1E9OA

Crystal structure of bovine sod - 1 of 3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
151
structure length
151
Chain Sequence
ATSAVCVLSGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADSNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Variability of the Cu Site in One Subunit of Bovine Cuzn Superoxide Dismutase: The Importance of Mobility in the Glu119-Leu142 Loop Region for Catalytic Function
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE
total genus 37
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1e9oA00
1XTLA 2Z7UA 3L9YA 4A7SA 2VR8A 2NNXA 1JK9B 4OH2A 3KH4A 2VR7A 2AQNA 2C9UA 4BCZA 1E9QA 3F7KA 2Z7ZA 4L05A 2GBVA 1E9PB 1YAZA 2ZKYA 4N3TA 1BZOA 2C9VA 1QUPA 1SOSA 2AQRA 2WZ6A 2ZKWA 3K91A 4BD4A 1SXSA 2Q2LA 4A7QA 2LU5A 3CQPA 1IBHA 1SRDA 2AF2A 1F1DA 2Z7WA 1Q0EA 1EQWA 5KBMA 1B4LA 2ZKXA 1YAIA 1IBDA 4MCMA 1TO4A 1N18A 3H2PA 3KH3A 1F1AA 4MCNA 1Z9NA 4A7TA 2WWNA 1OALA 1PTZA 1UXMA 1S4IA 3S0PA 1SXNA 1DO5A 4A7GF 3ECWA 1ESOA 2E47A 3SODB 5CU9A 3ECVA 5KBLA 3GZOA 1F18A 1PZSA 3MKGA 4B3EA 1OZUA 1XTMA 1JCVA 1KMGA 2C9SA 3GZPA 2Z7YA 1EJ8A 3CE1A 3L9EA 2XJLA 1PU0A 3KBFA 3GTVA 1Z9PA 1HL4A 1JK9A 2WKOA 4BCYA 1N19A 3QQDB 2WYTA 3RE0A 3GZQA 1DSWA 2V0AA 2APSA 2WWOA 1SXCA 3HFFA 1OZTG 1UXLA 1IBBA 1HL5A 1XSOA 2WZ0A 3HW7A 3KBEA 1CB4A 1F1GA 3GTTA 1SPDA 3KM1A 1COBA 1SXBA 1YSOA 2AQPA 1SXZA 3CQQA 2SODB 2ZOWA 2WYZA 3T5WA 5KBKA 4N3UA 1E9OB 4A7UA 1E9PA 1P1VA 3LTVA 1RK7A 1L3NA 3H2QA 3HOGA 1SXAA 1U3NA 2R27A 2K4WA 1IB5A 4U4IA 1E9OA 2AEOA 2JCWA 2XJKA 3MNDA 1OAJA 3ECUA 1SDAB 2JLPA 3F7LA 1B4TA 2AQTA 2E46A 1BA9A 1E9QB 2WZ5A 3GQFA 1TO5A 1MFMA 4OJAA 2GBUA 2AQQA 4A7VA 1SDYA 4A7GA 3QQDA 2AQSA 1AZVA 1IBFA 1OEZW 1FUNA 1CBJA 3PU7A 3KM2A 2GBTA 2WKOF 4FF9A 2VR6A
chains in the Genus database with same CATH superfamily
4K23H 3WSQL 4PU2A 4B0MB 1M7DA 1M3JA 4JKKA 3V6ZB 1DQLL 5DJXA 2YAOA 3GIVA 5I1JH 3PDGA 1YYLH 2EH7H 1E5ZA 2PTVA 3IDUA 2RALA 5IQMA 3TBCA 2Z7WA 1NCTA 5LXVA 5DURB 1OTSC 1E5BA 2Q7YB 1USZA 2R0ZH 3IDGA 4Z78A 3LIUA 4IRZA 4HSCX 5LDSA 4PRHE 5EU7C 3QC5X 4KK6C 4OLZL 2XX1A 2XZQH 1RLWA 3O8XD 2GFBA 4X9YA 43C9B 4PJGE 4ANXA 1FLRH 4RZCA 4WWKD 3QQ9C 2Y5EA 1KTLA 1PLGL 2CA3A 1PKQE 3KW7A 1LTXA 5JPMC 1JNHA 3UBGA 2FT7A 3F58L 4GO9A 5T5NG 3F65A 4MHHI 4AEIH 4XOCA 3CFDB 3QFJA 4N28A 2FL5B 3IMWA 5D7SH 4J3OF 2B1HL 1PD1A 2IQAB 5ESQB 1IGYB 3WDIA 3O9WB 1QSFA 4PI2A 5AYTA 4H5SB 5DHVB 4QRFA 3NVQA 4AGOA 3UTPD 2XA8H 4LLWB 2LTQB 1N19A 2PCYA 5HDWA 3VX0A 2BVPB 1T4WA 1RZQA 1XD1A 4YE0A 3T2LA 5FECB 4NO5B 3REWA 2NPLX 4GG6E 4G6MH 1DFBH 1Q90A 4YPGA 5CEYA 2DBLH 5KANI 5C0FA 1YEWA 4FQ1H 4XC1L 2MNJB 4NQVB 3K3QA 2YXVA 3UTTB 1IMHC 4UQDA 1M1XA 2NY5L 3FFDB 5CBAA 3WU1A 5I74B 2R4RL 5E8NA 5FYLH 4RSVA 1DSYA 4AQ8C 4Z7WF 1X7QB 3FOMB 3PQYE 4XMPL 5IB4A 1WBZB 5I0WA 3HC0B 4B96A 1OCWH 1RU9H 4KRPB 4P06A 1A6AA 2FBJL 3GMLA 4FFYH 4L4VD 3V9EA 1BGXH 4AC4A 1ZOXA 5HGHB 3H2QA 2XQBL 2JK5A 1JZ6A 3CZNA 3OKNA 3G5YB 4LARL 1J7VR 4S1DC 5HGAA 3ARGC 3KPSB 3X11A 3DO7B 4FG0A 4FKKA 4LLUA 2IDTA 3GD1C 1BF8A 1E4HA 1KSRA 4TVPH 3OPZH 3TL5A 3B8SA 2HTLC 3PS6A 4PREA 3LZRA 4ZSOE 2IALB 4LQFH 3FYEB 3O2DA 4HT1H 4HEPG 4NZTH 2OMNA 4QMEA 3N0PB 3UADA 2V7HB 1OCWL 5FYKU 5ECGA 3BWAB 3LZOA 5JOFB 1GTNA 1EBPA 1UD5A 4MB5A 1PQZB 4S0HA 5D7IA 8FABA 1GMIA 3E6FB 1N59B 4JFDB 2XQBH 4HOMA 3D7PA 1V7MH 4HUUB 4TF4A 5DO2C 2YWZA 1CL7I 4OLYH 1C5CH 3L8QA 2VO5A 3AREB 5E99L 2WC7A 3E1ZA 1ACCA 1T5XA 1B0GB 1HL9A 2AKRB 1OAUH 3G9AB 2Z4QA 1FG2A 3WUWG 4IRJC 4AYID 3DXAB 4OD3H 1ZK5A 1IFRA 4AL8C 3IGLA 2CHWA 4O9HL 3VCLA 4XBGB 2DMHA 3SHSA 2ZYRA 4G8AC 3BDXA 4DP7X 4NQEB 5JQ6H 1BMWA 4KRNA 4QLRA 1RERA 3VI4E 2FGWL 5DD3L 1MWAA 3WJMB 4K8RH 2RMNA 2HKHH 5K39B 3VM5A 3FC8A 4BWUA 3ABLB 2Q86A 4NRXB 4BFBD 2VTFA 4QRRA 1ITBB 3E7JA 3AT9A 2YN3A 3OR7A 2DLTA 4ONHA 2FE0A 4YXLH 1HSBA 3C9NB 4GI9A 4E9WA 2Y06L 1IAIH 4FXLA 3LJ3A 1CGWA 2XFGB 4WV1A 1HQRA 2OKMA 3OVUB 4FZ8L 4IQHA 2NOYA 2ZZUT 5FKPA 4CNIB 1TJMA 3Q2LA 4Y89A 5E2VH 2AJVH 3JT2A 1UA6L 3T0AA 3V4VL 1MQKL 4EI5B 4OV5A 1JK9A 3UYPA 4URKA 2O72A 1T6WA 2UXTA 1FCGA 2R0KL 3FUKA 4FFZL 4DEPC 2IPKB 4I0KA 5DD6A 4L3CB 1S7QA 1Y07A 3VWJB 2NX5B 2JJTA 4W68A 3QZWB 4UT7H 5ISZB 5FECA 1D9KA 4O02L 1JERA 1RJLB 3QJOA 1QEWB 3D33A 4QJ4B 1YDPA 4Y2DD 3F85A 4X5LA 1KTDA 1LGVA 2B1AH 3EAKA 1MOEA 5AVVB 4MMZA 5CJQH 3E1F1 3RBSA 4M7ZB 5C1MB 5FIEA 1FZJA 4R90H 2OQJA 3CPLB 5IK3B 5JW3L 4HQQL 1KN4L 1NCAH 2EYRB 2FX7H 1RHFA 4G7YH 3AUVA 3WMQA 5LQBH 3U82B 4PS4H 4LCCB 4GRWB 3SYCA 4QXUL 2WBJA 2B4CH 2Z91A 1WGOA 5B39G 4FKEA 4M6MH 1XL6A 3LH9A 4NWUH 3TJHD 5T1JA 1JVKA 5HGAB 3X11B 4BGLA 3GSOB 5I30H 1RZJL 1K9TA 2EDNA 2CHDA 4S1RH 4UYQA 4JO2L 4HK3J 2TSAA 2VR6A 1ONQB 3D69A 1XTLA 4NN6C 1OE2A 4K9EC 5FOJA 2OS7A 4GS7C 2YEVB 5KSAC 1ZT4B 3WLWD 3F7RA 1FE8L 4YXKH 2OX5A 1YUHA 2BERA 3ILPB 2LLLA 4X9GA 4JDEB 1F13A 2NNRA 3APMA 1P0SE 4FQ2L 2VAJA 3FCSB 1NLBH 4HUCA 4X4KA 5BQ7A 2W9EL 5CJ5A 3CZGA 3EDEA 4UBDD 3FQTA 4Y16A 1Y7VA 2MIZA 4YXHH 2XN9D 5JHBA 4OF3A 5AENA 4J8RA 4AUYA 4F8PA 3O2WH 4IBUA 4RESB 1H3GA 3F00A 1MNNA 3JTBA 2K6ZA 3TX4A 4Q9QH 5C9KA 1QHQA 5I1AA 5D9SB 4L9LC 5SWQB 1D6VL 2NDGA 4A7GF 3ECWA 3QCUH 4HCRA 2E47A 1GS6X 3GMQB 1OPOA 3R1GL 4PJXE 4JRXA 3NJKA 4YIQA 2FEEI 4WFHD 1ZLSH 3VGHA 3II1A 4IBVA 3F7VB 3P77B 3N42F 4YDKL 4POYA 1RI8A 2D73A 4UTBH 1RIVH 4JFFE 1OARH 2A9DA 2YXFA 5EBLB 3HUJE 2H6OA 5HHMB 4G70B 2AJ3A 5BXFB 5HVWA 4U33A 1X9UA 4DETA 1IC5L 3GJFK 3ZHKA 5IB1B 4BELD 2WLLB 4L4TA 1VADB 5CLZA 4M7KL 2BIQA 4LSSH 1P5UA 2J6EA 3GRWH 35C8L 1YSOA 3HAEB 2Y5TB 4DN4H 3OKDA 4NHUA 1T1ZA 1CVRA 3WAJA 5FOBA 4M61A 5L8JB 2F18A 1P4LB 3STZB 5FPIA 3LXAA 3RNQA 4QYOA 1UADC 5KYWA 3MUJA 5E6YA 1I85A 3UGXA 2KPWA 5AKRA 1QFHA 4LDOB 4EUPB 5BNXD 2N7BA 1VGKA 3ZDZB 2Z34A 1FFPB 4G59C 1T3FB 4C4UA 5ITBH 1E9QB 4ONFH 2VJXA 4TUOB 2AQSA 2FJGB 5HI3D 4KITB 2H5UA 2WAHA 2X40A 3IJEB 4WW2B 3VM7A 3WO4B 5JDJA 3QXAB 1KJMA 3NZ8B 4M7JH 5DJ0B 3VXNB 5I16B 1IX2A 1JS4A 4NWTH 4DW2H 5DJAA 4P4KC 3EH5B 2ADGB 4I13B 5IFJB 3S2CA 4ZUVB 3A6CH 3PNWB 1REIA 3MRPB 2OJZL 2QDWA 4G8GA 2CBTA 4F2FA 5I73B 3C5ZB 4WO4B 2VIRB 3L95B 2A9AA 2ESVD 5L8KB 1SVBA 3SBWC 3RVTC 4KKZA 4N8UA 2FQFA 1RUAL 4RX4A 4AJ0A 3F2LA 1MLBA 3VD0A 1RFDH 4QCIB 4BZ1L 3BWSA 4PBDA 1HDMA 5HP5A 3CFJA 1PZUB 1N6QH 4MWFB 4D2NA 5FKAB 2JCCF 4U1LB 2F7QA 5F1OB 5HGDA 5J3HC 4FDWA 1LDPH 5G4OA 3H56A 3V0GA 5HGBB 4CBPA 2VMEA 1GGIH 4JN2A 4YZFE 5MEPB 4NRZB 1S7UB 4F2MA 1UATA 3N44F 1PD0A 1AYRA 2AANA 2OMTB 1FCCA 4K7PX 3D0LA 1JNNL 5CUSH 1K4CA 2ITDB 2OSLB 4M5YL 4WCYH 3D2UA 2QFRA 4FMVA 4N26A 2CLRB 4P59L 4LLDA 1KT2B 2Z35B 4WTZG 4I2XE 1XIWA 5F0MB 1HEJC 3V4PH 2YLHA 2ZTBA 4QYAA 1AKJA 1SOKA 5C07E 1JE6A 2WTOA 4J3BA 2R0ZL 4FCAA 5AVRB 5FXCH 5T3XH 3RWJB 1N6UA 3LS4L 2F5BL 5KG9A 4HX1B 4OLVL 4POZC 2FJHB 5I1DB 1MRCL 2IH1A 2DEXX 4HJEA 3F6LA 4PGEB 1VDGA 2LAGB 4G42B 3FTWA 5AW2B 2EIEA 5HYIA 1KB9K 1MVUB 4H20L 2YAEA 2O5ZL 3BKJL 4L4TD 4TSCH 4GXUN 4KO7A 1PBYA 2FATH 3SE9L 1V3JA 2FAUA 2JH2A 4J4PD 4OGZA 4LKCA 2XA8L 4I87A 2I26N 4GG8B 4JPVH 5SX5K 5KZCB 2BK8A 2OMYB 2A4EA 4KGJA 3BRFA 3BJ91 2BVUA 4KK5C 2PETA 5FUCE 4MD4A 4R8WH 1QO3A 2JKRM 5DSCA 2VXTL 1UH4A 4YHML 5IQ7H 4L0YA 1OCCB 4LSPH 5A16A 1UA3A 3CK0H 3UC0L 5FYKD 3KCPB 1T3FA 5SWZD 1S9YA 4JKPH 2IXQB 1J87A 2A74B 2ZG1A 3MLXL 3V7AE 2A9NL 1CK0H 1TPXB 3VFNB 5BS0A 3MBXH 4QHUB 5GISL 3T3ME 1BXVA 3S4SG 3C09B 3HPJA 1S7RB 2YPLD 3LN4A 3UAJD 4YSEA 3ZPDA 1PAMA 1I53A 1T2JA 4P49A 3KWTA 2W95A 2WINB 5GS0C 4ZO7A 4Q6IB 4WWKB 4S1QH 1JRHH 2X4NB 4M8QA 3X1BA 5EH1A 4AMWA 2OL3A 5HSFA 3FZUD 2BSSA 4MJ6B 3P9LB 4WFFD 5TPWH 3DUSA 1TQWA 3OJ2C 2YA1A 2VIRA 4M7LL 1J05B 5BV7L 3CU7A 2EYSB 4JUTA 1WITA 3BUIA 2PCFA 4F15B 5EUOF 3PHOA 3S96A 1MVFA 1BQKA 2NYKA 4ZQKB 3DURA 1J0YA 3U6RA 3IS1X 1OAKH 3L1FA 5AZEH 1GC1C 2Q8AH 3Q3GA 5JXEC 1XF2B 3GFUA 5CCJA 5I6NA 2DQFA 4NJ9H 4N86A 2AGJH 3SOBL 4BFOA 5CCKH 2C9AA 3M8OL 1N8ZB 3IGKA 4UT9H 1JZIA 4YZWA 4LCYA 4I0CC 3BPLC 5JMOC 1U92B 5K59E 6PAZA 3AG4B 1HL4A 5KVMC 4GP8B 1S7SA 5AW9B 3WYRA 1O7VA 3QB7C 3O0RL 1G9EA 4QLWA 4F7KA 4H0HB 2AJZA 1WZAA 2BS71 5LB1A 4BXVA 1V5JA 2NXYC 3HN8A 5DJYA 5AWNL 1VGEL 4HA1A 2ZUWA 4YPGB 5D1ZB 1DQMH 4HJUA 1J8HA 5DO2D 1U8JB 2YAFA 1DLFH 4YHKL 3RIFK 3QIWB 4X99A 2CSPA 1N3NB 4QRPA 2NUPB 5DT1L 3TASA 1DL7H 1ZLUH 3ZE2F 1HXYA 5A6IA 1OTTC 3MV8E 3Q2CA 2KZ1B 4NN5B 1KNOB 3QSKB 4UWQB 1LK2B 5FGRA 4N5ED 4LEXL 4R5TA 4FABH 5JMRA 1FNEB 4WV1B 3RWDB 3KLDA 3P9WB 1X7QA 1SDDB 2XV3A 3FOMA 4XGZB 1SFDA 3PGFL 4YR6A 4CVUA 5IB4B 2VLJD 3AQDA 5CMAA 2PW2B 3TA3C 1C12B 1O6SB 4E41A 1JNHB 5TDNA 1UM5L 4FXGA 4Z7WA 4H1LA 5FCUH 1I4FB 1M6UA 1BXAA 1ZV2A 1KXTB 4JFDD 3G5ZB 1ZTMA 1FGNL 5KSBE 5ICXB 2Y7LA 3LPFA 2XG4B 5DT1H 4CA4A 5T3ZD 3QQ9D 4HFWA 5IHZB 4JRYB 2EADA 3WLBB 3QUYB 4XWOC 1D2PA 3ZRCC 4FYTA 4NKMB 4KO6A 1LEIB 1YHPA 5TH2B 4NCC2 1INQB 2BZ7A 1GGCH 2CQVA 5GGSB 2XZCH 5ICYB 3NJNA 4FYRA 2BXYA 4J1UA 4X8JB 2VN4A 3BZFA 3G3LA 3WFHA 4Z7NE 2EUWA 4LMQI 3WMSA 4CAGA 2GY5A 5BS0D 3AY2A 3VW3H 3ARVA 1D5IH 3JWNH 5KOMC 1BQLL 4PV9B 5IB2B 1CR9H 1NC2D 1U8HA 2OXGB 2P43B 4LESA 1SRDA 1NBYA 3QIUC 4HEPA 1M2OA 4PGDB 4R3SA 1E50A 4OZFA 5LAPA 5HI3C 5I8KL 1YVLA 4NUJB 1NGXB 4ZFZA 2ZXCA 1JHTA 2R2HB 3HHRB 1IC1A 3RTLA 4MJ6A 3CN4A 1RK0B 4P3DB 2EVJA 1GHFH 2ZCZA 3PAYA 3Q6GH 3G6DL 5LWYL 4EI5D 1L5GB 1WPCA 1SXNA 5PCYA 2VCOA 3QORD 4JCMA 4WFGE 3EXLA 2MPAL 5D7LE 1I8AA 1N5YH 1I7TB 1HYSD 2EDMA 5EWIH 5B1BB 5SWSB 4M48H 3WFBH 1XTMA 4JBSA 2AK4A 3ZL1A 4PCSA 4ONHB 3PP4H 2NX5D 2VR4A 5I24A 3ZDYB 4BFJA 1V8HA 4ZW5A 2C9QA 1F6FB 1OSYA 5INDB 2FO1A 3B4NA 2UZXB 5E2VL 2GI7A 3MSPA 1EV2E 2F53E 2GK0B 5GIRB 1A6UL 4MDIB 4Y2DB 4KQ4H 5DZNA 3K2KA 2PR4H 4QF1A 5FK9B 2ARWA 3CK0L 3NESA 3W1ZA 1SVZA 3S4SB 4OFIA 1UWEH 4OZHB 2YEZB 2AKRA 2MPAH 5BRZE 5GJTL 1A0QH 4J5VA 3FTYA 4XOEA 3T0ED 1G1KA 1UWGH 2QADB 1SXBA 4FG6D 5ADPL 3ESVF 3FTSA 5GISH 4ZZFA 3HRZB 2Y1ZA 3IJ7A 3DPDA 2GK2A 4AIOA 2CO4A 5TE6L 5FUZL 2NY4B 4MVBC 1RZ7H 5ID1B 5E9DE 2HVKA 4MCZB 1SVCP 5HI4D 2DWDB 3CFMA 3RUGE 3AQYA 1QLEL 3T3PB 5C6WH 5LBSL 5EU6E 1TETH 4U1NA 3EFOB 1WT5A 2OQJB 4DK3A 1AHWC 2EYRA 2QTVA 5KVDH 3N40P 3K72A 1LO2H 4WSKA 5F0JB 1AHMA 3E80A 2ZPKL 3IDMA 2AABL 3NCJL 5TQ2H 3BWUF 1KJ3H 1T2QL 4F3FA 4HKZB 1YEGH 2F74A 1A7NH 5KS9E 4PJ8C 1KDIA 1ZHNB 4YDVB 4EQ3A 3QJTB 2ARJA 2IPKA 2DJMA 4OAWB 4P5KB 1J9RA 2ITFA 3MRGA 2VSCA 1TZIA 1NCOA 3DX6B 2EEFA 3LN5B 5AZ2H 3JTTA 2BY1A 3SKOB 4HDIB 4RVBA 1E42A 1ES0B 2EIZA 3HFML 1AGDB 3M1BB 3PYCA 4KXAA 1NDMB 1ILSA 3VXRA 3CZLA 5FUCC 3VRJA 3QZOA 4ES8A 2L7UA 1TEYA 1MJ8L 4MMYB 3SE8L 1AP2A 2PPFA 1VPOL 4UDTB 2DMKA 5E00A 5J12C 1E0OB 4NC2B 2AQ2A 3Q06A 2V3FA 5ID0B 1NC4A 1JJUA 3NK4A 3FQUB 4NT6A 1LO0H 5AL8A 3TYFB 4L3EA 1PTZA 1F4XH 4JFOB 4F7CB 1JGDA 4JN1H 4HWNA 3RY6A 2BIPA 2HT4C 4DO5A 1KIRA 3RL1A 2RQ8A 3MLRL 4XPGH 3STBA 2PWHA 4G8GB 5E23A 3LZNA 2OLDA 3L6FB 5CU5A 3S8FB 1CT8B 2NT1A 2NXZC 1MJ7H 3DETD 1OAQL 3B37A 2YD8A 4AIXA 5JORB 1ONQA 1BZDA 1JPFA 2MPVA 3FTXA 3QQDB 1MW2A 3HPLB 4H8VA 1DQJB 4Q4EA 3BHBA 3QJRB 5KEZA 1R5IA 2DD8L 2Y1VA 3QULB 5TDPB 5BUGA 1XX9C 1KTRL 1QFUL 1S7XB 4NI6A 2VERA 1EEYB 3VYPA 1A7PL 2ICEC 3V10A 2IH3A 3TCLB 4M1DH 5HDRA 3SDXF 1XFPA 1NBZB 2X41A 1XH1A 3LRMA 1MFEL 1E6OH 3SJVE 4IBTA 5HHXL 4FLHA 2DQJL 1NLDH 2QQNL 2ZOLB 5KVGH 1PCXA 1XGQB 2APVA 2H6PB 3DX1A 2VN6A 2ZUSA 2FLMA 1INDL 2VDLL 2WIIB 4PHZA 2AAAA 2Z1KA 3GS7A 1CN4A 5ILTH 4IHBA 4M61B 2YAMA 3G5XB 2I9TA 4JFFA 5I9QC 4HUVB 1YNTB 2AXWA 1R3IL 4WGVB 3WN5C 4UT6L 2J4WL 2DZEA 2YRBA 3FYIB 1XF4B 5EU4A 1R0AL 3UEQA 4JUSA 3KPQA 3U4KA 4JDVB 1X5GA 3GIZH 2BNRB 3GSNB 3A4DA 4MAUH 2I85A 2AJXL 1CLZL 1WTGT 2NRDA 2XWBA 2BSRA 1PKOA 3LHAA 3BZ4B 3DTDA 3EBHA 2GC4C 4ZO9A 2GBTA 1KJVB 2WIMA 4RNRB 1OK8A 3L9YA 4ELDA 2GT9B 3VXNA 1TVDA 3QDME 5LGJA 3H9YA 1BZ9B 1RP9A 3P02A 3MRRA 3K5SA 3NRFA 1QSFD 5CCGE 1RZFL 2XN9A 4UTBL 3GM0A 3ZDZF 1UASA 2BVOB 1JGVL 2YPVH 3AMLA 3BH8A 5CSGA 3CN3A 4BD4A 1IIIA 2WJ5A 5G5DA 3ABGA 1B4RA 3NZHL 4KNSA 1FYTA 3LEXA 2YUVA 4UZSA 2IWGA 3SGEI 4OF8A 4LAQL 1EERB 3EGDB 1FFNA 4JZOB 3ZN6A 5L2JB 3IJYB 5C0AE 2V5RA 2WWNA 1INEL 4UQCA 1DVFC 4Q74A 5JQHC 4YIQB 2DH3A 2D03H 4XNMA 4JN2B 2WSDA 2Y7OA 3VD4A 1A7OH 1KC5L 3K71B 2IDFA 1EPFA 1F90H 1BQHG 5E6UB 5J89A 3JUYA 3RVXD 1F4YL 1CXFA 3VFWB 2R8SH 2X6BA 2W94A 3GZPA 1M57B 2XN9E 2DBJA 3FQWA 3LKRA 1UVQB 2IC2A 3TJEH 3QUMA 3VH8A 4NC0B 4KROB 2EDJA 5IQNA 3WDHA 1GW6A 5IB3A 2HKFL 5EC1A 1AHWA 1XCWA 5IVXF 4MJ2A 4M93C 4TQHA 1FNGB 4LPWA 3BPCA 5I6XB 2ZP8A 1O7DC 1OLLA 3LH2L 1DVFB 3DRQA 5IR1B 3BKMH 2H8PB 4BKSC 4PTUB 1B3IA 5FOBB 4H0IA 1BP3B 3S88H 3CHPA 3FQNB 3L5JA 5JPNC 5T5FA 2O5ZH 4O4YL 1WD9A 1Z3GH 4LVNB 1H6FA 5E08H 4B6ZA 4JY4B 4FG2A 5DEFB 4TVSa 2CE6A 3ABMB 2LV4A 3FPYA 1I3GH 5SWZB 1OSEA 2IJ0C 2W60B 3S36H 3BCFA 2OR9H 1RUQL 5DRZB 3UTSE 2NT0A 4GNKB 2SEBB 1ZTXE 2MH4A 3K8KA 3QNFA 5DJ6A 4BSVB 2FEDC 3SPHA 4E9SA 5AOZA 4ABVA 2EP6A 3QCTL 1NANI 2LABA 5EC2A 3FOLA 2QKIC 4JFFB 3D8MA 5L0QC 5EEWA 2WZ5A 4HUVA 4IKKA 1TVBB 4KKLD 1Q1JL 1HHIA 1EGJL 4LQFL 5EUKA 3GBEA 1U91A 1RPUA 4FTVA 3QG7L 3B5HA 1S9YB 1FP5A 4OQ1A 4QTIL 2ZT9C 2XQ0A 2XWBB 2YA2A 3U30C 4XNQA 1JI2A 3AS1A 1WUZA 1TQUA 4GAYB 3EYFA 1TZGL 4V1DD 5I19L 3QDMA 3W5NA 1LO4L 3SE6A 1LDSA 1T0MB 3JSSA 3HC4L 1NJ9B 2H1LM 5C2UB 2NY1D 2OCJA 3HZ3A 5EG6C 3AUWB 4Q58C 1NFKA 1N0XL 1N18A 4XVSL 1EAPA 4YHYC 3MI6A 4UQ2A 3GXMA 3I50H 4M5TA 1T22A 3MLSL 2CUHA 1ZHBA 1PZSA 9CGTA 2CIKB 4PRPA 3IKCB 4QTHA 1A9BB 3F8UB 2RCSL 4G83A 5D1ZD 5AVTB 1KWKA 4OZ4B 1HDMB 5J6HA 2HFEB 2YD9A 4Q8BA 3QIWD 1C7SA 1L7TH 1CI3M 5H2BA 1DUYB 5EHFA 4AMKH 2DKMA 1CD1B 2IQ9H 3NAAL 1ZT1A 1QYGH 2CXKA 5HHME 2EO7A 4Y7OC 1L7IH 2XWCA 3BQUC 2J5LC 3I9GL 4HCGA 4RAUB 4UNTA 2QSTA 1AVAA 3VWKD 4AWJC 3BLPX 1G9NH 3Q6GL 2ZG3A 3CZFB 4ENZA 1ET5A 3O6ML 3RWFA 3ZSSA 4Z8FH 4WI8A 2F9BT 3DYOA 2VLJB 3QHFL 5DK0B 2EE3A 1UXLA 5I1EH 1P6WA 4TNEA 4UT7L 1N5YL 4C4KO 1JZGA 2JCCA 3CN2A 3L4ZA 3DIDA 1FVEB 2QZ5A 5IROA 4OB5L 3GRGA 1XT5A 4J6RL 2JI3A 2UXFA 4YDJA 4P5TB 4YXHL 4OI9A 1CYWA 4BCXA 3QNYA 3C6SB 3L4VA 1G9NL 1HSAA 3L3OB 3CGTA 5AD0A 3VFVA 3ILDA 3PAZA 4OZGF 3DJ9A 3ULUC 4L1HA 3CU1A 4XNAA 3T04D 1SJHA 1A3RL 1I8UA 1FO0B 2CKNA 3JYBA 4P3CL 3DV4B 1RZPA 5TK4A 2WMPA 3DECA 5BS0B 1MCWM 4YN3A 5T1KB 3WUWA 3EHBC 4AX3A 2RR3A 3OHXA 1QTSA 2DQUH 4TQIA 1NC2B 3O11A 1TVBA 1G4MA 1EXHA 2AXGA 2ZP0T 3JWNE 4PJFF 2F19H 4A7SA 4P57B 4Y5VA 3V5KB 1RV6X 2DQGH 2AGJL 4DZ8A 1G7MA 5F9OH 1ECZA 1X9RA 4D0DA 4N3TA 1FZOA 1K8IA 3QHTC 2YRPA 2HT2D 5FYKE 2EDXA 2WW8A 5C07A 3NGBB 1G7PB 2BRQA 4O2EA 4IJTA 4BV1A 2HTLD 3TIDB 5EOCH 1TJGH 5GSVA 2OYMA 1VAHA 5ITFB 5LCVA 4CSZA 1GJIA 1YLBB 1FA4A 4PWGA 3MA9H 4X8GA 1PKQA 4CILA 3KS0J 4G8EA 1IEBB 2ZUUA 3PAUA 4NO3B 1P9MC 1E2WA 4HUXB 2PO6B 3QEGH 4AQOA 5JW5A 1T4KB 4I0PC 4X6DB 2B3IA 3HFMH 3E9UA 3ZO0A 1BXXA 4U0RB 2BP3A 2GHWB 1HJCA 4YSPA 3LNHA 2YARA 3CHSA 2MOGA 2Y36H 4WW1A 1IGCH 2QADD 2AVGA 3H9SE 4S1SL 2GFBB 1R46A 4JFZH 5ISZE 5CKAA 2V17L 4AEHH 3PHOB 3P9MA 1MCJA 2CD0A 1IGIL 4NO2A 1OT2A 3AG2B 3S5YA 3ZY7A 1E43A 3KPNB 4H0GA 2UY6A 5E70A 1TENA 1N67A 4PJDB 1LE9B 4E42A 3INOA 5DR5L 4K5MA 4XCFL 2CGRL 1FG2B 3ZGHA 1JGDB 1KOAA 3VFSA 3MV8A 1HXKA 5JA8B 1Q9WB 3GSVB 2J8UF 5LXGH 5C0JA 2NXZB 4JFEB 2XU9A 1A14H 4GQ9L 2EABA 4U1KB 1QLFA 3T0VA 7PCYA 3IPBA 1Z66A 1W2KT 4AT6B 3N42B 1FZMA 4XMVA 5HHPA 1HNYA 1GCYA 3G5ZA 2IV8A 2WUCL 3B9KB 4C83A 3RNKA 5JIMA 4D94A 4JQIH 1HAUA 1WBXA 1PD6A 4N8VB 4NZFA 3V7MA 3TT3L 5F7UA 3QNYB 2AEPL 1PLGH 4HEMA 1NCUA 4OJAA 2IFFL 2NW3B 4XMKL 1OM3H 3S8WA 4UILL 1MUJA 2ZOUA 1FNEA 3VWJC 4B5ZA 4BZ1A 1Z0MA 1QR1A 3FQ1A 5I71C 4QXTA 5BZWB 3SQBB 3MRIB 5E94B 4HKZA 5DK2A 3TXAA 1AQKH 4F92B 4UTCA 1VFAB 4P2QD 4U2YA 2HUHA 1ICTA 2NNXA 4NUGL 1JYWA 4K4KA 3GSQB 1U9KA 2EDEA 1OIOA 2RCSH 5E4IA 4LVHB 1ASPA 3T8VA 2OJZH 3IF1B 1CGSH 1U3ZA 4QPEA 4F80A 1CE6B 5DMIL 3T71A 2P26A 4G3YH 3ZU8A 5AB1A 5DQ9A 2WYIA 7FABL 5I6LA 4X6CA 5IBLC 3CQPA 4D9QD 1G43A 3KEHA 1NMAH 4HWEH 4GIOA 2QQLL 4GFXA 2UYLA 5IVOA 1UEYA 3UERA 4LNRA 2DLFL 2WWMC 4U2ZA 4R97B 3CZSA 4FL4C 3GF8A 5CKGA 5J57B 1PYWB 2XN0A 3DIVA 3ZTNH 4DHLA 4OFVA 4AYBA 2R9HC 3CXFA 3CLEL 4R96B 3MACH 5CWSA 4NUGH 2HRGA 3M86A 4D9RE 1I7ZA 4Z7IA 4P04A 3GK8L 4LDEB 4XI5D 3F6IA 2Z0BA 43C9A 4BSJA 3F7PC 5CUSL 4ES9A 2L4OA 4ODWB 4U7KA 2GJPA 2X6MA 4PY7A 3U1SH 2CO1A 1S8DA 3V8CA 3POCA 2BDNL 3CX5K 4YC2B 4IRSD 3VD9A 4EXPX 3FTZA 3LQZB 1BCIA 1CT8A 1XBRA 4Y4KA 3PWNB 1KACB 1MCNA 3BAJA 2BOBA 3Q8BA 4PVNA 4GFTB 3MRCB 2MTPA 2IG2H 3JTTB 3SKOA 2VAAA 1R5VA 3MACL 4TYUA 2HB0A 3U2JA 1FVDA 1DJIA 1I7TA 2R1YB 4IU2B 1Q1PA 4MB3A 2WZ0A 4NPYB 2VC2L 4DN3H 2KI6A 3JZ7A 3WI9A 3P3YA 3QYNA 2PKDA 1I7RA 3HIZA 1JZ8A 3OZKA 1HIML 4WZ9A 4HOWA 4IOSA 4PGZA 3B8YA 3EOYG 1IJNA 5B39B 3KPRE 1QG3A 4K71C 2X7LA 3KDPB 2H32H 5ABAA 3RIAK 4F93B 4YHZL 4UI2A 3N40F 2I24N 1FAKT 1WS7A 3IBEA 1PY4A 2EVHA 1QSED 2DL9A 5CJOH 4FE9A 3HBQA 2VDQL 3ILQD 1PZ5A 3EG9A 3PWJA 4P2RA 1C9SA 2IOIA 1TQBC 5AW6B 1SFHA 5HJBA 4YHIB 3UCQA 3TYGL 2W0FA 3MLWH 4GSQA 1QSFB 2BP8A 3NJHA 1B90A 1ETJA 3AACA 1I9JH 2IGTA 5J13C 4A7GA 2WQUA 5IG7A 3FNKA 1AZVA 2WJ7A 4LXFA 4DKTA 4NKDA 4CMMB 2MCMA 4RWYL 2WLLA 3RVWD 1VZIA 4ABWA 5AW8B 2EZ0C 3I6KB 4NJAH 5F7HA 1F00I 3FT0A 4FP8H 4KJYB 3WY1A 4ZPTB 3DJRA 3L3DA 4ZOBA 1N9PA 2IBBA 1X7SA 3OMNB 1Z9OA 4QHKI 5DRNA 3RWCA 2C7UA 4JM2F 5BUPA 2WXKA 2WXHA 2VDQH 4TNWK 4RQQB 3L08A 3K91A 4ELMB 2A6JB 4AJWA 3EJYD 3G5YA 5TF0A 4Z3IA 1ZIAA 1V55B 2F8XC 1MFUA 1S5HB 5CILH 3WFEH 2K78A 3QG7H 4HKBA 3FT1A 2C3XA 4X6CE 2ZF9A 3MQIA 3H42H 1MWAH 4CC4A 1ZSDB 4ZODA 1TMQA 4OTXL 5FM4A 2Y1YA 3UJTH 3N1QC 4P4KD 1ZVYA 3A67H 3IMBA 1AOHA 3ZHDA 3ARDA 4XR8C 1ESOA 3RHWK 4DF9A 2Y25A 2B16A 1HKLL 3SGKA 4FD0A 4M8UA 1THAA 4HSAC 1T0NA 2W81C 3MXWL 5JDSB 2L7QA 2YBRB 4WEEA 3ULUL 1IC5H 1BD2A 4DKEH 2X5PA 4GW1A 1N4XH 2X38A 4Z78B 3EADA 3MRBB 1NEPA 4G7SB 4EMZA 1T89A 4EKXA 4PJIF 2EH8H 1MDTA 3L3HA 3S9DB 1GY1A 1RLBA 4JFXA 2YLKA 3VTMA 2BXZA 3EYQC 2J43A 2V8LA 4X9BA 3RVUD 2DH2A 2YSSA 1HESA 1YQ2A 1CF1A 4E9YA 3SGJC 2V2WA 4JFPA 3KGTA 2K70A 4TULL 4NQEA 3KWVA 5JHDB 5HD8C 4FZ8H 4HGKC 4IIZA 2O26U 5D72L 5MEQB 2IGFL 4I1NB 3RZCB 3IRCA 1ZMYA 4ZAKB 1A4BA 1CS6A 2K4WA 3JWOC 3ZTCC 3DUUB 3I75A 2VUYA 3Q0HA 3QRLA 4IHOB 1JDAA 4Z76B 4S11A 4N8CL 4KKBC 4ZMXA 2YAHA 5MI0C 4JQXA 3N2JA 4JB9H 4PUBH 5K9OB 3WO4C 2OTPA 4AUUA 4NX0A 1BLIA 1F6LL 3NGBC 3EW3B 1T66D 3O2DL 5C2BH 3SDCA 3EO1A 3P30H 1R33A 2Y07H 4I0PA 3U2IA 3ZQXA 3UMTA 3CVHH 3U7WH 2B1AL 1TKWA 4HJGB 2X09A 5GGUB 4UAHA 1VFUA 2O1AA 1HINL 2OMVA 1U6AH 3MUHL 4PGEA 3D69B 4YFEA 3HZVA 4JFHD 5E6SB 1P6FA 4EIZC 2YEQA 4MA7H 5GJSL 1EVUA 3MV9D 1QRNB 4UCFA 1IKFL 1P4IH 5IB1A 5L7XL 2NLJB 3ZKXC 1QEWA 5FHAH 4YO0A 1CTOA 2MQ0A 3HZMA 3LMJL 3I6GA 3BI9X 2Z91B 3Q5TA 1RU9L 3OMAB 2WQWA 3LPPA 3PWVB 3LKOA 1QD0A 2XV2A 4QRRE 4WFHE 3MNWB 2ZXGA 2R4SH 2G5BB 3QXAA 2Y5TA 1IFGA 1Z32X 4WCYL 2ICEB 5EO1A 3UBHA 3KLLA 4XH2A 1BECA 5C3TA 2EC8A 2H2PD 4XO5A 4HWUA 5TE7H 1BAFL 2J6EH 1ILUA 1ZCRA 1R5WA 4KTEH 4FXGC 5EDXA 1P69B 3D25B 1ZIBA 4ZX6A 2Y2WA 3P0YL 3TVMB 2VERN 5FKAA 2CH8A 2VMDA 4BXSV 3FTGA 4ONFL 1BWWA 4QRTB 5DI8A 3JV4A 4PP2A 5F2FA 5E56A 2QPFA 2BMKA 3TIEA 2J1YA 5EV7A 1UEMA 2J57A 2R56H 4Z0BL 1C1EH 4BCYA 1I1FA 4OUOA 2VDML 3N44B 4QNPF 4RETB 3KMDA 3IB4A 3PDOA 2AEIT 2GUYA 4H1LG 3CZFA 4PB9H 1BOYA 5J13B 1YA5A 2NY0B 2BVYA 3K80A 3A6CL 4QAMB 1D5ZB 1D3CA 2IADB 3QZPA 1QPPA 4QY8B 4TLKA 4C4BA 4IBYA 3U4BH 1JDCA 1DJHA 1MI5E 3BDBA 4OZIB 3WTVA 3ARDC 5T1KD 3WNJA 2JKXA 4FKHA 5DZAA 4X4YB 1UCBL 3K2IA 4MXWL 3NQKA 3O3UN 1MG3C 1WSST 4JG9A 2BSBA 4MDRA 3AU1A 3LXCA 5EU6A 3D85D 15C8L 2C1PA 4PG2C 2QTEA 3M88A 2NY6C 1UQSB 5AG9A 4F58H 1O6VA 4WFEE 3BW9A 3FFCB 4G42A 4EE2A 1ED3A 3RX5A 1JXGA 4HMCA 2XWTB 1K3ZA 1A7NL 3TWCL 2AJZB 2BZCA 1FV1B 4X4MA 3T9WA 2B9BA 4JHVA 1Z0NA 3NZUA 3QDMB 1R9FA 4EVNA 2V7NB 3IRZA 5E4EC 1CFTB 1WAAA 2VDPB 1JWUB 3CXHK 4HGWA 4JM2D 1UACL 1DJWA 3R8BB 3T4YA 2CO7B 2F7IA 1FBIL 3F7YB 4Y16C 2PO6D 2KQMA 3G6AB 4J3OD 5DVNA 5BV7H 1DQIA 3VWKA 1A7PH 1DBBL 5L9DL 1XF5A 5GZOC 3D39A 3OAWA 1Z9LA 3FT2B 2Z64C 4XMKH 2CDGA 1OM3L 1NGWB 3W11D 1DN0A 2C4FU 2KZBA 3STZA 5IZ7A 1IM9B 3X17A 2DLGA 4LCIH 2X05A 3ESPA 4X6DE 1A4JB 3RY4A 3B83A 4RMTA 3C08H 5IUCA 1JSYA 4A7TA 2WQXA 2V5YA 3MUY1 2PABA 2PF6A 1GXEA 4A2LA 2ERJB 4OJCA 4X4ME 5E8EA 2Y3AA 3TBTA 4EOWH 4ABUA 1KDJA 5DHYB 3MJ8B 3VMOA 4MXQC 3OKYA 2PCPA 1HYSC 3NTCL 4BK5A 3PFUA 4UV4L 5HYSG 3DUHA 1DN2A 3QR2A 5D72H 3RGVD 4K9EH 3D2UB 4Z3TA 3GIZL 5HPMA 1K3IA 2NNCA 1KT2A 1T89C 4WO4A 2EDFA 1MF2H 1XH2A 2VW7A 3AT0A 4XCEB 1A02N 1CBVH 3BEVA 3ET9F 5GRJH 5F1KC 1RURH 1SYSA 2K3TA 3U6RB 3TF7C 1NBCA 1QPXA 2NQDA 3GBNL 4WKZB 1WBYA 1UCTA 1OO2A 2A9NH 3B7YA 2XZQL 5BQDA 3WEXA 2G9KA 3AWGA 3EYSH 5JUEH 3ISRA 1HHHB 5DZOA 3B9KD 4YSQA 4UIKH 1RUML 3KYMB 4HIEA 4LE8A 4Z7VE 1NCWL 2G2NA 1HINH 5CJXC 3T1WA 3GS0A 1MIEL 5LGHL 2ETWA 2WBJC 5IGXL 3HLKA 1F3JB 3AB0C 3FL7A 5F96L 3VGDA 5DYOB 1S3RA 1YMMB 4GIAA 3O6LH 3SKNA 4A37A 3VX1A 3OC8A 3AS3A 2EKJA 1I1AD 3QH3B 2E27H 1N3NA 4QRPB 4PGJA 2Y22A 3T3MF 3L3JB 1BAWA 4LVEA 4IBSA 4X8CA 3G6JF 1E5YA 4HS3B 4R7NB 4GW5B 4AQ1A 2X44D 5DJYB 2CO3A 1SZNA 1I8IA 2ED6A 3MRLA 5T1MA 3QC6X 3KLHC 2X88A 4B9CA 1ZY9A 2AJXH 4IMKA 4RGND 2O30A 4YR6B 3LDBB 2JELH 1KCRL 2OTUB 4NJ9L 4ZTOH 5A2JH 1C12A 1F4YH 3PL6A 4QXWA 3NFPA 4DK6A 1KNOA 3NJXA 3HC3L 1K4DB 4PSRA 1FWXA 3SGKC 3TFKD 2M8XA 3TO4C 4P23C 1VB9A 4CMHC 2JB6B 1CR9L 3QQ4B 5ACZB 2HKFH 3EOBA 1BGXL 3ZT5A 1F0LA 3QUZC 4RGMC 4RMVA 3L3IB 3RTQC 4DVRH 2EVGA 1Z5HA 1G9MC 4B9GA 1OAXL 3U9UB 4E9QA 1ZTXL 1T1XA 2HLAA 3GPEA 4OFYA 4AYGA 2E7MA 3PWPA 2DI8A 3L7FA 1XWVA 5T1LA 4MCYB 3ZZQA 2ATPB 1MJJA 5F7DA 4AEIL 2DLHA 4AM0A 4D8PA 4GG6B 1E2VA 2PO6C 5GS1B 4LAQH 3OLDA 1BFOA 5F1IB 4IRSB 4L8SA 1WBZA 4WI9A 5AOKA 3BIBX 4ZX5A 3TBBA 4BA0A 4YLBA 5DDHB 5E08L 4W9FC 1BEXA 3LOWA 1U8IB 3UROR 3EO0A 2LLGA 1M7XA 4N6QA 1FNLA 1JUFB 3RPIA 4ZQKA 1CXHA 3RAJL 1F18A 3UABA 3ZE0B 2FQGA 1CLOL 5A2LH 1ND0A 1EHNA 3CFIC 4YDIH 2QQKL 3HLAB 1JNJA 1MRDH 4MKMA 5DUML 2WSKA 4WNQA 3IGUA 4BYHA 1ZDQA 4O9HH 5I6OA 4IU3B 2ESVA 3DVGA 1U92A 2GHZA 3IMSA 4HKBB 2XWXA 4NRZA 3NA9H 3OD3A 4ZFQA 1OW0A 2XACC 2YGQA 4NM8H 3V52H 3F6JA 3WHXB 1S2EA 2FO4A 4PG2A 3QO1B 3N41F 1Q0YL 4M6AA 1LEIA 1QSZA 4WK2B 1G0YR 1GJUA 1QVOA 3GSNL 1A8ZA 5TF1H 5KVFH 4J4PA 4NYLA 4PWIA 2R69H 3Q1EA 4UDTA 1Q94A 1J8HB 4IGBC 3VGEA 1I82A 1HEZB 3ME0B 5D6DA 5AOMA 1HZHH 5LN8A 4Z7UB 3RUGA 1EZVX 4LNRB 2VN5A 3TTSA 4M5ZL 3BIKB 4Y2OA 1ZPLA 2G0LA 1KCVH 4HT1L 2XWZA 1I9RH 1GGIL 1KIUB 4NZTL 3D4CA 3MCKB 1TZHB 2FIKB 4FQXC 1VFOA 3EFDL 3MRDB 3GHEL 4LEOA 1JGEA 1EEQA 4W9CC 3T65B 1E9OA 2FL5A 4Z3HA 3J8F7 5C0JB 3EO9H 1FDLL 4FFVC 1SOQA 2CRIA 5FYJD 1GCFA 1PG7W 1EBAA 4QRUA 4NQDB 3WFDH 4TTGA 1MCRA 3V4PL 4P2RB 3I3BA 5K9JL 3GJEA 4BWWA 4UDUA 4JY5L 3QQDA 2DIJA 3T0WA 4LKCB 5BMFL 5CEZD 5F9AC 4JFPB 3D05A 2PPDA 2CK2A 5LNEA 2B5IB 1UFGA 1DE4A 1ETZB 2XDHA 4LLQB 4G6ML 2VYRE 1U2HA 1WVZA 2ROXA 1W8NA 2XOTA 5AYUL 1JK9B 3UYPB 4KJYA 4HCRL 3DX2A 1UM4H 4BK8A 1KTBA 3OR6B 5KTEL 3BOVA 3EKCA 1V3MA 4GUQA 1N6QL 1VPOH 2HT2C 3ZDXF 1UJ3C 1VESA 1PZAA 2X2UA 5K33A 4DEUA 3L4XA 1L0PA 1LDPL 3FU8A 3NBNA 4IK6A 1RJLA 2HRLA 1YYML 5JHLH 2I69A 3T1FB 1WG3A 3TO4D 3KH3A 2XTJB 5K9QG 1MSPA 3OAUH 3ZO9A 2PP8A 1RK0A 4P3DA 5C0IB 5KVEE 3UTTA 4XX1E 4HG4K 4NFDA 4BH7A 2YGPA 4TVPL 4FI8A 3S98A 5FYLD 1T5WA 1AJ7L 3IXTB 2GBAA 4L8CB 1G84A 5ESVB 3OG6B 2HJKB 4J3OC 3FUMA 4GRWF 2L7EA 4LSUL 4WUUB 1QSEA 1V3LA 4BUGA 3MV7B 4Q56A 4BGDA 3PIQB 1UOKA 2P4AB 4OLZH 4DK5A 3Q8CA 3A4EA 3QPXH 3Q7JA 5GGSA 2GJ6A 1MPAH 3CPUA 1EDQA 4KNTA 3MKKA 1U8LA 1BFSA 1UYWH 3UJJL 1RZJC 1EVTC 1MHCB 4OM1L 2F19L 2V5TA 1XR9A 3CTTA 3FONA 3QE5A 4I18B 1JHTB 2X4TA 1A1OB 2CIIA 3KJ6L 4G9FB 4KTEL 4RWYH 1I8MA 2WN2A 2IALA 4K8RD 3GHBL 3PQYA 1CO1A 1NCHA 1ZA6A 4FULA 1S3KL 1YEIH 5FYJH 3VXUD 5A1AA 4PJBE 4TNVK 1GOFA 3O4OC 3ROOA 1BG1A 1IAII 3BT2L 4NYLB 3IXAA 3QWRD 1A65A 4DVRL 5ES4B 4HUMB 1OARL 2WD0A 4HUUA 1IT9L 2BMKB 3GEWB 3S35L 3TIEB 5I73C 3RTQB 4F9PA 3KE0A 4FNQA 3AFLA 3UC0H 2NNAB 3SKJL 1RIHL 4Y2DC 3OMZA 3ZTJH 2F0CA 4PB9L 1UB5A 5I1IL 3Q2VA 3AWEA 3QIUB 2WSPA 2ATKA 4FLQA 3MV9B 1QRND 1O0VA 2IGLA 2GTZB 4ZT1A 1J1OL 1IARB 2WNXA 4A2EA 5B39A 3KAAA 1E8XA 3FU9A 4MMXB 2KERA 1YNTA 2OJ1A 4M1GL 4J3OG 4XPAH 5C09D 2KDGA 3SDCB 2LLNA 3P4MA 3ZE1E 3DO7A 1KULA 4I0PB 5KS9B 1U3JA 1GC1H 1CL7H 2WKGA 5HHOE 5IJBC 4TUUA 2J55A 4V2CB 1KB9J 4A6YA 5GS0H 3JT0A 2PYEB 5CLTA 3N91A 5E8DL 1LYQA 3W9EA 3ZL4L 1ID5I 3GHPA 1ZK9A 5DUPL 3NCBB 4Z7UE 2NY3D 4K94L 5I1KH 3VYNA 4LPCA 5D2LE 4M7LH 5IW1A 4MQXC 3F83A 1AC6A 1YRKA 3STLB 3A47A 1FIGL 4JDVA 2P80A 1FVCA 1MFEH 3AROA 1EQWA 1GPOH 3DX3A 2WNGA 4UNIA 2LVEA 4S10A 2DQCL 1PCSA 1U30A 4HFUL 4FS0A 2AK4D 2BFVL 2Y69B 4HIIA 1FC1A 3IWUA 1WCQA 3VXOB 4UOW0 1XEUA 2COQA 4KKNA 4YBLC 1H3PL 4UTAA 5AVXB 3NEEA 4AQAA 4NUQA 3D18A 5HHNB 2G5RA 4KJWC 3UTTD 2R69A 5ALBL 4FNLL 5F9WB 3LPOA 4HW6A 1QNZL 5BW7C 1FYTB 2UX6A 2WZPD 2E7BA 2V17H 3HVNA 4AEHL 5IT2L 3ZYOA 1PZBA 1KB5H 4QGYA 2FSEA 2XZCL 4YXKL 3K71A 2BW5A 2IDCA 4JO5A 3RP1A 1BX2A 3ELQA 5DMGC 2F54A 4KRPD 4L4VB 4PYGA 5IQOA 1KJVA 3S37H 3LNGA 3OJVC 1IL1A 5DTFB 5D1XC 5JIHA 4JN1L 3S3SA 2HMID 1SN5A 4K3GA 4XVTL 3KPSD 5AW0B 1M2VA 1NGPL 2A0LC 2GABA 3D85B 2FLBT 4P23A 3AY4A 4GEJA 4R4FL 5EIQA 2Q3AA 4EI5A 2UZXA 1G9ML 3PWVA 4W9ZA 4LRNH 2MCG1 4PGBB 5DZPA 5FCUL 1A3ZA 3ABZA 3FFCD 5GRJL 1QMUA 3OWRA 5KTEH 1S78D 2J71A 3KLSA 3LNDA 1A9EB 3ECBB 4QRQB 4XXDA 4LBAA 4XWGL 3G5XA 1WBYB 5ABZA 4NWTL 2AEOA 3WFBL 1NCDL 4P07A 2ZSVB 3WFZA 1MWAB 4J12A 3U0PB 4APQB 1MFMA 1YEEH 5C6PB 1VEMA 2BNRE 5E0FA 1CG9B 3LV3B 1J8RA 1GGCL 1H5BA 4NQVA 2Q3ZA 3ZR5A 1N12A 2EJ1A 3VNYA 4C8XA 2HWZH 4GAAA 1NH6A 4WI0A 3PXJA 5CR8A 3LIZL 3DXAD 4FC3E 1IM9D 1KLFB 2QGEA 1AOZA 3N5AA 4OLXH 4NQED 2H7WA 4KXZI 3BVDB 4NPKA 3WIHL 4M6ML 1GIGL 1Y18B 1FVEA 2X1XR 35C8H 5GGVL 1L9TA 5DJ6B 3W39A 1D5ZA 1SBBA 3BVTA 4B9JA 4TM9A 5T3ZH 3TBYA 2ZKWA 5C0ND 4WHYG 3UTQA 3EJRA 1ZLDA 3MRHA 1IILE 2OULB 4JRLA 5CEXA 1S7TA 3QIBA 3HA0A 1ZT4A 5KBMA 3ROLB 4OT1H 2PP9A 1WFJA 3K6DA 1OF0A 3D2UD 4ZUUA 3HI6H 1H3XA 4H2CA 5IFAL 2YHGA 3CVBA 5C0AB 4ZFOL 1OALA 1RZKH 1VADA 2JMRA 1P5VB 1FHNA 3LNEA 4MNQE 3DGDA 4HLEA 2CJTA 2Y23A 2AV1A 3O4OB 3O11B 2X4QB 1MJUL 1P84J 1S5IL 1ZPUA 3EYFB 3ULVC 4ELMF 4U7MA 2QSCH 4YHNB 4JKNA 2H0FA 1JRHL 4IGBB 3HG5A 1TQVA 1B2WL 1UWFA 4JPSA 4P9HH 4MLIA 3ESMA 3D39E 5IFJA 2EEBA 1WICA 4GG6A 5E2WL 1Z9PA 5TPWL 4ZUVA 2J20A 3UYOD 3ZT7A 3NSDA 4K07A 1K8IB 2G3MA 2XV0A 4YDNA 3OKOA 1PG7H 3WENA 4Z7NB 3D87B 2VDNH 3VI4A 4NN7C 3T6WA 2XZZA 4GY4A 2XN1A 2VC2H 1W15A 2KPNA 3EO0B 4TLSA 2FRGP 3MOBL 3GTTA 2FB4H 3AQZA 3QEHB 4FEIA 4QRRB 1IZKA 4IW4C 1OAZL 2QSCL 1CL7L 3QQ3A 4AKQA 5IQ7L 3P0VL 3WNKA 4UBDC 4QRPE 3HMXH 5B8CB 3MRNB 1M71A 1KXQE 3DDFA 3FCSA 4RGNB 1F5WA 4Z95H 5JW5B 5KBKA 4PJIB 1CDGA 5DK0A 1IRAY 2A38A 3VFRB 1YEJH 2E6PA 4KV5F 2CMRL 3X3GL 1VHPA 5BZDA 3Q1SL 4RAUA 4ORGB 1V27A 5HI5D 4LCWE 1GZPA 2C1OA 2CHZA 3I2CL 4DN4L 5FHBH 3FOLB 4CGUB 3RG1C 3MJ9A 2CLVA 4MHHG 2EAEA 4V1DE 3CFJB 3RGHA 5B21A 1LM8V 1WCBA 5E2JA 2BINA 5IB3B 5EDSA 1TQSA 4LHUB 1KIQB 5DC9B 2DYSB 1THCA 2WKOF 1YY8B 2DJ4A 3NUKA 3RGVA 3NABH 4XO8A 2X4PB 3MCKA 3R19A 4PJDE 4XBEH 5F21B 5KANG 5JIPA 3VH8G 5DMJB 4OZIE 1DVUA 5IVXB 2XG5A 5CGYD 4ACTA 5H37H 1LP9A 2VDOL 1KJMB 3HG2A 1HILB 3UPCA 5K9JH 1Y18A 2VLJA 3MYZA 1SGKA 3IFOB 3DROB 1UJ3B 3SKNB 4XVUD 3V0VA 3LS5H 4LSDA 1L6ZA 4J3OH 1JK8B 4XMPH 4JPWL 2R9HD 1DQLH 2AS5M 3FB7B 2I60L 7TAAA 3UJTL 3QNZA 4ORZC 3JWDH 1ZGLP 1JIBA 1NGPH 3NIDE 4UZGA 1MCIA 3GNML 5HHMD 2DF3A 3L5WB 3HKZA 4ZMVA 3RWIA 4NP4H 3ZYJA 1QPKA 1VACB 4HALA 1ZLVH 1NAML 2LVCA 1BQLH 4Y4HA 5I6KA 1ND0B 4DEWA 3ULVH 3FUIA 1SF5A 4RMSA 4XAKE 2E9IA 4K5NA 3LQAC 5ITFA 1UG9A 2BCKB 2JB6A 4LCCC 3EOBB 2A9MH 2VXQL 3QJFB 3VA6A 1JN6A 3SDCC 1G0DA 1WZ1L 3HBGA 4WNSA 4R90L 4RMQA 2EE2A 1U8KA 3CDFA 2OL3B 1JGVH 2YPVL 1IEHA 4ZTPL 1C16A 1EDYA 4HZAA 3PAVA 4KOBA 1NUGA 4U0QB 1RUKH 3FT4B 4Y5VB 5F7WC 5JO5B 3V5KA 1Q9OA 1W91A 1UVQA 4FAAB 1U8PB 5TGBA 1UZ6F 2CO2A 3TFBA 4A68A 4PWHA 4D8PB 1OSZB 5DCCA 4UANA 5FUOL 2FEEL 1W0WA 2WCSA 4PGCB 5HYSB 5HHQA 3IN2A 1G94A 4P2RD 4PJEE 4WJ5A 4ZMOA 2K6WA 3CIQA 3RJDA 3AAZB 5CZVH 1BJ1H 2ED7A 1ML0A 3T2NH 1MFDL 1M71B 2PR4L 4U49A 4JFEA 3LPGA 1EAOA 1I8LA 2FWOA 4TSBH 5CEZL 2N3JA 4V11A 5GS2H 3FB5A 4I18A 3FBKA 3H3BC 1G7IA 3MLTA 3MODL 4FG4A 1R1CA 4X6DA 4F20A 4PIRF 1USQA 3C5ZD 3KXFA 3Q5YA 1GZPB 3QISA 5I0ZA 3C6EA 3JV0A 3FCGA 2WXNA 3DURB 1T1ZB 3O8XC 5IW6B 3VYOA 4I77H 3D0VA 5EULV 4HKJB 1BM3L 4MTMA 4O02A 5GS1C 1U58B 5HJ3A 4RGNE 1DR9A 3PJNA 1Z3GL 5AD0B 2MWCA 1SHWA 3MODH 4A7QA 3JXAA 1IE5A 2XVGA 3PHQB 4N0UA 4DFHA 2DJUA 3TPKA 5BCAA 2R2CA 1QW9A 1P1ZA 4JFVA 4WUUD 5ACLA 1KJ3L 3VXSD 3MV7D 1FO0H 4ZK8A 1AC0A 2Q6WA 1U21A 4NM4L 1KV3A 5EZLA 5EEZA 3P4MB 1YMHA 2A77L 5HY9B 2J25A 1UXMA 2P44B 3BMWA 2ITCA 4OZGA 2A83B 4FNRA 4ZX4A 3Q6FB 2VN3A 3SPVA 3EYUH 1F58H 1E8WA 2Q7NA 4PWEA 1OGAA 1GZHA 3LVEA 4BK5C 5B1JA 1XGUA 4OD3L 1WEJL 1ETB1 1R3LA 4Y1AD 3DBSA 1YJDH 1CE6A 4MAZA 4G9FD 4Q6IC 2IANA 3ESUF 2AVFA 1JCKA 4R0LA 1NCJA 3DO3A 3QPXL 4L1SA 1KBBA 1IGTA 2CM5A 4XTRC 3VXUB 4XCNB 4GSXA 1QQDB 2F2HA 5FGCE 3TBVA 4DNLA 2F74B 1RP8A 3Q3GB 4JGMA 1U8IA 5HVHB 5IBLD 1MLBB 1UWXH 2JKIS 3EJPA 3BVXA 3BDYL 4OSUH 4O2FA 4EI5C 1JHKL 3KJ6H 3D07A 3H2WA 3DOSB 2EXWC 3LQZA 5GS0D 4G8EB 4PMFA 3T0DA 4PEEA 3ZKSD 5E9AA 3P2BA 3DX0A 2FT6A 2ZOWA 2WYZA 4WAFA 1QFPA 3QIUD 1DBBH 4RWHA 1Z9SB 4GRMA 5HBBA 3FU6A 5FEBA 3AXLB 3WKPA 5EO9B 2H3XC 3HG0A 1ACZA 5J6GA 1L9SA 1XGPB 3MLZL 1L3NA 4HKXA 4QRUB 3SDCD 1NZRA 5CCHE 1ZS2A 4QHMA 4I0PD 2R1XA 2IF7A 2V37A 1T7XA 2LTQC 2GJZA 2YBRA 1RSFA 2ZXQA 1F4WL 4GOSA 1YYMH 2YPLB 2FQDA 2GITA 3MGTA 3QDGD 1FAIH 1T7ZA 2X7LB 2NY3B 4OCSL 4YAQA 3BPOC 1E6OL 3SO5A 4ODWA 1CXLA 2D7PA 1NCCL 3JZYA 2A1WL 1UXSA 4WQOA 2EDWA 1BFTA 4HZLB 4JW3A 5IMMB 3HNSH 2KS0A 3ZUNC 3KZ8A 1H9VA 2JJWA 2P45B 4EDWH 1EJ6A 4PFEA 3VGFA 1HH9A 2K4AA 9PCYA 3P11L 4P05A 5SWSA 4YXLL 1OV8A 1BPVA 2AK4B 1BBJA 1HCYA 4YSOA 4G6AC 1MEXL 3REVA 4Y4HC 3MUZ1 2P9RA 4X7SL 1IM3A 4OGAC 1ORSB 1I3VA 1URIA 4AENB 1NBZA 4KUCD 2QJDA 4NKMA 3WJJA 4AV5A 1FIGH 3ECQA 5DWPA 3IDYB 3NH7L 1KGCE 1I7UB 3UXFA 1H5BB 1R3KB 5TFSL 3IN0A 3UAAA 1TO4A 5KYXA 1FYTD 3BUQA 3CDZB 3VFPB 4X4XA 3SCMA 1T7WA 4NDMA 5IB2A 3QWRA 4AEEA 5DK2B 1EEUA 4AMKL 2PW2A 1HTYA 4ISVA 3S3JA 3HRZA 1E8ZA 2VWEC 3HMWH 3SDDC 1ZSDA 3TA4D 3H9HA 3OAYK 3PWLB 4X6BB 1OGAD 5DRXA 3W37A 4Z77A 5I1EL 5DQ9B 3ZOAA 4PJHE 2BJML 4BH8B 2PO6A 1QFWH 4BH7B 1T0NB 3MOAL 1AGEA 2A6IB 3EYOB 1MHEA 3KWWA 4J3SA 1UC6A 4NQXA 4QRAA 2F54B 3LDBC 2FWSA 2ZICA 3IAQA 4IEFB 2D03L 4WU7B 2WQ8A 2VMFA 3AREA 3P4LA 1FVCB 4NPYA 3CQQA 3BGMA 2J12B 3DMMC 2HPTA 4TVPD 2MQCA 1A3LL 3BGFB 2E6QA 3DLQR 4APQD 2P8PB 5GQBA 3LEXB 2F8VA 2FBOJ 4OAWA 3CDCA 4BQ9A 3T2QA 3GMOB 5C0CD 5DJXB 4EBQH 1BIHA 4RGNC 1E7VA 4QWWC 4KJQC 4XXCA 3X14A 4OD2B 5DD0H 3W9DA 5SX5H 5IREA 1JMXA 4JG1L 2OJEB 1MCHA 3DNKA 4C57C 5EEVA 1UKQA 4MMXA 2QVFB 2X1OA 1TTBA 5EA0H 3D3VD 3BX7C 1OQXA 2OCFD 3ATFA 1R4XA 3QWNA 3O2WL 4EZLA 4GKZB 3PDOB 5CM1A 5IQ9A 1GYUA 3VA2C 1MW3A 4YAQB 5SX4H 5AAPA 4BUHA 1CYXA 3DDGA 2CMRH 4UT6A 3O4LE 2XWJA 2ZSWA 2CR6A 2C9UA 2DN7A 4ZAKA 5F3BA 1F97A 2JKJA 3OHXC 4PPTA 4NPJA 4X83A 3CN1A 4QAWA 4HJ0D 4XBPA 3RWGB 4OCWH 5DLMH 3QZWA 25C8H 1GYWA 5ISZA 4NCC1 3EDFA 3OM3B 5SWSD 5GGQL 5MI0B 1F3DJ 2I9TB 1KXTA 4HIIB 3WY2A 5L4FA 3G6JA 4KNQA 5HHVL 1ACYL 4JO3L 3G04B 4IGBD 2NY2D 2FATL 3NIFB 3QIBB 4FN0A 3RKPA 3OGCA 4OCYL 4DSYA 5HYQA 4ETQB 4NC1E 3JTSA 5IIEB 1RZKL 1NCBH 5DMYA 3KYAA 1TYEB 4ZMZA 4G72B 4J28A 4MCZA 1MHPL 4PLNC 1BG9A 5J8OA 3SZ6A 5LNDA 1KB3A 1CFQB 4C4KT 1YEFH 2X53A 2OTWA 2X1PA 3S8GB 1J5CA 3LZQA 4PJ5B 5C08B 1A6ZA 2MSPA 2VDOH 2GW5A 4XPTL 1BQHA 1KB5B 3FQYA 3HC0A 2FUQA 3T0EB 4IMKC 2GT9A 4JB9L 4XPFL 5B1AB 2IBGA 1GAFH 1QATA 2BC4A 1NFDF 4Q52A 1MIML 1U8HB 2B2XL 3P30L 5E1HB 3CFTA 3ES6B 2WBKA 3RWCB 5BMFH 2PLTA 4FLSA 1TTAA 1NINA 5IJDC 4RMUA 5J56B 3VQ1C 4M5YH 1RUQH 1OPGH 1UA6H 1T66C 2WQSA 1X5IA 2ZUXA 3QEQD 3KBEA 4P5KA 4LLVB 4YQXH 3U36B 4GRLC 4N0YH 3L54A 1HZHL 1S5HA 1FNHA 2HN7A 3ZE0F 4HJ1A 4ZW8A 2JJVA 2WCPA 3WS6C 3HN5A 2B0SL 2NW2A 1DBMH 4PG9B 2WTRA 4IDJH 5EZOL 4ZUWA 4WU7A 3VDBA 1GAFL 3SN6N 1T20A 3APDA 4AGPA 5BV7B 3ARBD 4MLSA 2KBGA 1P5VA 5F6HI 4UV7H 4X80H 3RDTB 2CR0A 3B2MA 1S9WB 3VFRA 2Q10A 4FL4B 2YQBA 3UBFA 3OXRA 4ICXA 4MDIA 4Y2DA 3CXHJ 1DBKL 3ECUA 1WFIA 3NDYE 2ORBL 4GXVH 1GSMA 2Z4QB 1BAFH 5M94B 4Y1TA 1I8KB 4HAGA 3ARGA 1A7BA 4ZDHA 4FZEL 3DYPA 1BF5A 1OEZW 4YDZA 3S48A 4OJFL 1XH3A 4M02A 3PG2A 4OI7A 1DJSA 1ROWA 1PAZA 3OB0K 2FSDA 4XXDB 3CZUB 1GZHC 1G9NC 4XMZA 2D4FA 2AQ3A 2BY3A 1IAMA 3SDYL 5DFAA 5AVZB 1OP3K 3DMMD 3QYMA 2WWKO 3KH4A 1UQSA 2XC8A 1LEKA 3OB8A 4JO2H 1IV8A 1EJOH 3HZVB 1SJEB 3RWFB 1X5HA 4DCQB 1UD8A 5CLYA 5B1CA 4JY4A 3FQWB 4LCIL 3B9AA 2BRRL 3MBWA 5DYOA 1D5MA 1SXSA 5BUAA 1UB6A 5AKVA 3L2NA 1FPTL 2AV7A 1SM3L 2OMBA 4G8GD 4XCYB 3HS0B 2IDUA 4O51B 3V6FA 4BSVA 1AHWB 4GYBA 4P5RA 2OZNA 3MN8A 4AE1A 5K9OA 2WLIB 1CDUA 3B9KC 3BZ5A 1F02I 3K6IA 1DO6A 4JFYA 4K15A 1P4UA 3C12A 3V0IA 4DO6A 4ZW3A 1KN2L 3KYKL 5BV7C 1IE4A 4HWBA 4MNGA 1HX0A 3BAIA 1AJ7H 3FSVA 4PVLA 3WN5A 4HKJA 1IM9A 2WVUA 5EN3A 4QXUH 1NA8A 2B3RA 3BKJH 3ARBA 4L29B 1CD9B 3ETSA 2H4EA 3KVPA 4YBQD 1U8MA 2O5YH 4KKAD 4OCRH 5AFAA 1TQBB 3QP3A 3BWZA 5D1XD 2N0KA 3TWYA 2H45A 3IMRA 5T5FL 3MGOB 4XNMB 3JV4B 1X44A 3GBML 4N8VG 1P1ZB 5FUZH 3FUFA 4U4BA 1ZLSL 1FNFA 4OQTA 2ZOOA 3T0EA 1WD8A 2V33A 3NN8B 4KK9C 1CGUA 5AEAA 1PX3A 3VU1A 3VI4F 4XOBA 4ZTPH 1BJMA 5HYFA 1JDDA 4NSKB 2OMZB 1PF3A 1TJXA 4XH2B 4MZ3A 3I84A 3WEOA 4HLZG 1XGUB 4OU3A 5T3XD 2PPCA 3N50A 4FYSA 1PJ9A 5CN2A 2XLLA 4OFQA 5I0VA 5CINL 3QG6B 3IFPA 5I8KH 3DRQB 3BAWA 1SUHA 5LBSA 5C0DB 4Q9RH 5IY5B 4WVRA 2NW2B 4LGSB 4MA1C 3TYGH 3V0AC 4WV1C 3L5WA 4UAOC 3GXUB 3TCTA 1X6NA 2CRMA 4MKTA 5LBGA 2VB5A 2JLPA 1ZANH 1I3RA 1LMKA 3BAXA 4NERA 3RU8L 2C9RA 4AYEC 5A2BA 2D31B 3BZEB 3FB5B 1M53A 1J1OH 1X6LA 3QAZC 1RH8A 4UB0H 3VTAA 4XBMA 1YO4A 1URLA 2BCKA 4OGQC 1U95B 4G8FB 2NY3C 5LHDA 4OLUL 5M7QA 3GMPA 1FL3A 3QDJA 4FNLH 5K9QI 4R7NA 3BCDA 5D1ZI 4LHJB 3D30A 4QNPE 3VXSB 3GXIA 3R7RA 1XZWA 3ME0A 4HX1A 1UJTA 3WIIL 5T33H 3EYQD 2X1WL 1FORL 2YRLA 4L8BB 3VSTA 2OP4H 1E3FA 2C4FT 3B2DC 4M7KH 2J8UA 3M8OH 3I6LD 3TJPA 1BVKA 2ZOTA 2LU5A 4KXBA 3V7AG 3IPEA 4LHUA 4XPGL 5ADPH 4IJ3C 2C5DC 4NGHL 1MAML 1M6OB 3QEUB 3PDDA 4RGOL 3GJFB 4PW3A 5DJZB 5GGUA 1KTLB 4NAQA 5HDBB 1WH0A 1CXIA 2ADJB 2WGXA 5D2LF 2BFVH 2A77H 1KWGA 1KCWA 4XP4H 4YS4A 5JYMA 3F84A 4O51A 2I5YL 4RFOH 4XN1A 2M2DA 2NDFA 2V4LA 4MNQB 4J3XA 2ZCKH 1LP9B 2GCYA 1ZVNA 2BHUA 2P5EB 5D7IE 1DHKA 2LGNA 3GT6A 5EB9A 3QUXB 1MFVA 3QHZH 1UD3A 2B4CC 3VMPA 4NOBA 1AIFB 2KLRA 3HRPA 4G3YL 4NM8L 1K5NA 3V52L 5L9DH 3T4YB 5LXGL 4R2GC 1CWVA 1TU2A 1Y1UA 5IT2H 4R5XA 1BEYH 1JZEA 1KENH 1IZJA 4ZRGA 32C2B 3G08A 4K3EL 1DBKH 2GJRA 5G5DB 4EVNB 4KUZL 4F1ZA 4K94C 1ZS8A 1J0IA 1EA9C 3W81A 3BH4A 3ILEA 3L3OC 1VGKB 4RH4A 2R29L 3WEAA 4IOIA 5BZXA 4DW2L 2Q87A 1DSWA 2XVKA 3MR9A 4M03A 5CGBA 2G9HB 1A4JA 2O6EA 3J27A 4GW4A 5KN5B 1CMOA 2VSKB 4GO6B 2UXVA 3H1ZA 1QUNB 1U42A 1EH9A 2J4WH 5T1KA 3WUWB 4CKVX 4IU3A 2DBLL 1MCLA 3DV6B 4JFFD 5KSUB 1DVXA 2BVEA 5FAAA 2X4OA 1IGJA 2R51A 5DJAB 1BFVL 1W0YT 2XZAL 3WXWL 3ZTEA 2VSDA 2RGSA 2UZYA 4G6AD 3SE3A 1QBBA 1EHXA 1UT2A 3BO8A 1JF6A 5DD1L 3TPUB 4ERSL 3ZDYF 2OW7A 1TZOA 4H8WC 2VDMB 2R1XB 5LVEA 3L48A 1TTGA 2ZXWB 2JFCA 2VDRL 1I31A 4R0LB 4TQEH 4V1DB 4NO0A 4PRBA 4MRBA 4P2RE 1F4AA 3IJHB 4N2OA 2BSCA 5C86A 3KS0H 5GJSH 4I4WA 1CFBA 2KC0A 2NY1B 5GSRA 4Y2OB 2X3BA 1SJHB 3F04A 3WFCL 4EDWL 3FTUA 4OGYH 5TE4H 4CBZA 2F5BH 4N0RA 4AVJA 4YH6A 2D7NA 1KPVB 4PIBA 4W9HC 3TZVB 4ALAC 3LRSB 1XDTT 3KYMA 4H8UA 1E9PB 1FVDB 4HIEB 4L1DA 5EOTB 1BVNT 2JKWA 3X14B 2LW3A 4FQCL 3U7AA 1QACA 2AABH 2SEBA 3IXAB 1PX8A 3FU7A 4CVXB 5DEJA 5B8CC 4NQDA 2BW4A 3PHAA 5IV2B 2R69L 3THML 1NIAA 4U3SA 2VXUH 1B4LA 1E3XA 4FFVD 2OK0H 5JZ7C 1PNCA 3DBXB 3GZKA 3SE9H 3VRLF 1R3KA 4IRSC 1OGAB 4FTVB 5TDOB 3ARFA 1I9RL 4P5MB 3L81A 4L8DA 2B59B 3O2VH 2AEPH 4MRCA 3VWKB 4X5WB 2AZUA 4BE5A 3ZVVA 3MKGA 1TJGL 2VXTH 3LH2H 4GI6A 4GQQA 4LVNC 3QQ4A 2HG0A 5ACZA 4HJTA 1PZ5B 2XIIA 3PWJB 4X0KB 4JLRB 2F54D 4PH8A 5IBTL 1J88A 3VVWA 3VXME 5DRWA 3FF7A 4XMLL 2IIJA 3D4ZA 5IP4A 5KOVC 4C55A 1NFDB 1RHHB 1K4DA 4HWZB 4JFQB 4ANVA 3MNMA 2UVEA 1TZAA 2HP4A 2PTUA 3CFCL 4HZLA 3PWLA 5DD6B 2F58H 3ZYZA 3EUDA 3IT8D 1TITA 2QVIA 1T5WB 4QJ3B 3G04A 3QXVA 4ZI8A 4ZPTA 3VQLA 3PGDB 1FBIH 4UTAL 1DE4B 2AJVL 4Q9BA 5C0CB 1QP1A 4ZNEA 1BZQK 2O5XL 1D7FA 2BFGA 4HXBH 4HCRH 2G75A 4Y1AE 3TO2B 3KM1A 4N1CA 4MASA 4WY7H 5HDBE 1BF2A 3GKWL 1E6JH 5KN5A 4TXVB 1CLOH 4FQJL 1XL4A 3SQBA 1OANA 5IFHL 4JK0D 4DGIH 2Z93B 4JFDA 2J3SA 2VM4A 1DLFL 3OAZH 4YHKH 4Z95L 4UU9A 5IEHB 3D3VB 1EEZB 2X10A 4YNYB 4YGVA 2E6JA 1M05A 1A4AA 3CZKA 4UM8A 3X3GH 5CLXA 4XP9H 3RFZC 1N7ML 1T04A 3OQ3B 3QR0A 4D8OA 4F58L 1S8DB 4JG1H 4LEOB 3GM8A 2CHNA 2DWXA 1MCOL 4KMTH 2ODHA 4A6YL 4QOKD 3FCTB 1M7DB 4XHJC 3N6YA 4L4TE 1ZHLB 4HS8L 5KYYA 2AQQA 4ZXBC 4NQCA 3B5GA 4ZNEE 3CUPB 4W4OC 4MD5B 3LKQA 4PRDA 3GJEB 4QD2E 5JNYA 2OX5B 3FH5A 4ODSL 3O6FA 1KJ2B 4UT6H 1A4KB 2C8NA 2WK2A 3QIUA 4NB7A 4WFGD 2E0PA 1J9QA 4YDJB 2W0KA 4XNZC 4DKDC 1LEGA 5EUOB 5KJ7E 4RIRA 2GEQA 1M3IA 4NQUA 5I0DA 3I50L 3PP3K 3EGSB 4H44C 3ULUE 1L0YA 3LY6A 4HC1H 5I26A 1DZBA 4X5RA 5DZJA 4AKPA 1E3ZA 1OP4A 5IMLB 1GTFA 1P7KA 4F7EA 5EU5A 5I74C 4PJ5D 5C08D 4JY6B 3LS5L 3VW3L 4JO3H 4XP1H 5DEGA 3IAGC 1BM7A 3H53A 1AD9B 4JKMA 1AQ8A 4U1KA 3GMQA 2JIXD 2R1YA 4IU2A 2Z6FA 4BFNA 3S0PA 1SQMA 3A0OA 4PRHA 5BRZD 3STLA 4B7IA 1GYCA 5CGMA 3LRKA 4AGQA 2VO8A 5CR1A 4MA7L 3SKJH 2ICWJ 1UM4L 3LQMA 3DVNA 5KSVA 2DQJH 3HHSA 3OKLB 3A22A 3OSKA 1IKNA 1QKZL 3QDHA 4ZTOL 1J86A 5GS1A 5FO7A 3HAEH 7PAZA 2NZ1A 1JYXA 1WRFA 4NJAL 1JF5A 4JFED 2UWEE 3ZHFA 3EYOA 3KEDA 4N68A 4TULH 3ZE2B 4AITA 4OB5H 1AXSB 4RFNC 5E5UB 1PPIA 4FXGB 1HXMB 3RX7A 4F8QA 1HZLA 4BKTC 4XI5C 4I9WD 5I1GL 3FUNA 1ZGLA 2WWOA 2LT9A 3UZVA 1FYHB 3BKCL 1MHCA 3RDTD 1HL5A 2G2PA 2GB2A 4LRNL 2VMCA 4J8QA 5ENWB 2J6EL 5A3IC 4JREC 1PGRB 1QBAA 1MFCH 4MJ4A 1QKZH 3RY5A 4BRJA 3NG5A 3BVWA 4KHXH 1JWSA 2V5MA 5GHWH 2FEDD 3FCUB 4FFYA 2BSEA 4XVOA 3T1FA 4KZEH 2KMWA 1WA0X 4F9LA 1QLRB 1AZNA 4E9XA 4KH2A 1AP2B 5ETUA 4KDVA 1IL1B 3NJGA 1U3HC 2Y07L 3DC0A 3QRBA 4LP4A 3U6XA 1VKXB 5C09E 5DLML 5E7BA 3GMRA 5BQ7B 2H0EA 1HKLH 4W9DC 43CAB 5CD5C 3DJZA 4PLJD 4ONGH 4XN7A 1OAJA 2P7TB 4PJ5A 3DMMB 5C08A 4Z7OF 5ELIA 4ODHH 3MLSH 1HIMH 2XWRA 4EZKA 5E4OA 3ETBJ 3NPSB 3RL1B 2OMZA 4FZEH 3WDJA 5I6MA 5L7XH 5D1QA 1I3GL 3BISA 1CE1L 3QUXC 3DVIA 5BO1L 2OAAA 1WZMA 4X7DC 2YD5A 5HHNA 1QR4A 2AHIA 4JM2C 5DJ2A 4ZSOA 2E8YA 4DEPB 1FZKB 4EAEA 1VFMA 4AQ1C 3DX7A 2QVTA 2FJSA 2X87A 3WTYA 5MHSD 1F90L 4RA0C 2Q7AA 4N20A 4GAFB 4HCIA 4OFPA 2DPKA 3KL5A 2OSWA 4KZDH 1EXUA 5F1SA 5EF1A 4DCQA 2G60H 3MYJB 3PV6B 4X7EC 1HL8A 3WD5H 5E8OB 1E4XL 4ENED 3U0PA 1S9KC 1J10A 1UB5B 1MHHA 2A7BA 1DCEA 1KCVL 2AZAA 3QUZA 3FBQA 1OSPH 12E8H 4L9DA 1I9EA 2WOYA 1G7LB 4YSSA 2OZ4L 1BVLA 3QJVB 3HKFA 1AGFB 5D1ZC 4Z76A 4RAVA 1EZLA 5FV2A 2ZWSA 4TVUA 5EBWA 4ELMA 5DS2A 2JCCE 1F4HA 4HLJA 3WIIH 4IDJL 4JRWA 5GPRA 2EIJB 5GRZA 3VO0A 1TMCB 4LBEB 3S5LA 5HDOA 5F9DC 3O3AB 3IDXL 3MX0B 3NA9L 3NFNA 1TKWB 4B5EA 3BSZA 1FL6B 2WKLA 2PNDA 1MAMH 3HHSB 5CEXB 3NCWA 5E5LA 1MCOH 2IANE 1V7ML 2CDFB 1ZT7B 5IG7B 1CGTA 1LNUB 2Q3XA 2ZKMX 4ZO8A 3R06A 4NKDB 2VLRE 4LK4A 1KTDB 4XP4L 5IOPB 1FGNH 2XBZA 4NAMA 5T3XL 3T3PF 4BFFA 4YHOL 4OJFH 3WIHH 4OFDA 2DEYX 3IDMB 1QSEB 3RLSA 2ZXAA 2F5AL 3UAFA 1KXQA 1QA9A 2CRYA 3HS0A 4K3HA 3V4VA 2R83A 3BUDA 5JW4R 3D85A 5DFVD 1EMTL 2F08A 1ECYA 3GSXB 3RX9A 1EX0A 1K5NB 3T5WA 3U79A 2FCBA 4PRAA 1WFNA 2YD7A 4EIGB 3PHSA 2FVNA 3GXDA 4Z8FL 4LQ1A 1QW8A 4TSCL 2AI0L 5EEYA 3IFPB 3NIGB 5KW9L 4UIMA 2OMWB 4BDVB 2DQHH 2D3JA 4DAGH 5C3LD 1D5IL 2MKLC 3BPNC 2FSEB 2ICES 3IDNA 3AGWA 2VLRA 3D6GA 5C09A 2AQTA 2WY3B 3I6GB 5TD4A 1ZVSB 1ZHKB 1XF3A 1HNGA 1CXEA 1JPGA 4UB0L 2JB5L 4QHPA 1MW1A 3ZKQD 3EH1A 1LVEA 2YJLA 4OLUH 1OCRB 5EU6D 4CL7A 3GSUB 3MZTA 4PCTA 2OMTA 4OM1H 3QUHA 5KJRH 1KBKA 3T6QC 1UGNA 1N10A 3S37X 5AW3B 1Q0XH 4OF6A 1OY3B 2ZUQC 4POUB 2NZIA 4CVWA 3C8KB 5F7BA 5KBPA 1JMZA 5HHQB 3OC5A 5C2BL 4LL4A 4MNQD 2QSVA 3NJIA 4RRPA 3TBWB 5E1IA 2EDYA 4XP5H 4PJXF 2ZIDA 3QUXD 2PYFA 4ZFFB 3ARTA 4BIKA 3FSWA 2N59A 1RZIB 2BP8B 4JNXA 1BSIA 1QRNA 3QQ3B 4HUKB 4E5XB 1C5DB 1WF5A 4I4WB 3QDGA 4X0NA 1MHHB 3SDDD 1KGYE 2ZX6A 3FO1B 4KRPC 4PJCA 5IKCB 3IFOA 2D2CC 5KBLA 2BP0B 1YC7A 3V4UL 2HZHA 3KLAA 4NN5C 3HHMA 3W2DL 3E2HB 2EIMB 2DDQH 1XMWA 5IVXA 4XB3A 2F61A 1KTJA 4MMZC 3CLFH 3MRMB 1P5UB 2VXUL 3C5JB 3B7TA 5LGHH 1FE8H 2OMUA 5JHDD 3NFPB 3QI9B 5GGRA 3FB6B 5HJ3B 3FB7A 3TV3L 1AO7E 3CDGA 5J11C 4XHQA 1HXYB 3RZCD 5IESL 1FRGH 1GGBH 3L5XH 3UL4A 4LSSL 3R06B 3V4PA 3VQ2C 3K5RA 3L3IA 3F5WA 4F9PC 2WANA 5D55A 2VLKE 5I66A 1GYVA 4OM0H 3AADB 3CFNA 2CUIA 7FABH 3IU3A 4PR5A 2Y72A 3NRQA 4Z7OE 1ULVA 2NUTB 4UAOB 1WWAX 5TDNB 1JWMA 1N5AB 4P46A 1MFBL 3UPRA 2V9TA 3MAWA 3UTZB 2AK1L 3QR1A 4NNYA 2MEJB 3I74A 2NCMA 4U4IA 3QJFA 1UM6H 1LJMA 5CBEB 3KPPB 2HRPL 4J3WA 4NN6B 3ULVD 5IW3A 3PWUA 4N9GB 1AI1H 3BPLB 4FQIH 4YDKH 1TO5A 4L0PB 5EO0A 4LRIA 2ENPA 3OF6A 5CP7A 1A6UH 3MA9L 1BV8A 1SLWA 4GO8A 4PRBB 4NUMA 4X6EA 1GS7A 3SDDA 2LE9A 1T83C 2WNWA 2RD0A 5DUPH 2ZUVA 2IOMA 2Z7UA 2ED8A 3OKEA 3KNBB 4RAHA 5DYFA 1M05B 2WXQA 4KJQD 4P99A 4QWWD 4TTDD 4OTXH 1N6VA 2X89D 2WWMD 2WQRA 2I25N 2EXWD 5KAQF 2F8OA 4MMXC 1WFOA 1ODUA 1L9PA 2ZOKB 4LSRL 4Z3JA 1MIEH 5ANME 2OV0A 4N6RA 3H54A 3IETA 5DD5H 3IDIA 3BVUA 3ENEA 2MOVA 3D34A 3TVMD 1IGIH 5HHVH 1X7TA 3NOIA 4RZKA 5GRYA 4HSQA 4MNQA 2Z35A 4QY8A 1DBML 4XHJD 2E27L 1RUPH 2XY2A 3IDGB 5D1ZA 5FWQA 3T8XB 4OUUB 5DR5H 2OYPA 1YNLH 4RX4D 1KIUA 1NSNL 4YHZH 4LU5L 5EMYA 1QI5A 2Z1PA 3FT2A 1A7QL 3VD7A 4Y0GA 1HSAB 1CDIA 3ZDWA 1NMAL 1LEGB 3B56A 3QUYC 1NLDL 4DP0X 4PJCE 1WCBB 1IQWL 2PPEA 2Q6WB 2FWOB 3PUUA 5C6TL 5C3IA 1EHKB 4X0KA