1E9OA

Crystal structure of bovine sod - 1 of 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
ATSAVCVLSGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADSNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oA00
2AF2A 1SXCA 2NNXA 3KM2A 3QQDA 1SPDA 1BA9A 1SRDA 1E9QB 3KBEA 2AQPA 1COBA 1HL4A 2AQQA 3MNDA 2E47A 3HFFA 1CBJA 1IBBA 1MFMA 1Z9PA 3T5WA 1N19A 3PU7A 1E9QA 1IBFA 2AEOA 1YAZA 4A7GF 3S0PA 4BD4A 2WKOF 3LTVA 1PTZA 3QQDB 3K91A 2GBUA 2WWOA 2Z7YA 1PZSA 2VR7A 1SDYA 1IBDA 1SXZA 4BCZA 3RE0A 1JCVA 4N3UA 1IB5A 1TO5A 1E9PA 2R27A 3CQPA 3F7LA 3H2QA 1L3NA 3GTTA 1JK9B 4A7GA 1TO4A 4U4IA 1UXMA 1SXSA 2WWNA 1SOSA 2GBVA 2WZ5A 2C9VA 3HW7A 1BZOA 1F18A 3ECVA 2WZ0A 1XSOA 1SDAB 2AQRA 3CE1A 3GQFA 1P1VA 2LU5A 1JK9A 1AZVA 2AQNA 1S4IA 1F1GA 1E9PB 1OAJA 4N3TA 2ZKYA 4A7UA 4B3EA 2AQTA 1XTLA 5CU9A 2C9SA 3SODB 2ZOWA 5KBLA 2WKOA 1F1AA 1B4LA 3ECWA 3KH3A 1SXBA 4A7QA 1ESOA 1B4TA 1FUNA 2Z7WA 2VR6A 3L9YA 1IBHA 1U3NA 2APSA 3GTVA 3KBFA 3KH4A 1E9OA 4MCMA 3HOGA 1OEZW 1SXAA 2K4WA 2XJLA 3F7KA 2JLPA 3CQQA 1KMGA 4A7VA 1DO5A 1QUPA 2GBTA 3ECUA 4A7SA 3KM1A 5KBKA 1OALA 1DSWA 1YAIA 2AQSA 3MKGA 4MCNA 4L05A 1YSOA 3GZQA 3GZPA 3H2PA 1UXLA 1EQWA 1Q0EA 2XJKA 4OH2A 1SXNA 1E9OB 1RK7A 2C9UA 2WYZA 2Z7ZA 2WZ6A 4OJAA 1XTMA 1Z9NA 3GZOA 2V0AA 2SODB 1EJ8A 1OZUA 1PU0A 4FF9A 2WYTA 3L9EA 2ZKXA 1CB4A 4BCYA 1N18A 1OZTG 2JCWA 4A7TA 2Q2LA 2Z7UA 5KBMA 2ZKWA 2VR8A 2E46A 1F1DA 1HL5A
chains in the Genus database with same CATH superfamily
2Q5BA 1S7QB 1WAAE 3K1DA 3OKNA 3H0TA 3IPFA 2OL3A 4JPKH 3P3TA 4LCWB 2AC0A 1JXFA 3MTXA 4KOBA 3WD5L 3F04A 4PGCA 2M83A 3AAZB 1LD9A 3MLZH 3OJDA 1EEZA 1CYGA 1DN0A 4MRCA 3VACA 2IAMB 1OGPA 3NJIA 3W39B 1M1SA 5SWZD 2EDHA 3BZFA 3MN8A 3K91A 4LVHB 4OZGB 3EAKA 5BOJA 4PJXF 1TEFA 2BSDA 3C12A 1ONQB 3FU3A 2EE6A 2R0LL 4K8RH 1D6EA 4GINA 5I1KH 1Z5LB 3C6LB 1AGBB 1NA8A 3HG1A 3CFDA 4B60A 1JK9B 3PGDB 1ZT4B 5E0QA 4CVZB 5J11C 3VRIB 3VWKB 2BSTB 1S9XA 2EDBA 1EZUA 1EANA 3ZE1B 4PLJC 1F18A 4PWJA 4IKJA 4EIBA 1Z2KA 3ISYA 3BPOB 3QFJD 4IRSD 3ZPDA 3AROA 2O93L 2X4OB 2VISB 2X4UB 2VDQL 1X7QB 3BW9B 3TM6A 3Q2VA 1I85A 1Q1PA 2B4CC 2A6IA 3KNBB 5F7LB 3X1FA 4OJCA 5GRWA 1LO0H 2A74A 4JLRB 5CZXC 4X4YB 3QUYC 5JQ6L 1B0GB 2W8CA 1OK0A 5D2LE 4ZAKB 1S5IH 2OP4L 3FB8A 2ID5A 3QQ3A 1ZTXL 2C3VA 2F5AH 2MSPA 2QR0B 2YXVA 3SBPA 1YMHB 3QCTH 2DMKA 1XL4A 3LPFA 4XODA 4RQQB 5SWZE 5EPMB 3HB3C 4TYUA 3FU8A 2RAMA 5E8DH 2EYTA 1RD6A 3DK2A 5JO5B 3DRQA 2FEJA 3NVQA 2HWZH 3BPLB 2ZWSA 4CU8A 2B3RA 1GJWA 2A7BA 1XT5A 2HKFH 4FGMA 4JO5A 4OI9A 4XMZA 4RBPH 3T6QC 4W81A 2KL6A 3GZKA 3MGOA 5D7SH 3RNKA 2DLEA 2QEJA 2MEJB 4F15C 4RA0C 1WWWX 4HKJB 1F4AA 3VFGL 1EAQA 2BOBB 4ZTEA 3QFJE 3I02B 1QLFA 4FCHA 3S5ZA 5AFAA 5D7JD 4RMVA 2ZWZA 3A21A 4DQOL 1C5DB 2ERJB 1BFSA 3I6LE 1I8KB 2F18A 1NKOA 2UY7A 2B20A 4F33B 3OJVC 5GS1C 2H3XC 1DQDH 2LFEA 3KM2A 1MJ8H 5C0AA 4A67A 3SEPA 4C83B 1D5BB 2JH2A 4IRJA 1YNTA 4DCQB 3CDCA 4HAFA 2IAND 1GMEA 5L2KA 4BQCA 4A6YA 5M7QA 1UA6L 3RUGF 1BIIA 3GXMA 1HEZA 4L4VA 1MIEH 2ITDA 3VFUA 1VGEH 2A6KA 5DK3A 3MLSL 1L7TL 4LNRA 5T1DH 4CVXA 2X3CA 4ISVB 2OMBA 4IRZH 4OQTA 1JHLL 1DDHB 4PJIE 3FBKA 5AYUL 2GHWB 3HC0A 3SJVD 4EE2A 1Q9OB 3WKMH 1EZSA 4P48A 5I1GL 1PMYA 3H1ZA 5I15H 5ESVA 2APTA 3EJQA 2G5BA 3IGUA 5IT2L 1E4JA 3D1MC 3LNDA 4PWFA 4NQDB 1XCXA 2GT9A 5I6XB 4LEEA 3P3SA 1QHQA 1SVBA 2EDTA 2FWOA 4PJ9D 1FVDB 2BY2A 3RVVC 4UIMA 2WXLA 5TDOA 3WN5A 4F37K 3S48A 4FABL 4DESA 5B3SB 4R8WL 1ZHBA 1YY8A 1P6FA 4HHWA 5IJKA 4OZFA 3NIDB 5ELIA 3EYVB 3CLEL 2QELA 3OF6D 4I85A 4PM1A 5EBWB 2VN5A 5CKGA 1FH5L 1WFMA 3KPRD 2BOCB 3MTRA 3ZYJA 1CDIA 3CN3A 4NN5B 4WU7A 1W72H 2CO7A 3QUXC 4E41B 3HUJF 4QYOB 1MY5A 4U0RC 5DYOB 1BF8A 4N0CD 2YFNA 2G4GA 4P07A 3FAXA 1KBGH 3O3BB 2XX1A 4X80L 4K94C 1GYWA 4TULH 1MCQA 3ZTEA 1E8ZA 4BKTC 1GGBH 2BX5A 3W9EB 4OCXH 5IMKA 4A2EA 1FNEA 3O3DA 2GIMA 5EC1A 1ZGLA 1AAJA 1KBKA 4XC3L 3RWEB 3QDGB 4LSSL 5CFHA 3GSVA 2JLPA 4TTDC 5HYIA 1QEXA 1M7IA 2D03L 3V0JA 1HWWA 4MQTB 1BP3B 1QKZH 4FXGA 4PD4K 3IAQA 3GF8A 1E6JH 5INCA 2DF3A 3MR9B 2BW5A 2CQVA 4N2DA 3DYMA 4PGEB 2R8SL 2BS71 4WNQB 1EQWA 4L8BB 4NSKA 2H8PB 2NXYB 2RIKA 4HAKA 3S3PA 3CJJA 1MNUL 4KMLB 3QPXL 1ZANH 1KF9B 4PGDA 4P05A 3C8KB 2QV4A 3KPRE 1NDGA 2CLVA 3U0PB 1OWWA 1X9LA 4M61A 3AS2A 1F2XK 5JHLL 4BH8A 4MSWB 4GUOA 3NACH 5LB1A 4OUUB 4NZTL 3CFKB 5AG8A 1IBZA 3QDJB 4UV4L 4HJTA 1IM9B 1CICA 1XMEB 4F3FA 2J56A 1AXTH 2B5IB 3LS5H 4O02B 4UINL 1OAXH 4K3JL 2VDRB 3V9CA 1EWHA 1PZAA 2D0FA 1A6VH 3RPBA 4J3OC 4KMTH 2TRHA 5GZNA 3T3PF 4FQCL 2QVTA 1RIUH 1TG8A 4YWGL 4UQEA 1UM6H 4ADGA 4N5ED 2HFFB 4CJ1A 5GS0L 3AU0A 2JK5B 3AS0A 4PP2A 1T5WB 2Y7SA 5E94A 2OZ4L 4MMXB 5EH1A 5T33H 1JVKA 3EJJX 1BAFL 2I25N 2XWBA 4AZ8A 4G6FB 4P0DA 3P4OB 3UJIL 3HG1E 5JNYA 1A02N 3FTSA 2B1HH 4HCFA 3GSOA 1QSFA 5AOJA 4BQ6A 3RJQB 3O0RL 4IEFA 5DHDA 3LPOA 3KXFB 1T03H 2YLKA 2Y22A 4DVRL 4ZS7H 4BDVB 2H32B 3MBEC 3SCMA 3AU1B 4WEUD 3GXPA 3MV7B 5ESQA 3VFNB 2APVA 4EDWH 1H5BB 1DYZA 1AACA 3IN0A 1NUNB 1W0VA 4BZYA 4JZJA 3B43A 3TPUA 5F6HI 1G7IB 3VXUA 5C0AD 4OLZH 3QXDA 1AZNA 2PR4L 5I16A 5DCCA 3VFWB 2KS0A 2XQBH 5L2KD 5DJ0A 5AW6B 4Z7QB 2F9BT 4F91B 4E5XB 5J6HB 1UURA 3MMEA 1Y6NR 1A7NL 1LQSR 1MI5B 5LGHL 4YUEL 2F68X 1XH2A 1EHAA 1IEBA 5B4MD 5DEGA 5CP3H 1U8OA 5KVGE 1PSKH 4XZ4A 3CN1A 3MJ8A 5IF0B 4D2NA 2ZAIA 3WOVA 4AQEB 3KDPB 2E9BA 3I9GL 1T6VN 4TSBL 3RY6A 3LEXA 5MHSD 4YSCA 3VTMA 4OD3H 4UCFA 4A7VA 2PW1B 5BQDA 4XWGL 1JZFA 2YSSA 1MFUA 1WWCA 4JRWA 3V8OA 3MCG1 2CM5A 2F1AA 5IB2B 3ROLB 2GJZB 3QQ4B 1F56A 3T1FA 4X7DC 3HS0C 4IOIA 1HHKA 3LNHA 3HNSL 3PHOB 4HUWB 4QXUH 1L6ZA 1U8CB 4BXVA 3GHEH 2BWDA 2C7UB 4NPKA 1HE7A 2WINA 1T7WA 5ECGA 3QWOB 4KGLA 3RDTB 1P5VA 2VZSA 5CSZA 4QRPA 1YC8A 4EQ2A 5C0AE 2TSBA 1L9SA 3FTZA 1U21A 5I1CH 2XG5B 5IQOA 1QEWB 2AJZB 5JR1L 5L2KE 4RZKA 2DQEL 5CNHA 4ELMF 4UNTA 4DGYL 3BD3A 2FGZA 4L4VE 4BH7B 1A4KB 3QQDA 3EOTH 1Z9OA 4FQXC 3VRJA 2DQTL 4YLQT 3WLBB 5BW7A 1EGJL 1VKXA 2AQPA 4LGPB 1R17A 3D2UB 5AL0A 4YGVB 2X7LB 4F8QA 5I1DA 3D6GA 4HIPA 1AHWB 3MA9H 2VNCA 4QXTB 5A6MA 2HLFD 2YUWA 3LZQA 5IHWA 1MAJA 5CR1A 4K07A 1IKNC 1GW0A 5TJWK 5FB8A 4LP8A 5KSVB 4P9ML 4R7DA 2P45B 2VDMH 3FW6A 4Y16B 3HZYA 2XWZA 2E27H 4HQQH 1Q9WA 1FO0B 1LGVA 2B59A 3RWHA 4BGLA 2PO6C 5D71H 2QTEA 1SYVB 3GJFH 4MDIB 2EDFA 3MYZA 3DYPA 1SUHA 1TNMA 4XNYH 1KGWA 3N44B 3RVXD 5FO8A 5ITBH 4YBQD 1FQ9C 4GKNB 3FRUA 3ULVL 2AQRA 4ANUA 1XXDC 5J9PB 4BK4A 5GRXG 2DOCA 4NP4H 1CICD 2MNJB 3BGMA 3BWSA 3KPMA 3QNXA 4KMQA 4UT6A 2OULB 3DOHA 1EVUA 1T0MA 4W6XB 4I18B 4QI3A 1JXDA 1WCBB 3DIFA 3QQNA 3DO7B 1UFUA 3S7GA 3QIWC 2FATL 4X7SH 1H8LA 3UJTH 1LE9B 4HFWB 1QHOA 3UPAA 1TSHA 1VFBA 2X05A 5KVMC 3ULUL 1FAIL 4D0CB 4YPGB 2Q86B 1QI4A 4HK0A 2GFBA 3L5XL 2Y07L 4PCYA 4Z9KB 3QUMH 3DTXA 2J73A 4OD1H 5B21A 3OG4B 2IQ9H 2I85A 3AT9A 2V3DA 3VSQA 4KITB 3BYTA 3QXWA 4Q2ZB 4AT6A 2RTTA 5E4IA 3SCMD 4AQZA 2ADGA 2RMNA 1JV2A 4XC1L 4N8VB 3S37X 5C0CA 4TUJA 2E59A 3S36H 3MUUA 3RI5K 3T0EC 1T04A 1UWGH 3DPBB 2EUZA 3BEWA 5F9AC 3AREC 4I3GA 3CX2A 4QRBA 1G9HA 5CILH 1KXTB 1N0LB 1SFHA 2E9JA 3APCA 1UYWH 3OJ2C 3VXUD 4CGTA 3KPNB 4PLKC 3EYQD 4OZFG 7TAAA 4PGBA 2ZSWB 1D2PA 3QZOA 2JCWA 3K2MC 4KDVA 5ECJE 3QC5X 3D08A 2OL3H 3TJPA 4LSRL 4P2OB 5IMMA 2ENSA 4QNPE 1M2OA 1SXCA 1JHKH 3LZNA 1IKFL 4S0SD 4QRAA 4JY5H 3E3QC 4H20H 1IBGL 2CBTA 3FB5A 4JM2C 5C0DA 1D5IL 2ZONA 3DOIA 3TX4A 1CIUA 1QSFE 1ZA3B 3GEFA 4AENB 1ZVHA 3VXSB 4A7GF 4M8QA 3OR6B 2HT2D 1KB9J 2J1ZA 4FJYA 3BAKA 1WRFA 2LU7A 3GSNL 4MCYA 5KVEL 3NABL 5F93C 4BFGA 4F24A 4F7TA 2JCCF 2P8PA 2IDSA 1CXIA 3TVMA 3FSWA 3NFPB 2WBJA 4LMQI 1VF5C 4B50A 3PDOA 1SN2A 2GVYA 4S1DC 1KTBA 3BD5A 3V0WL 2BNQB 4F8TA 3VXUE 2H45A 1LEKB 3CK0H 4TF4A 1BZOA 3BKYH 3TBCA 1J0IA 4ZX4A 3MRCA 5JZ7D 3RIFK 1CQKA 1S9KC 1LEGA 3V0AC 2AZAA 3M86A 4OZHF 4OAWB 3RY4A 1RUML 3MREA 1TMCB 1FWXA 1AG6A 4PRDA 1MF2L 1NGWA 4UQ9A 1IGFH 4IW4C 2R1YA 4HIHA 4TNWK 4K3HA 4M6OH 5GIRA 1TNNA 1OAZH 1CU4L 4AYFA 1KGIA 3WLWD 1O9WA 4ATTA 4MJ5A 3US1A 1CF8L 4DP7X 1VRSA 4NO0A 4WJ5B 4KZDL 1KCVH 3OKEA 3MLYL 1XGRA 2R1XA 3K2UH 5IBUG 1E4WL 2WM0A 2VQTA 3L45A 3BSZA 2BSSA 3GBNL 3B83A 3I50L 4HXAL 3F8UB 1QW8A 3SOBL 5BXFA 5KYYB 2H2SC 4JFQB 1YZZA 2FAUA 2X4NA 3OAZK 4KX8A 3ALXA 4RDQF 5LN8A 2PP8A 4F8NA 5E6RB 3BZEB 2QPFA 4ALAC 2IH3B 4HZ1A 5DVKA 2OMWA 3BKMH 2R2EB 3M45A 2CCVA 3RVUC 5EBLB 1HWGB 4QRPE 1WA1X 2R29L 3FT4A 1PD6A 2QT6A 3L54A 5CMAA 3OKMB 1KIUA 4JKWA 1INDL 3MBWA 1MSPA 4NGHL 4QCIB 3VWJD 4RAUB 1OZUA 1MRCL 2HJFA 5J6SA 4RWHA 1QFWM 4BCYA 4OSUH 3F7YB 4EBQH 1Y0LA 1PLCA 1THAA 4P4KC 4DFIA 5IV2B 3PYCA 3I3BA 3KYOA 2CO3A 3DUSA 1E5CA 2L7JA 5ALCL 2XXMB 4P5KB 1HXMB 1PZ5B 4G8EA 5EA0H 5ISZD 4GG6B 4ENZA 3KLAB 1Z66A 5DHVA 4V11A 4Y7MA 2NX5A 4OBRA 4GKZA 4ZNEA 1RZ7L 3IJEB 1J48A 2WPGA 1E4XI 1CLYH 4XN8A 2EIJB 3B2VH 3U30C 3MVSA 4RRPA 4OQTH 1HEJC 3N85L 4TQEL 1TF4A 4LGRB 4OZ4A 1QRNB 1YNLH 3BVTA 1ZHNA 3HG0A 2G4EA 4BFIB 3OKOB 3TH4T 4D9RE 2GEQA 3S88H 2B2XL 4JFZL 2R2BB 5C0CD 4F7EB 3DA0A 1P7HL 3MOAL 4NRXB 3VI4B 1KCRL 4N3UA 2NW2A 3TBYA 4OJFL 4URTB 2WLIA 2CCLA 1FLRL 5MENA 1IGIL 1NH6A 1RK1A 5DD6B 5E8NA 1H0DA 1OSPL 5I1JH 3EJRA 4OZFH 5EO0B 1FFOA 1XVSA 5KZCD 1R3JB 1A9EB 4HX1A 5G55A 2I07A 1ZVSA 2A5UA 1AR1B 2BRRH 2CR0A 2BVUA 1OAJA 5L2JB 4YL9A 1O5PA 3H3KA 4P3CL 3B9KB 5EOTA 4UUJB 2UY6A 3MV8A 4U1NB 4B3VA 5CN3A 1U6AL 4BBWA 1PLGL 1YY9D 4QDGA 4GBXB 1B0RB 2FUQA 4PRNA 2EEAA 1EAJA 3VFMB 3D4CA 2V2TA 1OKEA 1OM9A 2V5RA 2VMFA 4ILDA 3CFJB 5D96B 3PDGA 5GRZA 5B3NA 1ESOA 1KFAH 3T3MF 2NCEA 3WTSA 1IC4H 5H94A 5IHUL 3II3A 4YSDA 5C0CE 1FGNL 1TPXC 5T5NG 5DO8A 3RAJH 1AE6H 5AW8B 5BRZB 1S7XB 3GMQB 3QHZH 4BHUI 1RULH 3L7FB 3AY4C 3SKNB 2IIJA 2N7SA 4KX9A 4HZLB 1HQ4A 3D12B 3FQ2A 3NJXA 1P7QB 1SMOA 5FOJA 3DGGA 5LKNA 4FFZL 4JPKL 1U8MB 3WS6C 5H37H 4JQVC 4F2EA 2EIMB 2CUHA 4XN1A 2BM3A 1WIOA 1KIPB 2YXWA 3A0OA 5FKAA 3KR3H 1HDMA 1YA5A 2JKTM 3MRFA 4DSYA 3ML9A 2B39A 5GRVL 3Q2NA 1NCOA 1ORSB 3QEQA 4KI1A 5FGSA 3MRPA 4HH9A 5KBMA 4HPYH 3ILEA 1UZ8A 1OAYL 3RL1B 2DBLL 4N22A 1HE8A 1XZWA 1PX4A 2L8AA 1A66A 5IQ9A 3TJHC 1LDPH 3MLXL 1BM3H 1BGXH 3MI6A 1KTKE 5I1IL 1TU2B 4OBSA 4RAVB 5KVFL 4L48A 2X9XA 2BC4B 4LCWA 4L1BA 4AYSA 1BF5A 4NFBA 4C57C 1LO5A 5LHDA 1AC0A 2DM7A 3Q6FA 1ETZA 2DH2A 3WIFB 3WJJC 2JIXB 3WJLC 2GSMB 1AD9B 2WWOA 4KU1A 2YD8A 2IAMA 3UZQB 4K7FA 5BZWB 1BYPA 5CLTA 1U93B 4M6AA 3W39A 1MCWM 1QSVA 2BVOB 2JKJA 2QKIC 4WHDA 5CM1A 1R0AH 1KJ3L 5BOZG 3NQIA 4OZGA 3EFDH 3VYOA 4KTEH 1LO0L 1TO4A 7CGTA 4P06A 3TBVA 1MH5B 2VXQA 1JF5A 1ONQA 5HHXL 4ES8A 5DJ2B 1LK2B 1KV7A 3W11C 4HULB 5HHPB 3RA7L 3C6LA 2R0ZL 4M7ZB 5AB2A 3L6FA 2XRAH 3HPJB 4XHJC 1JK9A 1PAZA 3FHAA 3NFNA 1YEKH 4HEPG 3GKWH 4WGVB 3RIKA 3TA3C 2QQLH 2CDEB 4HDIA 3UCRA 3VWKA 2HMIC 2BSTA 1RZGB 3QCTL 4NUMA 4Q9QH 3S8FB 5C8JB 3L1GA 3ZRSA 2PLTA 4NQSB 3GBMH 5IOKA 1A3LH 2Y72A 5K59F 2W1NA 2IV9A 3APFA 3MRRB 4P2RD 1EXGA 3KYNB 4FZ8H 4OF7A 2X4OA 2HWZL 3VFPA 2X4UA 4O2CA 1X7QA 3VQMA 5D55A 4AV4A 1ZS2A 3L3JB 3QEUA 3U7YH 4Z3EA 1CTMA 3QJSB 4G9DA 4G7YH 4NWUL 2OSYA 3QJFA 1KEMH 3WFHB 4DO4A 3E1ZA 5I24A 1XSJA 2VDNH 1R9FA 1NBYB 5C0GB 1FL3A 3J27A 5LCVA 3VFOB 2E7DA 1CIDA 3NDZE 4PS8A 2VLKB 5MEND 4RQQA 1DSWA 5EPMA 1EAPB 2CHWA 5JO5A 4E9TA 2ZG2A 3HAEG 1M9SA 4L23A 3BLKA 3MUY1 4QHKI 1NKGA 1S7TA 3DPDA 4EDXA 4YMPA 2V37A 3C5XA 3QI9B 1T66C 1OGAB 1BD2D 2XV3A 1Q94B 3DETD 4AV5A 5GXBB 3UBFA 5DO2C 1MWAL 1F2QA 1LMIA 3MV8D 3A5VA 4HKJA 4LCUA 4OVVA 2BOBA 3WNKA 1VGEL 5B38G 3HVNA 3I02A 3U1SL 2M8XA 2ZX9A 2NX5E 4ZNEE 3OPZL 4G11A 1QTSA 1C5DA 3D07A 1RQ5A 1I8KA 1ZSDA 2EP6A 3HVDA 1JI1A 3IDIB 5JHAA 6PAZA 1XIWD 3N41B 1MQ8A 1VZIA 5TDNA 4C83A 4L9LB 2EVHA 1D5BA 2VLMD 4BQBA 4ZMNA 4DCQA 5IB5B 1MRDL 3DKHA 3DVFA 3RBGA 1X5AA 3HC4L 1SQMA 5MENE 4V1DB 2HT3C 1MREL 3NK3A 4ES9A 4GAFB 4ISVA 5SX4H 1M2VB 1EHLL 4GEJA 4AVIA 3EUDA 2X1QA 3VGHA 1R5VB 1Q9OA 2WQRA 4QXGL 5TE4L 1GGTA 3QCVL 4X9YA 1ACYL 1I3RB 1WPCA 4N2KA 3MV8E 4MVBD 4TV3A 5JIHA 3RVTD 4TULL 3G5XB 3OC5A 1JPSH 1M6OB 4UT6H 3INUH 4OCXL 5CZRA 1AQHA 1PCSA 2FJSA 1FVDA 1O7VA 4EUPB 2EIZA 1ODUA 2Z4QB 2X40A 4Y19B 1ASOA 5GGQH 4NN6C 4Q89A 5EBWA 4NC1E 2JB5H 2GUYA 2BOCA 3IU4H 4WLCA 3P3YA 2YPKA 4MAUL 4R97C 3GIZL 3UX9B 1PD1A 5AVQB 4JQIA 3HI5L 3LNFA 1E6JL 3CVHH 4E41A 2IQAB 5DYOA 4LHJB 1JPGB 5B39B 4XO8A 4NQCB 1CL7H 5HDLA 2IAMD 1MLBB 2A1WH 2OI9B 3KYAA 2MCPH 4IKNA 1Z9LA 3Q8CA 3ZE0F 3VDAA 3GI9H 3ZK0A 2C3HA 2Y7QB 1MHEA 1OW0A 4QMEA 5F0LB 1NCAL 2GHZA 2HT4C 4ZTOH 2ZNXA 4L1LA 4IKLA 2ZJSH 4KXCA 5E6IB 4QAWA 5BV7H 3QDGA 2YGNA 1BW8A 1CT8B 1U0QA 3KPOB 3SKMB 5EU3B 1MHPH 2WB1A 2WLLB 4OLVH 3C6LD 3BT2H 3JV6B 3MKKA 4N9GA 2WO4A 3JVGA 5CXPA 1IFRA 3RFZB 3QEQE 3DRTB 1A6VL 2YGPA 4NHCL 3MR9A 1JGVH 1FG2B 4N1HB 4DAGH 4K7PH 5I30L 4WNQA 4XPTH 4LSDA 4N0UB 4L8BA 3VD1A 4GFTB 2H8PA 3AUWB 5EF0A 1S2EA 3FSAA 2VIRA 1D7FA 2WVVB 2WIMA 4QJ4B 3BKJL 3VJ6B 3C8KA 1ZHLA 3SDCC 3U0PA 4FLHA 4PJ7A 43C9A 5KOVC 4X6CA 4R2GC 1SRDA 4LCWE 1F90L 1KCLA 3CZNA 4MSWA 4G42B 1KPVB 5GRUL 2H0FA 3O6LH 2VMCA 4Y2NA 1ZLWH 3CHPA 4Y5VB 5E24E 3Q8FA 3GRWA 1IM9A 4FS0A 4ZAKD 1D7BA 2GQHA 5KWYC 2Y2YA 4DW2L 3HHSA 2WOBA 2P42B 4P2QA 2DTML 1CR9H 2MOQA 4Z7OB 1EHKB 1KELL 3PREA 2YRBA 2ADYA 5HDOA 3WU1A 4TRPH 4OZGE 1A3QA 3QA3B 3JTBA 2CO6B 2E9IA 2HFFA 3HAEH 1AKJB 4PV9B 4NUQA 1JV5A 2JK5A 4TLSA 1T5WA 5JA8B 4MMXA 1LTXA 2BOLA 3EADA 4OLZL 5C3TA 2I60H 2XIIA 2F1EA 3H56A 5G5DB 3L5JA 4QRTB 1AYRA 1GGIH 4FP8L 5E6SB 4LIQE 2I9LB 2RHEA 4PJFF 3HE6C 3ZE1E 2YEQA 2QGEA 4PMFA 1JZ7A 3O11B 3KXFA 2HVJB 2NY4B 2EDMA 2X10A 3AU1A 3GMLB 4JEGB 2DKUA 3ILPA 2KI6A 1H5BA 4PS7A 5HVWA 1USQA 3EDJA 4LLYA 1NBCA 2A9BA 2DQCH 2ICWB 2X4QB 2ZWKA 4NQXB 2OMZA 3C5ZA 4KV5F 2I7OA 1U4FA 4RGNC 3VXRB 5JDJA 2Y2WA 3O6MH 3VFWA 4P8QA 4LLWB 2WN2A 2RD0A 4Y7OC 3BSZH 3ZDXF 4BZ1A 2EXSA 3NTCL 5JPMA 3PL6B 4QXUL 4G80B 4UMSA 1U8IB 4NC2B 5EORL 5LGYA 1U8LB 2FGWL 2FSEA 2Y25A 1MI5A 1OXYA 5ALBL 5HGAA 1ET5A 2OMYB 3N42F 2PP9A 3CC5B 4ICWA 2FHFA 1TVBB 2CPCA 2HPTA 2VDPH 2WYIA 3E1F1 5IF0A 4AQEA 4Y89A 1RJCA 3ESOA 3UC0H 5FIEA 2FX8L 2PW1A 3WY4A 4KDWA 3A4DA 1GS8A 4NQDD 5IB2A 3ROLA 2GJZA 1N5AA 4OIIH 2DN7A 3Q6GH 4ZODA 3SY0B 1HXKA 1YEIH 4G3YH 4DEUA 1JGEB 1KYDA 2J57A 3PAYA 3KWUA 4HUWA 1ZWIB 3IMWA 3LV3B 3MRIA 2AQ1A 3IE9A 2C7UA 4BRVA 4FFYH 4Z3TA 3LEVH 2CR3A 2OAAA 3RDTA 4FHJA 2VC2L 2ADJB 3ME0A 2OJZH 4R7VA 4JREC 5DHVH 1XCTB 4HU2A 4I0PD 4K5OA 5I75B 2EDWA 3CDGA 3ZKXC 3LKRB 1MFBL 4Y5XB 3B2UD 1QEWA 2AJZA 3S3SA 1E5UI 4JGMA 1E5ZA 5HYJB 2H2PC 4KKQA 4IIZA 3K2KA 3WLBA 2XIDA 5MEOB 4GMTH 2JELH 2I9TB 3FTGB 4I48B 3SGKC 3N40P 4XNYL 5ITBL 4FG6D 4UDTB 4YGVA 3WJMB 4WI5A 1AHWA 1K5NB 3E2HC 3Q48A 1P9MA 4C4BA 2ZXAA 1U95B 4ZOCA 4KXDA 2GJ6A 3T0BA 5KJ4A 3RE0A 1O75A 3MA7B 4HWBL 1IB5A 3DARA 3PHSA 1TVHA 3CQPA 2QMKA 8FABA 3MX0B 3G6AB 5AOZA 3MOQA 5IJDC 5KSVA 2NNAB 2D3LA 3G3LA 5HHVH 3U4BH 3DX7B 3VG0H 4G8IB 2R69L 3LX9A 3ASOB 4Y16A 4RIRB 4YLCA 4GLRH 4X98B 2K8QA 4R90L 3VQ1C 2XZAL 4MDIA 1NGXB 5I8EB 2VR3A 5DZNA 5EO1A 4WV1C 3IJYA 4AY0A 2CUMA 4GKNA 1QWUA 2UZIH 1PY0A 1QO3B 2KT6A 3PXJA 3BYYA 4E41E 5J9PA 5JMRA 5DMIH 1G9ML 2ZX6A 4ZZFA 3QDJD 2NDGA 4HS8L 1LHZA 4WTZA 3WSQL 4FYQA 1I7TB 3PY9A 1QBLH 4P49A 4J3BA 1XGQB 3E80A 3EOYG 4Q6YA 1ZSHA 1J10A 5DJAB 1U42A 4I18A 3SPCA 3P9WB 2YJQA 1INQB 2SEBB 5CLYA 1WCBA 4UWQB 3DO7A 3V9EA 2VTFA 5FUCC 2X44D 1LE9A 4HFWA 1E7UA 1F4HA 3QDGE 2FIKB 1X9UA 4IBWA 4G7RB 3WG7B 4TUKH 4H0GA 4D0CA 4DZ8B 3S8WA 2Q86A 3ABKB 1PPIA 2CK0L 4POZC 1ND0A 1UD6A 3BUQA 4JG5A 5IBTL 2H0PA 3FB7B 4TLUA 1GHFH 3IF1A 4XHQA 3KXFD 3LRMA 1Q38A 2Z34A 4Q2ZA 4HLJA 2EUXA 4AYID 3J8F7 1UATA 3MV7D 3LN4B 3F85A 5J11B 4YSRA 3CZGA 4Z3FA 4PJ7E 3DPBA 4X6CE 2ZCKH 4I89A 3DX8B 2H4EA 4GRWE 3BN9D 5SWQA 4YZFE 3OKLB 4NKIH 2BIIA 4F5CA 3MXWL 1CFVH 4JO4L 1N0LA 4RVBA 1XSKA 3KPNA 2Y7MA 4QRSB 3GS4A 5C97A 3L5WB 2ZSWA 4P2QE 3VH8A 3BH8B 5DFTA 1GOGA 3QUYB 2OCJA 3IFNL 4TSAH 4GW5B 4P2OA 1BFOB 5CN1A 1MY7A 4XNUH 3VO0A 1K4DB 4KGJA 1EXUB 4IS6B 4CL7A 1OCZB 4N0YH 3BKYL 8CGTA 1D5ZB 2ED8A 4Z7WF 4M5SA 3FOMB 5JW5B 5ICYB 1MDAA 1ZA3A 2IPKB 2J2ZA 4N90E 1N6QH 4AENA 4APQA 4GIAA 3VXSA 3WTTA 2ZOUA 1PDKB 3MRNA 2EUVA 5JQHC 2VM3A 3ELQA 3KPSB 4D9QE 3KEHA 3KXFE 4M6OL 2O5XH 2VXQH 3C08H 2ED7A 1SY6A 4X6BA 5BO1H 4IHOB 4YJZL 1Z6JT 5J89A 4K9JA 2DJMA 5KUKA 1QRKA 5ADOH 3DURB 4F15B 5GZOA 2Y6SC 1AG0A 3D7PA 4MBRA 4RMWA 5F96H 4LIQH 5ILTL 3X17A 4L2LA 4A1RA 2DQIH 5GHWL 1BXUA 3C8HA 3NZHL 5AW9B 2BNQA 3GMPB 4MQ7B 4FRWA 3HKZA 1LEKA 4S1RH 3L1EA 5C0FB 3EGXB 5FX3A 4L1HA 3QJQB 4NAMA 3SE3A 4P3WA 4YHIA 2JI2A 5KVGL 3NCJH 1A22B 1H3PL 4MQSB 5I2IB 3ZR5A 5GS1B 2J5WA 1V10A 5EEXA 4RBPK 4LSQL 1MI5E 4M1GH 2O6DA 1AGEB 2G3ZA 2MWCA 3LZLA 5JW3H 3D2UD 4OT1H 2APWA 1S7SB 5BZZA 4KI5E 3QULA 3WE1A 3HG3A 1KYAA 3KH4A 3KGSA 3KPTA 1RZKL 2OR9H 4WJ5A 3ZE2E 1T22B 5INDB 1A1NA 5EU6B 1WBZA 2F5BL 3JWDL 2OXGA 2AI0H 4O58L 1L6XA 4NUJA 1ADQA 4Y4FC 5DRWB 4OSUL 4KK5C 1P7KB 4EN3C 5KYYA 4OM1L 5CEZL 4JFQA 1UEMA 4NERA 1ZE3C 3X1NA 1N59A 4QO1B 5B22A 3C09C 4I2XB 5BUAA 1R3KB 4UOZA 4WSKA 1LQBC 4H5SB 4H8WH 3ZXAC 2WZ6A 4OJAA 1NCTA 3BZEA 1F13A 3MZTA 2AK4B 2QPUA 2HKHL 2ICCA 2IH3A 3FULA 4FERA 4A6YL 1MW3A 5HHOB 3DOSB 2R2EA 5HDWA 3EYFA 4AH2A 1TYRA 3CVBA 2DL9A 3B2VL 3OKMA 3K0WA 3ZTNH 4N2LA 4OQTL 5BJTA 3LKOB 3QJVB 4F2MB 5F1IB 1AFVL 2H41A 4QCIA 4RFOL 4RAUA 1INEL 2QZ5A 2OMXA 2RCSL 4WFFD 2VXTL 4XN5A 2OSXA 4N2OA 3QUXB 3VXOB 3F7YA 1HCFX 1UJTA 2UYLB 5D4JA 4U0RB 1L0XA 4Y9CA 1HIML 5B7FA 1E28A 4NNYB 2IG2H 4ZG1A 1Q9KB 1PZ5A 4I9WD 2GJ6E 3OXRB 2DQUH 5E9AA 3GSWB 4O5LL 3S0PA 2YZ1A 3OL2A 5J3HD 3WY2A 2UXFA 3QUZB 4ZPVB 1M1XB 1BZQK 1PEWA 5F21B 4U0QB 3B5HA 5KSUA 2XZCH 2UWEA 3BEVB 2BRRL 1O6TA 4OF6A 4OF3A 1N4XL 5F7AA 3L13A 4M4PA 1MCKA 4AQ1A 4OCNC 3ZMNA 1V3JA 4BFIA 5KVDE 2V7HB 2GBAA 2YEZB 1CBVH 4PREB 2R2BA 4F7EA 1B0WA 4NRXA 1S78C 3VI4A 1KYUA 1PS3A 1L4IA 4FEMA 1N7MH 3DUUB 1QWHA 2XV0A 1H8NA 5IUCA 2DYPB 4WW1B 5DD6A 1J8HB 1ZT1A 3NFSL 2YS4A 3GNMH 2X0UA 4NCC1 1CDJA 4M7KL 4YDKH 3NJLA 3WNIA 3P30L 3QHFH 3BKCH 1IC4L 1YEDB 2Y06H 2WY3B 2YWYA 3OKYA 4P2OD 5L2JA 4JQIH 1NGPH 3VU1A 3VFTB 2D9QB 3B9KA 1LO4L 1DBKH 1XR8B 3LZRA 4NP9A 3D4GA 3ZZLA 2HTKD 2Z7WA 4N2MA 4GBXA 1B0RA 1I7UA 4BUHA 1XAKA 4H0LC 1TCMA 2I69A 4TSCH 3VXSD 1NAKH 2AK1L 4M43H 2Y5EA 2XKNA 1ZY9A 2CRMA 1W8NA 4ZPTA 4CJ0A 4B9PA 3KPQB 3TNNB 3GZQA 2YA0A 5E95B 1LILA 4JDTL 4HPYL 3UGEA 4AJVA 3UAJD 3K46A 4G1MA 5EG6C 2R56H 5IK3B 2IGLA 3QARA 3I6SA 1S7XA 1RZJH 3GMQA 2JTDA 2XCMC 3BP4A 3NCFB 4YHLH 3L7FA 4F5CE 2BNQD 1TITA 4AQAB 2X89A 3NSFA 4AIZB 1CJYA 4UM8A 1P7QA 1A21A 1VCAA 4ZXBA 3ZVVA 5EV7A 2Q76B 2QTVA 3WMQA 4KNUA 1NC2A 1NPNA 1NUDA 4HHAB 1KIPA 1CFQB 2JQZA 4QHLB 3ZIYA 5EUOB 4G1EA 4N87A 1XXFC 3L17A 3GRWH 2ZOLB 4M1CC 1DFBL 1HI6B 1OE2A 3BHBA 3QUKB 5FUOH 4AIOA 3EXJA 3B7YA 1HHGB 3MNDA 4O02H 4UB0H 1C1EH 3T8XA 3F6IA 3ULAB 2VDRH 2G30A 2ZPKL 4PJGA 1P4IH 4KTEL 1NAMB 3VI3A 1AZBA 5DGQA 1KXVC 2QZQA 4AK1A 3VXSE 2EDKA 2NT0A 3VNYA 1GYUA 4F58L 4YO0B 1TU2A 3PS6A 2BC4A 1YEKL 1V7ML 2QQLL 4ATWA 3LQAL 3TCXA 4LPVA 3WIFA 4Q9QL 2JIXA 1AD9A 1SHWA 2X3AA 2J8HA 3GBML 1A3LL 3L4TA 5IVNA 5AZUA 2CLRB 5HJ3B 1BQKA 2CKNA 5AB1A 4LCIH 5E8OA 4Z7NB 2BNQE 1IX2A 2GBVA 3SQOH 4KY1L 3D18B 3HS0B 1BMWA 4Z78B 1SDAB 2H32H 5DK2B 4F7MA 3UIYA 4NUPA 3EBHA 3FSZA 4YE0A 4D8PB 2YMXH 5E5MB 1MH5A 1AZUA 3IMUA 1JWUB 1WS7A 3C60C 4LDLB 4K4KA 5DJ2A 2J8UF 1LK2A 3D0VB 1LK3L 2DEXX 4KJPD 5HHPA 3CZFB 3U9WA 2VCOA 3IB4A 2O72A 5I5RA 1MAML 4NQVB 2CDEA 2FZ3B 5EOQL 5HGGS 1RZGA 3FO0H 4JY6B 5C8JA 1DVZA 2HLAA 1F42A 3VH8G 3MBXH 4FQXB 4S0HA 1J0ZA 1JYNA 3RP1A 3ARWA 3PPSA 1C16B 1S9WB 1GAFH 1HNFA 5DA0B 3L3JA 2Q8BL 3MLWH 4N6QA 1XSIA 4HIIB 2YKKA 4W70A 1DO5A 3WFHA 1FF5A 1QRND 2E6JA 1KEGH 4MA7H 1WQVT 1OD7A 1IE4A 1WEJL 2ZKHL 5ACZB 5C0GA 2W0FA 2M1KA 5KG9B 3FHQA 2FYVA 5AVVB 3VMOA 3VFOA 1RUAL 1GZHA 2IWFA 2VAAB 2HZHA 3NDYE 4XNZB 2Z8SA 1WBXA 4WZ9A 3X3GH 3HR6A 1OSEA 3RKDC 2FEEL 2DY2A 3UDWA 3FAWA 3N1FC 3P1VA 1AR1D 5L0QC 5E9DB 4Z7QF 1WAAF 3N04A 5EZIH 3QI9A 3UO1L 1OGAA 2J7LA 1EJFA 1CGSL 2P24B 1SJVA 2WIIA 3PHAA 2AABH 2N0KA 2FEDC 3FN3A 3F12A 3QAZC 4IGBA 4KZ0A 3KHOA 1IAKB 3PV7A 2CD0A 2CIKB 4HGWA 3RZCA 3QIWB 3GJFK 1ADWA 2UWEE 4L5FE 3VM7A 1P4LB 1EV2E 4FQHB 1GGCH 4M9PA 1A14H 1KXQA 2H1LM 1PIFA 3IDIA 4DKTA 3O2DA 1OSZA 4NZRH 4FZEH 1JPSL 2RBLA 5IB5A 2CO4A 3VI4E 2VE6A 1A7PH 3GRBA 2XG4A 4JO2L 4M7JL 4P04A 2JJVA 5BRZD 1BM7A 4GPVA 3RY5A 1QFUH 1NJ9B 3PE9A 2GY7B 5C7XH 2X89D 1FO0H 2HJKB 2XDHA 2CA3A 2BNRA 5KVDH 1ZPLA 4C56A 4HIXL 1P7QD 4YR6A 1M2VA 1VIWA 1WSST 5FK9B 3T0EB 1DVFD 4AQ8A 1E42A 4AIEA 4KJQD 3AREB 1AVAA 3G5WA 1R5VA 4ZYKB 3VX0A 5IVXB 1TQWA 5I66A 5AVYB 4ORGB 2CSPA 2Y1VA 4GP4B 2V6HA 2AJ3B 4LAQH 4E9XA 1FRGH 5AOIA 1VA9A 3Q9PA 5F0PB 3P0GB 3A6BH 2MCPL 3V0GA 3MQIA 3G5XA 3PXHA 1BVLB 3CSBA 3NA9L 1F3JA 2DQHH 1JZ4A 2WZAA 4EUPA 4FA8A 5I0YA 4JFYB 4X4KA 2NPLX 4ZTOL 4HW6A 5HGBA 2HX8A 5J5EA 2ZJSL 3GUFA 4Y19A 4UQBA 4JFTA 5F7EL 3VG9C 3ZO0A 3ECWA 2IMNA 5EZOH 4FTDA 4OLVL 5FDWB 3CH1A 2HRLA 2ZUUA 4J12A 4KQ4L 4MXQC 3N50A 2D7TL 1E9OA 3SYAA 3W9DB 3X3FH 5I73C 1PG7H 1KBBA 3FT2B 1JGVL 2WCGA 2EZ0C 1JPGA 1HK6A 1SQ2N 4B9IA 3L5HA 4LPYA 3U46A 1C5CL 5LG1A 1MLBA 2A83B 1MCNA 1CLVA 1U3HC 1I7RB 5KN5A 2Y7QA 1NCDL 4UTBA 4FL4B 1X5LA 3AM8A 4JPIB 4DO5A 5JIKA 2P47B 5B8CC 5IEHB 3NIFF 5HI5D 1A6PA 4UQDA 5DR5H 5FR3A 4PSRA 1CT8A 3SKMA 3KPOA 1FNSH 3N2JA 5C6WH 3A67L 3EGDA 1U8PB 5GS0C 2IXQB 4LRNH 2HYMA 1BQRA 3RFZA 2NY6C 4DGIH 3CX5J 4G8AC 1CR9L 4YHOL 4OUOA 3CQFA 2J88H 1NMAL 4AE0A 4LSVL 1FG2A 1Q4NX 2G5UA 2X88A 5C0IB 4TRPL 3V6ZB 4TUUA 1QYGH 3L3HB 4PJGE 3LS4L 4N0UA 3VI3E 3TYGH 1NPJA 4I3RH 3ZQ9A 1U8JA 2WVVA 4PJHB 3VJ6A 3ZRCC 2YGVA 3ALPA 3M1BB 5DUPL 2Y7OA 4PJIF 2F8OA 1KPVA 2XTJE 5DMKB 2YXMA 3GM8A 5DA4A 3EZ8A 5ITFB 1J87A 2FQGA 2YD4A 4WCYH 3F58L 5CCKL 1KENH 1DANU 1JGLH 1QNZH 4J8RA 5L8JB 2VDKL 2VLKD 4JO3H 2F58L 1T4KA 1XH3B 2YQ2A 1R24B 1N8OE 2R15A 1AKJA 2DQCL 5ENWB 4U05A 1SXSA 4FQJL 3EBAA 4HLZG 4UQ3B 3B9VA 4RLDA 5IVZA 3NSJA 3MFFA 1XGYH 1RHHA 1K2DB 3NQKA 3QI9D 5G5DA 4QRTA 5LGJB 2XHNA 3WCYA 3UBXI 3FK3A 2OK0L 3O11A 1KIRB 1I1AA 4J4PA 2H1XA 2NY7H 3HI1B 3M88A 1YECH 1JMXA 1KNOB 3ALWA 1LWJA 4P4KB 2HLEB 3BWAB 2WWMC 3VXMB 1I8LA 1P4BH 1DBMH 4HWEL 3DMMA 3TT3L 3EJSA 2ZWLT 4NQXA 3EOAA 5JIDA 3EJZC 2X9WA 3UTZB 3TN0B 2ILLA 3JTTB 2R9HC 2WUCH 3BSHA 3HLAB 4OIIL 5HI3C 3VXRA 1FIGH 1R19A 4G3YL 4LLWA 1FL5B 1X6LA 3PL6A 4G80A 4YHMH 4V1DD 3KEDA 3SBWC 1U8LA 4MCNA 3FONB 4JE0A 3LEVL 4ODWB 3CC5A 4LLQB 4CGUB 5E51A 1A4JB 5EZLB 4YX2H 2YOCA 1TVBA 5DFVC 4G83A 1E4KA 2L7QA 4RISH 3EFOB 5DD3H 1GS6X 4HWUA 1LEIB 4K9EL 1DQJB 1OGAE 4XXCA 5LNGA 1UJ3C 2DMCA 2NMSA 1QLEB 4IJ3B 5SWSB 3NJFA 5KW9H 5LDSA 4IMKA 5GS2D 1A7QH 4HKXA 5F3BA 1S7UB 2JELL 2OBGA 3NESA 4KKCD 4YHYC 5E6UB 3MV11 3SY0A 1JGEA 3SZ6A 3BPNC 5FGCB 3CLWA 2EKJA 4Y19D 4ZFOB 1QASA 2WWKO 3F65A 3SKJL 2O5ZL 4Q8BA 3GHPA 4V2CB 5TF0A 5K33A 1KXQE 1IC7H 2FLMA 2DIJA 1U8NA 4FQLL 2HFGH 4CUCA 3NP3A 3WGUB 2RJMA 2EIDA 5HHVL 3U4BL 3RJOA 3PQYB 1CXEA 3LKRA 3VD7A 2WKOF 5F7DB 3H42L 3L8QA 3ULVC 3BH9A 2H26B 2CLZB 4L5FH 4RX4D 4NQCD 5IG7B 5HYJA 5HYSB 2ZCHL 4NO2B 3AGWA 1QSEA 4WUKH 5E7BA 4ESKA 2ETWA 2PYFB 4I48A 3RJDA 2BNRE 4Y88A 3S36X 3KLQA 4P5TC 4C56E 4UDTA 5C92A 1TPXB 2WLKA 2EE2A 2R4RH 5E6ID 1K5NA 1W6LA 5BQ7B 3BT0A 1U95A 2WWNA 5EU5B 2N4IA 5C1MB 2VRQA 3QG6B 2LFGA 1BOGB 2CJ3A 3WEOA 2Z4TA 4G6MH 1D7CA 3MX0A 3G6AA 3ULUC 5I19H 3IDJB 4Q97A 3DX7A 3SDXB 4GYBA 1MCIA 4GG6F 4X8CA 3M8OH 4G8GB 5C2UB 3ISWA 4N1EA 3TH3T 4U1LB 3BCDA 4PJAB 1GIGH 4Y19E 5AZ2L 3CN0A 5I1HL 5J6GB 4AW7A 4F57H 1NGXA 3QR2A 1B4JH 5I8EA 2JB6A 3SODB 3WFBH 1G6RL 1CDGA 4U4BA 3VXTB 1I8IB 5D70L 5HGHB 2OCFD 5E08H 4OV6F 3SGJC 4A7QA 1I7TA 4KX7A 3LJ3A 4XBEH 1GOHA 1XGQA 5HI4D 5EORH 3EYSL 1IM3A 5DJAA 3F7KA 5JIMA 1J0YA 1INQA 5E03A 1T2JA 4PJEF 3IS1X 4JFXA 4M8UA 4Q74A 5FEBA 1LDSA 3ARSA 1AZZC 3FTVA 5K9OB 3NZ8B 3ECBB 2Z31C 1YPZF 4XTRC 4HLZH 4MKTA 4NKIL 4J2XA 2FIKA 3L3IB 4N9OB 3Q3GB 4GMSH 1U2YA 2IEPA 2XN9D 4NEHB 4DZ8A 4OGAC 2LT9A 2NYYC 4KWUA 4OCYH 4ZW7A 3RWDB 2QADB 3JBG7 3W82A 4L18A 1Z1WA 3QDMA 4WI7A 3FB7A 3BVVA 4BZ2H 5DHXB 5C70A 3Q2WA 2C3WA 5LAXB 2B8OT 4N0UE 5T3ZD 4MJIB 2DQDL 1CB4A 2NY4D 2JJTC 2DI7A 2YUZA 1JNNH 1TQCC 3WMSA 4DPBX 3LCYA 1RVFH 3TZVB 1A47A 4N0YL 3FTXA 5DD5L 1II4E 2QFPA 5LQBL 2O5YL 3QG7H 4X7FC 4X6DB 2QGBA 3OKLA 1HL4A 4EUPG 4ZW8A 1OLLA 1OE3A 4JM4H 4QRSA 1F11B 5FYLE 3C08L 2GTZA 3L5WA 3VXRD 4W9LC 3MODH 5CN2A 5BO1L 1Z5YD 4P9HL 2OX5B 4G9FB 3BH8A 1OIOA 4Z7OE 4U1HA 4FJZA 4L3FA 5ADOL 1ZKAA 2N7AA 5TQ2H 3LN5B 5F96L 4PJ5B 4LIQL 1T20B 3DIDA 2YOAA 5JOFB 1K4DA 3MHZA 1EXUA 5JA9A 3MACL 4IS6A 5B39G 3K74B 3Q9QA 3TBTB 1W8OA 3DX1A 4GT0A 4DP0X 3PAUA 5JW5A 3FO9B 5ICYA 4U3SA 3AG1B 2XN0A 2C9VA 2ICWJ 3HW7A 4G71B 1O6VA 1PDKA 2NW3B 3KPSA 4HOXA 4M1GL 5GJSL 1U3YA 1UWYA 5F1SA 2DJ4A 2OMUB 4M5YH 1FN4A 4TVUA 2CRZA 5IIEA 4IHOA 2OR8A 5JXEA 3FOLB 5FYKU 1NDMB 4DZBA 3BE1L 4TQ8A 4PG2C 1ET8A 5LCVL 3D33A 3V6BR 2OR9L 4YHPA 1OP5H 2FO1A 1NMCC 2C34A 3GMPA 1KTJA 4WO4B 4JFSA 3IKKA 3ULSA 2IPTH 2VH5L 1H3XA 1Z9SA 1Q90A 2Z35B 3F7QA 1CXKA 3EGXA 3VXRE 4PG9B 4PJCB 1G84A 3OV6A 2K3HA 2EXWC 4O9HL 5I2IA 5GS1A 2G5RA 3LKPA 1KTLA 3KAAA 1I53A 4A2FA 2FBRA 15C8H 1T1XB 1AGEA 4XPHL 4I1NB 3GI8H 4YDVA 3SQRA 2NYZA 1S7SA 5FXCH 1D9KA 4AEEA 4G8FA 3SPGA 1IGTB 4JPVH 2ZD0A 3CMOH 3CFNA 2ROXA 3H2PA 4TKWA 4W9ZA 4NZUL 1T22A 4W68A 5INDA 3C9NB 4M1DL 2HRPH 5KSAC 4NZFA 1GC1H 3AXIA 4MAYC 2DDQL 1RURL 4QIRA 2ODHA 5JW4M 1ZJAA 1MCDA 4D94A 1L9QA 2XWTA 2C8NA 2AITA 3NRPA 4HJ0C 2IG2L 4QO1A 3H9HB 4I2XA 1R3KA 2V17L 4TLTA 3TYFB 3LAFA 4H5SA 1F4XL 4LNVA 2LVCA 3B1TA 4MXVF 5AW1B 4KKBC 2DQUL 3T0DA 4EKXA 2AERT 3B9EA 1DVQA 25C8H 3EH2A 3DOSA 3RTQC 3ZMRA 2LU3A 3W0WD 2XZCL 2VQ1B 3T4AB 3ZHNA 1JZEA 4NN6B 3LKOA 5FFOA 3BQUC 3ARFC 1BPLB 5DDHB 5HYJE 1BVKB 5D1ZI 1QSEE 1WC7B 1DQKA 3DBSA 2D0HA 3GHBH 4JHWL 4NC0B 1WFIA 1RKRA 3D85B 4Y1TA 5I6NA 3QUXA 3CCHB 3VXOA 1A6TB 2UYLA 3O2DH 4HKZA 3IJ9A 3ZSSA 3GDCA 5J1TC 1H9DA 1NFDA 4NNYA 1JXGA 3DX3A 5ANHA 2BVQA 1WITA 1JXKA 4ZFZB 2UVFA 3B7TA 4GAAA 3GSWA 2B0SL 3LZOA 1XF5A 1NKRA 1CCZA 3NCMA 1J1OL 3QB7C 1QABA 3QUZA 4QRRB 4ZPVA 5D93C 1ULVA 2W65B 4PY7B 4Y8AA 5EOCJ 1FE8L 5GSRB 5F9OH 4DN4L 4Z3GA 5BNXD 2DWXA 1YEEL 3QS3A 2QQKL 4MD4A 1VESA 4JQIL 1NGPL 3BWUF 2H5UA 4NO3B 1HXYB 1DBKL 2V7HA 4FKKA 1F6LL 3OTTA 4XMVA 2IO5A 2EH7H 4QRFA 5DUMH 4Z8FL 2N7BA 5GS2H 2Y7NA 1WISA 3BAIA 4OCLC 3DUUA 2MHAB 1NCHA 3GGWB 3HI6H 4MQXC 4PLJD 4QHUB 3T2QA 4OCSH 4F1SA 1TJGL 4TSCL 4EUPH 5F70A 3N41F 1L5GB 4M43L 3EO0B 4O51B 3FQRB 1VEOA 5E2TL 2GK0B 4M6MH 4R4BB 3C87A 4QHNA 2ZQKA 4ZNCD 3MRLA 4XCFH 2FH8A 1YEDA 4ODVH 3QUYD 2CO2A 3B8SA 1BBJB 2NZ1A 2X4RB 5DUBB 2VAJA 3UYPB 3OLEA 2A6JB 2R0WH 5T1KB 1RZJL 5FA4B 1XR8A 1YYMH 4J1UA 2AJYH 3HA0A 1KTDA 1BG9A 3OR7B 2NY3C 1DCLA 4EXPX 2WP3T 4NJAL 5AOMA 4F7CA 3WNPA 3HB3D 4GRMA 1E43A 5F88A 3UTTB 4R0LC 3V5HB 3DV4A 1EBAA 3QDME 1Q8MA 2WLMA 3H3BC 4UTBH 6TAAA 3HUJB 4I0KA 4DP4X 3QRGH 3KPSD 4C59B 4M29A 2ZX7A 2BIQA 3DSFL 1Z5HA 3KPQA 1AJ7H 3TNNA 3QZNA 1LMKA 1ZLWK 2G0KA 2HVKB 3RQ3A 2VDRL 1BPVA 1XB3A 2WXOA 3HE6B 5DRNA 4L9DA 2XWCA 4AIXA 2ZOKA 3ZTCC 9PCYA 3NN8A 4A04A 2BNUB 1SOQA 5JIPA 5KTEH 2FB4H 2YJLA 4F1ZA 1JGDB 4JG1H 5LLIC 4G82A 4N68A 1JPTH 2X9YA 1IZJA 2GJJA 2Q76A 3O2VH 3ZOAA 3O6FA 3ARYA 5E2UL 1CBJA 4HHAA 1CFQA 5HDQL 3QDHA 2EH8H 3B9AA 4DF9A 1C7TA 5EUOA 3X1GA 1VEPA 2GIXA 4RGNB 3X11B 3FFCD 3T2LA 2FL5A 1HI6A 1Y6MR 4Z95H 3QUKA 1NMBH 3IS0X 1CK0L 1HHGA 4EI6B 2JI1A 5DURB 2Q87A 3ELAT 3SE4C 3LB6C 3NSCA 4ACTA 2A99A 1MIMH 1NAMA 1JWMA 5EU6D 1SLXA 5C71A 2ZUYA 2DYSB 5DFAA 3KPSE 2KLTA 3K4DA 3O8XA 4P4RA 3CPLA 4YO0A 1VACB 4JO1L 4GG8B 1A3RH 2AXJA 4YSAA 3FO0L 4OU3A 3ZLQC 5DC4B 3T3PB 3U36B 4UQIM 1AS8A 2RGSA 3VD9A 4ODSH 4QPEA 4BZ1L 2AK4D 1N5YL 2CLRA 1RI8A 4PS4L 2FX7H 3ARDB 3IJHB 5HHOD 4CC0A 1MJ7H 4ENEC 5KSBA 3RVVD 4XCYB 5T3ZH 4OI7A 3WKYA 3HS0A 3CSGA 4PCSA 4Z78A 4ZFGL 4LF3B 2BP8B 3O9WC 1AGCB 3AG3B 4ONGL 5D1ZC 1G7HB 1HU8A 5CR8A 5D5MB 4QTFA 4D8PA 2X12A 1NFIA 2JVUA 3MSPA 5E5MA 1TIUA 4MA7L 2Z0BA 5IMLB 3D0VA 3S4SB 3E7JA 1AR2A 2QSCH 4FXKA 4JN2B 3QUXD 3K81A 2WXFA 3KLKA 1T5KA 4WEEA 3ZKXB 2PPAA 4HIJB 1HOCA 4UIKH 3QBTB 3VGGA 4NQVA 5C09B 2ZXEB 4X6EB 2FZ3A 1IAOB 4JY6A 3IGAB 2FO4B 1A25A 5D9SA 1O7SA 5BVPH 3MV9B 4S2SA 5I6KA 4XBMA 4N2CA 2XJLA 1QR4A 4FQXA 1EIBA 3LVEA 5AWNL 4NUGH 4D3CL 5C0RL 3QUZD 1FFNB 3WXVL 1FZKB 1MHCB 1S9WA 2CMRL 5ICXB 1M05A 3QIUC 1IV8A 2QLVB 2ATAA 1AMXA 4TTDD 4X2UA 1IKNA 5EHFA 4I2XE 1HKLH 4MA8H 2YWZA 5CAYB 3D0LB 3VD3A 5IFJB 4JFFA 4GQZA 4MA3B 5ACZA 2ZSVB 1UB6A 2K45A 2E9GA 3WO4C 4L0YA 3J7HA 3RFRA 5M95B 4PLNC 1NLBL 2ESVB 3UYRH 4CC4A 1G7PA 3U48A 5BMFL 4LOVA 3U9UB 2DYPD 3FO2B 1DVTA 2DW5A 3L4XA 3T2OA 4YDLC 1J8HD 1A14L 4WUUB 4ZW5A 2W9DH 3NYKA 4TNFA 4WWKC 4XMPH 3FCTB 4WV1B 4FZEL 3NJKA 3WBDA 5BCAA 43CAA 1SLWA 4OIFA 4TMPA 2XBDA 4XI5C 4PIRF 2HSIA 1JGUL 1Y1UA 5CLZA 2P24A 1NFDE 1N8ZB 3H6JA 3T5WA 3DHMA 4K3EH 5JYMA 4BK8A 4U7MA 3TO4C 4GSRA 3PWUB 4FQIL 3P73B 1KGCD 4KKRA 4J3OD 4Y2DB 1AI1H 1MNNA 1IAKA 4TOYL 1NCIA 5FWQA 1NIDA 2H47C 3S3DB 3MNVB 3W57A 1SDYA 3G5VB 4AEHL 5C9JB 1KJ2L 1OT4A 3JV4A 3CFQA 4NM8L 4E9VA 4MYWB 3EG9B 1TJHH 4FI7A 3MYJB 1J1XH 3H2QA 3RBSA 3FQUA 2PN5A 3B56A 4LEOB 4HBCL 1TJXA 3UGXA 4U4IA 4B6ZA 4OLWH 5D7LB 2N01B 3RWIA 1MEXH 1HILB 1KB5B 3EJYC 4K7PX 4XNXL 1JNJA 1TENA 4FKEA 1S46A 2D31B 1XZ0A 2CGRL 4YDIH 5DQDL 3VXPB 1YEFL 4HVBA 3TESA 3MRQB 4JE4B 4AMWA 3MBED 1A2YB 4HS6B 5D7KD 3BUDA 4IOFC 1NSNH 1CVSC 5DD1L 4DUVA 3D50A 4IIQC 1TZGL 1OTTC 5J4MA 3IPEA 4MCZB 2K9UA 5FK9A 2WUBH 3F7VA 3JT2A 4JPWH 1PG7L 5JORB 2YIHA 2VLLB 4NAQA 4WI9A 5IVXA 3B3IB 5EOCH 4N2GA 4B41A 4TUOB 4YHZH 4U6XB 5AKSA 3KJ6H 4ORGA 5JTWA 2AJ3A 3L7EA 1UT2A 4X5QA 4E9QA 4XB7A 4G6AC 2BPBA 5E8EB 4WW2C 1BVLA 2WMPA 3S35L 4DT2A 1G9NL 1KGCE 4Q9RL 2PXYC 3U83A 4IBVA 3DTUB 1H3WM 4TNVF 2BWQA 3OWEA 4GKLA 2W81C 1VAHA 4JFYA 3VYPA 4KUZH 2Y4SA 3F7RA 5ANMA 5DR5L 4OLUH 4NNXA 2QGDA 4MB1A 4LZKA 3LIUA 2AJSL 1FNSL 1QUNB 1RIVL 1H15B 5ACLA 5FDYA 5FDWA 4X8JB 2D7PA 4BK5A 4EI0A 3ARBA 3W9DA 4J3UA 3V4PL 1A4CA 3FT2A 4TVPD 1AXIB 4HS3B 1MOEA 2PMZA 3I84A 4KDTC 1N3NB 3GRGA 3ZIMA 4DEPB 1RHFA 2RA1A 4DERA 2A83A 4MNGB 1JD9A 1G5AA 5LWYL 4GSDH 1B9KA 1EO5A 1I7RA 1HWHB 2YAQA 1RSFA 1DSFH 1AQKH 1JN6B 4HEMA 4LHQB 1EJOH 3AXLA 1CLOH 5DVNA 4FAAB 4ZMZA 3UZEC 4DETA 1U8PA 2IXQA 3GMOB 2CA4A 4ZOAA 4NWTH 4WCYL 4XH2B 5EUOE 3G6JF 4Z6AT 4RDBA 1QNZL 1C9SA 1HT6A 1N6VA 2B4CH 1WD9A 3EGSB 5C3LD 5C0IA 4L3ED 1SY6L 3V6ZA 3L3HA 3ARUA 5EULV 4FQXD 4M5TA 3E9UA 5C6TH 3OZ9L 3DNKA 2E7HA 3DI3B 4PJHA 4GKOA 5BS0B 3EHBC 3M1BA 2VSMB 2AMGA 2A3TA 4IBZA 2F74B 3K3QA 3N1MC 5F7YC 5AW7B 3MUZ1 1VPOH 2IANB 3Q5TA 4YXHH 5EWIL 3O41A 1ORQB 2H6PB 3AQXA 4XVTH 4JHUA 4OGYH 5T1LD 4JG0L 2NY7L 4EN3B 2L04A 5KSBE 3QQXA 1BAWA 1FGVH 4BSVB 2QQNH 3PXLA 4C8XA 1KN4H 2CXGA 5EEVA 3C09B 1R47A 2PO6D 1DBML 5FYKL 3L2LA 1DHKA 4UQ3A 3E38A 5GGRA 3TO2B 4LHUA 3ES6B 5E9DD 4KKNA 1A6AB 4CMHB 4X8XA 2XIBA 1G87A 4PJ9B 1ADQL 5LGJA 1N2RB 1T6BX 2JCCB 4EEEA 4IRSC 3REWB 1A3ZA 4Z0XB 4N8CL 2AXFA 2QFRA 1KIRA 2YMTA 4JGJA 5BVJA 1GZPB 2Y1AA 1K3IA 3HI1A 3ZL4H 1DQIA 1LO3H 1NL0H 3OKDA 3QIWD 4YX2L 5DJCB 3ZO9A 2VZUA 3BP5B 4WFGE 1FBIL 3FPXA 2X2YA 3BWAA 4F92B 1L0PA 1I75A 3MNZA 3NGBC 1MCHA 3L3GB 2RQEA 1F4WL 1MRFL 4XNAA 1YAIA 4JFFE 2E6QA 3TN0A 3UTZA 2LOEA 4RCAA 1UACH 2EDEA 3FU0A 1IL1A 5GJTL 1K8DB 5DSCB 1FL5A 1UCBL 3EO9H 2FD6H 2ZUSA 3R1GH 5DJYB 1QFPA 3UOAB 1G7LB 5FF6A 1TLKA 1ID5I 1D5MB 4CILA 1PQZB 3QJHA 4B0MM 2IWEA 5K5YA 1EX0A 4P57A 1S7VA 4ODWA 4IU3A 4LLQA 1OHQA 3FKUS 3T0ED 3UFIA 1A4JA 5EZLA 4ZFQA 1UUSA 2ZF8A 4M02A 4BYHA 2APFA 3IMRA 4BQ9A 3ARED 4H40A 2X3BA 5KBLA 1LNUA 1X9QA 1HKFA 2FHCA 3K71B 3NMEA 4L5FL 5SWSA 4PLKD 3RIAK 1PLBA 5D7JC 1JYXA 4WUKL 3CFIC 5IESL 4M7LL 1ZLDA 3MCKB 3Q1SH 4GW4B 1KCSL 2VKXA 4NM4H 3HG4A 2VMJA 3H9SA 1MKFA 2A4EA 4GW1B 4L8SB 5GGTA 3VW3H 2R4RL 4UT7H 4Z7VF 2IDCA 4ZFOA 3REVB 1MFAH 2V5SA 2VJXA 4KHXL 1Z3RA 3GLDA 4LQFH 3CZKA 4W9JC 4BCXA 4KJYB 4K94H 2R7EB 4Q0XH 3QW9A 5F6HJ 1G7JB 3HFMH 1U33A 2NOYA 3M8OL 3ARQA 5F7DA 3BFQG 1JZ6A 5HYSA 3GO1L 3WTXA 1K4CB 5IG7A 4KVPA 1OAQH 1G9MC 4HWZA 4NO2A 3WEXB 3AADB 4NXSA 1FORH 1OCWL 2E6PA 3R19A 4U1IA 3T6ZA 2PYFA 1B4JL 3HJEA 1KCUH 1XCQB 2WD0A 3IFOB 3QAQA 2FIRT 1G7MB 3GSRB 4K71C 1BMZA 1VGKB 2Y36H 3DUHA 1R3LB 1UA3A 4BFRA 1EZVY 2MOGA 3NRQA 4S1DD 1JZGA 5IVXE 3MRJB 4KKLC 1SEBB 4D0BB 4ZMWA 5E08L 2V9TA 3JYBA 3QG6A 4ZFFA 4E68A 2YA1A 1RY7B 3MRHA 4JFOB 5T5FA 1BOGA 5L88L 1J9SA 2YBRB 4I4WB 2B77A 4W4NA 1GMIA 5DJXB 2UUDH 3IDJA 3SDXA 4XPAL 3OZLA 4Z76B 2DEYX 3EOBB 1S8DA 5DD0H 4PJAA 5ANME 4DGWC 4YC2C 2Z93B 4DHLA 4ODBD 2DQGH 5AG9A 3MPCA 4N6RB 3AABA 1RZFL 1Z3GL 3NJNA 3E3QE 1MQKH 5CGTA 4RGOH 4R4NC 1IBHA 3IVKB 3RHWK 3VXTA 1I8IA 4XMLH 1SLVA 4QEGA 4AJ0A 4OCRH 3VVVA 1A0QH 3PLYA 3U4EB 3FUNA 1I9RL 1NOLA 4ZJ9A 4ZZKA 4X83A 4P23C 1O5DT 4XX5A 4EOWH 1T1ZA 2H2SD 4U6YB 2VDQB 4PUBL 2UZYB 1A5FL 2YQGA 1WZMA 1NFAA 5KYWB 2XV2A 3UXFA 3K5RA 4HEME 4WEBH 5HJDA 3K6SB 5K9OA 2OSLB 3ECBA 3NZ8A 5CWSB 4FYTA 3T04D 5A3IC 2CKBL 5AD0B 1H3VA 3RVUD 4BSWA 1H3UA 2CPUA 4XGZA 3Q3GA 3S34L 1NEZB 3AS1A 3U7WL 5ABAA 3KW8A 2X6UA 3ARXA 2IDFA 3BRFA 3T3MB 3RWDA 3MODL 3VGEA 3WI9A 5C2BH 3BVNB 2CBPA 1WUZA 1H6EA 1TOXA 3MUGB 3OKKB 1CLCA 4KK8C 1GS7A 2PTTA 3HNVL 3C60B 3QNFA 1A8JH 2D3VA 1QPKA 3G5YB 5DZAA 5FYJU 3PNRB 4J3OF 2VMDA 2A74C 1B88A 4GXFA 4P4KD 3DBXA 4PJHE 1QLRB 3TZVA 4YIQA 1DJXA 3ARRA 5IHZB 1EK3A 4F8OA 1R5WB 3VXMD 2RACA 1XF3A 5CO1A 3O3EA 4X6DA 4UNIA 3FQ1A 3JWNE 1NAMH 3QO0B 1OF0A 3CXDL 1OAUH 3L4UA 3UG4A 1QFWL 2J25A 4M5YL 4Q6IA 3PWLB 4EVNB 3CU1A 2OX5A 4G9FA 4KRMB 5HYQB 3HZKA 2XWEA 1WJ3A 3WTVA 4B0MB 2PPFA 2OYKA 2ZWNA 5IZ7A 4HG4J 3LN5A 4PJ5A 1A6ZB 3L4YA 3V4VB 1MCOH 3RRQA 5I1LB 2X41A 1W16A 1EFQA 1EFXB 2HTLC 4YHKH 2P44B 3SPHA 3BP6A 2IGTA 4HCGA 4G7SB 4AYGA 4J3XA 4ZX6A 4EI5C 1RZKC 1FFRA 4ZUWB 2DRUA 4B3EA 15C8L 3JWDC 4RGMC 2OMUA 4JKPH 4UTAA 1R3HA 5L0QB 3GI8L 1KGYE 4B9KC 1AD0A 4ZS6C 4DP2X 3FOLA 3JQOB 2IADB 1LXMA 2W92A 3NJVA 4L0PB 4DKFH 3JWOL 2CAKA 1RJZB 2GCYA 3KH3A 3QAZB 3I75B 4IRJC 2WYHA 4PJXA 1Q72L 1GC1L 2O1AA 1SZNA 4WO4A 5E0FA 5DMJB 3IJ7A 1V3MA 6FABH 2V9RA 4CN6A 2ADFL 4P2AA 3IMTA 2Y5TA 3PQYD 5DTFB 2IWGA 4WU5B 4PG9A 3S96B 3F5WA 2J1KA 2VLRB 2FQFA 4L1DA 3F64A 3NCWA 5L8KB 1FAKT 3QWRA 3K6NA 3D4ZA 4Z7NF 5LJYH 3BDYL 2BP5M 1T1XA 2QSTA 2HX9A 2WAHA 1DQLH 3A6CL 3EYUL 5GRJH 3JWNG 2P43B 2KUTA 3P0YH 2YC1A 2F7PA 3H4HA 4H2AA 2GITA 3FQTB 4PJ7F 1IGTA 4X6CF 1MFEL 3ARGB 5I8CB 3RPKA 4GRWF 3C9NA 4YZFF 5SWSE 1KN2H 1PYWA 4QF1A 1G7QA 5C07B 3BESR 3WN5C 1SEQL 1XL6A 3HE7C 2CRYA 5DJ8A 5GGSA 5CJ5A 1IVLA 3DX6A 3GHBL 3ZZSA 5IJKC 3PWVB 3CC1A 1MFDL 2VITB 2J4WL 3H3PL 4QTIL 4G8GD 5MEQA 3H9SE 4NKDB 5FGCE 3V2AR 4YSQA 1DSYA 3TYFA 2DTSA 4GIPD 4NCDA 3IT8D 1RUKL 3LNEA 2DWSA 2WXHA 4QD2E 1ERNA 4R84A 1CE1L 1NC4B 3BVWA 4ZTPH 1PZDA 5H35B 3ZL1A 4Q4IA 3M17A 1ZLSL 3T4AA 1ITCA 1S5HB 2CDFB 3TJHD 3VG9B 1NBZA 5DDHA 3FRPB 1YUHB 4KFMA 3EXLA 5GISH 1WC7A 3CVDA 4OGXH 3IMBA 4WGKA 3D85A 3GK8H 4HOWA 4MNQA 3CCHA 1A6TA 1E9PA 3X12A 3HI6L 1DBBH 2UVEA 1OGTB 2FEEI 1UB5A 3JYCA 4XCEB 3O6KL 2EE0A 1IFHH 1T0PB 1DR9A 2ATPB 4FXGC 1ZS8A 4M6ML 5JYLA 4PN6A 1M53A 1Q9LA 1U3HB 3Q05A 2N0MA 1DLFH 4QRRA 5IQNA 4JDVB 4P2YA 2QADD 2W65A 4XCFL 2EO1A 1EUUA 5GSRA 5B8CB 1J05B 3SDXE 3SGDI 4JGUA 1CGTA 3X13B 3RPIA 3CFTA 4MJID 3W11D 3HMXH 4NO3A 1HXYA 4PJAE 5SX4I 1D6VL 2FECL 1YYML 4XHJD 3RUGA 3TA3D 3TZVD 5EEUA 2AJYL 2EE9A 4XP6L 5D6CB 5T1MB 4RWYL 2HMID 1ZK5A 4DN3H 3GGWA 4KI5F 1VFAA 4QHUA 1N68A 4UQ2A 2BZCA 3T71A 1WBYA 1Y7VA 2R23B 5HDBF 3QRGL 3FQRA 3BH4A 1BZ7B 4Z23A 1U91A 1GCFA 4R4BA 1KBWA 5GZNC 3EBIA 4X5WB 1EHXA 2BCMA 4KPHH 3WL9A 2IF7A 1AJ7L 1SHMA 4G9FD 2KZKA 3FU6A 5H2BA 1BBJA 2X4RA 1IARB 5DUBA 5D4QA 5MEPA 3UYPA 2GSGA 1DVUA 2JJSC 1ROCA 3F6JA 4HJJH 3VA6A 5T1KA 2EVJA 5FA4A 1G9EA 1IO4C 5LXVA 1KJVB 4JN1L 4KTDH 3TFKC 1KC5L 5HYSG 5KTEL 2F8IA 4N25A 3ABZA 3OAUL 5K9QG 1ZGLP 1DVSA 5EF1A 3V5HA 3UTTA 2VL4A 3O2VL 2E4FA 5EO9A 5CLWA 3HUJA 3NCYP 1YNKL 2DWDA 4JDZB 4JKLA 5CEYB 5IFAH 2HFEB 4LL9A 5IQ7L 4IU2A 3KCPA 1CC3A 3MLPA 5DEFA 4Z95L 1REIA 3ZE0B 3F05A 5FYLL 4JZJC 5DO2D 3DV6B 1TTFA 2ZG3A 4X6DE 3FUMA 1Q1JH 4JM2F 1A8ZA 2BIHA 4WO4D 1FPTH 1NCBH 3ATDA 5CJXA 4PJ6A 2FBJH 4ODHH 4JCLA 2F19H 3AJ7A 1YMMB 2F54D 5E2WH 3VD4A 2BLFA 3PU7A 3KWTA 5E5UB 3QYMA 2B9AA 2XPZA 1IGJB 1M57B 4G9FE 3CIAA 4KQ3L 4AL8L 5D6DA 2P5PA 4E42B 4L3CB 5EU7E 2GIYA 4PB9H 4LARH 1UH2A 2VKWA 4PJ5E 1W72A 2ZP0T 3JWNH 4W4OA 2PKDA 3X11A 3LD8B 4J3SA 2PWFA 4ZDHA 3RY6C 4EI6A 1FFTB 3PF2A 3MV01 1S7WB 3SKUD 1RZIB 2HT3D 2VDLB 1PBYA 3QH3A 5I8OH 3ILQC 1H9VA 4MKMA 1FVEB 1VACA 4GG8A 3QZBA 3QPQC 5HSFA 1V27A 1D5XB 3QXVA 3C6EA 4KO9A 2VXSH 4Y2OB 3HBPA 4ZQTA 3U36A 1KB3A 5AW2B 4Z7UF 3ZTJG 3ARDA 1TQSA 3UAAA 4LCCC 1FNGB 4PJXE 4WI2A 1PJ9A 4XCYA 3B6SB 4WAFA 1TZ8A 3BPNB 5EIIB 2OSWA 4B9JA 3U2SB 4JVPA 1G7HA 1UVQB 5BW7C 1OB1B 3S5YA 3AZUA 1JZDC 4L29B 4RFNB 3U25A 2YAMA 2XWXA 2YHGA 4BIKA 4PJFB 4OB5H 3K8KA 3KLHD 1IQDB 1HSAA 4HJIA 3L81A 4OTXH 1B0IA 3WYRA 1P7BA 2WXRA 1X5JA 4AGLA 2KZWA 5C09A 4X6EA 1IAOA 3IGAA 3MKGA 1RLWA 1I1RA 3MV9A 4QGTA 4KXZH 3T6VA 5IW6A 1HZHH 1G0YR 2IPUG 2AJUL 2V4LA 1FDLH 4GFXA 4QRRD 1FFNA 2ICEA 5CINL 5FM5O 3G6DH 4HV8B 4P5TB 4S1SH 4HCRH 1MHCA 4H1LB 2HT4D 5DLLA 3KS0H 3DROB 3K4ZA 3L08A 4FYSA 1T2QL 4PWKA 2MQCA 3OSVA 2AJVL 3CDYA 1E8WA 3D0LA 1P5UA 1AGFB 2ZSVA 2Z7UA 4LPUA 1AY1H 4PB0H 1ZHKA 4QT5B 2ESVA 2NR6C 1VHPA 3N42B 5KS9B 4A38A 1S3KL 1I3GH 4MA1C 3Q0HA 2QMJA 1ZIAA 4ODTL 3VGDA 4BRJA 5GGTH 4WUUA 5IROC 1TJHL 4G70B 1TTRA 3NCBB 1J9CT 3SDCD 3BVXA 4DKEH 5CJOH 2YRLA 1GVIA 3G9VA 1PG7X 4MNQE 1KLGA 4QGYA 4UBDC 2CJSA 2FNWA 3BAEH 2K0RA 4W9FC 1N8ZA 3VSTA 4UM9B 1JMZA 1FL6B 1W15A 1SXZA 2OXHB 3PWUA 3P73A 3S35X 4Y2DA 1NSNL 1E2WA 2BS8A 3IGFA 4I88A 5EBMB 4QRRE 3VRLF 3UTTD 4XB8A 3WKNA 3MNVA 3ZDWA 1MXGA 2Z31B 3MJ6A 1K85A 2OJ1A 3BIAX 3EG9A 3KPPB 3KJ6L 1KOAA 3MYJA 2W9EH 1D3CA 2OW7A 3UBXB 4ELMA 3GC3A 3RUGE 2DIAA 1F1GA 1VB9A 1DO6A 1HILA 3BOVA 3C2AH 3HE6D 4XWOC 1KCWA 3T4YB 3VXPA 1B90A 3BSGA 2P48B 4OLUL 4TQHA 2HUHA 1R4XA 3H2WA 3S98A 3HBZA 1Q0YH 1TQCB 1A2YA 4HS6A 2R0KH 4L8CA 4E9YA 1IBYA 3GSNB 1VZGA 5F7MC 2YD5A 3NJGA 4AM0B 4OJYA 5D1XB 4I7ZC 4MCZA 1JNHB 5B1CA 4GLRI 4CKVX 2VLLA 5I8KL 4QHKJ 1NGQH 4U6XA 3ZKNC 4XP1H 2DJUA 2Q7NA 1T0NA 4D0DB 4RGND 2Y69B 5E8EA 1B2WH 3FU7B 1GCYA 1MCPL 3ECUA 4MXWL 5DURD 3WO3B 2NZIA 1YVLA 1TZHA 3UTTE 1TTGA 1K3ZA 4OM0L 4BUQA 5B1JA 1XHHA 2WXGA 3V0VB 3HUJE 1J7VR 4Z1PA 2XACC 1QUNA 2EDOA 1H15A 4LU5H 4IQHA 3P11H 2I24N 4X8JA 3TVMC 2XTLA 4LKXB 4DOHE 2WBJC 3LOWA 4U1SB 2C7FA 1F6AB 4N2FA 1U8KB 2IDTA 1I9JL 1VENA 5TD4A 4YQXL 4NDMB 2Y1ZA 1N26A 1N3NA 3ZTJH 3CFCL 4MWFB 5TK4A 2KH2B 1J1PH 3BN3B 3BO8B 3CX5K 4MNGA 4G6JL 4BINA 4XAWH 4WHCA 5LG6A 4FI6A 4MZ2A 1JN6A 2NTSP 1BD2B 4XE5B 1ZA6A 3KL3A 1NMCB 4PV8B 4YXHL 3IXAB 3V0HA 1KULA 1S7RB 3IDUA 1CLZH 4HALA 1E4XH 4KNSA 5AQ0A 2D3JA 4OGYL 4XH2A 2AEOA 4BA0A 4PYHA 2K78A 4PRIB 4OF5A 3TNMB 4XXWA 2ENJA 4F9PC 4KVCH 2H2PD 1IFGA 4C4KT 2BINA 4MMZA 2AQ2A 4MD5B 2Q7YA 5JW4Q 1IC0A 1FYTB 1XIWB 4QHMA 2LAGB 1OP5K 5BS0A 1X4YA 3K80A 1U8HB 3ZKMD 3FCBA 2F74A 4PI2A 5FHAL 1JL8A 5FW8A 5KYUB 1OAKL 2IANA 3QZWB 5KSAB 3WNNA 4WFHE 3T3PE 5TE6L 2AGJH 5HHMD 4MX7B 2XFXA 2C4FU 4WF7A 5CJQL 1SHSA 3QUMA 2OJEB 4UV7L 3ZL4L 4EN3A 1BEYH 4CKQA 1LO3L 1NL0L 4X6FB 4G7QB 4UTAH 2Y3AA 2QQQA 3C5JB 3SJVA 4WUUD 4Z7WB 1A7OH 4BFOA 3P0VH 3UP1A 5AKTA 3RTQB 4ZD3H 3W2DL 3VFRB 3VFSB 5JDSB 3QO1B 1Z0MA 1V05A 3T8MA 1A6AA 2C3XA 2LU4A 3O45B 4ONOA 4PJ9A 5J8OA 4FE9A 4EO5A 2BS9A 1C5BH 5C09E 3WXWL 3BQVA 3BQUB 3MGTA 1KFGA 1OT1A 2FD6L 2FQEA 3REWA 4Z0XA 4K9EC 1SN0A 1O9ZA 3MV9E 3C5SB 3OF6A 4O2FA 4ZMTA 5GGRY 1GZPA 3KL5A 4FOMA 2FJHB 5C3IA 4XNBA 3UZVA 4YBHA 4HUUB 3TOPA 3U1PA 2WWKT 3BP5A 4CDHA 4Z3IA 1AANA 1SM3H 4IM8A 1BJ1J 3GBDA 2JKLA 4OZHA 4EZKA 1P84J 2HFTA 3L3GA 4I5BB 5AUMB 2XZQL 3LMJH 3DIVA 3H7BB 2H1PL 3EFFB 3KGUA 2VJ0A 4DK5A 5D93B 5E4EC 3FTUA 3Q1SL 5D7LD 1JE6A 1F58H 4E36A 4IMLB 4OV5B 1T1YA 4JANB 1K8DA 5TGBB 2ESVE 4M48H 2AXGA 4QRUA 4PJDF 4G43B 5MERB 2N56A 4Z77A 1PFOA 5KBNC 3VW3L 5DJYA 4JM0A 2VN3A 4PJGF 1MFAL 3RTLA 1D5MA 2ZUQC 3VI3F 4WUUE 2RFXB 1NQBA 3EO1A 3QSKB 3O2WL 1SJEB 5K9KB 3N9GL 1GGUA 2QBWA 3FB6B 4PJCF 3ZTDC 4HKBB 2DQJL 1YUKB 4Q0XL 1MDTA 2WZPD 3NEXA 4OLYL 5DFWH 5F1NB 3HFML 3UH8A 2XYCA 2V8LA 1OF2B 1O6SB 4TPRH 3FN0L 3RLSA 3TEYA 3K71A 3QEHB 4B53A 1OAQL 2H0EA 4R26L 2A9NL 2HRHA 4J28A 5E2JA 3VD5A 2HH0H 5J57B 1YAZA 2RALA 3MCKA 4GW4A 2VXUL 3RX5A 1UH3A 2D7QA 2QV2A 3GMRB 1KCUL 4KZEH 1IZKA 2ZUWA 2CDGA 35C8L 3FQWB 4NC1C 4RMSA 3S4SG 2AEPH 4L8SA 3LQZA 4QY8B 5FUCE 5L6YL 1BYNA 3D9AH 3REVA 1QA9B 4B9ZA 2NY3B 4N0FB 3O3UN 4ELME 3US9A 3GIVB 2YMOA 3FH5A 3CUPA 3D05A 2X70B 4R0LB 4E9LA 1OV8A 1G7JA 2B3IA 3FQNB 3ECVA 1TDQA 4HC1A 5CZVL 2CJUL 4A66A 3AACA 3TT1H 5A2FA 1NWPA 1OVZA 5EB9A 1GXEA 1WUNT 3K7UA 2XQ0A 5LBGA 1EO8H 1VADB 5ICZB 5HVHC 3P02A 3HC2A 3I2CH 4FADA 5CEXA 1RIHH 1QACA 3GSRA 4XMLL 2VERN 2Y6SD 4JNXA 3OXSA 3UACA 1R3LA 3E0GA 1MCSA 4MJ6B 3L3OC 2A73B 4D0BA 1SEBA 3JVFC 1WD8A 5TF1L 3ESVF 4WVRA 4AXWB 3ET9F 4EJ1C 4I4WA 2MKLC 1HJCA 5BUPA 1OARH 1RL1A 2O61B 2EYRB 5DJXA 5D7IF 2D73A 1YCSA 5I17B 1CMOA 3SPVB 1B6DA 2YK1H 3EOBA 4F7PB 2XVKA 5C0JA 1OO2A 1NM9A 4N6RA 2ZYIA 2AZUA 5FOBB 1HHIB 5BS0D 3QYCA 3BXNB 1L0YA 4TM9A 4FQ2H 3V0EA 4ERSH 4B27A 1NUFA 5DMYA 5LBSL 4FEIA 3PWJB 4JJ5B 4YXLH 3LKNB 4MFHA 3R06B 4YFLI 4OJDH 3AMKA 4Y4FD 4U2ZA 4KK5D 4EN3D 3IAPA 4MNGE 2UZYA 2VLJD 3MRDB 4LOUC 1RLBA 5EF2A 1HZKA 1W0WB 2CG9X 4P9HC 2WK2A 2