDD 3PQYB 5ANHA 1FZKA 2ORBH 2FO8A 4XPHH 5DZ9A 4Z7NF 1QLFA 3ZZSA 5KVEH 1XGTA 2R0KH 3ISYA 1F1DA 4N1HB 4ZTOH 2VRKA 1GXEA 5DJ0A 2LE9A 2NSMA 4P07A 3TZVB 3GHEL 3FQ4A 2Q20A 4FHJA 4R83A 1ZLSH 3SO3C 1VGEH 3AT8A 1SHXA 3BGMA 4DGIH 5ETUB 2UWEB 2C34A 3QRBA 3H4HA 2XDHA 4TSAH 1Q9OB 1NC2A 2X4NB 3WYRA 3TX4A 1JL8A 2W0LA 4BINA 3WAJA 4AOFA 1NTDA 2TRYA 2CRMA 3FHQA 5EDXA 5FWRA 5KSUB 1RHFA 4GO6B 5C3IA 3CFCH 3RBGA 3RX8A 2AHIA 2CQVA 1ZIAA 3Q5OA 3LNGA 4ZSOA 3N04A 1A9VA 1MFEL 3Q8EA 3MJ9A 1OCWH 4OF0A 4N2NA 2G9HA 3KD4A 3OR6A 4DZBB 1FVEB 3H7BA 4BQBA 5IB1A 4MSWB 4OZHF 2ZSVB 3MCYA 3IJ7A 3UAJA 3POHA 1CFMA 2EO7A 2IQAA 2FD6L 3QQ9D 4HIEA 3SOBL 4Z3HA 1E3XA 3OMIB 3LSOA 4R90L 4JM2B 3GHEH 2H2SD 3RFRA 2E75C 2QKIC 5I17B 1XDTT 1DVQA 1RCYA 5FO9A 4DPRA 1KLFA 2PYEE 2MRYA 5DEGA 5FAAA 3L9RA 1QSVA 5CZXD 5FUZH 4RWHA 2HTLC 1ETJA 1TVDA 1NFDF 5GGTA 3UO8B 4PJ9B 5EU7E 2XV2A 2FO1A 4OW6A 1FH2A 4GSUA 3CFDA 2HG5B 4JG9A 4HGMA 5GGUA 4DGVH 5H35A 1BQUA 4HWBA 2DM7A 5C6PB 2B08A 4PH8A 4FTVA 4QHMB 3SDXE 3X3FH 3UG5A 2K4WA 2V5TA 4NT6A 4ZQKB 2ICES 2PPAA 3SDXA 1OL0A 3NIGF 2H2PC 1A7PH 2N1TE 1YHPA 1X5JA 1N6VA 4CN6A 3DSNA 5HHVL 4M56A 1YEJH 3UBXI 3D8MA 4E9VA 4LE8A 4P23C 2QMKA 43CAA 1BXAA 4FQ2L 4ZFGL 3DRTB 2I60H 1OM3L 1OLZA 1M7UA 3ZZ1A 2PETA 3FCUB 2FLRT 4AJYV 5D4QA 3E8VA 4BA0A 2V9RA 3IMTA 3NZHH 4M1CD 3ZR6A 5TE6H 3UPRB 5EO0B 3G08B 5C0ND 3W82A 5CCJA 3C09C 1P4LB 4ZFFB 1X7TA 1A6PA 3X14B 1PU0A 3KLAA 3S37X 3ESVF 3FYEB 4BZ2L 3MOBH 4RAVA 4MDJA 3LEVH 3LOWA 4JVUA 5E00B 1GGCH 2WVTA 2WLKA 3QRLA 3TCTA 3A67H 4KI5E 3RVXC 1E4XL 4F57H 2I07A 2Y1VA 3C5ZD 3SGEI 1IGIL 4AIZA 1PLBA 3AM8C 2KC0A 1JGUH 1H3PL 1D9KA 3C6SA 4FLOA 3OB0K 1NPJA 1TTGA 1AZUA 3D0LB 3OJMB 4E0RA 1FGNL 1WZMA 3I3BA 4Z18A 2X4QA 1DLHB 1EVTC 2DL9A 1MVYA 2GTZB 4P2OB 4BSWB 5IMLA 4DQAA 4NQDE 1U9KA 3OMNB 1R33A 2AV1B 2GB2A 1PZUB 5GGRB 2PR4H 1WS8A 3IDNB 2IH1B 4LLQA 3ZIMA 4B9YA 2Y6SD 5EZIH 2P5WB 2CO2A 4NKQB 1H3VA 4RRPM 4JQIA 4WVRA 3KYAA 2Y3AA 4N2MA 4X7TB 2DEXX 4I2XA 4OSUH 5E1AB 3CFJB 5B1CA 3RIFF 4H2CA 1EAPB 4GAJH 5TFSL 2JB6A 1DFXA 2GHWB 4XGZA 2B7DT 3O2VH 3T0AA 3BH9B 1XT5A 3ZKXC 1OPOA 3TNNA 4B0MB 1U8OB 5FA3A 3RB5A 1ACYH 1O7SA 3SZKC 3L5WB 1FNEA 1R24A 3O0RL 2NY1D 3FCTA 3LS4H 4LSVH 5BO1L 1XGRA 5DK0B 2DLFL 3MREA 6TAAA 3W38A 2CLRA 3RWGA 3PHOA 1L0YA 3BPOB 4ANUA