1E9OA

Crystal structure of bovine sod - 1 of 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
ATSAVCVLSGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADSNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oA00
4N3TA 2NNXA 4MCMA 4OH2A 3S0PA 1YAZA 3K91A 1P1VA 1OZTG 2Z7UA 3GZQA 5KBLA 2AQSA 5KBMA 1EJ8A 2AEOA 1E9QA 3PU7A 4L05A 3HFFA 3CE1A 3H2PA 3QQDB 3KM2A 1B4LA 1E9PA 2Z7YA 3RE0A 4MCNA 2R27A 1AZVA 2VR8A 2ZKXA 1XTMA 3GZOA 2E47A 3CQQA 2E46A 3QQDA 1U3NA 3GZPA 4A7UA 1Z9NA 4U4IA 1SDYA 4A7TA 1SXNA 2V0AA 4A7SA 1OEZW 1IBBA 3KBFA 4BD4A 3CQPA 2GBTA 2C9UA 1PTZA 2ZKWA 1E9PB 4A7QA 2C9VA 1YSOA 2JLPA 2SODB 3F7LA 3GQFA 2APSA 1UXMA 2K4WA 1BA9A 1JCVA 1JK9A 1E9OA 1IB5A 1L3NA 1F18A 3L9YA 1PZSA 2WZ5A 3KH3A 2WKOA 3T5WA 1COBA 1CB4A 2WKOF 4N3UA 3ECUA 1N19A 2GBVA 1OAJA 2Z7WA 2AF2A 4A7GA 4A7GF 2WZ0A 1SXCA 1IBFA 3SODB 2XJLA 3ECVA 1SXBA 1BZOA 2WYTA 1JK9B 2GBUA 1E9OB 3KM1A 1PU0A 1OZUA 2AQQA 1SXAA 5KBKA 2AQRA 5CU9A 1FUNA 2C9SA 3GTTA 3H2QA 1S4IA 1SXZA 1N18A 2WWOA 2AQNA 2WWNA 3GTVA 1QUPA 1Q0EA 1XTLA 4BCYA 2VR7A 2XJKA 3LTVA 2AQPA 3HOGA 1DO5A 1F1GA 1RK7A 1UXLA 2VR6A 2Z7ZA 1OALA 1ESOA 1TO4A 1MFMA 1HL5A 2WYZA 1F1DA 1SDAB 1IBDA 1SXSA 1XSOA 1SPDA 2Q2LA 4OJAA 2JCWA 1TO5A 2LU5A 2ZOWA 3KBEA 1DSWA 1HL4A 1KMGA 4BCZA 1IBHA 3KH4A 1Z9PA 1F1AA 3L9EA 4FF9A 1SOSA 2AQTA 1SRDA 3MKGA 3MNDA 4B3EA 1EQWA 1CBJA 3F7KA 2ZKYA 1E9QB 2WZ6A 3ECWA 1B4TA 1YAIA 4A7VA 3HW7A
chains in the Genus database with same CATH superfamily
4IIQA 4N6RA 1ZDQA 5F1OB 1HEJC 2V9UA 3KLSA 3HZYA 5FKPA 1CGYA 3QI9D 4OZIA 2KLSA 1A5FH 5ESVA 5LNEA 1IGFL 4JCMA 3U79A 4AYBA 4BGLA 3EXJA 1DZBA 1VEPA 2NNAB 4KROC 3CGTA 3VA2C 4NQQA 2Q6WA 3JSSA 2CBQA 4CVUA 3AREB 4JDEA 3GZOA 4M62H 4X6CA 5FFGA 4MNQA 4NKMB 2C9PA 1Z5YD 3OKLB 4BRVA 5KYYB 2KS0A 4Z23A 1N5YH 4N25A 5I0XA 3ZOAA 4JY5L 3RGVA 1KXVA 2JB5L 4R3SA 3ZO0A 2VDML 1SEBA 5L8LB 1ZGLA 2JCCB 4CBPA 4LSQH 1OT2A 1UVQB 4PIRF 5IK3B 1QR1B 2WQWA 3P9MB 2A6KA 5JIHA 5AVSB 5K9JH 2JH2A 2VR3A 2DIAA 3HBPA 2MCMA 2ZAHA 1BCIA 5LGJA 3C87A 4KTEH 4DNLA 1MHEA 3PXLA 2ZUWA 5AVZB 1CLZL 2A9NH 2DEWX 5CCGE 5FECA 2P7TB 4ZAKA 2Y6TE 3DROA 4JRYA 2JQAA 2HFGH 2VDOL 2E9BA 1HH9B 3TEXA 5DQJB 1NCTA 4HCRH 1KSRA 1WICA 1PG7H 4H44C 3DRQB 1YUHA 5CLWA 3V55A 1I7RB 3BGMA 1GRWA 1A65A 2NX5A 1HDMA 4N2IA 4S1DD 5DD3L 5F6IB 2NXYB 2ICWI 3CZNA 2J8UB 3RGHA 1ZA3B 3WY1A 2ZPKH 4DKDC 5I8EB 5IVXA 1YNTB 4ODXA 3FZUD 4OFIA 3VSTA 2X12A 1TVHA 3QISA 2KQMA 1PZ3A 1CMOA 4QTHA 3JV5A 3AG4B 4LB8A 4OY9A 4HD5A 4X4KA 1JMXA 2HTKD 4F15C 5TQ0L 1MVYA 4LEXL 3EJZD 3TU6A 1KCUH 4U3XA 5IR1B 1P4BL 5F89B 4PJXA 4ONFH 5AB1A 3WNMA 1KT2B 4PGCB 1BFOA 1R4XA 3MRPA 3CFJA 3GXFA 3QG7L 2C9RA 1SJVA 3HVNA 4NQED 3UJTL 2X6AA 4FMKA 3DX4A 5AB0A 2WVTA 1E0OB 2RALA 2X42A 3AY2A 1UASA 1NCCH 3L1EA 3MMEB 3R06A 4AM0A 1USZA 2EE9A 5AOIA 3MV8D 2BY1A 3P3TA 4WJ5A 2PN5A 3ARRA 2HFFA 4GAFB 3FU9A 1GZQB 3LNIA 3CMOL 2H6UA 3SY0A 1MFCL 1OXYA 1Z3GH 1TZGH 3FTZA 5JDSB 1ZA6B 3AQYA 3IM1A 2BO0A 1CBJA 3TA4D 4Y2OA 1P7KB 4E42A 4YHKL 2VDKB 3IEAA 4G6JL 2DQFA 3VXUD 1OHZA 1VB9A 2XV2A 1DL7H 4L9LC 4IDJH 3FT4B 4F7MA 4Z78A 4MNHA 2G60H 2QELA 5I8OL 1LQBC 1UZ8A 2VIRB 2QZQA 4MB4A 2ZXBA 3L3KB 1VFAA 3AAZB 3FQNA 4Q0XH 4XPAL 5MENA 2X6BA 2R9HD 3SPIA 2HVBA 2P80D 5GSVA 1K9TA 4GSXA 2NTSP 1QFOA 4HEPA 5E5MB 2ZKXA 1UT9A 3GJFK 1J88A 4YXKH 4BH7B 2I25N 3F2LA 4X5WA 4PV9A 4C56D 3BWSA 3I2CH 3EO0B 3NIFE 5FYLL 3PS6A 4JFFB 1X5FA 4WRLA 4QAWA 5D1XB 2ODHA 1DLFH 3MU3A 2VAAA 5F0PB 5CSGA 3IF1A 5LUMA 3FQUB 1QNIA 4MBOA 3RG1C 2CH8A 4MJ4A 4C83B 2CJTA 1O6SA 2JLPA 1A6AB 1UWGH 2IC2A 2HAZA 3UAEA 4PFEA 2DLTA 1O9VA 2W60A 3HI6L 2VDNH 3CDFA 4R4BA 3L4WA 1NINA 4RAVA 2XZAL 2CCLA 3C5ZA 3T2LA 5J1SC 1K5NB 2QQLL 2OL3B 2P28B 4NKQB 2Z64C 4YGVB 1SFDA 3NACL 3NSYA 2NYZA 4X80L 3EYQD 1EAOA 1L0PA 3IPEA 2Y23A 2EDQA 1XH3A 5HGBB 5TGBA 3NFNA 3ALWA 2YXVA 4DKEH 5I8KH 1WWCA 2DYPD 2Y07L 1RZKC 2IGLA 5AUMA 4E0RA 4FQJH 3E9TA 3QG6A 2EC9U 4FMVA 3T77A 3WI9A 5HJBA 4ZMXA 1G7LA 1H6EA 4TRPH 1J9CT 1R19A 1A3QA 1U8IA 1YDPA 2BNQA 2R59A 3MLVL 3I9GH 1NCOA 1PGRB 2C34A 2HRPL 3COOA 3S36X 3K71A 4JDZB 2A6JA 1FYTB 3OWEA 4XPGH 5F70A 1ZLUH 2YD8A 4ZUSA 3HMWL 1HKLL 4ZOCA 1IFHL 3V5DA 1CXEA 2CO6B 3NCXA 4LLMA 1CF8L 4XX1E 3QNXA 4W9IC 1KXQE 3AZUA 3IXTA 2BS9A 3E9UA 4FXGA 4LCWB 1HQ4B 5C3IA 1WSST 2MRYA 1T0MB 1PNDA 5LQBH 4PVNA 4OVUA 2QPFA 2BIOA 4GKZB 4TN9A 5JUEH 5LGHL 2AHIA 1SOSA 1YEEH 4B9YA 5IHUL 1DVFB 1JZ6A 1EQWA 3IGAA 1CFVH 4BQ9A 2ZKYA 4XB3A 4MA3B 1EDQA 2O6FA 3B1TA 5E23A 2F2HA 3NIDE 5GXBB 1CLCA 1WFNA 1WUZA 3PDOB 3QUZC 4ZO8A 5KJRL 5IQOA 5CD5C 3T0AA 5AL8A 4WWKD 1GS8A 3APFA 2ZUQB 3OR7A 2XX0A 4WWNA 4PJDB 3DX9A 3EYFB 4GW1A 5E99H 5BZWA 1F58H 4ZX3A 2A38A 2FQEA 4FG2A 3B9EA 5GRJL 3B2VH 1FWXA 4HIQA 3OWRA 4V2BA 3SKMA 1CN4A 5HHPA 4FQLH 4PQXA 1S9YB 4MJ2A 3B5HA 1MHHA 1CK0L 4P5MB 4JJ5A 4TPRH 5BRZD 5IB4A 3MRCB 3FN9A 4FG6C 2V2WB 2ZXQA 3D09A 4ZS6C 2WNWA 4GINA 3AXLA 1RI8A 1LILA 1MREH 2XTJC 5ALBH 4RGOH 1ZTXE 4W93A 1LGVA 5ABDE 5T1DH 2EQDA 4NO5B 3NJLA 2GSMB 2GJ6B 1YRKA 2QGBA 3ME0B 3OHXC 1CFNA 3B3BA 3H4HA 4PY8I 5C0JB 1Y6MR 2PWFA 2FECI 5LWYL 1AGDA 4HK0A 5HI4D 1FDLH 3LRLA 2K0RA 5D7LB 4X4XB 3N06B 2XJLA 3SODB 4LLVB 3L3JB 4NZRH 3MPCA 4I77L 2GYSA 3DVIA 4D9LH 4K8RD 2HX7A 5DD6A 4YDVB 3EO1B 4OD2A 5GGSY 3ZMEA 3TV3L 5EOCJ 4I3RH 4YWGL 3HC4H 4GXVL 5EWIH 3VWJD 4DO6A 5C0CA 3ESNA 3TN0D 1A1NA 4HMDA 3V0HA 3EYSH 1AACA 1HNFA 1AR1C 3AUWB 4ABWA 3IDXH 1ZT4B 5L4FA 1DQML 4LEOA 5HD8D 5I0WA 4U0QB 1P9MA 3FB8A 3VFTB 3EHBD 3SE4C 1I9IL 5A16A 1OTUD 5T5NG 3UMTA 4WI5A 4AH2A 3FH8A 5T3XE 5IB3A 4P3CH 1DLHB 5JW4R 1MCWW 3KVQA 3RWCA 4OI8A 4WU5A 4YO0A 3ATEA 4EOWL 6FABH 3WMPA 4PJEA 4KDWA 1H6UA 1HQRB 2X9WA 3BP7B 2ERJB 3RY6A 4G8FA 4ZD3L 5GS0H 3C60A 5GISH 3LD8B 3A4EA 4IIQC 1CVSC 4B3VA 3U0TA 5F6HJ 4AX3A 3D18A 2CMRL 4Z7NB 4UT6L 5DHVA 4KROB 1GY1A 3QW9A 2FGWH 2M2DA 4EI5D 3ZDXB 3PWLB 5IB2A 3KYMB 5I1HH 4E41E 3ZTJH 5KVFH 4D7BA 4BKLA 5DVOA 5IQ7L 2PP8A 3CHQA 1ODUA 3HC2A 3G08B 3GSOA 3WXWL 7TAAA 3GMRA 5DQ9A 3GJFH 4G8IA 4GG8A 4KTYA 3QHZH 3RGVC 5E8OA 3IRZA 2VQ1A 4HJ0C 4MJIB 1JF5A 5ISZE 1XGYH 3SKNB 2AJSH 1A5FL 2DN7A 2FT8A 5CIPA 1RP9A 5IB1A 2KPWA 3KPQB 3MNVA 4QI3A 2K1MA 5AVVB 4NHCH 3DKHA 4KUCD 2WTRA 4LDCA 2CLRA 1WLHA 4UQEA 3IS0X 2X87A 1JP5A 4M62L 1BQHA 2DQJH 2Y72A 3S98A 3EYVB 2WVSA 1CXHA 2A74A 4POUB 3DURA 4N2FA 1KBGH 1XR8B 4A2GA 1N5YL 1K2DB 4U6XB 4ZAKC 3OMIB 3RQ3A 3NIFF 5IOKA 2H6PA 4L8DB 4LSQL 5KBDA 5KS9F 1JYVA 1SXBA 5IKCB 3FOMB 5CKAA 4F92B 2AEPH 4AGLA 5K9JL 2HRHA 4BFIB 4RDQG 3G6AB 3ZKMC 2OMNA 2YOCA 4MJ6A 4NS0A 5DO2C 4K3DH 1QYGH 4KTDH 3KLQA 4F15B 5C0EA 4PIBA 4H8WH 1OD7A 1ZVNA 2ED8A 4KTEL 5EPMB 1AZUA 1JN6A 5DJ6A 2E56A 4XZ4A 2A9NL 4KK6C 1NKOA 3Q05A 3S37X 2PW2A 4FKKA 2H26B 1G9EA 4XOCA 1H19A 2HFGL 1EMTH 1V27A 1WEJH 3KHQA 3RYMA 4FNQA 1PG7L 1UKTA 4YVNA 4G8EB 3GEWB 3IDIA 4GEIA 5I6MA 5BZDB 4M8QB 5MI0C 3EGDB 2ZPKL 5JYMA 3IFOA 4U1HA 4YSSA 3CFUA 3F84A 1XGRA 4U1GB 4I1NB 5FCUH 1E2WA 5EF3A 4B9CA 3MNZA 4MVBD 2JF1A 1PKQB 2XG4A 1KCUL 2WGNB 4HKBA 5I1KH 4ONFL 1E3ZA 2JKTM 3UCQA 2A9DA 1BLNB 1YAIA 2VRAA 4XMZA 4KDTC 1NMCB 5H37H 1HL8A 1SLWA 4CVZA 4KJPD 1EFXB 3D0VA 1NCCL 2DTMH 5IROD 1TQCC 3HS0B 3NSDA 4G70B 1J9RA 1HILB 1KTDA 1SN5A 3BUBA 2XHNA 4R7VA 4ESKA 4ECNA 1KGYE 4Y4FB 5TD4A 1MFAH 1Z3GL 1TZGL 2EE6A 4F8QA 3TF4A 1U8HB 4PW4A 4U1NA 1U3NA 2X6MA 4S2SB 4WWPA 5C86A 5FPIA 5B1BB 3GS4A 2SEBB 3FCUB 4HETA 5I1DA 3ES6B 2WLZA 3W1ZA 1DL7L 1D5XA 4IDJL 1JHKH 4KMQA 3BP5A 2G60L 4Z7UA 1Q9LA 3T4AA 1BZ8A 3L3HA 3MYJB 3VG0H 5KN5A 4JNXA 1Y1DA 3UL4A 1HI6A 4OGYH 2QHRH 4XXWA 4Q0XL 2YD9A 3QQXA 4EUPH 1GIGH 2APSA 3FF8A 3P73B 4NO0D 4QRUB 2N0MA 2YBRA 3BKJH 5HHOB 1EEUA 3VYNA 3GBEA 3C5ZC 4YXKL 4RAUB 3N85H 3EH3B 5CBAA 5HYJB 2DQIH 4NDMB 2BSTA 3C75A 3I2CL 3D0AA 1COBA 3VYOA 5B7EA 3D30A 4FXTA 2L7QA 2F74B 2OQJB 1DLFL 1PCXA 4G5AA 3TBYB 3CSFA 4R0LA 3N5AA 1O5DT 2E75C 1PEWA 4MHHI 3Q6GH 3F58H 4IBSA 2QPSA 5J11C 1XCWA 1KYOK 1Z9LA 2DRUA 4TUJB 1UWGL 4RZCA 2VMJA 1AQDA 2MOVA 3OZKA 2DWEB 2VDNL 2V3FA 1PVHA 2ADGA 4QLWA 3FH7A 3PV6B 1KUMA 1JYXA 4RGNE 5FK9A 1WCBA 3K6NA 3AMKA 3DSNB 3CHSA 4M3JA 2J43A 4P5KA 3MA7A 5FW6A 2KHAA 5E94B 2C9XA 5L4JA 3KNBB 1NL0H 1U91A 1CFQB 1XH0A 4CU6A 5C8JA 1JYWA 4I48A 2MCPH 5I8KL 4DKEL 4B0MB 1AG0A 5IV2B 4U3SB 5SWSD 1SGKA 2Q7AA 3E2HC 4NQSA 2F1EA 4FQJL 2KBGA 2Y3NA 2OMXB 1NGYB 3HZKB 4P2OA 4F5CE 1H3UA 2ZAIA 4PRIE 1AGCA 3JTSA 4TRPL 1CL7I 4I18B 25C8H 1AO7B 4JFXB 4YHNB 1OF2A 3I9GL 3NJIA 3RL1A 1D7DA 3BUDA 3S7GA 1S8DB 2H0EA 4XPGL 5AZ2H 5IW3A 3P3SA 5F1SA 3QIUB 3QUZB 3L5JA 4XNMA 3QS3A 2AK4B 3HG5A 3MJ8A 3FT3B 4HXBH 3VXTA 4N8VG 1IAIM 3FRPG 4FG0A 3MI6A 4UZGA 4AVKA 2WY3B 3LNFA 5AKVA 4EJ1C 5AW7B 1OANA 2FX9H 3BXNA 4HOMA 3VQMA 2Z31A 2E8ZA 1MJ8H 3QDMA 1CIUA 1JV2A 4A66A 4CAGA 4OT1H 2X6VA 5LQBL 2CRYA 2PO6D 4RQQB 1MCNA 1AZZC 2BVPB 2WUCH 4NZTH 5JUEL 3KXFE 3AT8A 3TWYA 2VR8A 4RFEB 1YEEL 4F9LA 5BJTA 3KGSA 4JCLA 3S3SA 2XNAA 1CFVL 4LSDA 1LMKA 5C0FA 3ZMRA 3KPRA 1ZHBA 1ZVSB 2AV7A 2HKFH 4F2ME 4GMSH 4LSVH 3VXSA 2D3VA 4HGMA 3VFMB 4EDXA 1WG3A 2A3TA 3VFOA 1KIUA 5EC1A 1OGTA 4AE0A 2ZOLA 2B9AA 1UXMA 3OHXB 5E99L 3WS3B 3FRPB 1JCVA 5I6PA 1F58L 3E0GA 1BD2D 3OKNB 1T1WB 4PJBE 4PJ5A 3OD3A 4AE1A 3B2VL 4U05A 3KGUA 4W9ZA 1FO0B 5CZVH 3B9KA 1A1MB 2XX1A 2WB1A 1MCKA 3IGFA 1PQZA 3KBPA 4FQLL 2Y5TB 4X98A 4F1ZA 3HZVA 1KLUB 2J72A 1A1OB 5HPOA 4XCFH 3DX7B 4M9PA 3VXNB 4TPRL 3BCFA 1IBFA 4N4YB 4JRXA 3AACA 1H15A 2AXFB 2DLHA 4Y1AB 5ALBL 1MREL 4OFDA 1A9EB 4RGOL 1M7UA 2DWTA 3C6LA 4Z7OE 5KSAB 3ZN6A 1UZ6E 2HLAB 3CZKA 4KHTH 3GTTA 5T1DL 8FABB 2MKWA 2FDBP 2VERN 5INDB 5IJKA 3J2PA 5EBWA 3QEQD 1AR1B 4L1HA 2EDXA 4PJGB 3O8XA 1LWHA 1FDLL 3MO1A 4XWOD 3OKEB 5FHAH 4DEWA 3APCA 3CPLA 4YSUA 1FJ1B 3AABA 1AG6A 2GSGA 1TFPA 2EECA 4GQ9H 5DDHB 4NZRL 1CGUA 3HE6C 4NQDE 4TNFA 4D9LL 4WNQB 5HI5D 1P9MC 3BIKB 2ITFA 4YHOH 1EVUA 2B5IB 1I4FA 5BZZA 2OR7A 4BIKA 3RY4A 4I3RL 3TPUB 3HC4L 1EHAA 4KI5C 1IBHA 3LXBA 4NUJB 5EWIL 5IJDC 1QLEH 2A4EA 2XOTA 3OGCA 3QYCA 1TZHB 4QRBA 3W37A 4D8OA 5C2UB 4IIQB 3NT0A 4M29A 4N6RB 1IZKA 1S9WB 3EYSL 4Q74A 2I27N 3UZQA 3RY6C 3VACA 3HZYB 4NBZB 4X4MA 1CD1A 4RMSA 5BRPA 4OZIB 5J13C 3IDXL 1E8YA 1S9XA 2OX5B 1FRGH 1KG0B 3VA6A 3VFWA 4FQXB 4LCYA 1JVOA 1BV8A 5FUCE 4GFXA 2Q6WB 1A4KB 3NZSA 5J1AB 4P3CL 4MNQB 2XN1A 4JFYB 4HFWA 5C0AD 1JDDA 2IQ9H 4MCNA 2R27A 2GW5A 1QSFB 4UNIA 5TE7H 6FABL 1JVKA 2BVQB 5IEKA 1SEBB 5TJWK 1ES0B 5GISL 5A3IC 5GS0L 4ZFFA 2A6KB 1UD4A 3B34A 4AYEC 3NCJH 3CZGA 4F8OA 1K3ZA 1NUFA 3P69A 4XO9A 2FGWL 3L9RA 1JWMA 1B0GB 3CTTA 3I02A 3T2NH 3VFSB 2ARJQ 3OMNB 5I1HL 1IAKB 3MVSA 4CMHB 1BGXH 1HX0A 3GQFA 5KVFL 2FHFA 3FO1A 1KDIA 4KWUA 5K9OA 5D1ZB 1U8KB 1UADC 3DTDA 2ROXA 4HKXA 5FECB 2V9RA 4WI4A 2XWRA 1YEJH 2A74C 1W8OA 1HZLA 2I60H 4IK6A 1ZGLP 3QHZL 5HY9B 1FHGA 4B5ZA 4X0NA 5B8CA 3F05A 4P23A 3OZ9H 5GGRA 3V5HA 2NX5B 1XGYL 4PTTB 2AJSL 4WWID 2YAHA 1BEXA 3UYOD 5AAPA 1XAKA 3EBIA 2YQGA 4M02A 4GG6E 3BZ4B 3OJDB 4ODXB 2XN0A 5KYNA 1TVHB 1HC1A 2X88A 3GMNB 1E9OB 2P9RA 3NJMA 4NHCL 4BCXA 2BFVH 4N2MA 2E6QA 1QUNA 4G1EA 3FAXA 4GUCA 4X0KA 5E95B 1H3PH 4B95C 1ZS8A 2F8IA 3QAQA 2DQJL 4Q9BA 4LBEA 1KBGL 2P5EE 4PJXB 5D2LB 2MFNA 2R1YB 3TYGH 1DJHA 5AYUH 2NQDA 1MIEH 2WQXA 3MRPB 4HIJB 2Q7YA 2FYYB 3QUMB 4HEPG 4U6HA 3SEPA 2EXYC 5MI0B 3R06B 5B22A 4HFUH 1T7VA 2IJ0C 1XSKA 2HN7B 2AEPL 4JFWA 3P77B 5BOJA 3MOBH 1T04A 3VXMA 4Z3EA 5L2KD 5LCVA 4K3DL 1QYGL 3M17A 5HPMB 4KTDL 5IQMA 3BH9A 5G4OA 1E5BA 2FUQA 4H8WL 3MV7A 1JPFA 2DMCA 2A6DB 2E7LA 4GUOA 4I85A 5JTWA 5IVOA 5CINH 1IX2A 2NZIA 4W9GC 4MDIB 4OV5A 4CNIA 2LTQC 1WEJL 1EMTL 2DQFB 4KKRA 4WHTB 3ZL1A 4HUWA 4WTZA 5D96B 5DZ9A 3O11A 3CN3A 4LKXB 2CK2A 2D7NA 3KPNB 2OMTA 4C58B 3V6BR 5T3ZD 3FH5A 1TQCB 1MDAA 2PCPB 3VGEA 3NJXA 4X83A 3UAFA 3ULSA 5KBMA 5B39B 3IE9A 1J1PH 2NXZD 2DMGA 2GSIA 3W57A 5JXED 3WNKA 3GXNA 4KU1A 3M86A 4PV9B 5FCUL 43CAB 4UDTA 5GSRA 5ITFB 3SPCA 4QRSA 5CCHE 3CNKA 3SB3A 3ORJA 1TJMA 4AIEA 1I8KB 3O3BB 5I1KL 3GI9H 4MQSB 3C6SB 2DL9A 3NJGA 4JFTA 3STZB 4F7PA 1K85A 3IF1B 3UBXA 2ED7A 1F4HA 2LHAA 5H35B 4Z3TA 4CU8A 5JIDA 5FWQA 2IV9A 2N0KA 3G04B 4NN5B 4KVNH 4MXQD 1LVEA 5ABZA 3T4AC 3OQRA 2DTML 4XXWC 1FIEA 2BLFA 5F3HB 1OCRB 4QDGA 3W38A 4XODA 1BZ7B 2Y1AA 4YGAB 3V4VB 1MFAL 1QSEB 2VLLB 3N40P 3JT0A 2ZF8A 3WLWD 2QZ5A 3ARBD 2XBZA 2J25A 2XV6B 2DY2A 4Z18A 4YXLH 2Z4QA 1LQSR 5TGBB 4L1DA 2FWOA 4MCZA 4UTAA 4AGPA 5JMOC 5M95B 1JHKL 4YAQB 3VG0L 1JPGA 5EU3B 1I7ZB 1RU9H 3ABMB 2QHRL 3QG6B 4OGYL 3T77B 1DQIA 2H2SC 1K72A 3K7UA 4XNXH 2AABH 1NAKH 1GIGL 3AWEA 3B7SA 1PU0A 2R1XB 5J57B 4RNRB 3TNNA 1YDPB 2E7HA 4G6FB 1IGJA 3ECBA 3RNKA 5JW4N 1F0LA 3BKJL 4J3UA 3WNPA 3K8MA 3NSCA 1G1OA 3SE6A 2R7EA 3N85L 2YPLE 3K71B 1ZD6A 2DQIL 4PJBF 2Q2EB 4QRPE 4KRNA 4QWWD 1T20B 2VKWA 4E9WA 3MGOB 4HUXB 3BKYH 3IVKB 4WI0A 3E2HB 5BVJA 3Q6GL 3F58L 3MV9A 1DSFH 4IGBD 1WD8A 2P8LB 1SLXA 3LAFA 1N70A 2A9BA 1P5VA 1MJUH 5A43C 3OKOB 1D5IH 2ENSA 3KL0A 1BYPA 1JV5A 3O9WA 4PRPD 1A22B 4G6AD 4EQ3A 1S9VB 4TVSa 1M71B 4UTBH 2Q8BH 3X3GH 3V6OA 4HUVA 2X10A 4L3EB 1ZK9A 3B2DC 3DO7A 2P8MA 2CGRH 2QADB 5D2NB 1NL0L 2I69A 1BFSA 4MDJA 4UU9A 1N8ZB 3KDMA 4X9YA 3S0PA 3UTPD 4GAJH 3WEXA 3GZQA 5KBLA 1UUSA 2VC2B 2MCPL 3MA9H 2H41A 3FN3A 4HKZA 4OM1H 1V55B 2VMFA 4TTDD 2Z31C 2ZSVA 3K46A 4IU3B 3RI5K 2OJEA 3I6KB 1FCGA 3S97C 4Q9RH 25C8L 2VLKD 2ADJB 5I19H 5EB9A 4AV0A 4NLAA 1ZE3C 3QS2A 4F9LC 1LHZA 1M3IA 3UG4A 4I4WA 4EEEA 2DD8H 5AZ2L 3M1BA 5EIIB 2XRAH 1MHHB 3QXDA 4JJ5B 4J39A 5IB4B 2A1WH 1AY1H 5I5JA 3SKOA 4HHAA 4HXBL 4F91B 4F7KA 1UQSB 3ARPA 3RDTA 3AU1A 2QR0B 4ZOBA 4AYSA 1J0YA 1QBLH 2FX9L 4DAGH 1JGEA 1MJ8L 2EZ0C 3QJFB 2E9GA 4OT1L 2BSCA 4MSWB 1J8SA 5TH2B 3KL5A 4PJFE 4JPVH 2WUCL 4NZTL 4OJCA 3WN5A 2NLJA 3KBHE 5CP3H 1AGDB 3DMMC 4HK0B 1QLRB 4A6YB 3GMQA 1KCVH 2HFEB 5F1IA 3B9KC 3QUHA 1RZGA 2PWHA 2HKFL 2IADA 3B9DA 2ZTBA 4CMMB 4GMSL 2V8MA 1AMYA 2WLYA 1WWBX 3A22A 5CJXA 4WV1B 3K8KA 1EBPA 2HT3C 5EUOE 4ADGA 4GP5B 3ECVA 3QUYA 2PYFB 4UT6A 1Q9KA 4XBPA 4Z7IA 3C6LC 4X4YA 1JUFA 5C0CB 3ZTNH 1YMHB 1A1NB 4WI8A 4J3WA 3QI9A 5KOVC 5IJKC 1N18A 1R3JA 5CZVL 3U4AA 1GTNA 3HE7D 3O8XC 4LXFA 1FFOA 2BSSA 4WI6A 2ZUTA 4XCFL 3B2MA 1L4IA 3HE6B 3QULB 1C1EH 1MXGA 3TP4A 1PW3A 3S48A 5B3JF 1D7CA 3QFGA 4AH2B 3F6IA 1M7DA 3DUSB 1KYOJ 4HD9A 3TPKA 4WU5B 4YO0B 4KNQA 1U93B 4MS6A 3W9EA 4KHTL 1DUYA 1N6UA 4M5YH 5A2LH 5TE4H 4YHZH 5KSBE 4G8FB 2VZOA 1GZHA 4WW2B 2QQNH 5AOLA 1S7VB 5J13B 1W80A 3U0TB 4W9JC 5FAAA 1XV8A 1QACA 3KVDD 5D1QD 5FHAL 4JUTA 1AP2B 4WENB 1BQHG 3IDYB 1IBYA 1OQXA 3DYPA 4V1DD 2FL5A 4GQ9L 1UM6H 3RVUC 4AQOA 1RJLB 4B97A 4IRZA 4UQAA 4W9HC 3DXAA 2AQSA 2ESVA 3BAJA 1IEAB 1UFUA 3OLEA 5BRQA 2H3XC 4YHOL 4BKLB 5EC2A 2I7OA 1J8HB 1E3FA 3MCG1 2J7LA 1W0VA 4G7YH 4AIZB 2DTSA 3GMRB 2X9XA 5KWYC 3KM2A 4GG8B 1QLEL 4AG4H 4U3HA 1W8NA 1HSBB 4PP1D 2BZ7A 2QMKA 5BS0E 1J0ZA 4HWBH 4DEPC 2VLJD 4PLKD 1IM9B 3ARGD 4BFKA 3TOPA 4AMKH 1S7RB 1M6OA 5IB1B 3RUGF 3MNVB 4IJ3C 1SBBA 4PLOB 1CT8A 1OCWH 2IMNA 1FRGL 5JOPE 4HCRA 1MCWM 4R8WH 1JG9A 2J88H 1BQHB 4DKTA 1KTCA 5KANI 4V11A 3DBSA 1IM3A 3EFOA 1U92A 3WFDH 2IQ9L 2ATKA 3L45A 5TE7L 4KK9C 2IEPA 4F37F 2V9QA 1NC4D 1HOEA 3PUUA 4NQEA 2EDOA 4TNWF 2P49B 2FEEL 5DEJA 3U1PA 1KGCD 2WKOF 5B8CC 3IN0A 3MV8A 2VSMB 3C08H 4PRHD 4P23C 4N9GB 3NCJL 2KKQA 2DOCA 4AY0A 1YC8A 3BHBB 4K23H 3EOBA 5EU7C 3QQ4B 4FTVD 3K4ZA 1GVIA 4KNUA 4OIIH 4PRNA 3NFSH 4MJ6B 3T2NL 4JHBA 2YA0A 3PWJA 4M48H 3B37A 1NMAH 2G9HA 2PYEE 2PABA 3FFCD 1BGXL 1KELH 3IBOA 3MTRA 1IRAY 3DX3A 4JJOA 3STLB 1JN6B 1Q1PA 1JK8B 1AKJA 2BSEA 4I9WD 3SCMD 3ZR6A 5TF0A 4FQCH 5C0RH 1YEJL 4MZ2A 3EJRA 4IBZA 4Z7WE 2A6IA 2I60L 2ICEB 4JFEB 3BE1H 3W9DA 3OZ9L 1L0QA 3CFBA 3FUEA 3P3UA 2ZF9A 1QTPA 4Y4HA 5DJZB 1SUHA 2BIHA 4BRJA 5KJ7E 3IFOB 4MKTA 2F58H 3OL2A 4XMVA 1BVOA 1XGRB 3RX7A 2GITA 2BFVL 3DJZA 3SJVE 2J6WA 5HHMB 2OK0H 1ECZA 1H3PL 3MNZB 1MW1A 5DYFA 5C08B 1EAJA 5EN2A 1NIDA 2A7BA 2E7LC 3OGOE 3D06A 3TYGL 3HG3A 1M2OA 2W65B 1TQUA 3M7OA 5DUJA 5AYUL 4NCC1 1MIEL 3FYIB 3P4OB 4CVZB 5I1LB 3FT2A 3D0VB 4HFUL 2ITCA 1UB6A 4ISVA 3CVHH 2HFTA 1W15A 2GJZA 3UMNA 3MOBL 3BLKA 1B0WA 4ICXA 3PU7A 1NCNA 2YR3A 2YUZA 4L4TE 5F6HI 2BC4B 2Q87A 2YXWA 2HZHA 2I07A 3CPUA 5CINL 5E8PB 2QV4A 1SMOA 1TU2A 2DYPA 2D7QA 3AM8A 3QJTB 4E9TA 4D7PA 1D5XB 4K7FB 4JFSA 1AQMA 4Z7UB 1Q9LB 5KN5B 5DFWH 1INQB 4G80B 1SDYA 2W9EH 4GRWB 3KS0H 1Q90A 1RIUH 3N1QC 5ETUB 4DT2A 1HK6A 3PWVA 1KCLA 3JUYA 4YR6B 2Q86A 4G8GB 2YBRB 5CF3A 1UENA 4YBQC 1J1PL 1WD9A 3L3OA 2PW1B 4CGTA 3JWDH 3LKRB 3FT1A 2K4AA 1NGPH 2B59A 4X5RA 3RKDD 2CR6A 3FBKA 5ACZA 4HJGA 1RHFA 4JKMA 3GI9L 4M03A 4XNAA 2NY2C 4Y19D 1HKFA 1UM5H 4CC0A 5GS1A 2B9BA 3ZLQC 1CXIA 1Y6NR 4M1CC 3U2SB 5L0QC 1QKZH 5L8KB 3F6JA 4RZCB 3ESVF 4KVNL 3QCVH 2IAND 5K93A 3LNEA 3U9WA 3O6LH 4M4RA 1A7QH 3TO2A 1BZOA 4Z7AA 5FK9B 1WCBB 3NCEB 1SXAA 3PJLA 5EU4A 1DVSA 2BVEA 2C9SA 1ND0B 1S7QB 3H0TB 3BO8A 5J89A 3LRGA 2OSLB 4I3GA 4YXLL 3W2DH 4KBPA 3UEQA 2X89D 1T5XB 5BMFH 3TT3H 1N68A 2LU3A 2IWEA 3C5XA 6PAZA 1IJNA 4LOUD 1BFTA 1RU9L 1MI5D 4K3EH 4FA6A 1JTOA 3EG9B 4XNXL 2AABL 1CGXA 1NAKL 3JTSB 5EBMA 4KAQH 1OTSC 3IRCA 5PCYA 5JQHC 2JCCE 1CDJA 3PPSA 3O9WC 3O6FD 3NQIA 2CK0H 2ZUUA 5BRZA 2OZ4A 3U36B 1JGUH 3V6OC 3Q5OA 4HIEA 2GTZB 4UV7H 4ZK8A 3QNZB 1Q38A 5KAQF 1TJHH 2XWEA 3MJ7A 3BKYL 3BYTA 4RMBA 4GO8A 1PMYA 1ZV9A 3VXRD 2VERA 5EO0B 4Z5RB 3PJSA 1DSFL 3AVEA 2Z31B 4MXVF 1EXHA 5DHYA 1JV2B 3W11D 4OLWH 1MJUL 1D5IL 3W0WD 3WJJC 2NY5C 4X6DB 2AV1B 4TLTA 3ZE1F 1AOZA 3HFFA 2HA1A 2JI3A 4H8VA 4YDMA 5H2BA 5BJTB 2FD6H 4L29A 3O3UN 3EOTH 4ODWA 4J3TA 3WEBA 4R97C 1IKNC 3DOIA 2Q8BL 4UTBL 3X3GL 5KSBF 3KPRB 2J8UE 5E2UH 4J3OG 3V0GA 4CADA 2CGRL 2E7DA 3KAAA 4JVWA 1EAQA 3GHEL 3ZUCA 2A73A 4IMKA 3PLYA 4OTXH 3VFPB 1AGBA 1HYRC 2IAMB 1V3JA 1L9MA 3ARFB 4GAJL 5EC1B 3RDTC 3OPZH 1OGTB 2EDMA 1OCOB 3MA9L 1DQJA 3TN0A 4P2CG 4OM1L 4F2EA 1DEDA 3NSFA 1ILSA 1JPSH 2WVUA 3CVDA 3HAEH 3LZQA 3DMMB 3MRFA 5I23A 4Q9RL 1FNSH 5I19L 3WN5C 4JRWA 1JZGA 3MGTB 4HK3J 4GP4B 4EMZA 2WXNA 2DD8L 3L9YA 3V6ZA 2XRAL 2XC8A 3N91A 2F53D 2A1WL 1AY1L 2Z34A 3BQUD 4JDVA 1A64A 1QATA 4MNGA 1H15B 4S1SH 5CJXC 2VISB 4KQ0A 3PGDB 5KS9A 3ARDC 1EXUB 1QBLL 3C6LB 1DQKA 2D4FA 2H3NB 4YHIB 4DAGL 2WINB 1FNLA 5GGUA 2R4SH 2Z35A 3U7YH 3FSVA 4JPVL 4B9IA 1HHJA 2PPDA 2VW6A 3QI9C 1KCVL 4EI5A 5IMLA 2C8NA 3BFWA 3CPLB 4LCCA 4HWZA 4P05A 5F1NA 2WGXA 2ZONA 4M7ZC 1N26A 4N1EA 3ZHNA 5I6LA 4XMUA 1WA0X 1MHCA 2AP2A 2FCBA 3RWIA 5EHFA 2VDRH 4L48A 4JFFE 1PG7X 5D1XE 2DIBA 3ZTNL 3S2AA 3Q48A 1MLCB 3FBQA 3DO4A 1HNYA 4OLZH 1SZNA 2WOYA 2QGEA 1CD1B 2ZICA 1JWUA 4FJ6A 3ZE0B 4Z7WF 3GJFA 4UZSA 3D5OF 1C1EL 4WNJA 4UQBA 4FAAB 4HJEA 5GGSB 3QYMA 4HDIA 3C9NA 3OX8A 2QVIA 4AT6A 4WTXA 2FHCA 1ONQB 4HFWB 1G7MA 1KXQA 3VD2A 4M5YL 3PHAA 4LSSH 2OKMA 2R4RH 4FNUA 5TE4L 4AJYV 4C4UA 2YFOA 2Z92A 4YHZL 4OM0H 5IEKB 1IVTA 2QQNL 2DQUH 2E5EA 3CC5A 2D4DA 3IDGA 1A6PA 2IPKA 1ZIAA 3OAZH 4LCVA 1FIGH 1MOEA 2C4FU 5I1GH 2QT6A 4IJ3B 4JQXC 1U8PB 2IBGA 2D9QB 3FZUC 3GBDA 4JANB 5CMAB 3RJDA 4KZEH 3CCHA 1DJSA 4H8PA 1KB3A 1UM6L 4FP8H 2UXFA 3RWDA 4I89A 1DEEB 4MQ7B 5JPMA 3TCLA 1IQWH 1KCRH 1OVZA 5AALA 3VI3B 1FYTE 3EJZC 1NFDB 3MNWA 4K94H 5IF0B 1FNGA 3I85A 3RPIB 4HKXB 3G5YA 5IVZA 2AXJA 1YECH 4ZQKB 4Z76B 2YPVH 4G7YL 2BMKB 4I3SH 5DSCB 4Y2LA 2A0LD 2XN2A 4AG4L 4L0YA 2E6PA 3PDGA 1QZNA 5IHLB 3RX8A 5I2IB 1A6TA 3MDJA 5GGRB 4HWBL 3V5HB 1FFTB 1OPGH 1I3RA 1ZRUA 4AMKL 1OCWL 3CN4A 4R8WL 2H47C 4FNLH 4YVUA 2O5ZH 2VSCA 4GRLB 2J88L 2XFXB 2X1XR 5C09D 4WO4D 3FRUA 1ZS8B 2VL5A 3PGCA 4WTZG 4D9QE 2CSPA 4YSQA 4ZUTA 4ABVA 1CO1A 5LXVA 2ORBH 3WFDL 4M93B 2AQRA 4GBXD 4H8UA 5JZ7D 3DX6A 2I9LA 3SBQA 3MCYA 2Q7YB 2WO2B 3D2UD 5AL0A 4PJDE 5IROA 1U58B 3R19A 3C08L 1AXSB 3CZLA 5HDBF 4M6OH 2E0PA 1J9QA 4G72B 4K23L 5DJ2B 4OIIL 3ZMNA 1T04B 4APXA 4D8PA 5I66A 2R29H 3NFSL 3V6FA 1R0AH 5E6RB 2X53A 1TYEB 4M48L 1KIPA 3MR9B 1NMAL 3IJ8A 1T5WB 2OPCA 1DO6A 1F1DA 3UBXG 5J8OA 3WMSA 2NNFA 2CBOA 1YHPA 4OV5B 4FQCL 1IARB 1U8MB 3ZBMA 4CNIB 5C0RL 1EEQA 1JNHB 4BCZA 1TG8A 5I6NA 3BE1L 1YYLH 3ISRA 3DETC 2Z8VC 3LQAC 4JJHA 2OMTB 3QH3A 3ZE2E 4DOHB 3QDGB 1A02N 4TVPE 2W5PA 2XZQH 4ORZC 1TJXA 1ASQA 5FO9B 4TUOA 2GJ6E 4UUJA 4DFIA 5MHSD 2F58L 4XNZC 4O2EB 4B7IA 3DPBB 5GSRB 2VDKH 2OK0L 5D7LE 4EUPA 3POHA 4QY8B 3EYQC 4DP4X 3UFIA 3A6CH 5DHDA 5F96H 4B6ZA 5FA3B 1NBYB 3TIDA 4F7PB 3UBXB 4DZ8A 2EP6A 1FL3A 3AM8C 4P3DA 4DP8X 5HHXH 1M05A 4NKOB 4XBGA 3VVVA 3VH8B 3L6FA 4LHUD 2J55A 4X99A 3D4YA 4LNRA 2XVBA 2C9QA 5INCB 4HBQA 5G55A 3CVHL 3MLRH 3JBG7 3WCYA 2BNRD 2OCFD 2OXHA 3L3OC 4R7DA 4HWUA 4FLHA 4BK5A 4E41A 1N3NA 1FL6B 2E59A 1Y1UA 2N59A 2NY2B 2PLTA 4P4KB 4LDLB 1ORQA 5L0QB 4ZMQA 2FSEA 5GS1C 1P7QA 3I9IA 1CC3A 1YNTF 3MCKB 2W9EL 3RURA 1RIUL 4YDZA 1JRHI 1KWKA 2VZSA 2YSSA 4UAOB 3LNGA 2OL3H 3ZZLA 4JW3A 3TNNB 5ISZA 2J8HA 4YH6A 1HYSD 2Q7NA 5I6XC 5J56B 2HYMA 3PGFH 4WFFD 1NGQH 4OZFH 3FTGB 5F9JA 3JWDL 4TQIA 4LEBA 1NGPL 1XSIA 1NCUA 4GI8A 4PB9H 3ML9A 2N4IA 3T0BA 4Z7NE 1L9PA 3SDDD 2XXCB 3U0PB 4X6BA 4H20H 1S3KH 2GK0A 1YY8A 43C9B 3ZDXE 1G9MH 4DFHA 4NHUA 5IQ9A 5I74C 1UM5L 4WWKC 4L5FE 1Q0EA 4CW1A 2Y7OA 3UAJD 5E7BA 5IW1A 1QKZL 3F12A 1KJVB 1BAFH 1GKOA 1KTLA 2ZX9A 3B4NA 1MCDA 3QCVL 4O02A 3NEXA 4I7ZC 5TK2A 1A4BA 3O6LL 3SPGA 3WAKA 1A7QL 2ED6A 3SYOA 2LVCA 4LAQH 3Q8EA 2GC7C 2NY1D 4FFWD 4WI2A 3TCTA 3TTYA 3DO7B 2DF3A 3V4PA 4P8QA 4L4VB 3U83A 2DM2A 3PNWA 2NTFA 5EMYA 1OAZH 1UT1A 3DTUB 2XYBA 1F4XH 4H8HA 3W2DL 2C1PB 3HC0B 3TA3B 2DLGA 3WNOA 1WFTA 1CJYA 4GSRA 1UTDA 4IOSA 5BMFL 3BN3B 3TT3L 3DV6A 5IQLA 1J5DA 3T0WA 3T8XA 1E40A 3ZQXA 5EDSA 1BD2A 3D34A 1A4JA 4LCUB 4K3EL 1I8IA 1A6UH 5T1MA 5DRXB 2VCOA 4KAQL 2YC1B 3RB5A 5JQ6H 1EJ8A 3SKJH 4IMLB 4R97B 4FHKA 5HI4C 1SMDA 2W8CA 2VZTA 4LCWD 4MD4A 4PP2B 2CK0L 2XQYK 4Y89A 1JGUL 4ONHB 4XVSH 1GGIH 4L8SC 4PG9A 1U3HD 2AXGA 4UV7L 3V7AG 4HHAB 3UIZA 1L6ZA 3AADB 1TJHL 4CVXB 4JKLA 4IMKC 3MBXH 4CSSA 4R4FH 3VFRB 3HLAA 1GYUA 2LV4A 2J2ZA 1FFPB 2B4CC 4OLWL 1KYUA 3Q5TA 3TN0C 1YN7B 4GRMB 3JZ7A 4N5EC 3TBBA 4RESB 1XBRA 2NLJB 3EGSA 2FD6L 4KRPD 4CUCA 2AJZB 3EOTL 4RZKA 3U1SH 4ZXBB 4PCKA 5E9DB 4YDLB 2JKRM 4UT9H 1Q9OB 1J87A 4XXDB 5HD8C 5ID1B 1RAMA 5E2UL 4ZO6A 1M7IA 2D3JA 4KKBD 1RPKA 5DJ8A 5EBGA 3EHBC 5ERWA 3RFRA 3VFGH 3RVVC 4YN3A 1OTUC 2OTUB 1FNHA 5D7JD 1F6FB 3ARDB 3IJSA 4OTXL 3BUYB 3QJVB 4TVPH 5DI8A 7PAZA 3BLPX 1AJ7H 3OPZL 4IM8A 3IWUA 3FU0A 1UATA 3UPCA 2VNCA 5CD3A 2COQA 1BYNA 4QRRA 1JUFB 2WWKT 3EKCA 1YG9A 3ERXA 1JPSL 3B8SA 2P8PA 4JO1H 3QI9B 5J12C 4F20A 1G0DA 4AGMA 1R3JB 1LE5B 3RVXD 1FNSL 32C2B 1NGWA 4P5TD 5DMGD 3D12B 5D7EA 5C07A 3ROOA 2ZXCA 4M7ZB 4EI5C 4JFZH 3I9AA 3KYAA 1QFHA 1U8NA 2OAAA 4XB7A 3QEUB 3I74A 4L37B 1FZJB 1VRSA 4S1SL 2A9MH 5I6OA 2Y9RT 5GS0C 1JXDA 2VN5A 3CFMA 5D9SA 5C0AA 4PW9A 4KX9A 3FPXA 5EOTA 5DFVD 2YGVA 4HC1H 3SD2A 5E70A 3WE1A 3HZMA 3CDZB 2R4SL 1FV1A 1NCAH 3U7YL 4OJAA 4HF5H 4TM9A 1CQKA 5L8JB 4X6FB 5CZKA 2BY3A 5JIMA 2QSVA 1LO5B 4KKAD 2DICA 3RIKA 3NGBC 3MRNA 3MLWH 4U1KA 2FL5B 2Z93A 1KY7A 1TUPA 5HHOE 1EZUA 3HIZA 4M7LT 1KBBA 1B6UA 3S6CA 5JW5A 1LL1A 1CLOH 5EC2B 2ITDA 2WXLA 5JHDD 2VDRL 2G2PA 4QHMB 5FM4A 1KXTB 3MRIA 4HCIA 4PWEA 2BIMA 3EW3B 5DQDH 1JHTB 4YDKH 3MLUH 3C12A 2OP4H 4P3WA 1TYRA 1ERNA 1F11A 3QCTL 1QX1A 4F5CA 4OLZL 5JHMA 4A2EA 5JQIB 3FF7A 3QR2A 2DLEA 4RWHA 4PBVC 2HVKB 1ZLVK 1D7BA 2OV0A 4L5FH 1JI1A 1A21A 3UO8B 3BP6A 2H6OA 5D4IA 1WT5A 3V9CA 3BPNC 4OCXH 2F8VA 4WGVB 5DMIH 5EIVA 3NABH 5JPMC 2NYYC 1U0QA 3EFOB 1X9RA 4G43B 4RX4D 1XGPB 4HW6A 2AZAA 3CG8A 3GXMA 4LSSL 2R4RL 4NQEB 1YSOA 4ZMWA 1N6VA 3M8OH 1XGTA 4OM0L 4QOKD 1AD9A 4KK5D 2DQUL 1YEDB 3MV8B 3LH8A 2X4PA 2FJFA 1R9FA 4KRMB 1T66C 1FIGL 2UX6A 1FH2A 5I1GL 2ADIA 5L2KA 4P2RD 3A4AA 1RUKH 3KWXA 3WBDA 3N42B 3EOBB 4WFHE 5DJDA 2QV2A 1UH3A 1U36A 3AWGA 3HNTH 1RZPA 1AO7E 3PWJB 4FP8L 3RLSA 2WJ7A 1J10A 2G9HB 3WO4C 1PZ5B 2GBVA 2ARJA 2BINA 2FEEI 1ITCA 1IQWL 1KCRL 2IH3B 1ODAA 4MVBC 5E4EC 4ZW7A 3ESOA 4K94L 5CEXA 1BECA 3VXUB 1SVZA 4AW4A 5F93C 2YPVL 4I3SL 3LEVH 3CXDH 1X5HA 3NRPA 1HIMH 6PCYA 4JFPB 1IJ9A 2G4GA 3ARQA 4JY6A 2X70A 4JREB 3T65B 1LMIA 3T8VA 3DHJA 3UTTD 4NCC2 3W9DB 4PJBA 1OPGL 3TBWA 4Q8BA 5IROC 3T3PB 5JXEA 3NK3A 3HOGA 3MROA 3MUZ1 4PJAF 4C56B 1A6WH 2XN9D 3WIHH 3LN5B 4XBEH 3QORD 4FNLL 2KC0A 2O5ZL 5I28A 4PB0H 5IG7B 2ZX7A 1NFIB 1QFWH 1TCRB 3OKKA 4KTGA 4AGNA 3QB7C 5CN3A 1DDTA 4I0KA 5DK3A 3QPQD 2XTJE 4HCFA 3PAYA 4Z7NF 1N10A 4F7EB 2G9KA 3F01A 5F3BA 4PLJC 2YD1A 1WITA 2ATAA 3ASWA 4GQQA 1WZLA 3FSOA 4MWFA 4FN0A 2GEQA 3DYOA 3KJ6H 3DGDA 5JW4M 4ISVB 4M6OL 2QMJA 4XNZB 1BQKA 3D39D 3WHXA 2GJZB 1R5WA 2ZG2A 2R29L 1R0AL 3VXOB 5LAPA 3KWTA 5LGYA 5JOEA 1MIMH 2VRQA 4QHKI 2B1HH 1P69B 4JFDD 4NQDA 1DE4A 2EKSA 4IYKA 4JPKH 3H7BB 1CTNA 2FVNA 2VZUA 5K39A 4P59H 2DYPB 3LV3A 1CGTA 3DUUA 1OGAE 1FC2D 2R23A 5DWPA 1E9PA 3WLBA 5JOFB 1YYLL 3SKUD 4O2FA 3U9UB 3II3A 2XU9A 3EZJB 4U1SA 4XO3A 3S3BB 2BK8A 2DI7A 4HLJA 2XZQL 3RTQA 3PWVB 3MRHB 1O75A 2Q86B 1B0RA 1PY0A 2ZWNA 5DYOA 3L3OB 3QP3A 4O51A 4R90H 3D05A 2VXUH 3SBPA 1QABA 4UQ2B 4JKNA 3GDBA 5DD5H 2FLBT 2VDKL 3NCCB 2QTEA 3EH4B 3LH2H 2ZOTA 2CLVA 4JBSA 5ACZB 4HJGB 4A7QA 2JQZA 1QSVA 3A6CL 4PJIB 2X1WL 5GS1B 4Z7VB 1YN6A 2FLRT 4FCAA 1QI3A 2VM9A 4IGBA 1YA5A 4MB5A 1PG7W 5FGBA 4D0CA 5HHXL 1A66A 4OCNC 4UOZA 4YHMH 3CLWA 3ZZSA 2WZ5A 4UNUA 2Y1ZA 1KENL 3UTZA 3BX7C 3CUPA 3ATAA 3TO2B 2ICWB 1IFGA 4HLEA 1TIUA 1IL1A 3MLRL 1LK3H 3BFOA 3PP4H 1XZ0B 4OZIE 1MZYA 4PJ9D 4LPCA 1WIOA 1PLCA 4NQVB 5DEFA 5I74B 1NBCA 1RZKH 4WWKB 1WDAA 5LLIC 2DQGH 5I0VA 1ASOA 2X09A 4ZPTB 4GUQA 1P84K 1GZPA 2IFFH 2J1KA 4FFZH 5IGXH 3JV6B 4PREA 1G87A 2Q9OA 4MNQE 4YXHH 5E2VH 1BIIB 1NIFA 2CGZA 3CSPA 5E6YA 3VGDA 1QSFE 1HOCB 2UY6A 2VLKA 1U8CB 2OL3L 5EBMB 4RDQF 4NPKA 4AQ1A 3FO9A 3SE3A 4NO3A 3PGFL 3VRLE 1GYWA 1NGQL 1X9LA 1ZDSA 4OF0A 4NIYE 5BRZB 2KUTA 4PB9L 5K9QG 2JCWA 4B9GA 4N28A 1NICA 4H20L 1S3KL 3PABA 2Z1PA 1DCEA 1G9ML 1G7PB 1YYMH 3P4NA 5I30H 2GIMA 3PE9A 3SGDH 2P5EA 1JPEA 3PJSB 4BXSV 1NOFA 4X5PA 1TQBC 3HLKA 3PL6D 1BAFL 4GKSA 4DH2A 3MJWA 4U7SA 4AEFA 3CDCA 4Y16D 2XTLA 4NNXB 2O1AA 1Q72H 1J9SA 5K69A 1TVDA 1VFUA 4LAQL 1NBQA 2UVEA 1U4FA 3NCYP 5JIQA 2AJ3A 1KJ3H 3MC0A 4PRID 2NX5E 1G7QA 4HULB 4L8SB 2CDGA 3OB0K 4PN6A 3HKZA 5H94A 4CADB 4GI9A 4K7PH 5E6ID 3IAQA 5DZLA 1OAZL 5CP3A 2FWUA 1F4XL 4QUOA 4DP5X 4PGBB 1FVCA 3VWJB 3FONA 1E5YA 5AOJA 5G2NA 4KZEL 1PAZA 3TN0B 4ZQTA 4PJXE 5D2LE 1OT4A 2XG5A 4ZPVB 1A6UL 3I6SA 1NCIA 1ID5I 3RUGA 3SSGA 2E27H 3US9A 3MRFB 2DLFH 5JQ6L 1OP5K 4YHYB 4YK4C 4C59B 2O5XH 3GM8A 4G82A 4ZMZA 5JNYA 1BYOA 3DC0A 3KXFD 5FB8B 3GRWH 4M6MH 1PSKH 1ZAGA 3EHBB 5IBTH 4L18A 1FAIH 2DQTH 1GGIL 4XVSL 3LKQA 3OSKA 1ZOXA 4WDIA 1XHHA 2WSKA 1CDUA 5F7DB 3ZTJG 3MBXL 2WKOA 4RDBA 4R4FL 4TV3A 2CR3A 5KS9B 5AVWB 5GGUB 2XACC 4HIIB 4M8UA 2P24A 4PGZA 5DJAB 1FO0H 4WEBH 3T6QC 4NENB 2X4UA 1HHJB 3B43A 1TEGA 5D1QA 3TEZA 3U1SL 1WPCA 1D7FA 4ZO7A 4EI5B 2BOCA 3VU1A 4UT9L 4HWEH 1I1FA 3PQYD 3KPSB 3OXSB 4BFFA 4J6IA 3OR6B 2G2NA 1M2VB 4XX1G 3VFGL 1F4YH 1OF0A 1GYAA 5ILTH 1MHCB 2EE2A 1IU1A 4TVPL 1R75A 1AJ7L 3RWIB 3KLHC 3WTYA 1SLUA 4QMEA 2UYLB 2WLHA 3KLLA 2WVVA 4JE4B 1MFUA 1OAKH 1ZHNB 3REWA 3WHE0 4ABQA 1DBMH 1OWWA 2BJMH 3ARGA 3MRKB 2QL1A 4JO1L 2F1AA 2CHNA 3U4BL 3VNZA 3HHSA 3GSWA 1JWUB 3K2IA 2NQCA 3M1CA 3H9HB 3POCA 4E9VA 4JFZL 3IB4A 1RZJH 3VD9A 3Q5YA 1G9NC 4LK4A 5FHBH 3G5WA 2A9ML 4HWBA 4KJWC 4QRPA 3QPKA 1VAHA 1NM9A 1QBAA 3LB6C 1QSEE 4U49A 2J4WH 1T1ZB 4P4RB 3ZGIA 3O2VH 2DI8A 1G7MB 1NC4A 1TZIB 1YPZF 4HC1L 4NT6A 3X17A 1RHHA 1N64H 4ELMB 4G83A 1NCAL 2Z92B 3FQWB 3D7PA 3TBVB 3VGBA 1AHWA 4HF5L 2DEYX 3VFNA 4DKAA 5IFAH 1JE6A 1TSHA 3NP4A 2PTVA 4BFEA 5AZEH 3RGBA 1JL8A 5CM1A 4LL1A 5FDYA 2XIBA 3BD3A 2CCVA 3FFCA 3MLWL 2BNQE 4JFHD 1J0KA 5AW9B 3BQVA 3BPNB 1NDTA 4WGKA 5E9AA 1D6EB 3TBSA 3TCLB 5DRZB 1A6ZB 3MGAA 3MNWB 1QPKA 1WT5C 3G5YB 3DOSA 5DMYA 5DVLA 3VMNA 3INOA 1I1YA 2DMBA 1OE2A 2JI2A 4P5RA 3NCWA 3PCYA 5DQDL 1SOXA 3BZEB 4YDKL 1UXWA 3MLUL 2OP4L 3CSTA 1A6TB 3F7LA 2L3BA 1L9NA 4GMTH 5DEZA 4BZ1H 2C7UA 2MH4A 3FQ4A 5DRWA 2WLIA 4N90E 3NCMA 4FQ1H 4LQ1A 3TO4A 4L5FL 2DYRB 1MVUA 1EUTA 2CBMA 4G42A 3VB8A 5E4EB 2D7OA 2X4TA 3LEYH 4LVOC 4WSJA 2X0UA 1MCHA 4OCXL 2XLLA 2VL5B 4L3EE 3NABL 4W6WB 4E9SA 1J1XH 3UYRH 4PJGF 4LKCB 5I1AB 4YZFE 4JFQA 3M8OL 5LG1A 3WXVH 1AHKA 4I5BA 4R26H 2CPUA 5BXFB 4XP4H 1KYFA 4LP8A 2HMIC 2QVKA 3NESA 1RUKL 35C8H 1K3IA 4Q9QH 1X4YA 2UZIH 2NXZC 3SGKC 4D8PB 1N2RA 5JXEC 3VDBA 4PJHB 3HNTL 4OZ4A 2V6HA 1H6TA 2NY6C 4OGZA 3X3FH 1UD5A 3T3ME 3L9BA 4O5LH 3T6VA 3O6MH 1W0WA 1ZXKA 4A2FA 1FVDB 3CXFA 1DQDH 1MCPH 4POZC 3CVHA 1QO3A 4AVIA 5BO0D 3EGXB 3QUMH 2VDQB 3LEVL 2WWKO 1HIML 3AQDA 3W39A 1MELA 1S78D 5E1HB 3OC5A 1IILE 3RY5A 3OLGA 3QH3B 4MXQC 4PLNC 2BZCA 4NO0B 3CAFA 1KMGA 2VUKA 4MAYD 1Q9WA 5AOMA 4QXGH 3HG0A 1I8LA 1NGXA 4X8JB 4DP2X 1PZDA 1BQLH 1A6WL 1RL1A 1XF4A 3WIHL 2GC4C 1BF8A 4XBEL 1AZBA 2IALA 4FLRA 4PB0L 1NJ9B 1VZGA 1BFVH 3WLWC 4JPWH 5IIEA 1J8RA 1F41A 1G43A 1N6QH 1QFWL 2PETA 2WXIA 2OXGB 1E9QA 1E5CA 4DVBB 5FV2A 1FL3B 3L7EB 3MJ6A 2V5YA 3T0XA 3RWGB 2R56H 2IANA 3OB0H 5IMKA 1CWVA 2ZE0A 5KSBA 1N0LA 3KJ6L 2WAQA 5C0CE 3RTQC 2WMPA 3GO1H 1Z2KA 2EUWA 1MCFA 4R7DB 1MIML 3DV4B 4AMXA 5KSUB 2B1HL 3PF2A 1XCTA 2G75A 4QWWC 2AXWA 3ARVA 2GAZA 1GOFA 4JPKL 5FUCC 2H9GA 4PBWD 3RL2B 4P59L 4Z77A 1ORQB 5SWSB 2FSEB 2G3XA 4JVUA 4D94A 2JK5A 3T9WA 4IGBC 1MI5A 4KI5E 3ZYOA 2HG5B 3QZWA 4AV4A 4DSYA 4FYRA 5FGBC 3SDAA 1OL0A 3JV0A 5BS0A 1U8JA 2OJZH 4PJEE 1FG2A 4MBRA 3O6FA 3V4VH 4AQAA 4GQPH 5F9JB 5C92A 4GUPA 4R90L 5D2LF 5HXMA 2VXUL 2XFGB 4LARH 1U4EA 5DD5L 4LE8A 4DPAX 3VI4B 1KV7A 4R96A 5LBSH 4X6BB 3I9PA 2EDNA 3LH2L 3VXRA 1E28A 2WKGA 4I0CC 3MRBB 3QHTC 4N22A 3D3VD 4YSRA 2IMMA 5IW1B 2QPDB 4NC2B 2PO6B 3W0WA 2X9ZA 4TTDC 4DK5A 1J8HE 2KL6A 1FI8C 1KTLB 4YHML 3X1NA 5HYSB 5F9OH 1CI3M 4O02B 2HCZX 1DBKH 1AIFA 2XWJB 1KBWA 3DIFB 2J56A 1LK3L 1XF5B 1URIA 2M26A 4QRQB 4AQ1C 3SE3C 5DK2B 3EH5B 3K0WA 1T1YB 3PP4L 4MA8H 5ICUA 3IXAA 5DC4B 3V4PB 2IVFC 2VYRE 3MRDA 1R3HB 5DO8A 1RZKL 1AS8A 2NTFB 2B16A 4WI9A 4QHUA 2VO5A 1AD0B 3VE0A 1BM7A 2DQGL 4H7VA 1TQBB 3D85A 3IMUA 3DV6B 1D5ZA 2IDSA 2IFFL 2Z91A 3O3DB 1BD2B 4FFZL 4YHPA 5C0ND 5IGXL 2BIQA 4Z7WA 4YXHL 5E2VL 5HVHC 3N1PC 1QZ1A 4QNPE 3HI5H 5HGGS 5JPNC 1SRDA 4Q2ZA 4QF1A 5DLLA 4YSTA 3HEIB 1RZFH 4MD4B 3N2JA 3GHBH 4MS8D 1J5HA 3VWKD 2FBRA 4M00A 2F53A 1IAIH 2NDFA 4NQUA 4GIPD 4M4PA 4FA8A 3BWAB 3L3DA 5TDPA 2AXGB 1FVEA 2DDQH 4H0LC 1RJYA 3CH1A 1GOGA 1YYML 2VC2H 2XWTA 1NDGA 3W3BA 4AGQA 5I30L 2OMZA 3TJEH 2YJLA 3NA9H 1MY7A 2HT4D 1VLXA 2X6UA 1ASPA 3QEQB 1E42A 2I24N 4FOMA 2Y5QA 4L0ZA 4JFEE 1C7TA 3LKPA 4QO1A 1KGIA 1Q72L 2EXTA 1MRDH 3QARA 4QXTA 3UAAA 4KHXH 4BSJA 3HE7C 2JKXA 1KJ3L 3HCVA 5LBVA 3TL5A 4LF3B 1PTZA 5C0IA 5FDWB 3DOHA 3ETBF 2XXMB 5DJ8B 4K7PL 2Y3AA 2G2RB 2GCYA 1LEGA 3E6HA 3RVTC 4H4NA 3RJOA 4XN5A 2V4LA 5HGDB 3APMA 1X5MA 5C08E 4JMXA 1X7TA 4NRXB 5E03A 4E68A 4XP6H 4ODVH 4KK8C 4UDUB 1XGQB 2E27L 3BPCA 4A6YH 2EDTA 2P8PB 2V7NB 3LS4H 3TTSA 5KG9B 3DTXB 3QC5X 5FO8A 1RUMH 2O5XL 1NGWB 1UD3A 1OSEA 4FKEA 3ROOB 1P5UA 5D1QC 5IW6A 1BP3B 4NBXB 2UWEF 1BXAA 1PSKL 1AC6A 3GRWL 4M6ML 1FAIL 1FUNA 2DQTL 2ILLA 3UBHA 3DHUA 3MSPA 4OGAC 4N2KA 5C0AB 1YEIH 4WI7A 4YS4A 5IY5B 2BSDA 5CGYD 1T83A 1THCA 3OC8A 1K4CB 2EXWC 3BW9A 1FV1B 2FR4A 1FO0L 2AI0H 4WEBL 4PP1C 5LJYH 3D33A 3GMMA 1KPRB 4FL4C 2Z3FA 2MOGA 4JMNA 4PLKC 4WKZA 4Z7UE 4AZ8A 3ARGC 1BF5A 2XZCH 3LKSA 5JA9A 4ZUWB 3U6XA 4ADIA 4HWEL 3M88A 2EEBA 2OCCB 4KJQC 3LN9A 3DX8B 4G8GE 2Z0BA 1XXFC 4CA4A 2BIIA 4TSCH 5FLVA 5GJSH 1F4YL 1MCQA 1A3RH 1F1AA 5ILTL 1A8JH 2NNAA 4FG4A 2DJMA 2OBGA 5CR8A 5DZJA 1HXMB 2AQ3A 1OAKL 5L4MA 3ET9F 4NKMA 3MXVH 2P4AB 4XP9H 1DBML 2CHDA 3H7LA 1AHWC 3C8HA 4OJEH 2D31A 1IFRA 2YPVA 3TH4T 5FGRA 2XY2A 3BISA 5K9KB 1QR1A 3WU1A 4PJ7B 1RZJL 4NXKA 1CXFA 1VSCA 4NO2B 5C09A 3DBXA 1XAUA 2H1LM 5FHBL 1JYNA 1NC2D 4NBYB 2F8OA 4FKHA 1OSZB 1A7NH 1AGFA 1W6LA 2J4WL 4UM9D 3O2VL 4AEHH 5BW7A 2VO8A 3REVA 2H5UA 1SXNA 1N64L 3HNSH 3V4LA 1QHPA 3NRQA 2TRYA 1TTGA 4W9LC 1LE9B 5IFAL 5LO7A 4TULH 2NYKA 4JGMA 5BV7B 4UI2A 4AV5A 2WO4A 2FJFB 1HH9A 5AZEL 1W8EA 2OM5A 5DQJA 1S9KC 3FU8A 5L2KB 2ZYSA 3UJJH 3DRQA 3VD4A 1MCRA 1I7RA 4J4PD 5DJDB 3TO4C 4CC4A 4AENB 3MRGB 4LVOB 1IB5A 1KGUA 1ZA3A 2DQHH 3LNHA 5I8EA 2ARJB 1YNTA 4RFOH 4EZMA 2N01B 3L4ZA 4H1LG 2YRBA 1MG2C 1O6VA 4I0PD 2ODIA 3VGFA 2R29A 3M1OA 3QC6X 3DHMA 3WIFA 4ELDA 1QAWA 3BJLA 3E38A 4JY6B 2X70B 3MUUA 3CN2A 4PJ8D 5E24E 2GBUA 3MZGB 1KT2A 2AQQA 4GMTL 4NRZA 4PGCA 2EE3A 4BZ1L 2NXZB 3BZFA 2VN7A 1G4MA 4FQ1L 4X6DE 4LP4A 5GIRB 3HG2A 3TYFB 3B1UA 5ITBH 1KXHA 3JVGA 3MMEA 4PBXA 2WWOA 3T6ZA 3P0GB 5AENA 2IGFH 3DGCR 4BQBA 4OLUL 3LEYL 4PMFA 3US1A 3UACA 3VGGA 4OF5A 4U1MA 3KPRE 1GZQA 4WW2F 1J1XL 3SQRA 3UYRL 2PYED 5JDSA 1ZA6A 3CIQA 2ENPA 3QJOA 2NDGA 2G0KA 4PV1C 4ORGA 1DZ0A 4R7NB 4H1LB 1MWAB 2IG2H 3S3JA 1J18A 3WXVL 4R26L 2CNZA 2Z8RA 3B6SB 4LDEB 4XP4L 2ZUVA 2KDYA 4XXCC 3FT4A 3EBHA 1H3TA 1QR4A 35C8L 4Q9QL 2UZIL 4U1IB 3WHXB 1R5WB 3D8MA 1BJMA 3MHZA 3AAZA 2VDPB 1BXVA 1I8LC 2OW7A 1JD9A 3F7QA 4GAGH 5DMKB 2EIDA 2BY0A 3X3FL 3ARBB 2KZBA 5HHQB 4O5LL 2YMTA 3O6ML 5E5MA 3RKDC 4ATTA 1H8LA 4GLRH 5AAMA 1DQDL 1ZV2A 1MCPL 3VM7A 4BH7A 3SJVD 1MRCH 4JRXE 4KXDA 3EO0A 3QUML 5I0ZA 5LG6A 3DUUB 1ACCA 4B41A 4C8XA 2CRZA 2GJJA 4OLVH 1CICD 3JWDC 3NTCH 3ALXA 4YSCA 5B1JA 4O2FB 4B9JA 4PY8J 2O4EA 4U1SB 4UINH 1M56B 4NJAH 2HSIA 5FW7A 4QXGL 4JAMB 4EVNA 1JHLH 5FFLA 3GXDA 1PX8A 3B7UX 3ISYA 4O51B 3CFKB 5CO1A 5GRUH 3ZDYB 5DVNA 1ORSB 4GKNB 4XN8A 1BFVL 2HRGA 2OL3A 4JPWL 1KNOB 3V0VA 1N6QL 3H9YA 2JB6B 4YGVA 4L4TD 3RIAK 3FHAA 4OZFA 4IGBB 2GBTA 4GRWH 4WUUD 5F2FA 2OR9H 4N20A 2R56L 3ZO9A 4LOUC 4ZI8A 5EU5B 1BA9A 3NBNA 1KB5B 2BS8A 4PRPB 3O45B 1LYQA 3G5ZB 3GO1L 2EYRB 2W59A 5CLZA 4LVEA 3O6FC 2VLRD 1HXKA 4EI6B 2O61B 1WFMA 3ZE0E 1ZT1A 3L5HA 1E5UI 4BA0A 4JR9L 4W9CC 3L1OH 3ZRCC 5DEFB 1TFHA 1SQ2N 4NNPH 4JDZA 3LRHA 1F4WH 1MZZA 4RRPA 1GZPB 1O5PA 3BD4A 5KZCD 3ARUA 1M6UA 1VPOH 3W11C 4EPSA 4HOXA 2CO6A 3IMBA 2KERA 2H32B 2CUIA 2VLKB 5IFHH 2OJZL 5GZND 4LCWA 1HQ4A 1A3LH 4AQ1B 3V4VL 1T0MA 1L7IH 3F04A 4GOSA 1CFTB 3JYCA 4GKZA 1EJ6A 4LARL 1U3HA 1DVFA 1ESOA 2KYIA 1KYDA 1WC7B 5DT1H 3PABB 5LBSL 4MA3A 4XP1H 3T0VA 3JYBA 4ES8A 4NERA 1T7YA 3QDJD 3PDOA 1JXKA 3KPLB 4NOFA 1NFDE 5HVHB 1MXDA 5JPNB 2DB8A 4GKSB 5F9OL 4BH8B 3VG9C 1HE8A 1XT5A 1DBKL 2DEXX 4FF9A 5HTSA 3ZY7A 3EYFA 5FEBA 2QTVA 1I1AD 3OB8A 4QGTA 4Z3HA 3EUUA 4N6QA 1TR7A 2AJ3B 2YA2A 1KBVA 4WZ9A 4MA8L 4HBCH 4Y4KD 1VFBB 2CDGB 1JF6A 3IT8D 4N3TA 3ZKXC 1N4XH 2J1ZA 5DS8B 3IKKA 2JSFA 3BQUC 4EQ2A 3QDHA 4GRWF 1DFBH 1S9YA 1U3JA 1G4RA 3AB0C 3V0WH 5I18H 5DC0A 1QSZA 5M94B 4P5MA 3MRCA 1T22A 4YFLI 1D9KD 1T6BX 3E6FB 1WJ3A 5CN2A 2Y06L 3HI5L 3P4MA 1KPVB 4H25A 2YD0A 3T04D 1RZFL 3HE7B 5HHVH 4JZJC 5JIKA 3S5LA 4KZDH 3GHBL 1SM3H 4Y5XA 5C0JA 2LAAA 5JHLH 1UFGA 1IAIL 3B2PA 4S1QH 3KDPB 2GUOB 3VXME 3LKQB 2DDQL 5D7LA 4XOEA 2VC2L 4X4XA 1G1CA 3TJEL 4KKLD 3BAXA 2APWA 4LSPH 3L3JA 2D8KA 2NR6A 3GM0A 4P9MH 3NA9L 2FNWA 1MNNA 4KO6A 4YDVA 3EO1A 3L2NA 2HLFD 2IH8A 2ENJA 4DP0X 2CBTA 4QRAA 3AITA 1INDH 3ECUA 4IDLA 4KFMA 5DD1H 1OARH 5D1QB 1MRDL 4DOHE 4KHXL 4UOW0 5DZOA 3T4YB 5I0YA 3EOAB 4HC1A 4N2OA 2BOCB 3LKOB 4K5MA 4V1DB 3T71A 1P5UC 5J6HB 4RFNB 3V52H 3QT2A 4JO4H 2D03H 4LPUA 5JHDA 3D6GA 3UPRA 4K15A 4U2ZA 2HJKB 2YS4A 3FL7A 3HNVH 4TNVF 4N2EA 3VFTA 2FIKA 5AD0B 3T1FB 4A2MA 3V0EA 3ECQA 4XP6L 1DLHA 4ODVL 1T83C 1XZWA 4LOEA 4PJAA 4BHUA 4A6YL 2VLJB 4FL4B 3CH8A 3LS4L 3ARGB 1QI5A 1KCWA 1FG9C 1RUML 3HHSB 3GSWB 4ZG1A 1HQRA 5D7KE 5E5RB 2CIIA 2B8OT 1VKXB 4F8NA 1OW0C 2W9LA 4DO5A 4WY7H 3U0WH 5FGSA 4GSUA 5D6CB 5FOBB 5ADPH 4X6DF 1YEIL 1WS7A 4HJIA 4YLQT 1NC4B 3QPXH 2ETWA 2VT0A 3AXHA 1AKPA 5IZ7A 3UH8A 1NOAA 4B3EA 4IBUA 2XBTA 3VFNB 4PRHB 1GOHA 2WXRA 1OGSA 1S6NA 3G08A 4XPFH 1A9BB 4RIRB 3KZ8A 4MB3A 5ES4B 2XZCL 4FTVB 1L9TA 4K94C 4MASA 2ZG3A 4MJIA 1XO8A 3FFCB 1UOWA 3SKNA 3HS8A 4TSCL 3WGUB 5GJSL 1A3RL 4WO4C 2MQGA 3KPQA 3SCMB 3L3GB 1EX0A 3ZGHA 3M7FB 1I3VA 3Q6FB 2DKMA 3DOSB 1TVBA 3SPJA 2XWBB 5J6GA 3ETTA 2GUYA 3KYNB 3MQIA 5EORH 3P40A 3EYVA 5IM7B 3MXVL 4XP9L 1K2DA 3ELQA 4BHUI 4U6XA 1GMIA 1NCHA 3NOIA 3QQ3A 2XIIA 2C7UB 5DRWB 4M56A 3KPMA 1R33A 2LT9A 2XN9A 4L8DA 2KLRA 4KV5E 3QORA 3BZ5A 4G42B 2K4WA 3ZPDA 3PWPB 1ML0A 5IKCA 3FOMA 3R1GH 4Q6IC 2K8MA 4CC4C 2NXYC 3IJEB 5F7EH 3T0ED 3G6AA 4BFIA 3V6OE 2APXA 4HHGA 2F0CA 1A7NL 3TEYA 4TOYH 4NLHA 1BVZA 3ZTCC 4AEHL 4L4VE 3KPTA 1F42A 5EPMA 4UV4H 4F93B 2B7DT 3WIHA 3HNSL 1I3GH 1WP6A 1NCJA 4DPRA 4HQQH 4UMSA 2YIHA 2AF2A 4EN2A 2H26A 2WZ0A 1BVNT 2A99A 4TULL 5KAQG 1BIHA 4X9GA 3UJJL 3TEUA 1ZY9A 3KLDA 4AYFA 3D50A 1IMHC 4JFDA 2DQHL 3EGDA 3DK2A 3O0RH 4XVUD 1EA9C 5AW6B 4XPBH 1W0WB 1X3DA 2QVMA 1HAWA 2IOMA 2XUWA 4RFOL 1QO3B 2WYIA 4ZS7H 1P2CA 4LBAA 4E2OA 1KB9J 4UQDA 3U48A 3ZE0F 2ZP9A 1PKQA 2VR6A 4GRLD 4DEUA 5FUOH 3DJ9A 1SYVA 3F7YA 5HVWA 1DVQA 3MBEB 5LCVH 1TKWB 3FQXA 3FCTA 1BF2A 4A67A 1HS6A 1MPAH 1HU8A 1IGYB 1MLBB 4FQ2H 4B96A 1EFXA 3HG1D 4H88H 2XQYA 5ITBL 1XF4B 4MLSA 4EXKA 2VSDA 1RLWA 1S5IH 1UOLA 2IGFL 3I6LE 3HS0A 3TIEB 3VX1A 5IMOA 4RCAA 1HILA 3UTSD 2VITA 4MJHA 4Y19B 4OZGB 1BOGB 4Y4FA 3QZWG 3ZE1B 3A3YB 1E9QB 1UUNA 3HHRB 4ZW8A 5AAMC 4WF7A 1IIIA 2YWZA 2YHGA 1M1SA 2CG9X 3D08A 4J12A 4APQD 4XVTH 2SEBA 2VUYA 2IG2L 3ES6A 2IANB 3I84A 4E9XA 2CJSA 3QJZA 4PWIA 3V7AE 3RIAF 5IP4A 4PRBB 4BDVB 4Z7QB 4OCLC 3NP3A 2YD2A 3S3DB 1QFWI 2WZAA 3MYJA 4Y1SA 1LEKA 1GL4B 1NFDF 3VI3F 4FABH 1HYSC 3LZLA 2QPUA 4WHDA 4GAGL 3RE0A 2BP3A 3P73A 4QCIA 2OJ1A 4QRUA 1SEQH 3EDFA 4NKDA 3SDDC 5IT2H 2G75B 3KCPB 5HHOA 5E0FA 2CLZA 3HHMA 5ADOH 4RAUA 1AQ8A 2BNUB 5HYJA 4U4IA 2ISDA 4AQ8A 2VJXA 4NDMA 2PCFB 1MRCL 4Z77B 2NQ3A 4RA3A 2AVFA 4DVRH 5E2JA 1P4UA 2IDQA 2JK5B 2F74A 2OQJA 4OLVL 1MI5B 3NTCL 4W1TA 3TBYA 3BCDA 5D4QA 4WTQA 3CFQA 3QZWB 4LCIH 4EF3A 3Q0HA 4UINL 1U8JB 3UBFA 2BXZA 3N44F 4NJAL 1V3KA 4RMUA 4J8RA 3MKKA 3O6FB 4FQIH 3KMDA 1JHLL 5GRUL 1GGBH 4XVOA 2NY1C 4FFWC 4FFZA 1HWGB 4GUPB 4WCYH 2OTWA 1FN4A 3PV6A 4YBLC 1WGOA 1BJ1H 2GTWA 3IMVA 4UTAH 3H3PH 3VXRB 1BQUA 1E28B 1EGJH 5CEZH 1GGCH 2RR3A 3PY9A 2WJ5A 4LLDB 1TQVA 4IKNA 5E94A 3W0WB 2OR9L 3GF8A 3KNBA 4FFYH 1CFQA 1FGNH 2BP0A 5JR1H 1FNFA 4Y16A 3QFDB 1ACYH 5IV2A 1Y0LB 2ZXAA 3QJHA 4WFGD 3F7PC 4YE4H 2OMXA 1NGYA 1XF1A 3HZKA 2FQGA 4OBSA 5ELIA 2ZCKH 3F7VB 1FBIH 4I18A 3S8FB 1AO7A 3QFJD 1Z9MA 2QBWA 3L1OL 4JFXA 1M1XB 3WKPA 1U3HC 1E2VA 1TT6A 3K4AA 4DERA 2NUPB 4NNPL 1EHNA 1S8DA 4QHUB 3VE0B 1DUZA 1OAXH 2CD0A 3QIUA 3QUZA 1F4WL 4EZLA 2AK4A 3CZEA 3GD1C 1D5ZB 4UAHA 3DX0A 3FT3A 3G5VA 5EZLA 1VPOL 2MHAA 3NZHH 1UM4H 4WKXA 3VG9B 1G7HB 2FEJA 5IFHL 4QF1B 3ZRFC 4NQEE 2ZUQC 4FQPA 1A3LL 4OCRH 4HZ1A 2VWEC 2BHYA 4KRPC 1L7IL 5I1CH 4XI5C 2VMCA 5MEQB 3MV8E 5F9DC 3ZKXB 2BVPA 4XMKH 4A68A 3UZEC 1WF5A 3KYOA 2F53B 3BQUB 4RFEA 4FE9A 4F8LA 2WXMA 1YPZA 3ZL4H 5DT1L 2Q10A 3FB6A 4ELKA 1AMXA 1FVEB 4I1RA 3D69A 2XWTB 5D7JC 1RK0A 1NDGB 4XP1L 4B9ZA 1ZVSA 3UPAA 2W94A 2NY5H 1U8QB 2CBPA 4FTDA 3NDZE 3OJ2C 4BXVA 3ZKND 1M9SA 1MFEH 4Z8FH 3VXUE 1F3DH 3QE5A 3RZWA 4JL2A 4H13C 5HDRA 1PLBA 5CGMA 1JGVH 4JZJB 4PSPA 12E8H 3OHXA 5AG9A 3LKPB 3KLKA 4Y5YB 5DFAA 4QXTB 2JFCA 3SGDI 4PYHA 1Q4NX 2MMXA 4HBCL 3SBRA 3T3PE 3UJIH 4LOFA 5C0IB 4GH7B 5IHWA 1FO0A 1N4XL 1E5AA 1WZKA 2OZNA 3Q44A 4Y5XC 4EO5A 2F18A 4J3SA 5I5IA 2JIXD 1IBBA 2Y5TA 4C56E 5AAWA 1KLUA 1DFBL 1A1OA 3TVMD 1KZYA 1N5AB 1Z6JT 3V0WL 5I18L 4CN1A 1KJ2B 3DX7A 3VXNA 1IC0A 5AB9A 1UA7A 4RMQA 2HPTA 3H9SD 2NR6C 4BFJA 4Y1AA 5GS3A 3IN2A 1A9EA 5TPWH 3BPCB 5GRYA 3OLIA 5KSAA 1L6PA 3B2XA 2HLAA 1ZLUK 1OD9A 2IWKA 8FABA 2NW3B 5FO8B 3LXUX 5G5DB 5HHVL 5INDA 3OKMB 3N1FC 4KZDL 3AQZA 1P5UB 3DHPA 3FQ2A 4KKAC 4ZMPA 1SM3L 4GXUM 4L3FA 4FULA 5JHLL 2F7QA 4HJJH 4PJGA 3R0MA 4S1QL 2V2XB 3IMWA 4X50A 1V10A 2EEFA 3OKEA 3QZPA 4B27A 5ANMA 1FJ1A 4OZHF 3SE4A 3FU6A 4LSPL 1AZCA 5DDHA 4AKPA 5CU9A 1O7VA 4P9ML 1OLLA 3B3IB 1JSYA 3DGGB 3BIKA 1JWSA 3KPPB 1SYSA 2C3GA 2LW3A 2YAPA 3GB7B 3KW7A 3TPUA 2JKIS 4I2XB 5HP5A 3WE6B 1INDL 4NUJA 2WYHA 5DD1L 4BGDA 1OARL 1U2HA 2YAQA 5J7CC 5AOZA 1TCMA 4AK2A 3ZHDA 4ICWA 1S9WA 4KX8A 2ERJC 5KTEH 2QLYA 3V52L 4JO4L 3FTXA 3I3EA 2D03L 3LD8C 4ATWA 1BQ5A 1SDAB 2R1WB 3LZNA 3EUDA 4R7LA 3L95B 5ECGA 5HI3D 2IO5A 2J3SA 1B2WH 5D5MB 2OX5A 3HNVL 1KG0A 1OOWA 2X2UA 4EN3D 4FQXA 1HL4A 1X5JA 2IQAA 4BZ2A 1E8WA 1LK2B 1QFPA 2FT7A 3F7RA 1A4KA 5J1AA 3QVAA 3BUTA 4PJIE 4XT1C 2MWCA 3NCYS 4G9DA 4XB8A 4JFYA 2WLLA 1QSFA 4C4BA 3Q2WA 3BN9C 3RWFB 4JDTH 1UA6H 2D31B 3EO9H 2BVQA 1TTBA 2OMWB 1ES0A 4IRZH 3ROLA 2Z6FA 2RHEA 3QXTA 4WY7L 1RSYA 1LP9F 3N41F 3DBXB 4WO4B 5C09B 3U0WL 2NY0D 4CN4A 1HZHH 3BSGA 1KCSH 5ADPL 1FC1A 4MQTB 1B0GA 3VFSA 4BFBD 1OK0A 4BZ1A 1AGFB 4GBXB 1ZHLB 2DQCH 2L8AA 2UY7B 4OR1A 1IAKA 2AEQH 3S5ZA 4HAKA 3QPXL 3REVB 5GZOD 3D2UB 5ECJE 1ZTMA 5FCSH 5D1ZA 1U8KA 3WDJA 5EEXA 4A7UA 5HYQB 3TH3T 1KLFB 2MQ3A 4KPHH 4XPFL 5DHMC 5EU6D 2DV6A 4FI6A 4P46D 5FYKD 3PAVA 4HX1B 5HY9A 3A23A 1PZCA 3O2DH 1TPXC 1H3XA 1FORH 1YMMD 3CZJA 4Q6IB 4Y9GA 4PTTA 1PJWA 3QORC 4KX7A 2EDFA 1IGIH 4M7JH 3BZ4A 3OJDA 3MFGB 3MLSH 4XMWA 5BRZE 1J5IA 3GMNA 4UQIM 1E9OA 3SYAA 2MQ0A 4OVVA 4GW4A 3PREA 3TZVD 5D7IB 5I75B 3F00A 3QPQC 4GJTB 4GIOA 5EORL 3WIFB 3L54A 5D2LA 2WXGA 4W4OA 2R1YA 4HISA 1HHIA 5D6DC 1E6OH 4ZDHB 1J5OH 4NRZB 4LU5H 3BZFB 3WKQA 4HIJA 5E1QA 2FYYA 3QUMA 1LO3H 1QWHA 3GIVA 2FX8H 3V95A 2FJHA 3UCRA 4CILA 4FEIA 2OS7A 2ZX5A 3KM1A 2C4XA 1NANH 5T1LD 1OOAA 3R1GL 4J5VA 2X7LA 2HN7A 3HG4A 5F7EL 1GY2A 2UZYB 3P77A 2JVUA 4U1MB 2OSXA 4ZTPH 4TOYL 4HU2A 5HPMA 2V37A