4AGOA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5174
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
b'SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
molecule tags Cell cycle
source organism Homo sapiens
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agoA00
3D06A 1EANA 4IBYA 5AOIA 4AGPA 2X0VA 5BUAA 2WGXA 4QO1B 4MZRA 5AOMA 4IBVA 1IO4C 3TS8A 2XWRA 3D07A 3ZMEA 2BIQA 4AGNA 2BIMA 2J1WA 4AGLA 3WU1A 3US0A 3Q01A 3QYNA 3D09A 2AHIA 2XWCA 2H1LM 2AC0A 1LJMA 3KZ8A 3EXLA 4G83A 4IJTA 1UOLA 2X0WA 3IGLA 3D0AA 4KVPA 5AOKA 2IOIA 2FEJA 5ABAA 1H9DA 4L0YA 3QYMA 4AGQA 2J1XA 5AOJA 5KBDA 2J1YA 4L0ZA 5LAPA 2ADYA 3WTUA 3Q06A 2BIOA 2VUKA 3WTWA 2J1ZA 1TUPA 4LOFA 3US1A 4IBQA 5A7BA 3D08A 2MEJB 5LGYA 4AGMA 4GUQA 5AB9A 3WTYA 1CMOA 2J6WA 2IOMA 5ECGA 1EAQA 2IOOA 2GEQA 4A63A 1HJCA 4GUOA 1GZHA 1HU8A 1GZHC 2YBGA 3WTXA 3KMDA 4AGOA 4LO9A 1EAOA 1KZYA 2J21A 2BIPA 4LOEA 3EXJA 1T4WA 2OCJA 3WTSA 2ATAA 1YCSA 2P52A 2PCXA 1E50A 3WTVA 4L18A 1TSRA 3VD1A 3WTTA 3D05A 4IBTA 3Q05A 1HJBC 2BINA 4XR8C 5G4MA 4IBWA 2X0UA 2J20A 4G82A 4IBUA 4MZIA 2RMNA 4IBSA 5AOLA 5G4OA 1CO1A 4IBZA 3IGKA 4HJEA 3VD0A 3VD2A 5G4NA
chains in the Genus database with same CATH superfamily
2FLRT 3X12B 1HSBA 4X6CE 5F7EL 3OD3A 2WY3B 1CE6B 2H47C 3UAFA 3ZDZE 3GIVB 3Q43A 4ZO8A 4L9LA 1IILE 2PO6D 3F7RA 5FYKL 4HIXH 1IO4C 1YJDC 2VN6A 1MJ8L 2EEDA 3HNVL 3MJWA 4TQ8A 4JRLA 1TR7A 1HX0A 2ZZUT 4C4KO 4MCYA 1BEYH 3MRKA 3R0NA 3QAQA 4N0UB 4OSUL 5JNYB 5A40E 3D09A 3P69A 5C71A 3L3GA 1GYVA 4H8QA 4OB5L 5CSGA 3HBPA 5E4OA 5F21B 4I77L 3C8KA 4WO4B 3BO8A 3C5ZD 4R4FL 2ARJA 1R3KA 1EEZB 4PWIA 5IQ9A 4NUGL 2AK4A 5GRZA 4MJ6A 4CSTA 4KKBC 2YZ1A 1ECYA 5DQDL 5EHFA 3UZQB 4IRSA 4PJ9D 3QULB 4LCWE 2GSIA 1JD9A 3RLSA 4EOWL 1UZGA 3SOBL 3GGWB 3S2CA 2WSKA 4JFFD 3CZJA 3ATDA 4I9XA 5DSCB 3ZKXB 1NL0H 3ZQWA 1P4LB 2W8CA 4G71B 4HEPA 4NPYA 3H4FA 1J05A 2VLKB 4OQTH 2MOVA 1K5WA 4HS8L 1T2JA 2QHLA 5ES4B 1BVKA 2HRGA 3NYKA 3MLSL 1SUJA 1CLOH 3DIVA 5A7BA 3BGMA 4JRYE 5GISL 4K5LA 4JCWA 3OR7B 1FVDB 5FO7A 3ZZLA 1Q72H 4YDJB 5IMOB 2VXSL 2WVTA 5KYXA 1RJLA 2ZQKA 2OL3L 5GRWA 3SIKA 3D51A 1IM9D 1A8ZA 1Q9WA 3ARGA 4Y2DB 4ES8A 3TN0B 4HEME 1E43A 1KC5L 2VITB 4UT9A 1A3LL 3EFOA 1CF8H 3L7EB 3Q2LA 5HJ3B 4ZNEA 2QVIA 4JHAH 5CINL 4B9ZA 2ORBL 3RTQB 4MMZC 4KXCA 2YRPA 3PGCB 4FNTA 5DHYB 5GRVL 4UT7L 4PTTB 3BKMH 5EPMA 2ZKMX 4PVLA 3MOAL 2H0PA 5LN8A 2KZWA 1MDAA 3FB6B 2X53A 2ICES 1OAQL 2KKQA 4X99A 3EW3B 1KIPA 3GMPB 2AQ2A 4J6RH 2FJSA 4AQZA 2P5ED 2BLFA 5E9AA 3EJUA 1L3WA 1WFTA 4DSYA 3P02A 4F93B 1RSYA 2FX7L 1AXSA 5EUOA 5KSVB 5IOPA 4F1ZA 1I75A 5C08B 3B5TA 2PO6A 2Y36L 1J1XH 5F1IA 4KKCC 1USQA 5BUAA 4NIYE 1W72B 2WGXA 4UV7H 4NZTL 1TLMA 3CHXA 2P43B 5DK0A 2AXWA 2HFGH 5E6YA 3WFHB 4C57C 3MBXH 1X4YA 4KI5D 4CNIB 4EI6A 5F7DA 4XXWC 1MIML 2Q86B 3PG2A 3Q9PA 4EN2A 4N1EA 3QG7H 4QXTB 5BVJA 4NQSA 1KCWA 2DPKA 4OKVA 1HDMB 3PHOA 3N3EA 3ARYA 4C83A 3GXTA 4UILH 4B0MM 4BCZA 3Q6FB 3DVGA 3QDMB 5F88B 1JXFA 1HZHL 3NJJA 2WMPA 2NQCA 2O72A 3NACH 1K8IB 2A9BA 3CZFA 3QJSB 1T03L 2WIIA 4M6ML 3VFOA 3VXNA 5DJXA 4Z77A 1JV2A 2MNJB 2DTML 4LL1A 4P46C 4G6MH 1L0YA 4JPKH 4K5NA 3HE7A 2LLLA 3GTVA 3SKJH 5T1KB 1Y7VA 2R69L 5DUJA 4Z7VF 4OJEH 1AQKH 3QW9A 1FNLA 4NO0D 1KFGA 1A0QH 3P4MA 4I4WB 2DTSA 2VERA 3UC0H 4NGHH 4AKOA 1SEQL 2XWJA 3DIFA 4KRMB 5E0FA 1SEBA 3V6OE 1A2YA 2VW7A 2WPGA 2ZKXA 2NY4D 3A4DA 4XC3L 1V3JA 1FG2A 2HRLA 2NXZC 5CKGA 2ZCLH 4B9CA 4WJ5B 4OUUB 4YE0A 1ED3A 3I9GH 2CCLA 3ESNA 3ARDB 3BCFA 4ZFGH 3IRCA 5EB9A 4ZUWA 5DJZB 4JE4B 2CPUA 4C54A 3EHBC 4IJ3C 4P5TA 1UM5H 5CBAB 1FAIL 3HE6D 4JFZL 1W6WA 3WYRA 1VFBB 3JYCA 4L4JA 4UILL 2DLFH 1RZ7H 1RZKC 1YY8A 5HSFA 4OJFH 4ANUA 2VRAA 3MJ7B 3BWSA 3GS0A 3ZYIA 4LCCC 4R97C 1JDAA 4Y5XA 1KJVB 2X4OB 1LO4H 2HVKA 2Z35A 2EP6A 1QHOA 4O2FA 1JWSB 2I60H 5D93C 4RAUB 3IDNA 3SZ6A 1C5BH 1CIUA 1MCEA 2EXTA 4OI7A 2X70B 1SOSA 5BMFL 1AR1B 1HIML 2FECI 2OR9H 5DEFA 3PL6A 4HCRA 3BFQG 1AOZA 2EXYC 3UEZA 4PFEA 4Z0XA 5BOJA 2NR6D 2Z31A 4EO5A 2AJZA 3MLWL 3W0WB 4G6AC 1IT9L 2CHDA 3SGEI 4XMXA 2VZ3A 1ZT4B 2DD8H 3U25A 2EDKA 4LDCA 1Q9LA 5E8EA 1DBJL 2X3CA 3N44F 4MBOA 4X8CA 2EE3A 4RA3A 1FFOB 2PP8A 4FQLH 5HPOA 5IMMB 4S10A 4XB3A 3F62A 1I4FB 4ZDHB 5D1XE 4HSAC 4FQ2H 4OIIH 1JN6B 3ERXA 4G7VL 5T1LA 2NNAA 2YAQA 3TA3D 3EFFB 1KLFB 3E9TA 3SQBA 2IPUG 4N1HB 2Y7MA 1U2HA 3IFOB 4GAGH 1EZVY 2NY2C 4UV4L 2A9MH 3WFCH 2XVGA 3NJHA 1ETA1 2QLVB 4PM1A 5J06A 1B2YA 2KZKA 4WI0A 4L8BA 4PY8J 3C6LB 1YAZA 4NUJB 5I1AA 3JSSA 2OMZA 1M2VA 1ZVHA 2LU5A 3VXUB 4EDWH 1RK1A 4BEIA 2APSA 2Z91A 4TVPH 4AUYA 2W9DH 1S3RA 5IV2B 4NQDE 1A7RH 2XVBA 1OT2A 2W65B 3TM6A 5C6PB 1D6VL 4NKDA 3CFIC 1KYFA 1O9WA 1O6SB 2FBOJ 2FJHB 3FTZA 4HH9B 3OGCA 3O8XA 3VGBA 1OK8A 2M1KA 5D2LA 3FT3B 2HXAA 2HG0A 1T3FA 5HVHC 1QP1A 1YPZF 4OFYA 2NY5H 3MV7E 3UTTA 2AXHA 1URIA 4F9PA 3G5VB 3L95B 3H56A 1FVCB 1XD1A 2QT6A 4LSPH 3C2AH 5T5FA 1F3RB 2VLJE 1FUNA 1U8LA 3TEUA 2GY5A 1S9XA 2CCWA 3NPZB 4FZ8H 2X9WA 1FRGH 5FOJA 1H3WM 5KW9H 4LOFA 1MW2A 1FFQA 1HDMA 3PHOB 1TETL 3RWGB 3RKPA 4KKCD 4NKIL 4PJCF 5IW6A 2CO1A 3LQAC 2BFVH 3BQUC 4MJ5B 3EZ8A 4UT6A 4ENEC 1QFUL 4FQXA 1OLZA 3CSBA 1J5OH 1IKFH 3LAFA 1WEJH 5T1MB 1U8MA 1YPZA 3U7YL 4CVXA 4BDVB 2EUVA 1XGZA 3DUSA 2YAEA 4Y16A 1NC4B 2WUBH 1OAUL 5HDQH 1WIOA 4A37A 3FJTA 4RFEA 1G7PB 1MCOL 3CFDA 5E7BA 4KJWD 3RFZA 1AHWC 1RHHB 4MSWA 4FXKA 4PJHA 5I1KL 3UFIA 1CK0L 1KYUA 2A6DB 2Z31D 4RWHA 2VM4A 1R4XA 4FLHA 1ET8A 1DSFL 4JPWH 1M6UA 4QRQB 4V1DA 5CHNB 4P49A 5ILTL 1TTFA 2Q0ZX 5EPMB 4YFLI 4MZIA 4YAQA 5E2WL 3ARED 3IGKA 1HYSD 4MQXD 3B2UD 1CVSC 2Z7UA 3BEVB 1R5VB 3ULUD 3BLKA 2XNAA 1T6VN 2DWEA 3PYCA 2ZYHA 3HKZA 4C56B 2P44B 1WA2X 3A67L 4ORGA 5J5EA 4FJYA 3BPLB 5C0GA 1V3MA 4OCLC 4LLUA 4N9GA 3BZDA 1W9XA 3QUMB 3MRLB 2JELL 4OGXH 4JM2D 2YSSA 3GSNL 1FQ9C 2NY4B 5JMOC 1VGEL 2I9TA 2HMID 4GRLB 3CPLB 5HJDA 4AGLA 3KDMA 1HINL 2D7PA 4BFBD 3D39E 2ADJB 3OB0K 3S96A 5DFWH 5K9JL 1HEJC 2YD1A 5FYKE 4BQ9A 1AZUA 1KT2A 1YJDH 2KZBA 1L6XA 1GGIL 4FA6A 1CCZA 1E42A 4MNGB 3T8MA 4ELKB 5GZNA 4ZNCD 4HUXB 3G5VA 1JGDA 2VDML 3L95A 4MCNA 5JDJA 1U6AL 5IB4A 4Y1AA 5DDHA 2GSIB 4OFYD 2R0LH 2XFXB 3LDBB 3BVXA 3MBWB 3PGDA 4HFWB 5BRZA 4ZI8A 1EO8L 4UQCA 4LLYA 2IAMD 1MF2L 1YO4A 5DA4A 3O8XB 3BW9B 4JHAL 1BQHG 2CJSA 3AB0B 5ENWA 2ICEA 1XF5B 5BQ7B 1MVFA 2FWSA 4W4OC 5HHVH 5JHLL 4Z95L 4XXWA 1XZ0A 1NCGA 3ZKMD 3MMEB 4EEEA 5T1DH 7TAAA 2A9NH 2YBRA 5EUOB 2HTKD 3MLZH 3VE0B 2GJ6A 2XJLA 3LDBC 2PO6C 3BZEB 1J87A 3C6LA 4NUJA 4AUJA 3ZT7A 4JHZA 2HT2D 5BOPA 5IHWA 5KG9A 2HH0L 1HI6B 3PGFL 3WFDL 4O00A 1SMAA 5B38B 4JGJA 3HMWH 4DN4H 2SODB 2ITEA 3E2HB 5IVXB 4H8WH 1IBDA 1XF4A 2GEQA 2Q2EB 1GGIH 4DAGL 1ID5I 4HMCA 2V17L 5H37A 3VXME 2YEVB 2DQ6A 2JNZA 3AT9A 1U9KA 1H6UA 3OQ3B 4QTIH 4XZ4A 4Q0XL 1ILUA 1A02N 3BKML 3MREA 1KIQB 5HGDA 2RB8A 4F7CA 3EJQA 3HG1B 2VR8A 3G08A 1KCKA 1DVFC 1G0DA 4UUJB 3MA9H 1OZUA 3PAVA 5AEAA 3HC2A 2ISDA 1N8OE 3TH4T 5ABDE 3CC5B 1ZKAA 4N5ED 4N8CH 2OKMA 4PS7A 1IGCL 2ZYRA 1HS6A 3PL6B 5E5UB 4XB7A 4MNQE 1INQA 2IDSA 2BSRB 3MRCA 4LLMA 4XP6H 5K69A 5CN1A 1J88A 3NA9L 1MUJB 2YGNA 5I66A 1E9QB 1OTSC 4MD4B 3KPOA 4HUMB 4LNRA 3EF4A 3K6IA 5DSCA 3BEWA 5K59F 4GQPH 3ZX1A 2R1YA 4NNXB 5AVVB 4APXA 5A16A 1QBAA 2VH5H 3MRIA 2I5YH 4PLKC 3T0BA 2GAZB 1QSFE 5AW1B 4G8AC 3CAFA 3M8OL 2E75C 1A7NH 5HI3C 2XZQL 5DJZA 2X1PA 5B4MC 3ELAT 4KI1A 4BGLA 1UADC 2IDTA 2PMZA 1P6WA 3S3BB 2CUIA 4Q0XH 5IQ7L 3KEDA 4Y1AD 2WNKA 3P3SA 4HUVA 5F97E 1K6QH 2D7MA 4G8GA 5L88L 1PX3A 1QI5A 3R8BB 2CDGB 3WN5C 4CMMB 4TSCH 1BV8A 1IGYB 4P59L 3PCYA 1R47A 4G7RB 4F37K 3VTTA 4P23A 1U3NA 4KHXH 1A6ZB 2E7LC 1JWMA 2FGWH 3DUUB 4NNYA 1FZJB 1U4EA 1KY6A 1N10A 5KVFH 4MA8H 3WDHA 3EFDL 1MY5A 1QEWA 3PGDB 3GRWL 1OWWA 1JK8A 3BP5B 2NQ3A 5FUZL 3LH9A 4AEIL 5BVJB 3ML8A 3OWEA 3KNBA 1IGTA 4XBEL 3VTAA 4YZFE 3FU9A 4XOBA 5I1CH 3N91A 1QASA 1SDYA 2CHNA 1T4KB 4HWBA 5F9AC 1NDGB 4FS0A 4HLZH 3SYCA 3EJJX 5DRXA 3BWUC 3ATAA 2BHYA 2DD8L 3VYNA 1FFPB 4M29A 4NJAL 5B1BB 5DJAA 1BF8A 1RULH 2YPLD 4PHXA 1LO3H 2UUDH 1FYTD 1EV2E 3VRIA 3IMSA 2O5NA 3K8LA 3NPSB 4EI6B 4WCYL 5CFHA 3UPRA 1RZGB 2HFFA 1TZAA 1OP5H 1C5BL 4AUUA 3U0TB 2EDJA 3BPNB 3KJ4C 5SWZA 1MFMA 4FQJL 4OIBA 1B9ZA 3VXUA 4FG0A 3N06B 4AEHH 4F7TB 1G7PA 3MGTB 2R0WH 1HQ4B 3RA7H 1DBBL 2NZ9D 2ITDA 1CU4L 5EO0A 2B15A 2HLFD 3H9YA 4P2AA 1JI2A 2G60H 3WD5H 3KGUA 4IBWA 3E1F1 2EVHA 4M6OL 2H5UA 1JN6A 3FSAA 5DS1A 3W9EA 1A6TA 5E8OA 3VD0A 3EOAA 5FFGA 4M6NH 5TF1L 5B8CA 1E9PA 2C3VB 3OJ2C 1DE4B 1E65A 1EIBA 5J6SA 4A6YB 2EXYD 3Q3GA 1A6AA 2R83A 2DWXA 5GGRA 2GFBA 5D7IA 2DN7A 3MU3A 4RGNB 4TSAH 2Z93A 1AR1C 1KBPA 3PDGA 3PNRB 2WBXA 4PRIB 4E9LA 3MXWL 4WHDA 1OV8A 3BGFC 3KL5A 3ZE2F 4ODWA 4CMHC 4E42A 5KW9L 1T7VA 3BKCH 4PJXE 4L37A 1U8NA 1GS7A 3RUGB 5AAWC 3DO3A 5HHQB 4MAUH 3LNDA 2AHIA 3OGCB 3RWJB 5CKAA 4ONGL 1JUFA 2H9GA 1QPXA 2IQAB 5AYUH 3BDYH 4HWBL 2H1LM 5C0CA 4P5TD 2C7UB 4ERSH 4U1LA 1QWHA 2A73B 5IMKA 4W9LC 3V6FA 4X4YA 4DGYL 1WUNT 3KM2A 4X98B 4GKLA 1L3NA 4XCYB 4JFEB 4ELME 4Y4HB 4HKBB 1JWUA 1SMDA 3C5ZA 3HZMA 2R4RL 2AVFA 3NFSH 1XBDA 4HZ1A 5FUOH 5C07D 4PRHD 5AOZA 5IQ9B 3FT9A 4QRQA 4KDTA 4L0ZA 3L17A 5DRNA 4AIEA 3V5DB 1EJOH 2R1YB 4NNXA 4APXB 4MLSA 3SEPA 2GB2A 3E6FA 4OVUA 1E9OA 2VXQA 4JFFA 4UQ3B 4Y4FB 4NKIH 3P4MB 1VCAA 1Z32X 4MCYB 5AB2A 5CR1A 3MRKB 1MLBA 4I48B 5IKCB 3L7EA 4P4KD 1MRFH 3L3OC 4ZFZB 3F7YB 4C56D 5IG7A 3GHEL 1MPAH 1BIHA 5HDQL 2DV6A 5K1NA 3BGMB 2C1PB 5D2NC 4GQ9L 5B1KA 3OSKA 1FGNH 1MNNA 5D72H 2E6QA 5DQJB 3CVCA 4CVZB 2YXMA 4LPCA 1SOXA 4U6HA 4HIHB 3GSUB 1R1CA 1P4IH 5EO9B 5K9OB 3IJYB 3WL9B 2KDYA 5GSVA 2X4UA 1IVTA 1I3GL 5K9QI 2VDNH 3A6CH 3MLTA 4MD5A 2X40A 5JHBA 3D0VB 4YFDB 1G0XA 3ECVA 1BFOA 3DBXA 4TQEH 1Y6MR 1A25A 3TP4A 4KK8C 4G42B 1NFDA 4WAFA 5F3HB 5J6GA 2IDCA 4KRPC 1NEPA 4WWID 3MLVH 4P2QD 2IMNA 4TUOB 4AGPA 2KDGA 5DMGC 1NQBA 2HKHH 4I0PA 2VL5A 4M5ZH 1TCRA 4NQDD 4N5UA 1XZ0B 4AQ1A 1A9EA 5LVEA 3CXHJ 1KJ3H 3KGTA 4FFZA 4U1JB 2CLVA 3NJLA 2DQGL 1NSNL 3OKYA 4R3SB 4HIEA 1O7VA 4GG6A 3MV9D 2VIRB 3HZKB 1XCQA 4AI7A 2EYRB 3HPJA 3RTQA 1IGIL 3B7TA 4UYPA 3SGKC 2YPLB 5F3BA 5HJ3A 4LCUB 4OCSL 2QVKA 5J9PB 2BCKA 2JCCB 2NX5B 1S5HB 4KXAA 3TNNB 2Z7ZA 3QXUA 5EU7E 3ZDYF 4XN8A 3KPLA 32C2B 2AZUA 1B0GB 4WV1A 4PP2A 5GRYA 5M95B 4P9HL 1PPIA 1RIVH 2WTPA 3DSNA 1MHPH 3FQWB 3GJFK 5F44A 2AJXL 4HJUA 2Z0UA 3VFRA 1IAOB 2ZUTA 2FUTA 5I6NA 4AOFA 3JV0A 3FUMA 3JWOH 2VW4A 4FL4C 1MHEA 5GRVK 3MA9L 1GKOA 1K4DB 4Q52A 1PIFA 2BIOA 4CNIA 4NO0A 1KEML 3AAZB 4M93C 1OGSA 2J1ZA 4KKBD 1A0QL 2P8MB 5LLIC 2VN4A 4FYQA 4O2CA 3KBPA 2PYEA 1XCTB 4AYDC 4FLRA 4PWFA 4N2LA 1JAEA 5A7EA 1SF3A 3NFPA 4U6VL 2VR3A 3BUTA 4YOKA 1IE4A 1CXKA 2EO7A 4HSCX 2ZUQC 2XWXA 3BPOB 2IJ0C 2E27L 2FX8H 1LE5A 1BGXL 2RCSL 1HWGB 4LARL 3DIDA 1C5DA 1WZ1L 3VFWA 5FW6A 1P7HL 4J3SA 5IY5B 1QX1A 3O9WC 4FGMA 1NEZA 2CXGA 3RWDB 1BD2E 1PAZA 3F04A 1AO7E 3ULUE 4RMQA 3RA7L 3ECBB 1UH4A 4QWWC 3BWAB 3ULAB 1UOKA 1UQSA 2X9YA 3DJRA 5L4IA 7CGTA 4LVOC 5HHME 1AKJB 3GUTA 2WCGA 2WLNA 3HE7C 2IGFL 1YG9A 2FH8A 2XWDA 3OKMB 5KS9E 4JK0D 3WIAA 2NCEA 1D9KD 3ABMB 3VWKA 3TCXA 2AI0L 3SY0A 1WC7A 2D0FA 5EBGA 4HJGA 4LKXA 1HILB 5E2UL 4OGZA 4HU8A 1TJMA 4G42A 5F3HA 5FYKD 2W5PA 1BXVA 2VLKA 3JWNC 3MLXL 5GSRA 1NWOA 3IDMA 3SPGA 1P4LA 3KDPB 4NZTH 2MJWA 5K1JA 2AJUL 5TDPA 5MP6L 4CRPA 5MEOA 1EXUB 2DLIA 1HKLL 3QVAA 3MV8E 4F58L 4MQXC 2YQ3A 2PABA 5HY9A 2OMYB 2NRDA 3UYRH 1AD9A 3BAWA 3PUUA 5J89A 2E59A 4GAGL 2JKLA 4NN6C 5E1IA 3QQXA 3G6DH 3ILPA 2ZOTA 2YGQA 4JKLA 4KX8A 4PP1C 2L7QA 1YEIL 1ICTA 3ARWA 3DOHA 1JXKA 3W56A 5F9WB 2DM2A 2R2HB 2YEZA 4BZ1A 5EOTB 1HH9B 5IM7B 2COVD 3QZLA 3IGLA 2YIHA 5F0LB 2GJRA 3B9EA 4NKMB 5EUKA 2V3DA 5I1LA 2A83B 3KYAA 1O7DE 4ODXB 3V4PA 1FYTB 3GHBH 4M7ZB 5JHMA 5E1AB 3L1OL 4FQIH 2VLJB 4OCRH 3G9AB 3OMZA 5IEKB 4ZYKB 3FFOA 5F89B 2VUKA 1IAIH 4JKPH 4YJZL 1NIDA 4GP4B 3FZUD 4AQ1B 4ZYKA 2CUAA 2A1WL 2YD6A 1LK3H 3DXAD 2NY3D 1WP6A 4RGND 5AW2B 4XP9L 4BUQA 4A55A 1Z0MA 2CXKA 4G8IA 4HIEB 4H2CA 4JO2L 1PEZA 2K0RA 5AVWB 1KTLA 5JQIB 1WBXA 1DANT 3O0RH 4C47A 1TQCC 3U6RA 3MTXA 1HWWA 3F7QA 1XIWA 3GI8H 3VSQA 2IGTA 2FO8A 2BFVL 3BD4A 2XDHA 3QIUB 4GSDH 2XXMB 3IJ8A 3QZPA 4FFWC 4D0CA 4A2LA 3PRZA 4NKOB 1HOCA 1BVKB 4LEBA 2Z4QB 4AJYV 2WUCH 2WTRA 1ONQA 4PLJC 3RUGA 2VSKB 4O2FB 4YHPB 4EIBA 1LNUB 4CVZA 5C6TL 5DQJA 2F53E 3ATBA 3LKNA 2DWYA 5CZKA 4B5EA 2PW1B 5TE7H 1EX0A 4F8TA 2WBJC 3HVNA 5D7JD 5KYUA 3MRDA 4ELDA 6PCYA 4UUJA 1PFOA 5GSRB 3QFDB 5GGRB 4UB0L 1XF3A 1IAIL 1RIUH 4LK4A 5BS0D 3VD2A 1C12B 2J57A 3MLVL 3ZQ9A 4Q97A 2NUTB 1JV5B 2YQBA 4MNHB 5DLML 3BESR 3BXNB 3PFQA 5AZ2H 5ITFA 3OLGA 4Y5YA 3QAZB 3DC0A 4PJXA 4R4NC 3E6FB 3DIFB 4UQ3A 4PRIE 2AQTA 5TPWL 4OLYL 1KYAA 3TL5A 3U2IA 5JLZA 3QWNA 1MN4A 4I4WA 1UUNA 4APQC 2GPZA 3GXUB 4LPXA 1DUZB 4OF5A 5HI4D 2IPKA 1P7QB 4K3HA 1D2PA 1H3XA 4GSDL 1DCEA 3FYEB 3MRFA 1KEGH 1GAFH 4KC3B 5KSBE 5EG6C 3WNPA 2BOCB 2FWLB 3OL2A 3AM8C 2OMTB 3V6FB 3VI4E 5I18H 3ESUF 3H3KA 5IWLC 1YUHA 3AS2A 3TBSB 5EEUA 3EO9L 1KC5H 1T2XA 1N19A 2A9CA 3TBTA 4MAYA 4F2MA 2FR4B 4S1RH 2R4RH 2OQJA 2XWTA 2N7BA 4XNDA 3EYVA 2VMEA 2Y3AA 4P5MA 1S8DA 2V2WB 1H3UA 2DWTA 3OGOE 1N8ZA 3UAJA 2YD2A 3DTXB 1KCVL 4U3XA 4YFLF 2XFXA 1IQWH 4I0PC 4OCXH 4AQOA 2Q3ZA 1IAIM 1OD9A 3D0VA 1BBDL 1FYTE 1NDGA 4R7NB 4TKWA 3SDXE 4KUZL 3TJHC 1A1OA 1H15B 2ZOUA 4HEPG 2XI9A 4JCLA 4NQXA 3HNSH 1PG7X 4OT1L 4XBPB 1H8OA 2XXFA 4JPSA 1K4DA 3QWOA 2VRQA 1BBJA 3KYNA 4GS7B 4FEIA 4YLQT 4E9RA 1J18A 4R2GB 2QFRA 4BD4A 1C7TA 3IKCA 4Y4KC 1AQDA 1LM8V 3S96B 1U8PA 1DE4A 4AL8L 4Z7QE 1QBLH 5BUGA 4JDTL 3SPHA 2H6PA 1Z66A 2GIYA 3S3DB 3VM5A 3CHQA 2ICWJ 2VXVH 1NICA 2QSTA 2QVMA 1KUMA 3FRPG 3MOQA 2BY2A 3QWRD 3DYPA 2YFNA 3P9LB 4ZQTA 1VADB 3D1MC 3RTQC 3OM3B 1MWAL 2GW5A 3ZDWA 4U7KA 2DMBA 4B9JA 3RGVA 4ZUTA 4XAWH 2BM3A 4KTEL 2AEQH 3HE6C 2DQTH 4NQEB 5HDRA 3PQYD 3R19A 3BUDA 3WTSA 1CFSA 5IJVB 1OAJA 2L04A 5T3ZD 2X4RB 5I1KH 3MVSA 1DQML 1MREH 4ETYA 1T03H 1DQQA 3HR5B 1UWGH 3Q6GL 1TSRA 1U21A 4IS6A 4LLWB 1AGBB 1EA9C 1KJ2A 3NEOA 4U6XA 4W93A 2EIMB 4HETA 3BVWA 3THML 1JZEA 2WYHA 3C5ZB 3DHMA 5DFAA 4M5ZL 2OFQA 2F54B 2WCSA 5LBSL 3TA4D 3PWPB 3D06A 2YD3A 3HN3A 3FAWA 4G7QB 4BH7A 3B5GA 3PS6A 4JNXA 2D03H 3RNKB 3BKYL 3CU1A 3IDYC 3Q8BA 4IDJH 4NO0B 4BZ1L 4XH2B 1DSYA 3SKNA 1BZQK 2DQMA 2JWYA 3O2WL 4I3SH 2V33A 5GISH 1G1YA 1GW6A 3CFTA 1Z3GH 3F7LA 3I6SA 5TK4A 4E9SA 2FATL 2ZOWA 3FONB 2ALAA 4AGNA 2DEYX 9PCYA 3VU2A 5JORA 1HHGB 2UWEF 3RGBA 4CJ1A 1TCMA 1EEYB 2FEEL 3C5SB 4NOFA 5CD5D 4MKMA 3FQWA 1SBBA 2C3XA 2JIXA 3IE4A 5A2JH 5E0QA 1Y0LB 4Z7WA 2MCPL 2IV8A 1WBYB 2DQFA 1AVAA 4KY1H 5H2BB 5B3SB 1A3QA 3KPSD 4OFQA 3ZTJH 4IJTA 3D3VE 1R9FA 5JOFB 1H5BC 1MAKA 1M7UA 1UCBL 2R1WA 3INUL 3KBFA 4FJ6A 4YHNB 3QXDA 3K8KA 2P3YA 4NUMA 5F70A 1WGVA 3E8VA 3EH1A 2K3TA 3S5LG 3BVUA 4UQIM 4R90H 4MS8D 1VLXA 4NPKA 3NCYP 2M8XA 3Q1EA 5E99L 5C0FA 5CD3A 5CIPH 4UTAH 3U46B 5FM8A 3U82B 3SDXB 4JKMA 3E7JA 4XN9A 4Y5YB 3U2SB 4K9EC 5EIVA 5IW1B 2FB4L 1F6FB 1TUPA 1IC1A 4B53A 5FPIA 2F8XC 1NOAA 3QA3B 1DFBH 3TJPA 2CGRH 3EJTA 4X9FA 3S5ZA 2H4EA 1VHPA 4PD4K 1QRNA 2V7HB 4G8EA 5M7QA 2FDBP 1MI5E 5IFJA 2IQ9L 2V7NB 4FAAB 2BSEA 4JJOA 3GSNB 5HI5C 3WJMA 2AEOA 4TSCL 1CICC 1EXUA 2ATKB 5I6XB 2P8PB 4U7MA 2Y7QB 3KH4A 2O30A 3NA4A 5EU6E 1HYRC 5GSVB 5C0EB 2ZKWA 2GTZA 1TITA 1KT2B 4Z7NB 3BLPX 2Z4QA 3ARZA 4PJCE 1Z9PA 3HNTL 3WN6A 4Z7VE 4G6ML 3NIDE 4FQQA 1ZSDB 4TNVK 5EC1B 3MV01 3OMIB 5C09A 4N68A 3HW7A 5J56B 2ERJC 3MV7A 5EFIA 1XGYL 4MDIB 3E1ZA 2GJJA 4M62L 1EBAA 1M71B 1AH1A 3WLBB 3FW6A 1RUQL 3CVBA 3DVNA 1Z9NA 2AJ3A 3K2KA 3BUBA 5CF3A 4AYMC 3VFWB 5F89A 3FQYA 3MMEA 1T20B 5EU5A 1Q1PA 2VO8A 3GKZA 3KVQA 1H6TA 2EDRA 1S7QB 1NCOA 2HZHA 5F9WC 1P0SE 4Z8FH 1N5YL 1I9JH 1GTNA 5ELIA 4A68A 1YAIA 4HKBA 3HZMB 4YXLH 2NY1C 1KPRA 1N2RA 3KBHE 3H2PA 5K9KA 4W81A 3TVMC 3AABA 3V6OC 1E4JA 1GOFA 3ZUCA 1PFCA 3GKWL 4Y16B 2ZPKH 3VJ6A 3MROB 4HGWA 4KV5F 4PUBH 1JNHA 4WGWB 3GSXA 4H8VA 2YXVA 3T2OA 5E2VL 3LS5L 4Y4KD 5D9SA 4KZCA 1NGQL 4ACTA 3D85A 1HCFX 1AKJD 4E9YA 3JV4B 4IIZA 4DGWC 3QYMA 3CMOL 4FQ1L 1R3IH 4C8XA 1B3IA 5IBUG 1UXMA 4MWFB 5PAZA 1MCWM 4F1SA 1X5KA 4PW4A 2CZNA 4N25A 3WTWA 4RFNB 3KXFD 1NBZA 1S4IA 4LXFA 4FNRA 4OQTL 1WWCA 2Y7SA 4BM7A 5FA3A 4WGKA 1O6VA 1QRND 2J8OA 4NAJA 3WFBH 4Q14A 4LKXB 2A7BA 3EH4B 1N0LA 1UEYA 4IBQA 1ZVYA 3V0AC 4PJBA 1JVKA 4ODUB 1AO7D 4J3TA 4APQA 1A14H 3MO1B 2B1OA 3NCJH 2MQCA 5CCGE 3VAEA 2YD8A 2H32A 5DLMH 3BLBA 3PWLB 4N90D 4AENB 1XF1A 1QFWI 5DVOA 2XA8H 4JRXB 4KFMA 2OJEA 1TVHB 5TDNB 1PSKL 3HMXH 4NC1E 3WY3A 3DETC 4CA4A 4GRMA 5LBGA 1TO4A 1PLGL 2AEQL 4F37F 3U79A 4F7TA 5TE6H 1CDIA 3FO2B 3JTTA 1TVDA 2CR6A 1MCFA 2C4FU 2FWOA 2VN5A 2VDMH 2XQYA 1UJ3C 3NIDB 3ZBMA 1MAML 1AC0A 4RNRB 5HHOD 3O41B 3T09A 1ZK9A 4WI5A 5E4EB 5MHSE 3VXSB 4G82A 5LXGH 2JI3A 4H5SB 1L6ZA 1DFXA 2GI7A 3LNFA 3O3UN 4X8XA 2EKSA 3VD4A 3M88A 5I1HH 3AS0A 4ZFOL 3TV3H 1KZQA 4KZEH 4E9VA 3N1QC 2VJXA 5D71H 4LOUD 1P2CB 2NOYA 3DMMB 3FO0H 3HUJA 2EUWA 3ZN6A 4QR7A 1M7DA 4HV8B 1P1VA 3HNVH 4XWOD 2WYZA 5KJ4A 3RWIA 4HHAA 1A6VH 1DL7H 3VI3B 4CADA 1B4TA 3O3AA 3HPLB 1PF3A 3VXTA 4RETB 1JRHH 3V0EA 4WUUA 2BO0A 1PZ2A 2PYFB 2YQGA 1S5IH 2XC8A 4PJ6A 4OFDA 5IW6B 5I1JH 5A2IH 1OAKH 1PKQB 4XODA 4ZJ9A 1YN6A 2FIRT 3CHRA 5JQHC 4Y9GA 3DA0A 2XOTA 4UT9H 5TH2A 5KZCD 1NCDL 2UV3A 3C6SA 4NC1C 4D94A 4WTZG 5JIQA 4QXGL 3VG0L 3UIYA 3ZTNH 4NKDB 1TJGH 3P4OB 3DX0A 1IEHA 4QGYA 3HUJF 3SBQA 3OR6A 3COOA 3IDJA 3ZUNC 3CCHB 1WZMA 5D4HA 2X05A 4O2EA 2X28A 2E4FA 2ZG2A 4GBXA 1IM3B 1MRDH 4JQXC 1PJWA 1E4XH 1GZQA 1N3NA 2Y5QA 5ICXA 3L3KA 3LH2L 3LQZB 4N8CL 3U4AA 3VXQA 1NAKL 4Y4HA 3L3IA 2KC0A 3IVKB 3OWRA 1L0QA 1SY6A 5LAPA 8PAZA 4Y4FC 4PVMA 3C8KB 4ZQKB 4FG2A 4B5ZA 2Y07H 2XVLA 4L8DA 1GW0A 3PL6D 1E9QA 5E5MB 1VFMA 1KN2L 1OY3B 3TXAA 2EDQA 2GK2A 1BPVA 5INCB 3ENEA 1PZ3A 1RZFL 4LU5L 4IEFA 4MASA 5DO8A 4DWHA 4HCFA 2LLNA 1V05A 2ENQA 3IMVA 3U1PA 1CDBA 5A2FA 2A4EA 1QZ1A 3BH4A 1ND0B 3CK0L 3NSYA 4YBQD 4R7VA 5J1AB 4BQBA 2OZ4A 5L2KE 1DVFA 5KN5A 2VDRB 4A63A 3ASWA 4ODTH 4ZDHA 5C7XH 1ZS2A 2Z93B 3I6KB 4IHBA 5C97A 1GHFH 5AAMC 3OKEA 2VZTA 3LB6C 5EULV 2WP3O 5EEWA 2ZIDA 4GIOA 1EEYA 3C5SA 3PXJA 4YDIL 1QLFA 2D73A 2BIPA 1Q0YH 3QI9C 5I1IH 3NK3A 2E9IA 5JHDA 1XVSA 4L5FE 4LB8A 3I50H 2BHFA 4OZIB 4GRLA 5LHDA 4XMUA 2VLME 2N01B 5H37H 5DMJB 5FHBL 3PREA 1NBCA 3K2MC 4X6DB 4Y8DC 2XN9B 3QEQD 4LCYB 1MCPL 1T89C 3BQVA 1HH6A 4TPRL 1BECA 2Y1AA 5DD1H 5B1JC 3P3YA 1J5HA 1MWOA 3NK4A 2XV0A 2DIBA 2PO6B 3BKYH 2BVOA 4NYLB 4R0LA 5FA3B 4NHUA 2AJYL 4XVTL 1ZTXE 4BZ2A 3MGTA 2XY1A 3VGHA 1NCAL 4GAFB 2VYRE 3FH5A 4PJ5A 1NH6A 2GJ6B 3TT1H 3UJTL 1X5LA 1JG9A 1HCYA 4K3JL 2BSDA 2E7CA 5F7MC 2HT3C 3U2SA 3FH8A 1NCBL 2HG5B 3FB6A 4EXKA 5DRNB 5MEQA 5DURD 1G9NC 1CFTB 2IALA 5FW7A 3ZTDC 1XF5A 3O8XC 4YX2H 2C9UA 1UJ3B 2BNRD 4XN1A 1G9NH 4PJFE 4XMLL 2YAMA 3GB7A 1N7ML 2F74A 3RDTC 4GKSB 3BP6A 1KB9K 5DRZB 3VWJB 1J0JA 3I2CL 3IDJB 3RFZB 3FFCB 3D3VA 1Q94B 3FUEA 3T0VA 2F15A 2R51A 5F1KC 3GKWH 4KO7A 4S0SD 4RIRB 3SKOA 1LEKB 3DX7A 2EO1A 2XG4B 4E5XB 4JRFA 4S0HA 4ELKA 4H44C 3SKJL 3QXAB 4QD2E 2PLTA 5BZWA 5I9QB 3H6AA 3LNIA 1EERB 1RIVL 4RGNC 4UQAA 4A2DA 2EVJA 2VDOH 1YEKH 2DB8A 4OKDA 2QSCL 4L37B 3VG9C 4B6ZA 4QMEA 1ULVA 5KAQF 3RZCA 4I3GA 1KV7A 5LXVA 3B2VL 4HHGA 5D7LE 2MCMA 3STBA 3BE1L 3ARBA 3QCVH 3RB7A 1F4AA 3QAZC 2EIZA 4PRBB 3K6DA 1S9XB 3ZO9A 5F96H 2CGRL 2H1XA 1ANUA 3BAYA 2GSMB 1EMTL 1KN4L 5CUSH 2W0FA 3ARTA 2UXGA 4D9RD 1N6UA 3LHAA 3RB5A 3RVXC 3CDYA 4P4KC 3QQ4A 4U1KA 4I88A 4M61B 4F7EB 4QHUA 6FABH 2DLHA 2OI9C 3DXAA 1Z9LA 2W81C 4KQ3L 5DCCA 4NZRL 4LEOA 1OSPL 4NO2A 4FQHA 4GUQA 3BPNC 2GTQA 3KJ4B 1MH5B 3O11B 4X80L 3NJFA 4C58B 4OLUH 2RHEA 1OSYA 3FU3A 3CU7A 2WLLB 4ZUWB 5JHDD 5I73B 2Z91B 3R18A 1N5YH 2NNXA 3RY5A 1YEFH 2F53B 3CFDB 1FNEA 1L5GB 2O6EA 2CH8A 3GSRB 4P4RA 5DD3L 2HMIC 1UM4H 5FKPB 2PCXA 5IB1A 2CMRL 3D2UB 4OZIE 4Y9BA 3ZXAC 4QHPA 1T1WA 3Q8AA 1SXZA 4D9QD 2EACA 2UYLB 2A1WH 2W9EL 2AJVL 3QARA 4XBGB 4EDXA 2C3WA 2CHWA 5FOBB 2CIKA 4XO4A 3IFLL 1QSEA 3CZKA 4KOCA 4YBHA 4IBZA 4KDVA 4G7VH 1PCSA 3POHA 2HJLA 2IIJA 4JO2H 4XTRC 1O75A 3P9MA 1HXKA 3B7RL 3TBWA 1IX2A 3O6KH 3APMA 1PQZA 1ZVNA 2NSMA 3QDGD 4WEBL 4XP1L 4IIQC 5E00B 3TYGL 3UIZA 2NY5L 5EORH 1JYXA 1BREA 5C0RH 4WWOA 3AUWB 3DX9A 1M7XA 3J07A 4LQFH 4JM2F 1AS8A 5J1AA 4Q6YA 4WCYH 3DYOA 4WNQB 3LSOB 3NJIA 3LN5A 5AYQA 5J1SC 1WS8A 2V7HA 1BQHA 1S7TB 3WHXA 4BKTC 4YHPA 3LMJH 3TVMB 1TSHA 3BUIA 3X1BA 2WLHA 3AWFA 4HPHA 5JIDA 1JF5A 1IBBA 4QJ3B 2OMWB 4DP9X 2OV0A 4Z7UB 5GS1A 2Q7NA 4OR1A 2WXNA 3EF7A 4NI3A 1LJMA 4I85A 2MCAA 4AKQA 3V52L 4G83A 2W07B 4YPGB 1I8LA 5GGRY 1M2VB 3C6LC 2BSED 5CD3B 3BH8A 2DMHA 1QSZA 3CV5A 7FABL 3U9PL 5ENWB 2X10A 3A6CL 3DTDA 5DMIL 5AZ2L 1R3KB 3QIWA 2TSAA 3QUYD 3QH3A 5JO5A 1SJHB 1SYSA 4N8PA 2H41A 3O2DL 3NZUA 1H6FA 3HJEA 5IR1B 2OK0H 4EZJA 3WAJA 1UT9A 5EU6D 2P4AB 4TM9A 1S7RA 2WOBA 5IT2L 2I9LB 5KSUA 2BMKB 2JJVA 3WUZA 3GMLB 3X14A 3FCUB 4N2OA 1DDTA 4FCHA 1VGKA 5EZJA 3BWZA 4YDJA 2IV9A 2UX7A 4JVUA 4PJDE 1QD0A 4HD5A 3ARVA 4H8WL 1IC7H 4DF9A 1XGQB 1A65A 2V9QA 3MRLA 4EVNA 1CDJA 4ZT1A 1FO0A 1JRHL 4WY7H 3A5VA 1HYSC 3QWRA 4LDEB 5DQDH 5ACLA 3EH2A 1TPXC 1LNUA 4M56A 4X4KA 2NLJB 2YD7A 5JPNC 2DOCA 1KELL 1HOCB 1CFMA 1NDMA 3VXOB 3PWVA 2B5IB 4EN3C 1BAWA 1CL7H 3FUKA 5ESVB 2HKFL 5DZOA 5ACMA 3TA3C 3CFJB 4XNXH 1LHZA 3M1CA 4WKZB 4UYQA 2GJZB 4TVUA 4M1DL 2W60B 1WK0A 5HI3D 4CVUA 1RHHA 3FO9B 1ED3B 5AOIA 2LHAA 1NFIB 2YBRB 5DD6A 1PD6A 5C2BH 1JYNA 3ZSSA 2R27A 1I53A 5L4MA 1FL3A 3A6OA 1VADA 1N4XH 1FV1B 1S7XA 2WANA 5CFAA 1KWKA 1JYWA 1NGZA 3NTCH 2AS5M 3QEHA 5KYYA 3DPBB 4ISVA 2ZUSA 4PP1D 5ESAA 1NLDH 1Z0NA 1ZIBA 3GMMB 3MCLH 5C0NC 3FQUB 1MIMH 4L3CA 3WS3A 4YL9A 2WN2A 2Y6SD 3NJKA 2EC9U 3QDJA 2FATH 1MREL 3WMSA 3EOTH 4AC2A 1RPKA 1TJGL 1UACH 4FE9A 5E8DH 2N1KA 4H0GA 4GFTB 2EKJA 1WZ1H 2ENYA 1CXHA 2WWOA 3HMWL 4DN4L 1IBYA 1KXQA 3ECWA 4WFED 5KUKA 3HG4A 4KMLB 4OLWH 4GG8B 5IBUB 3VCLB 3QDMA 5F88A 3KYMA 5LBVA 5EF0A 2ZAIA 3HC3H 2QSQA 1YECH 1FNFA 2PCFA 2X42A 3QQ9C 5HPMA 1MZZA 2FEDD 3DTXA 1I8MA 2J6EA 1HE7A 4JPQA 4FKKA 5GRJL 3SE8L 1L7TL 2DI8A 2IANE 1MJJB 3P4NA 4R2GC 4F33A 5E08H 1S46A 1RU9H 3RILA 4DP0X 4K9EL 5BNXD 4KUZH 4N90E 2Z34A 3SKNB 4AVKA 5JXEC 4YBLC 5C08E 1HEHC 3WS6C 1HVXA 4ZOBA 3TBYA 1RK0B 4PY8I 3BSZH 1L9PA 2AQRA 5DZAA 1TZHB 3RDTA 4UTBA 4AMXA 1CS6A 3CN1A 1BLNB 5SWSE 1RKRA 2DM3A 2ZNXA 1ETZA 2HYMA 4MAZA 2HTKC 4P5TC 3C9NA 3DSFL 3ETBF 5EF3A 1YVLA 5A2CA 4K94C 5IVOA 1NCIA 1DUZA 2OM5A 2HX7A 3EOTL 1UM5L 3MACH 4KK5D 2BVQA 4PD4J 1X4ZA 1JF1B 3IAQA 2H8PA 4PYGA 1NBVH 4LP5A 5KVDL 3LRKA 2DIJA 5F2FA 3DHPA 2LLGA 1BCIA 2AAVA 2OMVA 4KXBA 1HSAA 4JQIA 1UM6H 2VNCA 1AIZA 3E3QE 3K0YA 1NFDE 3NIGB 5J3HC 2VJ8A 4YK4B 1X6NA 3HC4H 2AJZB 3EYUH 2BINA 4DOHE 4TRPH 1JE6A 1FSKC 2YJQA 2BERA 5EC1A 3NRQA 2E9BA 2RACA 2WXIA 1BOGA 3I3EA 3FRUB 1SJEB 3MBEB 3MCKA 3E80A 3FL7A 3KPRD 3MX0B 3K6OA 2PPAA 3W39A 3QWOB 4LESA 4NPYB 5FYJU 4NQXB 1CVRA 1OOWA 5IVNA 1CT8A 1WIUA 2FLBT 4OUOA 4PW3A 1ZTXL 2ATKA 5AOMA 5E6UB 3NABH 3QPXH 3UG5A 3I2CH 1GTFA 3LCYA 3U36B 3S3JA 3QZWB 1W15A 3B9AA 3OLDA 5MEND 2E5EA 2EE6A 4OTXL 1E67A 2EECA 4FCAA 3D2UD 1NBVL 2E47A 4AITA 2YEZB 3ARDA 4JPVL 4IOIB 4UQDA 4ZMWA 3TBVB 3IXTA 3IK2A 4K71B 4KOBA 4HP5A 4CW1B 3SYPA 4BBWA 1S78D 1UEMA 2ADFL 2BXYA 2ITFA 3QUYC 5KANI 2QHRL 3VXMB 4NENB 3TNNA 3QJVB 2YN5A 3HLKA 4WZ9A 4ESKA 2XYBA 1M56B 3JWOC 4N0UA 4FTVA 2VLLA 5JNYA 2D3JA 5BZDB 1B0IA 5JR1L 1X7SA 3UCRA 3DVIA 1DVTA 4AY0A 1U95A 2ITCA 4Y4KA 4OD3H 4QRRB 2O1AA 5C7ZA 1IBFA 2HB0A 2XBZA 3EJRA 3D85D 2W80C 3QXDB 4QTHB 4QT5A 3BH9B 3DYMA 3QEUA 1W0WA 4OM1L 4X6FA 4Y1TA 1TIUA 3WO4C 4N2MA 1UOVA 3P30L 4L3EA 4ENED 2NNAB 5IHZB 5L2KD 1WAAE 3L3DB 3MHZA 4QXVA 1JV5A 3GTNA 1P84J 4WI9A 5L6YL 4P8QA 1BSIA 4KQ3H 1HSBB 4LKCA 2E0PA 5LNGA 2QTVA 3QDHA 3TTYA 2LR4A 4Q6KA 1TNNA 3LV3A 2DH3A 2X7LA 1E2ZA 1S9WA 5ICYA 5FYKH 2N4IA 3TCLB 1RJZA 5HYJB 3G6JA 1D7FA 1IC7L 3KAAA 4P2QA 4MJHA 4BK8A 2XG5A 4M7KH 3GXPA 1HU8A 4KXDA 4NQDA 4YMPA 1MEXH 5D7IF 5HHQA 3IDNB 5AKTA 4HK3N 3T3ME 3QFJE 2CMRH 1OIOA 2O61A 4GMSH 4AT6A 1CD8A 1UYWH 2FUQA 2EIDA 1P7BA 3N6YA 3QNYB 3FRUA 4GQQA 3TJEL 3DV4B 5I19L 1BF5A 4AQ8A 2DLTA 5CJXC 5FX3A 1ORSA 3GFUA 3UP6A 4HBCH 1U91A 5EU4A 3ZDZF 3RTQD 2FQDA 3QIBC 2G0LA 3C60C 4DP7X 3GMQB 3LPFA 3K0WA 3KPRA 5FEBA 2ZP9A 3CZEA 4Z5RA 5ALBL 1DSFH 2I07B 1X3DA 4G80A 4JPWL 4OZHB 4HX1B 5I5JA 4WFFE 1BIIA 4XHJC 5CMAB 4RAVB 5AD0B 4ZUUA 5C2UB 1A2YB 1P4BL 2BP0B 3BFOA 4K4KA 1FL6A 3GK8H 3SO3B 3BVVA 2D2OA 2D7OA 4AL8H 4X5RA 1DR9A 4JDEA 4RZKA 5CZXC 1FJ1A 3OF6A 3ZKSD 4JM0A 5K9QG 4HOZA 4PY7A 1Q38A 4YHLL 4H20H 5HGAA 2JLPA 1ERNA 3SE3C 1VA9A 3BIBX 2Q1EA 3L2LA 1QO3A 3KH3A 1BJ1J 1TMCB 4Q8BA 1AR2A 1G7LB 1JGVL 4DH2A 3L6FA 4R7XA 4AV5A 3LXAA 3S36H 2YPVA 5J6HB 1F3DH 3FFCA 4P9HH 4HG4J 5E8NB 2DQTL 5GQBA 5GGSB 3QSKB 4BK4A 2VAJA 4GQ9H 1EGJL 1VFAB 4DN3L 3CH1B 2G2NA 5ISZE 3DJTA 3SBPA 4PB0L 1O9ZA 1IAOA 4X4ME 4ETQB 1OGAB 1FFPA 2DYPB 4E68A 3SE8H 3VFRB 3FTUA 1QR1A 5I15L 4OZFH 5I6KA 2PCFB 5HPMB 2IAAC 3U4KA 1A7QH 5GGVY 2J71A 4XCNA 1R34A 4G9DB 5I8EA 4NP9A 2JK5A 3Q0HA 4W9HC 4Y4HD 3E3QC 4G43B 3B1TA 1YHPA 2V5SA 4X5LA 3VRJA 4Q74A 3RJDA 2RFXB 4JFYB 5HHVL 1NCCL 3QNXB 2W1NA 3HRPA 4DPAX 4Q6IC 1B2WH 4DTGL 4K7PL 2VR9A 4JLRB 4NQCA 5GJSH 1DEEB 1PD0A 3FULA 4FTDA 4BE6A 3K72A 1RSFA 1WAPA 4N2AA 3T8XB 2F5BL 4W6YB 5E2TH 5EOQH 3KG5A 5EOCJ 1TNMA 3M7FB 3TV8A 3X3GL 4KKZA 3D39B 1NGZB 2LVCA 3HFMH 1ACYL 4IOFC 2CLVB 3L13A 3VFSB 2NLJA 1FNSH 5ID1A 2OXGA 3HEIB 3NFNB 4TQIA 3BQUA 3UTSE 4U1IB 1WJ3A 3CXHK 5B39G 4HUVB 1OCWH 4MNGE 3MXVL 3QNFA 1HQ4A 4PJXB 1MFDL 5TE4H 3SJVA 5C9JA 1XZWA 2OA9A 2QFPA 4KKLC 4KMQA 4X0NA 2ZOKA 2EZ0C 1YEHL 1E90A 5KYWB 1TJHH 3HB3C 1LO2H 4UT6L 1JF6A 4NRYA 2WINB 1CZ8L 3I74A 3DBXB 1ZT7A 4ZS7L 4BSJA 1J10A 2Y5EA 2IGFH 4R97B 4GRLD 3PIQB 4HVBA 1IC4H 2YRBA 3RI5K 3UDWA 4EI0A 1GGBH 2RR3A 4MJIA 1LO0H 3LB6D 5CS7A 5I66B 1HTYA 1A1NB 1GMIA 1KJ3L 2FECL 3GSUA 4JFOA 3R7RA 1NGPL 1F6AA 3WS6A 1BQRA 3LZRA 5EZIL 1SYSB 5FCSH 3P0YL 2R7EA 3QK0A 4HMDA 4L4VB 4PIRF 3HBQA 3RE0A 2YJLA 2UWEB 4RQQB 2EEXA 4D0CB 2VISA 3T77A 5JPNB 4PJ5D 4B60A 3EYOB 1JFQH 3FYIB 2R4SL 3I9GL 4PRAB 1KCRL 5IFHH 4WHCA 3BKJH 2BVPB 1MI5A 4JO4H 2B0SL 4NFDA 2FYVA 5HVWA 5DTFA 3HS0A 2PR4H 2HFTA 1D5IL 4WWKA 5HHOB 1CD1A 4KBPA 2YUVA 4OVVA 2G3MA 3X14B 3U36A 4DQOL 3ZR5A 3HG3A 3JWNH 5FYLL 4N2BA 4NZ8A 1FO0H 1B0GA 3VQ2C 4HZAA 1MCNA 3C12A 3D69B 4NXKA 1OARH 4PG9B 4XPAL 4DEUA 4BINA 3F7PC 2IANA 4QKXB 2EXWD 3T0EC 3S34H 2IOIA 2NXZD 5E1AA 5JZ7D 1QI4A 4Y2OB 5D7LB 5TTRA 4JO1H 5EIQA 5CCJA 3TCTA 4QPEA 1KEMH 2VDOL 5D7JC 1H3TA 1QNIA 1WO2A 1LWJA 4TL4A 5T33L 1I1CA 1N12A 1GXEA 3MNZA 1PDKA 5E00A 3RIAK 2HN7B 3C09B 3SDCC 1J8HE 3E9UA 2HJLB 4TRPL 3UGXA 2CHXA 3FTYA 4U4IA 3B6SB 3CIAA 3CXFA 5LDUA 1GYAA 2JLLA 2QV4A 4PLKD 4QLWA 5SX5H 1PW3A 1J0HA 2H3KA 1D5BA 2J12B 4BH8A 3GSVA 2MNUA 1I7RB 3HAEA 4ODWB 4P9HC 1QI3A 2CE6A 2R56L 2X2UA 3FHQA 3RFZC 1TFPA 4LOUC 1CFQA 1NANH 4YSCA 5GZOC 5L2JA 4G7YL 4XNYL 5DEZA 4PR5B 3BSGA 1OSEA 4E9TA 1SJMA 4F7CB 5AW5B 3CLWA 1K9TA 1U3YA 4UBDC 3AY4C 3T0ED 3MBEC 5KSAB 1EH9A 3CFCH 1YEJL 2KYIA 2ZX6A 1CJYA 1KN4H 4IRJD 3VX0A 3BVTA 3BN9C 1HESA 1E6JL 2BY0A 1W80A 4QRBA 5GGUB 5GXBB 2IGLA 2LTQB 2QGDA 4LRIA 2YARA 4KJYA 1T4KA 3D6GA 1DP0A 4L4TA 3WV0A 1U8HB 2B1AH 2ZCLL 1FLTX 2AJUH 2APWA 3MKKA 4K5PA 4MCZB 4P3CL 5MP6H 5GS0H 1J0YA 4F3FA 1E27B 1MHCB 4LMQI 5DJDB 1P84K 1UURA 5TFSH 3H9HB 4BKSC 3WFBL 1XGTB 4E0RB 5ICZB 2IQ9H 4HC1L 1CGWA 4PS4L 3ZE1B 2NTSP 1OSZA 2VDLH 4TOYH 3UAJC 4M9OA 5D1ZI 3T2PA 1JHKL 3FQNB 3O6LL 3SODB 2X4SB 2VSCA 3CZSA 1VPOH 2IAND 3W2DH 1JTTA 2P8LB 2F7RA 3DX3A 4E9QA 4XXCC 2DBLH 4YZWA 3MR9A 3R06B 1WIPA 2HVBA 3CLEH 2AC0A 3G5ZA 1KB5L 4GEIA 3NJNA 3CVHA 4MA1C 4HS3A 4Z7OF 4AQAB 1PG7W 1T0OA 1I7UA 1S7SB 4NBZB 4O02L 1M6OB 3ZVVA 1J9SA 5CJXA 3U30B 3V0FA 1L7IH 1NC2D 2VXUL 5DWUH 3VXRD 1OLLA 2AZAA 3SCMD 3KWXA 4DW2H 3QDGB 2QVFB 3B7SA 1PYWA 5DGQA 5HHMB 3RGVD 3SD5A 3MJ8B 5ERWB 1X9UA 1NZRA 2K4AA 4J8RB 5LWYL 4P06A 3PQYA 1ZA3A 5I1EH 2XZZA 1HXMA 3DVNB 5GHWL 3M17A 4LSQH 5LAXB 2HT4D 4KZEL 1AZBA 2E8ZA 1U58A 3APFA 4LQ1A 5IFAL 2BVOB 4NYLA 3MUZ1 4R0LB 1J8HB 2FBJL 4W9JC 1UH3A 2UZYA 1CD1B 3ARSA 2HRPL 3IFNH 4GKNA 2FD6L 4KJWC 1XCQB 1U3HC 4DPCX 5JPMC 3EGSA 4JR9H 4GG6B 2BSCA 4PJ7E 5F9DC 2J3SA 3ARFA 4CC0A 5I1JL 4UIMA 4H13C 1ACYH 1NGYA 5HYSB 5KSAA 4Z7NE 3A6BH 5KJ7E 1FIGL 3AWEA 3DRTA 3B2MA 3FMGL 4Q4IA 3FU7B 4P48A 4A67A 3I75A 2A6DA 4UT9L 3OXRA 2QKIB 4UCFA 5GIRA 4FXKB 4RMBA 3MCG1 5C0EA 2AEWA 2AGJL 3KPRE 2OCFD 5DXWA 2WGNB 2CALA 1BZ9A 1KJMB 5IVXA 1BMWA 1R0AL 3PJSA 3AU1B 3V55A 1SJHA 3D2UA 4X7SH 1PY4A 1F4HA 5IUSA 2G60L 4YZFF 3X13B 4ZMLA 5GGQH 4XT1C 5JXED 35C8H 2EO9A 4L8CB 1NKOA 4IRZA 1FG9C 3AZUA 3DROA 4QOKB 1BG9A 3SOTA 4PRNA 2BSTB 3OXSB 3UC2A 3AQZA 2BY1A 1G4MA 1H19A 4F7MB 4URTB 4S2SA 2ZWKA 3LNEA 3WFEL 3GBNH 3STZB 4OBSA 4WEUD 1CBJA 4HLEA 2HFGL 4ABWA 1SZNA 3SDCD 2FCBA 2WWMC 1R24B 4HJSA 3P9WB 5D72L 4AENA 1RZFH 1DQKA 2ZXAA 4ZUSA 4O02A 4BK5C 2J4WL 1OE1A 7PCYA 2X12A 3A6BL 1SGKA 1I7ZB 4JRXD 4NX0A 1XX9C 4XN4A 4JPIA 1XTLA 2Q10A 5FHAL 3ETSA 3IAGC 3EG9A 4R4FH 3PFUA 4U6TA 1EXGA 3JVGA 3ETBJ 3TO4D 3MRNB 2NY3B 4K7PX 2WXJA 3X3GH 3MJ7A 4F8LA 3N43B 3UL4A 3V0IA 5BRQA 4K8RH 4RZCB 5KBNC 4HWUA 4LSRL 4G8GD 1XSKA 1IQWL 3KCPA 4OCXL 3MZTA 3CSYB 3VXRA 4Z1PA 4XAKD 12E8L 3K80A 1U8CB 3Q1SH 1CF8L 3ROLB 1GIGH 3D85B 2QDVA 3QXTA 4LPUA 3QDMD 1IBHA 4ZBJA 3F5WB 3AACA 4OZFG 1YNTA 4PS8A 5IESH 3UDWC 2FZ3A 4A6YL 2XTJE 4LSUH 4PCKA 1P2CA 2BC4B 1JYVA 4NZFA 4X6CA 4GQRA 2EVFA 4F9PC 1D9KB 3VXMD 2JKRM 4I0CC 1NGXA 4O9HL 5HDBF 3GNMH 2AQQA 4XNUL 1KPRB 1BX2B 2BNQA 4HMEA 5KOVC 2D3VA 2IWEA 2JVUA 3I75B 4UNUA 2V9UA 4FHKA 5E4IA 3HAEG 5EEYA 2W88A 3G5XA 3ELQA 2YC1B 5CJOL 5T3ZH 2IALB 4HCGA 1MRFL 2Y4SA 3NIDF 3F7VB 2OYMA 3E6HA 5TDOB 1CURA 1H6EA 4GG6E 1DQDL 4J6IA 4RBPK 1CG9A 2LAGB 1AZZC 4TYUA 1PZBA 5I75B 2BDNH 3MQIA 5BZZA 1M7DB 4HV8A 1F56A 1A6UL 3MACL 4OD2B 2AABL 3ZKNC 1RUKH 1OAZH 3FUJA 4XO9A 4J12A 3OF6D 3KPRB 2HT3D 3MV7B 5EFIB 5IF0B 1X5FA 3D25B 1FNGA 3CLFH 4Z78A 1E4XL 3MJ8A 5EEVA 3WJJA 4Z7IA 4D0DA 5FYKU 2BWQA 2K4WA 4FQXC 4FHJA 4F8OA 1L0XA 4M8QB 25C8H 1UA6L 3BUQA 5EZIH 2D31B 1J0IA 5ANMA 1KF9B 3BZEA 3FQ4A 3K4AA 4YNYA 4KMTL 3QUZD 5L9DL 4QOKA 4GMTH 3PHQA 4JZJB 3JWNE 4LHUD 3WEMA 2CKBB 3I6GB 3HS9A 5DJ0A 3E0GA 2DL2A 1I9IH 2J6EL 1TTBA 4K7PY 5DZNA 5T1MA 2BS71 4JRXA 2V5RA 5MERB 2JXMA 4IMKC 3TCLA 5L4JA 4I1NB 4ZMVA 1U36A 1MG2C 1A4BA 1Y6NR 4BH8B 1ZSHA 4FQPA 2ZT9C 1U3JA 1CICB 4MDJA 3T6VA 4F58H 4L8DB 1NEUA 5E5MA 3GS7A 4DGIL 4GI6A 1UACL 4O5LH 3ARGB 5I71C 5BO1L 1JGEA 4UOW1 2ENSA 3L5JA 5IROD 2WNXA 1SHMA 5IBLC 2E7BA 4TLSA 3II3A 5DD3H 3U4EA 4UOZA 2QV2A 3MRQB 4HZLA 5ABAA 2I27N 1PZ5A 1AS6A 2L7EA 3CCHA 1F8TL 1B6DA 1KYDA 4K3DL 1PKOA 3VG9B 4TL5A 1A5FL 2WAQA 5H2BA 1IAMA 3BCDA 1DQTA 1ADWA 4OLVL 4TNWK 2DJMA 1R24A 2BP5M 3H42H 4UZGA 3NCBB 2VQ4A 4F9LC 4M43H 5EO1A 3VFMB 2XTJB 1QLEL 4P2RE 5ERWA 3APNA 5GJTL 1JXDA 2B2XL 1E6JH 2FJGA 3EAKA 2FHFA 3KS0H 4X9BA 4IU3A 3FCGA 3ABGA 4XXDB 5EORL 4XI5D 5I0ZA 4OZGA 2IG2H 4X6EA 3DO7B 5I74C 2XQYG 3QZBA 5JTWA 3NP4A 2B9AA 5CCKL 2ZWLT 1JERA 4LLAA 4XP4L 2YO3A 4PRPB 4Y5VC 2G4GA 4EZMA 5DEGA 1J1OH 3A23A 2C9SA 2JQAA 2CKNA 3IFOA 2I60L 5H94B 3U0PB 1JK9B 2BH0A 3QIUC 4JS7A 4GRWB 4J3OG 5IB2A 5C92A 5KBPA 5JW4Q 3IFPB 3L3GB 5D4JA 4Z76A 2VN7A 2MNWA 3WKYA 2ZSWA 4Q9BA 1AFVL 5EWIH 4WUUD 1HQRA 1QFPA 1J9CT 3IFPA 4LSDA 2NW2B 2ATAA 4X6DE 1ETB1 3QO1B 5DK3A 2VLRB 1NM9A 3MRHA 4OCYL 1R5WB 2GJPA 4WWKD 2A74C 5DRWA 3EYUL 4JO8A 4AE1A 3CC5A 4OFIA 5F1OB 1AOHA 1XO8A 2QADC 4RMWA 4E41D 4F3FB 1A9BA 1DJZA 2F2HA 2BZDA 2WLKA 3NEEA 4D0BB 2UY7B 3WFEH 1KIRA 3SDXF 5E6IC 5FO9A 4TNEA 5B39B 3QUYB 2HVKB 3HE7D 1HXMB 1U8LB 3LH8A 1QZNA 3IGAA 1J12A 5EIIG 2X2YA 3EDEA 4MKTA 3RL2B 5DS2A 3WIIL 3CX5K 3CPUA 4F2FA 1GOHA 1OAXL 3UYOD 4PJ8B 1JIBA 4DZ8B 3TZVC 2V4LA 1ADQA 3D4YA 3QJFB 5E1GA 4Z18A 3AADB 3OAZK 4YQXL 3GD1C 4GPVA 2WIIB 4EKXA 4HS6B 4O02B 3V0HA 1HL8A 4WK2B 2IAMC 4PRHE 1Y0LA 1RURL 4GG6F 1MY7A 4X7TB 2IH1A 1C8PA 4I87A 4AYBA 5I8EB 4TQHA 2CA3A 1QFUH 1Y1UA 2HTLD 2FSDA 1DBBH 1CLYL 3L7FB 3F12B 1M42A 3CFNA 4DW2L 3KLQA 3NAAH 1O7SA 5AKVA 5C0FB 4UIKH 4G3YL 1L9TA 2X4TB 2XHNA 1WBZB 4RRPM 1JHTB 3RU8L 2AQ1A 4YSAA 1GC1L 5GGSA 1AGEB 2XN9E 2A6JB 1BM3L 3H7BA 3EYVB 2KZ1B 3V4LA 1ZT7B 2UZPA 2RGSA 4JM4L 4YR6B 4HGWB 1J5IA 2X4PA 4H26A 4OCRL 3RVWC 5FV2A 2ROYA 5DO2C 2VQ1A 3QQDB 3GXDA 2FQFA 3F00A 3Q2NA 3CSFA 3W0WD 3FT2A 4U7SA 4GKZA 4UM8B 3DX8B 35C8L 3OPZL 1FFOA 1LDSA 4PY7B 1UZ8B 1I1FA 2H6UA 4HUUA 3NZHH 4Z0BH 2ADJA 1SHSA 1P7QA 2W0KA 5JORB 3WFDH 1CIDA 2BRQA 1AZCA 4DP2X 3K3QA 1QBLL 3GSQA 3EJSA 3ZGIA 2JE8A 1PLGH 3QJRB 2YSSB 5DEFB 1NBYA 3QJTB 3CXDL 3ESOA 3GJEB 4GSXA 4FFYH 4YHKL 3VI4A 5L0QC 3FC8A 3MUJA 3QUHA 3V8CA 3LKQB 5EEXA 3HFML 1BJ8A 2J21A 3PY9A 1NWPA 3JVGC 1GYWA 1S3KH 5HYQB 3AW5A 4Y19B 1P9MA 4NM8L 4DKAA 1YN7B 1F4WH 2X38A 3PUCA 4YEEA 1SN0A 3IEAA 2H2SC 3CVHH 2NNFA 1FLRL 3M1OA 1QWNA 3PPEA 1IGJA 2F7QA 4LLWA 2ADIA 1JTOA 2D4FA 1YEHH 2X0UA 1GYCA 1IBGL 5FDYA 1VZGA 2C8NA 3KW7A 5H35A 3BZ4A 1U8JB 4OLXH 4ZTEA 3GUFA 4JJ5B 4GUCA 5BOZG 1FG2B 3UJTH 4JN1L 1X7QA 3CFEB 5F7EH 1KJ2H 2CO7B 1X7TA 1A7PH 4YHZL 3FCSB 2EDNA 3Q8FA 1IV8A 2EDMA 2OTWA 2V7NA 2QPEB 4Z95H 3Q7JA 3RWCA 2QQQA 5C0AD 1Q0XL 4C4KT 4JCMA 2X7LB 2A0LC 3CH8A 3C2SA 2Y5TA 1WCBB 4X4XB 4LVHB 1MJUL 3TIEB 3C08H 1ACZA 1KEGL 3BKJL 4LLQB 4ZK8A 4BSVB 3NIFE 4JB9L 4TSBL 4ZO7A 4RZCA 1DSWA 2WXHA 4JG1L 1J11A 1DLHA 3MPCA 4YHMH 3WY4A 5D2LF 4WK0B 1I1RA 4CAGA 2Y72A 5EU3A 4PWHA 3JQOB 3U30C 3K7UA 3WIHA 5D1ZC 1P53A 1ZS8B 3T3MF 1FVCA 3CDZB 4PJGA 3U4BH 1EJ6A 1HEZA 2K3HA 3W81A 3BMWA 5JOFA 3T8VA 2BHZA 1WITA 4W9ZA 3UZQA 1LD9B 3NIFF 4Y16D 2QQNL 4S1QL 3GMNA 1OAZL 2VRKA 3ARBC 3BUPA 4R4BA 4TTDD 3ZGHA 2CDFA 3LKOA 1GOGA 4I0PB 1TTGA 2V3FA 5AVXB 3MV11 2DQIH 5I2IB 4L4VA 4KX7A 4XCNB 1PLBA 3I9PA 5C3IA 4G8FA 4PJAF 2CJUL 1TVBB 3DARA 1F42A 4G11A 4GB9A 2X87A 4PJDB 2PWEA 5GJSL 5HGGS 2BVPA 4XVUD 2EQDA 4I2XB 4UDTB 1YLBB 3LQMA 3I6LD 3SGJA 3QE5A 2PTTA 4HIPA 2UZXA 1Z9SB 4N28A 1A9VA 4HISA 4FG4A 3WKPA 4POUB 4YDIH 2G9HB 1QRNB 2CO3A 2JKWA 4IKIA 1BZ9B 3QR2A 5F7HA 1RUKL 4KH2A 1PEWA 5AUMB 5H37G 2ZUWA 3IYLW 5ANHA 3X11A 1X5HA 4XVUC 5INDA 2ESVD 1JPTL 4OV5A 3U4BL 3GBML 3F2LA 5FOBA 4EDXB 4WW1A 2EIEA 3IU4H 1XXDC 1OCCB 3VD5A 3T0EA 2ICWI 3GMRA 4HWEL 3MBED 1JMXA 3AS3A 1OP4A 4W70A 5HGBB 2Z8SA 1CDUA 1OB0A 2ITCB 5I5RA 3MV8D 2I9LA 4X4ZA 1IKNA 4IRJA 5D5MB 2DMGA 3PLYA 5GZND 1DBKL 2BWDA 2P1YA 3GBEA 2L7UA 3MRJA 4KHXL 5D7JA 1Q90A 4YGVB 4A2GA 2QSCH 4NUQA 4OM0H 1U58B 1UGKA 5BRZD 1UTDA 5C0AA 2JV6A 4DIXA 5BS0A 3Q2CA 2HPOA 1UA7A 4OF7A 3V0WL 4QO1B 1PBYA 5HVFB 3Q9QA 5I76A 5DMKB 4G9DA 5T1LD 2HVJB 3AM8A 4NM4H 4JRYA 3K72B 5KEZA 3P2TA 4RX4D 4I9WD 5G5DB 2Q8BL 4G8GE 1XH0A 3FTVA 4ZTPL 1SHWA 2E3VA 3TO4B 5AL0A 3H2WA 4JY4B 4WF7A 5BJTA 4N9OB 1KBBA 2JKSA 2J2ZB 2DKMA 4JFQB 5EZPA 1INEL 2CAKA 4G5ZH 1FPTL 4LBEB 4PV8A 3VMOA 1KSRA 1RJCA 1I3RA 3IU4L 2VLJA 2E7MA 4UIKL 2JCCF 2C9AA 4P46A 4AYSA 2Z9TA 3CLEL 1MQKL 4YPJA 1WFNA 4JKWA 4Q6IA 2R69H 3QRFM 2AI0H 5JOEA 2J1YA 4F20A 4CJ0A 1RY7B 4RESB 2ADYA 3H9HA 3WTUA 3WUWA 2WP3T 2YKLH 4AX3A 2NPLX 2ZUUA 3FCSA 3P0GB 1JSYA 5LCVA 4LVHC 4HGMA 4YR6A 3SO5A 1TMQA 3X12A 3L4CA 5TGBB 4YXLL 3HZKA 4GOSA 5CEYA 3QC6X 3MODH 3PP4H 4HK0B 3IBOA 3UZVA 5FUCE 4LCCB 4BCYA 4MD0B 4LGRB 3FQXA 5ETUA 1GGYA 5DC4B 3SDDB 1KGCD 3M86A 5K39B 3VQMA 3QEGL 2OJ1A 3AJ7A 4FNLH 4UDTA 5DJ8A 4PREA 2LABA 5E9DD 4DP8X 2OX5A 1FH2A 3MAWA 4EN3A 1R6VA 1VFUA 2DS4A 1ORSB 3LS5H 1URLA 1NFIA 4MGXA 4KNQA 1T21A 2H6PB 3D9AH 2YBGA 4GJTB 1H0DA 4JFUA 2OMNA 4NHCH 2VLRE 1CU4H 3CMOH 3FFCE 5J11B 3MNDA 4HUCA 4LOEA 1ET5A 3FT1A 4XPGL 2QR0A 4G43A 3LKQA 4EMZA 4NRXA 2WUBL 3GMQA 3ET9F 1WD8A 3CFJA 4FQHB 1XH2A 2DY2A 3VQ1C 2CDFB 4NQED 3MFGB 3VU1A 3VW3L 1M7IA 2CBTA 2XICA 3KPQA 4X7DC 3OMNB 4PSPA 1QKZL 4G9FD 4R8WH 2VQUA 3GHPA 1MFUA 5B39A 5I16A 4O2CB 1PZUB 3AGVA 5B3JF 1FVEB 3KYKH 4JDZB 5K93A 5CZVL 3T4AB 4TSAL 2ENJA 4JGUA 1A14L 5LXGL 3MCKB 3EYFA 4NJ9H 3MRJB 4KHTL 1W0YT 2XIBA 3AREA 5E8PB 1RVFH 1EHKB 1WFJA 3K8MA 1J5OL 3RYMA 4JRYD 4IKJA 5EBMA 4N0FA 4WI2A 1RJZB 2PTUA 1YEWA 3IDGA 1E5AA 5CO1A 1S9WB 3C5JB 3CFBB 3UTQA 4HC1H 4FDWA 4HUUB 3O6MH 3ZL1A 2VQTA 5B3JE 3RIFK 1ZAGA 5SX4H 4OV5B 2Z92B 3MI6A 1FN4B 1YY9C 1LO5B 4X7SL 3IB4A 3OAWA 4HW6A 4PJ9B 1U93A 3FOLB 3U0PA 2DLEA 2YPLA 1XH3A 1XGRB 3AVEA 5BJTB 4LSVH 3T65A 2A6JA 2ORBH 2LVEA 3G5YA 5ADOH 4HBCL 3HJ0A 1W0VB 4Z7WF 4HA1A 1JZ2A 1IM3A 5AB0A 2VLLB 3O4LA 1A4KA 3MOAH 3GI9L 4X5WA 1GS8A 3KCPB 5E08L 3AWGA 5C07B 5GS1B 3RHWK 3TBYB 4LNRB 3TPUB 1DZ0A 4R96B 3GSNH 2CR0A 1EVUA 1O9VA 1VSCA 3EH3B 3LKOB 3IPBA 3QI9B 4L1SA 4ODHL 3LEXA 4POYA 5J6GB 4OZ4A 1WZLA 2ZG1A 4YHIB 4DVRH 5GZOA 2UY7A 4HIXL 4MB5A 3O3EB 2C26A 5EBWB 2AXGB 1E7VA 1PKQA 1F4XL 3VX1A 2EE0A 2GJ6D 5TK2A 1JS4A 1XGQA 1JNLL 2XX1A 3ZTNL 2RA1A 2ZCZA 4PG2A 5D7SL 5BRPA 4YO0B 4K8RL 3TPKA 3VI3A 5D1ZA 1M2OA 3PP3K 5D2NA 4AZUA 4EJ1C 2EINB 4Z3HA 2L0DA 1BQKA 2BMKA 5EH1A 2BJMH 3GSWA 3I9IA 1FE8H 1G6RL 2ZXWB 1H8SA 4JHWH 3AG4B 1GHFL 3PNWB 5AUMA 2J8UE 3JUZA 1CXEA 3R1GH 4NERA 4J2XA 1SRDA 2UYLA 5DZ9A 1RLBA 2GT9B 4HUNB 1XSIA 1RZJH 3H0TB 4U3HA 1KDIA 3HC4L 1AKPA 2ZOOA 1SXAA 3TFBA 1OP5K 3AXLB 4YN3A 2WYIA 3AU1A 2B20A 3FN0L 3KGRA 1E28A 2APFA 4XP5L 4N24A 1Z9MA 2E56A 2EDXA 4BA8A 4NWTL 2O5XL 2EEAA 5DFTA 3HC3L 2QEJA 5FDWA 3PDDA 2FVNA 5KSBF 5FYLE 2C9XA 4U1SA 4XHQA 2GSGB 2YAOA 2JQMA 5FGCE 1EUUA 1DQDH 4KKNA 5I2IA 1BZDA 5EO1B 3VFMA 1I8LC 3NA9H 2WSPA 2AAAA 3C09C 4KJPC 4YHOL 3SY6A 3VSTA 5I8OH 1AQ8A 2Y2YA 4TUUA 3TS8A 3C8HA 3TVMA 5I82A 1ETZB 1BQHB 1S7TA 1TQCB 1TZOA 1V3KA 3AXIA 3WHXB 4N2KA 2O6DA 2BIMA 5DJAB 2A73A 3DDFA 2EE2A 2O6CA 1KTKE 1PZ5B 1YNLH 5EA0L 3WKMH 3WLWD 1W0VA 5KS9F 1FI8C 4P3WA 5BZXA 3M8OH 1BVLB 2P5WA 1FE8L 5F9JB 4EAEA 5JW4R 4XCCH 4MXWL 1NBYB 4ZPVB 1I8KB 4AQ1C 5AW3B 4HUWA 1YMHB 4LCWA 4X6BB 2H0JA 1CXIA 4K7FA 1QO3B 1U6AH 1YC8A 3MJ9H 2DJ4A 1UWGL 4IRJC 4L1DA 2X0WA 1L7TH 3W0WE 1XGUB 3P73B 1O5DT 1HIMH 2X6AA 1T0MA 4QGTA 4KNSA 3FSZA 1H9DA 4L3CB 3ZT5A 5FC9A 5BV7L 2CIKB 3T08A 1OZTG 3D30A 4P46B 3TH2T 1MQ8A 1OQOA 4GKZB 4FLSA 1AKJA 4UANA 2PYEE 4FXTA 4JEGB 4BFOA 5ADPL 2G5RA 2C9PA 3MR9B 2NY6B 3R06A 4A6YA 5GZOD 1KULA 2FZ3B 1F58H 1VKXA 1KBWA 3WGVB 3W9EB 2CNZA 2R15A 5FR3A 4B97A 1U8QA 4Z76B 1Q9OA 3FQTB 3UZEA 4B3VA 4K94H 3TASA 1V7MH 2R2BA 4MMYA 4MTMA 3L5XH 1K8DA 4PRPE 1NUFA 4WO0A 3QP3A 5K33A 2YMXL 3CSTA 3RY6C 4EIGB 4UTCA 2W95A 1MJ7H 3ARQA 2WXGA 4U1JA 3AT0A 5ITBL 4LPTA 1AO7A 2FO4A 4AIXA 1KFAH 1TT6A 3DXAB 3CUPB 4IKKA 3RTLA 4ECNA 1IGML 1NDMB 1KLUB 4JFXB 3VXOA 4QTIL 1TTAA 1TZGL 2NXYC 2Q76B 3L08A 3DK0A 1UWXK 2FNBA 5DQ9B 3VI4B 1HL5A 4GP5B 2F5AL 2J8UB 2YK1L 4HKJA 4JPVH 4PJDF 5K59E 1FGVL 4LCYA 2IADA 3FO1B 3GBDA 4MRCA 1MFNA 3QJXA 5DZJA 4Z78B 5ISZB 1CDCA 1G7HB 2EDFA 3FS9A 1DLFL 4PWEA 4NT6B 1WT5C 5C0AE 5EO0B 3N42F 3MFFB 4UNVA 4IQHA 4F8NA 3CZGA 4H1LG 5D6DC 4NJ9L 4Q9RL 4B9IA 3FT2B 3N0AA 1KLGB 5K1VA 5T5FH 5EIIA 1NFDF 3FB7A 4KITB 2BC4A 3IDIA 3O45B 3HHSA 3BP5A 3WXVH 2XACC 4JKPL 3GSVB 3IF1A 5AG9A 2F74B 4I13B 4MS6A 2YHGA 3LKRA 3QO1A 1KG0B 2VOTA 1HQRB 4WO4D 3BP4A 4N2GA 3KPNB 1WEJL 4AQEB 2AANA 1EHLL 1L9QA 1PSKH 1ASQA 2W9EH 4GAYB 2R8SL 3HC0B 1NPNA 4PGDB 4X5PA 1AG6A 3GZKA 2WV3A 4DN3H 1XD0A 4MB4A 4WI0B 1FCGA 1TQBB 3IDXL 2FAUA 3LEYH 5C0CD 4UOW0 1YEKL 3DHUA 4MCMA 2J72A 3H9SD 1AC6A 4YHNA 1F8TH 5IMKB 4FYSA 2HVJA 3MNWB 1HEZB 5CXPA 3U0WL 1UYWL 3TJEH 3RKDC 3SJVD 4NS0A 2WLYA 3BWUF 5AQ0A 4HU2A 2V8LA 4N2HA 1O5PA 1KTRL 4OU3A 1H3PH 4WO4C 4IOFD 3LRSB 2Q6WA 4JQIH 4JREC 3UBXA 2EEFA 1JRHI 1E6OH 1MCRA 1NUNB 1J8SA 1B0RB 1I1YA 5G2NA 3REWB 5C9KA 5FYJD 2DQHH 4LBAA 3TEWA 1WA0X 4WNQA 5TQ2H 1CTMA 1RUAL 2B59B 4IMLA 4PS4H 1UB6B 4ZW7A 1QSFA 1ZHNB 2P5EA 3V10A 2HX8A 2HAZA 4PIBA 2Q9OA 5ACZB 2WVVB 5GS2H 3WLWC 3GXFA 1A22B 1Q72L 4WUUB 1VGEH 1OSPH 3CG8A 4A2HA 1LE9B 1IBZA 3F7YA 5JIKA 5CBEB 4TVPL 4M03A 5HHOE 4N2IA 2MPAL 3UROR 4X5XB 4YXHH 3AXHA 4GRLC 4WU7A 1XEDA 1KJMA 4O58H 3A22A 3BAEL 4JHUA 3CGTA 3D3VB 2DL9A 3H8NA 1CICA 2ZSWB 4AVIA 1INDL 1HOEA 1KBGL 4YAQB 4FFYL 4YHKH 3BSZA 2O5YH 1R3JB 3JV6A 3TGXA 3X13A 1OSZB 2V9RA 3FAXA 5MI0C 1BW8A 2AK1L 2B5IC 4LSRH 4Y5XC 4AG4H 3ARRA 1HL9A 1JGVH 5FK9A 3QH3B 3VA2C 3QXWA 2YGPA 3B5HA 1UXSA 2NXYD 3CX2A 4GBXB 3P0VL 1E5UI 2G5BB 4M00A 1ECZA 4NUGH 5DFVD 5GGVH 4IDLA 1TZHA 4JL2A 3HMXA 2UZYB 4U1LB 4KJYB 4UOJA 3VDAA 3ULVD 1T1XB 2FSEA 2DQCH 5F6IB 3FOMB 2VDRH 3PWLA 4IGBB 1B0WA 1I7TB 4Z7NF 5TH2B 1RUMH 2CNYA 1BEYL 4JPIB 2GY7B 4OSUH 1J9RA 1S7VB 2AV1B 3MLRL 1NCWL 3WKML 3V7AE 4PJIF 1LQSR 2OZ4L 2NY4C 3VSUA 1NSNH 1R46A 3CDGA 2WCPA 1EPFA 4JZOB 3TYFB 3DX1A 2XKNA 5KJRH 3I84A 4R26L 1X9RA 4PSRA 5FF6B 4TULH 3TYFA 8FABA 5I5MA 1DO5A 1NMAH 3H9SA 1GC1C 3V52H 1E3ZA 1CGXA 3F05A 3EOAB 3RAJH 1L9SA 4JREB 1ORQA 4OCMC 4MNQD 1YNKL 3SPJA 3REVB 3G7TA 3IT8D 1AGEA 3FT3A 4HKZB 4WSJA 4Z7VB 5HDOA 1WBZA 5CINH 4QRRD 4LPYA 4J27A 3REVA 4GW1A 3HHRB 3LIZA 2W9LA 1QPKA 4M8UA 4NGHL 5J6HA 2DQGH 1RZJL 1T83C 1NIBA 3ATFA 5E9DE 3UPAA 1MCCA 1AHWB 3VFGL 3WG7B 4F15B 1DQLL 2J73A 2JELH 3OPZH 4PJFF 1DVUA 2W38A 1YYLH 3LRMA 3NIGF 3IJSA 3QISA 4L4VD 4XNMA 3NESA 4PJIB 2MEJB 5FGBA 5F1SA 1CE1H 4FXLA 3WGUB 2VLMD 4A38A 5HDWA 1UT1A 3GLEA 2IPTL 4Y7OC 1R3JA 5AVTB 2XZQH 3EFFA 1GJIA 2C9QA 1MHPL 1FNGB 3HBZA 4R26H 3W5NA 3L1GA 43CAB 4OZIA 4FJZA 5JIPA 4WUKH 2HWZL 3EG9B 3F6LA 3H85A 4PB9L 4W9CC 1CL7I 2AITA 1WPCA 3MRCB 4L3AA 4LLMB 4X5XA 4DESA 2E27H 5AG8A 2MFNA 2VKXA 1XF3B 3NG5A 1QSEE 1RJLB 1BVZA 1RD6A 2F5AH 3J7HA 3PQYB 3RUGF 2ESVA 2IBBA 5EF1A 4X8JA 3L4UA 5DUBB 1ZSDA 3EFDH