1E9OA

Crystal structure of bovine sod - 1 of 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
b'ATSAVCVLSGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADSNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oA00
1SXSA 1MFMA 2AQPA 4BD4A 3ECUA 3ECVA 2JLPA 2C9UA 2ZKXA 1Z9NA 1OAJA 1E9OA 3ECWA 1QUPA 3GTTA 3SODB 1XTLA 4A7SA 3KH4A 1KMGA 2ZKWA 1OZTG 1XTMA 1RK7A 2V0AA 1SXCA 3KM2A 2NNXA 1N19A 1E9QB 3F7KA 4U4IA 1F1GA 2SODB 3PU7A 1B4TA 2XJKA 1XSOA 1IBBA 3L9YA 1B4LA 2AQNA 3T5WA 1OEZW 2Z7UA 1YAIA 3HFFA 1YSOA 1COBA 4N3TA 3CQQA 2Z7ZA 4BCZA 2AQRA 2E47A 4N3UA 1YAZA 3H2QA 3GZOA 4OJAA 1SXBA 1EJ8A 2WWNA 1Z9PA 1F1AA 3CE1A 1UXLA 2ZOWA 3RE0A 2Z7YA 4MCNA 3HW7A 3L9EA 2VR7A 3KBEA 1DSWA 4A7QA 2WWOA 2VR6A 1DO5A 1SDYA 3S0PA 3K91A 3MNDA 2LU5A 3H2PA 4A7UA 2GBVA 1E9QA 4A7TA 1Q0EA 5CU9A 4A7GF 1IBHA 3CQPA 2AF2A 1TO5A 1JK9B 1E9PB 1F18A 1CB4A 4A7VA 2R27A 2C9SA 3GZQA 4A7GA 2XJLA 3HOGA 1F1DA 5KBMA 2Z7WA 2E46A 1SRDA 1JK9A 2AQSA 2WZ5A 1E9PA 2AQTA 1BZOA 1FUNA 2AEOA 1SOSA 2WZ0A 2WZ6A 1EQWA 4MCMA 4FF9A 1AZVA 2C9VA 1SPDA 1HL4A 1PZSA 1OALA 1E9OB 1BA9A 1IB5A 2WYTA 3GZPA 1PU0A 3F7LA 5KBKA 1IBFA 3GQFA 1L3NA 2WKOF 2ZKYA 4B3EA 1SXNA 3KH3A 2K4WA 1UXMA 4L05A 2GBTA 2JCWA 1N18A 2WYZA 3MKGA 1SDAB 2WKOA 3QQDB 1SXAA 3GTVA 5KBLA 1CBJA 3KBFA 1ESOA 1S4IA 1TO4A 1IBDA 2AQQA 2Q2LA 1P1VA 1SXZA 2GBUA 3LTVA 3KM1A 3QQDA 1PTZA 2APSA 1HL5A 1U3NA 4BCYA 2VR8A 4OH2A 1OZUA 1JCVA
chains in the Genus database with same CATH superfamily
1YN6B 3DTUB 2V9RA 2C1PA 1FFPB 4YDKH 4M8UA 1C5BH 1NPNA 2WIIA 1MEXH 2AJVH 3FRUB 1QBLH 5FHAL 3RY4A 1BYPA 2YXWA 3BSHA 5IMOB 5JPMB 1R0AH 1TZ8A 1X5AA 2YGPA 5T1KA 4ZS7H 1FCGA 2AW2A 2EIZA 1XFPA 3VXRD 3GSNH 1I3VA 3BLPX 1JPSH 5CLWA 4CUCA 5H94B 5IFHH 2ROXA 1LEKA 2FWUA 4ZMLA 3OKMB 3DX2A 3BCFA 3QXAA 4IM8A 1F4XL 4JFQB 1XF1A 5C1MB 5INCB 3T5WA 2OSWA 2D7QA 4HUUB 2WBJC 2P7TA 4ZO9A 2ADYA 5T5FH 3Q8AA 5KANI 1E7VA 4FI8A 4XO4A 3S8GB 2WUBL 2H7WA 4MQTB 3AY4A 1HT6A 2WSPA 2HFEA 4KJQC 1IM9B 2I60H 5BQ7B 4H4NA 1NEZG 4NZTH 4JPKH 1J8HB 2QV2A 3CFBA 1KIRA 2AJ3A 4C4UA 2DYPD 2OZ4L 3U0TA 2FATL 3O11A 4EOWL 1OKEA 3L7EA 2IH8A 4NM4H 3VD5A 4QRPB 1G9MC 3VWJC 1T0OA 4Z7WA 4J6RL 4AC2A 2LABA 3WU1A 2DQGH 4PGDB 4YSRA 3X13B 4MB3A 2IBBA 1HHKA 4Z1PA 3FQRB 3S5LA 4P9HH 4WTZA 4PP2B 1F3JA 4AL8H 3I9PA 3SGJA 5KSUB 4N0FB 3UX9B 3ISWA 1JYXA 3V0AC 5ENWB 3NSXA 1YQVH 4OI7A 5HYJD 1W0VA 5TPWH 4M7LT 4TUJB 1Q72H 5AW5B 5H35A 4UINH 4OV6F 4YDNA 5AB1A 4MJ6A 4J4PD 2A6DA 1QUNA 2EIDA 4L9LC 4P5KB 4UUJA 2N59A 3EO9L 1DBAL 2OKMA 3WFEL 4NO0A 5HY9A 5E2WH 4N8CL 4HK3N 5K9OA 2RB8A 5SWSB 3Q2VA 5A3ID 4FTDA 2NY3B 1LO3H 3CK0L 4PJAB 4UMGA 3VGBA 5IGXH 1ZDQA 4LSUH 5J12C 3PGCB 3IWVA 4ZMAT 1I1AA 4WI0B 5EO1B 4Z7NB 1EJ6A 3QUKB 2FQFA 1JWMB 5I1HL 5FO9A 4G6ML 5T8IA 3LH8A 4XE5B 2J57A 5CLZA 2BERA 2G5RA 1DUYA 3IFPB 3L3JB 4PJHE 3LNFA 1ROWA 3KPLA 3DTDA 5F7FA 3EBGA 3LCYA 4AQ1A 4Y0GA 3EJZD 3P0VL 3AGVA 3HZMA 3PDGA 2OMVB 4QHKJ 4YL4A 3ECUA 2X9WA 4RRPM 1V8HA 1OCWL 3WG7B 4D7PA 4PJEF 4Z76B 2XBZA 3H3PL 1CR9L 1HH6A 2FYYB 2CJSA 2QVIA 3IDMA 4JKPL 4PRIE 3V6ZA 1NC4A 4N2HA 5HI3C 4HG4K 2V2WA 4DZBA 5I2IB 1XZ0A 3H53A 4WENB 1DLFL 1RY7B 3ARWA 2PYFA 3IAPA 2BVQA 4GMSL 1IUZA 2VIRA 5G4MA 4H8QA 1FNFA 4A2EA 3HIZA 2QLVB 1IFHH 5I1AA 4ONHB 1MLBA 3EJQA 3SY0A 1K3ZA 4KVCL 4IRZA 1VADB 3SDYH 3F58H 4FQIL 1RMFL 3QULB 2KLSA 3FO2A 3PUUA 4XRCB 3ZDYE 2ZWSA 1L4IA 3M7OA 1VIWA 5CFHA 1KCBA 2NUPB 4HLZH 4JFVA 4NP9A 2YLHA 4YPJA 1D7BA 1OAZH 1MQKH 3P4MA 1RZKH 4RWHA 2OQJB 3CLEH 1L3WA 1XX9C 4KTDH 1MIMH 3D25A 3O2WH 3NBNA 3UOAB 3OL2A 2YN5A 5IESL 4WWKA 4JQIH 1G94A 5DLLA 5D9SA 4UYQA 4JANA 3SDAB 4LL4A 4AM0B 5B38B 5IHWA 1Q94B 4C8XA 4TLKA 4E0RB 1DLHB 3CCHB 2ICWA 4HLZG 1JF1A 2V2XB 3QUZD 2R1WA 3GRWH 3RUGA 2EJ1A 4P23D 2YD8A 4OQTL 2G5BA 2FO8A 2CRIA 2CRYA 1D9KB 3HC0B 1GC1L 4DO5A 3EJJX 5F7DB 3GYRA 4ZT1A 3V5DA 1BZDA 4X50A 4IGBB 4ADIA 3GKWL 1JTTA 1KCRH 2G3MA 1GS8A 1RZJH 3BKYL 5IQMA 3D3VB 4G5ZH 1NCCH 4HZ1A 3ARFB 2OXHB 4YXLL 3QXTA 3EGXB 1BX2A 4CC0A 2JWYA 1FFRA 4K7PX 4ZUUA 1O6SB 3LVTA 4TUUA 3RZCB 1N0XL 3QR2A 1SJEA 4MNHA 3WKMH 3MRMB 1DBKH 1FP5A 1T3FA 4KGJA 1ZHBB 2BSEA 2UY6A 1CVSC 3ZKSD 5I19L 4OBSA 4LPCA 4IEFB 3WFZA 1HL9A 1ASPA 3NZHL 4ZG1A 3WKNA 4OI8A 3ILEA 4JPVL 4X7TB 3G6DH 4OGAD 3EOAB 4Y7MA 3L3OC 4MA8H 2WP3O 4MS8D 1ZDSA 2ROYA 3DNKA 4PTTA 3EHBD 4PJ7F 4W6WB 5A2IH 2H2PD 2F15A 1UXWA 3L3KB 3BPLC 3UTQA 3DX6B 3OZ9L 3MCKA 3GUTB 2FR4B 4D0CB 3MYZA 5A6IA 5EZJA 2HJFA 1IKOP 3MBWB 3APFA 4G7YH 3TCTA 4W9EC 4OLVL 4ODUA 3P0YH 4Y2DD 1YNLL 4NBZB 2ZKXA 4IYKA 2YBRA 5FGRA 3LEYL 4HKZA 2EKSB 2J1YA 2VW7A 4NWTL 5E23A 1U8QA 4X8CA 4JNXA 3WY1A 2APVA 4WV1C 4JFOB 2AJYH 1AGCA 1LO4L 5ABZA 3TURA 2Y7SA 1CE6A 1BVLB 5I71B 1EUUA 3LKSA 3RNKB 3U9UA 2JH2A 3GJFH 4KRPB 3TJHC 1I3UA 4KAQL 1IILE 3QUMA 2E4FA 3TT1L 4M3JA 5JYLA 4XMVA 1JDDA 2X5PA 1H3WM 1GIGH 3DBSA 3S34L 3UTPE 3SPVB 3VMPA 3ZDWA 5B8CB 2ATAA 4KO7A 1K3IA 4OI9A 2K4AA 4ZSOE 2CK0L 1YPZB 1I4FA 3HAEH 1OAYH 1AHWC 2VMEA 2YKLH 2DWDA 2HLEB 2W95A 3HNSL 3QUYC 3RB5A 3BT2L 1E5YA 3TCLA 5F9JB 4EO5A 2XQYK 3FTUA 4QHNA 5E2UL 3UTSB 4NPYA 4IKKA 3EXJA 1AZUA 4K2UH 2FB4L 4HG4J 2J1XA 2FHBA 2NY7H 4OIAA 3HG1E 2DQHL 1ZSHA 1MCHA 2FX8L 2Y24A 2AJSL 3PNWB 2PW1A 1BMGA 4KFZC 1M9WA 4LEOA 5CLYA 1D5ZB 2VDMH 1TMCB 3AS0A 4KX9A 1J5DA 3RX9A 4CSZA 3HPJB 4BFJA 3DJSA 3VGEA 2I25N 3CVCA 2IGFH 2O5XL 4G2AA 1E5UI 2WWKO 4TF4A 2DRUA 1MPAL 3NG5A 4FNPA 1O5DT 3FCGA 2K7PA 5IT2H 1ILSA 1A21A 4X99B 3DVNB 4HJ0C 1FF5A 5FM8A 2B59A 3KDMB 3PL6C 4XBMA 4LBAA 1SVBA 4GKZA 3VJ6B 1HDMA 5L4JA 4WO4A 2RFXB 4ADJA 4QWWC 1NUDA 1RZFL 2A6KA 5D1QD 3D9AL 4NLHA 3QQ4A 2P5WD 4E9RA 4F7PA 3IGLA 3M7FB 3K6IA 4MSWA 2B1HH 1KJVB 3G5ZB 3V7AG 2B4CL 5ECJE 3QPXH 3IGUA 4L8DB 1JXFA 3OHXB 4QAMB 1QFUL 3QJTB 4ONGL 1J1XL 4X0NA 4J39A 3AXIA 5D2LE 5D70H 4A2FA 3HG5A 4I1RA 2UV3A 5GGQH 4Y5VA 4KKLD 1KTLA 3FQXA 1C9SA 4F7TA 1UACL 3HC4L 1GZPA 2Y6SD 2XG5B 1E2WA 1FH5L 2R0ZL 4M48L 3MBXL 1XV8A 4XXWA 1YEGH 1UHVA 2AXFB 2EVHA 4HBCL 1L7IL 4JZOA 4L8SB 1TQCC 1UM4L 2APTA 2OMYB 4O9HH 5DC0A 5KZCD 3LN5A 5CJQH 4HAKA 4MLSA 2IH3B 4UT6L 2OBGA 5DEZA 4HT1H 1RCYA 3STZB 5AB2A 1EO7A 2EADA 4TNFA 3OSVA 4KUCD 1UYWL 2FQEA 4AIOA 1ZA3B 1KC5L 3AUWB 3BN9C 3COOA 1BVKA 2ATPB 5FYKU 4ZD3H 2OMXA 4R2GC 1MW1A 5TE6H 4CAGA 3C60A 3FU5A 4NJ9L 1J10A 2PO6A 2Z7YA 2ZCLL 5E8PA 4CMMA 3FQ1A 4X4YB 4BFBD 2VDNB 3ZUNC 1ZSDB 4TNWF 4HK3J 2QPSA 4OFKA 4OM0L 5EOCH 1NC2A 2HT2D 1ZHNB 4MMZA 4TULH 5D2LA 4JFED 1P2CA 3V0JA 2CLRB 3WLWD 3MMEA 2DM4A 2CM5A 4ODWB 4X6FB 4IBVA 3GSVB 1CU4H 1SRDA 3KPRB 1RKRA 3TIEA 3FJTA 3P9MB 1AYRA 4EN2A 1HE7A 1S9WA 4XCCL 5MEND 3L6FA 4PG2C 4WY7L 1U2HA 5CBAB 1KEGH 4I2XE 2ZX9A 4IKLA 5I18L 1QMUA 2AVFA 5BUGA 1NFDF 1ZS2A 4OCYH 1KB5B 2ADJB 2NW2B 4WDIA 3LKRA 3RIAK 1J8SA 3AZUA 3BWUF 2ZOKB 5BZDA 3N6YA 2VN3A 3FUFA 1XH1A 1SHWA 2AEWA 3BLBA 3IAGC 4U1GB 4L3ED 1YYMH 2CE6A 2F8VA 5DJYA 3FFOA 1O7DC 3BWZA 2R2EB 1RIVL 1H5BC 1TIUA 1TU2B 4HGWA 5B7EA 4PLOB 3THML 2K45A 2PCFB 1KLGA 1W0WB 5F1KC 3TBCA 3FB7B 1TTRA 3HHSA 3KPRE 3V4PA 3HRZA 4ZAKD 5KOMC 1U33A 2NPLX 3TZVD 3N1MC 3ULUF 4FQPA 3PQYB 1SJVA 5E24E 4DPAX 4EIUA 2JXMA 2BVPA 3F7PC 4S0SD 1URLA 3MNMA 1JV5A 1Z66A 2ZKMX 4Z77B 4QUOA 2WBJB 1A7BA 2ADIB 4LSQH 2FBOJ 3RL1B 1RK7A 2IOIA 2IXQA 2EZ0C 4S0TD 1WTLA 4XC3H 4YFDB 4AIEA 4ZW3A 5IEHA 5JNYB 3AVEA 4X5QA 3ATDA 2NDGA 4LHUG 2O6EA 1S2EA 4OZIE 1U92B 4JFXB 4MKTA 3KPSB 5DJCA 1XGYH 3MV01 3QH3A 4M7JH 4YAQB 5FKPB 4OSUH 1D3CA 4YX2H 1MIEL 2ZOUA 4IIQC 5F2FA 1R17A 5E6UB 1OE1A 3EGDA 1FZJA 3VWJB 3RVWC 1UOWA 4OLZH 5EIIG 4JG0H 2Q87A 3KNBA 3NAAH 1UXSA 4EE2A 3EJPA 3HUJF 25C8L 4UZGA 1G9NC 3LS4L 2WNKA 5GGTL 2XWBA 4RVBA 2VXVL 3N44B 2V7HB 3OXRB 4A2GA 4KK8D 1OF2A 4FQXD 1ACCA 3FO1A 2KZBA 3CN1A 3GMLA 1GAFH 1IRAY 3KPSE 5LNDA 1E9PB 4GI6A 3CPLB 3OC8A 12E8H 4L9LB 2IBGA 4ZS6C 4YFEA 1F18A 3O4LB 1FAKT 3CZSA 4LEBA 3BO8A 3QDJD 4R0LA 4LF3A 1JUFA 3KPMA 4F15C 4JY5H 3BPCB 3ZTCC 5GRXG 4HEMA 1GZHC 5HVHB 1JRHH 2DQUH 3G5XA 3RWCA 3UBXA 3M07A 4E2OA 3A21A 1CTMA 1R3LA 4O2FB 5J12B 5FO2A 3WFCL 3EYQC 4YHYC 3VRJB 1ZA6A 3ZR6A 4IRJA 5EZIL 1D5IH 3U6RB 4ZOBA 1JZDC 1WWAX 4UQ2B 4EIGB 5C09A 4L8CB 4OFYA 3FRPG 4KNUA 2V17L 3ZK0A 4HOZA 3U6XA 4WWID 4U1SA 3WGUB 1D7DA 1X44A 1IAIL 3CFQA 1WO2A 3EUUA 3WTXA 1P7HL 4ZUSA 4XN1A 1DL7L 2CGRH 3JV6B 4KMTL 5GZNA 3X17A 4Q9RL 3MXVL 2MNUA 4LVHB 1G7LB 2Y1ZA 3BSZH 3WNLA 1G87A 1VFOA 1JNLH 3V0IA 1TVBB 4AI7A 1LP9B 2F19L 3SDCA 5KSAA 2RGSA 3ABKB 3F7KA 1MNNA 2HCZX 1DEEB 2BHYA 1F56A 5I76B 1P0SE 4N2IA 1G7PA 4B9JA 4ZW5A 2BIMA 4PWIA 1AD0A 4XB7A 2WC7A 2B14A 3BHBA 4X8JB 2LV4A 1MF2L 1H15A 1ZXQA 2YPLB 3UCRA 2YS4A 4GMTH 2G30A 2WXMA 3MA9H 1DSFH 2R69L 3BQUA 1SN5A 1Z3GH 2VDOB 3FB8A 4MNGB 4Q9CA 1HXMB 3CBKB 3OJDB 5SWQB 1FBIH 1MHPH 5EFIB 3AQYA 4JAMA 3ECQA 1E8YA 1QKZH 3WS3A 5TK2A 3KYMB 3S36X 4HIHB 4OGZA 5EO9B 3RDTD 4LLMB 3L1FA 2FEDD 3SBPA 1YAZA 3BVXA 4P9MH 4BUHA 1YHPA 1X9UA 4ZFOA 4EKXA 5AW9B 3K8MA 3ETSA 1FVDB 1KPVB 5K59E 2BFGA 5FHAH 2DQCL 5CLXA 1DN0B 1NFIA 3VXNB 2VERN 1PG7L 2X4RB 2NW3A 4ESKA 5E5MA 2O6PA 3ROLB 4G8IB 3FTGA 1CGSH 2DJUA 3GMQB 5JR1L 5LO7A 1F4XH 1M2OA 1OWWA 2CUMA 3CQPA 1KXTB 4I3RL 3HLAA 4HULB 2ZUWA 5BOZG 4M7ZC 1XF3A 4P2QD 5FAAA 3C09B 3SKOB 5CCJA 2WUBH 3BWUC 3MOAL 5DVPA 4G8FA 1C5DA 5SV3A 5KS9E 4KK6C 2GSGA 4XTRD 2NY0B 4JM2D 3X1EA 1WAPA 1HI6A 2BO0A 1BWMA 3ZW3A 3P2TA 2OZ4H 1VPOL 1IGJB 5FDYA 1BD2B 4LMQI 3W5MA 4FFZL 4XNAA 3RWGA 2YGOA 4TSAH 3TBYB 2OAAA 1AOZA 3KE0A 5DC9B 1AANA 4P3DB 4N22A 4XPBH 1A4BA 1GYUA 1RJYB 3ULUC 1YMHA 3DX4A 3EJUA 4QRRE 3BPLB 5F7NC 5HJBA 4ZFZB 1MCDA 3A5VA 3Q7JA 5F3BA 4NI3A 1IGCH 3E6HA 5IW1B 2H32B 3C8HA 4AQAB 3F85A 4JDEB 3DOIA 1KJ2B 1IC7L 4X5XA 3TA3D 3FTSA 1E4WL 2VLRA 4C57C 2MFNA 1ZJBA 4WV1B 3O6KL 4I85A 3EO9H 2OV0A 3WFEH 4ZDHA 1F11B 1WV7T 2FT7A 4N8CH 3BUPA 5TK4A 1YMME 2QHRL 2CIKA 1RUKL 2CCWA 1AO7E 2ARJQ 4GUPA 1E9OA 1M56B 1DR9A 3CK0H 4DOHB 3GXFA 1Q9OA 1E65A 1W72B 3UJJH 1ADQH 3WY3A 5EEXA 2M1KA 3RWDB 4KJYA 2JV6A 1U3HA 3Q8BA 3PU7A 2R23A 4RWYL 2X9ZA 1FZMB 3OGOE 4X6DB 3FQTB 4G6MH 4X9IA 2XA3A 1UQSA 4JE4B 4M7LL 2QVTA 2P8PB 3VCLB 5EU5A 2X1XR 1CFTA 4YGVA 4EQ2A 4LCYA 1AHWB 4BCZA 4GG6A 4M6AA 3QUYB 1WVZA 5AAWC 2QPFA 3DVGA 3KLSA 4ONFL 2F53D 4U3SB 1KCWA 4IIZA 4ZPTB 5DRNA 4ZYKB 4CNIB 2IBZY 5KG9B 3WTTA 2E27L 5JO5B 4MJID 2VNCA 4QRRA 4DOHE 3H3PH 1CR9H 4U0RC 2B9AA 4NHCL 5HBBA 2Y36L 4M6OL 5GS0C 1A02N 5E4IA 3IAQA 3IFNL 3V5HA 3HVNA 4JHWL 2KLRA 3DHUA 4G72B 4XPTH 1SDYA 2EDEA 3CHRA 1OGAE 1KTJA 3K91A 2VZVA 2A83B 4GMSH 3UMTA 4L1SA 3CZLA 4X6DE 1CDCA 4QJ5B 2Q20A 4EN3A 4ECNA 4Y2LA 3TCXA 2QTEA 4F7CB 5ERWA 1A2YB 1NSNL 1KIUA 2V6HA 5BRQA 1YMMA 1RZGB 1R5VB 1AO7A 2VC2L 5F3FA 2NLJB 4FADA 1CS6A 1FGVL 1Z9SA 2V9UA 2W92A 4FQIH 1ITBB 4JHVA 4QHUA 4OU3A 5DYOA 3ZU8A 3OM3B 2DQJL 1UB6B 4KRNA 1GPOL 3LQZB 4NQEE 4M5ZL 3DIVA 4LSSL 3A6BL 2IWFA 1CT8B 5FV1L 1RIHL 1U58B 3EJTA 4JDZB 4G1EB 1QFOA 4X5RA 2XKSA 4FA7B 2MNJB 4LDLB 2DS4A 3GSQB 4UAHA 2X3AA 2NZ9D 3FTXA 2NYYD 3LD8B 3GJFK 4PJEB 1T2QL 5IESH 1S7XB 1MW2A 1ZPUA 4XAKE 3VRLF 4DF9A 4A55A 4FHKA 1NCGA 4Y1TA 4UDTB 6PAZA 3MCLH 1G6RB 1A6TB 4ZTEA 1RUML 4A67A 5AAPA 1RHHA 1U9KA 3OTTA 3WD5H 4WI5A 1WT5C 1RZIB 4OQTH 1CTNA 3KBFA 3PV7A 1JNNL 4KK9C 4MJ5B 4TQIA 2DKMA 4YFLF 1AZCA 3QUXA 3GKWH 2VMFA 3BKYH 3NFNA 3TS8A 4F7KA 2L7EA 4YXLH 3O45A 3H7BA 1NH6A 1QFHA 1Z5LB 1P7QA 1TQCB 2NX5B 3I50H 3I9IA 3PP4L 4F8TA 2PN5A 4W93A 3V0VB 1K5NB 1QI3A 4FN0A 1GGYA 1NKRA 3ARDC 1EXUB 1OTUD 4PJXA 5T1DL 3ZHFA 5FUZH 1EVTC 4QI3A 3BN3B 3BH8A 1B3JA 3FN3A 3OG6B 2FECL 3NZHH 5KJ7E 3G9AB 3CN4A 1T22B 2XKNB 4JPVH 3ETBJ 1Q4NX 4KROB 3UGXA 4JPIA 4R2GB 4WJ5B 1H8OA 43CAA 1RUQL 4Q74A 1JRHI 1WFUA 1NIEA 3QUML 3HS0A 2UZYB 3OZ9H 3ZKND 4FFVC 4Y4KD 4ELMF 4JB9H 3AREC 3CLFL 4OLVH 5G5DB 3U0PA 2DTML 2VN7A 4HX1A 1MAKA 1YNLH 1JHTB 3SDXF 3V0FA 1HTYA 1HS6A 3GK8L 2V8LA 2LFGA 1ZIBA 2XU9A 1BQKA 3CFUA 3QC5X 1FNEB 1TNNA 1IE4A 1J05B 4H40A 1BJ1H 1WE5A 4BH7B 3IWUA 4OT1L 1LO4H 5BS0B 5FB8A 2ZCZA 4TSBL 1P53A 5EU3A 3W9EA 4ZFFA 5EEYA 3UIYA 1A65A 3KJ6L 2A6JA 3AS3A 4CKVX 4I89A 4TKWA 1KT2A 2L0DA 3K1DA 4KJWD 4LPXA 4KAQH 4KHTH 1XSJA 5AW2B 2ZSVB 3TT1H 5K69A 3KYKL 4ZUVA 4IDJL 3I6LE 3ULVF 3T1FA 3ILPA 1EQWA 4JGNA 3JWOC 2CK0H 4DEPB 2XZZA 2ZKHL 1EZLA 2X1WL 3I6GA 4X9BA 2VM3A 1H5BB 3HNSH 5IROD 1QRKA 3LV3A 3P30L 2J12B 3FQNA 5E2UH 3M46A 1PNCA 2BSSB 1L3NA 5E8OA 1S8DA 1GGIH 4FEMA 3MLUL 5IB5A 1INQA 2FB4H 2Z8WC 3ILDA 1JPFB 5HHNA 4DAGH 3MLXL 2DQHH 3ARBB 4CC4C 1M1XB 2AQ2A 3ATEA 3O8XB 2ED6A 2FX8H 3D18A 2AJSH 1PJWA 2OMTA 1E7UA 1NOAA 5D72L 5D1ZD 4K7PL 3H4FA 1F6LL 3DIFB 5C0FB 1U8MA 2DJMA 4JLRB 3EUDA 2CDEA 4JKLA 1FI8C 5EPMA 4GXFA 4UU9A 4YDLB 2EUWA 1CWVA 1HAWA 3VXMD 3FTVA 4QYAA 2KPNA 1TXKA 4M4PA 5EZOL 5CCHE 2O5XH 1KJMA 1CLZH 1ETZB 2YRBA 1Z7JA 3N5AA 3RB7A 4I77L 2X28A 4P2RB 4UBDC 3L2LA 3VQ1C 1F00I 4IIQB 4G42B 5LWYL 2HA1A 4DQAA 1K8DA 1NA8A 3TEWA 1RU9L 1RZFH 3QNYA 3D9AH 4Z3HA 3TO4C 2HAZA 3KWTA 1IQWL 2Z7UA 3C6SB 4I9WE 3UTZB 4Y4HD 4YK4C 4CVXA 2B4CH 3QG6B 3V10A 4FCHA 4LPVA 3CFDA 1ZWIB 3QNFA 4LOVA 3WTSA 1NCHA 2ORBL 3WNKA 4RGMC 3HB3D 3HR5B 1QFUH 2MWCA 2Z8SA 4ONGH 1YEFL 2KS0A 5D4JA 3IJEA 5IY5B 1P84K 1SEBA 3NDZE 4MD5B 4AYFA 1WHOA 1TJIL 1BZ8A 2ZQKA 2H0PA 5DZOA 3DVIA 3SE4C 4MNQB 2FLRT 1UACH 3HC4H 1LDPH 2QDWA 4QYOA 2R0ZH 1JOIA 2J6EA 4GRLC 3MBXH 4HWEL 3FSVA 4M48H 4AUYA 4J3TA 3SKMA 5IKCB 4F15B 3DX7A 4XVUC 3BDYL 2HFGL 4FJZA 2AANA 5KYUB 1U8OB 1AHKA 3CDZA 2QADC 4HBCH 1L7IH 1WYJA 1OPOA 4YHMH 3TEYA 2DI9A 1SUJA 4UYPA 3OR6B 2AF2A 2LLNA 1B90A 3SD5A 3WXVH 3KMDA 1VACA 4ABQA 4E5XA 4YHYB 5DFVC 1HHHA 4IU3A 3VU1A 4UT6H 4N90D 5GGVL 1BHGA 1HHIB 4PRHD 2A74C 4EUPH 3UO8B 2N1KA 3FT4A 2ITFA 4UT9H 5IIEB 3TBVB 2FSEA 1G84A 1IKNA 1F5WA 1KC5H 4M00A 2X0UA 5EDSA 2UXTA 3IGAA 4C56B 4R4NC 2F61A 4LCIH 4Z7QE 4X42A 1I1CA 4WFFD 2CHZA 3ZZLA 2IH1A 4NJ9H 2ZCLH 3L48A 4JRLA 2VDQB 4PJGB 2BP8B 1SBSL 4S1DD 3SJVE 5EU7E 2FJHB 3WENA 3V95A 4EUPG 5KVEE 4ZQKB 5D6CB 4ELKB 1QSED 4N0YL 4NFCA 4YZWA 1R3JA 1OP5H 1KULA 4YEFA 1EFQA 5T1KD 4DGYL 1GGTA 3ARVA 3HZKB 3UC0H 2HRPH 3OZKA 4PP1D 3GJEA 5CMAA 2X6UA 2ZAIA 3GLAA 3WE6A 3CFTA 2RCSL 2AJZA 5JW5B 5GGUB 2QMKA 2VAJA 3V4PL 2IPTL 5CM1A 1PMYA 2WQ8A 2WBXA 4POYA 4UQ9A 4Q6IA 4LDEB 3IKCB 5I18H 2BINA 4PJGE 4OR1A 5MHSE 4ZTOH 4J8RA 4LP5A 3CFJA 3L13A 3FT0A 2YPVA 2WK2A 2GKIA 4W4NA 3CHSA 1OZTG 2D0FA 2OTPA 5EUOF 3VXSE 3NJVA 3WFDH 1QBAA 1WDAA 5G2NA 4J7RA 2BXYA 1RIVH 1ZT1A 2J56A 3BUTA 4MCZA 5C0CA 1AY1L 1U30A 4PJ9A 5I5MA 5FOBA 4LP4A 2E9GA 3HN8A 4HUWB 3SJVA 4A6YH 3BFQG 4F7MB 3IT8D 5FIEA 3QFDA 2FHFA 3RDJA 1B9KA 2KBGA 4S11A 3H9HB 2GHZA 4E42A 3B2DC 1HHGB 4NKOA 1HHJA 5HHME 3KEDA 4PJIF 3GSRA 3WIIL 3IB4A 5KUMA 3TH2T 4LIQE 4EZMA 3BDBA 3R1GL 2DICA 4R5XA 2ITDA 3UJTL 1NFDB 4M7ZB 4KKNA 1RZ8B 4OKDA 4YNYB 3RNQB 4NO0D 2UWEA 3MLPA 1DO5A 1TZOA 5D7IB 3A67H 4AY0A 3UAFA 4AZ8B 4XNDA 3VVVA 1TZIB 2I7OA 4OV5A 3OAWA 5C70A 5JOFB 1I1AD 5HI4D 3T3PF 4EI6A 4AXWA 2LU3A 1MIEH 4WU7B 5IJKC 4L8BA 2GTWA 2VQTA 3GSOA 3Q1EA 5KYYB 5C0IA 1OGPA 1QLFA 5EV7A 1QVOB 3VXSA 4C83B 4EJ1C 3A6OA 1QFPA 1J18A 1E3XA 5LGHL 2I32A 3OD3A 3LS4H 3I75B 4OUOA 4OCSL 5GGTH 4YZFE 2WJ7A 5B22A 1P84J 4A1RA 3WUWA 2VXVH 1OCZB 4RCAA 4PBDA 5D7IE 1Z5HA 5AYTA 1TENA 3ZE0E 4LGPB 3SZ6A 1QHQA 3T2LA 1NC4D 4F24A 4K3EL 3FB5B 1ZGLA 3DI3B 1PZCA 4JFYB 4EI5A 4F37K 4JGJA 2PW2A 4HPHA 1IC5L 4F80A 4PVNA 3L9RA 3X2QB 3V5KB 4OY9A 4GO6B 4POZD 1Z1WA 3Q01A 4LXFA 4G9FB 2XRAH 4I13B 1A9EA 2GTZB 2MHAA 5DD5L 1MHEB 2X4SA 4ZXBA 3WFCH 1ND0B 4OFQA 4L1HA 3NGBC 2B1OA 1NUGA 4M7KH 4NLAA 2ITEA 4YPGA 3UIZA 1CICA 5E2TL 3WFHB 4DGUA 5I1EL 5AVQB 1GYAA 3G5VB 3HUJB 2JCCF 2RTTA 1MCBA 5CIPH 4ZPVA 3KL5A 4XH2A 5HGGS 4OUUA 5ESAA 2OYPA 1LE5A 3PRZA 3RY5A 1IAIH 4FKHA 2IDTA 3V0DA 2LR4A 1N2RB 3BCDA 3CHXA 4WWKD 4AQEA 4K9EC 4Q9RH 4JO4L 3MXVH 3N04A 1KXVC 4FX5A 5L8LB 3MV9E 1FVCB 2KLTA 5B39G 4G9FE 3TVMD 3ECBA 4XBGB 2LTQC 4U0RB 4IS6A 2KHAA 3DO3A 5C0AB 4B97A 2F19H 1QLRA 4EVNB 2XTJC 3IMUA 3QCVH 4RZCA 4Z7VE 4P04A 2X2HA 4PRID 3CN0A 5A40E 1T89A 3NIGF 3RWEB 5EBWA 4U49A 1Z32X 1U8HA 4F58L 1B6DA 1WAEA 3IDIA 5LGJA 1T0PB 4X6EA 1XCQA 1J1PL 3TN0B 4LK4A 5I1IL 1MF2H 4W4OC 1CPUA 4A7QA 3D05A 3GIZL 4KXCA 4NQCE 4N2FA 4OD2A 1MFAL 3RL2A 4X6CA 3UTTA 4QLWA 1N0LA 1UEYA 3UYRL 2BSED 2C3VA 5LXGH 3GI8H 2QTVA 32C2A 5C0AE 4FYSA 1HSAA 3P73A 3KHOA 3P3RA 1N8ZB 4X5WA 5EN2B 3STLA 1HZKA 5GS1C 1N70A 1S7RA 4NOFA 5AOKA 4NDMB 3GEWB 4F9PC 3D33A 5AVSB 2FT6A 4PRNB 2DD8H 3I85A 1K8IA 2DQCH 4MAYC 5CN1A 5KN5B 2WN2A 3EH5B 1TCRB 1CD1B 2OCJA 3LS5H 1PG7H 2CDGA 3MV9A 5AOMA 3VWKA 3QWRA 1KTCA 5GJSL 1SVCP 3NSFA 3IVKA 2Y2WA 2NSXA 3NSYA 3X1FA 4YSQA 1A7QL 5JR1H 1DDHA 1IAOA 3QJSB 2ESVB 3VFUB 1P4BH 1UWFA 5E8NA 1JVOA 4E9YA 1MN4A 5KYWB 1MWAA 4I3RH 4HAFA 2CZNA 3SKNB 3OLDA 1S78C 3MRQA 5DRWB 5GGRB 4UOJA 4QHMB 2NY4C 1A6ZB 4KY1H 1UC6A 1EK3A 1U36A 3MXWL 3MOAH 4NNPL 3LNEA 4DSYA 2DWEA 5IQNA 3R8BB 1T5WA 3O3EB 4ZUWA 2C9PA 5GJTH 3LN9A 4P3WA 1OSPL 4NXKA 1UWGL 4M1CC 3ARDB 4N5UA 1MCLA 5AD0B 2H26B 3BVNA 2VDOL 4GAGL 3HA0A 4OZHF 1AGEA 4Y1SA 3WN6A 1AYOA 2EEDA 4QKXB 4WTQA 1CFMA 1OSYA 4IHOA 2P5PA 1GRWA 3UGUA 5C0EA 1TR7A 2BFVL 4JGUA 1XMEB 1S5HA 2DBLL 3HJ0A 2JJWA 1FG2A 1UH3A 2Z31A 2G2RA 5FPIA 3V52L 3MV8B 4E9QA 2X2JA 2GAZA 3MRBB 1IE5A 4TMPA 2BNQE 5KOVC 1OHQA 3ZQWA 3AREB 5HHOE 4UB0H 3F64A 4NUGL 3FTWA 3DJ9A 1URZA 2H2SC 3D34A 3DUUB 1B4RA 3RWIB 3PP3H 2Y3AA 3UBHA 5F7AA 3D39A 4XNMB 1IC7H 5BOPA 3HNVL 5F9WC 1E4WH 1M05A 2KMWA 5M7QA 1GGUA 1KV7A 1NM9A 4U7KA 4UNIA 5F1OB 2D03L 4KUZL 5T3XE 2TRHA 2GIMA 4FZEL 1RUKH 1WP6A 4H5SA 4M5YL 5EO0B 3UYPB 3FONA 1ZT4A 3QO0A 1X7TA 4N85A 3BP4B 4A04A 5IMOA 1BQSA 3MV8E 3S36L 1J0YA 4P05A 3UDWC 2VWEC 2PXYA 1B9ZA 5J5EA 4RWYH 3BI9X 2WINA 2YLKA 5H94A 2NY1D 4MA3B 4XNUL 2RA1A 3KXFB 3OKMA 4CJ0A 4WHTB 5KSBE 1G9EA 3FOMA 2F5AH 5INCA 2EXWC 3QDME 2ZYIA 1I7ZA 4HUUA 3T1WA 3LH9A 4XP4L 5FHBL 4DKDC 1H6FA 1DQLL 1G7QA 4C47A 4XWGL 3CZNA 4ONFH 5C7XL 5E4EC 3WNNA 4KOCA 3HE7B 4R96B 4FFYL 4NOBA 3T3MF 3DX0A 2E27H 3RWHA 1XIWC 5GZOD 3DRQA 5C0DB 3IRZA 1JI2A 4NHCH 1J8HA 3T6QC 4KZEH 5GSVB 1CGVA 4HUVB 4GUQA 3IFNH 2VDLL 3INUL 4M02A 2PWFA 2WYTA 4JHWH 1N7MH 1G7JB 2YD7A 1QSFE 4QRPA 5TF1H 3QB7C 4N2MA 4BKTC 4HJ1A 3UGEA 3V6FB 5LBSL 3WAJA 1I82A 3RY6C 4PGDA 1Z0MA 3X13A 4XWOC 3O3AB 5SWZB 3FQRA 4OCNC 3PHOA 4HA1A 5I17B 3CDGB 3PWPE 4ETYA 3PHQB 4XC1L 4PP2A 5C0NC 3H1ZA 4AIXA 3TJPA 5KSUA 2VC2H 1FGVH 2ZYHA 3RI5K 2CLVA 3NIDF 2F5BH 4PS4H 2DQJH 2LAGB 4BZ2A 4DETA 1SF3A 3LN4B 4LSSH 3A6BH 4M9OA 3Q6GL 1EHNA 1ZE3H 4JG1L 2F1BA 3C75A 2H3KA 2J5WA 1IAIM 4FTVE 5KSBA 2YAQA 1CBVL 1HNFA 2HVJB 1O6VA 2UYLA 4U0QB 3QDMA 4FNLL 1T2QH 3C60D 4YK4B 2PO6D 3B8SA 4M1DL 5SWSA 4Y9EA 1VEPA 2QQNH 3F6IA 4PJAA 3C6LA 3TBTA 2DAVA 2XBTA 4JO1L 2AITA 4NZJA 2FWSA 4RGMB 5D1ZI 2DL9A 3NEXA 3PGCA 4LU5L 5IB2A 3IDGA 4GPVA 5TDOB 1CD8A 1RP9A 3ARSA 1SQ2N 3CZFB 3BEVB 3IPBA 4GQQA 2EYRB 4JBSA 3QUKA 3T0VA 5ABDE 1JNNH 1JWMA 2CJUH 4HSQA 2GEQA 3ZL4L 4UM8B 3KPOB 4L2LA 5F7BA 2P26A 4P9HC 5I0WA 4AL8C 4HJGB 3N9GH 4KKPA 3E9UA 4OLYL 4GRLB 3HHMA 4HSAC 3RVTC 4L3FA 3S7GA 1VENA 4I3SL 5GRVK 2QADB 2FJFB 1OTTC 4HC1A 4HHAB 3GO1L 5AAMA 3PP4H 3D5OF 4K5OA 1HQ4B 3SD2A 1TJGL 5T1DH 1DZ0A 1Q1JL 1EVUA 2A74B 3UAJD 5LAXA 1FFOB 2R7EA 4NQXB 3GBLA 5I2IA 1A7OH 4AM0Q 5JDJA 4JZJA 5CU9A 4A7GF 1L0QA 3K81A 1AZNA 3QIWD 4OLWL 2EDRA 1HZLA 4GRMB 5L2KE 3I6KA 3NOIA 2JVUA 2OP4L 1IMHC 1RUQH 2O61B 1JFHA 3NCBB 3QUMH 4XCYA 1MCPL 4RQQB 3BX7C 1MG3C 1YJDC 1IGYA 1FO0A 3CLFH 3QULA 1ACXA 1BM7A 3T0EB 4XRCA 3TEZA 2YRLA 3GK8H 5J89A 1CXFA 2RAMA 4NFDA 3DIDA 3U1PA 4LQ1A 2QFPA 3BT0A 4NQQA 4P2OC 1UG9A 3WNMA 4K3DL 4Y16B 4ZNEE 4OT1H 1IAII 3EG9A 3WJJA 4B3EA 1NCBL 2FZ3A 2IAAC 4TSBH 5B38G 1WAAF 4QHLB 2DOCA 2FRGP 2EC8A 1OSEA 3KJ6H 1Q94A 1WD8A 4E0RA 5CLTA 4HJEA 4PU2A 4GIAA 2AMUA 2AFNA 1NUNB 1NFAA 3AM8C 1ECYA 3UFIA 2C4XA 4OCWH 1Q1PA 4IDJH 3NN8B 5DTFB 5IBTL 4DPRA 2Q86A 4Z78B 4JRXA 2X7LB 3X3GL 1D9KA 2IQ9L 3JQOB 4MWFA 3T0EE 4PJFF 4AEIL 1JNJA 1SQMA 1N59B 4OIIL 2Y07L 4OTXL 4AYGA 2ZKHH 1OW0A 2CCVA 3ERXA 1R6VA 1ECZA 2D31B 2OXHA 3TA4D 3EGXA 1OAXL 4TTGA 3P30H 2GJ6E 5L2KA 3MUZ1 2QHLA 5ES4B 2BMKB 1MCKA 4DKTA 1AQHA 3MLUH 4PWKA 4PJCF 5F93C 1RZKC 4JVUA 5C9KA 4FD0A 3MLXH 1BOYA 1ZHBA 4P4KD 3P02A 4LBEB 3ZMNA 4S1SL 1OAQL 1YYLL 4K7PH 4D94A 2Y7QB 2VDPL 2VDRB 4H8WC 2E7MA 1EAQA 4X7TA 4E41B 3EOAA 4F2MA 2DMGA 2R1XB 4G83A 4G9DB 1PLGL 4GAAA 5T1MA 3OF6D 4GFTB 2ICCA 3MKKA 2Q8AL 2C34A 2WXIA 4YHPA 3W39B 5TQ0L 4TQHA 4TNGA 4ZNEA 1OP5K 4B0MB 3GB7B 3L3KA 4IRSA 4PRPB 2KZKA 2ZXEB 3DX6A 2FR4A 1OK8A 5EZOH 1ZANL 5TQ2L 4MZ3A 4D0CA 3MBWA 2WBKA 4JY6A 3IETA 2WQVA 4HCRL 1BJ1J 1RZJC 4IRJD 4RGNC 2EKSA 2XX0A 4FMKA 5DVLA 5IVXA 3QZBA 5LWYH 2DM2A 3S98A 5C09D 2WW8A 4LLDA 2CO3A 1RU9H 1ZLEA 2DIAA 3H55A 4U1MB 1QA9B 1JGLL 3PV6A 3CPUA 5IJCC 5IVOA 1A7NL 3NJIA 1MZZA 2XHNA 3WAKA 4E41E 5KVFE 3F04A 4YDIL 4NWUH 5GZND 5EEUA 2ORBH 2P5EE 4WHCA 3TPKA 4PRPE 3DHMA 1YEFH 2IANE 2UXVA 1JGVL 4HIEB 3NIFE 1CE1L 4B96A 1EPFA 3JTTA 3V9EA 3SPVA 5IJDC 1TJIH 2Z65C 1TEGA 3BUYA 3GWJA 4O58L 1PZSA 2E56A 1CFNB 1R19A 3CLWA 5GS3A 5KSAD 3SDCD 1IL1B 5J7CC 5DD6B 1YPZA 2XWJB 3IDXL 1RAMA 3PDDA 1IB5A 2MIZA 3AY2A 2ZSWA 4W9DC 1K6QL 5JZ7C 5I26A 3BDYH 2HFGH 3MX0B 4QXUL 2X4TB 1G6VK 4P46A 4R8WL 4UM9A 5I9QB 5IB3B 5CU5A 5F9JA 1WUNT 3K1KC 3WKPA 3WDJA 3UTSA 2QGCA 5M94B 5I5IA 3DGGA 5GIRB 5GGVH 1MNUL 3CFMA 5F21B 3UXFA 5B7FA 4P2YA 4BSWB 1BECA 1IGIL 3NGBB 3SDDC 3WEAA 1JG9A 4KO9A 5CKGA 5FOJA 1Q0XH 4HZLB 2VLJB 1D5ZA 5GQBA 1U8IB 4J4PC 4NCDA 1MFMA 1SBSH 2V8MA 4JO8A 4OKVB 3HPJA 5DJDB 4YSSA 3GMRB 1T04A 2I24N 3AABA 2GUOB 3EBAA 4HCIA 4DGYH 2E7LA 2LTQB 2NR6A 2Y5EA 5CEYB 3UZVA 3IJSB 4D9RE 4BIKA 4X99A 3DVNA 3Q2CA 2DKUA 1U2YA 3CVHB 3X12A 1I8LC 3B4NA 2C4FU 4TL4A 1B4LA 4WEUD 1JS4A 2RCSH 3CFNA 2RFXA 3VSVA 3ULSB 4I9XA 3V4PH 2C9RA 2NY6B 3ALPA 2UZPA 2R83A 4NSKB 1KJVA 3G5ZA 2LW3A 4GRWB 1NAMA 1A25A 1R5IB 1WCBA 4IKIA 3BISA 5KVEL 3ZRCC 2E47A 3SYQA 1RK1B 1PX3A 2AS5M 3EJZC 3MPCA 4L8DA 2W59A 4X4XB 2WWNA 5HDBF 2XPGA 3KVDD 1UATA 1PIGA 3WUZA 1EZUA 3FQYA 5C0BB 1LE9A 1CXHA 4XX1E 5CGBA 3KPQA 3TH4T 3D87B 4FMVA 1T7YA 2X4UA 3NA9L 2D2CC 4PHXA 4GG8B 4JO5A 3V6OC 1SF5A 5D93C 5E94B 2KC0A 2ICEC 4HUNB 3TBSB 2XG5A 1TJMA 5GS1B 1FHNA 2GY7B 2F8XC 5ITBL 2ZZUT 3IK2A 3QNZA 1S9KC 3D8MA 2OMYA 3M88A 4MS6A 2DMCA 2FJGB 1HQRB 2NZIA 3GZQA 3II2A 4GRWE 4MAYB 4AVIA 3DO7B 1GHFH 4FLQA 4GT7A 1DVZA 3STZA 1JK9A 3WHXA 4WUKH 1E50A 3JWDL 2VH5L 2E75C 4DQOL 3E2HC 1G9HA 3K7UA 3UO1H 4JZNB 3WIIH 2OMZB 2AEQL 1YNKH 3R1GH 1Q9KB 2YBGA 1LILA 2ATPA 4G3YH 2VLRD 3UERA 3D69B 4AX3A 2JIXB 2VZ1A 3ESMA 5EOTA 4DEUA 3QXUA 4MDRA 3R18A 1SY6A 1FZKB 3D07A 3KWXA 2NY4B 1FFNA 5HYEA 1IQDB 3QI9C 2YEZB 4G1MA 4FYTA 2AK4E 2EDNA 4FABH 3MRLA 2D3NA 2X2YA 4C59B 1XEUA 2CRMA 1D2OA 1XGQA 1U3HD 3KW7A 3O3BB 4ODHH 3T8XB 1UD6A 2HB0A 3H9YA 4LIQL 2CLRA 4JVWA 4X6FA 3JVGA 4WCYL 4P23C 3FU7B 2EABA 4QTHB 3GSVA 4S1QL 3D52A 3B56A 1DE4B 1ETJA 1EBPA 3GXIA 3L81A 4FULA 5MEOB 3P9MA 4N9GB 5LGHH 2ZXWB 1LEIB 5CBAA 3RGVA 3UG3A 3V4VB 4KU1A 4HF5L 2GTQA 5F9AC 2BRRH 4OCSH 1TQSA 1KB5A 4UQ3B 3SBWC 4BV1A 2XSKA 2A9NH 4QRRD 4RIRB 2ZOKA 5JIKA 4B9CA 1QNZL 2V0AA 3KPNB 1JYVA 2VRKA 4HALA 4K3EH 5IHZB 5IG7A 5F9WB 5K1VA 3T0XA 1BXAA 5H2BB 4K5NA 2R2EA 1H6EA 1IC5H 4U6XB 4UOW0 2D0GA 4WUUE 2YSTA 4G7SB 2X40A 4EN3D 4NQUA 2X3BA 1U91B 1I1FA 1W0WA 3BUDA 5FUOH 3EOBB 4OGAC 5CUSL 4MS8C 5DD5H 1XF4B 3ES6B 3T3PB 2HT3D 1YMMD 1FHGA 3EHBC 3NQIA 1AO7D 4F5CE 1S7WA 3P4NB 3GBML 1J5IA 1BW8A 2ZF9A 5BJTB 3SPJA 1TYJA 2IOOA 3MLVL 3PQYA 4GSQA 1MHHA 2WLZA 2AK4A 3M1CA 2JKXA 5E2TH 4P4RB 1AR1B 3AS1A 5DS8A 3L4VA 1JK8B 4Z77A 1L0YA 2A0LD 4AMKH 3P0GB 3RL1A 4K23L 5E5RB 4QXTA 4JCLA 1DQDL 5E4EB 1XH0A 2PYEB 4JO4H 3WN5C 5JNYA 4FLOA 1MCEA 3BZFB 4H2CA 2MCMA 3ZO9A 2AJXL 3NCCB 1XIWB 4PFEA 1U92A 1L9NA 4L4TE 1FAIL 3PE9A 3O6FD 4XPFL 2YSSB 1A6AB 2PETA 1KWKA 5K9KA 2VJ0A 2CDFB 2E6PA 4XVOA 1LWRA 2Q6WB 3FF7A 2HPOA 3LNHA 4FQJL 4LARL 1LDSA 1U8NB 3QXWA 1OGAD 3GSNB 2H9GB 2A4EA 4PSPA 1FYTE 5I1IH 4LCWB 1NEZB 1P7QD 5CO1A 5D7JC 4XMLL 3V0EA 2PYEE 3GIZH 3DGDA 1MFAH 5I8CA 1CIDA 4JEGB 3SYAA 5BXFA 4KV5E 1YQ2A 3L1OL 5K93A 3UYRH 1P9MC 3L5IA 3UEQA 1EDQA 2J73A 2YOCA 4NQED 3DGCR 4PJDE 4Z7AA 3VA6A 3T65A 5HVWA 3FSZA 3BZ4B 4Z3GA 4L0PB 4W6XB 1U3ZA 1YECH 4AYSA 1F58L 3BPCA 3U83A 1PYWA 4HQQH 4EDXB 3DSFH 3TM6A 1IZKA 4ILDA 1O7VA 2AQ3A 4CN6A 3W9DB 1OOWA 4XGZA 2A6IA 1F3DH 1IEHA 1X5KA 4LVOC 3BSGA 3JTBA 1H8LA 5GJSH 4I0CC 3T9WA 3NIGB 1Q38A 2ED9A 5D7KE 1A7QH 3H56A 2XZQL 2J88L 4UQ2A 4DGIH 4F8NA 2WMPB 3F05A 3EFOA 4GNKB 5AOJA 1A3QA 3T8VA 2EYTB 2SODB 2EAEA 5AVYB 1SDDB 1G0XA 4WFHE 3GMPB 4DKFL 4V33A 4IU2B 3MXWH 4NNPH 3JV6A 4J2QA 1EEYB 5D1QC 3VMNA 2VR3A 4RAVB 1G7LA 1FYTA 3ISYA 1OSPH 1UWGH 1HESA 2F54E 4HW6A 1UB5B 4NM8L 2ZX5A 1EHLL 4S1RL 3EYFB 5DVMA 2ADGB 2DEYX 1VFAB 4U1IB 1QRNB 5DK2B 2JKRM 2O6DA 4QRBA 4LLVB 4EEEA 5IUSA 1JHLL 1ZK5A 1O9ZA 4OF5A 3TFKD 5I76A 4XZUB 1ZT7B 2KUTA 2A9AA 3DXAE 2BFVH 4KKLC 3RFZB 1QR1B 3QFJE 3FC8A 2BVOB 2JKLA 4HV8B 4HFUL 4QMEA 3CSPA 1TQBC 2Y6SC 4X8JA 1NMBL 1GS6X 2BSRA 3QR0A 1K4CA 2R0LL 3K2UL 4L9DA 3ZKXC 5I75C 1MXGA 4Q9BA 3TBWB 1TEFA 3BRDA 3GINA 4MNGA 4NUGH 3DRTB 3OJDA 2H4EA 2G75B 3TEUA 1A14H 4MGXA 3KLAA 4HEPG 4M93C 3HNVH 4HZAA 4RAHA 1QRNE 3BIKB 4FQ2L 1K2DA 4HIHA 5EO9A 4LLMA 2P9RA 4BKSC 4KUZH 5JW3L 2I69A 3MZTA 4L37B 4OJYA 4FZEH 4Y1AB 4M5YH 2HX8A 4K4KA 3D2UA 4NIKB 5C2BH 1DQQA 1KOAA 2VLKB 3HRPA 4GP5B 5EMYA 1JPGA 2CG9X 3VXNA 1ZLDA 4ODSL 4LEEA 4NN7C 1DP0A 2WKOF 5EU6B 3ROLA 2ENSA 3FUDA 2F54A 4MYPA 6FABL 4PCTA 1VZIA 3E9TA 4XNUH 3EYVB 4A38A 5E9NA 2RIKA 4I1NB 1DVYA 3TESA 1T2XA 1KXTA 3I6LD 3T09A 2Y7NA 1GZQB 1S7TB 5D7LB 4XP4H 5FHBH 2A9CA 1WZAA 2G4GA 5T3XL 1MCCA 3SKOA 3DXAA 4XWGH 5C7XH 3QFJA 1FV1A 2GBUA 4FFWD 4FFYH 1VLXA 5EZLB 4J5VA 4BFIA 4U1JB 2DZEA 4OFPA 1H3GA 3JVFC 4GH7B 4ZOAA 1MFEL 2EECA 4JFHE 4J27A 2VDLH 3INUH 2V4LA 3SQOL 1BD2A 1OIOA 3ZR5A 3OWEA 5EU6E 5I1DA 2FK9A 5F70A 5CBEB 4GJTB 5LBSH 4HWBA 3FT3B 1CGUA 3C9NA 3L3OA 4JM4L 3VI3F 1X4XA 3H0TB 4K9JA 5BUPA 3Q06A 1NJ9B 3OMIB 1DCLA 5MP6L 4ZFZA 1OSZB 4DH2A 2VE6A 3MN8A 1IGFL 3FFDB 4N8VG 4YQXL 2D7NA 3L7FB 43C9B 3U4BH 2I85A 2Z7ZA 2JFCA 3P1VA 4PGCB 4ZAKC 5B1JC 2D7TL 4JDEA 4BRVA 2CALA 1L9PA 2HFTA 2L7UA 4JG1H 3TZVC 3VXRB 4CGUB 1KJ2A 3U7WL 5FYJU 2ZOLB 4HWZB 4ATTA 5FYLD 3T4AA 1CBVH 3T3MB 1F11A 3OR7A 3DSNB 4FNSA 3VD4A 3WJMB 2JQZA 3P9LB 4M1DH 5FW6A 2Q8BH 1TQTA 3MC0A 3LKNA 3ABGA 5ALCL 1J0HA 2GHWB 3HE6D 2FCBA 5F89A 4QNPF 1Y0LB 4OBRA 4LU5H 2HYMA 2NXYD 3N41B 1IBHA 2C9QA 4CU8A 2R29A 1IU1A 2Y72A 1M3JA 4RX4D 4F20A 1FZMA 4YDMA 3OLEA 5E2JA 5HJ3A 4LVNC 3C5SB 4DP6X 2P8PA 2DYPB 1EV2E 4XP5L 4OLYH 4XNXH 4CILA 2XX1A 3QUYA 2WB1A 2CA4A 3T2QA 5HD8D 1FO0L 4U3SA 1A4JB 3DOHA 3UBFA 4ZYKA 3LRHA 4CNIA 1CDIA 2CLZB 2YKKA 5KG9A 4JUTA 1MZYA 1PY0A 1RURL 1TJGH 1IARB 1RJLA 3U4KA 3R06B 4MXQC 5A2JH 3HTLX 2HH0L 5ADOH 3PYCA 3W0WE 1ZLSL 3MA7B 2ICWJ 4LAJH 1SXNA 4HK0A 4KK8C 5HYJB 4PJ8C 1LL1A 3LMJL 2Q3ZA 4KTYA 2XETA 3GJFB 3ZKMD 3B5HA 1MVUA 2OP4H 2XVLA 5C0CD 5FUCE 4F7CA 5B3JF 2IEPA 1A2YA 4PJ9D 1RUPL 4AGQA 4QRTB 5LDUA 1VA9A 5CJOL 1TO4A 1MCPH 4N9OB 1R5VA 5CHNA 3SJVD 3J07A 2J7LA 1M42A 2K3TA 4MQXC 3QQDA 3HAEB 3CH1A 3AWEA 2W1NA 3P69A 3U4EB 3LQZA 3QE5A 5ID0A 5AOZA 4K5MA 2QELA 2OJ1A 1CT8A 3PL6A 4MQSB 1U58A 4JDZA 4OCXL 3Q2LA 4G1EA 3CSYA 4WGWB 2DL2A 4KKCD 3FQ4A 2ED8A 5LJYH 1TZHA 2QPEB 4K3DH 2BNRB 3IFOB 3GSQA 1DQJB 1NCBH 4MD4B 1EO8L 4PJEA 1X5HA 3S3DB 5CWSB 2JELL 3RWFB 1BJ8A 1KN2H 4H88L 3PWVB 1XCTA 1G6RA 2VXSL 4NCC2 1L5GB 1YAIA 5AB9A 1SYSA 3RIFF 2Y25A 3P77B 1PW3A 4V1DA 5MHSD 5IBTH 4R5TA 1JZ8A 3PJSA 3X3GH 1TITA 4UIKL 2IQ9H 4QOKE 2OYLA 4AEIH 4OIIH 2Y07H 4OTXH 4LLQB 3C8KA 1YA5A 5D93B 2EVIA 4PJBE 2IG2H 4RA0C 4HGKC 1KLFB 4P5TA 1RJZA 3VXSD 5I6PA 1OAXH 1V5JA 2HVKA 3ZE2B 1Z5LA 1BFVL 4BZ1A 4C54A 2NX5A 5KJ4A 2H8PB 2MJWA 4ZW7A 3AB0C 1EXUA 4LSTL 4AITA 5HHPB 3V6BR 3E2HB 5D7EA 4S1SH 2XIIA 5CCKL 1OAQH 1YYLH 2LLLA 1T22A 2XKNA 4GS7C 5DEGB 5B4MD 2ZXAA 2VDPH 5HHMD 3AAZB 4A7VA 2L3BA 4WK4B 2A77H 4OW6A 3HOGA 1PX4A 4WJ5A 2Q8AH 1LWJA 3SYCA 5TQ0H 3RDTC 1H6UA 4UT7L 2FEDC 3U79A 4I1PA 3C5ZA 3MRKA 1ZANH 1GC1C 1FRGL 2I5YL 3NEEA 4ZXBD 2C7FA 1JSYA 2G9HB 4KQ0A 4PJFB 5EBGA 5D5MF 5G5DA 4HJSA 2FGWL 4HCRH 1VHPA 3Q8CA 2ATKA 3R8QA 5T3ZE 1ZGLP 1UA3A 4WHYH 3G6JE 1CICD 4P23B 3BP6B 1J05A 3VI4B 3TTYA 2WLNA 1RPQA 4BH7A 2XQBL 5BS0A 1JGLH 5ACZA 2CWRA 1A7NH 2BHUA 4NHUB 4PG2A 1GJUA 1LNUB 1M6UA 3HBPA 4N24A 4RZKA 1UOKA 4YDIH 5KW9H 5F1IB 1HWWA 1CBJA 3N1GC 1MCRA 1LTXA 4XCFL 5FYLH 4O58H 4XOAA 4QRUB 4PJ7A 2HJKB 2QGDA 2ZD0A 4DN3L 3E6FA 4QF1B 5F0JB 4LCUB 1I3GL 2YAHA 4GSRA 5ESQB 3U7YL 1K6QH 4GSDH 1XR8A 4QXUH 3OKDB 5FXCH 4R8WH 1CGTA 5KVFL 2HVBA 4LKXB 1A9BB 3NZUA 4Q4EA 5HJGA 4QTFA 4CSTA 3WLBB 3VGHA 4U1HB 3EHBB 1VFBB 4UILL 2QMJA 4IJ3C 3QEQA 3VD2A 3R19A 1MNUH 1JPFA 1IBBA 1A1NB 1T21B 4M8QB 4EDWL 1ETB1 1HH9B 4W9HC 3BKCH 3S3CB 1RI8A 3SGEH 4JFZL 3UTTD 5B7MA 1X7QB 4JREC 4KXAA 4ATWA 5ANME 2GC7C 3CQQA 4Y2DB 4XO5A 3DIFA 4WJKB 1FDLL 2N3JA 2X4QB 5C0FA 4O51A 2AQRA 1UGKA 3CIQA 5F1NB 1SNRA 4AVHA 1BCIA 2H6OA 3F12B 1AS6A 1NDGA 1WWCA 4YIQA 4S0HA 4DKEL 2Y0SA 2ZF8A 2QKSA 3WN5B 4YE0A 4X7EC 1M7IB 1ETZA 4XP9L 3NJGA 1CTOA 3MLWL 3I9GL 4JMXA 3SCMA 3MV9D 3VWKD 3OLIA 2MMXA 3QWRD 2DQ6A 4WW2F 1HXKA 2GBVA 5DS1A 4IIQA 4A7TA 3GMNB 3FU3A 3EAKA 5CP7B 4NCC1 5JHDA 2GABA 2XXCB 1AKJB 3UTZA 5C0JB 8FABB 4LHUB 1ZWIA 4NNYA 2YK1L 1PY9A 4HLJA 2X4OA 5D7JB 2ZWYA 1AH1A 1SOSA 3HR5A 5HDLA 2JJTC 1SMOA 4WLCA 4OZGE 2K1MA 1T20B 4BRJA 2A1WL 4JJ5B 4JRWA 1KACB 3MACL 4NQCD 4HKXA 2AZUA 2I9LB 3LQAH 4OVVA 3NJMA 4CSSA 3V2AR 3VXUE 3ZZSA 1USZA 5KYUA 5ITBH 1JXJA 1GZHA 4FEIA 4Q2ZB 1KGXA 2Z31D 4GUCA 1ZKAA 3DURA 3OR6A 5AZ2L 1WITA 2BY0A 3MDJA 1CGYA 3RA7H 5DVKA 3REWB 2OW7A 2I27N 3S48A 2VH5H 1AD9B 2Y1AA 4LLUB 4DQOH 2YD4A 5ALBL 4NRXA 2FWOB 3TBVA 1I7TA 2WM0A 2V7NA 5L88L 2GK0B 1IGML 1T1XB 2AEQH 2B4CC 4NQDE 1SYVB 3C08H 5CILH 5JIIA 2YARA 3IDYC 3SGDH 1BF5A 5E8DL 2VN5A 4CBPA 4BUQA 3FU8A 5D1QB 2J2ZB 4D3CL 2P5WB 1PL3A 2EO1A 5D6CA 5AQ0A 1OD7A 4YBLC 3BMWA 5DLML 1R75A 1AOHA 2J8UE 2PXYD 2QFRA 4K15A 4LIQH 4WGVB 4BCXA 4FDWA 4WCYH 2W9LA 3K71A 2WVVA 3A4AA 3JWNH 4PWFA 1AXTL 4W9FC 5DJAB 5JW5A 1J9QA 5F7YC 5GGUA 3DV6B 4U1NB 1R5WA 2R1YB 4XPGH 4NO5A 2A9DA 3B2UC 3LKPB 2I9TB 5DURB 1E5ZA 2BIOA 4Z7UF 4WK0B 5DD1H 1K72A 4ENZA 3N1FC 1ZS8A 3GLDA 3ZKXB 2VZ3A 5I75B 4QIRA 1ZTXE 2YMTA 4ZFQA 3FW6A 3W11D 5KZCB 2MTPA 3JYCA 4RAUB 1QNZH 3T71A 2BNQD 2IDSA 5ESVB 5I8KL 4IK6A 4M93B 5CJ8A 1MVYA 2VL5B 4UANA 1HIMH 3WEXB 2OTWB 4N2EA 4J1UB 5C08E 2WANA 2BP5M 5I23A 3X1NA 3BKJL 5CUSH 4R7VA 1AQDA 4QRSB 4F7MA 1REIA 4B9GA 2H45A 2WD0A 3GBMH 1PKQB 3H9HA 2MCAA 4TLSA 3SSGA 3K2KA 1RZPA 2P8LB 3MLVH 4LSRH 4QXGH 2ZPKH 4NN7B 3IJHB 1FNLA 2QQKL 4HMEA 3FCBA 1T1ZA 4PY7A 3VFSB 1NEPA 1NIFA 1OGTA 4O2EB 4PLKC 5JHMA 4BA8A 4P5RA 1NFDA 4JFEB 4Y5YC 4G6AC 4YNYA 3RNQA 4K23H 2H3NA 2F2HA 3SZKC 3QDMD 3C5JB 3PCYA 3VM5A 3B6SB 3K72B 4I4WB 3CDFA 2AJXH 3C6LD 4AZ8A 1VEOA 3RBGA 5HJDA 1TZIA 1FAIH 2GJJA 4PCSA 4FI6A 3RRQA 4YDJA 3UZEC 4KJWC 5J57B 3EYUL 1PKQE 3GI9L 4U31A 3LRMA 3MRCA 4WU7A 2D3JA 5KYYA 1PTZA 2R9HD 3IRCA 1QVOA 3ZOAA 4C83A 1TSHA 1JCVA 1QSFD 2HWZL 4XMKL 2W88A 2HRHA 4R26H 2W5PA 4Q8BA 4DK3A 5H4ZA 3NCWA 3RPBA 4K07A 4XMLH 2VUKA 1EFXA 3WIFB 3ZTDC 1ODUA 1I1YA 2IDCA 3G5YB 3PWPD 4I18C 4LCCB 1P69B 4EXKA 1XBDA 4ZAKB 4LNRA 5MENE 4U4IA 3RILA 1MWAH 2DDQL 3TZVB 1BM3L 3FB5A 4CGTA 3KJ4B 4JFYA 3O3DB 2ZTBA 4J3OG 1XXDC 4NC2B 3FO0H 3L3DA 4XVJL 5DO8A 5ABAA 1NCUA 2ENJA 2YD1A 2ADFL 3N2JA 4L1DA 2LU7A 3DV4B 5D1ZC 3V5KA 1AI1H 1ZRUA 4YHKH 5CD3A 1I8UA 4L3EE 2R2CA 1MHEA 2ZAHA 5TE7L 1UKSA 3BJLA 1ND0A 4WW2C 2HN7B 5TDNB 4YJZL 1DSYA 4OJAA 4ZFGL 2WUCL 3T4YB 2N01B 1WBXA 5C8JB 1KJ3L 2XICA 3E7JA 2MKLC 2VLLA 1IZJA 3CZKA 2QDVA 3RWJA 4PVMA 4LRNH 4AENB 2XZQH 5JORB 3EH1A 4NUMA 3G5VA 4G6KL 3HUJA 2Q76B 4KH9A 5DK0A 4TXVB 3MRNA 2IVFC 5J3HD 1C5BL 3OV6A 4JL1A 2Q7AA 1QBLL 2EE0A 1JWUA 1ZVNA 4DKFH 5AAWA 1R0AL 1N2RA 4ZS7L 2ZUTA 4B53A 5ICZB 3GSNL 1SGKA 4PVBA 1OE2A 2DQIH 3IMVA 4Y9CA 5FGCE 1FVCA 3NFPB 4MBRA 5ICUA 4IMLB 4XBGA 4U05A 1TETL 2H6UA 4S1RH 1UURA 1PF3A 5IMKB 4YHLL 4MJ4A 5J9PB 5K9QI 3RG1C 4PJHF 4JRXD 2AQ1A 4MJJA 4EVNA 4FFTA 3LXAA 1JHLH 1KELL 4PJ8B 1ORSB 5CJXC 4FQXB 5T5FL 3EOYG 4BFGA 2B1AH 4E36A 3MLTA 2I60L 1NICA 3FU9A 4NFBA 4NC1C 1S3KH 2D9CA 3BJ91 4G80B 3IGKA 1NMBH 4JPKL 4F27A 3DECA 2R0LH 3QDJB 5IJBC 5L2KD 2ARJB 2K9FB 1KIPB 2APWA 3WEOA 1TEYA 4A2HA 2WZPA 3IU3B 4F1SA 4NBYB 3SGEI 4GIPD 1A3RL 5FDWB 3N40P 5FC9A 5F71A 1H0DA 1GCFA 3VXPB 3D0LB 5LHDA 4FL4C 4FQ2H 4UTBA 2BRQA 2P52A 3DETC 3KG5A 1N8ZA 3AG1B 5JW3H 5EN2A 2IPUG 2O5NA 4YO0B 5J6SA 1NCIA 2OTUB 2UY7B 3LB6D 1IFGA 4PBVC 5F7KC 2X6VA 4NDMA 1KG0A 5DJZB 1QW9A 4PRNA 1BQHB 1WRFA 4IRSD 4JM0A 2VKXA 1ZGLM 5KWYC 1M6OB 4UINL 2OJZH 1EWHA 3ZDYF 2QVFB 4ODSH 3MFGB 1EDYA 4HISA 3KLHD 2FUQA 1WT5A 3VDAA 4AEHL 2EIEA 5JLZB 2XN9B 1HEHC 5FO7B 4HWBL 1ET8A 4I5BB 1TJXA 2ESVA 3VFUA 5DMIL 3TT3L 1U3JA 5KYWA 3BDXA 3X11B 3MRRB 1LO3L 3A4EA 1ZV9A 5DRWA 1XCWA 2DQMA 1A6ZA 1D5RA 5D2NE 5IWLA 2DTSA 1BMZA 3I84A 3L4XA 2EYSA 3O3EA 2GJ6D 3AB0B 4JE0A 1MFEH 3OKKB 3AY4C 4G6FB 1M53A 2BWQA 1SFHA 5T1LB 4QXVA 5TE4H 2CR3A 2OYMA 1A66A 4GS7B 4MQ7B 3EFFB 3ILQD 3VGAC 4ZRGA 4PBXA 3U9PH 2IMNA 4JM4H 1RUAL 2FO4A 4N6RB 4Y9GA 1JZ6A 2ZUYA 4UM9D 3RDTB 3QJZA 1BZ7B 4P46D 3K71B 2FEEL 1QHPA 5JQHC 3FUJA 5CNHA 1D5XB 1VGEL 1SMAA 3BWAB 1F45A 1IGFH 1PQZB 2AV1B 4YQXH 1CG9B 1E4XH 2HX7A 3AREA 3ARYA 3SOBH 3ZN6A 3FL7A 3MHZA 5E03A 1TNMA 3DUUA 4CL7A 3TTSA 3S96B 6TAAA 3SGJC 1U8LB 3N40F 5DJ2B 1JZJA 2BZ7A 1MRDL 2W0KA 2EACA 4I0PC 4BDVB 3SE8L 4R7XA 1WUZA 1MWOA 3SGDI 3ROOA 3NABH 2X70B 2X09A 5DQDH 5EO0A 5MEPB 3UYPA 3CWGA 1U0QA 3ARQA 4TVUA 5CXPA 2CNZA 2XWTA 4HMCA 4PREB 1MUJB 4JCMA 5AVUB 2A4ZA 2VXTL 4Y9FA 3ZDXE 4N2CA 4WFEE 4L05A 2NR6D 4R4BA 1VJSA 8PAZA 1MQKL 4JM2B 1NMCC 1OQOA 4FHBD 1OQXA 2JK5A 5JA9A 2V37A 4IOFD 4MA3A 3VI3B 2IAND 2GSIB 5DFTA 4L2YA 4HS3B 5IW6A 1EAJA 4XP5H 5HI4C 1U8CB 2CHWA 2YQ2A 3Q6FA 4DCQA 15C8H 2AP2A 4AGLA 2VZUA 5C0RH 5HDOA 5HI5C 3PWJB 7CGTA 1FO0H 4FNUA 2VR8A 4R96A 3VXTB 1TFHA 4WIQA 1DZBA 3CUPB 1UUSA 1ZHKA 4IJ3B 4F93B 1RURH 5C0DA 4AQ1C 1GJWA 4P2QE 4NT6B 2D7PA 3GXTA 5DUJA 2HH0H 2W8CA 2XVBA 2CXGA 5GSVA 4CC4A 1XZWA 1XH2A 4HUVA 1EHAA 4JREB 3LIZL 3CIAA 5IOKA 1HILB 1D7CA 1YC7A 4G5ZL 5AZUA 4NN6C 1I9JL 3V6FA 4LLWA 2X87A 3HZVB 3LKOB 3WOVA 5BV7L 3TA3B 4DGVL 5J11C 2XFXB 3WMQA 5SWZA 3WKML 1RUPH 4CVUA 5JIHA 1ZVSB 3PHQA 1DBKL 5AB0A 3K6SB 2WHVA 1INDH 4NYLB 1W80A 2DH2A 4WNQA 4MRBA 2EDHA 4JRYE 5IB4B 3LN4A 1YYCA 3PGDB 1P6WA 3PDOB 1MREL 1DVXA 4FGMA 1BFSA 2WCPA 4ZMWA 1FNGB 3BE1L 3U2JA 4D9RD 1K4DB 3FB6B 4HKJB 2PCXA 3KYOA 1U8PB 3RJQB 5DMJB 3CZJA 3QJVB 4GB9A 5DHVH 3TO4A 2HVJA 5FR3A 4ENEC 1KN4H 4LPYA 1EO8H 2WXKA 1XQ4A 3D2TA 2CIIB 2DMHA 4AJ0A 2X4PB 4XMPL 4AJWA 3GTNA 2VXSH 5MERA 3FOLB 1FA4A 2NXZC 1X3DA 1R33A 3BEVA 3RTQA 4MJIB 4UIKH 3DDFA 2AI0L 3TVMC 3T0DA 2YRZA 3KPOA 4L4JA 1OP3H 3VD3A 3VH8B 1OV8A 3OKEB 5EDXA 4MX7B 3GDBA 5DF0A 1GKEA 2YUXA 1UD5A 1BVNT 3SO5A 4NQVA 1BFVH 1LQBC 5LNGA 2Z91B 1YG9A 1QNIA 2CPUA 5T5NG 3RGVD 4B9YA 1ZE3C 3VFWB 4LOFA 1HQ4A 5JQIB 4GAYA 4N0UB 1KIQB 3KD4A 3VFPB 2FT8A 4LSTH 1O5PA 3B7RL 4FQQB 2A74A 2JKSA 2K4WA 1FFOA 3EO1B 2EQDA 2F53E 1IC4L 3IMRA 2Y5QA 1BFOB 3KCWA 3QAZB 1H3XA 1HNGA 1E28A 4GRMA 1ES0A 5H37A 3IDYB 3SDXE 2O61A 3CJJA 1KY7A 3CXHK 4K2UL 4UT7H 1NBZB 1B6UA 1FRGH 2I5YH 2P46B 3QPQD 3D48R 4RQQA 4UDUB 5L4IA 1P5VA 1UZGA 4YBLB 2EICA 1TKWA 2LHAA 2WOYA 3QS3A 3OGCA 3D0VA 1RVFL 1FJ1B 3V0WH 2AK4D 3HI1B 5GSRB 2VDML 4IW4C 1MI5B 4XNZC 2KQNA 5K39A 1XF2A 1BPLB 2XQBH 4DN4H 1YEIL 4L29B 2W80C 3QT2A 4QHLA 2E9JA 2VM9A 2IIJA 4EUPB 2P3YA 3ULVE 4R83A 1HU8A 3WIHA 4EBQH 4GXVL 2LU4A 1L7TH 1J11A 4YSTA 5G55A 1MCSA 4WTXA 5EC2B 2OULB 3HG2A 4XCFH 1IM3D 5DTFA 5KAQG 3NN8A 5T3ZL 5J6GB 2EUXA 2Q5BA 2A99A 1S9XA 2AAAA 1U95B 1NAKL 3MNWB 4PR5B 2VAAA 5K1JA 1EGJA 3SDAC 3ZZQA 1I3GH 2OX5B 1BJMA 2D31A 4ELMA 3H4HA 3QHTC 2VR7A 5D5MB 2V5SA 3SDXA 3FQUA 4WUUD 2AGJL 1DFBH 4QHKI 4UILH 1S7UB 2LU5A 3EGSB 4LL1A 4N2GA 5EWIL 3M6DA 1MCJA 4EDWH 3RHWF 3BRFA 2W07B 4QGTA 4RSVA 3QXDB 5FO8A 4JFZH 4Y4KB 1WIUA 4IGBC 4KKAD 1CFQB 4YL9A 1LM8V 3ARFC 4GFXA 5I16B 3CMOL 1FDLH 1UTDA 3DBXA 1UD2A 5KBMA 3VD9A 1NAMH 2QSQA 3S4SG 1E40A 3GS4A 4G9DA 4O9HL 4Y5YB 1H3VA 4D0BB 2W94A 4DKEH 3MRFA 4FF9A 3W39A 5BO1L 4N8PA 2GT9B 1AGFB 4DFIA 4LKCB 1HOCB 3JTSB 4FNTA 1KTBA 4ZI8A 2BVEA 3ZJAA 4XP9H 3PWLA 4KH2A 2Q3AA 2EH7L 3MLWH 3T0BA 1NCNA 4ZD3L 5D1XE 2RHEA 1CD0A 5IJKA 2XWRA 4NS0A 5F3HB 4O00A 4MFHA 5EF1A 4A6YB 3DX8B 5LNEA 2NY1C 4U1MA 2XQYA 3VDBA 4AG4L 2EXTA 3Q8FA 4RNRB 2X10A 4OZIF 2YK1H 3ME0A 3PIQB 1D6VL 2EP6A 5G4NA 2IOMA 5LN4A 2OYKA 3SQBA 3MLRL 4G8EA 1FYTD 1HL5A 5IVNA 3QDGE 4AKPA 1R3KA 4HIEA 4ANVA 2R4SH 3N1PC 3LPFA 2A1WH 1T0NB 4LLYA 5GZOC 4FNQA 1CU4L 3U46B 4P48A 1FL6B 3PFUA 1CFNA 5IJVA 2Y7MA 5DD6A 2PWDA 2XWJA 3K2IA 5HDQH 5ITFB 5EEWA 1KEGL 2E8ZA 4JFTA 4PGJA 4N2LA 2JB6B 3FZUC 3KGTA 5D1ZB 3UAEA 4YSEA 3MX0A 2X4TA 4TRPH 5IB3A 3L08A 2ZT9C 5AW3B 4BQCA 5B1AB 2PTVA 2VMDA 2UXFA 3ZMRA 2C3GA 4ANUA 4Q7DA 3RVXD 2E7CA 2B39A 3IKKA 5GIRA 4NEHB 1BV8A 3VXMB 2F7IA 1YYML 2E59A 3BGMA 3QPKA 1L6XA 5ALBH 1IGMH 1H9DA 1JTPA 1I8MA 1JHKL 1B2WL 1DFXA 2VLJA 4YN3A 3CXHJ 5D7KD 4PLJD 4WZ9A 5JYMA 1WZKA 4QCIB 2F74B 5I0VA 1OXYA 2BCKB 2C7UB 1MJUL 4QGYA 1S9VB 3D2UD 1KXVA 3GMRA 1U8KB 2BP0B 2IDFA 4WFHD 5ETUB 5CN3A 4UCFA 2FWLB 5SV4A 3T6VA 4PV9A 3UC2A 2GUOA 3US1A 5KBNC 3S0PA 2F6AA 2VSCA 2BNUB 4ZOCA 3UYOD 1D6EA 2LVCA 4NAQA 3CVHA 3HB3B 5BRZB 2PPEA 2F54D 1N9PA 2ZE0A 4XC3L 5I6OA 2QBWA 3SPGA 4UOQA 1KTKE 3GBEA 4NSKA 2GJZB 5DT1H 5IP4A 4E9SA 5FV2A 1R5IA 3DXAD 3P4OB 3QDHA 2WZ0A 3VX0A 3D1MC 1XGYL 1LMIA 1OGSA 3QFJD 4W4OA 5EUOE 5B39B 1WQVT 3EO0B 5PCYA 1MCOL 4NRZB 2YC1B 4OSUL 2VMJA 1EEZA 3DMMC 3KW8A 4X4XA 5CIPB 4KQ4L 3QEHB 5IF0A 5JMOC 5C0BA 1BMWA 1P4IL 4OLZL 5I8KH 3QJXA 3IDNB 4JG0L 1BD2D 4GG8A 4PRHB 3NAAL 4HUXA 3UAJC 4FL4B 5E94A 5F88A 3KH3A 1SZNA 3U1SH 4UAOC 5FKAB 5GS1A 5FECB 4ZO6A 1HXYB 1OWRM 4H1LH 4MVBC 3QIWC 3OHXC 4XCEB 4W9IC 3AACA 3BKJH 3TWCL 4OZFH 3FMGL 2WNWA 2FJGA 1I8IB 1F86A 1S4IA 4HS8H 1ZTXL 1SJHB 2Y5TA 3BZ5A 2C1PB 1G9MH 1QSEB 4N68A 1F4HA 2QQKH 4UOW1 5E6ZA 3QEGL 5FFLA 2XN1A 2NTFA 4IKNA 1JI1A 4JZNA 1LP9F 2DEXX 5T1KB 1V7NH 4H1LG 4JY5L 2EIZB 1ONQB 3D69A 2G4EA 4N90E 2JIXA 2DQUL 4OZFG 1QPKA 3IE9A 4QEGA 1QUPA 3QUHA 5AL0A 1XTLA 2V5MA 2FJSA 1FZKA 5K59F 4IDLA 2KERA 4X6BA 1P5UA 2COVD 2DPKA 1XTMA 4APQA 2OM5A 5ACLA 1IQDA 4XPAL 1WC7A 4V11A 2B2XL 4JHUA 3RGHA 5E1IA 2ITCA 4OGQC 1T0MA 3ZT7A 5EUOA 5IW3A 2X0VA 2HFEB 1TSRA 3T8XA 5IHLB 1LD9B 3GI9H 1E67A 3GNML 3OKOB 1X5MA 2Y1VA 3MODL 1HFUA 5AW8B 3VGAB 3REVA 3FU7A 3MOQA 3HKZA 4YVUA 2CGRL 5HVGB 3U0TB 4XMKH 2HWZH 5MEOA 1AJ7H 1MFDL 5HYIA 1PEZA 4XN4A 5KS9F 1RULL 2EO7A 4OJFL 2EIKB 3QFGA 4HVBA 3V4VA 4Z7WB 3DARA 2DEWX 4U3CA 4ZMQA 2EKJA 4PJIA 2WXNA 3CX5K 2Y22A 1EAPB 1C16B 4TQEL 1DUZB 1E2VA 4RIRA 3S5LB 3WSQH 4PMEA 2VKWA 1F3JB 2JKTM 3KPNA 4XR8C 1BM3H 1W6LA 2APBA 5IHZA 3V4UL 4QT5B 2BSTA 5H2BA 2NT0A 3ML8A 1AXIB 5H35B 1XR9A 2ADFH 4P4KC 1HJCA 3EFDL 3E1ZA 1HN1A 5DC4B 4U6XA 3TIDB 2PP8A 2W60A 2HTLD 4JY4A 4GMTL 2A6DB 1QUNB 4N1CA 4A66A 1DSFL 3A0OA 3HG3A 5AW6B 1Z3GL 3I02A 4UUJB 2OR9L 1MHPL 3ES6A 1FORH 4NO0B 4R0LC 5TE7H 4B9IA 4DKAA 4ZFGH 1GTNA 2XT1B 5CCGE 4Z7WE 2WUCH 2X05A 3UDWA 2W0FB 5BJTA 4CVZB 3CV5A 3VA2C 1H3PL 2E9WA 1NMCB 5LXVA 2K7QA 4HJ0D 4P4RA 5I0ZA 1BA9A 1A1OB 1T6WA 3LOWA 3PL6D 4P9ML 4G6KH 4IRJC 1JK8A 1UJ3C 3KYNA 4F9LC 1FL3A 3LRSA 2N7BA 2ZP8A 3HEIB 5FO9B 4G7VL 4AOFA 2WXQA 4KXDA 1JYNA 2DKSA 3CHQA 2HFFA 4NUQA 1BBJA 4EAEA 3CFEA 1CGSL 1QZ1A 4AQ1B 2FE0A 1TETH 3VACA 3NP4A 1A6AA 2QPUA 4V1DD 1ASQA 1NGYB 4YHLH 4HKBA 2BSDA 1KELH 4NN6B 3HNTL 2Q6WA 4X5PA 3QORA 1PD0A 3W0WD 1IAKA 3V6ZB 4ALAL 3RY6A 2WB7A 4P5TD 5J11B 2H9GA 3CVBA 3RQ3A 2PYFB 1NEZA 2BVQB 2VIRB 2VYRE 4S2SB 2NX5D 4P57A 3BMVA 4BE5A 2EVGA 1A6WH 4KKRA 1VB9A 1RHFA 2JCCA 1A3RH 5TDPA 3LPPA 3IS1X 3SY0B 4TSAL 3MV7E 3FO9A 1L0XA 3AU0A 4X6DF 2W0LA 2NQ3A 2D2OA 3H42H 4XPBL 2CR6A 4J3UA 1ZHLB 2YUVA 3DJZA 2YQGA 1T7VA 4EDXA 4XCNB 1IV8A 1NFKA 2QZQA 1IGCL 2VZSA 3LZRA 4LLAA 3C5ZD 4PJHB 1JXDA 4JVPA 4QDGA 4JANB 2NXZB 2OMBA 4AEHH 1FE8L 3D12B 3S5ZA 1BG1A 1M4KA 3TVMB 4HWBH 3MCG1 1SHSA 1JF1B 3LEVL 4TNVK 1OD9A 5E1HB 3K4AA 5DMIH 3PABA 1DQTA 3HPLA 3TT3H 3EF7A 5HVHC 2VC2B 1TLMA 4QOKD 5HXMA 2EYTA 4BZYA 3GKZA 1SDDA 3UJJL 4IBYA 1ADQL 1OY3B 3GMPA 4PRIB 5BS0D 5CZKA 4IU2A 1KFGA 3N06B 1B0WA 2BOCB 3U0WH 1DJHA 4E9XA 3SBQA 1BZOA 1UB5A 1QEWB 2NT1A 3EYFA 2PF6A 2WZ6A 3H8NA 4U1IA 2N4IA 4ERSH 3T6ZA 1R24B 3QZNA 4OB5L 5DK2A 2W9EL 2F8OA 4Q52A 4LLVA 5KSVA 2HT4D 4KWUA 3HMXL 1T3FB 1QFWM 5LG6A 3MV7A 2DYRB 2UY6B 4Y7OC 1QR1A 3QRLA 1RUAH 2IADB 4WI2A 4HV8A 3SE9L 4LVHC 3ZDYB 3RUGE 4MCYB 3CC1A 3CX5J 2XNAB 3APCA 4GAFB 1VGEH 5DDHB 1U42A 2EUVA 4PTTB 3QEQD 3QP3A 4XPTL 2G75A 1WPCA 3NPSB 4ZQTA 5EZJB 2HJFB 1OPGL 1MRDH 1YN7A 4XNZB 2AXGA 1F97A 3SE8H 3HLKA 2YBRB 2DMBA 4N5ED 4P2OA 5T3ZD 5INDA 3MLZH 4L37A 1U8QB 2Z3FA 4Y1AA 1IAMA 1DJXA 2DLHA 2VLKA 2EINB 5CP3A 4DVBA 4EZJA 3KGSA 4OZHA 5TGBA 4IMKC 1FN4B 4RGNE 2WO2B 2VXTH 4PJ6A 5JQ6H 4Y2NA 2P28B 1TZGH 5CJBA 4YC2C 3SCMD 1OP3K 1OCRB 4R4FH 2R59A 1FFTB 4MZIA 1J12A 3QUMB 3FCUB 3VFNB 3EYVA 1ED3A 1RP8A 1UCTA 4L4VA 4P49A 1T5XA 4HDIA 1DJSA 1GZQA 5D7LA 2XOTA 3RVWD 1FGNL 5I8OL 5JHDD 1Z9LA 2WLMA 4LFHD 3CHPA 5FCUL 3MCLL 1LJMA 1I4FB 3GXDA 2KZ1B 3WD5L 2EDYA