4AGOA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5174
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agoA00
2RMNA 5LAPA 2MEJB 2YBGA 1LJMA 3Q05A 4MZIA 3WTXA 1E50A 1IO4C 4IBYA 4AGOA 3WTSA 3US1A 1HJCA 3WU1A 5AOJA 5G4MA 3IGLA 4LOEA 3VD1A 4L0YA 5AOMA 2BINA 1GZHA 2AC0A 1KZYA 3D05A 4IBWA 5G4NA 2ATAA 4GUOA 4AGLA 3Q01A 3D06A 1TSRA 3QYMA 4IBSA 1HJBC 3WTUA 2BIQA 2J1XA 2P52A 5AOKA 3KMDA 2XWRA 3US0A 2BIOA 4IBZA 1H9DA 3D09A 3ZMEA 2GEQA 4QO1B 2J21A 2X0VA 4AGPA 2AHIA 2IOIA 3WTVA 2FEJA 4L18A 5AOIA 3VD0A 3D07A 2J20A 5ABAA 4MZRA 5ECGA 4L0ZA 1EAQA 3WTYA 2XWCA 2OCJA 5KBDA 4G82A 1CMOA 4LO9A 4IBQA 2X0WA 2IOOA 3WTTA 4IBTA 1TUPA 4KVPA 3D08A 2J1ZA 2VUKA 5BUAA 1EANA 5G4OA 1EAOA 4XR8C 4GUQA 4AGNA 3D0AA 2ADYA 4LOFA 2BIMA 1GZHC 5LGYA 2J1YA 2H1LM 5A7BA 1UOLA 5AOLA 3QYNA 1YCSA 4G83A 2X0UA 3VD2A 3TS8A 2IOMA 5AB9A 1HU8A 3KZ8A 1CO1A 4A63A 2BIPA 4AGQA 3IGKA 1T4WA 2PCXA 3Q06A 4HJEA 2J1WA 2WGXA 2J6WA 3WTWA 4AGMA 3EXLA 3EXJA 4IBUA 4IBVA 4IJTA
chains in the Genus database with same CATH superfamily
2WLHA 2VITB 2D7PA 3EBAA 4MXWH 3GBMH 5AW2B 1S9YA 5IIEA 1LE5A 5TJWK 5J06A 4LVNC 1T0NB 1SF5A 3KWWA 4HSQA 1ZT1A 3MQIA 3BO8B 3JVGC 4O9HL 4B41A 1T1WB 1F86A 3DHMA 1RJYB 2XACC 3D1MC 2EILB 1NM9A 3PUCA 4NQSA 4UZUA 3IPEA 1R5IB 5D7LB 5E7BA 4HULB 3MZTA 4X4KA 4L1BA 2GJ6B 3D18B 3I6KB 4NZDA 4U0RB 1J8HE 5CSGA 4PU2A 1IKNA 5E8DL 4I9WE 1TQCC 4M48L 3CHOA 3HUJE 4WUUA 4PJFB 3IU4L 4YO0A 2Z7UA 4LFHG 4F8PA 3U6RA 3FW6A 2QV2A 4X6DE 4XP9L 2FNBA 2B8OT 1N67A 4JM2F 2H47C 1BVLB 4ZW6A 3C5SA 1E6OH 5D7JA 1V3MA 4UNTA 4N0RA 3QUYD 4AMKL 1QRNA 4JFQA 2A6KA 4KO6A 3K6NA 3NIGF 2BSTA 2Q8BL 4WSJA 2XV2A 4Q14A 3HKZA 1JDDA 1EVTC 3N41B 3QEGL 2PO6A 4RX4A 3TIDB 2FB4L 1P0SE 2CO2A 4ZUVB 4H0HB 3QUZD 5TDPB 3H9ZA 3OKEA 1M9WA 3UYPB 3VI4B 4YXHL 4MVBD 2FEEL 4NN5C 3QFGA 5AKSA 3DTXB 5E6SB 4FFWC 5F3BB 4NO0A 4O00A 4A04A 2A6DA 2Z7WA 5ENWA 2BRQA 1I8IB 5SWZA 4M7LH 2IALA 4QKTA 5K1JA 4WJKB 3SYCA 3MI6A 5EZIL 1ASOA 3GSUB 4AZ8B 3VFSB 1EO5A 3NZSA 3BISA 3BE1H 2W91A 2PXYB 4FQPA 4MHHG 4WGWB 3BQVA 1KBVA 1N10A 1I9IL 2WOYA 3KL0A 5BVJA 4H8UA 2BDNH 4LOVA 1UOLA 1IU1A 1A4CA 1YEIL 2XNAA 1X5JA 1CXIA 3GS0A 3IRPX 4EI5B 1NWOA 4GKLA 1JRHL 2AERT 4LVEA 3IAPA 3NJNA 2EIJB 1SEBB 1XGRA 3EZ8A 3WV0A 2Z35B 4HXAL 4XOBA 1RUQL 1CZ8L 1YNTF 1XHHA 1XTMA 2FT8A 1CI3M 2NQCA 1HYSD 3TBYB 1BVKA 4G80A 2X88A 3GSNA 1G9NL 3FO1A 5AB0A 3ILQD 4DTGH 4PSPA 5KBPA 1IBZA 3NP4A 1OW0C 3GNML 5DJ8B 4HFUL 1IV8A 1Q1JL 3GFUA 3D9AH 3GSVA 5DC9B 1JZDC 3QPKA 4FE9A 4Q9BA 2YAHA 5E6YA 4AT6A 5DO8A 1QYGL 5IHLB 2CO7A 3ARBC 1YYMH 3F7VB 2GK0B 4IKIA 3ARDA 5K69A 3C08H 3U1SH 3JTBA 4LPYA 1ASPA 1CVSC 4BZ1H 3NJHA 1LNUB 4F37F 5T1DL 2MTAA 4KBPA 2JKSA 3IKCA 5JXED 3Q8FA 4S1SL 5B1BB 3BIBX 3LKQA 4PJIE 4XPGL 5L8JB 4K8RD 1BAFH 4E9RA 2WXNA 5DJCB 4XX1E 2R29L 4DHLA 1TTFA 4Y5VC 3U4EA 3B6SA 2PPAA 3BI9X 3KXFE 4Z7UA 2BSSA 4AYFB 4M1GL 1WGVA 3CZEA 5BS0E 1OAXH 5HSFA 1P4IL 3HE7B 5FC9A 3T6ZA 1F00I 3VTMA 2Y2WA 3MRNB 1ESOA 4R3SB 2WLLB 5GZOD 1JWMB 2G60L 4ORZC 2X05A 1NOAA 1GH7A 5MEND 5EEZA 1BXXA 3PL6D 5ILTL 4B9FA 4Z76A 4DZ8A 5I73B 1S7QB 2DTMH 3DDFA 4N26A 2WTRB 3ARFC 1GIGL 2NY0C 3H2QA 4JKNA 4Q52A 5DGQA 1EAPA 4WU5B 3JV6B 4FFZA 1DE4A 5B1AB 1NCBL 3TZVB 1NKOA 1WTLA 3K8KA 2ZWLT 3ZE2F 2V17H 2LTQB 5AB2A 3FUJA 3L7EA 4Y7OC 3K71B 4K5MA 1QX1A 4G42B 3C5ZA 5L2JB 2R15A 4WKZB 3NIGB 1UURA 2WSDA 3DOSA 4GKSB 1UZ8A 3FU6A 1HHIB 1BQHB 3HVDA 3UYRL 2IWGA 3FSWA 2YGNA 4I0PA 2WBKA 3MLVH 3TA3C 5HVWA 5AOZA 5DJZA 3L3HA 5E8OA 1GGBL 4P48A 1IGIH 2G75B 5HHME 2AXJA 3NJIA 3IMBA 4YPJA 3N06B 4YZFE 5KTEL 1AOHA 2V9QA 4UINL 1G4MA 2W95A 1YECL 4JFFD 5T1LA 3IGAB 3KVDD 5D72L 4A2HA 5E8EA 3JZ7A 3WN5C 4B96A 2CGZA 2ZWYA 4KAQH 4MX7A 3VXUB 1I3RB 1AXTL 1MI5B 2CRYA 4OGAD 4B9KC 1U8CA 3OX8B 5MEPB 2VDMH 4WHDA 3VRJB 2XDHA 3V4PB 3WEAA 2K9UA 1P7QA 2O72A 4UNUA 3UAJA 3MMEA 3HCVB 3VWJB 2FIKB 4GG8B 5I5RA 8FABA 3FU7B 5A16A 1M71A 1R75A 1H3PH 2XWBB 1BW8A 1X5MA 2C3WA 5KVEH 1BVZA 4RWYH 3BDBA 4TVUA 1U4FA 1CLCA 3DSNA 4B9JA 4HG4J 3WE6A 1TJIH 4PCYA 5LXGH 2EIKB 4DF9A 2WTPA 3I50H 4ZFGH 3SGJC 1YNTB 1BD2B 5IJBC 1WWWX 5AZ2H 3VFNB 1IEBA 4JO1L 5DS8B 4YH6A 5TE4L 2ADIB 4WWNA 3VFVB 1BZ9B 1TYJA 1NJ9A 1ZHBA 2YRLA 4G6JL 4QRSB 3PABB 4KI5C 3QZWG 5EIQA 3WIHA 4BH7A 5JPNB 4PJCA 4LEEA 4P2OD 2J1XA 4WGVB 4JFPA 5ISZA 3FT2B 5C92A 1RY7B 1L9NA 3UBXB 4D0BB 5FX3A 4ETQB 4EUPG 3JWDL 4PJEA 3V6FB 3ZE0E 1MAJA 2BVQB 4JFOA 4F91B 4IKNA 3OHMB 5E70A 1AGBA 2NX5A 3JTTB 3UTSA 1UH4A 2AJSH 3B1UA 4I3SH 4ZTOL 1U3NA 3CVBA 4XCYA 2VLME 5F0LB 4L9LB 4N20A 2HJKA 2IV9A 5D5MF 2NDGA 4E2OA 2BVOA 1GPOL 5ABAA 2VQUA 1NCWH 4QWWD 1XF1A 3ARVA 1GZPA 2MPAL 2YMXL 1MLBA 4XXDB 1BOGB 4JKMA 5CILL 1CMOA 1MEXL 1MRFH 3U9PL 3T5WA 4QXVA 1A5FL 3SE4A 1PFOA 5BQDA 2P5ED 2YJLA 1R9FA 2EIEA 1D5ZA 5EC1B 3KH4A 1OTUC 4OZHA 1RIHH 5GGSY 4PJXA 5FFLA 1GGTA 5I1AA 2BVYA 5CO1A 2ITFA 4NB7A 3QJXA 1U2HA 5EBWB 5KAQF 3HI5L 5FUZH 4TNVK 5GS1C 5A1AA 3PU7A 1D5RA 1JZFA 4G9DB 2ZWZA 5J1SC 5A7BA 4QTHB 4I4WA 4V1DD 1IX2A 3ZE2B 2Z4TA 5FYKD 2XA3A 3GSOA 3SSGA 3VO0A 3IJYB 3X12A 2A3TA 4JFDD 2CXGA 2ZX6A 1G9MH 4JMNA 1ETZB 4U7KA 1RJZB 2BMKB 4EQ3A 3EW3B 2B39A 1BGXH 4H20H 1P84K 1ZGLM 3MRRB 1VFAB 4HT1L 4KO5A 3FK3A 1OPOA 1F41A 1PL3A 1RZ8B 4NN7C 4NNPH 4UDTB 3UERA 3X3GL 5J6GA 5EEYA 1MHHB 2GSGA 2B15A 3APCA 1WCQA 5GRVK 5C3TA 3UIYA 4LEXH 4M5ZH 3UG4A 3T0DA 4B9ZA 4MQSB 1ERNA 5IW6B 4OCLC 3Q2VA 4O58L 3QO1B 5DMGD 3EJZD 2R0KL 1GOHA 2XZAH 5FW8A 3MRCA 1BQSA 3IGLA 4UQCA 3VH8G 3DGCR 3GJFB 5G2NA 1HH6A 2PNDA 5DMKB 4YR6A 5LJYH 4PGDA 3SDXE 4GG6E 4IBWA 1CYWA 1CGVA 1NIFA 4OIIH 2DICA 3DRTA 4P05A 3NDYE 3BSZA 2P8LB 1MW1A 3MN8A 1FO0L 1FYHB 5DI8B 4UV7H 3EYUH 4O02H 1YEFL 4FKHA 3O11B 1JZ8A 3RQ3A 4M6ML 1UEYA 1TQWA 2Y36L 2H3XC 1F6AB 4P57B 3DXAB 1UD8A 2E74C 3CCHB 3AU1A 3BC9A 3U6XS 3F3HA 4UQAA 4XNYL 1R24B 3AM8C 4S0HA 4EOWH 1J1OH 1XGPB 4LQ1A 5DHXB 3II3A 4YWGH 2J21A 2EDRA 1OAZL 1SLVA 3V6OA 3GRWH 1FGNH 2UZIH 3NK4A 4GP8B 4ORGA 2OMZA 2P44B 1LQSR 1XGZA 1NFIB 2C7UB 2YPKB 4YS4A 4LASH 3GBNH 2RTTA 3VXNB 3K3QA 4HUWB 3MROB 3BDYL 5H37G 4MWFA 4Y2NA 1QASA 3B2UD 4HS3A 3MLXH 2ED9A 1R19A 2VSDA 3T09A 3LIZH 4Z7OB 1L5GB 3FUDA 4KVPA 2CUMA 3QQ4A 4KK5C 3WCYA 1ETB1 4NC1E 2LLNA 3DROB 4LCWA 4R0LC 4W9FC 1J8KA 1KTRL 4Y4KA 5D5MB 4JPIA 5DD0L 1ZXKA 1I3GL 1XX9C 5TK2A 4AIXA 3CX5J 4OF8A 4M56A 2PCFB 2DQCH 4D8OA 4A2GA 4DP6X 3ZR6A 4XO3A 2MCMA 1A6WH 4HK0A 5EU6A 1UZ6F 4NO5B 5EBLB 3VFGL 4WU7B 4KJYB 5J11C 3V0GA 1HNGA 4F2MA 2F8VA 4HIQA 1QWUA 3LH2L 2ZCLH 4YGAB 3EO9L 1YNKL 4MDIB 2Y06H 1A4JB 5I8KL 4AJ0A 1K2DB 3IJ9A 2YLKA 5IKCA 1O7VA 1NDMB 3NA9L 1A66A 1HL4A 1P5VB 3GMQA 2EQDA 1X44A 5DK2B 3IETA 1RZQA 4BRVA 1ZANL 3D51A 1XAKA 1ZT1B 5GGUB 2QPFA 4G2AA 3HB3B 3QQ3A 4D9LL 4NN6B 3F62A 2YXFA 1Q4NX 1OL0A 1E8YA 2VDOB 4GSQA 1M7XA 4Z7UF 3QDME 3EOBA 2XTJB 2ZE0A 4J3BA 1U6AL 1EGJA 1MHEA 3I6GA 4TL5A 4MZIA 3QH3B 2PMZA 3AAZB 2DEXX 2NYYC 2X4SA 1TTRA 3F00A 4M6AA 2OTUB 1FAIH 1EZVY 2GIXA 2R39A 3BVVA 3KYKL 4P2YA 1PEWA 3LNGA 1UVQB 4YVNA 4MXQD 2Q5BA 1NUDA 3K91A 4YO0B 4UIKH 3S36L 1RHHA 4U1GC 1EPFA 1MRDL 1SLUA 3MRQA 4FLOA 5F93C 2G9KA 3HBPA 5I8CB 2WBJB 2EJ1A 2ZXDA 4DGVL 2EVJA 1ZDQA 1RZKC 2AV7A 1I7ZA 5B4MC 4FQ2H 3HPLA 4S1RH 4JFQB 1J0KA 1GR7A 1W8EA 3BHBB 3IF1A 2VQTA 5GGVY 3RBGA 2DLFL 1HOCB 1NL0L 3BT2L 1Z9SA 5I9QC 5D8JL 1G87A 3OAUL 2A9MH 3QIUD 1YUHB 3OF6A 2UWEE 1XCXA 2AEQH 3LEYH 2EXWD 3UL4A 2HH0L 3BKCH 3OKEB 1HQ4A 3HC2A 2CR6A 3P2BA 4WHCA 4WK2B 3V7AG 1K4DA 3AS0A 2AJZB 1NICA 3CU7A 3H1ZA 4NO0B 2JKLA 5ENWB 2HRGA 4BA8A 5KVEE 3HI1B 3MPCA 5J1TC 5E08H 2PCPA 5ETUB 5DC2A 4WV1B 1KJVB 2QSCH 5I6XB 2K6ZA 2BP5M 3L9EA 4OY9A 4DVBB 5ID1A 3FAWA 3L3OA 1YEKH 2YKKA 4AV0A 1B2WH 3VGAB 1XBRA 1PSKL 5E6ID 1WE5A 1JNNH 2A74C 5DHVB 3UYOD 3KS0H 1QATA 2VLJB 4P5KA 4RBPH 1U58A 4Z7NE 4MAYC 2P26A 1A14H 3QZNA 4L4TA 4JKPH 3RKDC 2YS4A 1BHGA 1XGUA 1W72B 1YEHH 1KN2L 1XGRB 2YAEA 3BPOB 1TQSA 5EN2A 4EI6B 4ZNCD 1U41A 4ATWA 4GPVA 3S3PA 4FJYA 1ZE3C 2F61A 2Y72A 5EO1B 4ODSH 4XP5H 1A1MA 1OZTG 4NKMA 2JSFA 1GW6A 1HESA 1B4RA 5IJDC 4GBXD 3P11H 1ZTXL 4PG9B 5IHUL 1UXSB 4PJCF 3CDGA 4M8VA 4PGCB 5I28A 1GTNA 3L95B 3MLYL 4ZPTA 5KYYB 3NIDF 1WPCA 3KGUA 4PJEF 1DQKA 4HIIA 1N8ZA 1NLBH 1AFVH 2YPVA 4ZXBD 1JN6B 3RWEA 3BCDA 4XWGH 4ZD3H 2EO9A 1S8DB 1MFNA 4TUOB 4WVRA 3BOVA 1CDJA 2EE9A 4NZRL 2BO0A 1TSHA 3NIFE 1PZ5A 1BJ1J 2Q86A 3PXJA 2ZX9A 4HZLB 4N1HB 1BDYA 1W16A 1JK9A 2EE6A 3MLWL 4PBXA 5FA3B 4DP9X 4Q6IA 3ABZA 5IY5B 2QVFB 3F7YB 1E90A 4UYQA 2WCSA 2H8PA 3O8XA 4ODUB 3IGFA 3L48A 5JORB 2GJRA 1K72A 1TQTA 3GXMA 3U4EB 1L9SA 1EEYA 4Z7UB 1TMQA 1JNHB 4X9BA 1GKOA 2F8IA 4U1LB 2A83B 3RVWD 3QUMB 2P43B 3TN0A 4L37A 3B9VA 4W70A 3QXAA 4LARL 5IVOA 3DX1A 2I7OA 4RIRB 4PAZA 4Z76B 3MRKB 3KLAB 3UZQA 4FG2A 5I1JL 3UPCA 4NQCA 4Y2DC 4GKZB 1YZZA 3DUUA 4K71C 4WI5A 5IBTL 3ESUF 1YY8B 3EDKA 1A3LH 3VXPA 3ZUCA 3CBKB 4ZSOB 2WK2A 5C0BB 2X7LB 4ZYKB 4TQIA 2GPZA 3WFHA 4KXCA 3IDIA 5FYJL 1OY3B 1MCQA 2N4IA 3AREA 2NUTB 2VQ1A 4G8IB 4NM4H 1CTNA 4JVWA 5L2KE 3GMNA 2AQ2A 3GYRA 2BS9A 1FC2D 2CJ3A 1QG3A 3JWNG 4UT6H 5FA4A 2L3BA 1P1ZA 3G5XA 3V4PH 1EAQA 4DN3H 4DP0X 2JCCE 1T2QH 3BYTA 4KH2A 1EXHA 3BWSA 2FX9L 1L6ZA 5E8OB 1T20A 1X5XA 4OZGA 1KBBA 4XVSL 1IVTA 5KSVA 5J56B 1CGTA 3C6LC 4LK4A 4PREA 3LQMA 2KS0A 1A3RH 1AR1B 3PWVA 4LRNH 2O61A 2QZ5A 1EDHA 2XG4B 2WWKO 4FTVE 4PVBA 1E7UA 3E3QE 2FUQA 1NSNL 1USQA 3FUEA 3V0VA 1A7PH 2JXMB 4PW9A 4IOFD 4MS8D 5JZ7D 4QT5A 5AWNH 1V8HA 2DWTA 4WY7H 2NQ3A 2OSXA 1HNFA 2FHBA 1TZIA 3AW5A 3RNQB 4NQEE 4K2UL 3PV6A 4JY6A 4JO2H 3RY6C 1FVEA 3ZVVA 3HJ0A 5BRPA 4P07A 1F3DH 2BP0A 3GMPB 2E75C 3RZCA 2B9BA 4CMHC 3ZKSD 2FL5B 1G9HA 3QIBC 1SJXA 5HHMD 5IBLC 3SCMA 1AGDA 3RL1B 4PJBE 1N6QL 1C8PA 1DCLA 4XVJH 5C0AA 4EDXB 4XZUA 4ZW5A 1NBZA 5L6YH 1UC6A 1DBJL 3EO1A 4P4KA 1IEBB 2ZONA 2WXIA 3ZZLA 2WNWA 3W2DL 1EXUA 4ELMA 5C2BL 4M8QA 1DZ0A 1OGAB 3QISA 1ZKAA 2GJZA 5HJ3A 1UM4H 3QB7C 4OCNC 5DRXA 3N85H 1OOWA 2OJZH 2D9CA 2MQ3A 4W6XB 3O2DL 2EZ0C 2E4FA 2AF2A 2ED6A 2BFVL 2ARJA 2X6AA 1JXGA 4HLZG 4JPSA 4PJCB 4JFPB 5ISZB 3KNBB 4M6OL 5G4MA 2X4UA 4Z3IA 1SM3L 2CDFA 5KSAD 1UB6A 3NIDB 3SKMB 1SLXA 4PPTA 4BYHA 2VM9A 5EU4B 4PJEB 5E7FA 3FCSA 1UA6L 1QFOA 1UENA 3EYFB 3UTSB 4BFIA 4PVNA 1UWGH 3NFSH 4PJ5E 2X4QA 2BVPB 3T71A 3WN6A 1KIRB 2GCYB 1OARH 2VDRL 2K6YA 1AR2A 5JHDA 2VL4A 3TJEL 4J39A 5HPMA 3EYOB 4GQ9H 3G7TA 4XPBH 3WFBL 3SJVD 3GKWH 2VR4A 2GY7B 3L5XH 1W2KT 3P3UA 5DEFA 1S9VA 5A2CA 3EJRA 3QNZA 1X5GA 3AXLA 5CEYA 3OWEA 2DBLH 2WSKA 2Y6TE 2J72A 1U8JB 1XSKA 1KTDB 4R5VA 2FNWA 3FRPB 2ICWA 3HC4H 1KWKA 4R4FH 4ERSH 4OV5A 5EU3B 1I8MB 1YN7A 3BZ5A 3L4WA 1O7DE 3QBTB 3IMWA 4WO4A 1FNGB 1KENH 4MQXD 2HUEA 4JZNB 5IREA 2OR8A 3MBEA 3GJFH 5CIPA 1ZHLB 1E40A 1EAOA 4S2SB 3MAWA 5JW4N 2OMTA 4TKWA 2ZX5A 3RIFF 2WKGA 2K3TA 3OXRA 1T22B 4LSUH 4XMPL 5CSZA 3F58H 1Z9LA 4LLAA 2YSSA 5KS9A 4XMKL 2H9GA 1NCTA 4W9HC 1DJIA 1P6WA 1IBFA 4YHNB 1QSFB 2WYTA 3BIAX 3SD5A 4LLQB 3R1GH 1URLA 1UT9A 1BREA 2QKSA 4BGLA 3F7PC 4O2EB 1MCRA 4AMXA 2WNXA 3SDAA 1D6EB 3B5TA 4PRHD 4HWZA 4FP8H 2K4WA 3RGBA 1I9JL 5AW5B 3WEXB 5JNYA 2VSMB 4KQ3L 3ILEA 4KOCA 4KJQC 4FFVC 1I85A 3Q9QA 2J4WL 2FBRA 5T1KA 2ID5A 1KJ3L 4JREB 4PGDB 1XCQA 4DK6A 1XXFC 1K8DA 2LLGA 4DKFH 2XN0A 3QFJD 3IFOA 3GIVB 3MOQA 4Y4HC 4LLWA 4MJIA 3ROLA 1EBAA 4JLRA 4WSKA 5AEAA 4WAFA 3DHUA 4HPYH 3S6CA 2BS71 2VIRA 3RYMA 4OF5A 2XYCA 3WKYA 7PAZA 2FZ3B 4AKPA 2J88H 2V5TA 4K5NA 3UX9B 5B8CC 3QWOA 4GRLC 2NT1A 3VFMB 1E3ZA 1HXKA 2CA3A 4X7SL 3DX6B 4PV9A 4BBWA 2WO4A 2XIBA 1HSBA 4HFWA 3L4CA 4ORGB 3NT0A 2HYMA 4PRDB 1REIA 5GRXG 3C6EA 3CLFH 3VSUA 4UU9B 4N5ED 3P0YL 1MHPL 1WZKA 3QXTA 4YHZH 4AM0B 4F5CE 4F9PA 5CD3A 5K9JH 4QHUB 1HOEA 3RA7H 4N2HA 1OV8A 1CLOL 2QZQA 2C26A 1A9EA 3QNYA 4GP4B 1TVBA 1N0LA 1R3HB 3B83A 2IOIA 4MMXB 6PCYA 1JNLL 2WQAA 4XX1G 3RDTC 2XA8L 2XG5A 4YDIL 3VD0A 1T2XA 5GRYA 2VDOH 2APSA 5EZJB 1FL5A 4WNSA 3GTNA 4IMLB 1KB9J 2YAFA 4XN5A 1T5XB 1J18A 4HK0B 5EU6B 3ZKXB 1DBBH 3KLLA 1D7CA 1TPXC 3WSQL 1BFOA 3LN5B 5LAXB 1XF2B 1I7TA 2C3VA 3NSDA 2EEBA 1AS6A 5BRZA 3S4SB 3ZKMC 1EIBA 2EKJA 2HVKB 5C0EA 3IBOA 4DWHA 1RULH 2AJXL 5J13C 4U05A 4M1CD 3H56A 1FPTH 4AM0Q 4XBEH 5C0GB 1M3IA 2W9LA 1ES0A 1F2QA 1AKJA 1ZA3B 4FDWA 4IU3A 4ZX4A 5CLTA 3LSOA 4ZOAA 1OAKL 1YMMA 3MGOB 3TH2T 4Y2OA 2HA1A 2ZX8A 1S4IA 2Q8AL 1M7IB 3VXUE 1JK8B 3EOBB 1RJLA 2P80D 3PWLB 4R0LA 3U46B 3L2MA 3LEVL 4IGBD 4ESKA 5CR1A 1BIIA 3EJPA 4BZ2L 3T0AA 2X4OA 1QLRA 1DO5A 4OZFA 1OTTD 3HNVL 1CGSL 5JPMB 3I75B 4ZUSA 2NPLX 5ICZB 4IKKA 4HUXA 3LS5L 2AEOA 3P9LB 4WI0B 1DSFL 3D69A 2K0RA 4AYMC 1NTDA 3QCTL 4PUBH 4X9FA 3LPOA 3B8SA 1IGML 5ID0B 5MEOA 2ZTBA 5E1QA 3LB6D 2DQDL 4APQA 3J8F7 4FNLH 3K6SA 3PQYA 3DVGA 4LVNB 4PJ6A 3PAUA 1O6SB 2NW2A 4QRAA 5L4IA 4FNRA 2MJWA 4PH8A 1KTLA 4M3KB 1II4E 1DJYA 5DHVH 5D6DA 1SVZA 1FSKC 5F3HB 1LDPH 4Y19B 5HXMA 5IVZA 1LLAA 4DOHE 2XWXA 2MWCA 1N4XH 1GYVA 4KKAC 4CADB 3ABGA 4JK0D 2AK1L 4QF1A 3Q6FB 2APBA 3Q1EA 4PLKD 4JE0A 4NKOB 3K5RA 4AC4A 2C4XA 2Q7AA 1TQCB 5DJYB 3RI5F 5CP7B 4ZAKA 3TEWA 3G5ZA 5HGBA 3FULA 3MRBB 1NUNB 1AAJA 5D7IF 5D7SH 4A7UA 3W81A 5J57B 2VXVL 5JYMA 3G08A 2XRAL 1CFTB 4P46C 2OLDA 2VDKL 1BPVA 4OM0L 3S0PA 2EVGA 4EVNA 2R2HB 2Y2YA 2WCPA 1MH5B 1TJHH 3L1OH 4XMUA 2X40A 4HIXH 4JMXA 5KBMA 5C09E 1OWWA 5D1QE 1HKFA 5DQDL 4YNYB 1XXDC 3EAKA 2BOBA 2PTVA 1RFDH 4LIQL 5DLLA 1U33A 1PJ9A 3V0FA 4FQIL 2ZKYA 2D7OA 3L4UA 3T04D 4NN5B 2VLKA 1IM9D 3E6FA 4X99A 5C0DB 4JKKA 2CXKA 1MVYA 3NZ8B 1UQSB 4FHKA 3CHSA 3MYZA 3C09C 4XAWH 4QJ3B 4QRPA 3IDXH 4F3FB 3QHFH 2Y7MA 3AQXA 3DIFA 3F6IA 4ODXB 4XPHH 4XC1L 1FZOB 3LS4L 1OAYL 2EYSB 3QUMH 4J3XA 1FNHA 3C8DA 2F53A 5C0RH 2FRGP 2R0ZH 4WIQA 1QPPA 2OZ4A 5BV7C 1T7VA 4JRXA 2H1LM 4FXGA 5JHLL 3RWEB 4P2RB 4GT7A 5E1AA 4X8JA 3WJLA 2O5YL 2I60H 1LWRA 2IAMC 1S7TB 3IDMA 4FFZH 1XIWC 3CLEH 1DLHB 2P7TB 2CQVA 5JA9A 1F1GA 5EC2B 2NTSP 1U8IA 4HVBA 3STZB 2X44D 4L8SA 2Z7YA 2QL1A 2ZUXA 1UEMA 2AABL 3FFOA 3GRBA 4N2NA 2VYRE 2BY2A 3T2LA 5E51A 4BIKA 3DO7B 3SPIA 1F3RB 3PJNA 3HE6A 4AE1A 5ALBH 2I5YH 3S34H 4NJ9L 4Q8BA 1FL3B 1HFUA 1N5AB 2HMIC 2WYIA 2YGPA 3MA7B 2ZCKH 1JFQL 3IVKA 5ACZB 4NI6A 1CR9H 4L8BA 1V5JA 3VD1A 4N0FB 2JELH 4G9FB 1L9RA 3ARBB 5CD5D 3DUUB 4GSRA 3MGAA 5C7XH 2DQEL 2W0KA 1QFWI 2BW5A 4IU2B 5IESL 1NLDL 2DMHA 1S7WA 2NZIA 1EZVX 2AXFA 4Y88A 4JANB 4DGYL 4KKLC 2H3NA 4Q89A 1XH3A 3UC0H 4PS7A 7TAAA 2JKRM 4GMSH 1KZQA 3H0TB 1CFQB 1SQMA 3D8MA 5FA4B 4Y5VB 4YDVA 1B6DA 3G5XB 3TBSA 1UD3A 1AD9B 1RLBA 1UM6H 1FCCA 3ZTDC 4P23D 1NIDA 2GUYA 4Y2LA 1IAIL 3VD3A 3OKLA 4A7QA 1MCNA 5I1DB 1ZV5A 2QHRL 4HWBA 2F15A 4NYLA 4D3CL 4P2QA 3P77B 3UCRA 4Z7AA 5ICUA 3ARFB 2NY0B 3B7SA 4PJGA 2EUWA 5J0BA 3MOAL 2O61B 2EACA 4Q4IA 2WLZA 1IT9L 1DFXA 3M17A 4QY8B 5D7IB 4JFUA 5CMAA 3QR0A 1P84J 3PG2A 3PGCB 1FH2A 4NHUB 4ZZFA 2ODHA 3WIHH 3RJOA 4YMPA 5I66B 3SBQA 4UBDC 5TTRA 3D4ZA 1R5WA 4JDTL 4YHPA 1M7DA 3MNDA 4HETA 4TNGA 2RBLA 4P5SA 1K85A 3FTVA 3CFQA 3MRHA 3VFPA 2XN2A 3DV6A 4NNYB 3TA3B 2EO1A 1JZEA 4Z7VF 1YC8A 1JGEB 2OMBA 2GHWB 3DX7A 1GCFA 1QFUH 2PP9A 4RZCB 4IJ3C 3FQRB 4GUPA 1DJSA 1HHGB 5EEXA 4K07A 3MV11 3HAEA 5CCKL 2CE6A 1X5HA 4LBAA 4XH2B 2BW4A 4OR1A 2GJZB 3MXWH 5DDHB 4WW2A 1MUJA 2XTJE 2EXYC 4OFQA 3TV3H 3NFPA 2NXYC 3WN5B 3HZKB 3ZTNL 4AY0A 3GHPA 1IQDB 4QAMB 1GYUA 2DW5A 4I77H 2ZUVA 2FCBA 2CDFB 1I7RA 4MJHA 2X41A 4GFXA 4Z7WF 5FUCE 1EBPA 4BKTC 3ZKQD 2YIHA 3CFDB 1JUFB 2E4TA 4JG0H 3QRFM 3U4BL 3W39A 4V2CB 1B88A 1WVZA 2BVTA 2QGDA 3F83A 4QHMB 3GSRA 4CMMA 1HJCA 3UZEA 3JV0A 7CGTA 2I32A 3S88L 4FOMA 3W11C 1YYLL 1QRNE 2ZYRA 2Y7SA 2ZJSL 1MCOH 1PBYA 4OB5H 5HPMB 5KOVC 3MRGB 3RWCA 2RALA 1XVSA 4LQFL 3PHQA 5D7LD 1FE8H 4F57H 2AQ1A 1WS7A 2GJ6D 3FOLA 3O4LB 2AVGA 3F6JA 4EN3A 5CN3A 3WFDL 1OP5K 3GJEB 4RMUA 3PXHA 3OJDB 2HTKC 2DI8A 5IR1B 2KPWA 5D70L 4NPYA 3IFNL 1CD1B 3NCWA 4TUJA 1TO5A 4FG4A 3TA4D 3UH8A 4TYUA 4WF7A 5JHAA 4HH8A 3MTXA 1VCAA 2AGJL 4R97C 4GSUA 1IC7H 2X3BA 1XFPA 2ITEA 2XBZA 3RVUC 4IIQC 1QOKA 4PJDA 4D94A 5AYUH 1W0WB 4RNRA 4PJHA 4YSSA 4LSSH 2V6HA 5DD5L 1R3JB 2BS8A 3T4YB 3EUDA 3VW3H 3AS2A 1CGXA 3OKDB 3BRDA 3C60A 4QXTB 1BEXA 2M83A 3BAJA 2GTWA 5DZOA 2HPTA 3RGHA 3BSZH 3NQKA 2OMWB 5EDXA 3HBQA 4TVPH 5ALCL 1AOZA 4V33A 1MJUL 3ZDXF 5LO7A 1EJFA 1YMHB 3HFMH 4HK3J 4KROC 2YPLA 2E7BA 2VE6B 3MJ9H 2V7HA 1O5PA 4K3EL 4ZW8A 4NJAL 3VG0H 5I18L 3CN2A 5GS1B 4J3OC 3HZ3A 2OW7A 3ARGA 4JHAH 3EH5B 5ESQB 4RFEB 4DEPC 4M9PA 2PXYD 3UTPE 2IH3B 3NJMA 5B1KA 5KTEH 4KDVA 4AV4A 2V9RA 4PWFA 1OAUH 1UZ6E 1AXSA 4WWID 3PREA 4XXCC 3IFOB 3CC5A 4EI5D 3PNRB 4FQHA 3RVTD 4UDUB 4WI6A 4R96B 1KGCD 2F58L 5EH1A 1TCMA 2X42A 3CFBA 4XNQB 2IJ0C 2VWEC 3MLTA 1H19A 5CU9A 4PG2A 4Z7VB 5DUBB 2QQKH 1WBZB 3Q06A 1H8NA 3N04A 4ZUWA 4NN7B 1UWYA 3U36B 4EMZA 4TN9A 4D9RD 3O41A 5IB1A 4X7TB 3TWCL 1ODAA 1BM3L 3QWOB 3QJQB 2DQTL 1E28A 2EICA 1WWBX 1WZ1H 2DWEB 4Z7UE 4GW1A 4L4VA 3WTSA 1U8OA 1YNLL 4OD2A 1WDAA 4IRJA 4D9QE 5IW1B 2FR4A 3SZ6A 2QPEB 3DV4B 5FK9B 4Z7WB 4UQIM 1EDYA 2Z91A 4WDIA 5CXPA 1E5AA 1OPGL 1AHWA 3MYJB 1L9PA 5E6UB 1LL1A 1BZDA 3B5HA 2ZXQA 1BZQK 4W81A 3LKPB 2G2RB 3JZYA 1DQQB 4AYEC 4RVBA 1QVOB 3LAFA 1QEXA 4XRCA 5BV7L 5L0QC 2XQBL 3LN4A 1WFNA 5CCHE 2E8YA 2YA1A 3HMXA 3MJGX 3P9MB 5K33A 4DFHA 3L2LA 3H9HA 3LKRB 2CKBL 4DPAX 4MNQB 1E3FA 2OR7A 5TGBB 2MCPH 3CFMA 2CDGA 3D0VB 3F12B 2M26A 1UWEH 3KPPA 4LGPB 1JOIA 1BEYH 3HE7D 2Z34A 5I1KH 2NYKA 5J6SA 3GBLA 3DVFA 5EV7A 5IEKA 1N2RB 3KPRB 4HEPA 3U1QA 1BOYA 5D7KD 4X6CA 4BE5A 5AVTB 4RMVA 5H4YA 1WLHA 3OJ2C 2Y1VA 4L8CA 3W37A 1JZ3A 1U8LB 4I88A 1L0XA 5CILH 1KN4H 1PF3A 3NJLA 5A2LH 3HG4A 4GLRI 4G72B 2XWCA 4HIJB 3TZVD 3ARUA 3IJHB 5IMLB 3CC1A 2EE2A 4XVTL 3D5OF 4R0LB 1ONQA 3RFRA 3QPQD 3QK0A 2H26B 5CFAA 2VMEA 3JWOH 4NOBA 4FA7B 5E8PB 4FG6C 4D0DB 2F74A 2NNAB 3NCYS 2E9JA 5IVNA 1RIUL 3VXMA 5FLVA 2I25N 5J11B 4AUUA 2BIMA 5D7EA 1OSEA 4HU2A 5J3HD 5EOCJ 5BW7C 4QOKB 4RQQA 3BCFA 3SYQA 3HPJB 3OZ9H 5CM1A 1UYWL 4XP1L 2ZXGA 4JO3H 4D2NA 3G5VA 1WZAA 3ZDXB 3FXIC 3WXWH 4KH9A 1U3HC 5IMKA 4J6RH 4UT9H 1YEJH 2JJWA 3OD3A 1DDHB 3PJSA 1U2CA 2BIPA 2R56L 4NRYB 4PB0H 3KBFA 2AI0H 5EUOA 3FO0L 3T0EA 3VXUD 3VX0A 1T1XB 2IANA 3X3GH 3H2PA 4HV8A 1E4WH 4PJCE 3VQ1C 3P73A 5KVDH 1MI5D 1YEGH 5ISZE 2A2QT 3Q2NA 3K2UH 3TBWB 3NIDE 2EIBA 5KJRH 4XP4H 3WOVA 1ND0B 1H3VA 4PJEE 3LPGA 3VWJD 3O9WC 1CT8A 2F2HA 2D0HA 1NPJA 1LVEA 3FTYA 3WFZA 2NX5E 3UTSE 3HS0C 5GGRA 5IHBA 4PJGF 2H6PB 1R6VA 4NIYE 4MJJA 3RILA 4Z7IA 3W9EB 2PW2B 3TIEA 4U1GB 1IJ9A 2FSEA 3MHZA 2CCLA 1RUKL 3ISYA 1BQLL 4MNGA 4GEJA 1BD2D 2IDCA 3OKKA 1EMTL 5FF6B 3UBHA 5CJXA 5IOPB 1DVFC 2VN3A 4G8FA 4KTDH 3L4XA 1HC1A 2VZTA 5J9PB 2J2ZB 3ASWA 3GSXA 5KVFL 4PQXA 1Q0EA 3FTGA 5TH2A 4U33A 5I9QB 3QS3A 1BAWA 1X4ZA 2VERA 2C3GA 4WEBH 1I4FA 4ONHA 3DTDA 5EOQL 2OMUB 2OSYA 2AFNA 1I1FA 3RU8L 4N0YH 5AVSB 3VRIA 1NGZA 3D09A 4PJXE 4N2BA 3CHXA 4FLRA 3ZMEA 5HHOA 3W5NA 1VSCA 1OAZH 1CTMA 2VLKB 12E8H 5TF1H 2WVTA 3P0VH 3W56A 4CGTA 4QIRA 1AS8A 1HS6A 1QR4A 1TJGL 4NGHH 5F3FA 3DSFL 3ATEA 5C0NC 1SZNA 4LLMB 3PP3H 3UG5A 1MFCL 3BH8A 3UBGA 2WHVA 4M6NL 4B9IA 2HJFA 4CVXA 4KQ0A 3RWIA 2GC7C 2CALA 3WS3A 2CGRL 1V54B 2DQHH 3H3PL 3PWUB 2ENQA 4ZQKA 5DEZA 4FZEL 1E27A 1YEEH 2EIDA 4G6AC 2OSLB 4LO9A 5CHNA 3SOBH 2A74B 1NGWA 4U6VL 2IAAC 5E1AB 4KKRA 2WVVA 5FGBC 1MJ8H 4MAYB 1HHHB 1QSFE 4HJJL 2R83A 1M2VB 2R1XA 3VQ2C 3L3JB 2C1PA 4ZMOA 3ZJAA 5I5MA 5AVXB 3KCPA 1VEOA 2XC8A 4LOFA 5FYLH 4EIBA 3D85A 5E9AA 4MA8L 3FUNA 4UIMB 3TJHD 4EJ1C 4MMZA 4FXKA 4J8RA 1ADWA 2R1YA 1J8SA 3NA9H 3P3TA 3PLYA 1SVCP 1JWUA 1JPEA 1N9PA 4JM0A 3LQZA 2TSBA 2ISDA 5FO9B 1I8LC 1EHXA 1KCBA 4BJLA 3DX9A 3V5HA 4J23A 1Q0YL 3EBIA 1UXWA 3OMIB 5J89A 5LGJA 2PF6A 1T1YB 3ZO9A 5T3XH 3W5MA 2QKIC 1KXTA 2OXHA 4LCIH 1O7SA 4NBZB 4UILL 3AWEA 4HIEA 1XSOA 5I1IH 1VCBC 1P5UC 4R5XA 3LZLA 1C5CH 2BSCA 3KH3A 4AIEA 4WTZG 5LWYH 4YDLC 4PJDF 3V79C 3TV8A 4YSRA 2G9HA 4AEIH 3RUGB 5DTFA 1J48A 4WHTA 4XGZB 4PJHF 4XO8A 4F8TA 4XNAA 3SIKA 3V6OE 3S36H 2WTOA 1NC2B 1PDKA 2A77L 1DQIA 3D2UB 3R8BB 1VERA 3LQAC 1HKLL 4KQ4L 3T3MF 5F9DC 5J6HA 1KGJA 1OHQA 1JSYA 5E9DB 2ZOWA 5KSUA 4YC2C 3L7FB 4JUSA 1AQKL 4AGLA 3WY4A 1NOLA 3GMOA 5E94A 4DVRL 1B0GB 2X70A 4LE8A 4NSKA 3QQ9C 3D4GA 3B56A 4UTBL 4WI7A 4HUUA 3ROOB 4Y2DB 2PYEA 2HG5A 3LPFA 3MRJB 2BCKA 4K71B 1HEZB 3QZLA 1CLYH 3DXAD 2PCYA 1FHGA 4TLTA 1C9SA 1I9RL 4U6HB 3WLWD 4BSVA 2OMYA 1VGEL 3X14A 1SN0A 5EFIA 3L3DA 4K7PH 2D2CC 4XN4A 1KBGH 1B0RB 1PLGH 1R3LB 3R4DA 5DVOA 5EWIL 5F89B 4MAUL 5EU6E 4JKWA 1OTSC 4PCTA 2NTFA 3RAJL 1BBDH 2QDVA 1KJMB 3E9UA 3VB8A 3NTCL 4RMQA 2IWKA 4AQAA 1R3KA 3MKKA 3T9WA 1K5NA 1TR7A 1X5IA 1VIWA 3MRHB 4WFFE 5DD1L 4Q97A 5TQ2H 5HVFB 5C70A 2R29A 1ZVSB 5DEJA 1UWFA 3RTQA 1H8OA 4IIZA 3Q7JA 25C8H 3US9A 2UXVA 5EZOH 2OCJA 3O3AB 4FNPA 2GJJA 2Q76B 1MG2C 2CA4A 4LHUB 4ZMTA 1ZJBA 3C6LB 1P2CA 1PMYA 3MLRH 3BP6B 5EBMA 5DVPA 4AUYA 3NCBB 4QRQA 5F1IA 2R2EA 2ERJC 4NQVA 3EFDL 5FAAA 3SN6N 4W68A 5IF0B 2NNCA 3E7JA 3X17A 4OCMC 2D73A 4JCLA 4FA6A 3MLZH 3QPXL 3TH3T 4KRMB 4LNRA 4F2FA 1WIPA 5EOTB 5HDRA 5FO8B 3D87B 3WL9A 1QBBA 4OI8A 1Q0XH 3V5KB 1BXUA 3GSRB 4JHVA 2PYFB 4CMHB 1GTFA 2Y6SC 4DEUA 1SBSH 1F97A 1P4LB 1UA3A 3ENEA 2O6DA 3QCVL 3QIBB 4MDJB 5E2WH 5HI5D 5ADPL 3HB3D 4CBZA 5HDWA 1VEPA 4TLSA 2WGXA 3NN8A 3BEVA 2RAMA 2JB6A 4WK4B 35C8H 3ABMB 2XTJD 3GSWA 2PKDA 5EEVA 2DIJA 2CWRA 5LGHH 3FOLB 1HI6B 1NUFA 4OLUL 2VC2L 5IWLC 4N68A 2HG0A 4R4BB 4QD2E 5F1NA 4TUJB 4EDWH 1VFBB 1KXQA 3T2PA 1EEZA 2O5XL 2FO1A 2WBJD 3KEHA 3D39A 1V7NL 2DM4A 3CFCL 3RWHA 4PJDB 1MWAA 4E5XG 2BNUB 5DRWA 1THAA 3ZLQC 4JZOB 5EZLA 3RWJB 3TCLB 2BIOA 5T5FL 3V0HA 1DEEB 4EZKA 1L7TH 5D2NC 1UACL 5KVDE 3S5ZA 3T3MB 2GTWB 1SXZA 1DO6A 1S7VB 1WFJA 4ODVH 3KM2A 1U36A 2ICWI 4DKEL 1ZCRA 4L4TE 1U93A 3FO2A 2BNQA 4RRPM 4EZMA 4IK7A 43C9A 5KBLA 1TZGL 2QPUA 4XCCL 4ZFFB 4AKQA 4NWUL 5FO7A 4YFLF 3WGVB 4MJ6A 2OTWB 2ZXEB 1ZSHA 4G1MB 3F7RA 4NO0D 3QXUA 4W6YB 4X4MA 2DRUA 4HAKA 4KX8A 1RZ7H 4Y5YA 3RWFA 3E1F1 4IDJH 2HRPH 2X4PB 1C08A 4IHOB 4AIOA 3WEBA 3MCLL 4HISA 1J0HA 5MI0C 2YUWA 2I9LA 3N55A 1EA9C 4XMZA 4R9HA 1ASQA 3GHEH 2VKWA 1X7SA 4P3CL 1ZHNA 4IIQA 4OLWH 1PU0A 1MXGA 4UAHA 1S78C 4P9HC 4KK9C 4D7BA 3UJTL 3IT8D 2VLJD 3REWA 1CF8L 5EG6C 3MTRA 3V9EA 2CHDA 2NUPA 3QORA 5IB5B 3H55A 2NY3C 3OJVC 3QXWA 4B60A 1AY1H 2HCZX 3MLTB 5GJTH 4Q0XH 4AQ8C 3O2VL 5KANI 4L3EA 3JTSB 2W0LA 2N3JA 5KZCB 1D6VL 2VISA 5DQJB 1F0LA 3DO4A 3L4YA 4U3SA 2FLBT 3N9GL 2W0PA 4ZT1A 4IRZH 4AEFA 1ZDSA 3MRPA 2H2PC 2JQAA 4A63A 2KI6A 1I1CA 2L8AA 5KEZA 3KPOB 2F5BH 3MRMA 1K6QH 1MFBL 1YN6B 3B7TA 1GRWA 5GISL 1KXHA 1PGRB 5F2FA 2DLHA 3BESR 3DX0A 1F4WH 4OJFL 4YLBA 5J8OA 4NQCE 1XR8A 4G9FE 3FO9B 4FYSA 5AALA 5HHQA 4Y4HB 3V52L 2MNWA 3L3KA 4WI9A 5BRQA 3FCTA 5DRNB 2GAZB 2F18A 3CVIL 1S7RB 4K5LA 2VAAB 2WXPA 3ATAA 2VN6A 1OCRB 3QUXC 1T7WA 4AV5A 1A2YA 4QLRA 5IQ9B 4WUKH 2LU4A 3S5LB 1EH9A 3N1GC 4L29A 3STLB 5B8CB 3SPCA 4GRLB 5ABZA 3FZUC 4OZFH 4J4PD 2I7SA 4UQDA 2QBWA 4D9QD 4YX2L 1EFQA 1ZVHA 4HJGB 4JJ5B 4QHLA 3GDCA 5AD0A 5T3XE 1OD7A 3NSXA 3SDDC 4Y16C 2Y5TA 4OZGE 2MHAA 4WW1B 2G5UA 4PHXA 4XNUH 1OF2B 2OMXA 1QPXA 2Q87A 4D8PA 5BVPL 3U25A 1M1XA 2KC0A 3GO1L 3KEDA 4K3DH 3P40A 5C0BD 5D7IE 4LRIC 3I02B 1FO0A 2GYSA 1VFMA 3EFOB 3NJGA 1NC4B 2DQJH 1ADQH 3RDTB 4IHBA 4HWNA 2CLRA 2D31A 4FGMA 1TXKA 4FQQB 4MBOA 1IGCL 3EJCA 4RZKA 1Q9OA 1ZGLA 4X8GA 3CDZB 2VN5A 5E1HB 2D7QA 1TPXB 4N0UB 1ROCA 4L3AA 2VM4A 3L2NA 1JGIA 3BPNC 4TRPL 4HCRL 1KCSH 4U6XA 1ACXA 3LPPA 4MBRA 5J13B 1IBBA 2A4EA 2J1ZA 3OBAA 3BAWA 3BH4A 4N8CH 2CRIA 3A3YB 3TYFB 5CEXA 1FZMA 3H9SA 3ZIMA 3QWRA 1AR1D 4ELME 2ITDA 4KI1A 3VB9A 4KZDL 2FX8H 2UYLB 4WWKC 1RZKH 5CBAA 1RK1A 5ANMA 3MJ8B 4TQ8A 1A4KA 3IBEA 4TNWK 2G0KA 5EIIA 2HT3C 2EKSA 2MQGA 3ARSA 3ZHDA 3DKHA 1I53A 3GS4A 3CN0A 5JW4M 5D9SB 5K9KA 3DUSB 5DUML 3CQQA 1BVNP 4NP4L 1JAEA 5KAQG 2OP4H 1F1DA 2BWIA 2HLEB 1GY2A 3G6DL 1SNRA 4KO9A 4PCKA 4YUEH 3TIEB 1DUZB 4G8GB 1QW9A 2YD1A 3OKKB 2I69A 1F4XH 4JRYB 4TTGA 3TESA 4IBUA 5TDNB 3J2PA 5JHDE 1A6ZA 1OGAD 2GSMB 3R0NA 3NSYA 2JLPA 4NC2B 2RFXB 4HC1L 5JDSB 2W38A 2BNRA 1WF5A 5TH2B 1MRCH 3GUTA 1N5YH 5ISZD 4AEHH 2FJGA 3LXUX 4Y4FA 1FSKB 2CK2A 5HI3D 3ULVC 3O6MH 1FFPB 1NPNA 5AG9A 2DYSB 5F9WC 4MCMA 1HAUA 2O30A 1EFXA 2YR3A 2E7DA 1NGZB 5EF0A 1BFTA 4MD0B 5HHOB 4DQOL 3NA4A 3ESPA 4E41A 2DM3A 5FDYA 3FT4B 3WIAA 1WBXA 3UTSD 2UY6A 4P4RB 3GT6A 3HMWL 2NNXA 5FKPA 3U7YH 1JGVH 1JI2A 5F7DB 3EKCA 3SQOH 3WKPA 3ZDZB 5CZKA 4N2CA 1ZE3H 2HJFB 1U8HA 4DGWC 1K9TA 3KG5A 1LEKB 4M62L 2CAKA 3PP4L 4P46B 4QCIA 3IXAA 3NACL 2IADB 1TETL 1NGXA 1F90H 1OE3A 2GUOA 3CUPA 2X0VA 5BQ7A 4JRFA 4LBEA 4N87A 2CBTA 3U0PA 4YDIH 1DSWA 5KS9E 2FGWL 4PY7B 1XH2A 3NYKA 3UEQA 3LH8A 2ATPB 4X9YA 3SPVB 1OCZB 1WP6A 2C1PB 4TQPA 2DN7A 4BSWA 3CZLA 3FUKA 4NC1C 3VXSA 4S1QL 5DUPH 1BMWA 3A6BH 4M7JH 2HFEA 4OZIF 1QZ1A 4PJ9A 5IM7A 2W9EH 1WFMA 1IGFL 3AFLA 2B4CL 3IMTA 4J8RB 2AK4B 4KVNL 5CZXD 4YHLL 4YLCA 4OVVA 3C09B 3QA3B 4AMWA 4OCSH 3O3DB 3WS6A 3A22A 4JPWL 4XR8C 4AQ1C 1IM3B 2JE8A 2YEZB 3DX9B 3MRFA 3MNVA 3ASNB 4GIAA 1DQML 2HFFB 2ADYA 3U48A 1OAKH 2P5WB 4WTWA 4NBXB 1NMBL 5BV7B 4HWBH 4L3FA 4A66A 5F9OL 1L7IL 1QSFD 1WHPA 1AO7B 4U6YA 1WGOA 1DQLL 2IAMB 4OJDH 1J1XL 4M43H 1XIWB 3ET9F 4BM7A 5LBSL 3BN9D 2XWTA 2J8OA 1SHMA 4WHTB 4LPTA 3BP4A 4PMEA 3WNIA 2BOCB 2IPKA 3LTVA 4E36A 3TVMA 5L8LB 4X9GA 4A6YA 4QLWA 4HKZA 4JFWA 2OJEB 4U31A 1NPUA 1B3IA 3MO1A 1WBYB 4MNHB 2DMCA 3DK2A 5KSUB 2B2XH 4Z7WE 4UWQB 2GITA 5IZ7A 5K39B 5AENA 3A6CL 1H8SA 1TVHA 3EFFA 3FCUB 4PLJD 1CGYA 5E94B 4X0KA 2VLRA 4TVPD 3G04B 3LXAA 5EA0L 1IO4C 4BFEA 1OSPH 1IGJB 1JD7A 3S3DB 3U9UA 2OYPA 3K4ZA 3MV9B 4H8PA 1K3ZA 3X14B 5EFIB 4HPHA 2NY5L 1WO2A 2QTEA 2IDTA 3H6AA 4OUOA 3EYSH 1NEUA 4CSZA 3D06A 2DWDA 3FTZA 4N2DA 1LP9B 4MNQE 1TSRA 1RUAL 4I0KA 2JKIS 4A67A 3DWTA 3E38A 3B9KC 1RZJC 3FQUB 2WXJA 5BRZE 2YARA 3KYAA 4GXVH 4NO2A 1KTKE 3KPRE 3VXRB 8PAZA 2W65A 3D6GA 5IT2H 2W5PA 2RA1A 3E0GA 3OAYK 2X4RB 2IQAB 5AYQA 2Y24A 4NKIL 5GGVL 2MMXA 3MFFB 3UCQA 1PY9A 2D8KA 3WXVH 3T4AC 4JDVA 1B0WA 3SGEI 2Z4QA 3LMJH 5FUOH 2FEJA 1YMME 3OPZH 1HZHL 1FJ1A 3L4VA 3D25A 1EO8L 4J3OF 3S98A 3VXOB 3SDCC 4G7QB 4PB9L 2HT4D 3E9TA 5ECGA 3WY2A 1DFBH 2YD0A 3OHXA 3OM3B 5D1XC 5EU6D 4YHMH 1NMAL 3SPHA 5C6TL 1AI1L 5DK3A 3BKML 4PGJA 5FCUL 4WFFD 1O5DT 1MJ7H 4XODA 1H0DB 4H0GA 1XBDA 2AKRB 4K9EC 3ZDXE 4EN2A 3C6SA 4W9KC 4ZMPA 5C0CA 2HWZL 4IOIA 1M42A 1TZAA 1V3KA 4QGYA 4GYBA 2IH8A 1DBKH 4IJ3B 4AVJA 4OZIB 4JFSA 1OOAA 4MCYA 1HDMA 2QDWA 4JN1L 2CO6B 3DI2B 4LEOB 1TO4A 5DFVD 3WBDA 4MXWL 3GBML 3EH4B 4NENB 5T33H 1YRKA 3CSGA 4PJAF 4E9SA 4AVIA 5ELIA 3VH8B 2NXYB 2FHCA 5F71A 5GZNA 3VTTA 3L3IA 1KYOK 2FH8A 1IZJA 1P9MA 2FWSA 5C8JA 4OFPA 3ZZ1A 3IXTA 2EEFA 2UY7A 1ZS8B 1HXYB 2CM6A 3P4LA 3CBRA 4B7LA 2JJVA 3WJJA 5J1AB 4M5YH 3D39B 1E2VA 1FL6B 1WT5C 2IGLA 3EGSB 3QIWA 1FNLA 1T89A 2X4TA 2ZKHH 2VRAA 3U4AA 4K7PY 5L9DH 2YBRA 3GSQA 4OQTH 2VJ8A 4ZFZB 2WM0A 2OCCB 2W9DH 1PG7H 5IB2B 3H3BC 1G9MC 4Y19D 3AROA 1E6OL 3I74A 1I1YA 3HN3A 1U42A 1X7QB 4OVUA 2W92A 3KVPA 3SYOA 3HNTH 5I1EH 1E4KC 2Q2EB 4EI0A 4MJ6B 1JHTA 2VLKE 4B6ZA 2I07B 4HX1A 3IWVA 3CZFA 3BQUA 4BKSC 4K0OA 1C5DA 3S96A 3F2LA 3W57A 5IVXB 5TD4A 1IAIH 4QRPE 3QAZC 2FWUA 4CA4A 4A2FA 1VLXA 1F18A 4IIQB 1NZRA 1IGYB 3RGVC 3DJ9A 4QRFA 1S7SA 2F53E 4GAGH 2FDBP 4PJ8A 3SQRA 1KFAH 4FABH 3T1WA 3HKFA 1D9KC 2P24B 3AS3A 4JRXE 4M7LL 3V5DB 3LD8C 5IBUG 1EV2E 2XKNB 3UABA 1JZ4A 4LSRL 4UUJB 5IHZA 2ZSVB 3FRPG 3QDJA 1KLFB 4XXWC 4GRMB 5HYJA 1DEDA 3AY4C 3BE1L 4AZUA 3SKOA 1JZ6A 3FT3A 2CJUH 3QVAA 3FQWA 2BDNL 4EKJA 7PCYA 3B37A 1NFAA 4LZKA 2VISB 5KG9A 4FFWD 4KROB 3E3QC 2EADA 1W9XA 4JEGB 1U8PA 3FB5A 5GS3A 1KT2B 2ZAIA 3DX8A 1MXDA 3HMXH 1BZEA 1FH5L 3LHPH 3D7PA 2WLNA 5DMJB 3GGWA 4QRRA 3I6LD 2CBQA 3NGBB 1C12B 43CAA 4NQDA 3JYCA 4ZI8A 3QI9A 4DEPB 4U1KB 1QA9A 3M6DA 2PP7A 3MV7B 4Z3HA 2A6IA 4LCUB 1D3CA 4U1HA 3UEZA 4LL4A 4HMCA 4P2RD 4DTGL 9CGTA 3HA0A 3N5AA 2ZOUA 3EDJA 3C12A 3CSPA 1TLKA 1PCSA 2J7LA 2P49B 4F8QA 4HUVB 4PWEA 4JB9H 3I9PA 5EF2A 3QUGA 4AH2A 3CPLA 2JH2A 4AQ8A 3ELAT 2OXGA 3ABKB 3OR6A 2KMWA 1YYML 1OB1A 2UZXA 4FLQA 3PGDA 1WISA 1MCLA 3C08L 5AUMA 3U1SL 3AJ7A 4BZ1L 1HXMA 4XC3H 2YUZA 3VDAA 3BUYB 4NM8H 1CL7H 1WA1X 3TO4A 4L1TA 5E2UH 2ZPKH 3GXDA 5F88B 4PJAB 5DZVA 5E9DE 4U6TA 3QDGB 1C1EH 5FKAB 3FPYA 1BAFL 3QWQB 2J43A 1A6AA 4KFZC 4ANWA 4Y1AA 2WBWB 5ADOH 3CAFA 4G9FD 3ARBD 3HHMA 2ETWA 4U1MB 1GS6X 1OAXL 4PJGE 4S0SD 1M1XB 4JFEB 3H3KA 4B9GA 4L4JA 5AW8B 1PYWB 5FYLD 3D3VB 2JJSA 2AJ3A 3HZMB 2H0EA 2AQQA 2DTML 4LSVH 4LPCA 4OLEA 5L0QB 2BIHA 2D31B 3A4AA 2R2BB 5ICYB 2P48B 5D93C 1U8NB 2D3NA 4JZJA 4J28A 1A47A 3LEXB 4O2FA 5ICXA 3VCLB 2XN9B 4WFHD 1L3WA 2V17L 2JKJA 4JG9A 2GEQA 3U79A 5T3XD 3ZR5A 2J57A 1Y1UA 4Y9FA 4N3TA 3AITA 1T0PB 5DD5H 4NUJA 4CC4A 1EERB 3SKNA 4Q9RH 1NFDB 1J9CT 4QRBA 7FABH 2KDGA 1O7DC 3ARFD 2NY0D 3AQDA 3NJKA 3VFWA 3GMRB 3MLVL 2FK9A 4QR7A 2FQEA 5SWSA 2OULB 3I85A 1KF9B 4P5MB 3RWGB 1MJUH 3STBA 1ROWA 1IGIL 4C56B 5DA4A 5CBAB 1NCHA 3CDFA 1SOKA 2AANA 3QEHB 4ZMYA 5C07A 3S4SG 4YK4C 1EHLH 3Q8AA 2J12B 3BGMB 4G3YH 4HMDA 5DJAB 5FO2A 4PRNB 3FL7A 4L05A 4KKBC 3GB7B 1E42A 4YFLI 5FOBB 2EINB 4GW4B 2J5WA 2R23A 1INEH 2OMVA 1PX4A 1A9BB 2YXVA 3CN4A 3K74B 3PUUA 1W0VB 4KAQL 1CICA 3TA3D 2CHZA 4U1SB 5EO0A 1GZHC 2QR0B 2CM5A 4DCQA 4EIZC 2R8SH 4PW3A 3RVVC 4HIHA 2ZXCA 1A3QA 3HG1A 2VDML 2DQFA 3KLQA 4ICWA 4X4XB 1ZRUA 2RGSA 3IN2A 1U3HB 4OQ1A 4XHJC 1D7BA 5D2LB 3UZVB 1P7HL 3HZVB 1H3PL 2HVBA 1DVUA 2MCG1 3HZYB 5I1CH 5KVEL 4RWYL 4HHAB 1TJIL 5LXGL 4ZFGL 3I50L 4M4RB 5AAWC 2OW6A 3NRPA 4N25A 3D0LB 5AZ2L 4WI2A 4RETB 3AVEA 2MOVA 3SE8H 3I84A 1XH1A 4R90H 4ZO9A 2V2WA 4RBPK 4BZ2A 4HWEH 1YVLA 2CLVA 3QJHA 3O9WB 2UY6B 3FJTA 4HH9A 3ECBA 3GXIA 4MQ7A 2QLYA 1WTGT 3HS0B 4OTXH 2IDSA 5CKGA 3VFOB 4PJDE 4FZ8H 2BWQA 3PWPA 1CQYA 3HI6H 5A40E 5I2IB 1IAOB 2XX1A 1DVFB 1XZ0B 4PJHE 4Z78B 5DSCB 3SDYH 1EVUA 3N1FC 2AJSL 4M7LT 4X0NA 4I3SL 1NGXB 1BECA 1RXLA 3MGTA 4JO4L 5B21A 4MA7H 5AZEH 3T3ME 4KI5D 3SY6A 2YA0A 3O4LD 1ITBB 1IL1B 2V37A 3QEQB 2UXGA 3T2NH 1NCWL 2EDLA 3O3EA 1PCXA 4KVCH 1VACA 4WNQA 4XNXH 1T6WA 2G3NA 4JM2C 3MRIB 4IBZA 1MRFL 5DHEA 2F19H 4IS6B 4GW5A 4JAMA 4PJ7A 1BJ1H 3MRLB 1JL8A 4RMSA 5I1HH 4C4BA 4GINA 2YRPA 3CPUA 3KPSB 3PFUA 1FLTX 1MVUB 2OR9L 4HS8H 3T6QC 1RIHL 5C9JB 2ARWA 4XMLH 1SHWA 1T7XA 4OU3A 1Q1PA 5D7HA 4DFIA 4XBPA 3FFDB 5FUZL 1AC0A 3FFCB 2A4ZA 3DJRA 2P8MB 5IUCA 2GTZB 1XD0A 2IH1B 2WB1A 2DAVA 4QO1A 3DC0A 3THML 1SMOA 3EDDA 2IOOA 5IG7B 1OCOB 5LN4A 2Q7YA 3CXFA 1QQDA 5MERA 4FMKA 1OTUD 1G7PB 5LXVA 3KPMA 5F7LB 1G9ML 3IE4A 1KPUB 5CLZA 2HPOA 4HJIA 5DJ6B 1BGXL 3D2TA 1JPST 1MZZA 4TVSa 5JW3L 3NJFA 4JCMA 2F7QA 4H1LB 3CFEB 3QUKB 4L4VE 4NNPL 1HHKA 1WC7A 2F7PA 3OC5A 3WJMA 1G6RA 4A6YB 5I1GH 4LEXL 4M5ZL 4D0CA 4IRSC 5BZDA 2KERA 4N2IA 4OUUA 3VXTB 4XI5C 1RMFH 5IFHH 4XT1C 2A7BA 2I9TB 2XZAL 2PPFA 5JUEH 1JRHI 4Y1SA 5IFJB 2P3YA 3TNNA 3QJSB 2QKIB 3NP3A 4KXBA 5DEGA 1HIMH 3C9NA 4ZMVA 2EDNA 2JVUA 4LT7A 2HFGH 3TXAA 5JHLA 1P5UB 1G7HB 4OIIL 3LH9A 2W0FA 3TBTA 4YDLB 5I15H 5E1GA 3P30H 1FVDA 3EYUL 4FXTA 3LV3B 4O02L 2QSVA 4OFIA 4UV7L 3WTXA 4OZ4A 4RDQF 3A4FA 4AGOA 3RDJA 5JIMA 2WKLA 4ZMZA 1J8HB 3BAIA 4GMTH 1E4XH 4OF7A 3X3FH 3GEFA 1QRKA 5LN8A 1FVCA 3L4TA 2W65B 4QYOA 4EOWL 1J1OL 4X6CE 1S2EA 5HHVH 4RLDA 3DECA 4YC2B 4YWGL 3ZPDA 3FU9A 4JDEB 3GRWL 1KIQA 1FGNL 2UZIL 4UQ2B 4JDVB 1P69B 3DTUB 4LASL 3GBNL 4URKA 5H35A 1KIPA 3II2A 3WHXA 3I3BA 4HW6A 4WGKA 4F37K 4W4NA 4WK0B 1HT6A 3MLXL 3SBWC 3EIFA 4BH8A 1D5XA 3MJ6A 1WIUA 3DHPA 5D1QC 4MNQD 3W9DA 3LIZL 1GJWA 4HKXB 3LY6A 3ARQA 3MX0B 2VH5H 3VXME 4POYA 3TJPA 2QGCA 1MFCH 4N0UE 3LRGA 4ZUTB 1QO3B 1A9VA 3KPRD 1BLIA 3EOYG 3BXNB 1EWHA 3LRKA 2DOCA 4U7MA 2DQCL 2XZQH 4HUMB 1A6WL 2Z93B 4HWUA 1Q94A 2FO4A 3C6SB 4LOUC 1FDLH 4MKMA 4PV8A 5DYOA 3PHOA 2ZCLL 1IAKA 5LCVA 4PBDA 1LE9A 2VO8A 2Y06L 2ED8A 1EJOH 4KK5D 4ODWB 4ZK8A 1LEIB 3T0EE 2F6AA 2IANE 4B5ZA 1N59A 1FYTB 4Y5XA 3KLHD 4NLAA 5I82A 1XF5B 2ERJB 3ECWA 3QR1A 2UV3A 4B9CA 1OP4A 3V55A 3OGCA 4HPOH 1JHKH 4ECNA 1DBMH 4QOKD 1UJ3A 2FJUB 2PWHA 3QJRB 4ZFOL 5C8JB 5JLZB 1CXKA 5H37H 1FN4A 3RG1C 2D03H 4PRPB 4AUJA 2N7SA 1AZUA 4YSQA 1KG0A 1UOKA 1MW3A 4MNGE 5KVGH 1SDAB 2EC8A 1I8KB 1WD9A 4JRYE 1FAIL 1IFHH 1DVXA 2ZZUT 4WTXA 1UCBH 5DZ9A 3W1ZA 2XFXB 4PRAA 2LFGA 5FLUA 1BZ7A 1NQBA 4W4OA 5GSVA 1DQJA 4TQEH 4U4BA 4ENEC 4ACTA 5IV2B 1BQRA 2DJSA 2NCMA 5LAPA 2ZNXA 5CCJA 4FQ2L 4RA0C 4S1RL 3MBWA 4ZTEA 2BHZA 5A3IC 1ZLEA 2V3EA 4RAUB 5HHOE 2ZXWB 4DO5A 2H2SC 3VD4A 3QCUH 2PPCA 1UB5A 2A9ML 3AGVA 4KQ4H 4YHOH 1AS7A 2AEQL 3LEYL 2EYRA 3MUGA 5D4IA 3BKCL 3VWKA 3CSYA 4YAQA 1Z66A 2WQUA 1PD0A 1J1PH 2OJ1A 5HD8C 2B59A 1PZDA 2W60A 4J3OH 1N19A 3HBGA 3L5WB 5KSBA 3BZFB 4B3VA 2JQMA 3KXFB 5B4MD 1T21B 4H0IA 5BS0B 4FADA 5GJSH 2K4AA 5E08L 3OLEA 2CPCA 3IJEA 1I75A 2OYLA 3MUHL 1PKOA 2QSCL 5D2NB 1OHZA 3INUL 5DO2C 1BVNT 3QDJB 4X5XB 5HYJB 2Q6WA 1YEKL 1B2WL 1BBJB 3HN8A 3UTQA 1N0XL 4I7ZC 4MAUH 2H7WA 2DYPB 1A6VL 1JNNL 2VLKD 3V4VB 4LLYB 4I87A 3T8VA 1XCTB 4AENA 2D9QB 5TFSH 1QEWB 3IFLL 1A14L 2A1WH 3OSKA 5F7WC 3BH9B 3OG6B 4JKPL 5E03A 1YEHL 3CU1A 1JGDA 1L6XA 3B1TA 5MI0B 4QXGH 4OIBA 2DWXA 4J5VA 1K4CA 4FLHA 1I1AC 4PRIA 4M8UA 3MRDA 1CE6A 4LLVA 4RH4A 5HY9A 5BMFH 1F3JA 2X0WA 4ODSL 5B7EA 4XP5L 5JOFB 4JNXA 3DGGB 2E6QA 2Z6FA 5CLXA 4GSXA 2NR6A 3P11L 4MAYD 4FQXA 4YHIA 5G4OA 2JI1A 5DK0B 3V6ZA 2VZSA 3FF8A 3RJDA 3AQYA 4XXWA 3O6KH 2NY3B 1EHNA 3RKDD 3AY4A 5IHWA 3EFDH 4UM9A 1DUYB 2BP8A 5I0WA 4Z5RB 1XR9B 4X8XA 1NLBL 1AFVL 4WLCA 5JIQA 1OEZW 4XWGL 4ZD3L 3WNLA 4YBLC 4XCNA 3HHSB 3QQDB 1MCSA 3MUZ1 1LO2L 4BDVB 1MCDA 1A7NH 5EPMB 4KKZA 4GG6F 1IKNC 1ZK9A 4PP2A 5FFGA 2F9BT 1HINH 4E42B 3H7LA 2A0LC 2AMUA 2DKUA 2PTUA 3BD5A 2B77A 2ITCB 3ULVF 1CCZA 4AGQA 3GXTA 3IEAA 3N43F 3TP4A 3CSBA 2KZBA 2C1OA 3S36X 5HGDB 4FMVA 1B0IA 4H88H 3DRQB 5D7JC 1K8IA 4NT6A 1J7VR 3EXLA 3T8XB 2OCFD 1ZS2A 4KDTA 1GS7A 1SOXA 3CZJA 5I23A 1HZLA 3DMMB 2YD7A 4OGXH 3QUXB 1KTBA 2A73A 4XNZC 3UO1H 4J3VA 3VFUB 1MNUH 5CEZH 2JMRA 2QADC 4JPQA 5I0YA 2B1AH 2PO6C 3JV4A 1NC2D 3D2UD 2F1BA 4KTEH 5AOMA 2PWGA 1AG6A 5KYXB 3OXSA 1A3LL 4GIPD 5DQ9B 2X89A 1Q72H 5E9DD 5CSBA 4MAZA 1JPFB 3VXRE 4K7PX 4AL8C 4GUOA 4NM4L 4FX5A 1D5BB 4JO5A 3ZRFC 3QRLA 1RSYA 2MTPA 4NUJB 3SDDB 4Y16B 4U1NB 1SFDA 3JUZA 4UT6L 5T5FH 3TTSA 4Y2DD 3V4PL 4DN3L 4CC0A 4XNMB 2KHAA 4JM4H 1T2QL 4GI8A 1CBVH 1H9DA 4C55A 5I17B 4LDCA 2NY1C 1FFNA 3M8OH 3QFDB 4NWUH 4P8QA 1QUPA 4MJ5A 1ZV2A 3EG9B 4CNIB 5LQBH 1JF1A 1N7MH 1A3RL 1F13A 4UCFA 4LRNL 1JERA 5INCB 3L5JA 4JHBA 3IE9A 4LKCB 3HR5A 1PLBA 1MQ8A 5A2FA 4DZBB 1KCWA 2CKBA 1A7PL 2OQJA 1PVHA 5EO0B 3BPNB 1G7MB 5AWNL 3K2IA 4F7PA 4PGBB 4GQQA 1R5VA 2IFFH 2H4EA 3FUFA 4WY7L 4AW7A 4LHUD 3F04A 1FCGA 1AD0A 4P3DA 3C6LD 1MW2A 1UKQA 2VL5B 4G8EB 4JO2L 3OLDA 5HYFA 3KYMB 1LK2A 4OZFG 3U9WA 4WWKB 2XKSA 1H3TA 4YSEA 2XV0A 5AAMA 3ARDC 2L4OA 3N0PB 5L6YL 2NW3A 3U2JA 1JMZA 1RP8A 3X13B 4PM1A 4QHNB 4V2BA 1UM4L 5HBBA 5LKNA 3N85L 1YCSA 4NAJA 3SGDH 3OKMA 1KXQE 1M4KA 3NVQA 4YBHA 5B3SB 3QGVA 3QUYA 2FEDC 3TYGH 1ZLVH 1VJSA 3QIBD 3H2WA 5IBLD 1JV5B 3D39E 1RZIA 5GGTH 2ADJA 2R7EA 3UPRB 3TEZA 1E5YA 3O6FC 2XWDA 1G0XA 1SXSA 3PWPB 4W6WB 2VDQB 3GWJA 4OFVA 4YXKH 1NIEA 1JDAA 4AGMA 3BEWA 1IVLA 2CIKB 3I6SA 2UWEF 3EXJA 3DBSA 1Z9MA 4X4ZA 4IBVA 3QUZA 1UWGL 3K0WA 2OS7A 3OAZH 3HLKA 5EU5B 3SDXB 4GG6B 3EJSA 3NFSL 2EZ0D 3TWYA 2V8MA 4IBYA 4O2CA 4NNXB 1OARL 3CZUB 4KTGA 4O51B 1PTZA 3N43B 5F9WB 4ZBJA 4X4ME 4XPBL 4Q58C 1V10A 3GKWL 2FUTA 2E3VA 3L5XL 3NSJA 4X6EB 3DETC 2YRBA 3L9YA 4JAMB 1T4KB 1FFOB 2H32B 2XZCH 1FZJA 2FH6A 5KVGE 3C5ZC 5H2BA 2YC1B 1Z9NA 3ZHFA 4KY1H 4ZMQA 2ADGB 2ENJA 4ZUUA 2DBLL 4H1LH 2DEYX 1DVSA 3VGFA 1VESA 2XV6B 4A6YH 1H3GA 4CSPA 5IMMA 4L3CB 1IGTB 4I0PC 3QC5X 5I76A 3OG4B 4R4FL 4ERSL 2VUYA 5FECB 1J0ZA 3SQBA 1R46A 1YQVH 2NZ9C 1KENL 2SEBA 4QO1B 4ODTH 1OGTA 4CRPA 4OKVA 1I82A 1IB5A 1EHKB 1T0MA 3JVFC 2FE0A 3MCKB 1KNOB 3K1DA 3S9DB 4X4YB 4LSUL 3KPMB 1L4IA 1OO2A 4WJ5A 2PW1A 1KYOJ 3F58L 5F7HA 4MZRA 2WZPD 3M88A 2P1YA 4JN2A 4OFKA 2YN5A 2VAJA 1RQ5A 4N28A 2F54B 4IOSD 3R1GL 1KCKA 4N9OB 3OPUA 3GMMB 2FWOA 4XBMA 1CXHA 3UAJC 3LQAH 4XBGA 3FRUA 3MV7E 4AQ1B 4P5TC 4FP8L 3K80A 1AP2A 1LWHA 3LN9A 1Q9LA 5LNEA 3VRLE 3QXDB 4KZDH 3LZPA 1H15A 2A4CA 3TEUA 4ZG1A 5JXEA 5KYUB 2EVFA 3DX2A 2CNYA 3NIFF 3NSCA 1MIMH 3C8KA 1U92B 4JS7A 3NZUA 2WQRA 2ICEA 4KJPC 4TMPA 5KZCD 1SBBA 2G5BA 4DKFL 1WUZA 3AMKA 4MMYB 3EGXA 4YDMA 3QDMB 1OCWH 4HPYL 3CVHB 4OZ4B 2FATH 1TKWA 5GZOA 1CDYA 4QNPF 1CFNA 2P8PB 5MENA 4K7FA 4LL1A 4PJAE 3PL6A 1VEMA 4KJQD 4FFVD 4U1JA 3BVNA 32C2A 2J88L 2LVCA 3MVSA 1CYXA 2J6WA 5C7ZA 4JGJA 2AXGA 2D2OA 4Z0BH 2V7NB 3I2CH 4HQQH 1QI5A 5KOMC 4HDIB 5AYTA 1UFUA 4Y4HD 2MEJB 1EZLA 2Q3ZA 4R7LA 2AITA 5C2UB 5A2AA 2WWNA 4JFEE 4IEFA 2IBZX 3C5JA 3CLFL 2YOAA 1CIDA 4GKNB 1S5IH 3MFGB 3TH4T 4YHZL 5K9JL 3NFNB 3OR7B 3DOIA 4JW3A 2XQYG 4H26B 3RA7L 2ZUSA 1ZLWK 3R0MA 3G5YB 5JO5A 5E6ZA 1CDUA 1E9QA 3G3LA 3IMVA 4GRLD 5TDOB 3DBXB 1OF0A 2UWEB 3SE4C 5BXFB 2VRQA 3ZQ9A 4OGYL 3B9KB 2CK0H 4X5WB 1U3JA 4GXUN 1ORQA 1SHSA 1SY6H 2VDOL 4KK6C 1MCEA 4DKDC 4F15C 1KGXA 3AZUA 3IDGA 5KUMA 3PP4H 4JFFA 5JMOC 5FM4A 1U95B 1KGYE 3MUY1 4J3TA 1DBBL 1PAMA 2L7JA 4KXAA 4AXWA 3AG2B 1TETH 3L5IA 1MWOA 2FJSA 4J27A 4YGVB 4HKBB 1SHXA 3H9SE 5IHHA 4Z77A 2UUDH 1IAKB 1J5DA 3T4AB 1SJEA 3U2SA 2IDUA 5MEQB 5GSRB 1LE9B 4KK8C 4YDJA 1F5WA 4LCYB 2EUXA 1MCWM 1FPTL 4X7FC 4C56E 3RDTD 1NC4D 4UTBA 2J5LC 4XBEL 1A1NA 4WFGE 1TZHA 5CWSB 5ANME 1FNEB 3RWDA 5CEZE 5LGHL 5CN1A 3SDCB 5ESAA 3PRZA 4HBQA 4F7MB 2XPZA 2COQA 1BZOA 2WLIB 4HF5H 5D1XB 4Z7NB 2BSRA 1RZFH 3QULB 4OSUH 3PDOA 2NLJA 1QR1A 3DURA 4M02A 1U9KA 2G30A 3DNKA 3FH7A 2F08A 3ZKMD 1SOQA 4LHUG 4GAFB 2WAHA 2V2TA 3QHZH 5BUAA 5LBGA 1YEDA 2ENPA 3NZHL 5I0DA 5IJVB 5TE6H 1HL9A 3BFQG 2DIEA 4MJ2A 2FGZA 3TF4A 3IDYC 2E9IA 4P2OA 4X6BB 1ZMYA 4PUBL 1FLRH 3QDHA 4PW4A 3TPUB 4B50A 1W6WA 2BVEA 4LP5A 1OE2A 1QFHA 2BNRE 5MP6H 1DQLH 5HYQA 1RL1A 4Q9QH 1KCVH 2R4SH 4FNLL 4W9IC 1VKXA 2EDHA 2AQSA 4R8WH 5AOLA 5F1KC 1ZVYA 1IC1A 4PR5A 5CGYC 2EXSA 2WO2B 4E41E 2YMTA 2OX5A 4AIZB 2CLZA 3CTTA 4PFEA 2WXLA 3V4VH 4JFHD 5E24E 3NIFB 1LDPL 4J3UA 4DJMA 4F93B 3C87A 4L0PB 1GHFH 5FOJA 3W0WB 4G8GD 1B9KA 1N4XL 3X1GA 4R2GC 1G7IA 4I2XA 4BFKA 4JRYD 3A6CH 2W60B 4LPWA 5C0IB 1M6OB 1WFOA 3WG7B 1JTOA 5M95B 4RGMC 2VKXA 1NCUA 2X2IA 2R0WH 3IJEB 2GY5A 2P5EA 4L8DA 4ONFH 1ZT4B 2NXZC 4RWHA 2CGYA 4P9HH 1YY9C 5D7SL 3CSFA 4DPCX 1CS6A 1TZ8A 4UNIA 5GIRB 1A6TB 1FG2A 4KKAD 4XO4A 1H6UA 3UTQB 5HHOD 4ISVB 3F64A 5DJXA 1TJHL 3L1OL 4H8QA 2FO8A 3TBVB 3EYQC 4HIXL 3VXSE 3ZO0A 4NZTH 4Y4KC 2IXQA 1CFVH 3QW9A 4V1DA 2DLIA 1XL6A 1RFDL 1R4XA 1YUKB 2OBGA 5LUMA 5PAZA 1KB5A 1JGDB 3L9RB 3CWGA 3MJ7B 3FHAA 4JFDA 5L2KB 4P46D 1T66C 2HLAA 1VGKA 3LKNB 3U30C 4FNTA 3FQNB 4B0MB 4FYTA 3FFCE 3RGVB 3NQIA 1F3JB 4PTTA 3U0TA 1BMGA 3NCXA 1D9KB 3DO3A 4M61A 3IDXL 3LD8B 1NUGA 3QHFL 1T3FA 4XPHL 1NDGB 2X4NA 3FSOA 4EIGB 3QUML 3U82B 2JKNA 4YSUA 5C0RL 3V8CA 2BP8B 2R0ZL 3OL2A 1P7KB 3VI3A 5DFAA 2YD4A 5DURB 5DZJA 4PYGA 3GI9H 2NY2C 4FTVB 3Q1SH 2J8HA 2FVNA 1YJDC 2AK4D 5E4OA 4FFZL 2D3LA 2Y7OA 3CLEL 4KOBA 4M9OA 1IM3D 1MFDH 4A7GF 2F7OA 4FFYA 3ZBMA 3AMLA 2Z92B 4NQEB 2PUQT 3QNXA 1ZTXE 1SYVA 1RPQA 2P5WD 4PGZA 2VLRE 3RRQA 3GKZA 2Z31B 1BG9A 2XXGA 1AO7D 3Q2LA 2CO4A 1G7QA 2H0FA 1U8KB 5ALBL 2I5YL 4NT6B 3S34L 1C5BH 2IAMD 4PJBB 2Y7QB 2APTA 4C47A 4CVZB 1M53A 1XIWD 4NXKA 2ZCKL 1CFMA 1CD9B 5I30H 1J05A 4N86A 1CR9L 3WENA 2ZUWA 4TLUA 4NO3B 2JELL 4HKJA 1HH9A 3JWOC 3WHE0 4KUZH 3V95A 4L2LA 5C7XL 4RRPA 3ULSB 5ITFB 3ES6B 4G43B 5EDSA 4JY5H 1MPAL 3OKOA 5BJTA 2Y1ZA 3CQPA 4Q2ZB 2EO7A 4EKXA 3FONB 4GQPH 4Q6KA 2HMID 1NDTA 1OLLA 3UC0L 2FYYA 2DB8A 4GMSL 5EOCH 2C5DC 2JV6A 4OGQC 3ZZSA 2R1WA 3GXNA 3B9EA 2C9RA 4X5RA 5JIHA 2PN5A 4H5SB 1UM6L 4W9DC 5AW0B 3GDBA 3BVWA 4E9YA 3S5LG 1WIOA 2WMPA 3CH1B 3L3OC 3MV9D 4MD5B 4PJ5B 5DHMC 2HVJA 1FV1A 2WW8A 1A65A 1E3XA 2ZOKB 5E00B 4F58H 1KLGB 3H7BB 4CSSA 2QQQA 3Q5TA 4ZFOB 3BKYH 4GAAA 4KKLD 3QYMA 2WUBH 3O3BB 4J1UA 1LK3H 3ZZQA 3EGDA 4EF3A 2NSQA 1P53A 2O5NA 5FYJE 5DD6B 5D93B 3QJUB 4FHBD 4KRNA 3VE0A 2WXKA 3VXRD 3V4UH 2VR7A 4M00A 4NKDB 2APWA 3CZGA 3WIHL 1WRFA 4PIRF 2A6JA 1N68A 2X1XR 4OCRL 3BFOA 2EEAA 2WP3O 5C0CE 3N44F 4P3DB 3PNWA 1MFEH 4BFOA 5I1LB 1HK6A 4LSRH 2YRZA 2VDQH 3RL2A 2HRLA 4NQQA 3RNKA 1HYRC 2FJHA 1FYTE 1LILA 4UANA 1QFUL 4TM9A 1BG1A 2EDTA 5HGGS 4YIQB 2WXHA 1TNMA 4UBDD 4YK4B 2HJLB 1Q9KA 2ZOLB 1U91B 4RGNC 4BKLB 3SY0B 3ULVH 3ULUC 1FH5H 1MNNA 1SJHB 3MREA 1JYVA 1INDH 2ZF8A 3MXWL 4YPGB 3D4YA 5C0JB 5FHBH 3TV3L 2OI9C 1ZT7B 5E2VH 4Q6IC 5HGAB 1KPVA 1AGEB 2IWFA 4PRPE 4I77L 4L5FH 3V9FA 3O8XC 2H32H 4N8VA 3NEEA 4NCC1 3VJ6A 4HU8A 1U8QA 2WWOA 4HCRA 3QIUA 3G6AB 4JG0L 5DJ0A 3G6JA 3T65B 5IB4A 1AJ7H 1LDSA 3GEWB 5DVLA 3TBBA 2RQ8A 1NGYB 3SE9H 3WNOA 3TN0C 1NBVH 1Z1WA 3PP3K 4XN9A 5B39A 3BWZA 1QUNB 4OAWB 4E9XA 2PP8A 1JHLH 5F6HJ 4Z3EA 2EXYD 1HU8A 2BXYA 2NXYD 3HUJA 2HRHA 5F6IC 1ZHKB 2CHXA 4R7DB 5GGSA 3BLBA 1OAQH 2HUHA 4N0CC 4N85A 1Q8MA 4X6DA 3NCYP 1MCOL 2VMCA 3REVB 3KYNA 4OB5L 4OW6A 3RX8A 4YSAA 1PG7X 4H40A 1DLFH 2B3RA 1HQRA 1QLFB 1FE8L 3AREC 4F33B 4F57L 3VD7A 2Y1AA 5HHPB 3D39D 5EO9A 4ELKB 3UTZA 1BF8A 5E6IA 5E5MA 1E2WA 2EDMA 2APVA 1OSZB 1HL8A 4OT1H 3FH8A 2Y69B 3O6FA 3W11D 2PWFA 2JQZA 2ZXAA 1LO4H 1DDTA 1X5KA 1S3KH 4KJWC 4LLUA 2Y23A 1OKEA 1TU2B 4Y1TA 3BZDA 3BZ4B 3M1CA 4APXA 1IC7L 5D2NE 2VLLB 3QDJE 5HYJE 1ILSA 1S7UA 2SEBB 2ZXBA 4AKOA 4CW1A 3W38A 4BK4A 1OGTB 3BWUC 5E99H