4AGOA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5174
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agoA00
4MZRA 2MEJB 5KBDA 2ADYA 4L18A 2P52A 2ATAA 1UOLA 2AHIA 4QO1B 4LOEA 2BINA 3QYMA 3D08A 2J1XA 3WTWA 4L0YA 1T4WA 1E50A 2YBGA 3IGLA 5LGYA 3Q01A 5AOKA 1HJCA 2IOIA 5G4MA 4AGNA 3WTSA 2BIMA 1GZHC 5ECGA 3US1A 3WTYA 2RMNA 4IBWA 3IGKA 4IBSA 4LOFA 5ABAA 1HJBC 3D09A 3WTTA 1GZHA 2J20A 4A63A 5G4OA 1TSRA 1YCSA 2BIPA 2WGXA 2J6WA 4IBZA 3D06A 5A7BA 3ZMEA 3VD0A 1KZYA 2J1WA 4AGLA 2X0WA 1HU8A 4MZIA 3EXJA 2H1LM 1CO1A 2IOOA 2X0UA 3VD1A 3US0A 3KMDA 4AGQA 4IBTA 4AGMA 4IBQA 4LO9A 4AGPA 3D0AA 5AOLA 4G82A 3WTUA 3D07A 1CMOA 2PCXA 5AOJA 3D05A 3EXLA 2OCJA 4AGOA 4KVPA 4GUOA 3TS8A 4IBYA 1IO4C 2J1ZA 2BIOA 3Q06A 2BIQA 4IJTA 3KZ8A 2FEJA 3WTXA 3QYNA 2AC0A 4HJEA 1EAQA 2XWRA 5AOMA 4IBUA 5AOIA 2VUKA 2GEQA 4GUQA 4L0ZA 2J1YA 1EAOA 1H9DA 3Q05A 5BUAA 2J21A 4IBVA 5LAPA 4G83A 3VD2A 5G4NA 3WTVA 3WU1A 2X0VA 4XR8C 1EANA 1TUPA 2XWCA 1LJMA 5AB9A 2IOMA
chains in the Genus database with same CATH superfamily
4ZOEA 3QIBB 1L9PA 4UIKL 1G7JA 4YE4H 4WNQB 4ODTH 4KWUA 1ADWA 4APQA 1EJFA 1UG9A 1JPGB 1NIBA 5C0JB 4OUUB 4ABWA 3CFCL 1TLMA 5E6IC 4RGNB 1RH8A 3WD5L 4D9RD 2XWEA 4TPRL 4BHUI 5BVPL 5D1QE 3RDTB 1F41A 3MV7A 4AQ1A 4K8RH 1EHLH 4NZUH 2OP4L 5B39B 3ZYIA 3BD5A 1YPZB 1PCXA 4N85A 5GSRB 2IGFH 1OCOB 4XO8A 2DQIL 2FD6L 5EB9A 5ABAA 3VFRB 4HWNA 1HC1A 5DZAA 5EV7A 2J2ZA 1GYUA 3O2WH 5HY9B 3UBXI 4CGUB 2ZYHA 2X9XA 3HC3H 4PG9B 3LKNB 2ZCHH 1D7CA 3BD3A 2MJWA 2DDQH 3ZX1A 1IIIA 1CI3M 2GUOA 1LE5A 2YFNA 1EO5A 5KSAB 3F83A 2BLFA 3FTSA 4HGWB 1ET8A 2NMSA 4NQDB 2WIIA 5E95B 3DXAB 3RWGB 2LT9A 4PBDA 4RQQB 2FR4A 5DZ9A 5E1AB 2EILB 4M7JL 1G4MA 1VPOL 1MSPA 2IBGA 4AXWB 2X2YA 4GP4B 3VQ2C 2NR6A 5HHMB 1TTFA 1OW0A 3FFCB 4KOCA 3D2UA 4XWGH 1J0HA 2XWXA 2BXYA 1RURL 4WFHD 4U4BA 1NMAH 4JHAL 4MMXA 2I24N 2DI7A 3EDFA 3FPXA 4MD5B 1OTSD 4MYPA 4R97B 3ULUC 3S8FB 2JJSA 4U6YA 3Q1SL 4OF8A 4XWGL 1D5XB 3WTXA 5B3SB 5EU7E 3QZMA 1KCRH 4CSSA 4KO5A 3DO7B 2C3VA 1KTDA 1VGKB 2D0FA 5DJ2B 1AGEA 1N8ZB 4XB8A 1BHGA 3NZHL 2AS5M 1OTTD 3NIFB 1F3DJ 2F1AA 3IS0X 5C0BA 1OGSA 2WXOA 3DSFL 3UOAB 5EU3A 3WD5H 3CVHH 3B3IA 1AGDA 1TQSA 1QX1A 3HNSH 2XX0A 4I9XA 1DVXA 3BSZH 4G1MA 1FPTL 4G7YH 5HYJE 4IJ3C 3SPCA 4Y9CA 2IO5A 3HPJB 5JA9A 3EF4A 4U6HB 3D87B 2GTZA 3FQUA 4L9LC 1MCPH 1PG7W 3TA3A 4ZZKA 4DUWA 4JHWH 3BQUA 5GGRA 5HDBE 1G84A 1CXHA 4U7KA 3C60D 4OFQA 1ZXKA 3BVWA 5KBLA 3DLQR 4HCRA 3D6GA 1KN4H 1OGTB 1J1PL 1E6JL 1CTMA 1OAZL 4PR5B 1FZOA 4UQEA 1DVTA 4Z0BL 3CVBA 3DX7B 3QIBD 3ES6A 1DDHA 3ZSTA 2WTRA 3RX5A 2OW6A 3AQZA 5EPMB 3FPYA 2QKSA 3LRSA 3W0WA 1SFHA 1PLBA 4FYRA 3FOMA 5A6IA 2Y3AA 3QPKA 3HZKB 2R2HA 4O4YH 2J6EH 5FYLD 4JRYB 1NCIA 1O6SB 1T04B 3DUUA 3FSAA 4ETQB 3VXTA 3WENA 4FLRA 2OX5B 5I8EB 5F88B 4AC2A 4DVRH 1BVOA 3QFJE 2FAUA 5F7HA 3ZBMA 7PAZA 1SHXA 1WD9A 1P84K 4MAUL 3WN5B 1BBDL 1XF4A 1F4XL 1VFBA 4M5YH 2WKGA 4ZMYA 4NKOA 1RVFL 4A7VA 4RMVA 1P7QA 1NBZA 4QHLB 2R4RL 2FLRT 3OAUH 4ALAH 1H8LA 4Z7UB 1J1OH 3EOTH 1XXFC 1PD6A 4P2QA 3QZBA 4W9DC 4TTGA 1GS8A 1O6VA 4RISH 5ALCL 3HRPA 4OLZL 1MUJA 1UEYA 3P73B 2D3VA 3F7YA 3OG4B 3T0EA 1BZ8A 1LO5B 1Y7VA 1J87A 2X6MA 3FU0A 2ZCLL 5C0DB 1SPDA 4LSSL 1GMEA 5C0CE 4H0LC 1M05B 4YSPA 2IQ9L 2PCFA 3DXAD 2MH4A 5SWZD 3RNQB 4KUZH 4NZTL 1A4KA 4Z95L 3DURA 2GITB 3PGDA 5BZXA 3DVNA 4JPWL 4X6CA 4ETQA 3VVVA 1BZ9B 3GIVB 4ZOBA 1W80A 1AKJB 2EAEA 3BWZA 4HXBL 2H6PA 3OLEA 5FUCC 2QDWA 5T8IA 2EP6A 2WWOA 5DJ8B 4J6RL 4JY4A 3TN0B 1HCFX 2B59B 3V6OA 1MNUH 1EXHA 3J27A 1OQXA 4KBPA 3WDJA 4YDVB 1M7UA 2H1XA 2J72A 3ES6B 3JVFC 1MWAB 3P4MA 2BHZA 2AGJL 4Z3TA 1RV6X 2K1MA 1TEFA 1SVBA 2BNQD 2NDFA 1EVTC 4JFFA 2NW2A 5IREA 3UYPB 4EN3B 1KIUA 1WEJL 4N5EC 1AQMA 2YJLA 3QDMA 4KROB 3GTTA 3PJSB 5EBMB 5ISZD 3WO4B 2WKOA 4PRIE 3E80A 4YXKH 1N6QH 4UNIA 4J8RB 4G72B 4NQUA 4HPOH 2QVIA 3MRMB 5JDJA 3TNNB 4QO1A 1NGYB 1AGDB 3INUL 1TF4A 5DJAB 1JTPA 5IVZA 1JFQH 5BZZA 5JPNB 3RWJB 4JY5H 4OI7A 1FORH 4XHJD 4KY1L 4HWBA 1A6VL 5E0QA 3D34A 2WUBH 4AV0A 2LU7A 4CW1A 4PW3A 2X2UA 5FECB 5BOJA 3L7FB 3RVUD 2WZ5A 2R1XA 4B9JA 1JDAA 4A39A 4HKZB 1UOWA 3CFIC 4XMUA 3U6XS 1AO7D 4KQ3L 4RNRA 5ABDE 4X0NA 5BO1L 1MVFA 4I13B 1BFVH 4GAJH 3AUVA 3BVVA 4X99B 1UJ3C 1XIWB 1FO0A 1MJ8L 1AGBB 4AY0A 3K6IA 3EFOB 3KPSB 5HGDB 1G9NL 2AK4B 5GRVL 1GZHA 4D0DA 3QVAA 1EZLA 4G6KH 4X7SH 4YHLL 3HKFA 1TTGA 4L3EB 1HCVA 5EC1B 2CLVB 2MTAA 4XN8A 1JL8A 3OKMA 2XQYG 4EI5A 2YPLE 1WA0X 1X5KA 1KGIA 3HC0B 4PGDA 4NZ8A 1XB8A 4XC1L 1TPXC 3DJRA 1QSFD 2H3KA 3HHSA 5KN5B 4L8SC 3ZR5A 1BJ1H 3EOBA 4P9ML 3EO9H 5TFSH 2C1PB 1COBA 2OL3H 3BN9C 3DYOA 5DJXA 2VJ0A 2PYEA 4U6XA 1QHPA 5DHYA 1JGEA 4WUUE 4H0GA 4ZMXA 3O6FD 2VR7A 1JYWA 1GAFL 2DLGA 1BD2E 2ZWYA 5IESL 2H6PB 4FADA 4X7EC 1GYCA 3N42F 4LXFA 2IMNA 4DN3L 5J6GA 2UXTA 4IBLT 2P5WD 3MOAH 4HMCA 4HKJA 1E2VA 4YHZH 1DQQA 1EUUA 3N91A 4PJFB 4H2AA 1T7VA 4N3TA 5DRXB 1EEYA 4Y1AA 2VRKA 2HVKB 1XHHA 2DQHL 4XBPA 5CLTA 2VQ4A 1OWRM 3D7PA 1U42A 1ZKAA 3G6JE 4YX2H 5I1HH 1H6TA 1G9HA 2KZWA 1Y1DA 2A9AA 3IFLL 4H20H 1KTCA 1ZVYA 2HX7A 3HW7A 3NH7H 2Z0UA 5J0BA 4PJHA 2DQDH 4IMLB 3T77A 2MFNA 2YPVL 4ZTPH 5EOQH 1P6AB 1IARB 4EOWH 4JR9H 1G7JB 3P3RA 5AWNL 5H8DA 1WV7T 1ES0B 2FJFA 3DUHA 1JPTL 2IDUA 4P2RA 5CZVH 3F2LA 1KJVB 1P5UB 3BEWA 4DK5A 1ZGLM 1TQCC 2G5RA 4NRYA 1OAXL 3HI6L 1TQUA 5JW4Q 2VIRA 2V5RA 2XCMC 3P3UA 2Z0BA 3A6BL 4PGCB 5DJDB 1F3JA 1OO2A 1MFVA 3KYOA 3QORC 5IG7A 3FF8A 2QVKA 5TDNA 4ANWA 1VB9A 1E2WA 1JWMB 4JFDD 4K23L 4FD0A 4Q4EA 3HR5B 1G6RB 4WTZA 2WVTA 4YFLF 1BBJA 3B6SA 3RWIB 4HJGA 2L4OA 5GGRY 4LBEB 4KMTL 2HFFA 4BSWB 2X4SA 3VGHA 3G6DH 4MMZC 3GDCA 4UAOB 4LCUA 1E27B 4MJHA 5ESVA 3QGVA 4FZEH 4WLCA 4DTGL 4RMUA 3RY4A 1GGCL 4R2GC 2PW2A 3MDJA 1FFPA 1J8HE 2Y7QB 1TQVA 2YUVA 4W4OC 3KPSE 1BX2B 1I8IB 3O6LH 4EKXA 3I3DA 1U21A 1VJSA 5KW9L 1B0GA 1ZAGA 3J8F7 5E2WH 1KTJA 3ECBA 5CUSH 5B1BB 4AEHH 2EUZA 1YY8B 4QT5A 4DN4L 1BWWA 1T5XB 3KLHC 5A2AA 3SYCA 3MC0A 1UZ6E 5EIIG 4TQEH 3SDYL 3R7RA 5IVXA 2V33A 4M62L 3KWXA 3PQYB 3T0EC 5L8JB 1AXTL 2WCPA 4HZLB 5CLWA 1S3RA 4JM2F 1YEJH 3S7GA 1HQRB 1KYUA 4Z7OF 2VW4A 3PWVA 1QFUH 3ARED 1DQJA 3TIEA 4RDBA 1SDDB 3LNGA 4AJVA 1D5XA 8FABA 4R97C 3ULVD 1WBXA 3ISYA 1J5IA 1CTNA 3CDCA 3BXNB 2V2TA 1MFCL 3SGDI 2EQDA 2AEQL 1M7DB 5IB3B 1Z7JA 2X4OA 1S3KL 2N7BA 3QEQD 5ISZA 5D4JA 4AIXA 1QO3A 2OPCA 5HXMA 1MJJA 2YGVA 3HAEB 1NGPH 4TOYL 5KVGH 4DETA 5A2KH 5C6WH 3SDCA 1A66A 4LAQL 4AT6B 3CAFA 1GSMA 5LN4A 1E9OB 2R7EA 1IQWH 3VFWB 5JORB 3TT1H 1A1MA 1Q9LA 1ORSA 2X4TB 3MR9A 1IM9B 5T3ZL 1TPXB 2CBOA 4QWWC 3VQLA 3WIFB 4AMXA 3BAWA 4ODTL 1C1EH 3K6NA 1F90H 3SBWA 2XIDA 3BWUC 2J88L 4EKJA 3R18A 1P7KA 2ZOTA 3MLSH 4S1QH 5AYTA 3VD2A 4LSDA 1ECYA 2I5YH 3KPRA 4FI6A 1AR2A 3O4OC 4YE0A 1N3NB 5JHDA 3U7YH 4HS8L 1F1GA 2Y3NA 3L08A 3TCXA 3DBXB 2C3HA 4Q6IB 1IEBA 2BZ7A 2NY1C 1A6ZA 2VR6A 4FI8A 4WHTB 1M57B 4DGWC 3LD8C 3ZQXA 1A02N 5AWNH 5D5MB 3V6BR 1OAJA 1Y6NR 1ADQL 2K6ZA 2JCCF 3TYFB 2Z6FA 1IM3A 1UA7A 1A14H 3CU1A 1NCWH 2WLIB 2ZT9C 4AJYV 4AYGA 1QZNA 3IDJA 4C4UA 1CDYA 3CVCA 5CEZE 4U1LB 4ICXA 1BXUA 2ARWA 3SOBL 3ZDZB 5L6YL 1N19A 3WIIL 1FF5A 1YO4A 2CHDA 3MJWA 1UXWA 2Q8AH 3B3BA 3QIWC 3LEVL 4F57H 4JO5A 1TO5A 3GZOA 2CHZA 4FFVD 2E7DA 2DJUA 1AANA 2XNAA 3GWJA 1K4DA 2OAAA 3U0TB 3IGKA 1S7TA 4G7SB 1RL1A 4GRWB 4MAUH 2BVOA 3NIDE 1DJWA 3EG9A 2OJEB 2R56H 4JDTL 3ZDZF 2HG5A 4PJBA 1P6WA 4KKCD 1H8SA 4ZT1A 5K9KB 4QHNA 2WXFA 3QJFA 5DJCB 3VRLE 3GMMA 4OT1H 1T0MB 1X5IA 5GRVK 5C0CB 3RIKA 4XE5B 4G42B 3MRQB 2AK4D 4FMFA 5G5DA 4G8IB 4ELKB 4HS6A 5LCVH 3WJJC 2A1WH 3FHQA 3ZDYB 4F7CA 1VKXB 2BC4B 4JM4L 5FM5O 3ZO9A 4B3VA 3RZCA 1YY9D 1VESA 3ARDB 3RVWD 3SKJH 5FW6A 4TQHA 1L9RA 1HSBB 2GFBB 3MV8E 4G82A 3ZT6A 1S9WA 3C5SA 1K4DB 3CFEB 5TK2A 2BNRD 3RVXC 1XDTT 2B1AH 4LP5A 5DRZB 1C8QA 3SJVE 3HFML 4TSCH 4D9QD 4Z0XB 5E2UH 5CZRA 5BPPA 5C3LD 1FGVH 3CCHB 4I7ZC 5IVOA 3UX9B 1Z9PA 1ID5I 2VERA 1VEMA 2QDVA 4P46C 1JV2A 3O81A 3ARGA 1CFBA 5J06A 2MCPH 2FL5B 1IM3B 4TULL 2EDFA 3KR3H 4PJBF 3CV5A 2H32B 3DX2A 1YA5A 3MFFA 5CNHA 4DP4X 5E08H 1IGTA 4G5ZL 1D2PA 5I8CB 3G08A 4ZYKA 3HNVL 2ZAIA 4JPKL 2ETWA 4ODSH 3RWCA 3IU3B 1I75A 2QPUA 4YXKL 2OMUA 2V7HB 4QGYA 4FL4B 1E28B 4QMEA 3MA9L 2AITA 3BVXA 4DP6X 3TH3T 4CILA 1HHJA 4PJGA 4DO4A 5GRJH 4N2HA 3HS9A 4N0RA 3EO1B 2GEEA 4D9RE 2HKAA 4OLZH 4XVUD 3T71A 4K5MA 4OKVB 1BLIA 3RG1C 3CDZB 2JI1A 1UD3A 4G9DB 1H6EA 1RUQH 2Z7ZA 1EXUA 2W5PA 5FHAH 4EI6B 3FUIA 3MLZH 3F01A 1Z1WA 4U31A 4KPHL 1X6NA 3DV4A 3TBYB 1IQDA 4N22A 2L7EA 5J6SA 3ZTCC 5BRQA 3AJ7A 2ZAGA 4WI8A 3ARQA 3QR2A 1KG0B 1DFBL 2WQRA 3HG5A 1LE9A 1CYXA 3BKYH 3QEQA 4HW6A 1KXQE 1TENA 4OLYL 3ETBF 4L8SB 4YHLH 1BOGA 1E5AA 5D1XC 3ME0B 1ZRUA 2IBZX 1NCTA 3L5HA 4Y2DD 2ZUXA 4TSAH 5KAQG 3CFNA 1EHXA 5EF1A 4KJWD 4JREC 1WZLA 4N8VG 3G6JA 4NHCH 1AD9A 3VRIA 1I8MA 5EUOB 4FQHA 2QMJA 2KZBA 1T1XA 4P4RA 4JQVA 4OQTA 5T1JA 1HNGA 1G9EA 4K3JL 4OCMC 1MY7A 4RZCB 4PJ9A 5ICUA 1EO8H 4YLBA 3NIFE 4N5ED 2BNQE 5CFHA 2GAZB 4OFDA 5TDPB 3L1GA 1OP5H 5F1KC 4MQ7B 3MRJA 5AW4B 1BQHB 1YZZA 3FT2A 3UO1L 3S4SB 4B9YA 3D3VD 3NZSA 4LGPB 2QPFA 2XG5B 1JFQL 5JHDD 5I8OH 2G2NA 5AOJA 4F9LC 5DWUH 4NCDA 3FO1A 5C07B 5DEJA 5IF0A 1JZFA 4Z1PA 4Y5YC 2YQ3A 4CVZB 1TZOA 3ROLB 2F54B 3BMWA 4AZUA 3OKOA 2K3TA 5AKVA 5TDOB 5I6MA 2O5YH 2DBJA 3U9UA 1ACZA 4JFFD 3SYAA 4PY8I 4ZX4A 4NQSB 5JDSA 3QCTH 2CPUA 2RFXA 3L9RA 1AQ8A 1BDYA 4H25A 2LLNA 5D7LB 1U6AL 1S7UA 3NZ8A 1FIEA 5EOQL 2EUVA 3NK4A 4KXCA 4HEME 1OAQL 4JPIB 3ZKMC 1VIWA 4Q9CA 4XTRD 1R46A 1PPIA 3PXHA 4NO5B 4GMTH 3DOSA 4HIJA 3ARBC 4P5KA 5KSBE 3B2VL 4PMEA 3BT0A 3DARA 4HZAA 2CUMA 2VDKL 5CZXC 5FOJA 4NAJA 1ETB1 3MVSA 2FT7A 1FVCA 2E7MA 2G60L 2HN7A 4W9HC 4CN1A 4KUZL 2Y7MA 4BFRA 3F5WB 1LP9A 4H1LH 4DKEL 1OM3L 3QDJA 2TAAA 1OZUA 3QFJD 4XWOC 3WV0A 3DHJA 3WEMA 4X4YA 4G43B 4YHYB 2VLKA 1HCYA 2AJVL 1J9CT 3DWTA 3JSSA 4M1CD 6PCYA 4YHML 2ICEC 2Q2EB 3SCMC 1MCBA 1LNUB 5E9DA 3BWAA 2VRAA 1V7NH 1I1AD 4TS6A 4M7ZC 3JZ7A 1QSEB 4FXTA 3LIUA 3MGOB 4LCYA 2BNRA 2I25N 4JDZB 2Z8RA 1VZIA 4N9GA 3EUDA 1ZLSL 5DVOA 2QGEA 3BDYL 1Y0LB 3H0TA 4I4WA 5FKPB 4KVCL 4D9LL 4NO0B 2PYED 2Q86A 1JUFA 2J6WA 1VDGA 5F7WC 2K0RA 4D8PA 1F6AB 5F0PB 3PHSA 1FNGA 2ZQKA 1KCKA 1LO3H 3IU4H 4JQXC 1A7QH 3SB3A 5DD3L 3EJZD 1RIVL 4N1CA 5I26A 1ET5A 2JJWA 1G7QB 3ESUF 4MNGE 3ENEA 4FTVE 4HPYL 2XN0A 3FB6A 3CUPA 2E6QA 3MRDA 1KPRA 4KY1H 1T0NA 1ORQB 3VFPA 4AYSA 1FNEB 1QOKA 1WRFA 1X5JA 1Z9SB 4MJID 3QFJB 4TQ8A 1BJMA 4QRFA 2BZDA 3RTQD 2WXGA 2E5EA 1QAWA 2H47C 4RCAA 5GS3A 5BJTB 1JPTH 4X6CF 1FL3A 4FQIL 4YSDA 3FO9B 2WJ7A 4P46A 1ZV9A 3GUFA 5FF6B 2IEPA 2Q0ZX 1S2EA 4HOWA 5EOTA 1QRNE 3EBHA 2OCFD 4JY6B 5EO9B 3ZDYE 3GHBL 5KVFH 1XAUA 2HMIC 3ARYA 1LVEA 3CPUA 3FDWA 3Q13A 4ENEC 1FFOB 3EGDB 4OM1H 3WY2A 4MASA 3QEHA 2ICCA 4YDKL 1SXNA 5LJYH 1CZ8H 1GA2A 3VTMA 3B4NA 4ATTA 4E41A 3TF4A 2BWIA 2P28B 2GBAA 4IK6A 2WBWB 4ORZC 3SGDH 4M5SA 4MA8H 2KLRA 4B9FA 4K7PY 5E1QA 2KS0A 3H9SB 3NPSC 2PW1B 3ZO0A 3FTZA 5I1DB 1A3LH 1EANA 3OMIB 5MERA 2FYYA 2ZJSL 3DTUB 2ED6A 2HT3D 2NUPB 3DPBA 4MMYA 4FHJA 5EOCJ 2VSKB 5GGUB 4N28A 1UB5B 4MJIB 3WYRA 4KRLB 4GH7B 1KXTB 4CDHA 2ARJQ 4OF7A 3RDJA 1MZZA 1ZTXE 3SQOH 4M7LH 3NABH 4TLSA 1QR1A 3LIZA 3P30L 2BZCA 1JCKA 2CO6B 2X88A 2YN3A 4R2GB 5D1XD 3POHA 1YEDB 4WGVB 3P0GB 3HS0B 3WLWD 4IMKC 4PPTA 2RH0A 2ORBH 5BVJA 3G04A 4X6CB 1N5AA 3L17A 1GZHC 4PGBB 2OS7A 3BAEH 3DMMA 4NNPL 2QHRL 1G1CA 2RMNA 1V55B 4UTBA 1AZRA 2Y06L 3V0DA 5HDQL 2Y1YA 4QRSA 3F00A 4FQPA 2G5UA 3PWNB 4KAQH 5CMAB 4X7FC 4HIHA 2X89A 1BZ7B 2XLLA 4LPXA 3UG4A 4Q97A 4MNHB 5SX4I 3TO4B 2YAQA 2XWDA 4DUXA 3Q8EA 3AREA 1XF3B 4YSSA 1MUJB 4NXSA 1O7DE 3ARFD 2AJ3A 3L5WA 3CFBA 1IIKA 2DQ6A 1KBWA 5KYNA 3L6FB 2W9DH 4NM4L 5FEBA 4LLWB 4ZQKA 1MF2L 1OSZA 4BFGA 3HZYB 1KUMA 4FG6D 4O02B 3WHXB 1M1XA 3L2MA 1SN2A 4I5BB 4OIIH 4X7TA 4IK7A 1M6UA 5DHVH 5ANME 5CEZH 5E9NA 4YWGH 2WUCL 1A4AA 2EDKA 4HUCA 5CP3A 1FGNL 1ZJAA 3QUKA 2WLMA 2ZX8A 4Y19B 4JO2H 5JIPA 4Y5YA 1FFRA 3C60C 5FDWB 5SWZE 1NFIB 3IMUA 3SDXE 3ARZA 4PP1C 4FXKA 4K3EH 4B5EA 4JRYA 2ZXGA 1RIVH 1LEIA 1IC5L 4TV3A 1P7HL 1RHHA 5LBSH 3AB0B 3P11L 1O7SA 1MELA 5CBEA 1XH3A 3U36B 3NJKA 5L9DL 5K9OA 2ESVB 1U58A 1PFOA 5F1IA 3KPRD 2VDRH 5EDXA 4HCGA 1BM3L 4KKLD 4RWHA 3VXMB 1CBVH 4JN1L 4QRPE 4OIFA 3NACL 4ODUB 1YN7A 4WO4C 1TCRA 3CFJA 1AJ7H 1KOAA 1NIAA 1ZA3A 2IDSA 5D70H 5C9KA 3EGSA 2W0PA 1E5UI 3REWB 1BZQK 4FJYA 2FEDC 3QNXB 1EHKB 2FATL 5JOPE 2H7WA 3BZFA 3BLPX 1P4IH 3IFPB 1UYWL 5E2JA 1IL1B 1IM3D 2BVEA 3WFDH 4NNYA 2OMYB 3NPSB 3AS3A 3UO8B 1KCSH 3SYPA 3SHSA 3TBSA 4KITB 2YXWA 3HR6A 5ALBL 4UINH 2HPTA 2FLBT 3BGMA 1A6AA 3FS9A 3QR0A 1R3LA 3PXLA 1RK0B 1ZHBA 4LOEA 3VRJA 3DUSA 1NL0H 4UIMB 4G9FD 2J1XA 1HINH 4PJ8A 4YSAA 4OGAD 3ARWA 5T1DH 1C12A 5FFOA 5FX3A 2AXJA 3ARDD 2FE0A 1K72A 1KNOA 1EX0A 1AD0A 1BBDH 3QUHA 4NAMA 5F7AA 2X70B 4W4NA 5GGQH 5I1IL 1BZ7A 1NGZB 2WZAA 3HN3A 3LQZB 4Q4IA 3T3PE 3H6AA 3B2MA 1FZJA 4O5LL 3T4AA 5JOFB 2F18A 4WSKA 2YSTA 3ARBA 1BQLH 1EEZA 2DMHA 3OZKA 4BQ9A 1EJOL 3QJOA 4FFWC 1BGXL 1S7WA 2YMXH 3P0YL 5JXEC 1N12A 4YAQA 1IGYB 4LKXB 5D2LA 3LQAL 2AKRB 3S3DB 3ZT5A 4AYMC 5H2BB 1UACL 3KW8A 5HPMA 4JE4B 1MNUL 4R96B 5IFHL 3QRLA 5IIEB 5KS9E 4JN2A 5K59F 3AY2A 3HPLA 2BVYA 1N7MH 4FI7A 3OKKB 4LHUB 4WFFE 5EU4B 2CSPA 2AGJH 3OL2A 3QO1B 4M8RA 3AT9A 1C5DA 3MBWA 4XX1E 5EEVA 4BFKA 2A4ZA 3CZGA 6FABL 5HDBF 4AGPA 4B7IA 4N6RA 4Y5XB 2FSEA 4IRSA 2OXHA 1M6OA 3CVHA 2E47A 4HUWA 3V52L 4DZBB 5JYMA 3GLDA 1EMTH 1OCZB 3LCYA 2EH7L 5MERB 4FQ2L 4P3WA 3C2AH 2E75C 1ZEAH 1AOHA 1RUQL 4OIBA 2EDTA 3N5AA 4X6FA 2AVGA 4WU5B 3ESOA 5ELIA 1HDMB 4AVIA 1GYVA 5C92A 3CIQA 2OCCB 1RJCA 1L9MA 1JF1B 3CC5B 3TO4C 4E41B 4YMPA 2YPLA 1ITBB 4M1DL 2GBVA 4HUMB 4GKZA 2R51A 3FT3B 4NLHA 2IDFA 2CRIA 3QCTL 1ROCA 1SLXA 1ZY9A 3CG8A 4UV4L 3SCMB 1OHZA 1VF5C 3IE4A 3MRFA 5EO9A 1R5VB 4X8XA 3SE8H 3W3BA 2DLHA 4F58H 4FGMA 1BP3B 4OQTH 3PPEA 5AYUH 2UWEE 2JI2A 3MNWA 3DX8A 3J2PA 4HH9A 1AG0A 1OGPA 5ESAA 1M6OB 4UT9L 4YK4C 1AGCB 5DQ9A 1UJ3B 2V2WB 4WUUB 4XZUA 4FHKA 4J4PA 1P84J 2FQDA 3K4AA 4G6FD 2P9RA 3V79C 2H26A 1U8PA 2X89D 3H42H 5IGXH 1UH4A 3F8UB 3IXTB 1U8JA 4RESB 5IMMB 4DP7X 4NQEA 2XWZA 2NY5H 3HFMH 1TT6A 4BKTC 1IT9H 5LBSA 2ZKXA 5DJZA 5CEXA 2EVHA 5LNGA 1IGYA 2WO2B 1UD4A 4LKXA 1F6AA 4UU9A 2F8VA 4K71B 2DYRB 4ILDA 3G5ZB 5H4YA 2IGTA 4U33A 1WFIA 1SXAA 3MV9B 4PRIA 5DO8A 3DJSA 1S7VA 1JVKA 1SMOA 3KHQA 5IJVA 5E56A 2I07B 5I9QB 1FYTA 3D4YA 1MWAL 1QEWA 4NSKB 3W0WD 3NGBB 1I3GL 4POUB 5DDHB 1HILA 4FKEA 2OV0A 4NQDD 4ANXA 4MJ6B 5DC2A 1Z9MA 3IJ8A 2DIJA 3DIFB 3JTBA 4WEEA 5FUOH 1RJZB 8PAZA 4UIMA 4OJFH 3D51A 3CZJA 2WLLB 5TQ0L 1I3VA 5F7NC 4P2YA 1BFOA 3D18A 1WUNT 3I9AA 1F4HA 1B2WH 3B9KC 3CHOA 1QABA 4JDEB 3ARPA 1A8JH 3LPGA 1KPVA 4KHXL 1T7XA 4WJG3 3QXWA 4WI5A 3FB7B 2NSQA 3QUXB 2XKNA 5ID1B 1CE6B 4G8EB 2BIIA 2R2EB 2SODB 4LAJH 4PJCE 3NZUA 4BFEA 4MXWL 3QEQE 1EO7A 3TCTA 3WHE0 2R0KL 2CXKA 2J8UF 1XH2A 5FGCE 3WFZA 4L1DA 5JNYA 4GO8A 4OB5L 3TNMB 4TUOA 1B4JL 2DAVA 2VDQH 2ZOOA 3KJ4C 3AREC 3BVUA 5F3HB 1GC1H 1SUJA 2Y69B 2ZCZA 2H5UA 2X4QB 1MW3A 1JNNH 2P3YA 4KTDH 5CBEB 4P59L 5HDWA 1SBBA 1VCAA 2YAEA 1EZUA 1A47A 1AP2A 4FA6A 2VERN 2R69L 1ERNA 1VACA 4H8VA 4NQCB 2Q3ZA 4WIQA 4KMLB 4PYGA 1A2YB 5FC9A 3PPSA 5D93C 3RX7A 3B9AA 2WCGA 1T7ZA 2FJSA 4JM2D 1ZEAL 4OZFH 4GRMA 3JWDL 3K4DA 1G0YR 5KSBB 4L8CA 1KEML 5DEGB 4R90H 4F33A 1IBDA 1N64H 2NY3C 2AQQA 4FFYL 1CZ8L 3ZTNH 2YK1L 1UHVA 3FT9A 3ZE0E 4ZTOH 4ZO7A 2F9BT 1IQWL 4AEIH 3PHQB 3FQRA 2JXMA 4AIZA 1MHCB 3CFCH 1WUZA 2ICES 5K9QI 1T5WB 4Y7MA 4N90D 5TTRA 3WFBH 4F1ZA 4C58B 4GRLB 1I53A 3GD1C 3TH2T 4OAWA 3L9YA 2H2SC 4XNYH 4YEFA 2CNYA 1PX4A 5CJXA 2YJQA 3VRIB 1I8MB 2ZUWA 5LO7A 4QRSB 2MHAB 1EBAA 4TN9A 1KBVA 3CN3A 3OQ3B 3BP4A 4LEXL 4LHQB 2QQNL 1MRCH 4N2CA 5TH2B 1K5NA 2BP3A 4H8PA 4EZMA 3EYUL 3Q2VA 3APNA 1HL8A 4LDOB 5JPNC 3HA0A 4U3HA 1F4WL 4UBDD 5L7XL 3HN8A 2ZUYA 2VDPB 2VITB 4JRYE 1WAPA 4M61A 1T89A 4HUXB 4AK1A 4YHPA 5JXAH 4GRMB 3FCSA 2PPEA 3WUWA 2UY6A 3CN0A 1MIML 3IWVA 4MS6A 4C55A 1KB5B 2OZ4A 5IHUH 3PJNA 2DY2A 1IQDB 2HMID 1I1CA 4E5XA 4J23A 2AJSH 1F2QA 1LO2L 2MNWA 2Y07L 2QLVB 3FJTA 1IFRA 2O5ZH 5I16A 2CE6A 4NKIL 1HKLH 3IK2A 3IN2A 4RGOL 3SE3C 1B4LA 2DICA 2DYSB 4L3CB 3WY1A 5E8PB 3V7AG 5I66B 4U0QB 4X7SL 4WEBH 3SDXB 3LKOB 1QBBA 2VLRA 1XF5A 5ETUA 5KUMA 1FNFA 4P9HC 5EN2A 1I7RA 1OSEA 2AF2A 1DLFH 1KGYE 1OB1A 2ZUTA 1INDL 2ESVE 4JDTH 1KB5H 4PRNA 2P8PA 1ZCRA 2G0LA 4Q6IC 4H8WL 2X38A 4EDXA 3VXOB 3MODH 2X6AA 3PIQA 4UDTA 3SDXF 3VUAA 1OT1A 4XMVA 5IBTL 1T6BX 4U1JB 4BZYA 4TYUA 3T8XA 4NAQA 2EE3A 1O5PA 3FSZA 4GSDL 4JDEA 3RL1A 4CMHC 1CF1A 4QWWD 4KDVA 1HQ4A 4TUKH 3S37H 4AI7A 2O6PA 2FEJA 4ZFFB 2DQUH 3LJ3A 4BXVA 2GSIB 3EFFA 4EDWL 5L9DH 1J5CA 1F3DH 1PCSA 1WZKA 1YEEH 4PJ9C 5T5FH 1HHKA 3RTLA 1HS6A 4ODBD 1NCDL 3VWKA 1NBYA 3VE0B 4LL1A 4AQEB 3HC3L 1ADQH 3BKML 3C09B 4DEPC 4XXCA 3HBGA 4ZFZA 1MDAA 3GO1L 1JZHA 2DPKA 4NOFA 1OAQH 5KVDE 4J4PC 2AJZB 2Z31A 2EIJB 4KRPD 3ULUE 3FC8A 4JPSA 2VLKE 5DZNA 1MREH 2CDEB 4GAAA 1E4WL 3FT0A 3C5SB 1P4IL 3LPOA 4OTXL 3QDHA 1WF5A 3VXUA 4A2LA 4MDJA 1LP9E 4G6ML 1IGML 1KGUA 1TVHA 3GLAA 1DN0A 1AZUA 4MS8D 3MRIB 3BQUC 4OCLC 5DJZB 1C7TA 5I1GH 2XQYK 2F58H 2J12B 3HS0C 3QXDB 2ITDA 4R90L 3ZL4L 3NFPB 1OTSC 4JDZA 3KGTA 1WFJA 2D2OA 2DYPD 3HBZA 4OZHB 3SDDD 3U1SL 1JZ5A 2VC2H 1K8IA 1KCRL 4LPVA 4M4RB 1IC1A 3JT0A 1NGQH 1Z3RA 1F11B 2CRMA 1EDYA 2ZD0A 3HZ3A 2ROYA 4RMWA 4E9WA 2XN1A 4EN3D 2AI0H 5C2BL 4J3WA 3O11A 3GMQB 4OJDH 3QIWA 3ETSA 5EIIB 1HJBC 2Y72A 2A1WL 3MO1B 4KJYA 1NBCA 2UZYA 3T3ME 4F24A 2IH3B 4BZ1L 2BSTB 2VE6A 1CL7L 1LP9B 3QEUB 1NCAH 2M1KA 3H4HA 1S8DA 2FB4L 3HG1B 1LWRA 5GZNC 1QSED 5INCB 3T0VA 4DZ8B 1X5FA 3ZUNC 5HYQB 3PIQB 2NY5C 1L7IL 4OV6F 3WAJA 4GEJA 2GC7C 4X8GA 2ZCHL 5L0QB 5I74C 1G0XA 4F2EA 4HEPA 5CIPA 3OKEB 1HEHC 2WINA 4TL4A 5C3TA 2BSRA 4JKLA 4J3VA 1H0DA 1A6ZB 3SDAB 1FVDA 2A6IA 4IYKA 3AQDA 4GW4B 1EQWA 3PNWB 3VXNB 1K8DB 3EO9L 2PWGA 4LRNH 3RPKA 5CCGE 2HTKC 2ZX7A 1UKTA 3DGGB 2EDYA 2ZXBA 3MLTB 5IFJB 2VO8A 5GS0H 5DS8A 3EO0B 5IIEA 3LH9A 1XEDA 3GHBH 4FXLA 4YBLC 4E0RB 4UF7C 2B4CC 1F00I 4Z7VF 3ZZLA 1CR9H 3TYGH 1GOFA 2AKRA 3ZE1F 3UTTD 2I9TA 3B5HA 2C3WA 2V2XB 3EYOA 2DQHH 1HK6A 5AB0A 1KN2H 1TTCA 1MLBB 2EDQA 1FVDB 2A6IB 3H85A 2BY2A 3RY6A 1W0VB 4A6YH 2E7HA 4JKWA 3LXCA 4KVNH 4WTZG 3QW9A 1RKRA 4AX3A 1GGYA 1ZLWK 1T3FB 4P3DB 1J5DA 3CDYA 3VO0A 3F7LA 2W91A 3ATFA 1NANI 1XGPA 1CI5A 2BCKB 1RULL 4G6AD 4HKBA 5KYXB 4AIZB 4HLZH 4EUPA 3B9KB 4PJ8B 5IKCB 1NCGA 4QJ4B 4X8JA 4AL8C 1H5BC 2VR5A 4LLDB 4A68A 4G70B 3BIKB 4PI0A 3IMBA 5IFAL 2Q7YB 4QT5B 1IGFL 2X6BA 2IMMA 1FL5A 2J3SA 4C83B 5B3JE 4FC3E 1B0GB 1A2YA 5LGHL 1UCTA 2UVEA 4QTIL 5ITFB 4F2ME 1XD1A 1ADQA 3NJIA 1ASOA 1TTRA 2OZNA 1OSPL 2FJGB 2MCG1 4MCYA 1BZEA 1KULA 2ENYA 2HRGA 4HGKC 1S7VB 5AZ2H 2HP4A 2YAHA 1IJ9A 5D71L 5HGGS 4B3EA 4M00A 3VFTB 2IF7A 2HFFB 5IB5B 2HKFL 4RAVA 5D71H 3PE9A 5J1AA 2PMZA 1I1AB 4WWKA 3K4ZA 2X0UA 4RFNB 5D7JD 1WITA 1G6VK 4L2LA 4Y9BA 4DVRL 3HNTL 1GYAA 3IMWA 4HIIB 1DL7H 1QZ1A 3HG0A 5ADPH 1PJWA 4OCWL 2MQGA 1Q0EA 2Z31B 1MRDL 4PGCA 1UWEH 2XFXA 4PS8A 4BRJA 3PWUB 2FB4H 3QH3B 5K93A 2CR3A 1ZHKB 4WU7B 3FAWA 1GHFH 2CDFB 5E4OA 4NZTH 4ZUUB 4N0UB 4PRBA 5AQ0A 5TE7H 3HCVA 3FRPG 3BP7B 1ZHLA 3PP3H 4I0CC 2BFVH 4KFMA 3FQWA 3SGKC 4DK6A 4LLWA 4J28A 2HG0A 2BCMA 4U0RB 5DMGC 1MCSA 2F08A 2H6OA 1I85A 4I0PB 5I0YA 2K8QA 1S46A 2OFQA 3NJFA 4TNWK 4MFHA 3I75B 2IPTH 2DKUA 4J4PD 3EOAA 4P99A 1AHKA 2G60H 2VQUA 4LSTH 4XPHH 2VGLM 3IJSB 3V0EA 1QRKA 4DO6A 3LZOA 1A1OA 1TTBA 1XR8A 3MGTB 1FIGH 3STBA 3RZCB 4ENED 4PBWD 3ARDC 2OK0H 4XXDB 1TDQA 1OP9A 4NQED 5ERWB 2NPLX 5FLUA 5K69A 4GUPB 3MUGA 4HS6B 1NM4A 1AIZA 2YXFA 3ARTA 3IXTA 3GB7A 3K80A 4M6MH 3RWDB 1A6WH 3DECA 5D5MF 3BUDA 4X5XB 3SQBB 2JB5L 3H7BA 4QKXB 2YOAA 5DJCA 1A6WL 3M1OA 4OZIF 1FAIL 1MI5B 4IOSD 1SYSA 4JNXA 5F6IC 1BMGA 4AMWA 3EG9B 2NT0A 4W9IC 5I9QC 3D25B 5A2FA 1CXIA 5FO9B 2Y1VA 4HS3B 3ZN6A 3OGCA 5EC1A 1DQDH 5CGYC 3DROA 1JGDB 4OF3A 4H7VA 5FYLE 3TBTB 3I9GH 4YAQB 4Q8BA 3VXPA 5CN3A 5HTSA 1CFNA 5AZUA 4NS0A 4OZFA 2F15A 5TH2A 1Q4NX 3KBHE 3AZUA 4P59H 4M62H 5PAZA 1UENA 1ZT4B 2CWRA 4AIOA 1BM7A 1TJGH 2HTLC 2R1XB 3D30A 4K3DH 1AO7E 1YCSA 4OAWB 2NYKA 3CZSA 3PNRB 1UFUA 4WU5A 4DP9X 2A83B 5JZ7D 1Q9KA 1KZYA 3EJJX 4JQIL 2VDQL 5MP6L 4O9HH 3D1MC 4JFOB 4CMMB 4R7XA 1A1NA 2CPCA 2V6HA 1KV3A 5KSBF 3BWSA 1WWBX 3WJLC 4K7PX 1U92A 4NZFA 3IKCA 3TBSB 3MRMA 1IC0A 4RGNC 1HKLL 1E0OB 4MNGA 2WB7A 2V5MA 3LZPA 4Z7NB 4KI5D 5AUMA 3NRFA 3CUPB 1UZ8A 2V3FA 2FQFA 2XZCH 4UT7H 2EVIA 3DGGA 4HJ0C 2XZAH 3KCPA 4LF3A 1HOCB 2I85A 3RFZB 3CPLA 1H9VA 3THMH 5GZOC 4JFEE 4DP8X 3ARBB 4Q52A 3GSXA 5E8EB 5C7XL 4HFUL 4WCYL 4JG1H 4TUJA 5CIPB 4Z0BH 1H9DA 4QYOB 2CMRH 3EGXA 1J1PH 1OAZH 1W91A 2QSVA 5GS2H 1R5WB 4F92B 1BIHA 1YEJL 3EJQA 3RNQA 3BKJH 4QTFA 1H3GA 2X4UA 2LVEA 5SV3A 3P9MB 4L4TA 5CP7B 3C5XA 2G2RB 4NYLB 2E9GA 1Q94A 3EJYC 1ICTA 4PB9H 4HMEA 3IFOB 2EDDA 3SYQA 3T0EB 2YQGA 2GTQA 4H8UA 2WO3B 5IGXL 5C0BE 3LTVA 3O11B 4MXQD 4X83A 3SPVB 3V8OA 3D08A 4PV9A 1E5BA 5CIPH 1QLRA 2RAMA 4P2QB 3CSGA 5DSCA 1E5ZA 5I8KH 5DFTA 1SGKA 1N0XL 3CDFA 1ZWIB 1MW2A 3BLBA 3KM2A 4I9WE 3EGXB 3OF6D 5FCUL 3LX9A 4TVPH 5D1ZC 2APWA 4X5XA 3SQBA 3WIAA 1NMAL 1UD6A 4JHAH 4JFQA 1W0VA 2CA3A 3ZDYF 2VLKD 4JPIA 4NBXB 1C8PA 3BIBX 2N56A 1SEQL 5F7EH 2FEEI 3ORJA 4IJ3B 1UZGA 4YH6A 1XGQB 4PG2A 5IHZA 1DUYB 4F9PA 3NBNA 2O61A 4YBLB 2R2HB 3FB8B 2CO2A 3UZVA 2XI9A 3FU6A 1GKEA 2OMBA 3I3BA 1UB6B 1CL7H 2O93L 4LDEB 3LRSB 2DBLH 4YDMA 2Y7NA 3W0WB 4Z7OE 5FFGA 5AUMB 3VXMD 5JIQA 5DS8B 2VSCA 4F20A 4GRWF 1WC7B 4CVZA 2VLME 2GJZA 4NCC1 5LGJB 1IE4A 4MHHI 1TQBC 4OQ1A 4NN5B 1GGUA 1KACB 3GXPA 1FG2B 2NTFB 3RX9A 1AGCA 3JVGA 1I8LA 2A9ML 2BNUB 4AUJA 4YSTA 3RVTC 3TM6A 4JL2A 3S98A 1JDDA 4HISA 4ZUWB 4YJZL 1HHIA 4M7KL 4N0UA 3VM5A 3H1ZA 4BSVA 3L6FA 1J8RA 3QYCA 2IPUG 2Q8AL 1E8ZA 3BQUD 3N2JA 1UM4L 1XGYL 1UATA 2BHYA 2JCCB 3C60A 3VNYA 4NNXA 1IRAY 1GSKA 1LO0L 2XHNA 4LT7A 5I0XA 4P4RB 3QDGB 4M8VA 3QUZB 3QYNA 1XGYH 3BOVA 4K8RD 3OLIA 1HDMA 3QNYB 3EYVA 3KYNB 4QRPB 3UEZA 4AEIL 1VFOA 1LGVA 1TVBB 1NFAA 3L7EA 3VGDA 4S0HA 3SKUD 1G5AA 2A9NL 4GXVL 4NHUB 5D96C 1JBJA 2E7BA 4K7PL 2OXGB 3QIUC 1UCBL 1B9KA 1JGIA 3OB0K 5EBWA 3SDXA 4JZNB 2A0LD 5DMYA 5A1AA 4JGUA 1KEMH 4IIQB 1B0RA 1DSFL 1ZVNA 3O8XB 1H5BB 4HX1B 5I0ZA 1FLRL 4E41D 1HINL 1QFWI 5IOPA 2Z92A 1MW0A 4TSBL 4G3YL 35C8H 1Z9SA 3BSZL 3WDHA 4QAMB 2AAAA 2ZXEB 5DEFA 1KB5L 1DZ0A 2EZ0D 1C1EL 3OB8A 4PY7B 4B0MM 3QXDA 3IMSA 5CO1A 4E68A 2DQEL 1FYHB 1I85C 2C1OA 4PJCA 5IMOA 2ZE0A 1I1YA 3VQ1C 1WFOA 1MJ8H 1D9KB 2R8SH 1PFCA 1XV8A 1XX9C 3OAYH 2C9QA 4GW5B 5IQOA 5KEZA 1NCNA 4OFVA 1T89C 3H0TB 2YHGA 4I4WB 4NFBA 3BJ91 4Y16A 5DD6B 4RX4A 4CKVX 1THCA 5B3JF 4AMKL 1G87A 1RIUL 3L45A 3EOAB 3PL6D 4P9HL 4X5PA 1WD8A 3IU3A 3PLYA 4ATWA 5D6DC 4H1LG 4TNFA 1OM3H 2XU9A 4CNIA 4ZYKB 3VCLA 4GRLA 2LU5A 2X53A 2YRBA 1WLHA 5DURB 1MXDA 2J5WA 2EC8A 4KO7A 3CK0L 5KVFE 4XMXA 4M43H 4UQIM 1BFSA 3BGAA 1XZWA 5D7KE 5DWUL 1UA6L 1EAPA 1RFDL 3M17A 2MKLC 43CAB 3OKDB 3EYOB 4ZUUA 4OJFL 4HYTB 4LBAA 1QWNA 3FBQA 2ODIA 2NCEA 3TT3L 3US0A 2WXIA 4GXVH 2IADB 4ERSH 2GT9B 3LEYL 1RZIA 4FEMA 2VABB 1N6VA 2X9WA 2Z7YA 2X40A 4QRRB 4Y2OA 2XBZA 1GGBH 3TEZA 1MCLA 2ENSA 5JHDE 5E2TL 1U93A 3QDMD 2BX5A 4N2GA 4WW2B 2G30A 2KPWA 2DQDL 3P0VL 2N3JA 3CVDA 4IRSC 3RB7A 4XNDA 4UYPA 1CBJA 1ZHNB 4NFDA 3AADB 1OTUC 4HAGA 3SOTA 4K9JA 4KVPA 5I18L 4QRUB 5ICXB 2EEXA 4WO4B 4K9EL 1N5YL 4QY8B 2QHLA 1AXTH 2WXJA 3IPFA 1Q72H 2A4EA 2J57A 3A4EA 3BGFB 3OLDA 1TJMA 4OIAA 3RTQC 2A74C 3ZU8A 2FJGA 3ASOB 1I82A 3MRGA 2VUKA 4G1EB 25C8L 2GJRA 2NYYD 3U9UB 1GKOA 1NCCH 1YMHA 2XTJD 5HVHC 4TNGA 3TASA 3LN4A 1IBBA 3BSZA 5FO7B 5M7QA 4NBYB 3WIHH 2G3ZA 4BZ2H 5BUAA 3D69A 1MY5A 3KYAA 4FNQA 3L9BA 2OULB 4ZAKB 3QEUA 4YUEH 1XF2A 1HZLA 1AO7A 1TUPA 1S7RA 4K5OA 2P5EB 3EJPA 2Q8BH 1B4JH 4GKNA 3K6DA 2XG5A 3IFOA 2XYBA 2G2RA 1SHMA 1YDPA 1YN6A 3HZYA 5DO2D 2YLKA 4L4TB 3LKQA 5SWSB 4P4KB 2J5LB 3KG5A 4M6OL 5GRJL 4ZMNA 2ADYA 3A47A 2ATAA 5E4IA 4EI5D 2Z7UA 1NKGA 4NPJA 4CNIB 1V7MH 4NKOB 4OCWH 5KSAC 1S78D 1NMBH 2J25A 1NUGA 5CMAA 1KC5L 5I1KH 1ITCA 5EU6B 1O0VA 2JIXB 3VH8B 3UBXA 3GSXB 2JCCE 4NEHB 5ID0A 2CKBL 2KZKA 5H37A 4RMRA 3CPLB 5LN8A 3FO2A 3CGTA 1KYFA 4PS7A 3ALXA 5D93B 4RLDA 4O51B 1HOCA 4XMPL 4XBMA 2Q6WA 4P2OD 3BRFA 2X1WL 1NOLA 1O9WA 2VR3A 1FZMB 4H25B 4E9YA 5I82A 1I1YB 4YHNB 5IMMA 4L8CB 3IMRA 1B2WL 1S7SA 2P7TA 2P5WA 2GG1A 1OHQA 2AZUA 4ZFQA 4XMZA 2CA4A 1W72L 5HI4C 1J7VR 5KUKA 3LYRA 2ZONA 4TQIA 2R23B 3BEVA 2J71A 4BK4A 2QSTA 2EABA 2GT9A 3ARBD 3MJGX 1SEBA 3I02B 1K8DA 2F8XC 5E99L 1S3KH 1FFNB 1U8OA 4ONFH 4KZDL 1RZ7L 2VZTA 2R0KH 3PAVA 4FE9A 3RVTD 3P3SA 1QO3B 1I3RB 4IDJH 3KPLA 4GSXA 5AD0A 1IZJA 4U2YA 5EORL 4WY7H 4O2CB 2A83A 4G1MB 4M43L 1I8KA 5AOLA 1AACA 1UJTA 2IXQB 4UAOC 2Q5BA 4OFPA 5I6PA 4U1JA 2J44A 3UO1H 1DVFC 4OD1L 4OZGE 4PREB 4F7TA 1BQHG 5INCA 2F5BL 4DZ8A 1MAML 1OK0A 5DUBA 1KLGA 3KXFB 1EH9A 4NNXB 2P8PB 4X4MA 1QRND 4Z7OB 4UT9A 5T5NF 4ABVA 4WSGA 1BWMA 2C3VB 2ZNWA 4LRIC 4GW5A 1MAMH 2ZOWA 3PQYA 2JQMA 1D9KA 4N2DA 4LHUD 3ARXA 4J7RA 4YLQT 2Z1KA 3OG6B 4WRLA 1VSCA 2XFGB 3KDMB 2EEDA 2E8ZA 5FGCB 2BNQB 1AG6A 3BGFC 4L3ED 4Z8FH 3I02A 5JUEH 2X10A 2OZ4L 4XNUL 4ODXA 1T20A 4Z76A 1WC7A 2B1AL 3ZK0A 4RQQA 1SJEB 5EU4A 5FXCH 3WJMA 1EEUA 4DKFH 3PL6A 4LSUL 3UEQA 3HNTH 2QPDB 2QPEB 4XBGB 4J3OG 4HJJH 1B0RB 3O8XA 4HX1A 3TPUA 3UMTA 5L2JB 2HTLD 5D72L 1B88A 4Y2DC 5F6HJ 3P1VA 4P46D 4HUXA 5JIKA 5CEYB 1PY9A 4HSQA 1XWVA 2GIYA 4YGAB 3SJVA 1I9IL 2QKIB 4O51A 2Q6WB 1FNSH 4HQQL 4RBPH 4FTDA 5F7FA 5FA4B 1KBPA 3BKCL 1A21A 4RAHA 3G5VB 4ZRGA 3MRQA 1KJMB 4N9GB 1RUAL 4NJ9H 4XOBA 3B2VH 3Q43A 4ONHA 1MPAH 2JF1A 3HMWL 2DWSA 4M29A 4HJTA 3LRMA 2VLJA 4JRXB 3SE9H 2V2WA 2A9CA 1P7BA 4HWBL 1HHKB 5E8OA 1TZ8A 3IJ7A 3L1FA 4PW9A 5KYUA 2VLKB 4JUTA 4YK4B 4NQXA 1T2QH 4KX8A 2WQWA 4K94H 2CDFA 1F02I 5C0JA 2VISB 3BP5A 1MCCA 3Q8BA 3LDBB 1ZXQA 2K6WA 4U1LA 4ZW6A 5HI4D 5CR1A 2P5EE 3FU8A 3DRQB 4GKSB 4P8QA 3G9VA 4EE2A 2VOTA 4S0SD 1H3VA 5HP5A 4HCIA 3FL7A 1UB6A 5LHDA 3QJXA 3KS0J 2VTFA 1E30A 4HPYH 1S9KC 4Q58C 3KWTA 1DUYA 2IAMD 5D7SL 5E6ID 1QUNA 4R7LA 5E8NB 4ZFGH 4IRJC 3WGUB 2V0AA 4QRUA 5ICXA 1NGWB 4HJJL 4N0FB 2JLPA 3APCA 2YPVH 3BZ4A 3R19A 4MSWB 4HOZA 4G42A 4PLJC 4R4ND 2BSEA 4Q7DA 3RPBA 2IG2H 3VG9B 3FHAA 1V3JA 3GRWA 3MRNB 5CXPA 3MV7E 5I1GL 4XNQA 2K78A 4XODA 1FNAA 1WJ3A 1PZAA 2OTWA 4Q6KA 4R7DB 4WTQA 5DMGD 4DQAA 2AC0A 4C83A 3FCSB 5HHQA 4PV9B 1A1MB 2ENQA 4Y5VA 1X9QA 2YFOA 3QG6B 2XNAB 1E9OA 4AIEA 2DKMA 3HE6D 4ZMQA 5BQ7A 5C0CD 2QPSA 3HMWH 2NQCA 4I87A 1CLCA 4JM2C 2W80C 1M1XB 4CU8A 3QUGA 5I8KL 3VB9A 3MBEA 4YHKL 4C47A 1RMFH 2YC1B 3L4TA 3DA0A 5FGRA 3QE5A 3GBEA 4XCNA 3WUZA 1DJGA 4LLUA 1I7UB 1HILB 3MRBA 4D8OA 5AB9A 5DJYA 5D5MA 5LNEA 1TU2B 1ZT4A 2IANE 4JO3H 5E6UB 1UOLA 1YC8A 1GC1C 3WEOA 1OGAA 2OZ4H 1KIQA 3MV9A 2K9FB 3DMMB 1CS6A 1QFWM 4JL1A 3ZKXB 4GB9A 4FZ8L 2VDNL 1XIWC 1NCBL 4GAJL 5BQ7B 4OV5B 1JPEA 3INOA 2CRZA 4PJAF 1HX0A 3OX8B 3S5LB 5HGHB 4TQPA 3BMVA 4JHWL 4JGJA 4M48H 1EZVX 3NSJA 1PLCA 3V9FA 4BWWA 4K94C 2CO6A 5B21A 4HETA 5HVWA 4HWZA 2CAKA 3P9LA 5MI0C 4FFZA 1XBDA 1IKOP 3PGFH 4OBSA 5AKRA 3KM1A 1UD2A 3LKSA 1U2HA 1WWAX 2NR6C 5DMJB 4MSWA 3GS7A 2VXUL 5F97E 4G9DA 3SZKC 4LCUB 3UJIH 4E9RA 1QSFE 1T0PB 5L2KD 4BE6A 3PQYD 1Z5LB 5HD8D 1KTBA 2XTJB 3MNWB 2CKBA 1WPCA 2PWHA 3CXDL 3GF8A 5KVGE 4AQ8A 1GAFH 1JI2A 3DHPA 4XVTH 4LP8A 5DTFA 1U8IB 3KLAA 3ZZSA 4MQSB 3OC5A 3DETD 3TC9A 5LXVA 4YZFE 3OV6A 3BD4A 3MSPA 4LPYA 4PRAB 3ULUD 4X7DC 1KCWA 3DURB 4M6NH 3T0EE 4XN5A 3X12B 5TQ2L 5LAXA 1KJ2L 2WW8A 3ML9A 4N24A 3KPRE 4JM4H 4I77H 3BP5B 4DCQA 2EINB 4BCXA 2IH3A 4ZW7A 3U0PA 1PS3A 1C5CH 5JMOC 1HHIB 4NP4L 3KEDA 4H8HA 3RGVB 3UTQB 2R0ZH 4EOWL 2F7PA 4QF1A 3I50H 3RURA 2NY0C 1DO6A 4X6CE 5HSFA 4XO5A 5GXBB 2ADJB 2XWRA 3FN0L 4N6QA 1FQ9C 5EC2B 5J11B 3OKKA 3JXAA 3KYMA 2PW2B 2QSCH 32C2A 1TOXA 5KOMC 4W9CC 1CLYL 1N5YH 2R27A 4JHBA 2X4RB 4G8AC 4HT1H 4MGXA 5DVKA 4B9GA 5J3HD 1OKEA 4GUPA 3UPCA 2CM5A 3MCG1 4N8VB 4PCKA 5CCKL 1IC7L 3W0WE 2O6DA 4H0HB 4N86A 4ACTA 1J05A 3GXIA 3DX9B 4PM1A 3GI8L 5CEYA 5GJSL 1A1OB 5DLMH 3ZOAA 1U8JB 1T21B 2A6KB 1NUNB 4OI9A 2PWDA 2PO6B 4LDCA 1KCUH 5EH1A 1NBVH 5EPMA 4FQ2H 4FMKA 4PJIE 4LSRL 3R7QA 5G55A 2JKWA 4HKXA 4AZ8A 3T3PF 3ABKB 4D0BA 4PI2A 4S1DC 1U8HA 3B56A 3EW3B 2H6UA 4OCYL 3OKMB 3DUSB 5I8OL 2C34A 1ES0A 1G7IB 2CGZA 3ABGA 3RGVA 4C56A 3U4BH 1YEKL 3BN9D 3ZL4H 3FFDA 2ZG1A 4EN3C 4ZFFA 3BIKA 1XGZA 2DL9A 3D3VA 4PS4L 4KH2A 1OTUD 2QVFB 4V2BA 3HEIB 1AZVA 4H8QA 4JY5L 5TE4L 1WS7A 4IMLA 4YVUA 3RWFA 4XZ4A 4UDUB 4DQOL 3QEGH 2QSQA 2IFGA 5E2TH 2CR6A 4PRPE 5AAPA 1WGOA 3A0OA 1NC2D 3REVA 5K59E 3L7FA 4JFWA 5F72S 1A7OH 3ZE1E 5BRZE 1QTPA 2ZKHH 2FHFA 1U8IA 4QJ3B 3IAPA 1P4BL 1LXMA 3B2XA 5F70A 4DGYH 3MCLL 3ASWA 1R3IL 2XICA 5FO8A 1G9MC 3CLFL 2C9SA 2D0HA 5E6ZA 1SY6A 1E8WA 3UJTL 2GJ6B 5PCYA 2A99A 3O2DH 2FIKA 5JHDB 2V2XA 4BELD 2YR3A 1YSOA 2VMFA 4Y2NA 5IZ7A 2A2QT 5C07D 3TNNA 5F9AC 3ULVC 1A5FH 4PLKC 3LRGA 3WO4C 2X1XR 3QO1A 1IB5A 4JUSA 5ES4B 4QNPF 4N2AA 4Z9KB 3NVQA 4M7KH 5TDOA 2GUYA 3V8CA 1UGKA 3IS1X 4GAGL 4ZW8A 2YXMA 3SEPA 3FN3A 1G7QA 1PEZA 4D2NA 5JORA 3RKDD 3NCCB 4PRDB 5ITBL 1FZMA 1NCUA 3GPSA 1QLFA 1JE6A 3BDBA 1NEUA 2P5WE 4XC1H 2ZAHA 4H8WH 2J4WH 3JWDC 3KPPA 5F7KC 4XRCB 5BMFH 5HI5D 4FFTA 1OTTC 1U8NA 3ATEA 4XB3A 3DGCR 5JUEL 4A7UA 2JIXA 4HIEB 4ZBJA 4Y2DB 1MOEA 2DQEH 4ZMPA 2WQAA 4ZSOE 3RRQA 2GIXA 2F68X 4ABUA 5AENA 5IHHA 3GSNL 4OJCA 4LLUB 5GRZA 3WU1A 2J5LC 2A7BA 5C08B 1BVKB 5HYIA 5DRNB 3TEUA 2J8HA 1DCLA 3LDBC 3UTTA 3TJEL 2XKUA 2WLNA 3FW6A 3KL0A 2GPZA 2HXAA 4BGDA 4K3DL 1KB3A 1SYVA 2UZYB 3EYQC 2CU9A 3G04B 3U1QA 3ZHLA 4CVWA 4YQXH 3O41A 4V1DB 4NPYB 4OSUH 3S88H 3CXFA 4Q56A 4RA0C 3V55A 1PJ9A 4G9FE 4FX5A 4WNQA 1AE6L 1UM5H 2APSA 2H41A 1A7BA 3MYJA 1JXFA 4U3SB 3ARUA 2OTWB 2YBGA 5IROD 1ACYH 3IDMB 4NQCA 4JVUA 3EIFA 4KHTH 3WNPA 3EJYD 5DLML 1QSEE 3MA7A 3LKPB 1QI5A 3GRBA 1L5GB 5CZVL 4DPRA 1QLEB 1E9QB 12E8H 4MJIA 1EXUB 1FH2A 2FHBA 1V10A 3SBRA 3CHQA 3WTYA 3TO2A 3FSOA 4AYID 2X4SB 3MRIA 3NTCH 3LVEA 5LVEA 3V4PH 1ZHNA 3CX2A 4ETYA 2AXWA 3RAJH 3K1DA 3OKEA 1G6RA 1H3UA 1WAEA 3DO3A 1O6TA 1IBFA 1QI4A 2WGXA 1RHHB 3GNML 2AK4E 3O6FC 5LBVA 4XCFH 2V5SA 3T0WA 5FUZL 1XVSA 5IP4A 2BJMH 1HWGB 5AB1A 1AZZC 5D7HA 5DS1A 5DCCA 2N1KA 4Z3JA 2C8NA 4ANVA 3T1WA 4XP6L 1OGTA 3LEYH 4NQCE 1E4XI 3FK3A 1E90A 3D18B 1NCAL 4GYBA 5JPMC 1KJVA 1TQCB 2WLLA 3JUZA 3KWVA 4GSDH 1J9RA 5MENE 1JAEA 4HP5A 3V4PB 5KYUB 4P46B 1L7IH 3HCVB 3HPJA 2YXVA 2GAZA 2PYFA 4MB1A 3QCUH 4PLKD 4GG8B 5TGBA 1HQ4B 4WAFA 3PWUA 3QZLA 4JHZA 3C6LD 1SRDA 3GZQA 4UQ3A 3DV6B 4QD2E 5DQJB 4FQHB 1WZMA 4CADB 2PKDA 1I31A 2JMRA 2DF3A 5AAWA 5D7LD 1A4CA 3VWJB 2HVBA 1BVNP 2JQZA 2LGNA 2OX5A 5I8EA 1S9XA 2AANA 5H37H 1PYWB 2O5ZL 1M3JA 1I1AC 3BVTA 2FATH 2EECA 2F7IA 2VLRB 1B9ZA 3M88A 1F6LL 4JFYB 3HVNA 4U05A 1H3WM 4MDJB 3QFDA 1UWFA 2YWYA 5L2JA 1GRWA 2EVJA 3BYYA 2P5PA 1DZBA 3NCEB 3RYMA 2Z31C 4WTWA 3LKRB 1NLBL 3R8BB 3GKWL 4WY7L 2YD7A 2Z92B 3E7JA 3NYKA 4NN7C 2EIZA 2OJEA 3COOA 1NC2A 5KSAA 2XN9B 5EUOE 1OVZA 1UB5A 2DM4A 4P57A 4S1DD 2YGPA 2VLJD 4BZ1H 2CLVA 3CDZA 4JQXA 3DJTA 1FN4B 1KLFB 4JO2L 3IDNA 3V0IA 4GQZA 2JH2A 2X28A 1VGEH 3CSBA 4M7LT 4YHIB 5AOKA 4TLUA 4X8CA 2V4LA 1BVZA 3E8UH 3OM3B 3F6IA 3QWNA 3GINA 5C0BB 1JF1A 3CC5A 4X5LA 1MNNA 2ROXA 2OP4H 2XTJC 3EJZC 3UAEA 3H42L 4G6JL 4PLJD 2F53E 5I30H 1J1XH 3CH1B 1MFUA 3HHMA 5AVXB 3KPLB 1RUPH 4UOQA 4P2OB 4TL5A 3RWJA 4MMXB 4ES8A 3AQXA 3W2DL 2BNUA 2XPYA 1Q90A 3PP4L 2OXHB 1NINA 3C2SA 4QRPD 4MAZA 4B7LA 1T0OA 2I9TB 3W37A 3UG5A 4XC3L 5BJTA 3FUMA 5DEGA 5E5MB 1II4E 3QUYD 4BEIA 2FR4B 2YIHA 3CN2A 2CQVA 3ILDA 4LCCC 1PQZA 4UNUA 4OH2A 4JANB 5BS0E 4I0PD 4QHUA 4AM0B 1KB5A 1C16B 4GW1B 4KV5E 3CE1A 4EN3A 3O2VH 4X50A 1S7SB 2EYRA 3PFQA 1G1OA 5H2BA 1AQDA 1E4XH 5IK3A 4F15C 5BUPA 3R06B 4FG6C 2CUHA 1SQMA 2XWBB 1VKXA 1TJXA 4TMPA 2Z9TA 4ENZA 2Q86B 2GK0A 1XSJA 2VNCA 3ULUL 5J4MA 3DETC 5JNYB 5IB4A 4HCRL 3HLKA 3Q06A 2G2PA 5F7DB 2O5NA 5I71B 4H5SA 4X6EA 4MHHG 5MEQA 3QA3A 1XB6A 4K3EL 1HN1A 3HUJE 3UXFA 2X70A 3IDXL 1AYOA 1EK3A 2QSCL 5GZOD 3L3DB 3N1GC 5CN2A 4B0MB 4ZFOB 1AQHA 5IW3A 3L9EA 5HYQA 5E03A 1TEGA 3PL6C 4HK0A 3FTUA 1FJ1B 3CDGA 4NWTH 3MLXH 3UTPD 4WHYH 1DQIA 2H9GA 1YQVL 2IPUK 4PY8J 2GY7B 4PJXB 2QV4A 2G5BA 5GGSA 3K6FA 2CM6A 2XBDA 2CO1A 3OR6B 1GGIH 4FFYA 4GLRI 5D1QC 1PLGL 1SJXA 4NT6A 2CO3A 3P40A 2WLIA 3TU6A 3Q6FA 5IV2B 1PX3A 1GY2A 3BKJL 4W9LC 4YZWA 1NBZB 4QHLA 1RLWA 5EF2A 3BI9X 5B38G 4XPAL 1CURA 1FFQA 3JT2A 2OK0L 5IW1A 4YE4L 3QWOB 1JWSA 4ERSL 4J2QA 3JV4B 4PJAB 4XCYA 2X9YA 4AQ1C 2LTQC 3RHWK 4ODUA 2UY7B 3GSRA 1OAUH 4PJXF 5HYJB 1MH5B 2GABA 4LARH 3RBGA 4K9EC 1RFDH 3F7VB 2YQ2A 1ZLUH 1E67A 5L2KA 2AV7B 2MTPA 4HOXA 2YEZB 1P7KB 2B0SH 2F58L 4FL4C 3BPOB 5E2WL 3V4VL 4YR6B 4JB9L 1XO8A 3S96A 1A7QL 4BQ6A 3LZFH 3WNOA 4UTBH 5DZJA 2XY2A 4A6YL 1R3KA 3LS5L 1N0LB 2UUDH 1N9PA 5GRXG 3N55A 4OQTL 3GGWA 3P2DA 3PWPA 5LDUA 1QLEL 1USQA 1PZCA 1U92B 4MXWH 2G9HB 5HVHB 3ESNA 4MJJA 3VD1A 2M8XA 1JGVH 1FRGH 3IRZA 3S4SA 4K73A 3WE1A 3U6RB 4PGJA 4GQQA 2QV2A 3MV7D 5GJSH 5MEOA 5E9DE 3VFNB 3T4AC 4IW4C 1TFPA 5MENA 2AJ3B 3B9EA 4FYQA 3UTZA 2JKRM 4GXFA 4APXA 5D1ZB 4UMGA 4DERA 1DQJB 2AJSL 3TIEB 5CP3H 4GAGH 1AD9B 3KPOA 1MFBL 3FRUB 4R4NC 4FLHA 5LCVA 5KZCB 5DD6A 1YAZA 4XMKL 4LLAA 3V52H 2Q7NA 5KSAD 3KH3A 5DGRA 5F6HI 2NQDA 2PXYC 3L3OC 3MJ8A 2EKSA 3OZ9H 1AHMA 1R33A 1D6EA 1B3JA 5D7JA 4HUVA 2DQFA 3S34H 4ELKA 4F8LA 2ZYSA 1PAZA 4FTVA 3O0LA 3X11A 1CN4A 1L0PA 4HPOL 2YGNA 1UT1A 3FTGA 1BXVA 5D9SB 4M6OH 1XB3A 2GK0B 2VSDA 4OJYA 3MA9H 5IBLD 4HV8B 5LAPA 3BO8B 3R06A 3ILPB 4NQDE 4ZS6C 4KDTA 4PJ7E 1H3PH 3WG7B 2NCMA 3RWDA 4XZUB 3LHPH 1SXSA 4ODHL 4QDGA 3U4BL 1IFGA 2BRQA 3W11C 2NY4C 4M6NL 2IDTA 4YHPB 3MREB 1E9PB 4J8QA 3K6SB 1U0QA 4IHOA 4PTUB 2HX8A 2Y36H 4HVBA 5B38A 1P2CB 2NY3B 2FRGP 2EE0A 1XIWA 3DDFA 1K5NB 5AVZB 3CSPA 4HWEL 3WEXB 3KYNA 4QRPA 4Z3GA 2I60H 2ALWA 2PO6D 5CD5D 2E27L 1YNTB 2DIBA 5CGYD 1OP5K 3P3TA 1E50A 2DWEB 3H53A 3P30H 3QDJE 1E7UA 5F9OL 3C60B 5I8CA 4YQXL 4I0PA 1FA4A 4AVHA 2VKWA 2WWKO 1C12B 4NI6A 4XI5C 3TLRA 3A24A 3BEWB 1MHCA 2DH2A 5D7EA 2DLFL 4X4ZA 1EJ8A 4KTGA 1MZYA 3PUUA 1N10A 3I6GB 4EIUA 3BGMB 2XVKA 1Q1JL 4RX4D 3TBWB 4X9BA 4YDJB 2XFXB 3K71B 1BF2A 2AQNA 1QHOA 4QXTA 2WAHA 3WNNA 1SLWA 4L8DB 2X9ZA 3GMNB 1XF1A 4RZKA 5DK3A 1EA9C 4CBZA 2BHUA 4ANKA 4Y1AB 4FQJH 1XCQB 3C87A 1E3XA 2X3CA 5AW9B 2LTQB 2O61B 3ABLB 3GNMH 1TZIB 2XYCA 1XGQA 3C5ZA 9CGTA 1ZVHA 5D2LF 5BZWB 3WTUA 2DQJL 4PJCF 4W9ZA 3RTQB 1UUNA 2GY5A 2ADIB 1U8KB 1XT5A 2LLGA 5C0AE 3EADA 4F7KA 3SY6A 4A2DA 3ZUCA 4HK3N 3WIHA 4BZ2A 5J56B 5ISZB 3MV01 3POCA 4O00A 4LQ1A 2EDLA 2EXSA 2KMWA 1BZ9A 5A2LH 3TV3L 4HHAA 5IQNA 4BFNA 3BUBA 4A7QA 4JG1L 3HHSB 4NUJA 5KN5A 1Z66A 1FLTX 4FQXD 5A3IC 2WANA 3QDGE 4OFKA 3L1OL 1LNUA 4ZNCD 4PJIB 2XBTA 4KNUA 3QUML 1W72B 4DPBX 1CGXA 4WEUD 2R4SH 1SMDA 2RJMA 3V0WL 5DQJA 3F7KA 3BP6B 1OEZW 1UM4H 1MQKL 4AV5A 4CVXA 3PDOB 4BK8A 4FNLL 3KPSA 2KKQA 4JPKH 3HAEH 3UACA 3EBAA 1CYWA 3CZUB 3NCJH 4O02A 3TBVA 5IHUL 3E2HC 4NNYB 2YA0A 2BOBB 5E7FA 3JTSA 2WXPA 3NT0A 5M95B 3WTVA 4A04A 2IH1B 3CFBB 2IC2A 1WO2A 2Y06H 3VI4E 4B97A 1R0AH 1NL0L 1E3FA 3BWUF 1BX2A 4GQ9L 1JTTA 1VENA 1CTOA 2OR7A 3MI6A 4FNSA 4GXUN 5IROA 2VDLL 5T3ZH 1E4HA 3EUUA 2M83A 5J6HB 3ELAT 3Q2LA 1BYOA 2IVFC 3GSVB 1R3JB 3TYGL 4TVUA 5FHBL 3INUH 3WL9A 5IVZB 4YHMH 2NUTA 4QJ5B 5D1ZD 1TZGH 2YZ8A 1O9ZA 4MQXD 1RZQA 5LGYA 3SPHA 1CVRA 1TLKA 1N68A 3CLWA 3MNZB 4DVBA 4YO0B 4E0RA 1HZHL 3U30B 5JDSB 1Y18B 4BUHA 3MQIA 2W9EL 3BAYA 4J3TA 4NJAL 1OIOA 5FWQA 5MEND 3U4KA 4FS0A 1MCQA 4PJ5B 3D0LB 4F7PB 4JZJA 3O6FB 3U2SA 3MUZ1 3QUKB 4L4TD 4HHGA 2X4TA 3PDDA 5E1IA 2DQUL 3WKYA 3TZVA 3AG4B 4DEUA 4PV8A 3GHPA 2DQCL 1I9EA 3LN9A 3GDBA 4Z7NE 2J20A 5MHSD 1V54B 2OMVB 4ONGH 3BUPA 4PJHE 2NXZB 5CSGA 3TN0C 3JBG7 3T0BA 1CGYA 4FN0A 3SDAA 4XH2A 3L5XH 1Z3GL 4ECNA 3GLEA 2MNJB 3H9SA 4V1DA 3MUY1 2F8OA 3GIVA 4XO9A 4R5XA 2IG2L 5AKSA 1REIA 4DF9A 2AABH 1Y6MR 1MG2C 3BH8B 3PWNA 2CD0A 2J6EL 2QZ5A 3IAQA 3HG1A 1MIMH 1HHHA 4WEBL 2OMWB 4ZZFA 3RDTC 1OPGL 1DQQB 2XXGA 4KHTL 4M1DH 5AVWB 4AWJC 3F7YB 4JFUA 2HTKD 3ULSA 2ENJA 3UAJA 1M3IA 4A55A 4GKOA 1IO4C 2P45B 3MACH 5HI3D 5DC4B 3D25A 4I48B 5HDBB 3HG2A 5I2IB 4OU3A 4XH2B 1PD0A 1QSFA 4Z7WB 2LHAA 5T1KA 4KI5E 1QNZH 1MI5A 3CVHL 3IE9A 1ZE3C 5J5EA 3Q3GA 3V2AR 1IX2A 4G6JH 3TZVB 2O4EA 3GMPA 4R96A 5DK0B 4PGDB 5ESVB 1TJHH 2JK5B 3ZE2B 2FH6A 4ZW3A 3ULUF 2FGWH 2NUPA 3V4LA 4UANA 3DOIA 4P48A 5MI0B 1XSOA 1IAIH 5CJQL 3BESR 4PJEA 1NCOA 1I8AA 3KLHD 1DN0B 2JQAA 3EO1A 2X42A 2X7LB 2VDNH 1XH1A 3NEOA 4U6TA 4F2FA 3B43A 3VXUB 1BXXA 4RWYH 1BVLA 3D52A 1MCKA 3O9WA 2HB0A 4ZOAA 5ACMA 4IEFA 2YOCA 5ANMB 1JV5A 1DJSA 4HKZA 3HIZA 4NQTA 3VG0L 4F37K 1E4WH 4OTXH 3R4DA 3FQYA 1BEYH 3VJ6A 3C5JA 2EE9A 1MVUB 1QSEA 2NY6C 4JFSA 3T2PA 4DEWA 1SFDA 4KZEL 1FFOA 3KHOA 1KTLA 1Z2KA 4W68A 4WFHE 2WZ6A 1QVOA 3MFFB 4LASL 3UPRB 1KBGL 5DT1H 3H2QA 2F1EA 4FXGC 2RGSA 3BP7A 3HMXL 4BHUA 2QJDA 4LASH 3S8GB 2G9KA 1GIGH 1SJVA 4JFTA 5IESH 5DJAA 1XGTA 4XE0A 5A2JH 1OLZA 1WBYA 4OGXL 5I5JA 4APQB 3NCMA 5ECGA 3US1A 3F5WA 4XN7A 1LQSR 2EO7A 4PIBA 4Y4KD 5L8KB 1FG9C 2AAVA 5DRZA 3UH8A 1WISA 1UWXH 4H26B 3MRRA 3RVVD 2E4FA 2H0JA 3NSXA 4G8GD 4DP1X 1ODUA 2J6EA 1HSBA 4HIJB 1N8OE 5EZIL 1EFQA 1JZGA 2DM2A 3CFJB 1XD0A 4LPCA 3VWJD 1RK1A 5CZKA 4E42B 2GK2A 1X44A 2CUIA 1U95A 1MWAA 2B39A 4PJGF 4R7NB 3TO4D 4UBDC 4AQAA 5C6TH 1TJIH 4UYQA 5GIRA 3VG9C 4R4BB 1A9VA 2WNKA 3KPSD 4L3CA 2C3GA 1X3DA 3H4FA 2OI9B 5I16B 4M3KB 3AM8C 3LPWA 3GXNA 4FHBD 3NN8B 3EDJA 3QJFB 5I6OA 3IDIB 5A2CA 1ZANH 4GRLD 1TZIA 3IJEB 3E6FA 1A7RL 4LSTL 4XPHL 4N2MA 3OKOB 5J1SC 3HE7D 4I1PA 4Y19A 2JK5A 4N9OB 4FCHA 1XSKA 1BA9A 1U3YA 3H7LA 5C09E 1SN5A 2XN9D 5DFVD 4Z7WE 2XOTA 4BKLB 6FABH 2BP5M 3A4FA 4LSVH 4XOAA 2R1YA 4EZLA 5DR5L 4DGUA 4TRPL 4EIGB 4OD3L 4RGNE 2DN7A 3VD7A 5I1JL 4RDQG 2C4FU 1N7ML 3MYZA 3APMA 2XWJA 3OBAA 1HL9A 4Q9QH 1CQYA 4QF1B 2KL6A 4HF5H 4RSVA 1G7MA 3S3CB 3X14B 3VI3A 1LO0H 2VLJE 2WLHA 4FQJL 3H9YA 3VI4A 4XAKE 5ENWB 3PHQA 3RJDA 2B20A 1XMWA 3EYSH 2IOMA 3Q8FA 2F53B 4BSJA 4E5XG 3N3EA 5HGAA 5DRWB 2DL2A 4QO1B 5F9WC 5AYUL 5K33A 3DVIA 1Z9NA 4F7EA 2XA8L 2BMKB 2K7QA 1WICA 3L9RB 5EN3A 2YUWA 5C0RH 4BH7B 3SKNA 2YA2A 5E6RB 4IHOB 4PTUA 1HESA 4UV4H 3WKMH 2HH0L 5FLVA 2YWZA 3TONA 3WIFA 4CGTA 2P5ED 5DVNA 2WOYA 3FB5B 5F9OH 4O9HL 1L9OA 4YFLI 2X4QA 3U2SB 4WI0A 1BLNB 2WD0A 3UJTH 5CEZD 2MOVA 1FHGA 2AXHA 4FLSA 3O4OB 4GW4A 4XPFL 4BFOA 1F58L 1GZQB 4OKVA 3U9PH 3SPIA 1RY7B 2ICWB 4H1LB 5TDPA 1G9MH 3GSWB 1IBHA 1MWOA 2PLTA 4JFDE 3LNFA 3KWUA 5D7JB 3T9WA 4YDLB 3GMOB 5BO1H 3OHMB 1RLBA 4PJ9B 5F1OB 1R0AL 3B83A 5ID1A 3M6DA 3W2DH 4XPGH 5B1AB 3PGDB 1G9NH 1LDPH 2B5IC 2AJYH 3S37X 3C8DA 2P4AB 1SVZA 2N0MA 2B15A 2E9JA 2PCFB 5CJOH 3TF7C 1P4LB 3C6EA 4Y4FC 4NPKA 4YBHA 2J88H 5F0JB 3DOHA 5KVEL 5C86A 1F4YH 5ANHA 5DJYB 2BSTA 5CD3B 3QJRB 5ITBH 1J8HD 1CL7I 4EVNB 4OLXH 3QBTB 1T5XA 3RL2A 3QIWB 3Q1SH 4LKCB 4NB7A 3FH8A 1I1RA 3FO9A 1CT8A 1WFMA 3MUJA 1JPFB 4JVPA 5TPWL 3ECBB 4P5TC 3ZGHA 3LD8B 3MV9E 4E2OA 2QADC 1LK2A 2J1ZA 1R24A 5SWSE 5T5NG 3RWHA 1BQSA 3BDXA 3PWPB 2DKSA 1J0KA 4HJEA 4L4VA 1WTGT 4HDIA 2C7FA 3VU2A 1N0LA 4FKKA 1OZTG 2LV4A 1S5HB 3JTTA 1H19A 3S96B 3HC4L 3MRNA 3NN8A 3NAAH 4WUKL 2UYLA 1JI1A 4MD4A 5KYWA 2NY4B 5IJCC 5IR1B 4FJ6A 3GJFH 1Q0YL 1YECL 4Y7OC 4ODVL 5D1QA 3ZYJA 1ROWA 3BH9A 2H26B 2V7HA 1ZTMA 3KYOB 3MLYH 4MA1C 1WP6A 3RWCB 1X9RA 2LAGB 4D94A 1ZIBA 4K3GA 4J3SA 4KRMB 3O8XC 2VDKH 4PR5A 5B39A 4G2AA 4DIXA 1JWSB 4V1DE 5LLIC 1R1CA 2WMPB 4N87A 5LXGH 5E9DB 1D9KD 1QHQA 1AHWC 3RIAK 1JXJA 4U1SB 1WDAA 3ARGB 1ID2A 4Y4HA 1OOWA 5KVMC 4XMWA 4GXUM 4F3FB 2DWDA 2QTVA 5ADOH 1NMBL 4OCSL 4RRPA 4X98B 2WBJD 2YAOA 4DTGH 3MRFB 5CWSA 4HOMA 4L1SA 1FL6A 3IBEA 4IKKA 3FT3A 2LAAA 4PGEB 1H3XA 3ATBA 5I6XB 1WVZA 4WWPA 1OE3A 2EIKB 3PWJA 3BJLA 3FUHA 2V3EA 4KK6C 2Q9OA 3C8HA 1Z32X 3SY0A 4UAHA 4YXHL 2EIBA 4ZUTB 3LV3B 4DKTA 1OW0C 1CPUA 4C56D 2BW4A 4HKJB 2AMUA 4LNVA 4AITA 2D4DA 1T4KA 3D0VB 2BIPA 3UYOD 5B8CC 2QQNH 5D2NA 1XF5B 4KO6A 4DZBA 3QISA 1RUPL 5C0GA 3ZMEA 1CXEA 5C9JB 2TSAA 1AZCA 2PTTB 1V27A 1QQDB 2VCOA 3UC0H 2A73B 5E99H 3K2IA 4JR9L 5KANG 1P2CA 2XWTA 1PG7L 3G6AA 5BNXD 2UXGA 4BFBD 5K9KA 2VDPL 4FG0A 4NENA 3JTTB 3HNVH 4JN2B 4M4PA 1NJ9B 3BPLC 2UY6B 2DWYA 2AQPA 2FZ3B 3UL4A 2M2DA 1S7TB 4JZOB 2FZ3A 1YYML 3MROA 1ZK5A 2WNXA 1VADB 3B37A 4L9LA 1IFHH 3L3HB 1Y07A 2CR0A 1GVIA 5D6CB 4P04A 1IAKA 1NGXB 1OXYA 4LCWA 4ODXB 4MA8L 5D9SA 1E5YA 1FV1B 1NFDE 4YDLC 5D7JC 4PVNA 1TIUA 4YNYA 3VGFA 1M2VB 3MBXL 4LKCA 1NGZA 3U4AA 3EH1A 3QZWB 4MVBC 5A43C 1X9UA 5AL0A 4YN3A 2L0DA 3UTTE 4EVNA 3RVWC 2D9QB 3U2IA 1KNOB 3VB8A 1LLAA 4GG6B 2Z8SA 4DGVL 3OAZH 1SEQH 3MKKA 3RIFK 2BVPB 5KSUB 1A3RL 1HHGA 4Y4KB 3HNSL 3C6LB 2E6PA 3SN6N 5TF1H 1INDH 3AWFA 3WCYA 2OMTB 2VDQB 4NFCA 4KRPB 4XNMA 2C9VA 2WXHA 4PVBA 4OJAA 3WKNA 5IMKB 4H40A 4L3EE 2QZQA 2BWQA 4OLVL 2X4PB 4PJDB 3AS1A 5HGBB 2R8SL 1K4CB 5T1MB 5CBAB 2WIMA 4WNSA 4OM0H 4WK2B 5IT2H 2DD8L 4F3FA 1S9YB 5C1MB 5ICZA 3HOGA 4HEMA 4U3XA 1A9BB 1KXQA 2OYLA 3VD5A 3IJHA 4NM8H 2O6EA 1SF3A 5I30L 1FFPB 1NFDB 4OF0A 3WNKA 3HUJA 1K5WA 3HUJF 3BE1H 3D9AH 4CBPA 1M42A 5IQMA 1M4KA 2YEQA 4R3SA 3S3PA 1ANUA 1ETZB 4GLRH 3D4ZA 5I19H 4PJ5E 5J12B 5GS0D 5D1XE 3FU5A 4P5RA 2P7TB 4YO0A 3B8YA 1TO4A 1X4YA 4KZEH 2AV7A 1JWMA 3HZVA 3BCDA 4MA7H 3B9VA 4ZS7H 5FB8A 4G6MH 3LZNA 1M9SA 4L3A