4AGOA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5174
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agoA00
3D08A 2P52A 5AOKA 5ECGA 3D09A 1LJMA 2J1XA 2BIPA 4AGPA 5AOLA 2ADYA 3D07A 2J1YA 1EANA 1CMOA 1EAQA 3IGLA 2YBGA 3WU1A 4IBZA 4MZRA 4GUOA 4AGLA 4L18A 3D06A 3D05A 4AGQA 2ATAA 4IJTA 3EXJA 4LOFA 4IBUA 4G82A 2J1ZA 4IBWA 2MEJB 1HJBC 5AOIA 1GZHA 4IBSA 3WTSA 3VD1A 4AGNA 4G83A 4XR8C 3EXLA 2IOIA 1T4WA 5BUAA 1GZHC 4AGOA 2J20A 2H1LM 2OCJA 4IBQA 3WTXA 2BIOA 3WTUA 2J6WA 5LAPA 5KBDA 2X0UA 2WGXA 4IBYA 4KVPA 2IOMA 4MZIA 2J1WA 1EAOA 3VD2A 3WTVA 4L0YA 1HU8A 2J21A 5AB9A 3D0AA 5G4NA 4QO1B 3WTTA 3Q05A 1UOLA 2VUKA 2X0WA 3Q06A 2GEQA 2BIQA 5LGYA 5AOMA 2XWRA 4LOEA 3ZMEA 3WTWA 2FEJA 1TUPA 4L0ZA 2IOOA 1E50A 1HJCA 3TS8A 2RMNA 5G4OA 1TSRA 4GUQA 1IO4C 2X0VA 5A7BA 2XWCA 4IBVA 1H9DA 2AC0A 3US0A 2PCXA 4IBTA 3Q01A 3IGKA 4A63A 2BIMA 3QYNA 5ABAA 3VD0A 5AOJA 1YCSA 3US1A 2BINA 4HJEA 4AGMA 3KZ8A 3KMDA 3WTYA 4LO9A 1KZYA 5G4MA 2AHIA 3QYMA 1CO1A
chains in the Genus database with same CATH superfamily
3CLWA 4H1LA 3QO0B 2VQ1B 3RL1B 2AEPL 4FXKA 4N68A 1IEAA 3D07A 5KYXA 1PZ5A 3ECWA 3JV4A 1KV7A 3CFMA 1ZS8B 4WW1A 4IW4C 1MFCH 2EXWD 3B7YA 4Y8DC 4C57C 4XH2A 3GS0A 1XZ0B 3ZGHA 4P46C 4NI3A 2XPZA 5ID0A 2B77A 4QAWA 1JZ3A 3GEWB 2NYYD 5J6SA 5FV1L 4X7TA 1GJIA 4J3OH 4TSCH 4GQ9H 2WXNA 2MCAA 4KNUA 2WY3B 3AUVA 5KAQF 4UINH 1KJ3H 3M1BB 1VACA 4NWTH 1I7TA 4WEUD 4JLRA 4FDWA 4PRHA 3T8XA 2WNKA 1MRFH 5E1AB 3SBPA 1GGUA 3VW3H 4EZKA 4IRZH 4OCXH 2O5NA 1E3ZA 1A5FH 3BT2H 5KJRH 1TZGL 4KKPA 3ES6B 4N0RA 3MJ9H 3UP1A 1OXYA 3EH3B 3G6JE 5F89A 5KBDA 1GA2A 3PXLA 3MGOB 1PBYA 4HPOH 2CAKA 4UOW1 1KIRB 3C2AH 4GRLB 1F58L 3P77A 1U6AH 4WTZA 1KPUB 4GKNA 1XSKA 5T1DL 4NNPH 1NUNB 2HJFB 2Z34A 3PWLB 1AXTH 4FXGC 5EU5B 2YAQA 3P11L 5C0FA 5IB5B 4FYSA 3WTVA 1ET7A 2OR8A 2ZPKH 1FPTH 3P4MA 4LU5L 4M62H 3TT3H 5TDOA 1XHHA 4KKZA 5ESAA 3EOAB 5KVEL 1XVSA 5E6ID 3IF1A 4LLAA 2MOQA 1T2QH 1CICA 2JXMA 4F7CA 5JXAH 3QFJD 1OGAD 5IBTL 3RE0A 1Q1JH 1ZAGA 3D25B 1FYHB 1TTCA 1QVOA 3Q5TA 1NGXA 4KTEL 1BQLH 3FB5B 5C0BA 4P4KC 4XAKE 3FQNA 1JXKA 2X4SA 4PSRA 3AM8A 4LP4A 5B3SB 3UBXB 4LAQL 1OK0A 1H6FA 3RPBA 2XFXA 5DS2A 3ROLA 2WSPA 5E5RB 4BFGA 1URIA 4IJ3C 1DVTA 4HJEA 1D6VH 2HVJB 5A2JH 1KLUA 3SKOB 1PD6A 2P5WA 1HOCB 4FERA 1IGIL 2YN3A 4FTVD 1RZGB 5BNXD 3QEHA 4UIMA 4ZUSA 3BGFC 5I30L 5INCB 5CJQH 1AC0A 5BVPH 3TC9A 1TDQA 3VFWA 4TN9A 5AB2A 3LEVL 5IEHA 3IXAA 1J88A 4TUKL 2IPKA 4L1TA 2NX5B 3O3BA 4PIBA 1D7BA 3VH8B 1N12A 5IQ7H 1CMOA 3GLZA 3GSWB 4JGNA 3HAEH 2VN7A 5L2KE 5DD1H 5DS8A 5JNYA 1WTLA 2WANA 4U0QB 2BNUB 3UBGA 2GJ6A 4U1GB 2H47C 4HBCH 1IGMH 3CDFA 4V1DE 5EO0B 2W9LA 1AD9A 4LCUA 2ZCHH 4NUJB 4NQDE 4N6RA 3WE6A 1BD2A 3CHQA 1I31A 2FHCA 5IHLB 3CHRA 5DXWA 3UERA 4HWBH 3K3QA 3EXJA 3QUGA 3V4PH 3V6FB 1YEIL 4XTRC 2IPUG 1XIWB 2DPKA 4WO4D 2XKNB 3X1GA 3HRPA 4AKPA 1ZT1B 3ARFA 4D2NA 4MAYD 3U83A 1BW8A 4JFYB 3GRWH 3UBHA 3S8WA 3ZZLA 3TJHD 5DJZB 5I15H 4H0LC 1JVOA 5FYJU 1J8RA 4EF3A 2Y07H 5B4MC 1PX8A 1DJGA 4XO4A 1RZ8B 1CDGA 2LLNA 3ZTCC 5I6PA 3MBXH 2FIKB 3NK4A 1MVYA 3L3DB 5J4MA 5FYJD 1WWAX 3CHOA 1YEKH 3N55A 4FXGA 2WNGA 4GXUM 1BVOA 1CB4A 1OOWA 4UU9A 4UV4H 1C08A 2QKIB 2P47B 4LL4A 4IS6B 1LP9F 4U3SB 1FYTD 4ELMF 3NJNA 1HZLA 2RHEA 1B0RA 4G70B 3LH2H 1CD1B 2AV1A 4I88A 4OV6F 4V11A 1M6OA 2ERJC 4OCYH 4B27A 1H0DA 3HPJA 4OZFG 3WEAA 3FFCA 3PWNA 4A68A 1YC8A 2HG0A 4M61B 3MNDA 5E99H 4PJ8C 3MV7E 1SM3L 3CSYB 3P4LA 2MKWA 5AAMA 4YC2B 3EH5B 3ORJA 1TCRA 4CDGC 5CD3A 2OZ4A 1KENH 1R3KA 5AKVA 2FATH 4AM0A 1H3XA 1U8OB 4P2OC 1DQQA 1HN1A 3ARYA 4F3FB 2X0VA 1WF5A 5INDA 3X13B 5JZ7C 3PXJA 3SOBL 3F6IA 1ZV2A 1B2WL 2EH8H 2EACA 4YX2H 5BUPA 4NQTA 5JHLH 4NQDA 1VCBC 4YBQD 4R4FH 1KTCA 1EZSA 2VXQA 3WL9A 1RZ7L 4ZSOB 5D72H 2SEBB 1ORQA 1DQMH 4BK4A 3AQXA 2Y22A 1IT9L 1S9XB 2F74A 4XE5B 4ZX4A 1RZKC 1DP0A 2V9QA 2VW7A 3T2NL 3EJTA 2CR6A 3H53A 2NXZC 3C6SA 5IJBC 5E8NB 1FO0B 1A6VL 1INQA 2QL1A 3BAJA 4CC0A 2BIPA 4YHKL 1FDLL 5L7XH 3K72B 5EUOA 1KYAA 2Z6FA 3IN0A 5JOEA 5DJXA 4OZHF 1UJ3B 5INDB 3GT6A 3PWPD 3EYQD 2GVYA 3NJJA 2ATPB 3L45A 2CLRB 3DURA 4MKTA 4AT6A 2ZD0A 1ZLVK 5IEKA 3I6SA 2PTTB 1NBVH 5FHAH 2NY0D 1EEZB 2V7HA 4DPRA 1X5ZA 1Q9LB 3PNRB 4FADA 3GBNL 4ODWB 2AVGA 3ZKSD 1BIIA 3NACL 4NENA 4PJGB 1BF5A 2BNRA 1U3YA 1JPFA 4IBUA 5IREA 5DK3A 3LCYA 3IDMB 3MPCA 3FFCD 4X5PA 2IC2A 5B7FA 4EI5A 3L6FA 3FSOA 2IAMD 3ZL2A 4MAYB 4Z8FL 4ZX6A 1DBBL 3MV7A 1HESA 4I13B 3APCA 3N41F 2OCJA 1MHHA 5E8EA 3N3EA 4JJHA 4Z0XB 2F5BH 3FK3A 4JFFD 4BSVA 1AZNA 1MWOA 4Z6AT 1W0WB 4DIXA 3I75A 1YEDB 4BFBD 4E9RA 1NL0H 3HBZA 4WSJA 3DYPA 4PJEB 1F5WA 2QEJA 1H19A 4P99A 1U3HD 2COQA 5A16A 5DJZA 3L16A 1SYSA 1R1CA 1B4LA 1OP5H 1COBA 9PCYA 1WDAA 3UJTH 4DEPC 3RDTC 4MXQD 5IUSA 1QATA 2V2TB 2BP8B 3ARFD 4G11A 1P4IL 1UOLA 1ZMYA 4TLUA 2EH8L 1M7DB 4QCIA 3C5SA 1ET5A 4XPAH 2UZIL 2VLLA 3LD8B 4QXGL 1C16B 3VMOA 5C6WH 1QSFA 4ECNA 5JW5B 1HEZA 3IE4A 4Z7AA 3F8UB 2Z8WC 4J3VA 1BJMA 3D5OF 3WEOA 1P6WA 1HJCA 4GUPA 3MYJB 3D69A 4AQAB 4E9SA 1VRSA 2BRRL 5DMJB 4ETQB 3D9AH 3T0DA 3GSWA 1XH2A 2E46A 3GIVB 4I9WE 4OLVL 1BF2A 4M61A 3JT2A 1BWWA 4OZIF 1BZ7B 4PB9L 2LLGA 1IGTA 1CLVA 3IFNH 4H8PA 4QRAA 1XGQB 5DFAA 5TPWH 5DGRA 2KERA 4JFZL 2H0PA 4JFDD 4AUYA 3V6ZB 4PJDE 4MQXC 4HT1H 1M7XA 3FB8B 4WWOA 3ZQXA 4IIQA 2I60L 1SOSA 2EYRB 3LKNB 2KYIA 3BD4A 3AY4C 1NCCH 2V9UA 3QWQB 2VW6A 2BH0A 4FNUA 2NYYC 1YMHB 4QXTB 1N6QH 2LW3A 3F12A 5K9KB 1DQJB 5D4QA 2FK9A 4XNDA 4FQXC 3DBXA 4A55A 1VESA 5HDWA 2VQTA 2QJDA 4YSOA 5HHMD 1WZAA 5L2JB 2QPFA 4KY2A 2XBZA 3F05A 1JFQH 1MQ8A 5D93C 4P57B 4ZAKA 3W11D 2A5UA 1CICD 1WT5C 1BA9A 3IKCA 1I8UA 3MJ7A 2VXUL 2NZ9C 2Y69B 4AZUA 2XPGA 1BDYA 2ZX7A 2NNAB 4LLMA 2OMYA 1MCNA 3MO1A 4R0LA 3HMXL 4Z3TA 5IFHH 1BVNP 2PO6B 3GO1L 4ELDA 1S78D 5EDXA 4MA3B 1E43A 4UIKH 1I7RB 1PY0A 3ARGB 3GSOB 5BUAA 4KRLB 3D0LA 5CN1A 2H1LM 4XHJC 2F8OA 4LLDB 4FFZA 1QTYT 5IBUB 1I9JH 1NFDA 3J8F7 5EA0H 3VFTB 3IKCB 3UZQB 3SIKA 3E38A 3VFWB 2F58L 4XCEB 1BAGA 5H2BA 4OZGF 3HE6D 4ZUSB 1SXCA 4P4RB 4YFLF 4CVZA 2QZQA 1ZVSB 1ERNA 1KFGA 5SV3A 3LXAA 5LG1A 1A6ZB 4POUB 2YBRA 4OFYD 1QFHA 2XVLA 2UVEA 3WFHA 1Q1JL 4MA8L 4FOMA 1C1EL 2ETWA 4KX8A 3LQMA 5K9KA 5L9DH 3QDJB 2X70B 5ESQB 4RSYA 4UILH 4Y19B 4P2OB 2Y24A 3EJRA 3B1UA 4KZEL 3CC5B 1ORSA 4L5FE 4MHHG 4UM8B 3RUGE 3T0XA 2OMVB 2ADFL 1XGUB 5D5ME 1JGLH 1FRGH 1I3GH 2AMUA 4ZTOH 1FFOB 1EEYB 5LNGA 3GMOA 4R90L 3ULUF 3F5WB 1LVEA 2VN4A 2CQVA 5JPMC 1KXQA 4IBTA 1USQA 2WLLB 3FTZA 1EZVY 4OCLC 3SBWC 2QV2A 4YGVA 1PZSA 1AMYA 1CFQA 4FEMA 1A4AA 3WLWC 2NY0C 4DNLA 4GUPB 4R83A 4MS6A 1BFSA 3GQFA 3LD8C 4JQIA 1HSAA 4AL8L 4X83A 1G7QB 3FHQA 1TLMA 5DZNA 4XC3L 4IOIA 3PXHA 3KL3A 3L5HA 5F7WC 3QIWD 4F7PA 1N0LB 5AW0B 1T7YA 3AS0A 3PGFL 2JH2A 3OKNB 1PTZA 1LD9B 2VN5A 3NZSA 4OSUL 4CKVX 5IHZA 1RIVH 2ITCA 3WLBB 5AFAA 1E4XI 1G7LA 1J1XL 3JV6B 2D2CC 2XWBA 2JLLA 3BP5A 3QXAA 1AMXA 2FSDA 4JPVH 3U82B 5CBAB 1IAOB 1NBQA 1TJHH 3HBQA 1KB3A 3QNYB 1JGUH 3FCSB 1BPLB 4FTDA 3CX5J 1MFBH 4KNQA 1G9HA 3IGUA 1X9LA 5C07D 1PKOA 1HAUA 1QLFA 4EN3C 4EDWL 2J43A 1AQDA 1F11A 1XMWA 3FH8A 5E8EB 1S5HB 1M1SA 1RJZA 2R1XA 1CDUA 3EJYD 1A6UH 4TVUA 5I1JH 1H5BA 5I5MA 2OK0H 2ZX9A 2N7SA 2VITB 3E9TA 5TTRA 5MP6H 2BNQB 2ID5A 2V5MA 3RTQD 5KOVC 3VFUA 1R4XA 4LCVA 3ZHFA 4U2ZA 2CJUH 4L4JA 4NJ9L 2EDWA 25C8H 1MDTA 4ANKA 1X5YA 3VFOB 3VWJA 1NBZB 2WGXA 5GS0D 2LE9A 3ATDA 2V3DA 3QO0A 4KZEH 1ZLUH 2X10A 3GEFA 3PAYA 3EBHA 2AJVL 4LOVA 4FLQA 1IQDB 4XMZA 3U46A 1U8JB 3QQ9C 3RG1C 5JO5A 1AGFB 1PJ9A 4XN1A 3U9PH 1QLEH 1A7NL 4XPTL 5EUOB 4EZLA 4YDJB 1DL7L 3ZE2B 5AVWB 1KXVC 2ZXBA 2HT2D 4LLUA 3AABA 4NN7B 1MEXH 3WHXA 1BQUA 2FBJH 2AXGB 4P23B 3QUYA 1JZDC 4IDLA 5AW4B 3QI9B 3UAJA 2B4CL 1ZIBA 4LGSB 4C4KO 1N64H 3ZR5A 2YKLL 5IP4A 4K94L 1KJVA 3GK8H 2N1KA 3PWUA 4GEIA 2A6IB 1W72H 2N56A 4DPBX 4M6OH 3PP3K 4Y2DD 3PRZA 3A6OA 2XZZA 4WHYH 1GYVA 5E08L 3BAYA 1MI5A 5J56B 1O6VA 5ILTH 4YBLC 5EU6B 4HMEA 4QHUA 1PU0A 2B39A 1MVFA 2WKGA 2D7PA 1U95A 5IW6A 1JGUL 3WN5C 4NSKB 1NCDH 1F42A 2WVVA 1T89A 2X5PA 2VDNB 4AYFB 7PCYA 1WWBX 1UM4H 3GJFK 2G4GA 1JNNH 1RSYA 4Q9BA 4LNRA 5CP7B 5AYQA 4GLRH 4LSTH 4N2MA 1RZKL 4BWUA 5AVXB 1UWEL 1MFUA 5EEUA 4R97C 5D1QD 4R7DB 1UWEH 2OYPA 1MJJB 3MJ8A 4XX5A 3LDBC 2WLYA 3FAXA 5IMKA 1AANA 3R0NA 3FFDA 2R2EA 3A67H 4OZHE 1ZGLM 1DBJL 5F3BA 5DZPA 4G8IA 4PJHB 2B7DT 2VR8A 1Z66A 3HNSH 1CG9A 5FO7A 1PG7H 1NWPA 1F4XL 3KPLB 4WUUB 2X7LB 4NLAA 3OKKB 4H26A 3LN4B 4QT5A 1RVFL 5CILL 3W82A 4MD4B 4UOZA 3EZ8A 4HSAC 2D03L 3UAJD 4GW1A 5D7LA 1SVBA 4TQPA 3UP6A 1KBGL 2QTVA 2V5SA 2BHUA 4G5ZH 4Z7UE 1BXUA 3QP3A 4PJ9C 4O5LH 4B50A 4MX7B 1UUSA 4XPAL 3GHPA 5L4MA 3HZKB 1NQBA 4YHYC 4RMTA 3HZMB 3LHPL 3QUZC 5ESQA 3WJJA 1R17A 3LMJH 1BGXH 1T6WA 4BBWA 1TZHB 3EJUA 3S96A 2BHYA 3V6OE 3QDJD 2W95A 4IEFA 4WU5A 3L81A 2RAMA 1N2RA 2MPAL 1U8QA 2ZSVB 1V3JA 1OTTD 3QPQC 2L04A 5AEAA 2OYKA 2ZXEB 5I8OL 1JYWA 3BZEB 3MRGB 4KQ4L 4CMMB 3KPMA 2EDYA 1Q0YL 4HUXB 1Q9WB 4LPXA 3D2UD 2XXGA 5GSVB 1XF2B 1JPSH 2RMNA 2I07A 1SPDA 3RVXD 2H4EA 5TE4H 3SGJA 5JIMA 4YE4L 3KWXA 4Y16C 4ACTA 2ENYA 2G75A 3O6MH 4XMTA 5I1KL 1ONQA 3IDXL 5FUCE 1IBBA 1P4BL 4QXVA 2QGDA 4NO2B 1BQ5A 2E7MA 4U4BA 3TCLA 4L9DA 1OD9A 4LSUL 1HDMA 3AUWB 3PL6C 3EDDA 5KAQG 3C2SA 3OWRA 3TTSA 2ZOOA 1G1CA 4HJ0C 3WTYA 5CGYD 4DSYA 1VFOA 4R3SB 2IBZX 4X5LA 4F8TA 2VM9A 4KY1H 4MMXA 4YSUA 1PW3A 2N0MA 3EOAA 3RIFF 5DSCA 3C8HA 4JE4B 3W11C 1PL3A 3D85A 1CGWA 4JRYD 1OCWH 3CK0H 2WXPA 1I8KA 4JE0A 4XT1C 5T5NG 3T77B 3O9WB 3PWPA 4Q4IA 1OM3H 1EJ8A 3WEXA 4YHKH 2DL9A 1G43A 5LN8A 1IGIH 4DGYH 2GJRA 2Y5TA 1CVSC 4PI2A 1QBLH 4P2RA 2BHZA 5I1HH 2KKQA 4IQHA 4APQB 2EYRA 2MCPL 1F41A 3PG2A 2APBA 4H20L 3PDOB 4YHLL 3BGMB 5FCUH 1JXFA 3ZDWA 3BW9A 4KMTH 4YUEH 3WDIA 2ZWSA 3BVWA 3DK0A 3FOLB 3PV6A 3R18A 4GUCA 4KUZL 4X6CF 1PD1A 3O0RL 3OKYA 2J1ZA 4PWIA 4X5WB 1CL7H 2RD0A 4MQXD 5DRNB 4WFGE 1S7QA 2BVOA 3SCMD 3SZ6A 2WQXA 3H9YA 4G83A 1P6AB 1IGML 1JNHA 2DW5A 4M7JH 2ZTBA 4XP4L 1NKRA 1AY1H 4C54A 1CC3A 2LGNA 2TAAA 1O9VA 2CHDA 3F00A 3FUKA 4RMUA 2NQDA 4GKOA 1FQ9C 1J05A 1TZIA 5FYJE 3V0FA 5DJCB 4CVXA 5FB8A 3KS0J 3D3VB 2GTWB 3IAPA 4N2EA 4Q6IA 5DD5L 5EORH 2VTFA 4MD0B 4UQ2A 3FCGA 4LB8A 1QNZH 2VLLB 3ULUH 3GNML 2ESVB 2I25N 5GS1A 5EC1A 2WQWA 1BCIA 2CRYA 5CJXA 4BH8B 4JQIH 1IKFL 4NRZA 4HZ1A 4ONOA 3CFTA 2IH8A 4G9DA 4Y5XC 2VDPL 5T5FL 4DN4H 1M2VA 4HH9B 4PJGE 5ICUA 2KZ1B 4MD0A 4L05A 3X3FL 2DLIA 3MCLH 4YHZL 1KELL 2WCGA 3W0WE 2ZXQA 3TEYA 1OTSD 5DJCA 4L0ZA 3VXUA 1FV1A 2NW3A 2BY0A 3WV0A 3RZCC 2PWEA 1U0QA 4JZJA 3TIEA 1MRDH 4KK5C 2RCSL 4HUVB 3N0AA 2RA1A 4U7SA 3V0WH 4IDJH 4XB3A 1ZHKB 4KDTA 4MAYA 4EXPX 2Y06L 3QFDB 4EE2A 1ASPA 1ZS2A 1GMIA 3VD0A 1F8TL 3D4GA 1OARL 1NCGA 2KLSA 3KNBB 1IC5H 3GS4A 1DEEA 1RIVL 3Q3GA 1WCQA 4ONHA 2CA4A 5F6IB 3DTXB 1JZFA 1SEQL 1OVZA 3IFOA 3UTOA 1YUHA 3P4OB 2DWTA 2B1AL 3WMPA 1MHCA 1FNSH 3WN6A 5DURB 1GTFA 3T4AA 3EOBB 3LEYH 3ILDA 1YEFH 1X9UA 2GG1A 5GGQH 2ADYA 1GPOH 3AADB 5E8DL 1SJEB 2YRZA 4GIOA 5I1EH 3ZKMD 4JFXB 2COVD 4AY0A 2XN2A 3UYPB 1VSCA 4OT1H 4MMXB 4UB0H 3MUHL 4IU3B 3A4AA 4A6YH 2MCG1 1J0HA 1O7VA 1BF8A 1EK3A 4JPWL 3M7OA 2I5YH 3FQYA 1BX2B 2EKSA 3O4OC 4HEPG 5GJSL 1HZHH 2CBMA 4HJ0D 1JZ4A 1A6PA 3DMMA 3UYRL 4LSRH 2XN9A 4JY6A 2BC4A 1WBYA 2EDMA 2YJLA 4ONGL 3IS0X 2EVFA 4Q2ZA 1NMCC 4N8CH 2EQDA 2YMTA 1BZQK 3P0YH 4WHDA 4YHYB 5IJVB 2WXJA 3D2UA 3MRGA 1EJ6A 2Z3FA 2QKIC 5TDPB 2QMJA 2XN1A 2EIEA 4X5WA 5JXEA 3HC0B 2KH2B 3PGDB 1WEJH 2ZSVA 1LWHA 4TUOB 1O5PA 2F53A 2F5AL 1OGTA 4ZW3A 4P2AA 2AQRA 3ZE1E 4M6NL 4JPIA 2GIXA 3L1OL 4R5XA 3WUWA 3QRGH 1CL7I 2BS8A 4NFBA 4XVUC 4AUJA 1YECL 2V0AA 5AAWC 15C8L 3UEZA 3JZ7A 1G9MH 4IS6A 1HSBB 5B39B 2OMWB 3OSVA 4XP6H 4DP1X 2PW1B 4PBDA 1K4DA 5D6CA 4X8JB 1MLBB 1SJHA 1VADB 2IPTL 1XCXA 2K6ZA 3QULB 1NPNA 3U79A 3HTLX 4JPKH 5F3FA 3ZT6A 4ZYKB 2XTJE 3T3MF 1SHSA 1NGQL 1IO4C 4TSCL 4YDIL 2GIMA 1C12B 2HFGH 1MCBA 2QQKL 4U1HB 4MLIA 3UDWC 4I0CC 4XCFL 2IAMA 4UINL 4TTDD 5IWLC 1KYUA 1NAMH 2OSWA 4HIPA 1LK2A 3IJ9A 4Y1SA 3G5YA 4LRNH 3BIKB 2BMKB 3BD5A 3GLDA 3ASWA 4OQ1A 4MJ6A 5H94B 1WS7A 2R0WL 4LBEA 5IQOA 5EZJA 5I0WA 4IOSA 2DZEA 3BT2L 1ZCRA 4C4KT 3G5YB 4ZS6C 1OTUD 3CVIL 4LCUB 1J8KA 5KUMA 4POYA 2PCPB 4OI8A 2FH8A 2AJXH 3GJFB 5AW9B 4XC3H 2I27N 1HC1A 1UC6A 4GSRA 1JV2A 4AIZB 1N2RB 1DBJH 2E74C 2OSXA 4MVBD 3BH9B 3TWCL 3UTSD 3TCXA 2CPUA 5IW6B 2IXQB 2DY2A 1OPGL 3CH1A 1BAFL 3FN0H 3V55A 1RZJL 1U8LA 1CDHA 2MHAB 1EPFA 4AEEA 4HIXH 3VXOB 4YDLC 5MEOB 3MRBB 3HG4A 4KK8D 1MI5E 2PW1A 2AEQH 1DVZA 1ZE3C 5FK9B 1MI5D 2EZ0D 4TVPL 1N6QL 1GYAA 1RUMH 5IW3A 4ZS7H 3U4KA 4RA3A 5KVEH 2HFFA 4QYOA 1OT2A 2VR3A 1MJUH 2PPEA 3LS5H 5CN2A 3VXMA 3UBXA 3MBED 4B9YA 2OX5A 1MELA 3TU6A 2XTJB 3ESVF 3CVHL 5F7UA 1TYJA 4KKAC 1KFAL 3DECA 1BGXL 3T0AA 5DHVA 2PTUA 1WTGT 5D2NB 4G8IB 2XIBA 2HTKD 3N44B 4I77L 1P9MC 3OSKA 5AW2B 3V52H 3QIBA 3C6EA 1MJJA 3MJ8B 3DO7A 3ABGA 3IMSA 4M9PA 1L7TH 4Y0GA 1CPUA 5JORA 2AZAA 5IESL 1Q72L 4HS8H 2J55A 4MNHB 3L3IA 4G5AA 3MRFB 1ZK9A 4CUCA 3KBFA 4E42A 4YXKL 4H8QA 3FYIB 3RJQB 2YD9A 4LCCB 3TOPA 1THAA 2H0EA 1G5GA 1LP9B 2ADJB 2MOGA 2Z8VC 4K8RC 4YXKH 4GRLA 4C4UA 4ELMB 2WO4A 3HUJE 1A7RH 1KIRA 3RIFK 5GZND 2Z92B 3CDGB 4LHUB 1BQSA 2LVEA 3KGSA 2Z65C 4HF5L 1A0QH 3NFPB 1WCBA 3FSVA 1DVFB 1K2DA 3KR3H 5EU6A 4Q0XH 4UNIA 3BUBA 1JP5A 3JVGA 1BMZA 1BQRA 2ZCKL 1ACXA 3LRSA 2D9QB 3QDGB 1SY6L 4GG8B 1QR1B 3VG9C 1FZJB 4ZMQA 3RWJB 3W1ZA 3BUPA 2YEVB 2F19L 3EOBA 5HHQB 1IM3B 1KJVB 2D7TH 4M1CD 1M9WA 2KPNA 3NCMA 1CXLA 2WXHA 2OULB 1WFTA 3NIDF 4PUBH 3E7JA 3VMNA 1QI3A 5T1MB 5EF1A 2JQAA 1AXIB 1R5VA 4YHNA 2APFA 1IRAY 2DTSA 2DQFA 4PJDF 4XZUB 5LBSL 5FCUL 3RWDB 3QJOA 5HYIA 2VQUA 2XZQL 2WOBA 3GBNH 5MENA 3S36H 1AVAA 2IALA 1RHHB 4IYKA 5IJVA 1S9YA 3GIZL 3WFCH 3ISWA 2HTLD 1JF6A 1DSFL 2O6EA 2G9KA 4PSPA 4M7ZC 1B4JH 3LNIA 1D3CA 4H1LB 4LSTL 2PO6C 1BQHG 3ALXA 2AV7A 3BPCB 1F3JB 3E6FB 3BUYB 1KFAH 1SOXA 4HS6A 5D9SA 5IB2A 1J8HD 4KKCC 1HL4A 5DMGD 5HI5D 1QTPA 2HXAA 1EVUA 2WBXA 4OF8A 4FP8H 3MXWH 4LXFA 2M8XA 1FZOB 2FWUA 3RWFB 3VFOA 2NUPA 3QZWA 2V6HA 2AJ3A 2WXLA 4Q9CA 3VD1A 1S9YB 3GGWB 4PRNB 1JHLH 4HXAL 4XO5A 4XR8C 3CN3A 1DJXA 1J5CA 1YA5A 4G7VH 1MCWW 5C0BD 4BEIA 2X12A 3NJFA 2TSAA 2H32B 3V9EA 5E8OA 5GSRB 4LE8A 1T03H 2VCOA 1PX3A 2NDFA 2EIBA 5HHOA 1D2PA 3AAZA 5I6LA 1I9IL 5KVGH 4UV4L 3VVWA 3ASNB 2NSQA 5EU7C 1WZMA 3ARBC 3KPRD 5BQDA 4ZW6A 5AD0B 5T3ZE 1IAOA 4HF5H 1S3RA 3GD1C 3RDTD 3FFCE 4G6ML 3TWYA 3HZ3A 3UOAB 3V8OA 1ZHBB 3R19A 3QR1A 4NHCL 2RH0A 1HL8A 2BRRH 5JHDB 3FT2B 5E99L 3DSNB 2LU3A 3VWJC 4KGLA 3IPFA 4OB5H 4JG1H 3HE6A 1DJZA 1F1GA 4NIYE 2NUTA 1MW0A 2VDQL 1MFVA 3BSGA 5IMOB 1CU4H 4CMHC 2V5TA 5SWZB 5JXEC 4Z0BL 4DERA 1LP9A 4ELMA 4W81A 5E1QA 3SDCD 3UTPD 3BVTA 2Z93A 1UHVA 3I02A 2EDJA 4XAWH 4DOHB 3DWTA 1H9DA 4I48A 4PRHD 5HDLA 4C8XA 2H6PB 3B2DC 3OGCA 1VKXA 4TYUA 3TYGL 4PP1D 4G1EA 4LPTA 1FJ1B 2X89D 2LHAA 2XC8A 1F13A 5JUEL 3U9WA 2RIKA 2YPVA 4YVNA 2ESVA 1TMCB 1UQSB 2OL3B 2O5XH 1XD0A 3HHSA 4NO0D 3AMKA 4JG5A 4JFPB 4F9LC 2ODIA 1WBXA 3KCPB 1TJXA 4UOJA 4KAQL 5TGBB 2YA1A 3O2WH 4ETYA 1SDAB 1ICTA 2HRHA 3NTCL 4M4PA 5C0AE 3IGLA 2NXZD 1FFPA 3EJSA 2DWEA 4PRDA 4JZOA 4XP9L 2BNRE 3GMQB 4PJIB 5DVLA 4CMMA 1QZNA 2PUQT 4F24A 1CBJA 2FATL 4FNTA 2EIJB 1UZ8A 3UG4A 1BVLA 1JTPA 3FU6A 4FULA 3SDXB 2R51A 3RVUC 2WBJB 2KLRA 4NO5B 4FTVA 3MRJA 1XH3B 3E3QE 4LLWB 2BVQB 1I53A 4ZQKB 3RNQA 5HVHC 4KI1A 4TTDC 4GSDH 3V4VB 1FO0L 1Q0XH 2BOBA 4UQAA 5CEYA 1MCSA 4ODSL 2ZSWB 1CFMA 1U3HB 1KTLB 3VGEA 4NQEE 3GB7B 2IWFA 3JUYA 3CIAA 5I1CH 4OLVH 1L3WA 2DMBA 2M83A 2NNFA 3ZE2E 3DXAD 2WXQA 1EUUA 5JW5A 2E7CA 2FJFA 3OMNB 4JMNA 3MO1B 1A6AB 2BVPB 5E2UL 5CM1A 4AKOA 5TPWL 5J1AA 1WO2A 2WUBH 2ZUXA 2P4AB 5E00A 2WKLA 3VRJB 1CFVH 4Y2OA 4ZZKA 5I1IH 4XMUA 4B9ZA 4K9EC 4QWWD 5ANMA 5C0GB 3IMRA 3JYCA 3O6FB 4U3XA 2HT2C 2IAMB 4OCWH 3LS4H 1DE4A 3GBEA 3TA3B 2PYEA 4XP1H 1C12A 1XEUA 5KSBF 1MIEL 3HE6C 2MQGA 3O41A 4U4IA 4YHOH 2YEZA 1QSED 4ENED 1CT8A 3BVNB 3LPFA 4GKSA 5IMKB 3VXUD 4JFVA 4L9LA 4Z7UB 5L2KA 2BCKB 3X12B 2FQDA 4LCWE 2EINB 3T0WA 1GIGL 4L1SA 3ZTJG 1I3VA 3S7GA 4HUKB 3FDWA 1RP8A 4GKLA 1GIGH 1E90A 1HWWA 1ZRUA 3A4DA 2AJYH 1TQBC 1OAYH 5ABAA 3RDTA 3HC3L 4N9GB 3AG1B 3I74A 3NPSB 4GXVL 4BZ1A 1NL0L 3BRFA 2EUZA 4PM1A 2BNRD 4MYWB 4X42A 3GSXA 5J6HB 5HI5C 3OAYK 2XX0A 3GZQA 1NFIB 1NMAH 2Z0UA 1OT4A 4TL4A 3ZQ9A 2BSDA 3RI5K 3VI4B 4HX1A 2CLRA 4AT6B 1KULA 3ZSTA 4EIBA 4ZMWA 1O5DT 2JCCA 3G08A 3CCHA 1P84K 2YWYA 4MX7A 1UJ3A 4N2AA 5EZJB 4IOFD 3WY3A 2DWEB 4DN3H 2CLZA 1UOVA 2VRKA 3TT1L 1SXSA 3O6FD 1FO0A 4FG4A 1NPUA 3TN0C 3CVDA 1RUAL 1WBXB 3OAZK 4NLHA 4NFCA 4BSWB 1YC7A 4PJAE 4ZW5A 3CFDB 4M1CC 3KM2A 4ORGA 5CKGA 3UC0H 3WIHH 4IU3A 3U2IA 2J12B 1GL4B 4B3VA 2VM3A 3NSDA 4P2RD 4IHOA 3BFQG 3UC0L 3WIHL 4A7SA 1E8XA 2YD6A 2HJLA 3LN9A 5DU7A 1NFAA 2IGFH 4TNFA 3OPZH 1VKXB 1AGBA 4HMDA 1YDPB 3QQDA 3TEXA 4RMRA 5L0QB 5DC9B 5ICXB 4JRYA 5BJTB 4XP1L 1UD5A 3WBDA 4TLKA 4L23A 3GMMA 4LMQE 2R9HD 1ID2A 4AVHA 3GSXB 5F7AA 5FLUA 2WYIA 4NN5B 4K8RD 2P26A 4M5SA 4AYID 4Y4KC 1AP2B 1L4IA 3OWEA 1G7HB 4O2EA 4S11A 1P4LB 2GTZA 4YZWA 1G94A 1MEXL 2J57A 2OTPA 4QI3A 3SYCA 1IAKB 4NXSA 1ID5I 3T0VA 2LLLA 5ICXA 2WAQA 4LOUD 3PP4H 4LPCA 2ZP0T 5IMMB 1UZGA 1S5IL 1G1KA 5IQLA 2J71A 3RY6C 5IJCC 1G7JA 3CFBA 4RMWA 4HD5A 1S7WA 3CIQA 4O02B 1T0PB 3EYSL 4YHMH 3OZ9L 3B2UC 1KACB 1XCQB 1XF4B 2ENJA 4KJQC 4R26L 1BAFH 1RZIB 4NNPL 5G55A 3HG0A 3OZKA 1QSEE 2CWRA 3MRPA 1L6PA 3TA3A 1H6TA 4PGBB 5F9JB 4XNUH 2IPUK 3QA3B 3F3HA 2IF7A 1W8NA 4UTAL 2VISB 3PL6A 3C08L 4BFFA 2JI1A 2W07B 3TJHC 2YKKA 1E6OH 4M5ZH 3TO2B 2P8LB 4LPVA 5I1GH 2AEIT 4FHJA 4YO0A 3FT1A 4HWEL 4IOIB 1EXGA 2EH7L 3K91A 2BSED 1N18A 2FEDC 2IDSA 2W0KA 3CCHB 2X6UA 3RYMA 3MUUA 1UYWH 2DKMA 2N3JA 4NAMA 1F3JA 5IB2B 3S88H 3F2LA 2I32A 5KSBB 1U8MA 4JB9L 4LF3B 3N2JA 4WFED 3KDPB 4BZ2A 2J1XA 3SYAA 1ETA1 4BRVA 1GKOA 1IC5L 5FYLD 2J1YA 1P5UC 5BO0D 3ZMRA 3HJEA 3BO8A 4Q74A 3STLA 1E5CA 2DM2A 2Z64C 1KCVH 2YBGA 4BH7A 4KBPA 4ALAC 3HBGA 1QD0A 3ME0B 2R1XB 1I3GL 4R7LA 4G7VL 1JDCA 3QDME 3GDCA 1MCOL 5ABZA 3CC5A 5I28A 3ZDYB 1A22B 3F84A 1OHZA 2BVYA 1EHLH 3UEQA 3S35L 2EDDA 3NSYA 3APFA 4OD2B 1GZHA 2CKNA 4WEMB 2OK0L 1QSFE 5MERB 3P2TA 3SQBA 5HHQA 3RAJL 2W60B 4Y16D 3FB5A 2EUXA 1I8KB 4GG8A 1QR1A 2CXGA 5TH2B 1S2EA 3T2PA 5L88H 3V4UL 1RJYB 3X11B 3JV0A 5D5MB 5I6XB 2WJ5A 3VA2C 3QXVA 3BVUA 4Y4KA 1XL6A 1WV7T 3V6FA 5B3JE 1NFDB 1HILA 1DSYA 2AQQA 2PXYA 5K5YA 3X1FA 1IGJB 1J48A 1OHQA 2VDQH 3L1EA 7TAAA 3D3VA 4DW2L 4PS7A 1V05A 1W9XA 3AXHA 2X4OA 2UX6A 4QRTA 1J05B 1IEBA 3BZFA 5DI8A 3HNTH 5LNEA 2A6DA 1PS3A 2YAEA 3QW9A 4XNMA 2YA0A 1L6ZA 1W8OA 4AG4H 4Z95H 5BOPA 2B1OA 3FO2A 3O45A 4WV1C 3PFUA 4URTB 3TT3L 3RNQB 2P43B 5EO1A 3S3JA 2BNQE 3DUSB 1MJ7L 4S1SL 5GJTL 3ZDZF 3VDAA 4GPVA 4HIQA 2JB5H 4UDTB 1T5XB 2IFGA 4LAJH 1EHXA 3L7FB 1OF2A 1MVUA 2PCFA 1D5XA 3DIFB 3SODB 4TLSA 1QW8A 4JUTA 5F2FA 4KJYB 4P2OA 1RPUA 1MFDH 2E59A 1YYML 4FJYA 1BEYH 1LO2L 3S5LB 3M1OA 3QG7H 4L3AA 1DUZA 5HGDA 4HXAH 5SWSD 1MAJA 3RKPA 3O9WA 3PWPB 4IIQB 2VN6A 1N6VA 4KV5F 3QG7L 1QBMH 2P9RA 1NSNH 5KTEH 3L7FA 3FH5A 3M86A 3RWGB 4L3EA 3C09C 3LEVH 3VU2A 3AWGA 4IK6A 4UQBA 5KTEL 1G6RA 1WAAE 3BQUA 3WXWH 4CADB 4FXLA 3O8XB 4H20H 1V5JA 2WTPA 3D09A 3FO9A 3NUKA 4ELKA 2VMJA 4ZMPA 3H9SE 3EGSA 4FABH 4JN2B 4LQFL 3Q1SH 2VE6A 4MS8C 4PLKD 1L0PA 2E86A 3IMUA 3OKEB 5BW7C 3RWFA 1CG9B 2A6KB 4GINA 4LEOA 2ZUSA 5D72L 1U3JA 3O4OB 1BREA 3ESOA 3SY0A 3LN5A 3H4FA 3DGGB 1FFTB 5DHXB 2DQGL 4YQXL 3FFDB 5ITFA 2DMGA 4PW4A 4M02A 4HPYL 3VFSB 2CO4A 4PJDB 3D3VE 3V4VH 4EI0A 5C9JA 1UT2A 1KEGL 1OALA 3PGFH 3ASOB 3B6SB 4IGBB 1OO2A 5GHWL 4F93B 2VDPB 4QXWA 4BFOA 5L6YL 2E6PA 4J4PA 4DP4X 1K5NA 5JMRA 3H56A 4LNRB 5CP7A 5DURD 4ZUTB 4KXCA 4M6ML 3GTVA 1LO3H 3K6SA 5D5MA 5L6YH 2W80C 3O6KL 4M8UA 1F1DA 2G3ZA 3QAZB 4UT6L 5I75B 3MU3A 1KXVA 3VG0H 3ZE0E 4D8PB 5CLTA 2I24N 1UKTA 3CZGA 3S96B 5FKPB 4CW1A 1MCFA 2JI3A 4KI5F 5E6IC 4DF9A 1RPKA 2NT0A 3VG0L 3L3JB 3KPNA 2VOTA 5LVEA 5SWSE 3MRLA 2HSIA 5IQNA 4KI5E 3PAZA 5BPPA 4FFYA 5F7FA 3GMNB 3B9KD 1MCWM 1X5IA 1H3VA 1N7ML 4F2EA 4HK3J 2VDRB 5HJDA 3RL2A 3PFQA 4X6FA 3QCTL 4BH7B 5AB1A 4NJ9H 4EI5B 4JRXE 2ENQA 3DGDA 5ALBL 3JV4B 1A66A 1G4MA 1PZ5B 2A38A 2BNQD 2QGCA 4WUUA 3HE7C 3WFDL 1DVFC 1A21A 2EEDA 2BX5A 1FGNL 2WVSA 4PJFA 2Y1ZA 3LQZA 3H9SA 3RIAK 1F8TH 2P44B 3AZUA 3KYNA 5HDBE 2XVKA 4WHTB 4IRJD 2FJHA 4JVUA 5G4OA 2WBJD 3RVVD 1A7OH 4Q89A 4Y89A 1AGBB 4OZGA 2IGLA 1B6DA 3QHZH 4YGAB 3ARGC 3C5SB 1CURA 5MI0C 2BLFA 1S7UB 4K5MA 4B9PA 3KLDA 4XMKL 4GQQA 1P2CA 5MENB 4YDVB 1X4YA 4ALAL 1DQLL 3KWWB 5KS9B 3BJ91 5ALCL 5C0JB 2BSCA 4NXKA 5E8DH 4YHNB 3FU7A 5TF1L 4PGBA 1A9EB 1DQLH 2BFVH 2VZOA 4K7PY 1XL4A 4A04A 1AXSB 3UPRB 4HHAB 5I9QC 5CJOL 1UATA 2HJKA 4BZ2H 1IT9H 4BHUA 4MA7L 3L5XH 1HWHB 4XNZB 4LEBA 2VDLB 4U6HB 5DUMH 3SDXE 3OB0K 3VFGH 1JOIA 4A7GF 1GS8A 2Q2EB 4H88L 4I8DA 2HKFH 3QQ3A 1HAWA 1NGPH 2QZ5A 4XN8A 5IMMA 1ETZA 1VPOH 2N59A 3PAUA 3QORC 35C8L 5DD3H 2FBRA 4PGEB 4JFQA 2DYPA 1Y0LA 4M5TA 2AXHA 3TLRA 3IMWA 4OFQA 4R7NB 2E8ZA 3CDCA 4IBLT 2AQ3A 3D30A 2AAVA 1Q1PA 1BFTA 4X6BA 1MUJB 2FAUA 3MJGX 4KXBA 1FHGA 3CFUA 1KCSH 4TQEH 1ZHKA 2F8XC 3GJFA 1P2CB 1T2JA 1PEZA 3CTTA 3VWKB 2V5RA 4ZTPL 1NMBL 3LY6A 2ZUVA 5C0AB 3ZLQC 2QKIA 3VYOA 2HLAA 5E7FA 5HJ3B 2AI0H 2FR4B 4KO9A 4KJPC 4JO3L 1HHHB 5GGSA 5FUZH 5DLLA 3DETD 4UTBH 4IMKA 4X80H 3CXFA 3QEQD 4WI3A 1BZ9B 4K4KA 2VLRD 3BKJL 5C6TH 1JZGA 3Q1EA 5IIEB 4WW2C 3WNOA 5DHVB 2MH4A 4MNQB 1FNLA 3GSRA 2HLFC 3PHOA 2B9AA 2MQCA 4UQDA 2IV9A 3SYQA 2FGZA 4TNWK 5C0GA 4CMHB 2XWEA 3HHMA 4YHLH 1WPCA 2YN5A 4OAWB 1MLBA 4X6FB 2Y7OA 3KBPA 3MLXL 5TDNA 4I3GA 3VRJA 4KMTL 4YUEL 1UKSA 4WWKB 4XMPL 4QHKJ 4ZUWA 2XV3A 5HGGS 3LZRA 2OP4H 1UH4A 4IKKA 5AG8A 3LQAH 3Q8FA 4LRNL 4O2CA 2IOOA 1R3IH 2VKXA 5MI0B 3O2DL 2QFPA 3QNYA 4ZODA 4NFDA 4NNXA 1TCRB 1R3IL 3QDJA 1KTLA 5LDSA 2WXGA 4JO5A 1A6VH 3RB7A 3TBWB 1D7CA 2CHNA 4KOCA 5CJ5A 5M94B 2IPKB 3R0MA 3NIGF 3EFFA 1YY9D 2IANB 1I8IA 2NZ9D 1KCBA 2ITCB 2JLPA 4PY8J 2AV1B 4BJLA 4PYGA 1BMWA 1N8ZA 2B0SL 3HC0A 1CR9H 1GSKA 3WENA 3ZX1A 4AEIL 1H15B 1SEQH 2DQUL 4XMVA 2J72A 3EJJX 1IC4L 4JREB 1QFWM 5LXGL 3S3CB 3VFTA 4K0OA 4JZOB 2HN7B 1KLUB 4JQIL 4M3JA 3SKOA 4WK4B 4MJ6B 5H94A 5JMOC 2G60L 4FLRA 2BC4B 4D9LH 5HP5A 2XQYK 2I60H 4PGJA 1LK2B 1Y6KR 3L95B 3DGGA 4FKHA 1JCVA 4OF7A 3RVWC 1TFPA 1M1XA 4LRIA 3H9HA 4W9HC 2DQHH 1JV5A 4PJAA 4GUOA 2EC9T 3U4EB 1AZCA 4JG0L 4PV9B 1G9ML 1XGPA 4X6DB 1ET8A 2PABA 4W93A 2QPEB 3UYPA 1MCIA 5DEGA 5I1DA 3KPRB 3RTLA 4YSAA 4ZXBD 2V5YA 3U4EA 1K4DB 5D6CB 3V4PA 5I0VA 4ZFGL 3QR0A 1EO8H 1UUNA 2H6PA 1G5AA 3BUDA 4XNZC 4CKQA 1PDKA 4BINA 4F7EA 1JPTL 1E7VA 3IB4A 5E2WH 4OGAC 4G7YH 4KJYA 5IK3A 2DIEA 3EO1A 1X4ZA 3OMZA 1GR7A 1VEOA 3VGDA 1CCZA 3HB3D 2F53B 3N40P 1XR9B 3T0EA 3KPOB 2ED6A 3QDJE 1I1AA 2KT6A 4QOKD 5C7XH 3FYEB 3NIFE 2Q3AA 3N41B 3UZVB 1TT6A 1AQ8A 3OKLB 2EH7H 3NFSH 4QRSA 5A3IC 4GAAA 2B08A 1ZE3H 1JN6B 3STZB 4C56B 3BFWA 3OJMB 5E2TL 3B2UD 3FRPB 4YXLL 2YMXL 5E56A 1EJOH 4IEFB 4WU5B 4Z7WF 3S88L 3Q48A 3UFIA 1ML0A 3CLFL 3VDBA 1VHPA 3BDXA 3C60A 4N1HB 3MRHA 5H4ZA 4ETQA 2VMDA 2OI9B 3P9LB 3UH8A 1OCRB 4HZAA 1HWGB 1ADWA 2X4SB 2R15A 2ARJB 2HH0H 3RGVA 1A7QH 2F19H 4MNGA 4E2OA 1O7DC 3MACL 4FNLL 4M03A 5GSRA 2GC7C 4Y2LA 3U25A 4FQIH 4OIIH 1KWKA 1RZJH 4YO0B 5M7QA 1UOKA 5DEFA 1QFPA 2GT9A 3OMAB 4G9DB 1XR8B 4DK3A 4YWGL 4FQIL 2W07A 4OIIL 2B5IC 3DRTB 1ZS8A 3EJQA 4OUUB 4N20A 3LN4A 1QZ1A 3V0JA 4ZFOL 4OGXH 5T8IA 5I73C 4GSXA 4YPJA 1IBYA 3PUCA 3QJXA 1S3KL 4DO5A 1EGJL 4B9KC 4Y4FC 3DBXB 4UF7C 4I48B 5DZAA 1AS7A 2ZCLH 4I0PC 1PQZB 1S3KH 2JK5A 4KK9D 2Z93B 4WTQA 1KTRL 2VERA 1KPUA 2RTTA 3CZEA 4GKNB 2RCSH 3FB6B 4I2XB 1NBCA 1MFNA 3HFFA 1WIUA 5LCVL 3QZWG 2XV6B 3MZTA 3RZWA 1R75A 3QQ4A 1IVTA 3HC4L 1QG3A 4LSVL 4PHZA 4S0HA 3E80A 2W65A 3NDZE 1EGJA 3L9RB 3QAZC 3RKDC 2W92A 1QHOA 5DK2B 5D7IE 2AANA 1MG3C 2WVVB 4X0NA 5F72S 4F7KA 1LO3L 5LLIC 2BDNL 3ZL4L 2F54E 1TQCB 4HIEA 4N0FB 3SGDI 2YPLD 3A6BL 3O9WC 3E1ZA 2WLNA 1BJ1H 2DQCL 3JYBA 3BRGC 5ACLA 4M62L 5EA0L 1OCZB 2R0KH 3K0WA 5CU5A 4BQBA 5FGSA 2DQCH 2ZWZA 1HEZB 3S37X 3T77A 4AWJC 4IBSA 1T2QL 3TBBA 1FZJA 2YD1A 4JM0A 4LARH 3TFKC 1M2VB 4HH9A 3B1TA 3T09A 4JY4B 3VXUE 3ZBMA 1TPXB 4N3UA 5TDNB 3VNZA 1DYZA 2CDGA 4XH2B 5ID0B 4IHOB 1CTOA 3U9UB 1MSPA 4L48A 4K3GA 1OGAE 4G6MH 5EIVA 2EDKA 3PL6B 4E68A 2PWDA 1JXGA 1JVLA 1AQKL 4JJ5A 4QJ5B 4XGZB 5JHBA 2F1AA 2NW2A 4JO1H 1AXSA 2W81C 3QZWB 4Y8AA 3X1EA 5D93B 1RMFL 3U1SH 4MNQA 3I50L 2VQ1A 5JHMA 4FZEL 4Z7VE 3V95A 4Q6YA 1NSNL 5IGXL 3MRFA 3QJZA 1M71A 2KZBA 1S7UA 3FQ4A 2LFEA 3WFEH 3ILQC 2R39A 3VO0A 3WIAA 1IB5A 2QGBA 2NY4B 5EOCL 3TIDB 3OL2A 3DXAE 4F3FA 1IQDA 3U46B 1R3JB 4H0HB 1RHHA 1XZWA 1L9OA 3KYNB 1MCJA 5LQBL 4BE6A 5IVNA 1XT5A 4B5ZA 3QFJA 3S4SG 4ZOCA 2CIIB 4JAMB 3FOLA 4TVSa 5JHAA 4CILA 1MUJA 3GJEA 2WLIB 2OTUB 3PDOA 1B9KA 1TG8A 1FVDB 2DWXA 1TLKA 2PCYA 4M4RB 4UI2A 5TF1H 4R7NA 3S37L 4AJVA 2OTWA 1LO0L 4Y4FB 1QTSA 5B1JC 3BWAB 1NAMB 3NZHH 3DVFA 4PJCF 1KEMH 1VFMA 4A39A 1WD9A 4JRYB 2WKOA 3G5VA 3H3PH 5K93A 2BFGA 2O30A 5DFWH 2VN3A 3QXWA 2QADC 4X6CB 5AYTA 3KWVA 1YYMH 5CUSH 4JRXA 1J1XH 2XN9E 3D85B 3FCSA 3MBWB 3GJFH 5D7LB 5GGUA 1A4KA 1JAEA 3D4CA 2R7EB 4FQLH 4X9HA 4WU7A 3N43B 3O6ML 3SKNB 1JGVL 3IBOA 3CFCH 3KGUA 1P4BH 4JFSA 1X5AA 4KTGA 4DK6A 1M1XB 1MW1A 4HJSA 1RZKH 2OR7A 3FONB 2HPOA 4UYPA 4AQ1C 4YDVA 4TVPE 1S9VB 4RLDA 1ADQL 1S7RB 1K5NB 5CZVH 1KCSL 2DJ4A 4H8WH 1WGOA 5ESVB 1BYOA 2C3XA 2CLZB 3R4DA 2L3BA 2VIRB 4NHCH 4ZSOE 3WHE0 3QIWC 1TZGH 5ENWB 4QF1B 3SE8H 4OVVA 4E5XB 2BW4A 4JG1L 2F7RA 3MKGA 2NR6A 3EFOA 5KYUA 3RGVD 4IBWA 4G82A 1AQHA 5HI3C 3GB7A 3BPOC 5GHWH 2D8KA 1GZPA 4ZRGA 5DMIH 2V2XA 1T0MA 5J3HD 1JWSA 3FFCB 1AXTL 3PWNB 5LO7A 5A7EA 5J1TC 1UASA 4L4TB 1KBGH 3OHXB 3ULSA 1U3ZA 4I85A 1B0RB 5C2BL 1I9IH 1ASQA 5LWYL 1RK0A 2TRHA 4JRXB 1X7QB 3QNXB 4Y7OC 3WYRA 4ALAH 3JWNC 2XZQH 4QOKA 3QUKB 2YD8A 1ZLWH 2FBJL 5JXAL 3S2CA 2N4IA 5TGBA 3O4LE 5I8EA 2X1XR 3CVHH 2IDTA 5FYKD 4G9FD 4CW1B 3ESUF 2DF3A 1D2OA 4S1QH 3IDIA 3TN0B 2V2XB 1ZVSA 4H40A 3VRLE 4P23A 4PMFA 3ZR6A 1BM7A 1DE4B 2XPYA 1W72L 1INDL 1FHNA 4QMEA 2VJ8A 2WZPA 2EXYD 4R4NC 4ERSL 3F04A 4GAFB 5EC2B 2BS9A 5LGYA 4Z76A 1DCLA 1G7PB 4XNMB 1E9OA 3TIDA 5JOFB 1CDCA 5D4JA 3KVDD 3ZDZB 4D9RD 4I0PB 4NNYA 3HI5L 2J3SA 4LNVA 5DI8B 3QXTA 2E8YA 5DRXA 1GY2A 5IVXB 2XWZA 3FT4B 2EE3A 1Q9OA 5I1LA 4TNVK 3I02B 3EH2A 2FLMA 1BVKA 1KELH 2NLJA 3HI6H 1A2YB 1U3HA 1OIOA 4LQ1A 5JUEH 3O8XC 3OKEA 5SWZA 2OMZA 1GCFA 1U95B 1U58B 1AZZC 1TR7A 4LVNC 3VFUB 3IXAB 3VGHA 1SF5A 3GBDA 4FXKC 3I9PA 4M5YL 1BVLB 1EEQA 2E9WA 2MKLC 3SDXA 4UTBL 4X80L 3V0WL 4AM0Q 4HBQA 4KQ3H 3ETSA 3VAEA 5DD0H 2LAGB 4M5YH 3GHBH 4NQCA 2CGRL 1NC2B 1MZZA 3CX2A 2HVJA 1DZBA 1U8HB 1EANA 5A6LA 5B39A 5CNHA 3EJZD 3CV5A 1R33A 4P8QA 4NOFA 4EI5D 4CC1A 1A6TB 3FQWB 3OPZL 4L8BB 5GS3A 3ZO9A 2HJKB 4FAAB 4C56E 1AKPA 1N5YL 2PPDA 1G6RL 2IH3B 3QUMB 5K9QG 1KCWA 3QR2A 4KXZH 3D25A 3X3GH 3NIFB 3BGFB 1IAIL 4ISVA 3PGDA 4B9JA 2CIKB 2XXFA 2Y36L 3FW6A 4K9EL 3QJUB 1D5IL 1A1MA 1JZIA 5AW1B 1IKNA 3P3RA 2KLTA 2VR6A 4J4PC 5D7SH 3Q5YA 3CZFA 3TJEH 3SPGA 5PAZA 1L9PA 5H4YA 1R6VA 3N85L 4GQRA 1WFOA 1T1XA 2ZXGA 5JIKA 2IEPA 4NQUA 1FZMB 2QGEA 5AZ2H 3EBAA 1NICA 1NMBH 5E03A 3VXRA 2A77H 1OZUA 1QSVA 3BLPX 1YEHH 1SVZA 1NLBL 3VSTA 4TULH 2HJFA 1FZMA 4PJFB 2NQCA 1R3LB 1YNKL 1IQWL 1NMAL 4TXVB 5E1GA 5MHSD 5IHUH 3VD7A 2NY6D 3LSOA 1I3RA 2H26A 5CD5C 4ONFH 5LCVA 4JFHE 1EEYA 5EC1B 2E56A 5F9JA 1MWAA 4XNUL 1I7UB 4HD9A 3RILA 1NWOA 2G5BB 3NGBC 5KVDE 2FL5A 4CNIB 2R2BA 1HYSD 1Z2KA 3LIZH 4PJEA 4ZX3A 4XOBA 4HWZB 1MW3A 1X5GA 3K2IA 5AWNH 1HNFA 3LIZL 2I85A 1DJYA 3S3SA 3SY6A 2ZOWA 1RJCA 3E1F1 1QRNA 5GZOD 3AM8C 3OLDA 1JNLH 1A9VA 1N5AB 5IW1A 5FW7A 1MWAB 4WI0A 4NQXB 3UYOD 3F64A 1QR4A 1FYTA 3OJDB 4L37A 4MHHI 1HCVA 4Q8BA 1EO8L 1I82A 3W38A 2W65B 1M7UA 3PUUA 5TE6L 5ICZB 1FE8L 1FIEA 3RIAF 1MCKA 3US1A 3P2BA 5AVSB 3VSQA 5I71B 5EN2A 3BVVA 4PJCB 3DX7B 4JZJB 1WYJA 3TIEB 4UOQA 4HU2A 5KSUA 3VFSA 2HFGL 2AJZB 3FT4A 2JK5B 4TLTA 5IVXA 3BUYA 4HS6B 5D9SB 4MA3A 4UZUA 1ILUA 3BE1H 3L3OA 4K5LA 3L3IB 4XZ4A 1BFOB 4MNHA 4RAHA 4NQQA 4AV4A 2QV4A 2VDLL 4U0RC 5CFHA 2Y36H 5IY5B 1LEIB 2NNAA 2VXQL 2NY6B 4OJCA 4XB8A 3NT0A 2UZXA 4R3SA 4MCMA 4R5VA 4QDGA 1DHKA 5ITBL 1PAMA 2Z31D 4Q4EA 1IMHC 4MAUL 1G7PA 4IRJA 1OGPA 2F6AA 1G6RB 3BQUB 4CADA 5I0YA 1SMAA 1UACH 2X28A 2ATAA 2DQFB 4XPFH 1Z9OA 4MLSA 2WKOF 1CGTA 2NNXA 3MJ9L 4MQ7A 3H9SD 4N0YH 4HKZB 1GC1H 1NINA 2D7MA 3HAEB 3I50H 1AHMA 5IHHA 3FQWA 4FYQA 1T83C 2Q0ZX 3ABZA 4HDIB 1HZHL 4JFFE 5C86A 1M3JA 2YQGA 3O4LD 2HFFB 4HHGA 3ZE1B 3T0EE 4ONGH 3A0OA 3SPIA 5F9OH 4UQ3B 4Z78B 1EZVX 5BVJA 1JZ7A 2JIXA 3A24A 3VI4A 3HCVA 1E27B 2VL5B 3HPLB 5HYJB 1RUML 3B83A 1EHAA 4PN6A 5GIRA 3B2VH 4R0LC 1VA9A 1U8QB 2ZCLL 3IDGA 4MJ2A 3OXSB 2EIMB 2Z92A 3CDGA 1XR9A 3T0EB 5C9KA 1A7PL 3TBWA 2V2WB 4GQZA 4BUHA 4QLWA 1UYWL 2H9GB 3BH9A 2VZSA 3PQYB 4FNQA 2LU7A 4WW2A 5IK3B 3L4TA 1M05B 4JHWH 1BVKB 2NLJB 1IAIM 1GCYA 4KZDL 4RWYL 3HZMA 3BN9D 2QADB 4LCYB 3C60C 3CU7A 2NY2B 4IDJL 5HYSB 4R26H 3BRDA 1ECYA 5C6TL 1V7NH 5EBMB 4KVCL 1BEYL 1RKRA 3KPQB 3RGBA 1YVLA 4LHQB 3WDJA 3JTBA 4HK3N 4PTTA 4GKSB 1EFXB 5DJYA 4YDIH 4DZBA 4EN2A 2X42A 3CFDA 2Z9TA 3FONA 5KS9E 4A7QA 2A83B 2B1AH 5FXCH 4YDZA 3V6OA 5CJQL 4G8GD 1NAML 2GITB 1E2ZA 2UZIH 4Y9EA 5EBLB 1PZDA 1XCTB 3LEYL 4NBZB 4PR5A 4DEPB 5EUOE 5K39B 1ZANL 5FOBA 3ARFB 4F7TA 2XWTA 3DOSA 4YK4B 2WC7A 1A4KB 1RU9L 1YMHA 2UWEE 1OK8A 3BOVA 4KI5C 4YR6B 5F9AC 5ITBH 3ZYIA 4P5KB 5MEQA 4ZMZA 2FR4A 4CN6A 4N2LA 4DFHA 2AHIA 5IFJB 2WQAA 4J5VA 2YJQA 3G5VB 5MEOA 1RMFH 3U1SL 4HJJH 3LKQB 3O3DA 4ZFFA 4WI7A 1XB6A 2HUHA 3Q8BA 4PJIF 4PJXA 4D9QE 3EFFB 4A7VA 2OTWB 5J6HA 2GBAA 5DWPA 4NSKA 4JHUA 1T0NA 4ZUVA 1GW6A 4XBEH 4AZ8A 1EEZA 3D39E 1UFUA 3K2MC 4KROD 4PJXB 3VXSE 4AIZA 4LLQB 2BVQA 3IU3B 4DCQB 1BV8A 1XH3A 4ZQKA 5B22A 3CVHA 1J1OH 2BDNH 2WZAA 5L8KB 2R56H 4J3OF 1ETZB 4N22A 1JF1B 5FWRA 1J1OL 2H45A 3MV8B 4U6VH 2X53A 4JBSA 2AEQL 2OCCB 4L8CB 3TYFB 4BFJA 2FZ3B 5JLZA 4JM4L 4GB9A 2IDFA 5FFGA 3ROOA 3ZY7A 4BZ1L 5F7EL 1EVTC 1S7RA 4XN4A 1MH5A 2OZ4H 3EYFA 1B4JL 4FQXB 1D5RA 3IMBA 3MNVA 1PCSA 5GGVH 3UJIH 2HT3C 2AXGA 3TV3L 3L2LA 1AC6A 1UQSA 3SKNA 1OF0A 3KWWA 5KS9A 4ZSOA 3DX1A 1WSST 4PLNC 1V7NL 2CKBB 5MHSE 4Q9QH 3OKDB 2J5LB 5EF0A 1H3PL 2MJWA 3RX9A 5HGHA 2R83A 2IOMA 4LSSL 3RUGA 1G7JB 3CFBB 3OGCB 2HLAB 4G6AC 4H1LG 3NRPA 5HYSA 3SGKA 2LAAA 3LTVA 3T4AB 2I26N 4Y19D 3VFVA 3WOVA 2LVCA 1E9QA 2KUTA 4NM4H 1RI8A 2CJ3A 5JOPD 2VO5A 3A5VA 5EZIL 3DO3A 1DR9A 3WD5L 2APSA 1B2WH 4YX2L 1NBZA 5I16A 3SDDD 5EZIH 1FVDA 5CGMA 4DZ8A 2YUWA 1QPXA 3IS1X 4HIEB 5B38G 2PR9A 1JYVA 2E7HA 3HE6B 3SPCA 4QHUB 3HS0A 4M48L 2QPSA 1NZRA 2WYZA 4FTVE 4L37B 4XN5A 5JHDA 3RFZA 2NOYA 3CVIH 3KM1A 1KY7A 3H6AA 3TZVC 2VKWA 4ZTEA 1MN4A 1XV8A 1HIMH 1J5OL 1SBBA 3CN0A 4HUUA 2ZQKA 4J1UA 5AVQB 1VACB 1L7IH 5KG9A 3CHXA 1WBYB 4M7LL 4LCWD 1FNEA 2IH9A 4HZLA 3J2PA 4X2UA 5JQHC 2E0PA 3C6SB 2YXVA 1CIDA 1L0QA 1WZ1L 3ZDXB 4HKZA 3WXVL 3QI9A 4Y4HB 5IJKC 1LWRA 3HG1A 4G8EB 2OV0A 3C87A 4TSAL 1UWFA 3FU7B 4DQOL 2OYLA 4AYDC 1TQVA 3MBXL 2AVFA 2R0ZH 5DQDH 5IF0B 1JGVH 4YDJA 2NT1A 1IM9D 4XVSH 5I6OA 4F7PB 4P9MH 3QHFH 4TQEL 4N6RB 2XYCA 4HXBL 4M29A 1ZLWK 5FC9A 3WE6B 4GBXB 4OJAA 5D1QE 2JCCB 2BVEA 3KBEA 4L29B 2Y2WA 2ZOKA 4LL9A 4PGDB 4H8WL 4GIAA 4HX1B 2UXTA 1R3HA 4OJFH 1ITCA 4HCRH 5BV7H 2LU4A 4ADJA 4FNRA 1TZIB 3WNNA 2WVTA 3H9SB 4N5EC 1XD1A 5G2NA 5E2JA 2CR3A 4OLXH 4KAQH 2VE6B 1LO2H 2BO0A 2WPGA 3RDTB 2XWJA 2WXFA 1ZLUK 3PQYE 4FFVD 5ICZA 3H42H 3DIVA 3AB0C 5BCAA 2H8PA 1E8YA 3DUHA 3NESA 4JO2L 2R69H 1IARB 4NQXA 3ZTNH 3ARGD 3QHTC 4JVWA 1ZHBA 3ZRSA 3KPSD 4FXGB 1T3FA 4QOKE 1IM3D 4J2XA 4I2XA 1NUFA 1GGBL 5JHDE 4O51A 4XVTL 2FT6A 1ZT4A 2WM0A 4PG2C 1J0KA 2EJ1A 1G4RA 4HWZA 2IBBA 4F7EB 2ZUUA 3ECUA 2FO1A 3OF6A 1DVUA 4OCXL 3DX9B 5DHDA 4PHXA 1QHPA 1NGXB 2XWBB 5FGCE 4FYTA 3LRSB 5KS9F 3N43F 2ZCKH 1IGFH 2CXKA 1KXQE 3Q43A 5I0ZA 4OUUA 3DUSA 4NRZB 5CCJA 1E3XA 2VUOA 4A7UA 5E6YA 1CE6A 4G2AA 3QWNA 2XUWA 1RXLA 1T7VA 2FJFB 1R9FA 4N2DA 3DV4A 3IFLL 4NUJA 2DYPD 3RGVB 1IEBB 1HSAB 3VGFA 1Q9OB 2BSTB 3GXFA 5I1LB 2VDKH 1I7RA 3ARGA 4YVUA 3VI3A 1CFQB 1DL7H 3HMWH 3KXFA 5IB3A 4N90D 5L8JB 5CEYB 4E9XA 3QIUC 2NX5A 3L48A 4X0KA 4JN2A 2N7BA 4AW4A 1QEXA 4EQ3A 4Z5RB 4HAFA 4B95C 5T5NF 5I8KL 4FKKA 2XZCL 2CJSA 1D6EA 3RWDA 3ES6A 4NN5C 4A7GA 2DLFL 5J06A 1RUQH 4PJXF 1I1AB 1BOYA 3F83A 3GMQA 4PJIA 4U6YB 3VTTA 4AKQA 3NCEB 5D1QC 5EZLB 1FFPB 3BH8A 1A9BB 5FDYA 4F27A 3QIWB 1G0DA 4BK5C 2VLME 4ZFGH 4CSTA 4P5TB 3TN0D 4ZO6A 4Z3HA 3FQNB 1O0VA 2OQJA 5EZLA 3WU1A 1PDKB 4MS8D 4PLKC 1NC2A 2Y25A 2G9HB 1A25A 3CQPA 3HHSB 3FB8A 2VDPH 3BH4A 4W68A 4XBGB 1P4IH 1DDTA 4AC2A 4JQVA 2ZG3A 4DVBB 5C0BE 4HUMB 1I8AA 4I3RH 2X7LA 1S9WA 4PGCA 4WUUD 2IXQA 4TF4A 4WWID 4AOFA 2AXFA 5C0DB 5CR1A 3RNKA 4BFRA 2FD6H 4Z18A 4Y2DC 3BPLB 4N25A 2K3TA 3FQUA 4MA1B 2NY2D 4WK2B 1CBVL 3HC2A 2FJUB 5EZOH 3US9A 5IB1B 1NEZA 4QF1A 1IGJA 1NCAL 1J0IA 1C7TA 4UM9A 5TE6H 1KB5A 4PG2A 1E9OB 5JOFA 5IBUG 1JDAA 5HJ3A 2PP7A 1U36A 3IJHA 3BN3B 2DQUH 4WW2F 5EULV 1GTNA 1Y7VA 3VWKA 4U1SB 1BP3B 4AYFA 1CLYH 4YNYA 4Z7OB 1RJYA 1VPOL 2PR4H 3D7PA 1JDDA 1KCUL 3Q2WA 2CD0A 3SKUD 3CVCA 2ED9A 4AUUA 1I7TB 3A4EA 2PR4L 3VI4F 5A3ID 1NBVL 2X0WA 4N2IA 5FHAL 3VUAA 3WNJA 3ETBF 2ZICA 4Z7WB 1GPOL 1CXHA 1E5YA 5AW7B 3KLLA 3VRIA 4APQD 3M07A 2VLJB 1WH0A 2J6EA 1IJNA 2YQBA 4J23A 3F7YA 3VI4E 4PCTA 1AE6L 1SEBB 3C5ZA 4FI8A 5D5MF 5CEXA 3I9IA 4X7TB 4XHJD 2X2UA 1X7QA 3QCTH 4WGVB 5T3ZD 3FN9A 3TO4A 1FGVL 5D7HA 5SX4H 2VR4A 3MV7B 3QGVA 3SCMB 4AC4A 4IKIA 4ENZA 4HK0A 1KC5L 3DDFA 1IAKA 3WN5A 4CJ0A 5C2UB 4Y4FA 3KPPA 4HWBA 1JZJA 3GGWA 4PRNA 1IL1B 1T0MB 1UA6H 4FXKB 5BV7C 1GJWA 2YARA 2V7HB 4MSWB 3U4BL 4AQAA 1Z5YD 4PI0A 5F3BB 5DRZB 2AV7B 3FBQA 4G59C 3IDXH 4ZOBA 4ANWA 1HK6A 4XNYL 1FVEA 4AXWA 2VNCA 3O9WD 5AG9A 4RAUA 5F7BA 2F58H 5C0EB 2P8LA 4I3RL 3G7TA 2DQIL 3DMMB 3LXUX 3AREC 2KC0A 4YDKL 2NDGA 5HHNB 4HETA 3OLGA 4XMLL 3HS8A 3NAAH 4MAUH 3P02A 5E94B 4XGZA 4JJ5B 1NCNA 1U2YA 2GJJA 2EEAA 3SDCB 4H88H 1SJHB 2CDGB 1AR1D 5BRZE 4H5SB 4J1UB 4HWUA 4X6DF 1Q9KA 1MHPL 3K0YA 4ZFZB 1KMGA 2AQ2A 2XIIA 5KBPA 2VDNL 1T5KA 1GZHC 3GMNA 3NPZB 4OUOA 5DQJB 2GW5A 3CSTA 1WP6A 1QLFB 1NGQH 2VLMD 4PJEF 4PJXE 3MV11 4IGBC 3QXDA 2JKWA 5C0CB 5GZOA 1TO5A 1KLFB 4ZO9A 4J27A 1ZV5A 3D4ZA 1ZANH 4MJIA 3S8GB 2CO2A 1F00I 3SDDC 3CMGA 1LLAA 4R5TA 4DZ8B 4PV1C 4Z8FH 3O11A 1BAWA 2PTTA 3MRNB 3MLYL 2X2YA 2CIIA 4JAMA 2CO7B 4POZC 5CGTA 4JCWA 3W0WA 5JIPA 4MXQC 2JQZA 1NEUA 2EXYC 3SZKC 1HOEA 3RWHB 4YJZL 5CCHE 4X4KA 1N59A 5J0BA 1T7WA 4UU9B 5KSVB 1YEHL 5G4NA 2AJYL 2KHAA 3NZHL 5DJXB 3X12A 3FZUD 4HIJA 4M43H 2Y3NA 4KC3B 5CJ8A 4J8QA 1TZ8A 2CRZA 2X44D 5EO9A 2EDEA 1NCBL 3ABKB 2HYMA 2YEZB 1UD6A 1FH5H 3VJ6B 4PJ8A 4NJAL 3VXRD 1CI3M 4XWGH 3T0BA 1JHKH 4ZMAT 4ZMNA 1IL1A 3M8OL 5FA4A 3N6YA 3VXQB 1XB8A 1FNSL 2J4WH 1OOAA 3Q01A 4JZJC 4U6VL 3MNWA 1J8SA 4JANA 2XI9A 4L4VB 4QXGH 4FLOA 3IDJA 4XE0A 2R0ZL 5DQDL 1L0YA 4L3EB 3CFJB 3OQ3B 2NCMA 1ZK5A 2CSPA 3RJDA 2D7NA 4I9XA 1J5IA 5BQ7B 4G9FE 5ID1A 2K0RA 4J3XA 5HYJD 3PHSA 4JNXA 3UCRA 4IKNA 4J3OG 4F1SA 2R69A 1JGEB 4PREA 3W5NA 4TMPA 1A14H 2EDTA 3BEWA 1JTOA 3EUUA 2X41A 2DIJA 1AZRA 4JW3A 3K46A 1YPZE 2P8MB 1DEEB 1OF2B 2PCFB 2OJ1A 3AB0B 3Q3GB 4P46A 2X9YA 1NDGB 2XY1A 5DUPH 1W80A 2BVUA 3OKNA 3WE1A 1ZIAA 1GOGA 4HS3B 5D1ZC 5L8LB 4UAOC 3WEMA 3SBQA 4KKBD 2OA9A 5DZJA 1RFDL 2CHZA 1JZ6A 2W0PA 1ZD6A 1F4WH 3CZJA 1QHQA 5IHWA 4H8VA 2Y5TB 4O5LL 3O4LB 4NZRH 2PNDA 4AGNA 2EDLA 3LIZA 5D71H 4UBDC 1T4WA 1ZEAL 1J18A 2WBJC 4OZGE 2OMYB 4R0LB 3DMMC 4MNQE 4FNSA 4HIHA 4P59H 5F1IB 2WLLA 1FFQA 4Z77B 2P28B 5I1DB 3T6QC 4YPGA 1CICB 4F7CB 4YAQB 1F97A 2BK8A 1XIWA 2UXVA 1FFOA 3X11A 4NIKB 2JNZA 2XWXA 3GSUB 2H32H 4F33B 1ODUA 3RVTD 3AFLA 5EBMA 4EZJA 1THCA 2EYSB 3RPIB 3FU9A 4UM8A 4MNGB 2C34A 4Y16B 4Y19A 4TUJA 4KXDA 3K8MA 1H6EA 4JPIB 3WUWB 3PQYA 4WW2B 3B2VL 3Q06A 4GFTB 3FUJA 1Q9WA 5ISZE 5T3XH 3RX5A 3STZA 1JRHL 5F7YC 3ME0A 1VCAA 4KVNL 2W0LA 3ZTJH 1W6WA 4HXBH 5DFTA 1JZ8A 1N8ZB 1UD2A 4KTEH 1I1AD 3HCVB 2BM3A 4WFFD 2L7QA 1FZKA 3QEHB 4UIMB 3WFZA 3UZQA 2HMIC 1AJ7L 2L7EA 5IVOA 3PQYD 2PYEE 1TZHA 4KDTC 4MAYC 2QSVA 2UZYA 3I6LE 1AJ7H 1NIAA 3CSFA 4LLDA 3IGKA 1RIHL 1I85A 4HDIA 3D69B 5JPNB 4PJGF 3GSOA 1OWRM 1YAZA 4TQHA 1BVNT 3EH1A 2UY6A 4MZ2A 1UB6B 1G9EA 2E4TA 3DV4B 3KH3A 5JIQA 3SBRA 4RAVB 2GABA 2KZWA 2VXTH 5DK0B 5E8OB 8PAZA 4HWNA 5T1LD 1XIWD 5D70H 3ESNA 2TRYA 4K9JA 5I18H 1GY1A 2Y72A 5JW4Q 1T03L 4ZI8A 2BJML 3AWEA 4JANB 3MNWB 4GSUA 1I7ZA 4WW1B 3V2AR 2X6BA 2JCCF 1F4WL 4R2GD 2OLDA 4E0RA 4Z7IA 1JV5B 3MV9D 3QORD 4PJAB 2EVHA 2R2HA 1AGEB 2WTRA 1WUNT 4F58L 3MLZH 3BP4A 2AQSA 1BFOA 5A2LH 3SQBB 5KVDH 1DQJA 1GGCH 4UYQA 4AEFA 2ISDA 1YUHB 3MOBH 1C5BL 3P4OA 5H37A 5KSUB 1KEGH 4QRPD 5J12C 4O02A 4LP5A 2I07B 1OTUC 5F88A 2YRBA 5DYFA 3ZKNC 5ANHA 2V17H 4PJCA 4A37A 5IMOA 4F5CA 2BZCA 5C0AA 4QXUH 4F1ZA 5KSAC 3NH7H 3FN0L 1I8IB 3I84A 5AENA 4YBQC 4NZUH 1UXSB 1QKZH 1T66D 3KVPA 3N44F 3MLTA 5E6SB 3HFML 4MFHA 1FV1B 3F58L 1T1WA 3PU7A 5KSBA 3MMEA 5JW4R 3HMXA 5B1KA 1RH8A 3GDBA 4PGEA 5BJTA 1TQUA 1MI5B 1NCTA 2X4RA 3BFOA 2AK4D 3B4NA 3DJRA 5EU3A 5JXED 3O2VH 5DQJA 2N0KA 1AGDA 1E4KC 5EUKA 3WKML 4YL9A 43CAA 4S10A 5CD5D 4LSQH 4H0GA 1F0LA 3SE3C 4LVOB 3ZDXF 1M7DA 4QCIB 1XH0A 4OM0L 2NY6C 4PS4L 1DVFA 4YLQT 3S34H 3BEVB 2VISA 2C5DC 2CLVA 5IJDC 3KGTA 3I6GB 4LHUA 1DBKH 2ZXAA 4YFDB 2YD0A 2ZXDA 1AO7E 2OJEA 3P3YA 3G04B 4GKZB 3V52L 2C8NA 1DUYB 4UQ2B 5DF0A 2EEBA 3QEQA 4MWFB 3DSFL 5D8JH 2P46B 3F7QA 4WWNA 1N5YH 1OCOB 3NJVA 5ERWA 5I30H 3H4HA 2FJGA 1TOXA 4CAGA 2QDVA 5LUMA 1MWAL 1KXTB 3E8UH 3I9AA 4AIOA 4X7DC 1NFDE 2EE6A 4FQCH 1EDQA 2YOCA 5IROA 1SXZA 3IK2A 4OQTL 3TH3T 1U8OA 5T1JA 4L4VD 5EG6C 4NT6A 1AKJB 4G6FB 5F1OB 4QHNA 2Z7YA 2X6VA 1FC1A 3ZHDA 1OAKH 2CR0A 4RRPG 1CFSA 4PVBA 4P3DA 3CZNA 4X99A 1LDPH 5DJ8B 4L0PB 2BNRB 4PJIE 2Y6TE 3D39D 3G6DH 3L5XL 3VXSD 3EJCA 3EF7A 5DD0L 3CAFA 4JQXC 3I3BA 1X6LA 4M8VA 2XQYG 3LPOA 5DMGC 1MAML 3VFMB 1WBZB 1O9ZA 5AZUA 1CD1A 2PO6D 4EI6B 2O5XL 1EHNA 3DX8A 1CF1A 2O72A 3DURB 3QXDB 1AQMA 2Z31C 3AMLA 3TO4B 1N3NB 3ARZA 4UT9L 4X4MA 4FA8A 3W5MA 4GW5A 5D7JC 3R7RA 3LS4L 3N9GH 3SJVE 1IC4H 4KOBA 2Q10A 4E5XG 5DSCB 5I15L 3SDCA 4NUPA 2IFFL 2WCSA 5DD3L 1AZUA 4D9LL 5FKPA 3HI5H 2LTQC 1NIFA 2J8UA 4X4YB 1UM4L 2P1YA 3IJ7A 5KVGL 2GBTA 5AOIA 1GOHA 3G6AB 3EYVA 3OC5A 2WO2B 4NKQB 2ZXWB 3T3PE 3U0WL 1CD9B 3GKWL 4GAYB 1QASA 5ANMB 2Q7NA 2WQSA 1RLWA 1LO4H 2WK2A 3WKMH 4G71B 4EN3A 3DPDA 5CZKA 3RVVC 2MQ3A 4Y1AE 3GUTA 2F68X 5IZ7A 2FZ3A 4KHTH 1DBAH 2VAJA 5JORB 1JVKA 3TFBA 4EOWH 2NY0B 2J6WA 1XTLA 4RWYH 2ZF8A 4U7MA 5IG7B 5LAPA 3JWOL 5C9JB 3DO7B 1S6NA 3EZJB 2QMKA 3V0AC 4MAZA 5ITFB 3W81A 1FGNH 1TIUA 1UWXK 1HYRC 1IEHA 4YFEA 1TU2A 4PRID 1JCKA 2ZSWA 1NCBH 3VWJB 4NQED 1Q94B 3V4VA 2I9LA 2ODHA 3EGSB 4FL4C 5DDHA 3MLXH 4YL4A 5HYQB 3IDYB 2RQEA 5EEZA 3F5WA 4GRLC 2V3FA 1YJDL 4Y9CA 4KMLB 4XMPH 1VADA 1YEFL 2VUKA 3SCMA 4ANVA 3EBIA 1PFCA 3RL2B 4AX3A 1YZZA 3ZIMA 2HLFD 3VXNA 5GGVY 4O00A 3ARBA 4XNXH 4JGJA 4ZK8A 1OAKL 2G9HA 4ABVA 1CF8H 4Y9GA 2EDOA 3BUQA 3HKZA 5T3XD 3ZKQD 1U30A 3MRBA 5I6KA 3II1A 4LHUG 3MRLB 2ZWNA 3NAAL 3R1GL 5AAPA 4GP4B 3ZZQA 2A9MH 3RWCA 3ZIYA 1UVQB 2NY3C 2EIDA 5I74B 1MAMH 2K4AA 4QT5B 4YSPA 2EDXA 3QVAA 2YAPA 3EG9B 4MBOA 5HI3D 1MVUB 5FO7B 4HG4J 1FF5A 2CRMA 2H1PH 3NJGA 4M1DL 1KIPA 4MJ4A 4ABQA 1BJ1J 2VDNH 2AK4A 2B59B 2DLGA 2PCPA 3TPUA 5I73B 35C8H 2VJ0A 4YE4H 4DGWC 4UM9D 4X0KB 1ZKAA 3VGAB 3PP3H 2NZIA 3QPXL 3DIDA 4GT7A 2JKJA 4PJDA 3CFIC 4PJBF 4XMXA 4P05A 3D0LB 5F3HB 5K9JH 2GJ6B 1MCHA 2VH5H 3GMLA 4RX4A 5AW8B 5HGAA 4XXCC 4NQVB 4NQCD 2R29H 3Q8CA 4ODSH 1JI1A 4A2EA 3RNKB 2BOBB 4HGMA 1KNOA 2XLLA 2YK1L 1L9NA 4Z7NF 3MJ7B 2O61B 5M95B 3TVMA 5D2NC 3FFOA 4ABWA 2R7EA 5IEHB 3FO9B 1JNLL 2MNUA 2JIXB 4HUWA 1RURH 1NC2D 5CGYC 1KG0B 3EYOB 5JIIA 4RNRA 2CDEB 3DX3A 1GYWA 1L0XA 3P9WB 3RP1A 3ROLB 3MRMA 2XFXB 1NGWB 4OD2A 1OAQH 4HIIB 4RFNB 1LO5B 1M42A 1CXEA 1KB9J 2JKSA 3AAZB 1UZ6E 1CGVA 1TITA 4RGNB 3QUZB 5FWQA 2OTUA 1SDYA 3LKOB 3HUJB 4IRJC 1ZA6A 5T1LA 3KNBA 4I89A 2CUIA 5I1GL 5HPOA 3MLRL 5H35A 1DVQA 1D6EB 3BAXA 5IT2L 1ETJA 4N2CA 3LJ3A 4P23D 1MFAH 3DHMA 3QQ9D 4K3EL 5FUCC 4X9BA 3MLWH 3Q8AA 3C60D 1YMMD 2VJXA 4AQ1B 5JPNC 4JO1L 3KXFB 1AHWB 3VI3B 1GKEA 3MXVH 2LQRA 4HJTA 4NHUA 4NOBA 2Q86A 1IX2A 5EMYA 4EEEA 2A99A 1AFVH 4XWOC 2K7PA 1BX2A 1XCWA 4LLMB 1TUPA 3GF8A 1XGRB 4GI6A 8FABB 2Q6WA 4Y4KD 5LGJA 5EN2B 1AOZA 1CE6B 2BS71 2ESVE 4BHUI 5FYKU 3V6OC 1MIEH 2BP8A 2RALA 1MCOH 5H37H 3V9CA 5EOCH 1AI1L 1MF2L 5F21B 2QHLA 3DSNA 3WY1A 3U9UA 4E41E 4TVPH 2VITA 4LK4A 4JFXA 3EUDA 5GS1B 2ORBH 4U1MA 5HYEA 3B7RL 4FG6D 2VSCA 3OKOB 2W60A 1TF4A 4IKJA 2Y6SD 4Y4HA 4BZ1H 4D0DB 4KWUA 2GTWA 4Q6IB 2OAAA 1B4RA 4P4KB 3UX9B 2NR6D 2WUCL 2B3IA 2H3NA 4CVXB 5CLWA 2Y3AA 3VCLA 1CXFA 2ZZUT 1YYLH 1IM3A 1A8ZA 1MCRA 3L1OH 1T1ZA 4HLZG 3ZKND 4KZCA 1OAUL 1QUNB 3AREB 4WRLA 2EVGA 3KL5A 2CK0H 3KDMB 1WLHA 3FH7A 4Y88A 3V6BR 4G8FB 1JUFB 4MMYA 1XZ0A 5DRNA 3UBFA 4E9WA 2AAAA 3HMXH 5IFHL 1FI8C 2C9UA 1Z9SA 4DEUA 5FM4A 2C9QA 2YOAA 2OMBA 2WVUA 1N0LA 1U92A 3VVVA 3ZHLA 2FUTA 2VM4A 5AVZB 5CXPA 5I24A 3BPNB 1IAII 4QY8A 1KCVL 5DJAA 2FECL 3JWOC 4PBVC 3S5YA 4YC2C 3ZJAA 1VGEL 3DYOA 2FEDD 1C5DA 1MFBL 1PZAA 3MOAL 4X8CA 4LF3A 2BSRA 1UJ3C 3WUZA 3C6LA 5FYKH 4GRWE 5GGQL 1QFUL 1NMCB 4QHMA 4UT9A 5GRVK 3ZDXE 5CEZE 1ACZA 3L08A 1U9KA 1JNNL 1RU9H 3CFQA 3SB3A 4DVRH 4D9R