4AGOA

Structure of the p53 core domain mutant y220c bound to the stabilizing small molecule phikan5174
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Halogen-Enriched Fragment Libraries as Leads for Drug Rescue of Mutant P53.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4agoA00
2J6WA 3TS8A 2IOMA 5ECGA 2BINA 4AGLA 3VD0A 4LOFA 2YBGA 4IBTA 3D06A 4LO9A 3Q06A 1HJCA 1EANA 1UOLA 2GEQA 1LJMA 2PCXA 3VD2A 1KZYA 3D05A 3KZ8A 3EXJA 5AOIA 1T4WA 4IBVA 1CMOA 1HU8A 2BIQA 3D08A 2J20A 2FEJA 1YCSA 5AOJA 1IO4C 3IGLA 1GZHC 2X0VA 3VD1A 2AHIA 4MZIA 4MZRA 1HJBC 1GZHA 3WTVA 4GUOA 2IOIA 3D09A 2AC0A 4L0YA 5BUAA 4L0ZA 2J1ZA 3WTWA 5LAPA 4IBYA 4G83A 5LGYA 2OCJA 2RMNA 4GUQA 3WTSA 3QYMA 1CO1A 4A63A 3Q01A 3US1A 3US0A 4QO1B 2IOOA 3QYNA 2BIOA 4L18A 5G4OA 2ATAA 2J1WA 3WTXA 4LOEA 4KVPA 2VUKA 4HJEA 2XWCA 4IJTA 2J1XA 3EXLA 5G4MA 4AGQA 5KBDA 2MEJB 4IBWA 2WGXA 5AB9A 3WTUA 4XR8C 1TUPA 4AGNA 4AGMA 5ABAA 1E50A 1H9DA 4AGOA 2BIPA 3D07A 2XWRA 1EAQA 5AOLA 2P52A 2X0UA 2H1LM 5G4NA 4IBQA 3KMDA 2J1YA 3IGKA 1EAOA 3ZMEA 5AOKA 4IBSA 2BIMA 4G82A 4IBZA 3D0AA 3WTYA 2ADYA 5AOMA 2J21A 3WU1A 1TSRA 3WTTA 2X0WA 3Q05A 4AGPA 5A7BA 4IBUA
chains in the Genus database with same CATH superfamily
2F54B 4WSKA 2CIKB 4R0LA 5CLTA 1ZLWK 1UVQA 5FUCC 5D7KD 5I16B 5IFJA 5DYOA 2VABA 4PLKC 2O5ZL 1X5LA 3CVDA 5DHYA 3ZRCC 5FECA 4K3JH 3T71A 3SOTA 4MD4B 2XJKA 2A6DB 3ZE0F 4QYOB 4FFWC 4PS7A 2NY2C 3DLQR 4LLWA 4PJIE 3B9AA 3F7PC 2VDQL 4IJ3B 5MENE 4YBLB 5EEYA 4LSDA 4KVCH 3MRGB 5GRVL 3HKFA 5FPIA 4DZBB 4MNQE 4B9JA 2ICES 5IT2L 3TF4A 2R1YA 2QKIC 4GNKB 1DL7L 4Y1TA 3L1FA 3L3KB 5E00A 1DVZA 1GZPA 2Y3AA 3B9VA 3D08A 3RDTA 5IB2B 2JTDA 5DDHA 1YEIH 3BP7A 1JG9A 4ONFL 1GKOA 5I28A 3IFNL 4XNXH 4GUOA 3QJOA 4ODUA 4JFDB 5DJ2A 1U42A 1EZVX 3BSGA 4NQXA 1SVCP 2YXMA 3GK8L 1NJ9B 4N0FB 3X17A 4LP8A 1KJ2H 1SJXA 4ZOAA 1YQ2A 4L0PB 4GQZA 1RJCA 3PFUA 4GUQA 5EFIA 2L3BA 1I9RH 2YD8A 2LHAA 5GGQL 3TBYA 3B8SA 3MLRH 4A7GA 5E6RB 4AY0A 3BCDA 5ADOL 1T2XA 4P49A 3LSOB 3N04A 1F11A 5IQ7H 4Q6IC 3FQ4A 3T77A 1JWMA 5INDA 1C12A 1CFMA 2XIDA 2YC1B 5D2LE 5F1OB 4EDWH 1EXUA 3CDZA 4M3JA 1EGJA 2EO1A 4ZXBB 3T0ED 5DA4A 4F7PA 4WW2B 2J8UE 4AEIH 8FABB 5CZVH 2YGPA 2IH3B 3FB5A 5E51A 1Q9WB 3WO3B 5DUPL 1RJLB 1TJIL 1UM4L 3C2SA 2ZUUA 5FW6A 3I3BA 1ADQL 1CE6A 3V9CA 1YLBB 4XHJC 4HGWA 3RRQA 3ETSA 1L9OA 4XP9H 1YEEL 4I4WB 4YH6A 4CVXA 2DQIH 2XPGA 1DQQA 3GIVB 5K39B 3QFDB 2XG5B 4JDEB 1F02I 3QEQB 3UTZA 2V5SA 2P8MA 1VAHA 2CJUH 2WLHA 5ETUA 2BSTA 2VLJB 1BVNT 2NUPA 1YUKB 2OMTB 2AEQL 3N40F 3HJ0A 4PUBL 4U1HB 5DJDB 3DROB 1M7XA 2I07B 4ODSL 5FO8B 2FBRA 3I6LD 5IWLA 3SDDD 2FH8A 5TGBA 4ODHL 1RUPL 2EO9A 2Y7OA 3EJTA 4H0LC 5D9SB 2EICA 1JP5A 4GW1A 2ZYIA 4KH2A 2V3EA 2ICWJ 1YYLH 1GSKA 3RIAK 3DO7B 3GZKA 1UH4A 1AC6A 2FYVA 2WD0A 4TVPD 3FH7A 4PJBA 1J0KA 4RAVB 2VRKA 4QHNB 1GKEA 2XIIA 3NCCB 3PWPE 2VLRA 4U1SB 4WV1C 4Y5VB 1W8OA 3RNKA 5JPNC 1E4XI 1KCUL 4UILL 2X4RB 5GRZA 4EDXA 5F0LB 1I8MB 4OAWA 5CN3A 3FTWA 3RGVD 4FLHA 2VLKE 3ZKNC 1VFMA 1JV2A 1EO8L 2JLPA 5IKCB 2CR0A 2UXGA 1AG6A 1M3JA 3U46B 4XCNA 3DOSB 1FZOB 4TNWK 4ZFOB 5FXCH 1XBRA 4FC3E 3W5NA 1NPNA 3AS0A 5D7KE 1NDTA 3MCG1 3ULVF 1YCSA 3VXTB 5J1TC 4C58B 4IOFD 1YYMH 2QPEB 1YMHA 1J1PL 5AVVB 4MZ3A 2G5UA 3U83A 5EU6D 1ZLDA 3OTTA 3BO8B 2ICWI 2A9CA 2FJFB 4GXUN 5EN2B 5I17A 4QLWA 2PO6B 1L9SA 2J5LC 3V95A 2A1WH 3GHPA 5BRZA 4AWJC 4P8QA 4GUCA 4Y1AA 3M88A 4OTXL 1U95B 3A6OA 1GCYA 4NZTH 4F5CE 2BH0A 4UTBH 3ARBD 2BOCA 2R29A 4NZRH 1IAOA 3ARVA 3MKKA 3BVUA 4HFWA 2NXZC 3DARA 1ED3B 1KN2H 2IFFL 1RIHH 4IK7A 3ZT6A 1UA6H 2WKOA 5AD0B 3CWGA 5IEKA 1V7NH 2DOCA 2W91A 2AJYL 2QDVA 2FX8L 1BYOA 1IT9H 1FHGA 4MYWB 5IK3B 5INCB 3VGDA 4NP9A 1LEIB 1HIMH 4U1GB 3RL2B 4OCYL 1FNGA 1CFQA 1NAML 4Z7VB 1MEXH 3DETD 1JHKH 5ESQA 3ARTA 5ICUA 1CE1L 4ZFQA 3GGWA 2J88H 2X41A 2N59A 3D39A 3FUNA 1IC4L 4K5LA 5JIKA 5IR1A 2VH5L 3T3PB 4WGWB 2HKAA 1WAEA 5EORL 1NCIA 3DIDA 3PL6D 1CR9L 3RLSA 2XDHA 2CBOA 3QHZL 3DKHA 1OTSD 3P9LA 4UF7C 4V2BA 4BCXA 2Z8RA 1C7SA 5CBEB 3VXUB 1E5UI 2ZWYA 5DEFA 1I1FA 5HYIA 1ACYL 1OSEA 3IMVA 3KGTA 2NZ1A 1YY8B 3L3OA 4NHCH 3CTTA 3HUJF 4KXDA 2AERT 2Z7WA 3IAPA 5D93B 3IJEB 1QSZA 2XWBA 1FQ9C 4V1DB 4N5UA 4BWWA 5IMLA 1GS7A 1MF2H 4X7CC 5F7EH 2JKIS 1RY7B 3EG9B 4TVPL 1WTLA 4C4UA 5IFHH 3PP4L 1OPOA 3DSFH 2X44D 5GIRB 2Z0UA 1J1XH 3D0LA 4NNYB 4NFCA 3VFPB 3SDXF 3FJTA 2W59A 1D5RA 2IDFA 2YAQA 3G08B 3IDJA 1TQBB 2VLLA 1UCBL 1JGEB 3HBGA 3I6LE 5CEYA 2HFFB 1RQ5A 4YXKH 5BZZA 2C9SA 3WFEH 4PGEB 5GGRY 4A04A 4LSQL 3DUUA 5D1ZC 1JGDA 1XIWC 4WNQB 1S9YA 1R0AH 1QFWM 1MCHA 4J8RB 1GGBL 5DZLA 3MLYL 4M43H 2ED9A 1JFQH 3TH4T 3ESPA 3GB7B 4QHLB 3OKNA 1L3NA 4FNRA 2QT6A 2VDRH 4UZSA 4Z7WE 3F7KA 3SJVD 2CD0A 3JV5A 3MHZA 3RJDA 5C0RL 1JYNA 2QDWA 3Q3GB 4LVHC 1C5BL 3MRDA 3TN0A 4DGIL 1PAZA 2CDEB 1DVYA 4AM0A 1P1ZA 2Y9RT 5T1KB 2ZXAA 4TNFA 5DMGC 4U7MA 1EAPA 1WBXA 3JQOB 1Y6NR 1KCSH 4GG8B 2JCCF 4ZT1A 5EBMA 1W8EA 4JG5A 2BDNL 4G9FA 2JI1A 3NN8A 4N0YL 4PLKD 4XMXA 4TSAL 5LGYA 1SJHA 4UNIA 1ZVSB 3D4GA 3UAFA 4WNSA 1MCOL 1YPZB 4ZZKA 3APFA 5JXAL 3FRPA 3QJZA 5EWIL 4FFWD 1J0YA 4F37K 2NY2D 4GSUA 2Q6WA 4BD4A 5IMKB 1DZ0A 5EU6E 1WYJA 2BIIA 3P0VL 1FDLL 1UM5L 4KU1A 4PWHA 2JJWA 2Y2YA 2AZAA 2I5YL 4WJ5B 5HGDB 3KYNB 3D2UB 1JS4A 3GMNA 3CPUA 1OGSA 4PLJC 8CGTA 5E2UL 4E9XA 4FJZA 3SGDI 3RZCB 3SKUD 4NQDA 1SMAA 4E9SA 4D0CA 3V79C 5LBSA 5KW9L 4MQXC 2D03H 3S36X 3WEXA 2F58H 3RVWC 4B97A 3MYJA 5ESAB 5F3HB 4QRRA 3ZKXB 3KLHC 1X5FA 4YHKH 3ML8A 5KTEH 3GMOB 3AG3B 4JPVL 1A6ZB 2JJTC 4P23C 5MEOA 4NENA 1GGYA 2GJ6B 3KMDA 2OSLB 3QUZA 4Z7QE 1NBVL 5LBVA 2DIBA 2K4WA 2DMKA 5JYLA 2WQXA 5FIEA 4HKBA 1JN6A 4JVUA 4MBRA 2IG2H 1FO0H 5KVEH 1ET7A 3ULVH 3QDHA 4KI1A 5D5MF 2EVGA 2R4RL 4PV9B 4MJ5B 1NCDH 1WIOA 1CD1A 2WINB 3FFOA 3DX7A 3OMAB 4NFBA 3TJHC 3Q48A 5F7DA 2NSQA 3KVDD 4F2EA 3P40A 2I7OA 4J12A 4KKZA 3J27A 2DAVA 1A4JA 2YQ3A 3LH8A 4XHJD 5HVHB 3OMIB 1SBSL 2YFNA 3TA3B 4WI3A 2K9FB 3T04D 4YK4C 1MHCB 2F08A 3DA0A 3QEUA 4WY7L 1S4IA 2NSMA 35C8L 5DZJA 2EE3A 2CKBB 5K1NA 5JW3H 2GI0A 5FDYA 3G5ZA 4LIQE 4XBPB 1NCJA 1SJEB 3AREC 4Y16A 4F2FA 5CD5C 4GS7C 2X10A 5E8DL 2W8CA 4GRLD 4HOWA 3WEOA 2MNWA 3OKMB 4TVSa 2VQ1B 3QXTA 2NW3B 2ZCHL 4RBPH 4YC2C 3V0DA 2GUOB 1MCWW 3O41A 4XO8A 1BIIA 2PPAA 2V5RA 3VI4E 4XGZA 5BVJA 2OP4H 4AKOA 1V3LA 2GFBA 5ISZA 1Q0XH 4GB9A 1MJUH 1HSAB 4GKNB 2B5IB 5LQBH 1N70A 5F7MC 1KGCD 4YO0A 1JTOA 4N68A 5HDRA 3QISA 3BW9B 3ZTJG 2VRQA 3NCYP 4A63A 4M7JH 4PVNA 4A6YL 3WHE0 4LSSL 2TSAA 4AYSA 4APQC 1ORQA 3ZKND 3A67L 3REVB 3KWTA 4ZW7A 4ONGL 3K6SB 2VJ8A 2DWTA 2BNQD 4MMXA 1LE5B 5ACMA 3OWRA 4UQEA 1BVLB 2X6UA 2YUWA 1FV1B 3F58H 1IGCL 1F1DA 4X4XA 1NANI 2VDNL 4LF3B 1ZA6B 5DWPA 4HKXB 1MREL 1ZWIA 2F8IA 2GT9B 3BKYL 4JM2C 1B0GA 4XZUA 3JBG7 2GBTA 4L5FH 1S7TB 4A2EA 2ESVB 1MCFA 3VFOB 3H6AA 5I1CL 1H5BB 4X6DF 3DGGB 3LH9A 4FQHB 5C0CB 1UWXH 3C60B 1QSEE 5DO2D 2FECL 1EDYA 3NIDE 5C09A 3E8UH 4LCCC 4B0MM 5J8OA 4ZMZA 3NJVA 3D3VB 1N0LB 3ATFA 4QRAA 4Q0XH 3T3MB 5IB3B 4P3CH 1FYTA 4LFHG 4QXTB 4K4KA 2AJVH 1Z9SB 4C8XA 2HP4A 1WD9A 1IGYA 4QJ4B 4KROD 1C8PA 3QUMB 1A14L 4FQQB 3ILEA 4P48A 1S78D 2YZ1A 5J1AB 2AV7B 1UUSA 2HX9A 4MCZB 2YN5A 5I1EH 4Q4IA 3QCVH 1MCLA 4YAQA 1MAML 4YE0A 5C0JA 4J2QA 2I27N 4FQCL 4X7TA 4BK8A 2WP3O 3Q8FA 1ZA3A 3VXOA 3A21A 1MUJA 5JOPE 1UFUA 2ZXBA 4KBPA 2YPVH 3QQDA 2FGWH 5C08E 3BEVB 5KJ4A 4NZUH 1PKOA 5EBGA 2BMKA 3RWJA 2Q76A 5CM1A 4G5ZL 5CJXC 4IU2B 5B3JF 3UAJC 1I31A 3GMRB 3BLBA 4ZTEA 1XGPB 3T8MA 3P11H 1YMME 1DVFA 3IMUA 2CO6A 2ZXQA 2X88A 4DVBA 5G2NA 2EXYD 5CCJA 3RUGE 2J20A 4PJ8C 5JXEC 4G43B 3R1GL 2GIYA 4UAHA 3IJHB 3CHRA 1DEEB 3CZEA 1E7VA 3LVTA 3QDJD 2V8LA 4P3WA 1KGXA 3V4LA 2ATKA 3M1OA 4JUTA 3NGBB 2FATH 1TOXA 4HPOH 4M03A 2X4UB 5FOBA 4H5SA 3VJ6A 1PS3A 2NNXA 1L7TL 4ZZFA 4NKQB 4NWTH 3QPXL 1SF3A 2TSBA 3LZNA 3DMMA 2HH0H 4I5BA 3BD3A 3HPJB 4ZOCA 3VDAA 5E8OA 4CJ0A 3ARWA 5J3HD 4FQXB 4MMYB 4Y5YB 3UDWA 1ETZB 1KJ2B 3LHPL 2B16A 5EOTB 2IMNA 4KJWD 3UIZA 1EDHA 4EN3B 4RNRA 4WHTB 4PJEA 2Y1VA 2MOQA 3DHJA 3CDGA 3L13A 1X5KA 4M3HA 3MRNA 1KGCE 3TFKC 5CZKA 2Y4SA 1MFBH 3QR2A 3OAUH 1CGWA 1LWRA 4ZMWA 4C4KO 2WNKA 1UWEH 3IS1X 1B2WL 4PG2C 3H9HB 5DMGD 4DTGL 4WUKH 4L4JA 1AGFB 5ANMA 2MJWA 4JPSA 4NO2B 2TRHA 1TJMA 2L04A 5FKAB 2AJZB 4HUCA 1WZ1H 3DX6A 5GGSB 5I8OH 5I0XA 5I75B 5ID0B 3CK0H 3S3PA 2EVJA 4HUUB 2MCPH 4DEPB 1QYGH 3A4DA 1X5ZA 5BOJA 3A6CL 4YBLC 1RLBA 1CU4H 1WICA 4P99A 1W0WA 5I26A 4K7FA 2NUTA 2MPVA 4WFFD 2FQEA 4LLMB 4QD2E 5D6DA 1PPIA 1MVFA 2DQGL 5IREA 3NYKA 3IAGC 3FO2B 4AOFA 1D7FA 4WCYL 1GTNA 1E9OA 2IPTH 3BUBA 1QUPA 1XF4B 2QSVA 1T22B 1I8KA 1XTLA 5DQ9A 4MQXD 5AAWC 4MJ6A 3NDYE 3U6XS 4FDWA 4UU9A 4IS6B 5SV3A 5ICZA 1F3DH 3IGFA 4NUQA 1ET5A 5B3SB 2EIKB 4P2YA 2YXVA 5TFSL 5F89B 3RNQB 3PJLA 3IFLH 2D7QA 1K8IB 4YFLF 5ICYB 5C0DB 1JV5B 2YSTA 1RK1A 3L4WA 4X98A 3VXSB 3HRPA 4ECNA 3AWEA 3G5VB 3TBWB 3BWUC 2NY5H 3VXNA 3DV6B 3GLZA 4JB9L 4UM9D 3FU3A 3QFJD 4W4OA 2WO3B 1RZFL 4HPYL 5TF0A 4B9PA 3Q5TA 1QFUH 4JM0A 5MEQA 3G5WA 1CS6A 1GZQB 5EUKB 2X42A 1GZHA 4NBYB 2DDQL 2MMXA 4WW2C 3P4MB 4I9WE 3HB3C 5I0VA 3TJHD 5I0ZA 3HG3A 1NGXB 3K2MC 3JWOH 1VFAA 5IMOA 4PJHE 4LCWD 3T0XA 5AEAA 3SKJH 3O9WB 1U91A 2BSRB 1LMKA 1NGYB 1KTLA 2RMNA 3U0TA 4JFOB 4XO4A 1NEPA 4MS6A 3BHBA 4NI6A 3DVNA 4P5MA 1ZHBB 4GXVH 4JCLA 3WJMA 4NCC2 2OS7A 2YUZA 2FJUB 1TU2A 3QNXB 1LTXA 4FYTA 4MB5A 1VFUA 2FWOA 5FDWB 5GS0H 4KXZI 5CD5D 2Y5TA 3ARED 3QO0B 1FFOA 2E9JA 3B43A 4LE8A 4NCDA 4I3SL 5IBLD 4BKSC 1IC1A 3MUUA 3QEGH 1BVZA 2ZXDA 3O3AA 4JPWH 2NXYC 3DPDA 4ZO8A 3UYPB 3VE0A 5A2JH 5HP5A 5J9PB 4AGQA 2WQUA 5F8QC 1FNHA 4N4YB 3WDIA 2WIIB 5IIEB 2JCCA 1WFTA 3SBWC 5HGAB 2XN2A 4WFEE 1N19A 3ISYA 1OHQA 1WS8A 1TCRB 2UZIH 4AGOA 2CJTA 2X6MA 1XH3B 4FZEH 2DICA 2J1KA 3TJEL 1ZT4B 2JQAA 5FYJH 1DSWA 1QUNB 1KZQA 1LEKB 2NT1A 2WZPA 4GSDL 3S35X 1CXIA 1CL7L 2AQTA 4AG4H 1GVIA 2ARJA 3BH4A 1SXAA 4GP8B 2AJUL 4QJ5B 1EEQA 1MIEL 3ZE0B 1N6QH 2LAGB 3OQ3B 2X0WA 3MRCB 3MREA 4ZTPH 5SWZB 4J3OF 1IGML 4OGZA 4HZAA 2APXA 5GS1A 1T2QL 1OL0A 2I7SA 4JPQA 4PJ5B 4XNYL 1T89C 5F9DC 4XPAL 4RGMC 3X3FL 1M2VB 4BZ1L 5BJTB 4ZAKB 1QTPA 2JKWA 4WWKA 5FB8B 3NZHL 3OD3A 3VFTB 4WU7B 2BINA 4JM2D 2BHYA 5I6PA 1YEDB 3UO1L 2PO6C 3CZFB 1IC7H 1H9VA 2WLMA 2VXVH 4R2GB 2JJSA 4PG9B 1RU9H 4JR9H 5KUMA 1KJ3H 2EIEA 3GI8H 3KYAA 5TK4A 1OE2A 1IGFH 1FE8L 4YHNA 5BZWA 3KXFD 2UX7A 4GG6A 2VISB 1A4AA 3EGDA 1ODUA 4FP8H 4PREA 4O5LH 4EZMA 1JCKA 1OLZA 3LEVL 5JHLH 3NTCH 4F80A 4IGBC 4N90E 5D5MA 5C0EB 1RCYA 4HK3J 4AZUA 3LYRA 1TQSA 3N06B 4PJDE 2R2BA 4CSSA 2WIMA 3NIGF 1WA0X 1FAIH 2FT7A 5D7SH 4YZFE 1KB5L 1VENA 4JZJB 2E56A 2AMUA 3QZWA 5EHFA 1SF5A 5CN1A 2ADJB 1AE6L 2XNAA 2VDRB 3O8XD 2LT9A 1IC5L 2VXQA 3VQ2C 5EBLB 2FECI 3QFJE 3EOAB 3P4NB 3M7FB 1B0IA 2I25N 1WTGT 5ESVB 4OLEA 3FB6B 3F12A 2XYBA 5AW3B 3EFDH 5JORA 1GGIL 1TEYA 4OZHF 3MGTA 2F61A 2BIOA 3GSUB 4YLQT 1E2ZA 2KKQA 1NBYA 1J9TA 2OL3A 3BDYH 3VACA 4ZUSA 4TMPA 5AZUA 4MXQC 4PJ8D 2E86A 1NA8A 5JHMA 5C7XH 1QFHA 2XWTB 2V2XA 3U2IA 2WXJA 1AS7A 5CGMA 2VGLM 5T1MA 2VE6B 3W2DL 5DQDL 5IFAL 1I8AA 2XBDA 1EEYB 4JRXA 4PM1A 4X6FB 1L5GB 1SYSA 4I18A 2XPZA 1NAKL 4JPKL 1RULL 7PAZA 15C8H 4OF5A 2PP8A 3N40P 2YUVA 2WWOA 1TQBC 2WANA 4LMQI 1VB9A 1PZBA 2XBTA 4FMFA 4A7VA 3QDGB 1NCGA 2QQLL 4R7NB 4G80A 4WEEA 1AD0B 5AUMB 1S9WB 1G9NH 3S35H 1URIA 3LRSB 3I6KB 1MWAL 4LLQA 2OYPA 3IF1A 5HDQL 4BM7A 7PCYA 3W5MA 1NEZA 3RWGB 4JQIA 1JCVA 4H0HB 4JRLA 5LXGH 4X6CF 5JHDD 3QJVB 5GGUB 5JLZA 5BUGA 3RVXC 3IVKB 1AKPA 3TFKD 2FJSA 4EI5D 3NSFA 1L0XA 5EEWA 4G1EA 1U92A 2FSEB 3S3DB 1FO0B 4NO0B 2QQNH 1NPJA 3DO3A 3Q8CA 2R69L 2VZSA 5DQJB 2HB0A 2WPGA 3PWLB 1G5AA 5I8KL 4IRSA 3T8XA 1VJSA 3GLAA 4L3EB 4B9YA 4XCCH 1CGUA 4F7KA 1U8KA 3SE8L 2HKFL 3CHQA 3MV7E 3PIQA 4KX9A 5F1NB 3SPIA 4H1LB 4JHVA 4BFEA 3MLVH 3NP3A 3ZYOA 3AB0C 1TEGA 2DI9A 4LU5H 4YDJA 4WF7A 1T20A 3FTVA 4R0LC 3QIWD 4X9IA 4LSPH 3TH2T 1KIUA 2BVPA 5FK9B 5CZRA 4GKLA 5KBKA 3MV11 5HYJB 1CD8A 3L2MA 1F2XK 3MJ6A 2WMPA 4NPYA 3VG9B 4M5YL 3RZCC 4KHXH 3FSZA 3IDUA 2E0PA 3HCVA 4HHGA 4G5AA 3QZOA 3TIDB 3FTUA 1X4XA 2MNUA 3KXFE 4K2UL 2W65A 3KBFA 2W0PA 4BHUI 4FQLL 2NLJA 1YAIA 1LO5B 4HUVB 3NRFA 1KB3A 3TURA 3BP5A 3QI9D 1P5UA 2VR7A 3BAYA 4QWWC 3TTYA 3WY4A 3FH5A 4GLRH 2L7JA 2DWDB 2AANA 3VUAA 1CZ8L 3KWXA 2FAUA 2JIXB 2WWNA 1PG7X 4JKWA 3UPRB 3BVDB 3RI5K 3HMXH 4OLXH 3WDJA 4P59H 3RGBA 1U8QA 3LPWA 5FYLH 3OPUA 4HK3N 1KBKA 3GS4A 1OP5H 3U4AA 1PEZA 5JA9A 1IV8A 1I7ZB 4OCLC 1ZS8A 3HUJB 3FT3A 2YGOA 3HB3D 5C8JB 3EYSL 5TQ0L 1M7IB 5HVFB 2UYLB 2JKTM 3C8KA 1FFQA 5HVHC 3TA3C 4G6MH 1NDMB 2F53A 5IQ9A 4JO1H 2OR9L 3T8VA 4K9EH 5HHPA 2ZOLA 4Q9BA 3EOYG 4IBQA 3KPRE 3ZPDA 4YFDB 1BSIA 4ATWA 3GF8A 4XCYA 4WTZG 5C0AA 1AXTL 1MY7A 2QLYA 4U1IA 3QULA 3VO0A 3VWKA 1OE1A 3UTTB 3H4HA 3KWWB 4Q74A 3ZRSA 4AYGA 3RPBA 5D7JD 2MTPA 1JHLH 3FO1A 3UMTA 4FX5A 1C5DB 1JVKA 3ARGA 2NXYD 1BZ7B 3EZ8A 3RWIB 4K71B 4CMMB 3MRQB 4UNUA 2YOAA 3KLKA 4K7PH 4NZDA 4KNUA 4NN6C 4TNGA 5GZNA 1OTTC 3H9SB 3K72A 5I66A 4HEME 4GRMB 1ZANL 4WDIB 3WKML 4JG1H 2ITCA 3PDDA 1RIVH 1TZHB 4QY8A 1N59B 5IWLC 4N24A 4MD4A 1AZCA 1CTOA 4A2LA 3QDMA 2B5IC 1DEDA 4QYOA 4BIKA 4Z3IA 5C2BH 1C1EL 4RA0C 2R7EA 5F9JB 1MNUH 2O93L 4N2OA 3MRGA 4HHWA 1HHGB 2VXUL 4DZBA 3W11C 1BZEA 4FLSA 3UDWC 3ZE2B 4DKDC 3DX9A 3V5DA 3V10A 5D1QA 5D6CA 2F54E 4G8IA 5C92A 4MSWA 5E8NA 3G04B 2XI9A 3GJFK 2MPAH 3LRMA 3IB4A 4PIBA 4KNQA 4HUXB 2XG4B 4U1MB 1IBFA 1A7NL 4YR6A 3WIIH 3T1FA 2VDLH 3MBWB 2G0LA 2R1XB 4QXWA 4IRJB 2O5XL 3BMWA 2H41A 4M7ZC 1JXGA 3SBRA 3L1OL 3AQXA 5DK2A 3DIFB 4NBZB 2IQ9H 4O2FB 3RTQC 4POYA 3D69A 1HT6A 3LXBA 4XP6L 5E1GA 3ASWA 4B27A 3PY9A 3C60C 3KL0A 1R33A 1DVXA 3UTPD 3T2NH 4NQQA 3INUL 4UT6H 3U7AA 3LSOA 1YNKH 3TEYA 2WXRA 3EH3B 4J2XA 1JERA 4TQEH 4YIQB 1IKFL 4Z95H 1Z2KA 1BWWA 1CTMA 1PG7H 4DCQB 5TTRA 2AXFB 5A2CA 2MHAB 3PAYA 4JFDE 3WENA 4ZXBA 1HFUA 1XD0A 4IGBD 3SDCC 5GJTL 4F8TA 1H3WM 1AANA 1R3JB 2BIHA 4L8BA 5DR5L 3X1BA 5JNYB 5E2TL 1MLBA 5CMAA 5EH1A 1X5JA 4ZRGA 2EYSA 4OIIH 2R56L 3L4XA 2IJ0C 2DQJL 1FWXA 3QEQA 1UM6L 3K2UL 1ACXA 4X7SL 2WZ0A 3IGAA 2VLMD 2VLJA 4PJAF 3UOAB 4U1HA 5DJDA 3RP1A 4ESKA 4ADIA 3QR1A 1G7QB 3CMGA 2IDQA 4MS8C 1EHNA 2CHWA 3BGMB 3R0MA 3JXAA 1KBGH 2B9BA 3OGOE 3SGJA 4P5TB 4I1RA 1MCCA 5DVKA 3OHMB 2C9VA 3UMNA 3CFEB 3H56A 4M3KB 1UYWL 3NABL 4GMSL 3ULSB 1T0NB 4MXQD 4ZO6A 1ZSDB 3DO7A 3LXUX 3AUWB 3LHAA 1XGTA 4KJPC 4P0DA 3R8BB 4MWFB 5I71B 4Y5VA 3NGBC 2OYKA 3L3OC 4Y19D 1GIGH 5AVRB 5H37G 4JQXC 2X9XA 1H0DA 3LKSB 2BP8A 5F96H 4X5PA 1KCVH 1TFHA 3HZKA 3E2HB 1CF1A 5KVMC 2W0FA 4C83B 3D85A 5IKCA 1GMEA 4JMXA 3C5SB 3U46A 3AVEA 4WWID 2X2UA 3BP6A 1FZOA 1A25A 3DOSA 4I3RL 1DDHB 4K3EH 5DD1L 3BGFC 4MDJB 4OD3L 4FADA 3GJEA 1F1GA 4KTDL 1LP9E 4L4VA 4EN3C 2B1AH 4HJUA 1OGAA 4CA4A 4FHJA 2XTSA 2J43A 5DC0A 2DS4A 2VIRA 3FN3A 3UIYA 3O6KH 3MROA 3TESA 1XSIA 5ADPH 3KM1A 1U8IB 1G7MB 1ZHLA 3NVQA 3V6BR 1FZJA 2ICEA 4RX4D 3PGFH 5K9QG 3T4AA 1CVSC 1B9ZA 1S7VA 1U95A 1S3KL 4X5WB 1QNZL 1UATA 4RGNC 3RBSA 2QADD 1F6AA 4N8VG 2BVOB 5CZXC 5I75C 2ZUYA 4H8WC 3PHQB 2B2XL 1ED3A 2XWEA 3NFNB 4DEPC 4OQTL 2WUCL 4GEIA 2F1AA 2GIXA 1E4KC 2NSXA 3NEOA 2N3JA 1ETA1 5EU4A 3RAJL 3S4SG 4GINA 4MRBA 2CXKA 4PJ9A 4YE4H 3G9AB 4AKPA 4K7PY 3MJ8A 3JSSA 4FS0A 4HFUH 4MA8H 4XVSH 2VL5A 4Y88A 2F5BL 1I8IB 3A6BL 2OR8A 4J3UA 5G4MA 1UZ8A 3MC0A 2JKNA 4JFYB 5HYSG 4BWTA 4ETYA 3OAWA 4MA1B 4JO4L 3IYLW 1YEWA 3KJ6L 4PB9L 3RZCD 1NIFA 1U0QA 4E5XA 1FZMB 4KK5C 4FXGB 4POZC 1G43A 2P8LB 5TPWH 4HXBH 1WFIA 1EX0A 3WHXB 4KDWA 4OKVA 4I77L 4S2SA 5IVXE 3Q44A 5ABZA 4D7PA 4LGSB 5H4ZA 3GEWB 1Y1DA 3RDTD 3VXUA 4MJID 1JZ5A 4S0SD 4LLAA 1HAUA 1CI3M 4Y9CA 4ODTH 3FAWA 1LO4H 4CBPA 4J3VA 4Z7VE 1OB0A 2BVEA 3P0YL 4XOCA 1KYAA 4XX5A 3GBEA 1DJHA 4FG4A 1E0OB 1ZY9A 1SDDA 3KLSA 4S10A 5GIRA 3T3PE 4NNYA 4WSGA 2CUAA 2MRYA 4HT1L 2VLME 5FWRA 3WIHH 1ZE3H 1IGJB 2N1KA 1LO0H 2OZ4A 3G08A 2VXSL 3ML9A 1FVDA 3QUZC 2RD0A 1IAKB 3QWRA 3RE0A 3O9WC 3FUKA 4PGEA 3U6RB 4HJJH 2WAHA 4WNQA 5H2BB 4Z3TA 2GSGB 4LPTA 2NDGA 4V1DE 3U2SA 4NN7B 4IRZH 4FA7B 3TFBA 4QRBA 1CMOA 4AI7A 4AYBA 4F15B 1QLFB 1H19A 3ATBA 4Y19E 5GRVK 1XR9A 1HCYA 3Q3GA 3B7TA 4H8UA 3RFZB 1FI8C 4JDVB 2ZONA 4BCYA 3LEYH 4MXWH 5K69A 1ROWA 5HTSA 4ETQB 3BKCL 5FEBA 3NMEA 2BXYA 4Y89A 3TYGL 1OTTD 4QNPF 4A66A 1G84A 1BXUA 1YEFH 1NIAA 1BPVA 5DXWA 1EZLA 3GKWH 1CICB 1JRHH 1TCMA 4G7VL 4L1LA 5B22A 3TYFB 3ILPB 3L95B 4AVIA 1XGYH 5DURD 3S3SA 4K73A 3J8F7 1N10A 1HN1A 1JGVH 5DTFB 4HA1A 3W11D 1KCLA 2CIIA 3GIZH 1M2OA 4DP4X 2FR4A 4MJ2A 2WLLA 1CXEA 1F97A 4M48L 2N0MA 1V8HA 2QFRA 3NCJH 5CLXA 3QHFL 4N0CC 4R3SB 1MFVA 5KBDA 4YHOH 4LSRH 1QEWA 2QR0A 3HNVH 1T1YB 1H8NA 4JN1H 3VU2A 2PR4L 2QHRH 1Q90A 1YPZE 5F6HJ 4U1LB 2BIPA 4J1UA 5EZOL 2XZAH 2XVKA 1DJIA 3UPAA 1NOLA 4UWQB 5T3ZE 1BFVH 4PP1C 2WWKO 4R2GC 4YPJA 3RTQD 4DKFL 5A43C 5FYKD 2GJ6A 3HFFA 1KUMA 2I9LB 3K0YA 3UC0L 2OFQA 1E4WL 3HVDA 1BP3B 1A6AA 2EXWD 4R90H 4X5QA 4K9JA 3KPQB 3QJRB 1KFAL 3MUGB 2UUDH 3KYKH 3WFZA 4U6YA 1ECYA 1QTSA 4N20A 3EYOB 4XP4L 4MJHA 2ZUQB 3A5VA 4FLQA 4MJ5A 4Y1AD 4LRIC 1L7IL 3SDCD 5FW8A 3QJXA 2WBJB 4FCHA 2O5YL 4FFVC 5DT1L 4JZJC 4OD2B 4UANA 4MJIE 2FTAA 1ZV9A 4TV3A 4KH9A 2PCFB 3LKQB 2DQ6A 4TUKL 5F72S 2A77L 3U9UA 3BKJH 4MYPA 4G1MB 3SY0A 3F7LA 5JUEL 4AYFB 3QJTB 1DJGA 3QDAA 4NJ9L 5DJCA 5B4MC 1QFWL 1GYUA 2AQ1A 5E56A 5F6HI 1I1AB 1MXDA 1EGJL 2CKBA 1JPTH 2NZ9C 1AQHA 3GO1H 1MHPL 2PW2B 1ORSA 3QUYA 1F4WH 1IILE 2VQUA 2QSCL 1AGCA 2FX7H 2Y07H 4MS8D 1A7OL 2KL6A 4HV8B 4CJ1A 1V54B 3D39D 2C3HA 2X0VA 4Z0BH 2NW3A 3KVQA 1HJBC 1MRDL 1GPOL 1TYRA 1LILA 1W0YT 5IW3A 3QJFA 4OGQC 4U4IA 1FFRA 4KJPD 4HS8H 2A9BA 1EK3A 4MNGB 1DVFC 3MZGB 2XKNB 2ADIB 4UDUA 5HJGA 1YEGH 1E42A 2L8AA 2K78A 3I9IA 4O02H 5FV2A 4GI8A 3QORC 1I1YA 3KR3H 2Y36L 1IUZA 1VERA 1FN4B 1GW6A 3NESA 4DP8X 1JZ3A 3S5LB 1KACB 1O6VA 1PNDA 2JE8A 4KPHH 3ZL4L 2HVJB 3AM8C 1D5IL 3NACH 4PV8B 5L4FA 4ELKB 1KJVB 1TQWA 4F7EB 1MN4A 4MA7H 2BFGA 2Q1EA 4YWGL 3VI3F 1H3TA 2B7DT 4U4BA 1PDKA 4PV1C 4M61B 4R7LA 1DSFH 2HRPH 1ZA6A 5F9OH 3DMMC 4MDRA 5D7HA 5IB1B 1OF2B 1MJ8L 4UMSA 3SE9L 1D5ZB 1T5XA 3L9RA 3CVHH 3VXMA 2FNBA 3ATDA 3IDIB 1S7TA 2PKDA 4G8AC 1I3GL 4HP5A 4QR7A 4RQQB 2E46A 1OM9A 1SN2A 2PXYA 2QPFA 3PWVB 3ULVC 1HTYA 4DAGH 1H5BA 3GSWA 3K71A 3ZTCC 5FYKL 1NC2A 4RGND 2BC4A 5CZXD 2V2TB 4L8CA 1AOZA 3D3VA 3W9DB 1T6WA 4KK9C 1E30A 1Z9SA 4E41A 3RWCB 2GKIA 5I1KL 3HBPA 3QUMA 4QAMB 1JGLH 5JXED 1DQIA 3EUDA 3LZQA 3KLQA 2CLZA 5HHQA 3V6ZB 4TN9A 3BZ4B 3K7UA 2ESVE 4LLVB 4Z5RA 3WYRA 2R29L 5DMKA 5B38B 1L0QA 2A9AA 1A4KA 1FRGH 4GMTL 5FYKE 3LKNA 1KELL 1P4LB 5C0CE 1RZJH 1PX3A 4QHUB 1EQWA 4NUGL 5I8CB 5F7WC 2YKLH 4ZFZB 1NUNB 3E6HB 3VGHA 4K23L 3VD4A 1ZS2A 3SEPA 1P6WA 1PMYA 3MZTA 5D6DC 3BUTA 3KJ4B 1KN4L 2W5PA 2CLRB 5J4MA 1MH5A 1OB1A 5DRNB 1ZDSA 3FL7A 2YMXL 5ALBH 4NFDA 3IKCA 3OPZH 4X0KB 4NQDD 2NNCA 2C1OA 4F33B 1IE4A 3E0GA 1KDJA 3OHXB 3HS0A 5L7XH 1G6RL 2K0RA 1FH5H 4MZRA 5IV2B 3HKZA 5TE6L 5BUPA 4J6RL 1AHWB 1TTUA 1E8XA 4RDQG 3BI9X 5E1HB 4AYEC 1BA9A 2C3VA 3OLDA 5HI3D 3T9WA 4AVHA 2DQEL 2HTKC 1IJ9A 2Z92A 3U4BH 1E6OH 2IBBA 4AJ0A 2QVFB 3SKMA 3WY3A 3VXPA 2OCJA 3QUZD 4GSXA 4AV4A 3D39E 3LS5L 1RKRA 2QHLA 1VADA 3ARFB 3VNYA 5AVQB 1E4HA 3DK2A 3MV01 2R2HB 4MMYA 1IM9A 3QQ4B 4OM1H 1ILSA 4UQ3B 5E0QA 4JY6B 2F5AH 5F6IB 4EI0A 1HINH 4IDLA 5GS2D 1GXEA 2DLFH 2NX5A 1TZGH 1DLFH 2J1XA 32C2B 2GSIB 5DZVA 3FMGL 2X4QB 3RVTC 3OLIA 2KLRA 4FERA 3LY6A 5GGRA 4HQQH 3FSWA 3WXWL 1XCXA 2X89A 3BZDA 3H9HA 4HF5H 1PEWA 1N67A 3TO4A 5DUMH 1JK9B 1U33A 4XPBL 2NQDA 1ZLVH 1QPXA 3O0RH 3F84A 2UVFA 4Y16D 1RUMH 2H6OA 2HT2C 3PWUB 3FQWA 1XCTB 3B2VL 4WNJA 5D7IF 4LEEA 1T0OA 5IJDC 5JOFA 1AMYA 1A3RL 4FXKC 4HUUA 4HZLB 4H8WL 4NQSA 3RILA 4JFEA 4YHZL 2NW2A 3LEXA 3ZMEA 1KGUA 4XP9L 1TQVA 4NNPH 4NT6B 3HHSB 2CGZA 1OARH 4W9HC 5AZ2H 5TDPB 2AK4B 2WBKA 2J21A 1OZUA 4LLMA 4A38A 4HU8A 1TSRA 1S9VA 4M1DL 5DCCA 3S37L 2EEAA 4JFQB 1QWNA 2EADA 3N43B 1RZKH 5ISZD 1WSST 3KBPA 5K9OA 2IPUK 4A2HA 4PS4H 5LGKA 3KHOA 3WE6A 2IBZY 4RGNE 5DWUH 1ACCA 5B8CC 1T22A 3O6FB 4AMKL 1QOKA 1P69B 2Q3XA 4DPAX 2C4XA 5CHNB 5MEPB 2ZX5A 2JFCA 1AI1H 2R8SL 1WCBB 5F89A 3KGRA 3AY4A 3KBEA 3K81A 1ADWA 4PP1D 3NSDA 3DDGA 5ICYA 4UT9H 3WS3B 1JV5A 4UV4H 2FCBA 5T5NF 5I9QB 3VXSA 5ERWB 5GS1C 5LBSL 1RJZB 1I3UA 4GAGH 5C3IA 3DV6A 2ZXWB 3TTSA 4OY9A 1QSVA 1NFDB 1OCWH 2AXJA 1BJ1J 3B34A 1TVHA 3ATEA 5HDWA 2LVEA 4L23A 2JJSC 4JFFB 4OVUA 5KSBB 2F0CA 2BHUA 4WK4B 1HHIB 5DJ0B 2P5WB 4ANKA 3BDBA 3HOGA 5FUZL 3MLWH 5C09D 5AAMA 5BQDA 3VCLA 1D7CA 1X5MA 4LGPB 3ETBJ 2MFNA 3WGUB 1RHFA 5BPPA 5B1KA 4H13C 1WBZA 1NGYA 1UFGA 1JL8A 1FYTD 5FAAA 5LAXB 2FQDA 4J4PC 4UTAH 2WV3A 2Y1ZA 4QHPA 5J89A 2NZ9D 3G9VA 1R3KA 1WD8A 1SEBB 3FCBA 4I2XA 3IJSB 1MI5A 4KK6C 4KX7A 5AZEL 3V4PH 3QO0A 1QZ1A 4KDVA 2BZDA 4OH2A 3L9EA 4XCFH 5D8JL 1SOXA 3NJLA 4KUCF 3N41B 1S7RB 1EV2E 3FQNA 4BZ2A 5I1DB 4S0TD 4P5TC 5IBTH 5KVDH 5G5DA 2XACC 3VTAA 3UYPA 5J9PA 2BPBA 3UG4A 1KN2L 1UA6L 4XR8C 4XO5A 2ZPKH 4PAZA 4AGMA 1WHOA 3CXHJ 4YDIH 2X6VA 1QFWI 1TJGH 1TYEB 1SJMA 4QRFA 4UUJA 3NFSH 4X8CA 2BY2A 5SWSB 1WEJH 1YEJH 1DVFD 1SNRA 1NIBA 2Z4TA 2E7LA 4HBQA 1GAFL 3SDAA 3HS8A 3FW6A 1EDQA 3QXWA 2X1QA 1GYAA 4NAMA 4GW4B 3QORD 4OLZL 2Q8BH 4ODWB 3E2HC 3QPQC 1RIUL 5AOKA 4DGVL 2X6BA 3FQTB 4FABL 2AEWA 4U6XB 2G4GA 2LE9A 2Y7QB 2XHNA 1FNAA 4G6FD 4CSZA 5E5MB 5A2KH 4TOYH 2WTPA 1F90H 2WCSA 4MQTB 1S46A 1TJHH 1KXTB 5KYUB 2Y69B 4MTMA 5CBAB 4LBEB 3OGCB 3PV6A 1P5VB 1M2VA 3DMMD 2C4FT 2NY5C 4ZAKA 5BJTA 4M56A 1MCEA 4L9LB 1ERNA 5TE7H 3VFTA 3AS1A 1YEDA 3FK3A 2XN9A 3JWNC 4HWZB 4R97B 3MPCA 1PG7W 4XVTL 2BNRA 5IJVB 2JB6A 4I0PB 5I6XB 3HI6H 1WC7A 3WLBB 2V7NA 3DSFL 3MLXL 3ULVD 3LN5B 4WI6A 5HYQA 1Y6KR 4ZNCD 1URZA 2LLGA 3ZE0E 1SDAB 5JW5B 1S9XB 4BA8A 1LEGB 1JNNL 1ZTMA 3JWOC 4Q8BA 1SJVA 1X7SA 3GSOA 3SKNA 5SWZE 4AJYV 2R27A 4KK9D 1MIMH 1MFCH 2BP0B 3LQZB 4MJJA 2R0WH 4PJ5E 3DX3A 4F92B 5C0EA 4EZLA 4UIKL 4G7YH 3U6XA 1A5FL 2IDCA 1D5MB 1A7QL 1R0AL 3BUYA 3C5JB 3P77B 3KGSA 2FIKB 5BRPA 5J7CC 3U36B 3ET9F 2HG0A 4IRSC 5KVFH 1KXVA 2ADJA 2EYTB 5D1XB 3FO0H 3GD1C 5EO9A 3DX1A 2QPSA 1FBIH 2IWEA 4MA1C 4KZCA 3RWEA 1FLRH 3UXFA 2I9TB 1HHHB 1EVUA 3D18B 4MD0A 3ZKSD 4FG0A 3QG7H 3WE1A 5DVOA 2DQTH 1K6QH 4PRIA 1VACA 4JVPA 4DGUA 4U0RB 4XVOA 3F7VA 1QATA 2RACA 5DS8B 3UZVA 3GSUA 3SGDH 4WQOA 1VCAA 4D0BB 3ABMB 2ATAA 5LWYL 1DBAL 5D4IA 2O5ZH 4AQ1A 3W82A 4PJAB 2D7OA 3I6SA 1J9RA 4QKTA 5BS0B 2VE6A 1P5UC 3I02B 1RFDL 2ZUVA 4Z8FL 1G1KA 2VDQH 5CCKL 4LHJB 1TFPA 5CIPH 3UBXB 3LB6C 4OFPA 5IT2H 4QHKJ 1T6VN 4CW1A 2BP5M 1P9MA 1DL7H 3QDGA 3VDCA 4HJGB 1DBJL 1E28B 3NZSA 2DYPB 2BZ7A 2IBGA 2ZKHL 2PWHA 3MA7B 4PTTB 5E94B 2IAMB 1QR4A 4YDKL 1A1MB 4KK8C 5SX4I 3IFNH 1Y18A 5LN4A 3QRBA 4NN7C 5KTEL 1CBVH 1SN5A 1QNIA 3GK8H 3RWGA 3WEMA 1DUYB 2VW7A 2UZYA 1OAZL 4EZJA 3P02A 3UTTD 5GGUA 1F56A 3U9WA 4HPHA 5E9NA 2GTZA 4Y4FA 5GGQH 5GPRA 1VESA 5LGJB 1X5HA 4CILA 2FSEA 2C7UB 4E9LA 5ADOH 1AQ8A 5DQJA 3ULVL 4LP5A 3FXIC 2EIJB 3VWKC 1WP6A 4OZIA 1FNEA 4KZEL 4QHKI 4NQVA 4XPTL 4CKQA 1N12A 2IXQB 4DFIA 1NTDA 1A7RH 4H1LA 5DK3A 3FTGB 4JE0A 5D96B 5DUPH 1OP3H 1GRWA 1TJIH 1AKJB 1UM4H 3X1EA 1F3JB 2Y3NA 5LDSA 1ADQH 2UWEA 1KTJA 4ACPA 3DWTA 4FE9A 5FK9A 4Z76B 3X2QB 1FZKA 3S98A 2WN3A 5HDBF 1A1NA 1YEEH 3FB8B 4N2EA 4F1SA 5E8EB 5KVEE 1I85C 3WV0A 3AQDA 3L7EB 3ULVE 4HBCL 4ZOBA 2ZNXA 3RHWF 2YOCA 2WZPD 1BEXA 3VFSA 1JYXA 1K8DA 2YFOA 4PJXF 1E9PB 2AEQH 4PUBH 1J1OH 4BE5A 3IJYB 4ODSH 3H3BC 3QNFA 4W9DC 3EGSB 1CO1A 2H45A 4ODHH 5J56B 1RUPH 3QA3B 2F2HA 5KBPA 1VFBB 2FLRT 2VC2H 2ROXA 1QSFA 4PGBB 2ADGB 1XF5A 4K55A 2E8ZA 5HYJE 4E0RB 1SPDA 2AVGA 1OQXA 5A1AA 4IMLB 3FNKA 1N5YL 3BRGC 1NANH 4Y4HC 4U1KB 5HHNB 1SLUA 5C0BA 1KCUH 4UILH 1II4E 1BHGA 1MAJA 3SKOA 3ECQA 3CE1A 4NYLB 4R7DB 5C0GA 3EYUL 2A6IB 2JTYA 1EO8H 5BQ7B 5C8JA 5MHSD 2BVQA 1BCIA 1P4BL 2DWYA 2UYLA 5FGRA 4RLDA 4F37F 1G7HB 4PJCF 2FEEL 4PR5B 1QBML 3OB8A 1NOFA 2P46B 3CVHB 4J4PD 1BX2A 1EH9A 3CQFA 3WO4B 4WGKA 1CYXA 4F3FB 5I6OA 4YPGB 2O61A 1J1PH 3S36L 4TL5A 1EFXA 5GHWL 4KK6D 2I69A 1PAMA 4PGJA 2X53A 3NJMA 4JLRA 3KWWA 2Y6TE 4FI6A 4AQEA 2FD6L 2J57A 2R39A 3DYMA 4WHDA 3HUJE 2PYEB 5FLUA 3E8UL 2SEBA 4P5TD 4M4RA 5DVNA 5M94B 1Q1JL 4OTXH 1QR1B 1BZ7A 4CMMA 4XRCB 4MVBD 1PSKH 5DUBB 1JNHB 3VRLE 5AVUB 2B39A 5BW7A 2R0KL 1WUZA 3D25A 3OAZK 4N1HB 1UGNA 4WDIA 3ROOB 3SDXE 4OF8A 5E8PB 1N59A 4L5FE 4YHPB 1IEBB 3SGJC 2NTFB 2FX8H 5I1GL 1F8TL 1KCKA 2ITDA 5C07A 3I74A 4K5OA 1YDPA 5FCSH 4Q7DA 1OOWA 3LS4L 4AH2A 1OP4A 3UTTE 4Y8DC 3BEWB 4KGJA 3N42B 1NAMH 2X6CA 4NKMB 1MFAL 4XZ4A 3QPQD 2OYMA 1CE1H 2LR4A 3MXVL 1CLYL 4HETA 4JRXD 2GY5A 1IC4H 4OJFL 4PRAB 1AOHA 3W39B 4ZG1A 4QRTA 2VH5H 4Q4EA 3WBDA 3G04A 3JUYA 3H9SE 3DOIA 5EORH 4N22A 4JG0H 4HWBA 1CR9H 3L3DA 3L9BA 3LMJH 1NMAL 3QHZH 4AYDC 4TQPA 2HRHA 1U8HA 1H6EA 4JRYB 1THAA 1ACYH 2LV4A 2YARA 2XXGA 3HIZA 1KGYE 2GJJA 1W72A 4LOVA 4O2FA 1X4ZA 2F15A 4JFXB 2AFNA 3QH3A 3ZE2E 4P2RB 1A7PL 4J3OC 4GBXB 3AXLA 2GITB 3QUXB 2ZNWA 5E03A 3DK0A 4TVPH 3HZMA 3LKPB 1BQLL 4X8GA 3DO4A 4AE1A 4FXTA 2KZKA 4YIQA 5C0FA 5GRUL 1D6VL 4C56A 2AXFA 2MHAA 1HDMB 5CEXA 4QOKA 1UCBH 3CLFL 4HIXL 4F2MB 4UBDC 2BVYA 3FT1A 2E59A 5DF0A 1R3JA 5EZJA 1GA2A 3VRJB 5JNYA 3BPNC 4G8EA 4LSQH 4IRSD 2CRZA 2YAOA 1WF5A 2PCPB 5HHXL 1U8OB 2WP3T 1NDGB 2CHDA 2QGDA 4FTVD 4EMZA 1GGBH 5TDNA 3VFNA 1OW0A 2NY7L 1ZGLB 3MLYH 1H3VA 4MNHA 4AQAA 3RQ3A 1J0HA 3IFOA 1UACL 5CCHE 4PJ9C 3S97C 1UXWB 3DX2A 1YEHH 1JTPA 5I74B 4JGUA 4PRPB 1M3IA 5H35B 5C0RH 4UQAA 5PCYA 1ZGLP 1C5BH 4DGIH 3GJFB 3LXAA 1RUKL 1A3LL 1FFPB 2GJRA 3CN1A 5I8OL 1MCRA 3OLEA 4QEGA 2VXQL 2KZWA 1CLVA 2C1PA 3W9EA 1T0NA 1F42A 1FFTB 3K2KA 4LCUB 3FQRA 4UDTB 4TSAH 3UTSD 1WFJA 4KITB 3UBGA 3LD8C 1MCOH 1CU4L 5J0BA 1KPRB 4BSVA 1JYWA 1XH2A 1WZLA 1SMDA 3KYMB 3VGEA 4ZMVA 1G9HA 4LDCA 3P0VH 3EO9L 1FDLH 1UM5H 3LB6D 4L37B 5JO5B 2I5YH 2NNAA 4RMSA 3FCTB 2IPTL 3DJ9A 4TSBL 2Y2WA 4Z7OF 1TVBB 2AQRA 5E2UH 3G6DL 3ZO0A 3BSZA 3C5SA 2F7PA 4NWUL 4LQFL 3TPUA 5DD3L 2GJZA 4QO1A 1VGEL 1QKZL 2FYYB 5KW9H 3G6AB 4DW2L 2AI0L 4Z7UB 3DBXB 2WKLA 5F6IC 2EDJA 2G0KA 3L3HB 4XN9A 2F8XC 2DMCA 3RDJA 1VCBC 2Z35A 4M8VA 2F53D 5E1QA 4JPVH 4C4KT 4TLSA 2KT6A 3TV3H 2K6WA 3VI3B 1QZNA 2ICWB 1NBVH 2X09A 4XOAA 5C0AD 2XWJA 4PJFB 3VSUA 1I3VA 1QI3A 4JRXE 4X5WA 3T08A 3T0DA 3O4OB 3Q13A 3VWKD 3C87A 4X7DC 3QE5A 4KXZH 4WUUB 5EOCL 5I30L 2E7DA 1JZ2A 4XPGL 3L5WA 3PHQA 4KTGA 3M46A 5DHDA 2R4RH 2XTLA 3IJ8A 2BRRL 1BFOA 1N0XH 2ZAHA 1HZKA 3UYRH 2QEJA 5EG6C 3L9YA 3VQ1C 4M6ML 1ODAA 2P28B 4OFIA 5TD4A 1SBSH 4S1QL 5FA3A 1I8IA 1N64L 1EPFA 1NGPH 3QDMD 35C8H 3BVVA 4XXDB 4XMWA 4F1ZA 3L7FA 5A3IC 2XZQL 2RTTA 4WTZA 5DA0B 3S48A 2X4PA 4MCYB 4NRXB 4P5KB 5IVZB 4GKOA 2BM3A 4H20L 4JPWL 5SX5K 2VKWA 1FL3B 2J12B 5D1QD 4YSEA 3IGKA 2WVTA 3THML 4X6DE 2ZCHH 3MV9B 2KBGA 1WFOA 2HKHL 3HMWL 1GYVA 2VCOA 2E76C 1SXNA 4DN3H 5CFHA 4FTVE 4I0KA 3U4EB 4N0RA 2X1WL 4Y4HD 3V5HB 1FORL 4X4ME 1JDCA 3II3A 2LFEA 1A47A 4K3HA 3ZDYB 1DR9A 2H1PL 4ISVB 4HCGA 1TMQA 3NJXA 3JT2A 3ZE1F 3BT0A 1HYRC 3SDYL 2R23B 4JY5L 4LSSH 1I7UA 1QI5A 3QJSB 3MO1B 4A6YH 1A9BB 1QVOB 1YN7B 3M1CA 3A67H 2D2CC 2XXFA 5C0ND 2EDEA 4OIBA 4YSPA 3LQMA 4ONGH 2GTWB 1ECZA 1SXBA 1BQUA 4GFXA 1RJYA 1TKWB 3U6RA 4MZ2A 5FYJE 5H2BA 3VXRA 1QRNB 3UTSE 4HUKB 1IGCH 4NC0B 2DQFB 2VDNH 2FDBP 4ZS6D 5B3JE 5KAQG 3EOBA 1P1VA 1JUFB 4MA3B 3WFBL 3DYOA 1CDYA 2VXVL 4RFNB 3ZHLA 1BD2D 1MREH 1ZSHA 1RU9L 3BKYH 4LNVA 5EEXA 2OTWB 3GI8L 4RGOL 1BM3L 2YGNA 3R7QA 4JFZL 1KLGA 3AZUA 4QF1B 5I1CH 3ZT7A 3CMOH 2BZCA 4OFKA 3OL2A 3U30B 2A3TA 3Q1SL 1G9MC 5I18L 5IHWA 4ETQA 2N1TE 3AT0A 3OJMB 5CSZA 3GSVB 1XHHA 3WTWA 4G8GB 5E9DB 1HZLA 2FEEI 1OY3B 2OMWB 3QUYC 1EA9C 1I7RB 3D34A 4M7LT 4DUVA 4A68A 4R26L 4U1JB 1NLBL 5A40E 1D5BB 2WSPA 3MCKB 3WNIA 3U25A 1SUHA 3TYFA 1AGDB 5CJOL 3G6JA 3L95A 3IE9A 3SPCA 1T0MB 4NRYB 5ABDE 3BIAX 3GXDA 1T4KB 1LQSR 5ITFB 1MAMH 2W07A 4B5ZA 4EXKA 4FQCH 2PN5A 1JPFA 1XVSA 5MENB 3P4OB 1CDBA 2NNFA 3ASNB 3QNYB 2Z1PA 2GHZA 1R5IB 3DTXA 4B9KC 4JZOA 4XO9A 4R3SA 2K7QA 1XZ0B 3CPLB 4G5ZH 4PJXA 4CC4A 1XO8A 3M17A 4ES8A 3QIBA 3MRKA 3D85D 2JSFA 1LO2H 2A73B 4L9LC 3SE4A 1CDUA 4NKDB 3JV4B 3N6YA 1GMIA 1A6WL 2H1LM 3TA4D 1MHHA 4PWGA 2ZX7A 1E3FA 4HCRA 3R1GH 4QHMA 3UO8B 4OZGF 4S0HA 4L4VD 2VDQB 3CFDB 4J3OD 1OGAD 1FYHB 1ZE3C 3II1A 5CIPB 2I9LA 1TNMA 5ENWA 4GW5B 4P46C 4RDQF 5AOMA 5KYXB 4HIIA 3F5WA 3RX5A 3NEXA 2K1MA 4QCIA 4XXCA 4ZBJA 1A02N 4MGXA 4KHTL 1L7TH 1FVEB 2YPKB 2PXYC 4X6EB 4GJTB 2B14A 1U8MA 5DLLA 1GGUA 2J4WL 2NY1B 5H37A 3QPXH 4GIPD 3FO9B 2WBJA 2CO1A 1QW8A 1IIKA 2A4ZA 2ZIDA 3ZY7A 1YNLL 3CFIC 4KKAC 1Z32X 4G1MA 3LHPH 5BZDB 2IANB 4WJKB 1VEOA 2AJSH 4XN4A 4MX7B 2WXLA 2GEQA 5DSCB 5FFOA 4PJ9D 2WOYA 4HZ1A 3KPPB 3NIFB 1TVDA 2FL5A 2PW2A 4JFWA 3CSBA 5IGXL 3HN5A 2R0LL 5IZ7A 1RZIB 2OMZA 5J6SA 2RQ8A 4HV8A 1B2WH 5T5FL 2AVFA 1JPGA 3RPIB 3V0VA 3GUTA 3LRGA 1M6OB 4H7VA 1J8RA 4QGYA 3U1SL 3FRPG 1JVOA 1DSYA 2XFXA 3DXAA 4P2QB 3C8HA 4P5SA 2WTRA 5IOPA 1Z5LB 1KIRB 4ZSOB 4N8VA 4A7TA 1R46A 4RIRA 1RZ7L 2H8PB 2P7TA 2E4FA 2PYFA 4EXPX 1ASOA 1BD2E 5B1JA 1J9SA 3W0WA 3X3GL 3O2VH 2QELA 3S4SA 3HS0C 2HG5A 1U8PB 4CGUB 5JW4Q 3S3JA 2B59A 2QMJA 2DQGH 5IB5A 4WENB 2BOLA 2Y5EA 2NY4B 2FSDA 3S5LA 1MDTA 1HWGB 2CGRL 1K2DB 4WCYH 2EIZB 4UT7L 2QV2A 3ERXA 4D94A 1ZD6A 2VLKB 3R7RA 3TJPA 3DRTB 4OQ1A 4BSWA 1G7IB 1RZGB 5ACLA 2NTSP 1J0JA 5HJ3A 3VW3L 1Y0LA 4MNGE 3QWRD 2ZOKB 1NFIA 2X2JA 1J11A 5EMYA 5TFSH 4D9LL 5CKAA 2H2PC 1MCIA 2MSPA 2LLLA 3AQZA 2IPUG 2WNGA 4XNMB 5EPMA 5EOCJ 5I24A 2CPCA 5IMMB 4WSJA 4NUJB 3SYPA 4BH8B 4UQ9A 4OKDA 3OSVA 3CFMA 4AXWA 4DKEH 4U3XA 4JB9H 2CBTA 4NQEA 4LASL 4AIOA 4EKJA 1RZFH 2NR6C 4HPYH 4QTHB 1NIEA 3PUCA 3PGCB 3ABLB 4KI5C 3PF2A 5I23A 2KS0A 3TL5A 3W9DA 4F91B 5TE4H 4DQOL 1BQHB 3MNVB 2DDQH 3CAFA 3MRPB 2PPFA 3UGEA 1IBGH 4G6ML 3WTTA 3DX0A 3MGAA 2MOGA 5FYLE 4LLVA 2ZJSL 4B50A 2QGEA 2UXTA 3HVNA 3KCPB 5KZCD 43CAA 4E36A 3O3BB 1D9KC 2A74C 1WFNA 1H8LA 5A3ID 4LHUG 4QHUA 1SLXA 2J71A 3E6HA 2JJVA 3T6ZA 1XT5A 4PRHA 3BXNB 1JXJA 2FJGA 2CLRA 4TUUA 3UYOD 5DRNA 1M1XB 1TQUA 2ZF8A 2X4TA 1JIBA 4X0KA 3GSRB 1RIVL 2WXOA 1SXCA 3OHXA 3T0EB 4BFRA 1MCJA 1GJWA 4HUWB 3AROA 1FC1A 3CFKA 2F74B 1I53A 2CDFB 1NAMB 5SV4A 3TJEH 4BFNA 2VN3A 4Q9RL 1T7WA 4GSDH 1U21A 3NIGE 2FJHA 2N4IA 3VTTA 2QZ5A 4G9DB 2EUXA 3P2TA 3VM7A 4JE4B 1WVZA 4IU3A 4MB4A 1VSCA 2XC8A 4WJG3 3MRMA 3JT0A 2AJUH 3CQQA 3OM3B 4JJOA 4ZMQA 1QHOA 2Y5QA 1MIEH 3WIIL 4GQRA 3X12B 4OZFH 3ZDXF 3EFOB 3ARFA 4PRNB 5EULV 1IGMH 2ZG3A 2J6EA 4K94C 1XGRA 3SDDB 3WO4C 1T2QH 4JY6A 5I5IA 4XNYH 4XPAH 4BZ1H 3X3FH 2X1PA 4C4BA 5CLWA 1L9MA 2OZ4L 4JHWL 4AZ8B 1ZV2A 4OZHE 1DQJA 3NZHH 1P7QA 4B5EA 2ZSWB 1E27A 3KEDA 4W9LC 5IEHB 4CC1A 3UO1H 2Z31C 5J1SC 1JNJA 4B9ZA 3B7SA 5TH2B 4N2IA 1ZEAL 2OMYB 2Q7NA 3T65B 4XI5C 4BXVA 2WB7A 1FE8H 4F27A 1R4XA 5CD3B 3VD5A 1XF2A 1Q0YL 1W91A 5DI8B 3RGVB 3NRPA 3QUYD 4QTIL 1AGBB 4BK5A 1WWWX 4MCNA 4MQ7A 3TIEB 3B3IB 3IDGA 4PN6A 1D2PA 1FL6B 3E38A 3LEVH 3EJQA 1QQDA 3VSTA 4HZLA 4XN1A 1PQZB 2ATPB 2J8HA 3GSXB 4MD5A 4ZUWA 3ZU8A 2CLVA 3DSNB 4IBZA 5FW7A 2Z7UA 1I3RA 1KB5H 1PVHA 2P1YA 2R1WB 3HHSA 6TAAA 1AE6H 1OT1A 3K6DA 1KYFA 2CRMA 1YNTB 3V0WL 1IC5H 1IQDB 1T1WA 1B4JL 3KNBB 2OM5A 3MFGB 4Z3EA 2OMXA 3QEHB 5D4QA 5EU6B 25C8L 5TK2A 4FQIL 4KTYA 4X6CE 3S88L 4LK4A 1JF1B 1F5WA 4KMLB 4H8VA 4S1SH 3L4VA 3O6FA 4X6BB 4RAHA 4YDLC 2DTML 1GGIH 4FZ8L 3GRGA 5CHNA 4A1RA 4FOMA 3ARBB 4L05A 2Z65C 1KXHA 5DMIL 1E90A 2XN1A 1WCBA 2EYRB 1VPOL 5KVGL 3MR9B 1GHFL 2AS5M 1Q72L 1UD8A 2AK4E 2MKWA 2OSYA 2VTFA 2VRAA 5F70A 1AO7A 5IVNA 4GBXC 2PP9A 5DVPA 3QUXC 1VDGA 4U6HB 2PMZA 3W2DH 4N9OB 1G5GA 2D7MA 3KPMB 5DQDH 1ZHKA 1FG2B 2EXTA 4LXFA 3TO2B 5IFAH 5MI0C 1UKSA 3DVGA 4P46D 2XETA 4RZCB 5TQ2L 1NAKH 1U9KA 2B20A 1RULH 4JPKH 3VXMD 1GOGA 4UTCA 1A2YA 3MLZH 2PXYD 4XBGB 5M7QA 5DJ0A 4BFJA 1HHIA 1BEYL 4GP5B 1T66C 2QQLH 3NDZE 1NC2D 4HX1B 2CBQA 5HXMA 1EUUA 2V7HA 4PYGA 3PL6B 4ELMF 4KKAD 2APVA 1MWAH 2CO7B 4NSKA 4X42A 3TBVB 5B21A 3MI6A 4OF0A 1ES0A 1TTRA 4E41D 2OXHB 5EC1B 5DD5L 5ES4B 3VFRA 3ZDZF 5GSVB 2R83A 2DIEA 4GKZB 3DX8A 5I74C 5EV7A 3IJSA 4AVJA 5EO0A 1KXVC 4JFFE 1DO6A 3M86A 1YEKL 4M02A 5KSBE 3CXHK 1D7DA 4PJCB 1A3ZA 4WW1A 2P5WE 4ZUUB 2IQAB 2Z0BA 3S5YA 4AUYA 5I1DA 5EZLA 5I6NA 2YEZA 1HSBA 1KV3A 5K9KB 2NY0D 2R69H 3FHEA 4W6WB 3FB7A 1G9ML 3BD4A 5I8KH 3NP4A 3O2WL 3TZVA 3OJDB 1JPST 2CA3A 1JNLL 2OA9A 2HKFH 3EADA 2PABA 2W60A 3MBEA 3SE8H 3SZKC 4IOSA 1CYGA 4ZW8A 5I1LA 2AXWA 1AXSB 1I8LA 4HIEA 4XVSL 1RZKC 4EUPH 2K7PA 4P57A 4MAYA 4Y1SA 3VI4B 1BZOA 5JOEA 4AQ1C 3HPLA 4M9OA 4KQ3L 3R4DA 4RMBA 2AQQA 1WAAF 3L3GA 2CA4A 3EYFA 2ENSA 4M5YH 3PHOB 3RWFB 3SJVB 4HXBL 3L8QA 4U6XA 4DP6X 3AS3A 4AENA 1DUZB 2DWXA 4E9RA 4LLDA 2P5EA 1C16B 1WDAA 3TU6A 2YD1A 5KSAA 1INQA 1Z0NA 4OF3A 4K2UH 4XN8A 2DWEA 4LOUD 1KXTA 4NQCA 4FQLH 4YLBA 5KYUA 1P9MC 2XKSA 4JDTL 3WMQA 5SWSE 4J23A 3LKOB 4BRVA 1ZT7B 2EE9A 3AITA 2D3NA 5A16B 1DLHA 1EIBA 1Q8MA 1LNUB 2EH8L 1Q9LA 1P2CB 2QJDA 2EDRA 1AZVA 4EVNB 1OWRM 1S5HB 2WLJA 2COQA 3C08L 4U31A 1IM9D 2K8QA 4RSVA 3C09C 4L4TA 1QD0A 3ELQA 1H8SA 3ZYZA 5IJVA 4Z7AA 1K5NA 4MRCA 3HC0B 4I1PA 2NY2B 4Y9GA 2EDNA 1U30A 2A4EA 3KWUA 2IC2A 2NR6D 3O4OC 1S7SA 3WIHL 4A6YB 4X9FA 2NX5D 2VMJA 5L4JA 1LEGA 1DO5A 4TUOA 2QKIB 2JKSA 4XWGL 3IEAA 3PU7A 1J5CA 2F1EA 1BQ5A 4HGMA 4ZI8A 3NIDB 2RFXA 2Q9OA 1OK8A 2X89D 3WL9A 3EYSH 5TQ0H 2MKLC 1Q9KA 4FTDA 2HJLB 3TO4D 3P77A 1AJ7L 3C5JA 2FIKA 2VDNB 5E6IA 1TLMA 4TRPL 3IXAB 3DJRA 5FGBC 2OR9H 5D1XA 1I9JL 2VUOA 1E43A 1JWUB 2A9DA 1D9KD 4JFED 4J6IA 3QQ3B 3WTSA 1AXTH 1ILUA 1HHHA 5FCUL 5AVSB 1P7KB 1L9RA 2HTLC 4MXWL 5I15L 4ZNEE 2HJFB 3FOLB 3OZ9H 5IUCA 4QRSA 1AC0A 3VFUA 4NNXB 5JDSB 1B0RA 1M7DA 1WZAA 2WQVA 3MXWL 3V8OA 5IM7A 4N85A 4TS6A 3MNWB 1EO5A 4UOW1 5IUSA 5KS9A 4D0BA 4X2UA 4QRUB 3V6OC 4QPEA 3SYCA 1OE3A 1NBCA 4NJAL 4P2CG 5B39G 1L6PA 1ZANH 1KG0B 3WKMH 1XGYL 4B60A 4ANXA 4Y9BA 2YD6A 4XVUC 5KSUB 1JGVL 5IROA 2A83B 1C1EH 4AT6B 3NUKA 3ARDA 1NKGA 2OSXA 3CU7A 4DKAA 2VXUH 3CH1A 1AAJA 1HEHC 3WJLC 4R96A 3HG2A 4I1NB 1TQCB 5LNEA 2VO8A 1F3RB 2C5DC 3LIZA 2VM9A 5F7UA 2K4AA 2IGTA 2VR9A 3SQBA 2KQNA 3H9YA 4GRLB 2BIMA 3WFHA 1A7NH 5F7BA 1OAYL 2WLIB 3EH4B 2XZAL 4PJAE 4MLIA 3ZSTA 4WVRA 1MLCB 3O4LD 5BS0E 4KO5A 2O5XH 1U3JA 3REWB 1OCZB 4Z7OB 2HMIC 2EDFA 2AQPA 3L1OH 2YLHA 2Z31D 4ZO9A 3BZEB 5HHMD 3W81A 2H26B 4XP6H 1QEXA 5AW7B 5JPNB 1PFCA 4XI5D 3OBAA 4TQ8A 3I9AA 4JPIB 4FFZA 2OMVA 3GHBL 2UZXA 1MI5D 2DL2A 2XQYK 3AFLA 3TCTA 2AQ3A 4N2FA 1IKFH 4G42A 1X3DA 3QZWG 2TRYA 1OQOA 4KOBA 2IXQA 4PSRA 3F7RA 5B7MA 1QFOA 2BNQB 3K6IA 5GJTH 1NCBL 3FTGA 2F7RA 1SLVA 4RCAA 3BRFA 5DR5H 3GXTA 4G2AA 4DOHE 3V4UL 3VD1A 1J8HD 3AU0A 1HI6A 2D3JA 5EUOA 4Z76A 4PJIF 3S34L 4ABUA 2HWZL 4B9FA 2R56H 3FB8A 2LOEA 3STLB 5E8EA 3CGTA 2V2WA 4LFHD 5LGHL 2DQJH 5F7YC 4IYKA 1UM6H 3K2UH 3SDAD 4GUPA 4X7SH 2AGJL 5DJAB 4KQ0A 3KE0A 4KI5E 2J5LB 2OI9B 2WW8A 4DO5A 3NCXA 3VAEA 4LL1A 4YVNA 1IL1A 1B0WA 3EGSA 3JV6B 4QUOA 5KG9B 3FOMB 1BWMA 4KXAA 2Z91B 3CIQA 3G5YB 3QA3A 2ORBH 3SHSA 2WWKT 1LYQA 1EJOL 1UYWH 1VFBA 3LH2L 4GMSH 5ALCL 4QT5B 3V0JA 5PAZA 2X2IA 3L3JB 1BZQK 2E5EA 3GEFA 3IPBA 3L3IB 4KROB 1VHPA 4M6OL 4QIRA 3AS2A 5DZPA 1L4IA 4L18A 4H40A 1HXMB 1YEGL 3PQYD 1E9QB 4NKOB 4HW6A 4O02L 4ZPTA 5MERB 4PJGB 5ACZA 3TEZA 1NCCH 1V3KA 3UH8A 2Z4QB 5DJZA 3LVEA 2XN9D 3T0BA 1AIFA 3BQUA 4N8UA 4X80L 5KN5B 2BNRD 2J3SA 4NYLA 3OX8B 4B53A 3VFMB 1WE5A 5EU5B 1QO3A 5D2LF 1Q94B 1T66D 3WGVB 5GGVY 1NEZG 1FF5A 1QPPA 2J8UF 5DD1H 2MH4A 1BVKB 4OD3H 3BJ91 5BO1L 2WC7A 1FVCB 3PHAA 4G6KL 4KTDH 4XCEA 5GSRB 2O4EA 4LDOB 4PJHB 3FONB 4NDMB 2KDGA 3JTSA 4YGVA 4K94L 1HEJC 4YUEL 3ZTNL 4F3FA 2R2CA 4AQOA 4HXAL 5DHEA 2BWQA 2MOVA 3FUHA 5KYYA 1T83C 4MMZA 5JQ6L 2XQ0A 4Y2LA 1LL1A 4B3VA 3I75A 5HGHB 5IW6A 2IGLA 3QDJB 1U6AL 4F9LC 3TBSA 3F6IA 3INOA 5FS5A 3QWOB 4F8PA 2PWDA 1S3KH 1TZIA 4XRCA 5BCAA 5DUBA 5DVLA 4PRID 3ZGIA 2D7NA 1CGYA 1UC6A 2B2XH 6FABL 4OQTH 1DBML 1N5AB 4IIQA 4XWOD 5FO7B 2MCG1 1SVZA 4LCYA 4YHPA 4DPCX 3O4LE 3D33A 4BZ2L 3RAJH 1LJMA 1OZTG 2YPLD 2P43B 3CVCA 2A6KA 1WISA 4BCZA 4CVZA 2F5BH 1DN0A 3A6BH 3EJSA 4P2OA 2PYEE 1WFUA 4F7TA 3O3DB 1HEZB 2HUEA 4OR1A 3IGLA 1COBA 2PWFA 3KJ6H 4PB9H 2ZCKL 3SZ6A 1ZXKA 1ZT1B 4PRAA 4LVHB 1DE4A 4P4KA 1UB5A 3FT4B 5I8EB 2D0GA 1KT2B 4I77H 3MRLB 4XT1C 3QXAA 5EIIG 1IFHL 4AIEA 4PGZA 3KPSA 3C6EA 1UQSA 4AUUA 4ABQA 3MGOA 4PJBF 2R2EB 4IBLT 4TVUA 4Z0XB 3US0A 1J8HE 3P0YH 4GSQA 4DGYL 4P2RA 2AP2A 2WYZA 4DP9X 2DJMA 1DANU 2J7LA 4PMFA 1QA9B 4ZTOL 1UB6B 4JRWA 2NOYA 5EU3B 3P3UA 1E6OL 5I76B 3E9UA 1UKQA 4U49A 2X2YA 1LO3L 4HT1H 4Y4FD 1A9EA 2G5BB 4ZFFA 2DKMA 4TYUA 1UHVA 2BY3A 2XWCA 3L5XL 4N0UA 4OZFB 5EBWA 2VXSH 5BOPA 4JX0A 3T1WA 1G7LB 3LV3B 4JRYE 4WLCA 1RUQL 2GB2A 3IU3B 5BMFL 5HBBA 3EOTL 2BS8A 4M93B 4RETB 3UP1A 3LZOA 4PY7B 2YAMA 1PZ5B 4ELMA 1B2YA 1NDGA 4PJDB 2ENYA 4LLUA 1KCWA 2JKXA 1HE7A 4DK5A 1DLFL 3PQYE 3OMNB 4LEBA 1DYZA 5KAQF 3VH8B 3UERA 5HVWA 1UXWA 5DU7A 5I73C 4PRDB 2HTLD 5H35A 1UA3A 4U3HA 3ZMNA 4WFHD 3A3YB 3CZSA 1XQ4A 5C3TA 1MHEB 1DJWA 4P4RA 4UM9B 3QFJB 4WI5A 1L6XA 2IDUA 3GJFA 3FQXB 4DKTA 1X7TA 5HHOA 4F2ME 5JPMB 2IO5A 3BKCH 3MCYA 4PJ7A 4H0IA 4FLOA 1NMBL 1XR8B 2WKOF 4G11A 4O2EA 3TYGH 1NGZA 1AQKL 2OTUA 3VD9A 3Q0HA 3SE3A 4JDZA 4UDTA 4ZPVB 1PZ3A 1KB5B 1PYWB 1ZHNA 1OF0A 3BSHA 4G7VH 3BVNB 4Z3HA 1S7WA 4LCWB 1K4DA 3AWFA 2EDYA 3QXDA 1QSFD 3L2NA 4B7LA 4PRPE 2BOBB 4MAUL 3W56A 4DN4L 3ULUD 1RUAH 2X4NB 1JWSB 1J5HA 5JO5A 3KH3A 1UH3A 3HE7A 3UADA 1TJXA 4PS4L 1TVBA 1E4XL 1QG3A 5CEZH 2IPKA 3QS3A 1AD9B 1FSKC 1MG2C 4XP1L 4Y4KA 1WAAA 3K1KC 5C0BD 3V0AC 3AREB 1NL0L 1S7UA 3JV0A 4M48H 4GS7B 1BYNA 3QHFH 3UAEA 1HH6B 2OQJA 4FFYA 4PRIE 5I2IB 1AI1L 2PR4H 2X38A 3DECA 4Z7UA 3SYAA 3HZVA 4YC2B 1M7UA 1Q4NX 1T6BX 3HR5A 3ECWA 5EZOH 2HMID 4UV4L 1OCRB 2YPLE 4DKFH 2AW2A 5T1DH 2W94A 1DVTA 1MWOA 4Y2DC 1ETJA 1CT8B 3LZFL 3E6FB 3UBFA 2OMUB 3V6FB 4L29B 1E4WH 4L3AA 1KB9J 1BBDL 4PJFA 4PSPA 4DQAA 1EFXD 3QIUC 1FP5A 5GRXG 1KFAH 1H15B 2BXZA 2K9UA 3GMQB 4XP4H 1RK0B 4RBPK 2OMNA 1MWAB 1L7IH 4I48B 2X3CA 3L4UA 5EF3A 2G9HB 2Y7LA 2KUTA 2O5YH 1DQKA 1XF3A 2GW5A 2XVLA 1SDYA 1X5XA 3FRUB 3OZKA 3UJTL 4BGDA 1BJ1H 2HLAB 2VUKA 5CUSL 1JSYA 4CVWA 3PUUA 4TUKH 2A77H 1J86A 4IOFC 2H32A 1MSPA 1CF8H 1UADC 2H9GB 1MRCL 2ZE0A 1O7SA 3FU8A 3L4YA 5JUEH 4NJ9H 4JCWA 1QFWH 3VI3E 4BKLB 4WWPA 1WBYA 1EGJH 3V4PL 4JM2B 4O4YL 3UABA 5C07D 3ROLA 2GC4C 2ZYSA 4S1DD 5AQ0A 1J10A 5IVOA 4WUUE 5AOLA 1MHPH 4N2CA 2CU9A 2PW1B 3CZUB 3CDCA 1IC0A 4OJDH 5DHVB 3FU7B 2XVGA 3T6WA 1TENA 1A7OH 4ZMYA 3GS0A 3ARBC 2JXMA 1UA7A 1FL3A 4LCCB 1I9IL 1JDDA 3HFMH 2VN5A 4RRPG 3D4ZA 3KXFB 5EDSA 2ZPKL 2N56A 3H3PH 3VNZA 1TJGL 1MRDH 4WKZA 3Q7JA 3NFSL 1MCPL 1V27A 1JVLA 1HQRB 4EUPB 1HYSD 5A2AA 4DJMA 4Y2OB 1HHJB 3U4EA 3NT0A 2ZAGA 4NUMA 4DP7X 4WU5B 4LKCB 4HK0B 4OM0L 5EOQL 4RFEB 4JFHD 5DRZB 2WCGA 3U1PA 1VKXB 4NXSA 5KYWB 2EXSA 3O8XB 4Z7QF 3B2PA 1VGKA 2O6FA 1UWXK 3C9NA 2Y36H 2R23A 3ULUL 3MO1A 1FGNL 4GXUM 4GKSB 3AABA 3V4VA 3ZL4H 1MZZA 4BFKA 1D5IH 3KL3A 5L9DL 3S8GB 2ZXEB 5CGTA 3GM0A 2GTWA 2EINB 2MQ3A 3MV9E 4N2HA 2EE0A 1WA1X 2PCXA 4XB8A 1IJNA 3V6OE 2Z93B 4C56D 3BC9A 5D7LD 3G5XB 4QOKD 2IALA 2DQFA 3FQ2A 4ZDHA 1XSOA 1HU8A 4WI7A 2FHFA 4G7SB 1MJ8H 4PJ8B 3ZDYE 3SE9H 1FL5B 3V7MA 3HI6L 3DHUA 1QSFE 4ONOA 4A2DA 1J5IA 4F93B 2CRYA 1I3GH 3BFWA 2IOIA 2P24B 3OQRA 4OZ4B 4E68A 1N2RA 1MCNA 3H55A 3CUPA 3MLTA 4LEOB 1CXHA 1MRFL 4JREC 3WSQH 1U93B 1VZIA 2ICCA 3LN4A 1SYVB 2BRQA 4QRPA 5LCVA 3EJPA 3DPBA 1QRNE 3CD4A 3MMEB 3S37X 4U1JA 4FJYA 1R1CA 4E9TA 2KMWA 5I1KH 3MV8D 3C8DA 4KUCD 5D2NC 3WIFA 3U0WH 1M05A 2HN7B 1KTDA 5BXFA 1T4KA 1X5GA 4WO4A 3UJIL 2EEDA 1L9QA 3OKEA 1IM3A 3A4AA 2R29H 2DH3A 1NM9A 3BWSA 4HAFA 4PJIA 3EKCA 2PPDA 4GMTH 4KVPA 5JHDB 1KELH 5MENA 2Q2EB 1K6QL 4D9RE 4XXWA 4G8GE 4MNQA 5E9DE 4HC1A 3X13A 1AQDA 4EI5B 3MUZ1 1U8NB 4JG9A 5GISH 1U8LB 1OAQL 5LO7A 1HILA 1KN4H 3UCQA 5KVFE 2XY1A 1TPXB 1TTBA 4P3DA 1HVXA 2A6JB 2A73A 2G2RA 4AC4A 4CADA 4B9CA 3ZHFA 2YMXH 4HWNA 1CG9A 2DQHL 4LPXA 1OGPA 1EVTC 1UJ3A 2I32A 2E75C 2H6PB 2YD9A 4NKDA 1AGEA 5SX4H 3SGKA 1KIPA 1G6RH 3RX8A 4HWBL 4R4BB 3FQUA 5D7IE 4J6RH 5TE6H 1PY0A 3QIWB 5FHAL 4N86A 2H3XC 1PBYA 3FT2B 3MTRA 5C07E 5BOZG 2DQEH 4L2LA 1T1ZB 1H6TA 3PS6A 4JY4A 1W72L 3R8QA 4HIJB 3ZIYA 2XTJC 2NCEA 5D2LA 2F19L 1EMTL 3EFFB 3LS5H 4AGLA 4X8JA 2YBGA 4HG4K 2X7LB 3GFUA 3FHQA 4RZKA 1CBVL 3MRIB 4WGVB 2J8UA 5ELIA 1KV7A 1UT2A 2XVBA 4YSSA 3TBCA 2J56A 3Q9QA 3QI9B 1HQ4B 4KMTH 2TAAA 2ZWZA 4MX7A 3ESMA 5E2JA 5C9KA 1XMWA 4NN5B 5DSCA 4L8DB 5DGRA 3GSNA 1N6UA 3MJ7A 3C6LA 4QRQB 3VD3A 2O72A 3G3LA 3J2PA 1P84J 3KPPA 3V52L 1KTKE 3CSGA 5DRXA 1AYRA 3FMGH 3NQKA 4U3SA 2X1XR 4HLZH 4B9IA 3HRZC 2FZ3B 1RZIA 3WXWH 5FA4A 4XPBH 1EBPA 2I85A 2DQMA 2QL1A 4Y7MA 1A7RL 3CXFA 2DTSA 3B2VH 2IANE 3HB3B 4XODA 1BBJA 3VFWB 5CP3A 4H25B 1A3RH 4MB1A 5D7LE 4YHZH 4H8WH 5DZ9A 4BDVA 1DN2A 3JWDL 3A23A 2DEXX 3O11A 2CRIA 1YSOA 1N8ZB 3LKRB 3NQIA 3NIFE 4I0CC 1N8OE 2ZXGA 1CGTA 1KBWA 3IDMA 1U8PA 4XN5A 4M1DH 3S37H 1TQCC 3PWPA 5F0JB 2ENJA 4MDIA 5IESL 2NMSA 3CFJB 1JAEA 4Q56A 4YNYB 4LSUL 1J1OL 2GC7C 2XN0A 4LKXA 4GRLC 2VLKA 4P2QE 5D7JB 3DRTA 4OFVA 2NNRA 4AMKH 4AMXA 4XO3A 4NRZB 1G7IA 4ZSOE 4Z77B 4ZS7L 4D7BA 1NFAA 3KVPA 2DV6A 2NXYB 4L3CA 2VC2L 1MKFA 4YFEA 1KPUB 3MV8E 1I7TA 4PVMA 1UWGL 2ZOKA 3OKKA 4AGNA 4AIZA 2R8SH 3TV8A 2RALA 4LDLB 3Q1EA 1LP9B 4AQ8A 2CALA 1ET8A 3BSZL 3BP4A 3B2DC 4JQVC 2ZAIA 4UQDA 4Y2DD 3VSQA 3VXRD 3KWVA 1CUOA 1J5DA 4XMPL 5LBSH 3I9GL 1CJYA 1S7QB 3HE6A 1DZBA 4EI6B 4UOZA 3ABKB 3NPSC 1HK6A 4QTHA 2YD7A 2EDWA 3V7AE 3QIUD 3PGCA 3WJJA 3UZQA 3C5ZA 3CCHB 3D30A 5HHVL 1HH9B 2XA3A 3B9KA 2MQGA 1IAIM 2VMDA 4F5CA 5FUZH 1T1XA 4Q52A