3QIUD

Crystal structure of the 226 tcr in complex with mcc/i-ek
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
242
structure length
238
Chain Sequence
MKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPADSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 238
sequence length 242
ec nomenclature
pdb deposition date 2011-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuD01
5T1LA 2F54B 1JL8A 1MCOH 4WIQA 4G6AD 4POYA 1FIGH 4X0KA 4UU9B 1P9MA 5GGTA 3SDDB 3T4AA 1JGLL 4PJ5E 4PV9B 4RAVB 3G5VA 5F6HI 3DXAD 4MVBC 4PJ8C 2QSCL 3UBXI 1Q0YL 3S96B 1RUPL 4RQQA 1KG0B 5FUCE 4NBZB 4MHHG 32C2B 3HNVL 3MRBB 1OTTC 3L5JA 3NCFB 3FQUB 3VWJD 4HS3B 3W9DB 1NBYA 1NL0L 3DURB 5I1HL 1YNKL 4Y5YA 2W0LA 2ZUSA 1F6AA 4X80L 2MPAH 1INEL 1DDHB 1KN4H 2UWEE 1A6PA 3REWB 3VG0L 5GS1C 2YEZB 5D5MF 4PGBB 5EZJB 4XC3L 1KB5L 1XF2A 1OPGH 1MHCA 2MTPA 4JFFD 3EGSA 4DCQA 3HE7D 5ICZB 1CGVA 5IGXH 5E70A 1XR8B 1BEYL 5GGQH 2I25N 3RVVC 1I9IL 2IPTL 1MI5B 3QNXB 2NYYC 3WS6C 3TC9A 3BPNB 4JFHE 2QLVB 4JY6A 2F54D 1JTPA 5L2KE 1T21A 1NAKH 5L6YH 2X4PA 1DUYB 4H26B 4KRPB 1URLA 3P9LB 3BKJL 3VJ6A 5DJ6B 3SDCB 1RZJC 2NXZD 2EDOA 5J3HD 4PP1D 1KIPA 5IK3B 3RPKA 3CX5K 1IM9D 2V2XA 2B0SH 3IXAA 3QZWA 4OD3H 4AEIH 1IFHH 1K3ZA 2ICEA 2QADB 3GMNA 5E2TL 3RZWA 5JR1H 2XZAL 2YPLA 4L4VE 4WHDA 1CLCA 4XXDA 2P5EA 4I4WB 2VXUH 2GTWB 3BUYA 4R3SA 1L9NA 3M1BA 4M61A 1OAZL 2BDNH 4XP9H 4CU6A 3CVHH 4YPJA 2ZOKA 2HJKA 2ZUQB 1A6AB 3QCTH 1U8QA 5FM5O 5J13B 2UWEB 1RU9L 4FQLH 2MCG1 4Z7OF 5A1AA 4M43H 4NZRL 4Q7DA 3L3KB 4PJGE 2J1KA 3ZL4H 1UG9A 3QEQD 3K81A 2AXGA 2PUQT 4OD2A 4Y4HA 2ESVA 4KDTC 1F11B 5EU4B 4NYLB 1KCVH 3OB0K 2OJEB 3PDOA 3T1FA 5EU5A 1NCWL 4GXUN 2CDGA 4JCLA 1I7RB 4KQ3L 5L2KB 3ZZ1A 4HBCL 1T0PB 1Q0XH 3JWOH 3V0WL 4PG9A 3K74B 3PP4H 3QQNA 3QWQB 4MNHA 3O8XA 3TIEA 4YX2H 2GAZA 3FAXA 5GGUB 3TO4C 4O4YL 4JPKH 1I1AB 3X14B 2JJSA 5HGBB 5HVHC 1G6RB 4X7SH 2FD6H 4LEOA 4MAYB 5DRNB 3DUUA 1F3JB 3ULVF 4F7EA 1U0QA 2CIIA 5M7QA 2GEEA 3SKNB 4L4VB 3ZE0E 1PG7L 1OAKL 5D7IF 1LEKB 4HPOH 1AFVL 2C3GA 3QUXC 2CJUL 3GI9L 4N0FB 1C5BH 4RGNE 5DO2D 4JFOA 5FO7A 4KMTH 4NNPL 1UVQB 5DJYA 2CQVA 4ODSH 2BY0A 1DQDH 5E95B 5AYQA 2GCYB 5FXCH 3W11D 1S5HA 2IANA 1AKJB 5KOMC 3W39A 3C5JA 3FB5B 4PJGB 3GMPB 3KYAA 3ISWA 2XNAA 1JZ3A 1IT9L 3MJ7B 2WWMC 1XCQB 1YN7A 3BYYA 1M7DB 5JQHC 1N7MH 1AD0B 1QO3A 2LVEA 3OQ3B 1KB5B 5TE6H 3H3BC 1VEMA 2FIKA 4K8RC 1CU4L 1JNNL 1TVDA 1JHLL 3ALXA 3C5ZB 1FG9C 4L5FL 4YDVB 5HDBF 2QBWA 5DA0B 3VRJA 4Y5VC 5INCA 4OCRH 2X4SB 1ZS8B 1I1AD 5GPRA 4HK0B 1XGYH 1MSPA 1KELH 4UNUA 4KVNL 5F1SA 1HI6A 4PJFE 1VKXA 3VFWB 1XGRB 2NR6C 1UJ3C 5JHLL 4FXKA 3TN0D 1VACB 4LIQE 2QR0B 1LE9A 4YBQC 3BSZH 3L5XL 1NDGB 3B9KB 4HZLB 3SHSA 2X9YA 1NCNA 1R3HB 3MRIB 1IGFL 1R0AL 1HKFA 4UT7H 5EZIH 4TUOA 1MFBL 3MLSH 1JZ6A 3MRRA 3HI1B 1OSZB 3KXFE 5K9OA 2APVA 4P4RA 4C4KT 4GAJL 1OGAE 3MJ9L 1NGQL 1ULVA 4L29B 5C07B 1FBIL 1T5XA 4O5LH 5CIPB 3GSUA 1QBLL 2GSIA 1JF5A 5DLML 3T0EE 1YECH 4ZAKC 5JIPA 3MNVA 1S8DA 1MUJB 4CMHB 4HWEL 3CFKB 4HH9B 4KKLC 4LHUB 2AXFB 4HHAA 4K3JL 4AEHH 3X3GL 2OBGA 1IZJA 2Q7YB 3GNMH 5I1LA 1JGEB 5DHVA 4EI5A 3G5XA 5FEBA 1Y6MR 3LMJH 3QUZD 4YHNA 1ITCA 3FFDB 1IGJB 4X98B 3SGDH 2VKXA 1ZGLM 4Z95H 3FKUS 4JHZA 1NC4A 1JGUL 1K6QL 1TPXC 1AJ7L 3UTTD 2XPGA 2H26A 4JY5H 4JFQA 1CR9H 4OAWB 3DX8B 4GQ9L 3CDGB 4JN1H 1MIEH 2AV1A 4DKDC 3B9KD 4PP2B 1DBBL 4R4NC 3S3SA 5IJKA 4PJEA 5JA8B 4PJFB 3QO0B 1U8LA 5LXGH 1FZOB 1M7IB 1JRHH 2P8MB 3S37H 3C8KA 4AM0B 4EBQH 2DDQL 1N8ZB 4QHMB 2OZ4H 3P0YH 4KC3B 3ZKMC 5GSVB 4TNWF 3D69A 3EO9H 4OTXH 3BXNB 1BREA 4C55A 2R69H 3SKMB 2DQEL 3BVNB 3UAJD 3KXFB 1MNUL 5DJCA 3IKCB 3L3HB 1IL1A 1G7IB 1OGAB 3AAZA 3EJJX 3BO8A 2R1XA 4RMTA 4U1HB 3NZHH 1UADC 3TF7C 1P7KA 3D0LA 1A2YA 3X13B 3AB0C 2PF6A 3BI9X 3T0EB 3BP4A 2UWEF 4LFHD 2VZTA 3BE1H 3GHBH 3TH4T 4LKXB 1C16B 4OLXH 1N64H 1U2CA 4Y1AA 1AGDA 1R5VA 3FB7A 3BAEH 4WGWB 5B21A 1CLYH 2HH0L 2Z93A 3TVMB 1U8HA 4GMTL 4M6MH 3U4AA 3RDTD 3LEXA 4IHOA 1IC4H 3HMXH 4TSBL 2DWEA 1JGVL 3BQUD 5EOCL 1YEEL 2NY4C 2V7HB 2EDNA 5FYKL 1UGNA 4U1SA 2XI9A 4YE4L 3VFPA 1G9EA 1T22A 4H1LB 4X8JB 3VXTA 2FNBA 1FH5L 2JIXD 3RI5K 2XT1B 4KK5D 4GKSA 1LMKA 1JHKL 4ZFFA 5DHYA 4JY4B 4PRNB 4JHWH 4UDUB 1JP5A 1E27B 3TCLA 4ZO8A 4O58L 1FVDA 5IB1B 1BD2E 4NSKA 1BVZA 2VQ1B 3MXWH 3R06B 1B0RB 4HLJA 4PGJA 2SEBB 4K3DL 1E4KC 3QA3B 2J6EA 4WWID 4MQTB 4RCAA 4QT5B 3WFHB 1G7HB 1HNGA 1U9KA 3NAAH 2OTUB 3QR2A 1QA9A 1YEIL 4WENB 1EH9A 1UCBL 4MMZC 1AXTH 3PL6C 2E9BA 4DVBA 5JZ7D 3AC0A 2OQJB 4LPCA 1CQKA 2ZPKL 5IW6A 4P5TA 2ITDB 2YD3A 4UV7L 5ADOH 1O0VA 3N1QC 4XPAH 3O2DA 3T09A 4WI5A 5IG7B 1VA9A 4P2OC 4PS4L 5E99L 4G6FD 4LK4A 3STBA 1FG2B 4XAKD 3L7FA 4CN4A 4DK6A 2PYFA 4MX7A 4XWGL 4Y16C 5DRWA 4KJPD 3K1DA 4JPWH 1OOAA 4FQJH 3KYOA 2Y6SC 3TNNB 4DWHA 2YN5A 2Z9TA 3FQWA 5JNYB 1GGCL 5ILTH 1OAQL 4M5YL 3RKDC 2YD8A 5HHOE 1YMMA 4P57A 3RQ3A 4S1DC 3OPZH 4AMKL 4OJFH 4EN3A 3IDIB 1YEKL 3LKOA 5CEYB 1QSEB 1UA6L 1I4FA 4U0RC 2BNUB 5IEHB 1CXHA 2AJZB 4F33B 1N3NB 1MWAH 2VXVL 1QFPA 1OTSC 1U92B 3IFPB 4YUEL 4CGTA 2AABH 3WO4B 4XX1G 1SVZA 3VFMB 1KN2L 3PHQB 4RGMC 3F65A 4I13B 1YMHB 4L1HA 4HK3N 1QSVA 4OLZH 1MCKA 1BFOB 1XF3B 1E4XL 4DTGH 1TNMA 4UDTA 1ZANL 1EUUA 2DIBA 1AIFB 2HTLC 1QFWL 5DSCA 1XAUA 3I50H 2X1XR 4ZPTA 3ETBF 2P8PA 1NMBL 4L9LC 2DQFA 3VXSE 3CC5A 2FHCA 2E5EA 5F7MC 3FOLB 3VCLB 4X99B 3VXUB 4M7ZB 4U2ZA 3BP6A 4EUPG 5CILL 3ARSA 1MH5B 3MRKB 3KAAA 2VIRB 3H0TB 5HGAA 3MZGB 4U31A 1X5AA 5JPMB 3VXQB 1GPOL 1JWSB 5F1KC 1OSPL 4NN5B 4N9GA 3PABB 4I3RL 3RTQB 4WWKD 3FZUC 5B4MC 1QSED 1QLRA 3QXDA 1EGJH 3O9WB 2AI0H 3G5ZB 2DQHH 2VL5B 1E4WH 1FFRA 4R97C 3MV8D 4PJDB 5BJTA 3SKOB 5HHOB 2JJTA 1OAXH 4XPTL 5E2VL 1GIGL 3ZDYE 4I18B 4Y4FD 3M8OL 4NO0A 2B8OT 3S6CA 1LO2L 3JWDH 1FAIL 5F96L 3O3UN 5DUMH 3NPZB 3TJEL 1RZFL 3UJJH 1TZIA 3QIBA 5I30H 1D9KC 3S35L 1W72H 3LEYL 1D5XB 5I2IB 5DRXA 2E8YA 1A4JA 2ZOLB 4XBGA 5DZLA 3N50A 4PJFF 2BVOA 3B4NA 3VXUD 1X5HA 1S9WA 1S78D 4Q0XH 5D1QD 2WIIA 4X4ME 1N4XL 4U3XA 3TA3D 4P59H 3G6JA 5D7KD 3WNOA 3MV7E 3D3VA 4NWUL 3MRMA 4M7LL 1A02N 4J3WA 5BRZA 3RTQD 3DV6A 4G7VH 3O9WD 3SDDA 3O11A 4PRPA 2DICA 2ZCKL 3NOIA 1ZLUH 4ELKA 1TTGA 3NVQA 1YQ2A 4XP6H 4RX4A 3BD5A 32C2A 4KI5E 5GS2H 1KFAH 1X44A 3MNZB 1KJ2H 2CUHA 3AFLA 4PGCA 4NUGL 4Z7UA 5DZOA 3NACL 3WD5L 2W0PA 5BCAA 2ZKHH 4UIMB 4GBXD 4DUWA 3IDGA 4PUBL 4R6UA 3WS3A 5E56A 2HJLA 3UPCA 4QRPD 2F8OA 2NY0C 3REWA 5FYKD 3U4EB 2XFXA 3GMLA 3B9DA 1E6JL 1VADB 4MWFA 4PIRF 3KWWA 4OZHE 1A6WL 4Q9QL 3BPOB 3WNLA 4A6YA 1KOAA 4OCXH 1CYGA 5KSVB 1XR8A 2IGFL 3S36L 3JWOC 2V2WA 5I74B 5LWYH 2NTSP 3ZE1F 3WSQL 3QNXA 4WNQB 5FDWB 2EYRB 3MOBL 1RURL 3SJVA 1CE1H 2Z0BA 1B4JL 5JO5B 2IPKA 3FCTB 5DVKA 5GRJH 1H3WM 3SDXA 4M1GH 1JPTL 5L0QB 4H26A 1DUYA 1FFOB 5CS7A 2VQTA 4XCCH 3MV7B 1IAOB 1HIMH 2I24N 4YFEA 1QKZH 5FYJH 4XWOD 4LCWE 1FZMB 5JW3L 5EBLB 4PG2A 1NFIB 3DMMA 1S7UB 2P48B 2OSLB 3FFCB 4V1DE 2HRLA 2KH2B 3ZDXE 5E6IC 4PJ5A 5I76A 3IDMA 5KN5A 2F19L 4HUMB 1U91B 2VDML 2ICCA 3U1SL 3UXFA 5JTWA 1GZPB 3UZQA 4ALAH 2GTWA 2O5YH 4JPIB 1F45A 4GSDL 3FRPG 5B38G 1LK2B 4E41E 2X1OA 2EKSA 1L6XA 3O6LH 2BOBA 2FBJL 1HN1A 1RZKH 5GHWH 1QYGL 3O6FB 1QRNB 3M45A 5EZLB 1KGCD 2CRMA 4KROB 5JXAH 4P23B 1W0VB 4G6KH 2P49B 4ZOBA 3DVNA 3H9YA 3L3KA 5IP4A 4OZHB 1WK0A 1I8LC 5ACZB 1IAIM 1CD0A 5BW7C 2OJEA 5DFVD 3UTSE 3BDYH 3AMLA 2FH6A 4WEMB 5D93B 3BKML 4WU7B 4X7EC 3RVTC 4LVNC 3EYQC 1HXMB 3QXAB 3RAJH 1I7ZA 5HHQA 3AS3A 3OZ9H 5I8EB 5BV7H 1F58H 1Q8MA 3BPLC 3LD8B 4KKBC 5AZ2L 4OGXH 3EOYG 1FL5A 5HYSB 1UWXK 3AY4C 3DETC 1I3RB 3PGFH 2Y25A 12E8H 1VGEH 4LCWB 4F7CB 2B39A 4WUKH 3EKCA 3WJLA 3HAEB 4V1DB 5MP6H 5CFHA 2WBJB 3QFJD 4P4KA 5JDSA 4K3GA 4LSRL 3MODH 4NC1C 4LVOB 4QXTB 1DQTA 4H88H 1TLKA 1QRND 4L8CB 2HLAB 2WUCL 4KROD 1SYVB 3WUWB 5ESVA 5F1IB 3ZO0A 2GK0A 3CPLA 2VR4A 4JM2B 4PJDF 1V7NL 2H6PB 2R2BA 4P2CG 4E41B 2XN9D 5IROA 1G7PA 1N26A 1NFDE 1XR9B 4OZIB 2P7TB 3VH8G 4LPUA 2GCYA 4BM7A 1JMXA 3V5KA 3T1WA 4FP8H 4BQCA 2IH3B 5HPMA 4BK5A 4PJGA 4PJ9A 3B5GA 4F2MB 3A6CH 1RVFH 1HQ4A 3QI9C 3PUCA 1M7DA 3MLTB 1F6LL 1YEFL 1B6DA 1TJGL 3O45B 1KB9K 4RFOH 5IMLB 3DX7B 3ZKNC 3UTSB 3E3QE 2YZ1A 2O5ZL 4PBWD 5CEZH 5FYLE 2F58L 2E7MA 3TGXA 1NUDA 4ZO9A 2BOCA 3G5YA 2AKRB 3ULSB 5T1KB 1U6AL 1H15B 4OGAD 1Z2KA 3DWTA 1F2XK 2CLVB 4PY8J 1LDSA 1I1FB 4HK0A 3O2WL 4XNMA 3T77A 3ARGD 3QUML 4JFEE 5C1MB 2D4FA 3RHWF 4Q9RH 1F90L 1KJVA 1WWBX 1CD1A 1J8HB 3L1OH 2Q86A 4F3FA 4R0LC 1FN4A 5F7FA 3P4NB 1S7TA 1FFPA 2Y5TB 3H3PL 1MCQA 5HI4D 1RUML 4ORGB 1ACYH 3ZHKA 1R3HA 3ZLQC 3LZFL 3QB7C 1MY5A 1TETL 4UOW1 3ULVH 2R23B 1KCSH 3KPMB 3QWOB 1ZE3C 4UT6H 4GAYB 3MFFA 3GKWH 4HPYH 3QBTB 3RWDA 2G5RA 3P4LA 3QPXL 1U8JB 1T20B 1MRDH 2DAVA 3HC0A 2P42B 1J0KA 1G7QA 3MACH 3R4DA 3V4PH 4L4TE 3O6KH 3CU1A 3VXMA 4OLYH 5F7EH 4P2RD 3ZDYF 1MFAL 4M8QB 4TTDD 4F7MB 4LHUA 3E6FB 4TULH 2EYSB 5KANG 15C8H 5HGHA 5E2WL 4CU7A 4G8EB 2OR7A 2Q7YA 3W2DL 4E5XB 4PTUA 1U3HC 1OAUH 1UM4H 2AK4D 3WIIL 3GFUA 4JKPH 5AUMB 4M1DL 1NGYB 4X98A 1PKQE 2RCSL 1HHJB 5EFIB 3X11A 3FTGB 2I07A 2BSSB 2H32H 2BNRE 1BZ9B 3L3JB 3CK0L 2H2PC 4MYWB 4XVTH 3CDGA 1E6OL 2OCFD 4GRWB 3K0WA 1G9MH 5SWZD 1L6ZA 4LPVA 4JFEB 4YGVB 4P2QA 4CAGA 3MGAA 2EEBA 4WV1A 1WT5A 1IGYA 1NMAL 1XCTB 2B1HH 4OZGE 1GZQB 5F7HA 3G9AB 5CUSH 3U0WH 1M05A 1N8ZA 3NH7H 4YHKH 1U58B 4BQ9A 4M7KH 4Y4KC 2QQNH 4S1RH 4WRLA 3U83A 2BJMH 2ZNWA 4U1JA 4IRZH 3SGJC 1F4XL 1IGCH 3BVNA 5DDHB 3FN9A 3TZVA 3SQOH 3IKCA 3NIFF 1P4BH 3LN5A 1DLHB 4NQTA 4CDHA 2FJGB 1WBYB 2XKNA 3RWEA 1JPSH 1HHHA 4NCC1 2UY7A 4L4TB 5C0JA 3T0EA 2WQ8A 2ICES 5D8JL 3ULUE 1MIMH 4EXKA 4GW4B 4U6HB 4C4KO 4ZOEA 2DN7A 5I1CH 4RDQG 5TE7L 3IFOA 4KJYA 1A3LL 4G6ML 3NBNA 4OZHF 3GUTA 3IFNL 4X4ZA 1V5JA 4NIKB 3TVMA 2A74B 3OKEB 1FO0L 2NXYC 1OT2A 1PKQB 4LASL 5GS3A 4QY8A 4X9IA 2R2CA 4MJ5A 3O8XC 3GMRB 2BNRB 4LCUB 3MRJB 1BM3H 1BOYA 1KBGH 3SGKA 2EEDA 3DXAE 2UZIH 4PRHE 4Z8FH 4D3CL 3OTTA 3QPQD 5C0ND 4XVUC 1W8OA 1XIWD 1ZA6A 2WLZA 4UDUA 1U8IB 1ZA3A 2Q6WB 4OCSL 4HULB 1C5DB 1M4KA 3BZEA 4UMGA 4OGYH 5IB2A 5DUPL 1DANT 2D7NA 3EYUH 3IDXL 1FV1A 4J6RH 3LKSB 3SKJH 3WKNA 3EO1B 4OZGB 5E08L 4AY0A 3ZDXF 3O4OC 4XVSL 5DQJA 4YHLL 2DI8A 1UCTA 4JFPA 4H5SA 5TDPB 4ONGH 2YMXH 2CMRH 4QTIH 3UBXA 3UROR 2MKWA 2W9DL 3MLVH 3STZB 5E7FA 1SEQH 4JM2F 3WEXB 3MOQA 5LAXB 1QFUH 2DQUH 1NCTA 1NCBL 3MRNA 4BH7B 3HKFA 4IMKC 1HYSC 5I1GH 2BCKB 1IGIH 4DVRH 4X9GA 3OKDB 2ENSA 2AEIT 2NY1C 4OZIF 3TP4A 4HQQH 4NGHL 5C6TL 3JWDC 1XGPB 3KYMB 4NDMA 43C9A 3MLUL 3D9AL 1XZ0B 2A0LC 4OM0L 2JB6A 2PTUA 4QRRE 2OMNA 5CBEA 5CEYA 1QTYT 1EEZB 4JG1L 2BNUA 1IQWL 3SBWC 1WSST 2DQGL 3FT3B 4AL8L 3L3IB 1K4DA 1CT8B 2Z31A 5C6WH 4PRHB 3PGDB 1HSAA 5I1EH 1EAPB 1BFOA 1I9EA 1HZHL 1H0DB 3EOAA 2EDXA 4PJ7E 5D96B 1MQKH 3C09C 2W9LA 3L5HA 5F1OB 1BD2A 2FGWL 3VW3L 4UTAL 3UTQA 2R9HC 1G6RH 2E8ZA 2F5BH 4G6JH 1FNSL 2WUBL 1ZLVK 4QF1B 3VCLA 3U9PL 5IV2B 4HIJB 5TQ0L 1T1YB 4YXLL 2ATPB 4EDWL 2PW2B 4WFGE 3QEQE 3MRKA 2AS5M 2QSCH 2EDWA 2GT9B 4RAHA 1RUPH 2EH8H 1MAML 4ZNCD 3QDJB 1QVOA 5B38B 2H3NA 1PX4A 5I1HH 5DD6A 3QQ9D 2GITA 4D0BB 4U1LB 1JIBA 2ZWLT 3LH2L 4TSAL 5J6HB 4NQEA 5HBBA 1INEH 1EO7A 5CSGA 1ZLWK 3PWVA 3SKOA 3RZCA 4HS8L 4WW2B 1I8MB 2M2DA 4BUHA 1RZ7L 3FO0L 4KHTH 1DEEA 2ZJSH 3IVKB 5T5FL 3SDYL 3HR6A 1KB5H 4I18A 4QRRB 3ARBA 4P3CH 2R1YA 4Z7NE 4NPYA 1N5YL 2D7OA 3MROB 4PRDB 1A6ZA 4MHHI 2A6DA 2RAMA 5T3ZE 1T1WA 3K8LA 4YIQB 2Z4QB 3F7RA 4GRWF 1NCAH 1D5XA 1MF2L 2LQRA 4U1KA 4PJ7B 2FBOJ 1CF8L 1P69B 5JLZA 1G1CA 3RJDA 5ALCH 1HHIB 4J4PA 4JO4L 5KZCD 3D2UB 1CL7H 2VLRE 2AEPH 4KKCC 3VXSA 4ELMB 1UM6L 1K8IA 3QDJD 3RGVC 2CO7B 2BHUA 1BHGA 5EU6E 3RVXC 1DSFH 4ZFGH 2A73A 2J88H 1ZT1B 1FIEA 5CIPH 3V7AG 4XBEH 3KPOB 25C8L 1RZKC 1KEML 5DURB 1D6EB 3C8DA 3GJFB 2BFVL 3V5HA 4XBPA 1VDGA 5T5NG 3TCXA 3KPRE 3FT2A 3B5HA 4M8VA 5D6CA 1MJ7L 4JFDB 3DOSA 2W0KA 1RIVL 4BJLA 3VH8B 1DJSA 3IU3B 1R6VA 2W9EH 4QHLA 3WLBB 1PYWA 1U8MB 1WUNT 3CMOL 3QDMD 4LSVL 4FQ1H 1MCBA 3RWHB 3SDAD 4NP4L 2FX9H 3TEUA 3UTZB 5GS0H 2L7UA 1I1YA 3RX5A 5F7WC 2X4UA 3ALWA 1QRKA 3QH3A 4QKXB 1DE4B 1NCWH 2C7UB 3OV6A 5IB3A 3FONA 3PQYE 5FHAH 1IMHC 5C0AD 1F5WA 1TNNA 5BV7C 3ARPA 4JJ5B 3IS0X 2ZZUT 4IMLA 3Q5YA 1KEGL 1UWGL 4HS6B 4KQ3H 5D7JC 5DVNA 4LKCA 4WNQA 5MEOB 5MENB 1C08A 1JTTA 4LIQH 2Z8RA 4NKDA 3KLHC 3WN5B 3QNZA 1VFOA 5I0ZA 5JO5A 1SJHA 2R4RL 1S9YB 2V5TA 1UM5L 1DUZB 3VD3A 3NCMA 4YK4C 5JOFB 1IAOA 1DQMH 4R2GD 5I8CB 5KS9A 1JPGB 4TQEH 2X70A 2OSLA 2PCPB 2VLLA 3VFVB 3HNTH 1CGXA 5HY9B 1U36A 2X1PA 2X41A 5KW9L 5B8CB 2BSRA 2CJUH 3GI9H 2VWEE 1HWHB 4BZYA 1KTLB 1WGOA 5F89B 2A6IB 5B39A 3IAGC 4HCRL 3V0VA 4HJGA 2GYSA 4RIRB 4APQD 2ED7A 5D72H 2BSTA 2OJZL 3ARQA 4GKNA 3VGHA 3T4YB 1OLLA 2XWJB 4IRSD 4LNRA 3VD5A 2JJWA 1IT9H 3NCYS 1LO4H 3MFGB 1FFNA 2CIKB 4H1LH 4EIGB 3MRGB 3IAQA 2Z92A 5MEND 1J0JA 4ZUSB 5BOZG 1SHMA 1DCLA 2PO6D 4FABL 3PQYB 1YY9C 4JGMA 1CU4H 4HKXB 3OHXA 5F9OL 1JHLH 2YD5A 3N85L 3D39D 2JB5H 4JDVB 3N1PC 2P24B 5DD0H 1SJEA 3D85B 1J1OH 1DBMH 3DO3A 2J8UA 3QUYA 2I60H 3MBEC 3MR9A 3WIHA 3MLWH 1YPZE 4Y2DB 5LG1A 5JW4R 2LTQB 1A1OA 1I3VA 2CKBL 5JHLH 5LKNA 3ULVC 5I9QB 3KLAB 1NGWA 2YA2A 4M4RA 2HTKD 5IFJA 1FLRL 5BMFL 5ISZD 2WMPA 1ADQL 2GQHA 4LCWA 5IFHH 1R0AH 1FSKB 1RZJL 4Q97A 3HZYA 4GKOA 3MSPA 3OAYH 3HAEA 4V1DA 3LIZL 1WWWX 4KHXL 3H9ZA 1OARH 1G7JB 3JTSB 5ICXA 3QIUB 1RJZB 1BZQK 1QSFE 2Y36H 3BZFB 3VWJC 3WUWA 1SYVA 3GK8L 4BK4A 5D1XD 1O7SA 1EK3A 4IOFC 5C3TA 1XGUB 3U7WH 4XAWH 4AT6A 1E4XI 5ERWA 4HWEH 4E41A 5E8OB 1AQDB 3T0WA 2O61B 4X6EB 3QIBC 3CJJA 3QIWD 1CICB 4P46A 3TBTA 1QFWI 3X3GH 4EI6B 4LLQA 4K9EC 5IMOA 4FQXD 4XPFL 1U8PB 4CW1A 1WQVT 3EO0B 5I66A 1MHEB 5DJZB 1QACA 2IH3A 4JREC 2AJ3B 3D85D 3MLYH 3HE7C 4F2MA 3RKPA 2OYPA 5DEFB 3PWUB 2ATKA 1VHPA 3WNNA 4X5LA 2P47B 1U42A 5K9JL 2YKLH 4LSQL 1G9MC 2DTSA 5IMLA 3DX7A 1L0XA 4NO5A 2OI9B 3VFOA 3DV4A 3IDNB 2FB4H 4GQ9H 1KIRA 2IQAA 3VXRA 1ZKAA 3NCJH 2AKRA 4EQ3A 1K2DA 3SDDC 2DF3A 3SCMA 3IXTA 1H8SA 1J0YA 2FEDD 4NQXA 3HR5A 5MI0B 5J7CC 5HDOA 4ELMF 1GC1C 1X4XA 1FZKB 1KULA 1JWUB 43CAB 5J3HC 3ARFA 4PP1C 3U2SA 1NCDL 4GAGL 5GRWA 1A9EA 1NBVL 3F58L 4YXKL 3FQRB 3D1MC 5F9WB 1V3JA 2Y5TA 4XMPL 1KJ3H 1SVCP 3A67L 1I85A 2FGZA 3O81A 1AQKL 1MNUH 4OIIL 5GZOD 1AC6A 4MDIA 2AAVA 5GZNC 3WO3B 1QSFB 1UZ6E 3QWOA 5DI8A 5IF0B 3ILQD 4FNLH 4F7TB 1Q9KA 5GGVH 4I48B 2FX7L 1XMWA 2HVKB 5GIRB 4OT1H 1NFDA 3LRHA 4RMVA 1XGQB 4YZFE 1OGTB 4M6OL 3OXRB 4O2EB 2HH0H 3C60B 3ROOA 3JVGC 3K1KC 4QRTB 4I0PB 3BPNC 1CE6A 3WIFA 5A2LH 2Z8SA 3VGAB 1WF5A 2R0ZH 2MFNA 5EUOE 4JFXA 1IC5L 4LGRB 1JGVH 1RIHL 3BP7A 3BPCB 3U7YL 5FO8B 1GYAA 4KRPC 4NN7B 1DVFD 3B6SA 3N9GL 1CFTA 3SDCC 2VLJA 1MCNA 1MCSA 2VDRL 4NN6B 3RGHA 3C5SB 4Z18A 3H7BA 4K8RL 4NQUA 5DJDB 1RZIA 5D2LE 4DN4H 1I1CA 2BXZA 2QADC 1MRFH 4O58H 3X12B 4G5ZH 5FUCC 2XQBL 4K3DH 4OF0A 3BKCH 2WIMA 3OX8A 3D25A 4KRMB 4U1IA 2CKBB 3ARDA 3BJ91 4OFYD 5AWNL 2D9QB 1YY8B 1ZVSB 1UB6B 5JMOC 1U58A 2ZUQC 4MVBD 1FYTD 4PJ8D 4FRWA 5J13C 1QBBA 4UV7H 1QHPA 2I9TB 1BJMA 3WHXB 2Y7QB 1OTTD 4BFIA 3UPRA 4YQXL 1JBJA 3KPNB 3B5TA 4HWNA 1IM3A 2BNQD 3EYOA 3CLEL 2FATH 3EHBD 4HKBB 5LGHL 3V6OC 4L4TA 4CMMB 4LSDA 3C6LB 1SEBB 4CVXB 3GGWB 2VXSH 5E94A 3D6GA 1LE5B 1FL3A 3CUPB 4G8FA 4NQCE 5JA9A 2ADGA 1N59B 4ETQB 5CBAB 1A9BA 5I1DB 1AGCA 4QWWC 3RWJB 5EUOB 3OKEA 4NZJA 2D7QA 5HI3C 2L4OA 4PGDA 4YHYB 2HN7B 1LNUA 4QNPE 4LHQB 3OJVC 3DRTB 4DKFL 3RVVD 1F4WL 1KN2H 2VDQH 1ZLSL 2AJXL 2AJVH 4AG4H 3LN4B 1YEHL 4M7JL 1NEZB 1ZWIB 5D2LB 4DZ8B 1BBDL 2APWA 4Z9KB 4MAYC 2ICWJ 4NWTL 1NJ9A 4HIEB 4EKXA 5FHBL 2N7AA 2FCBA 4IOIB 3WKML 4PLOB 1C5DA 4UT9L 4JFZH 1VFMA 3GB7A 1BAFL 2IAMB 2GI7A 3LKSA 3EO1A 2BK8A 2IBZY 3C87A 2CGRL 4KRNA 1CIUA 5HYFA 2VE6B 1WAAF 3P0VH 1ZHBB 7FABH 4WUUE 1IKFL 5FYKE 5C0BA 4LQ1A 1KCUH 4WFFD 3DSFH 2GSGB 2GY5A 3GHEH 1GPOH 4BYHA 2FL5B 5EWIL 1OSPH 3GM0A 4WEUD 4R26L 1WITA 4I3RH 1VFBB 4RDQF 1NAMA 2A83A 4PJCA 1OD7A 2HRPL 4ZDHA 2BCKA 3V0AC 3REVA 1RMFH 5F7UA 3CZFB 4RFEB 4RBPH 5BQ7A 4WY7L 4HIHA 1KNOA 5BO1L 5EORH 5ESQA 5JPNB 1VEPA 3C5ZC 4NQCB 1LO5A 1RJYA 2VDKL 2BRRH 1NUNB 1UEMA 4RNRA 5E2VH 2PXYA 4JQVA 2HT2C 2V7NB 4JKWA 3NTCH 1QLFB 2VQUA 1IRAY 3L7EB 1D7FA 3QSKB 1FAIH 1S7RA 1WCQA 1KLGB 5A2FA 1RQ5A 1RZFH 1WJ3A 3INUL 3BHBA 2VABA 4JJHA 3B9KC 4X6BB 1CT8A 4DZBB 3DXAA 4ONFH 3PWPD 1JWMA 1ZT7A 2BVPA 4FQCL 1H0DA 4Z5RB 1X4YA 1V7MH 1PDKA 4OFPA 3WL9B 2GJZA 2W65B 4KUZL 2IFGA 5F8QC 5EULV 1JN6B 1OY3B 4GXUM 4CN6A 2DL2A 1KGCE 4QF1A 4WUUB 5DD3L 4CMHC 5LGJA 3WFBL 2KKQA 4OQTH 1T1YA 1FCCA 5HVGB 5D6DC 1FPTL 1FNGB 2ZCKH 4KAQL 4U33A 4KFZC 2X4NA 1MHHB 2VLME 3T04D 3QUXD 5GSRB 4IS6B 2VYRE 5B3JE 3DPBA 5HYIA 4GG8A 4OCWL 4XNZB 4WHTB 5I71B 1Z9OA 4PB9H 3TBWB 3K4DA 4PRBA 2PW1A 2D31B 4HSQA 2P5WE 4ZXBA 3T0BA 2CDFA 4H20L 4U1LA 5GS0C 4PUBH 4UINL 3MO1B 5B22A 3EZJB 3MNWA 3V8CA 3U48A 4WW2A 4XPHL 1F4AA 2WWMD 3IVKA 4ZSOB 2COQA 5C0CE 1KYOK 2DOCA 4Q9QH 1A6WH 2WZPD 3QCVL 4EJ1C 4K8RD 2EIZB 4GRLA 4WV1C 1IM9A 1SY6L 2XRAL 1DQJA 2IGFH 2NY3B 1QBML 1CDHA 3WHE0 4Z76A 1TXKA 4LLDA 1AXSA 3WSQH 2OS7A 3R1GL 1RURH 1IEBA 1B4JH 4AIZA 2R1WB 4HGMA 1JFQH 4WW1B 5LVEA 2NR6D 3OKKA 1ZSDB 3PGCA 4FTVE 3V5DA 4KK8C 1TCRA 1EXUB 1MCOL 1MEXH 5DS8A 1FIGL 3T0EC 5IFAH 3HFML 1P2CA 2D4DA 1UZ6F 4XCNA 5JZ7C 5I1IL 5ANME 1IVLA 2NY2B 3QEQA 2F19H 1FNAA 3TVMC 3U1SH 2VDMH 5KVFH 5M94B 3GSRB 4KMLB 3TNMA 3ZMRA 4KZEH 4ZAKD 4BFGA 1K9TA 4NNYA 4XNYH 4YZFF 4JPVH 3IRPX 4KKLD 2MPAL 3MREB 5IB4B 3CVIL 5K93A 4RMWA 5IT2L 4PLJC 5ECJE 3SGKC 3U82B 5EUOF 2NX5D 5F7YC 2NY3D 3ARXA 1EFXB 1OPGL 1A1MA 5J4MA 4XCFH 2UYLB 3RWHA 3OG4B 5IGXL 4M1CC 3TIDB 3J7HA 1G6VK 5EOTA 5FYLH 5GGQL 5IHZB 1UKQA 1RZ8A 2EDKA 1KF9B 2UV3A 1LEIA 5DJAA 4YAQB 4F9PA 2N56A 4GRWH 3BKMH 2XTJE 3U7AA 1I1RA 3MV9E 3BH8B 3FAWA 1WFUA 1NAKL 1FL6B 3QEUA 5L6YL 3JZ7A 4CVWA 2HKFH 2HG5A 3WBDA 3BP5B 4TVPL 3HCVB 4NQDD 4AQOA 1SBBA 3WN5A 3MYJA 4ODTH 4FTVB 5GRYA 4TPRL 4EUPH 5SWQB 1QQDA 3ZKMD 2B0SL 2VLRA 5D1ZB 1T04B 4OD3L 4AEIL 5JOFA 1IFHL 3WDJA 4WDIB 4X4XA 5JR1L 5ANMB 5IMKA 5EBMA 5ITFB 4Z7VE 2FIRT 5EU6A 1JPGA 4DN3H 2HFFA 4QO1A 2PCPA 5DFTA 5GGRY 4XH2A 4QOKE 2VXUL 5T5NF 1OP3K 3U9UB 3I3DA 2WUCH 3ARRA 3MLPA 2BDNL 4C83A 3CH8A 3M17B 1GSMA 3CVHL 5B8CA 3UYRH 3QCTL 5GRZA 4BQ6A 2DB8A 4L8SB 3G6AB 5H35B 3KPRA 2ZUWA 2FYYB 3WO4C 4U6VH 5AD0B 1A7OH 3TO2B 3ZKSD 2DMKA 2D9CA 2BX5A 3VDCA 5SWZE 3ZL4L 3CIQA 3OR6A 4MB5A 5CHNA 3MX0A 3T4YA 2XWJA 1KCVL 4IIQA 4NRZB 1IBGH 3TN0A 2NY4D 1P53A 1BX2B 1GL4B 1QOKA 1K85A 2HLFC 3EYFA 4F7PB 2F58H 2XTJB 4HKXA 5A43C 1DBJH 3MV9B 1WBXA 4X5XA 2ZUYA 4P5KA 3IDUA 4PJBF 4M7ZC 5D1ZD 5DTFA 1A8JH 3A6BH 3JWOL 1L0QA 3M07A 3V6ZA 4ZUUB 4UNTA 3QUMH 4Z0BL 1CQYA 4YX2L 1YEDB 5BZDA 4W4OA 3PHOB 4JPKL 4P3WA 4NN5C 5FK9B 3WE6A 5TDOA 3QUKB 3QZWG 3KLAA 4X7SL 4AK1A 5IB5B 3RTQC 2PR4H 5TDNA 2FD6L 4JLRB 3H3PH 5T33H 2YRPA 3O9WC 3PL6D 8CGTA 2GFBA 1T0MB 2Y1VA 3QUZA 2Q8AH 4B0MM 1C5BL 2BP3A 3QIUA 4P2OD 4KMTL 4I18C 5EBWB 5J8OA 3Q6GH 1MELA 2ZCLH 4ODSL 1KCLA 1MLBA 2ITCA 4JRYE 4Y16D 1DQDL 2Y6SD 1MJJB 2E27L 1BF2A 1PVHA 2DMCA 4R8WL 5E4IA 2X4RA 4K7PX 1MFAH 5EDXA 4X6EA 3RKDD 2UZXB 1IKNC 3T2OA 1OF2A 1OD9A 4RZCA 4EI6A 2NQCA 2H41A 1ND0A 1JPFA 1N7ML 5E5MA 1EMTL 2JJUA 4GW1B 1T7XA 5C71A 3L5WA 5C0GB 1TVHB 5DJZA 4AIXA 4OKVB 5D7LE 2AJ3A 2YS4A 5TE6L 3RWGB 4UV4H 2EKJA 2W0FB 5CINH 4XP1H 1H9VA 3PWUA 5EO9B 1SBSL 3P2TA 5D2NE 3HS0B 4D8PB 3CK0H 3IDNA 1KELL 3LQAH 3ILPA 2HTLD 2FSEA 3BIAX 5BS0D 5JORB 2R0LL 3FO2B 2VDPL 5KANI 1YPZA 3RWFA 3FQNA 4X6DE 1UACH 3BSZL 3BT2H 4DW2L 5DMGD 4UT7L 3S5LB 5EZIL 3P30H 4NC0B 3MLSL 1MQ8A 1AH1A 4F58H 3LS5H 5B3JF 2C26A 4MSWB 1NGZB 4MJID 3RDTA 3WFZA 4QRQB 3RWIB 3SPVB 3MCG1 2H9GA 3BQUA 1YECL 4FFWD 4PY8I 3LB6C 5DJ0A 1X9QA 2EDFA 3G9VA 4Y5XB 4JRYB 3FZUD 5B4MD 5I75B 5CLTA 4F7TA 1QD0A 2JIXA 4AEHL 3BPOC 2EDBA 2ED8A 3GNML 2HVKA 5GIRA 1KC5H 2ADIA 3DO7A 1WBZB 4NZTH 4PRID 5JW5A 5I19H 1XGQA 5I74C 1U41A 2JCCE 3C60A 3IFNH 5DMKB 4JQIH 3NFSL 1FO0H 3CXDL 1S7WB 3DVGB 2H8PA 3OAUH 5D7LB 1KENL 1TCMA 4PJXB 2GJ6E 1ZGLP 2O5XH 4XZUA 5DFVC 4JY5L 5L0QC 3BPCA 1CR9L 1D9KD 3O3DA 5D2NB 1KT2B 4TVPD 4JN1L 1MIEL 5E1AA 4ZOAA 3QJFA 4L3CB 4BZ1H 3MZTA 4X7TB 2R29H 3MRHA 1ZGLB 3C5SA 1ORQB 1RUAH 1W8NA 2ICWB 4YHZH 5ICYB 5IQ7H 1P1ZA 4GXVH 5LXGL 1JRHL 3H3KA 4CUCA 3DX6A 4OCSH 4X6DB 4MNQE 4EVNB 4MQ7A 1Y18A 2BC4A 5HHMD 3RVWC 2OZ4L 3P0YL 4AH2A 3ES6B 4D9RE 5E08H 3T3PE 3QRFM 2FDBP 4HJ0D 1AR1D 2YRZA 2DTMH 3EO9L 4KI5C 4OTXL 4XVSH 4YHLH 2R69L 3RX7A 5BOPA 4OUUB 3QFDB 4LSSH 5JXEC 1U2HA 4U1NA 4UQ3A 4G8GE 4FHBD 3O6FC 1PSKH 2XZZA 4H25A 4WGVB 3AS2A 3GJFH 3NZHL 1YZZA 1C7TA 4KROC 4P23C 1MCWW 5GJTH 3GSOA 4NJ9L 4IRJA 2X89D 2BXYA 1NCBH 4N90D 5I8KL 5L9DL 2FWOB 1CGUA 3AXLA 3BE1L 3GHBL 5HHXH 3O3BB 1N2RB 3KPSD 3Q6FB 5T1MA 3RY5A 4NGHH 3BAEL 5C6TH 5TH2A 1CLYL 1QUNA 4CMMA 4ZFOB 3AUVA 3O4LD 5HYQA 1RD6A 2F74A 2NY0D 2JCCB 5D93C 3VWKB 2VISB 4BKLB 2MQCA 1IC4L 3HMXL 2NNAB 1VGKA 2Y5EA 3D9AH 1V05A 2DKUA 4L3EE 4Q6IA 4Z7QF 5EO1A 3OJDA 3QG6A 5T3ZH 4L8BB 3HG1D 1S5IH 1IQWH 5ID0A 4H8WH 3LD8C 2HN7A 2DQGH 1EIBA 1YEJH 2CUMA 3HRZB 3MJ9A 4JHWL 3GSNB 4G9DB 5FB8B 4WFHE 4TN9A 5DK0A 4QXGH 2G2RB 3SGEI 5E00B 3O6MH 1NEZA 2WBJC 4NKOA 5D2LA 3MXWL 2G5BB 3QULB 4I5BA 3OGCB 2PTTA 2Q1EA 4LVOC 1MLCB 2Y06L 3MCLH 1YN6B 4WWKA 4UTAH 4DGYL 4LVHB 3NAAL 3NFNB 2WUBH 2HWZH 3Q5OA 1Z0NA 4CADA 1R24B 1NCCH 2IAMA 1TTUA 4NZUH 3MV8A 4OQ1A 5C0FB 4JM2C 5IW1A 1AXTL 4WEBL 4HT1H 4NM4H 5E6ID 3DX9B 4MCYB 4YXLH 4TVSa 4FFYL 4FQQB 4XCYB 4EDWH 5ADOL 4OD1L 1CVRA 4XPAL 5C0DA 4Y4FA 1JNHA 2CD0A 4NNXA 2DQTH 2IBBA 1L7IH 4X83A 5F93C 1MAMH 3H9HA 4JPWL 4C59B 1VFBA 4MNGE 3SY0A 3ME0A 5ILTL 3HLAB 2D0GA 1CGTA 4OJFL 4PJIB 1I7TA 2BVQB 4IDJL 5D1QA 3SDYH 5C9KA 1MWAL 3TA3A 1CG9A 2AABL 4XMLH 1T5WA 5EC1B 2PYED 2CDEB 4CVUA 1G0YR 1CCZA 4OLZL 5H2BB 2XQYK 3RVTD 4DTGL 3BRGC 3EYQD 2EDJA 1JGDA 4ZD3L 1FJ1B 4NO3B 1I85C 3I50L 4FMFA 4P99A 4Y19E 1GGYA 5J9PA 3EUUA 3PIQB 3UJIH 4GW5A 4MCZB 1CF8H 3KDMA 4PJHA 5E9DB 4GQPH 4KKBD 1J05A 1KCRL 4X5WB 4B7IA 2KPNA 1G1YA 4GBXA 5HHPA 4X0KB 3T4AB 3G5VB 4UILH 1U3ZA 1ZOXA 4QRPA 4RQQB 5DGQA 5FGBA 4OZFA 1KTDA 1PG7X 5CWSA 4I2XE 2QEJA 1NGXA 4YDLB 5AEAA 1AY1H 4ZODA 3UDWC 3MRFA 1IJ9A 5DHXB 2BFVH 4Y5YB 1EGJL 3TYFA 2AI0L 3GSQB 2DQHL 1E4WL 1OQXA 3W0WD 1RK0A 1EJOH 1H3PH 3LQMA 4WI7A 4GJTB 2C3HA 3E3QC 3MRQB 2D31A 1OAXL 1KXQE 1XF2B 1MHCB 3CMOH 3ESVF 4PJXF 2UY6A 1D6VH 4DCQB 3JWDL 2YN3A 3QI9D 1TVBA 4F80A 3UJJL 5HD8C 1ITBB 3QQ4A 3ZKND 1W72L 5E9DD 5JQ6H 4JY6B 3QEGL 5T1LD 1D5ZA 1IAIL 4JZNB 2VDLH 5KG9A 2X4PB 4X6DF 4ETYA 5CJXC 1KEGH 3RPIA 2WM0A 3VJ6B 5ABDE 5J6GA 4O2FA 1KIPB 1UM5H 3CCHA 3HUJE 2V2XB 5JOEA 3V6BR 3IXAB 3QZWB 1YNTA 1C12A 1RHFA 2ICEB 3GMNB 1V3MA 4EQ2A 4G7VL 4FFZL 2YPLB 2RFXA 4G80A 1P4LA 2AJSH 2P5EB 5C08E 4WTWA 3BUYB 4XP6L 3T3ME 3M1BB 3QG7L 4M61B 3TWCL 1KFAL 1G9NH 2HJKB 2ZOKB 4HIXH 3H42H 2ZKHL 2IBGA 4BZ2H 1U8QB 2DMBA 4ZUTA 2YPKA 5EUKA 2IANE 3ZKQD 1I9JH 3MRCA 2JCCF 3GSWA 4LARL 3G08A 2P5WA 4ZOCA 5IUSA 5I1AA 2AXGB 4OD2B 4Y4HB 1U3HD 3GSVA 1CFBA 1B6UA 1EV2E 1UZ8A 3MRLA 3SN6N 3PDOB 2CXKA 1SM3H 1K8DA 5TGBA 2VLKE 4HV8A 1EX0A 1I3GH 5C0CA 4W6WB 4GS7B 2D7TH 3ARWA 3EDJA 3LPFA 5LWYL 5HI5C 1J8KA 3GMOA 1T0NA 3N85H 3QFJA 2H2PD 1AHWA 2ILLA 1A7RL 4PLKC 1CE1L 3BH8A 5GRJL 4D0DA 2V9QA 2UUDH 3NIDF 4PG9B 4M1GL 2YPLD 2CPCA 4MNHB 1S7SA 2XTLA 2Q20A 2YD2A 2GAZB 2P5ED 1QKZL 2CKBH 5FYJL 2F8VA 2XN9A 4P9MH 2NZIA 4O2CA 2DM7A 2DLFH 3DUUB 3VG9B 4Y4KD 4F7EB 2CIIB 2DL9A 2EC9U 1OW0A 4F9LA 1U95A 4BFBD 4OLEA 4R4BA 3UJTL 5IBLC 1A3RL 3CFEA 4HUUA 5J12B 4JFOB 4JQVC 5FO7B 4XNUL 3PG2A 3U9UA 2VZ1A 2O5YL 5DJYB 4M93B 4Y4HD 2ESVD 1MPAH 3O6LL 4U6YA 1UFUA 5GHWL 1S5HB 2IANB 4MD0A 3UX9B 3C5JB 3JUZA 1PGRB 3PV6A 4PJIF 1J12A 5H35A 1WWAX 5JXAL 4G6KL 2XNAB 2FYYA 5DRZA 5AD0A 1PLGH 1YN7B 2A1WL 4XPFH 2DM4A 4PBVC 5HHNA 3WDIA 4EZMA 3ARGA 1BOGA 5IM7A 1OB1A 2FIKB 1Q9WA 4ISVA 5D96C 3KLDA 2HP4A 3LQAC 3BDYL 4OIAA 2OR8A 5JOPE 3O8XD 4O00A 2EECA 3VRJB 5INCB 5K9JH 4LSPL 3UO1L 3LAFA 3RAJL 3MV01 5FM4A 4PJEE 5FM8A 1HI6B 2J6EL 3OZ9L 4XVUD 5BV7L 4ZUWA 1F58L 4FXKB 5C70A 2EC8A 2GW5A 1LE9B 1OAYH 3L5IA 5I18H 3DRQA 2BNQE 4ZUUA 5KSUA 4ZTPH 3PGFL 1V8HA 1VGEL 3E8UL 4U7SA 2YHGA 3KYKH 1F97A 1YEDA 1Z9SA 2VJXA 3LKQA 1YJDC 4GAGH 4TUOB 5MP6L 3O2DL 4MA7L 4P2RA 3MRRB 4N9OB 3F58H 5K9OB 4P4RB 2Y23A 3MODL 4XMPH 1AQKH 4Z7VA 1T5XB 2AK4A 3GSUB 1AGBB 1OHQA 4KDVA 1OP5H 2GSIB 2IFFL 1HINH 4WW2C 4QOKA 4JFYA 3PXJA 3MNVB 1S8DB 4KVCH 3U30B 5FOBA 1HYSD 4JR9H 4HC1H 3DROA 3W82A 2NY1D 4PR5A 4Y1AE 5I1LB 5DMJB 3UYOD 1QZ1A 1TENA 5DHVB 4R7DA 4FP8L 4EI5B 3G5XB 4YHNB 1BJ8A 5SWZA 2CKNA 4AENA 2A0LD 1NC4B 4UAOB 2E9IA 4YFLF 3TLRA 4RFOL 2XPGB 4QRUA 2H26B 3U7YH 4CNIA 5J56B 1KXTB 4JFQB 2QL1A 5CEZL 3F7QA 3RP1A 5FA3A 1A3QA 2AV1B 2XA8L 4O02H 2VDRH 3K2UH 3HC3H 3CU7A 4PJEB 2XV6B 4D8PA 1U8LB 1IGMH 3MPCA 4UIKH 3SE4C 1P7QD 4X9HA 5J57B 4NRYA 3C8KB 1GGUA 4Q9RL 4O51A 4G43A 3FO2A 3BN9C 1FZJA 2R9HD 3L1OL 4E42A 2XQBH 3D69B 4RWHA 4J3XA 2ZSWA 1S9KC 5CGYC 5IR1A 3BMVA 3RUGE 3HE6B 1ACYL 4JQXC 4HH8A 5DJCB 2AJYH 3S5LA 2JKXA 3ULVL 3VFSA 1IL1B 3AAZB 1T7WA 3BO8B 3RA7H 3MUHL 1KCSL 1P84K 2R1XB 4UT6L 3GKWL 1RFDH 4HPYL 3ABZA 1A14H 1EEUA 1P7KB 3D0LB 1A2YB 1MRDL 1NGZA 1KPUA 3BP4B 5J11B 5EZOL 3UPAA 3MACL 4JDZA 3O6KL 5E5RB 4HG4K 4JRYA 1AGDB 4Y1AB 5F7EL 1R5VB 3FB7B 4AIOA 2XG4A 2Z93B 1CN4A 5LCVH 15C8L 4F9PC 4KH2A 3LEXB 5C0EA 1UM4L 1XIWA 4H8WC 2HAZA 4IHOB 4JKPL 2DWEB 3BIBX 4WHYG 2VTFA 1CTOA 4U1SB 4K9EL 5DK3A 1S7WA 3VXTB 4LLAA 1TZGH 1BPVA 3WN5C 3QNYB 4GKSB 3MMEA 3S35X 4ZFFB 1CDGA 5DHYB 3QCUH 5CAYB 1HNFA 2R2EA 4GRMA 3RNKA 3SE8L 1ZLSH 4XVTL 5KBNC 1WZLA 3TCLB 5KSBA 1FVDB 4L3CA 3NMEA 4M7JH 5FYJD 3SE3C 3TBYA 4C56D 1G9ML 2OL3A 3ZYJA 5C2UB 4HF5L 4NWTH 2VOTA 4OCYH 1CGWA 2B1HL 2EIBA 3TPUA 1M1SA 4EVNA 2QHLA 2HJFB 3U0WL 1BAFH 5B8CC 1QA9B 3P3YA 4KKCD 3NH7L 4YHKL 2Z91A 2UVFA 3GJEA 4DVBB 2I27N 1GC1L 3NCYP 4S1RL 1HDMA 3W9EA 2BJML 5EBGA 3RGVD 5IW6B 4IRZL 4NQSA 4OUUA 4P5TB 1IGCL 3RVXD 1IKFH 3SQOL 5K9QG 1P4BL 3BGAA 4WI3A 2R8SH 3L7FB 2PYFB 4MX7B 3QDGD 5C09E 5DRWB 1NFKA 1PW3A 1SQ2N 4D0CA 2CLZA 2HRPH 4LHUG 4LEXH 5I1CL 1YMMB 4P57B 3O3BA 4MA3A 5F9JA 5C92A 4EN3B 4JRXD 3LKOB 4QHKJ 1I4FB 4HLZG 2F9BT 5L2JA 4S10A 3LQZA 2F53E 5T1DL 4BKLA 1T7ZA 2NNAA 1A5FL 2XZQH 4Y2DC 2LTQC 2GJ6A 1KBGL 1Z5LA 3S36X 2UZIL 4UDTB 5I9QC 1CFQA 1BP3B 5DSCB 1O7VA 3GSNA 4HMCA 5D7JD 5FB8A 1FSKC 4Q2ZA 4K71B 4ZPTB 2P8PB 1NC2A 4N68A 4P5TD 3KLHD 4WFED 1RUQH 4HEME 4OGYL 1FGVH 4J6RL 3EYUL 2MQ0A 3D3VE 3CC5B 2BVUA 1MCDA 3QIUC 4MNQA 5DJ2A 1MLCA 1BFSA 2X5PA 1UB5A 5F88A 3VD9A 3BP6B 4BELD 3UZEA 2YSSA 2YMXL 2CMRL 1I9RH 5HGAB 4BSVA 3K4ZA 4PRPE 1GJIA 3MLVL 3RIAK 1INQA 4Z6AT 4OSUH 3WFBH 5GZOC 2NCMA 4G8GA 4CU8A 1CICC 2VB5A 4MCYA 4N9GB 1QFUL 2DQUL 4Z7UE 2KQMA 5CP3A 3IJSA 5IHBA 1B9ZA 3GIZL 4DVRL 3QXDB 3RY4A 2ICWI 4KMQA 4HQQL 5BJTB 2OK0H 2XWTA 1MAKA 3BGFB 3U0PA 2G60H 5ACMA 2X1QA 4H20H 4GFTB 5E8DL 4U3CA 4NO0B 5DVOA 5SX5H 5EB9A 2OI9C 1B0GB 1SMOA 2F53B 5CEZD 4F15B 4L3EA 3OG6B 4MQXD 2EE9A 1TZIB 3QIBB 5E7BA 5MI0C 3BZ4A 4QTHB 2NLJA 4A2LA 1B88A 4H1LG 1A4JB 4PJEF 2P43B 3RIFK 2XRAH 1T03H 2BVOB 3DYPA 3VFNB 5I1EL 4S0TD 5H2BA 4CKVX 3SDXE 1BMGA 3OXSB 3MBED 5F9WC 2HFEA 3G6JB 3D3VB 4PLNC 1G6RL 3MRMB 2XXMB 4MCZA 1TJIH 2F5BL 3TJHC 1UC6A 3ULVD 3MGOA 2B20A 3DV6B 4JEGB 3UBXG 1T89A 4LDOB 3O11B 3BH9A 3CDYA 1QFWM 3HFMH 4PRPB 4PGEA 1IEHA 1G9NC 4ELKB 3DECA 4UQ2A 5I1IH 4C54A 2EH8L 2X4OA 5I15L 4XP4L 1H3TA 3AREA 3C60C 2YD9A 4PGCB 4Z7UB 1F42A 2MKLC 1FYHB 4I0PC 1JZ7A 3VGAC 3IKKA 4XTRD 4IOFD 3EHBC 1PJ9A 3IDGB 3WS3B 5J06A 2HJLB 3CFDA 3GSQA 3QYCA 4XC1H 3QIBD 4K23H 4MNGA 4NN7C 3CVIH 4LLYB 3HPJA 5JHDE 1NBZA 5IT2H 2XFXB 4P48A 3GMLB 4KHTL 3MRQA 4KKAC 2ZJSL 3TYGH 3NFPA 4FQ2H 4NN6C 3TV3H 4MWFB 5CEXB 3KWWB 5I1JH 2XICA 4YC2C 4P3CL 5DQ9A 2DYPB 4A6YB 4NHUA 1ERNA 4G9FE 4GG6A 4ODXA 2V2WB 1IARB 5A16B 1FNFA 1NCAL 2VSCA 1HOCB 2IQ9H 5BRZD 3SJVB 2IPKB 3NPSB 3SDXB 4JZNA 3SDDD 2D7MA 3DJ9A 4JO1L 2V17H 4TVPH 5IWLC 1FAKT 3IF1A 4HJJH 4Y19A 5ALCL 1EHNA 3WFEH 2ARJA 1CL7L 2AEPL 3D87B 3IGAA 4TPRH 3DMMB 3RVUD 3VMNA 3ALPA 1JF6A 4PJ5B 5I76B 1DSFL 4APQA 4ZFGL 3IDMB 2J88L 3OF6A 3SGDI 2FX8H 5KN5B 4XBEL 3C6LC 5GZND 3LN9A 3GBNH 4IRSA 2FR4A 4I2XA 5BXFA 2FRGP 3A0OA 1M71B 5CJ5A 1A1NA 2YPVH 1K4CA 4X6CE 2EKSB 2BOBB 5E1HB 2PO6A 5C9JA 1WCBA 1A6UL 1S3KL 4YHYC 1BVLA 1U8NA 2W9EL 1EO5A 3D39A 5TF0A 3KR3L 3HN3A 3EAKA 3DVNB 4DGIH 1JRHI 1MI5D 4J3TA 1KSRA 4FQ1L 2FX9L 1YC7A 2VN7A 3SJVD 3OKOA 5GS0L 3SKUD 1INDH 3WHE1 4NRXA 1EO8L 3CSPA 4KRPD 4LMQE 4GLRI 5SX4H 5TFSH 3VI3E 5FHAL 3VRLE 1UH4A 4S1SH 3LKNB 4OF6A 5ISZA 3SDCD 4XGZA 2VR5A 1OCWH 2IAMC 3SO5A 5C7XH 1I7ZB 5HHQB 4G42A 1WV7T 4LIQL 5GGVY 4PJ5D 3GKZA 2QADD 3CFBA 3LRGA 1FL5B 3LKPA 3QXWA 4Z0BH 4FQIL 1X6NA 5D1XA 4E9LA 4YHPA 4K07A 2XYCA 3D0VB 2CLRA 1DQML 3HUJA 5JDSB 4P4KB 1R5WA 3DIFA 4DUVA 3QIWA 4TQEL 1TITA 1YNLL 4FQXA 3HNTL 4LCIH 1NKOA 1GVIA 4RISH 4YFLI 5ESVB 3ZYIA 5C08A 5IVXE 2X2YA 2GK0B 3CPLB 3GEWB 2P44B 1NANI 2R2BB 4X6CB 3IDJB 3FO1B 1G7PB 3NIGE 3VXME 2YA0A 8FABA 4GMSL 4HIIA 1BIIA 3V5KB 2DQCL 1QLEL 2E27H 4R8WH 5D72L 5FKAA 5FKPA 3RY6C 3THML 2LABA 4HDIA 5HPMB 2EXWC 4PJ9B 1I7UA 5K59F 1HQ4B 4JFHD 1LO4L 3MUZ1 4QWWD 1T83A 3GDBA 1EMTH 5F97E 1LO3L 1LWRA 5L2KD 5HI3D 5IOPA 2VLKA 2BY2A 3EBAA 4N0YL 2BOCB 3G5YB 2JB5L 1MCWM 4WU5B 4HXAH 3BJLA 1SBSH 3VGBA 5DD0L 2AJUH 3ZDZF 1J1OL 1DBML 2ARJQ 4U05A 4I3SL 3G6JF 2I60L 2DBLH 4P4KD 4XNMB 3T77B 3LSOA 4QCIA 3MLWL 2AK1L 4MAYD 4P2QE 4UOJA 1EVUA 1N5AA 2VXTL 2R0LH 1KJVB 2WP3T 3RU8H 1CD1B 4L4VD 2VDPH 4N90E 2Q86B 4F3FB 4LRIA 4QGTA 1FN4B 5I16A 4DW2H 1S7TB 1FFPB 1OWRM 2X10A 5IFHL 2FZ3A 1D5BA 3TPKA 4XNZC 3EDDA 5I71C 1OARL 3MFFB 2X7LA 4OF3A 4Z7UF 5DWUL 4NCDA 4GH7B 3RWDB 4LP4A 5IMMA 1AKJD 3EZ8A 3ZYOA 4XXCC 2Y36L 3HC0B 1VERA 5DJ8A 1H5BA 1AGBA 4PJ9D 4RGNB 1G7QB 1BFTA 5CMAA 3VXMB 2ERJB 3U7WL 4XAWL 5B39G 3E6HA 4DKEH 5HGHB 2IPUK 5MERA 5MHSE 4PTUB 3U36A 3C5ZD 3QXUA 4XNQA 2DKSA 2NY3C 2P4AB 4R90L 1SMAA 2RR3A 2HT2D 2BY1A 5HDQL 1LQSR 3MLYL 3NFSH 2YK1L 3CXDH 4PREB 3X11B 2I07B 1KENH 5E8NA 2YKLL 4OFYA 1IGTA 3IYLW 3SDXF 2FB4L 3P4OA 4ORZC 3NCJL 1G7MA 1CFSA 4PJ8A 1LP9A 4NQVA 2I26N 4P2QB 3VA6A 4WV1B 4HX1A 1IGYB 4I8DA 4HCRA 2NY2C 3OR7B 5KVEL 4ZO7A 4IDLA 1M05B 3IJHB 2BNQA 5C07D 5HYSG 3PDGA 5F70A 5D70H 3ZHDA 2G9HA 4RGND 5DVMA 2ED9A 1XF4A 2J4WH 4U1JB 4G8IA 1KJ3L 3HAEG 4GLRH 3HE6A 5DEZA 3TZVB 1TJHH 5GS1A 4LHUD 3DGCR 4JN2A 3LN5B 4X7DC 1N6QH 2XKNB 3RWEB 5ACLA 1XGTA 2W59A 1HHHB 4FNLL 3WUWG 2V9RA 4NJ9H 2EZ0C 5C0JB 5GGVL 4YWGL 3ZTJG 5L88H 3DYOA 4OLVH 4LSUL 4MD4A 5I8KH 5L9DH 1IAII 4OT1L 3IFOB 4KJYB 5KVGL 1X5ZA 3WS6A 1C8PA 3BFOA 3GUTB 5GS0D 5F7DA 3GM8A 5FCSH 5F9DC 1XEDA 2R0ZL 4QY8B 1S7XB 1ADQA 2DI7A 3Q3GB 4MJ5B 1WTLA 1IC7H 1IILE 1E28A 4JHAL 1NANH 4OFVA 3L6FA 3BYTA 3QNYA 1YYMH 3WFDL 4IM8A 3SO3B 1ZA6B 3HZVB 5D1ZC 5GQBA 4DN4L 3HMWL 4L9DA 2GK2A 5BZWA 1ZA3B 4ZTOH 3BZEB 1MRFL 3QHFH 2Y07H 2N7BA 4G5ZL 5IB2B 3KXFD 1MREL 4HMDA 1CWVA 2F5AL 1FV1B 4NBYB 3OMZA 7CGTA 1OGAD 3BKCL 5DQJB 4N8VA 2Y06H 4N0UE 2XY2A 2DJ4A 4JFPB 1ETZB 4H5SB 1ZXQA 4KK8D 4DGYH 1J88A 1Q94A 5HVFB 2HJFA 4M48H 5JIHA 3T0ED 3UBXB 1X5XA 4NFDA 3RUGA 2Q76B 1MVFA 4WEBH 3EOBB 4KV5E 4L8SC 1MJUH 2X05A 1T1ZA 3FB6A 3H9SE 4ZNEE 3KYNA 4FFYH 3BEVA 3LEVL 4OD1H 4JGUA 4OFDA 3MRNB 4F37K 3TVMD 4KDTA 1Y6NR 3HPLA 3S3PA 3WLWC 3EYSH 2FATL 4HFUL 4P3DA 4Z0XA 4WI9A 4NQEE 1TTFA 4PJGF 4M62H 2VXSL 4HK3J 4RAUA 2YD4A 1TQCB 4PLJD 3HC4L 4JZOA 4RWYH 5F21B 1ORSA 4NDMB 43C9B 1R3LA 2UZYB 2JB6B 3PWPA 2XTJC 1HE7A 4F8TA 5CBEB 4NO2A 2XOTA 4IDJH 4X4YA 5CCKL 4M1CD 5EO0A 5LQBL 3D18B 3TO4A 1K4DB 2Z31B 2WINA 2VDQL 4YDIH 4AG4L 2AJVL 1NKRA 1HSAB 5F1NB 4NOFA 3DSNA 3EOAB 2VAAA 4ZD3H 1QFHA 2DIJA 1BD2B 5FO9A 3HI5H 4ZO6A 3UTQB 3QUXA 2ZP0T 5EIQA 1CXLA 3C08H 4JFZL 4FXGB 2IMMA 1KCRH 4YNYB 3V4VH 3FHQA 3MLRL 5DMGC 3P0VL 3ZE0F 1DFBH 7FABL 2YOCA 3P11L 4NM8H 1KCUL 3DSFL 2G75A 1D5MA 3GHEL 1A7PH 3F62A 1QVOB 1U8KA 2Z35A 2H3NB 4A2MA 4YO0A 2DLGA 4FFWC 1NDMA 5DD6B 5C09A 1FNEA 1W0YT 4S2SA 2GITB 3TBSB 1RMFL 4PJBA 2YWYA 1RV6X 2MQ3A 4NQEB 4DQOH 3PF2A 3PWVB 5EORL 4Y5VA 5EOQH 3RZCB 1DEEB 2BRRL 1DN2A 3PXHA 4I9WE 4ZFZA 1YDPA 4P2YA 1ZLUK 4LLMA 3QT2A 3LRSA 3C6SA 3NTCL 4JHBA 4HZAA 3ARBB 3JTTA 4X6FA 3KPPA 1CFNA 2R1YB 1C5CL 4K55A 1B0GA 4NPYB 2AEQL 2F53A 3ZT7A 1UJ3A 1HHKA 1X5GA 4D9QE 5CJBA 2OXGA 1A6ZB 1FLTX 1BD2D 2A6DB 1AD9A 1T1WB 1UKSA 2HLFD 4QTHA 3WIHL 3AROA 4MXVE 1EEYA 3VGDA 2D03H 3QEGH 4HFWA 4ONFL 2EXYC 2HT3C 4U1KB 1X3DA 1IAIH 3VFNA 1KB9J 3QEHA 5JLZB 1BJ1J 3FMGL 5HTSA 3UCRA 1V7ML 2O93L 1MCRA 4QHUB 3OXSA 4NJAH 1R3JA 4ZUVA 5EH1A 3VXSB 4ZAKA 1JE6A 2MCPH 5DUBA 1K8IB 4HJ0C 1AR1C 5KS9E 1QEWA 1QHOA 3VFRA 3I75B 4MJ6A 1ZVYA 4KTEL 4Y5XC 2A73B 3R8BB 5I75C 4YPGB 4OQTL 4FFZH 1Y0LA 2NX5A 4OV5A 1T1XA 2K3TA 5TQ2L 5HHOD 1PX3A 3V5HB 4WO4B 4N1CA 2PTVA 3QG7H 4XBPB 3TWCH 1EHLH 3MYZA 2WK2A 4P9HC 4XB7A 3VI4E 1C1EL 2IH1A 5HYJE 3FT2B 5D6CB 4HWBA 2E9WA 4GKZA 4PB9L 2YD7A 5DHVH 1UYWL 1F2QA 1L7TL 4QHLB 5GRVL 3F7YA 1PYWB 4LARH 3RNQA 3VXNA 4LLYA 2NY6B 5D2NC 2WNGA 2FH8A 3R0NA 1I1YB 4GOSA 2X4UB 4NQDA 3KJ6L 5CEXA 4I3GA 1DEDA 5EU3B 3ZKXB 3QH3B 2DYPA 5IB3B 3FONB 2AQ1A 1T66C 1R3IL 4IMLB 4M9PA 1A6TA 5DMIH 3QXTA 5A16A 2J8UE 4HKJA 4LKCB 1C08B 1HOCA 1A7RH 2BERA 3VA2C 4NKDB 3QNZB 2IADA 1SJHB 2X44D 1JFQL 5MEQA 1AI1L 3PWLA 5IBTH 4MDJA 5IHLB 3PP3H 1MEXL 4LDEB 1ODAA 5KS9B 5IFAL 1DBKH 2X70B 3N06B 2VLLB 1NSNH 4LLVA 4M9OA 3UJTH 2BSRB 1A3RH 2AERT 4Q58C 5KVFL 4LLWA 4XNUH 4KZEL 3VWKC 3LB6D 4HUVB 1M71A 4XNYL 5B39B 4JPVL 4JDTL 1XH3B 3V0VB 4HJGB 1S7VB 2ZG2A 2RGSA 3LPGA 2BSTB 1N0XH 4GKNB 1CD8A 4KXZH 1A7QH 1J9CT 5JHDA 4LNRB 1M6OA 4XCFL 1FORL 1FFNB 2A1WH 5SWSE 1RUKL 5C0IA 2Z92B 4N1EA 2ZG1A 3GMMA 2C4XA 5FYLL 3T08A 1E4KA 4LQFL 3OHXB 4UOW0 5H94A 4Y88A 4G9FA 2A9NH 3MV7D 4XNXL 1Z3GH 1SJEB 3LKNA 2J8UB 3QUYB 4LVHC 1PD6A 2XXCB 3VXRE 3PL6A 4LSPH 3MR9B 3UO1H 3V52H 2FJFA 2HKFL 4DOHE 4PB0H 2QHRL 1A1OB 2J6EH 3FFCD 5L8JB 4UB0H 3VFGH 4HGWA 4ODTL 1NGWB 5IFJB 5TPWH 2VH5L 4KK6C 3RVWD 2AEWA 4Y16A 3E8UH 3GRWA 4ODVH 1PFCA 3HZYB 4KI5D 4POZC 3D0VA 2VL4A 1UH2A 4U49A 3O2DH 4MA7H 4AJ0A 5JXED 5A3IC 4DN3L 5ICXB 1F8TH 4EDXA 1BQHA 3O6FD 5E8PA 3B2UD 4PJAA 5DC4B 3FN3A 4XT1C 2FEEL 4GAFB 1T6VN 1SY6A 2FHFA 2IFFH 4P23D 1IAMA 3UYRL 2Q7NA 4AT6B 1BQLH 35C8H 1PBYA 3IDJA 4X6CA 5ERWB 3VGFA 3FO1A 3BW9A 2F15A 3NZ8A 4JGJA 5CD5C 4P46B 3TBTB 5T3XE 1BWMA 4U6VL 3I2CH 4LLQB 4QXUH 4HUXA 1I8KA 1FVEB 5E03A 5IMOB 2NY7L 1A7OL 4CW1B 1MCPH 5I66B 4BFEA 5BS0A 3OKNA 2E7LC 3MJ8B 1Z9MA 1IBGL 4NT6B 5F3HA 3T2NL 1KPVA 4ESKA 2ATKB 1GGBH 4UNVA 1HCFX 1UENA 2VLJE 3MRPB 4NO5B 2AGJH 3VFOB 5CKAA 3DV4B 4R4FH 3VMOA 5DYOB 1DBJL 1KIRB 1KJ2B 2IQAB 3VXRB 2YXFA 4Y8DC 2XA8H 4LCWD 4WU5A 3VFUA 1K2DB 1P9MC 4IEFB 1AGEA 5J1AA 1T89C 3SCMB 2HMIC 3IXTB 4NQXB 3A6BL 3HR5B 3STLA 2A6KA 2B2XL 4V1DD 2WBJD 1RPQA 2QQKH 3QO1A 4QYOA 3NA9H 3PWNA 3CFJA 3ARFB 3U2SB 5FUOL 1X4ZA 4YDLC 1EHAA 4BH8A 1A9EB 4XCEA 5D5ME 1FDLL 3EJYD 2PR4L 4XPBL 5T33L 2L0DA 4JM2D 4Y5YC 2A9MH 2LVCA 2VDNH 4PY7A 4E41D 4MDIB 5JW4N 1KXVC 4HWUA 1Q9OA 4PRIA 1F6FB 3L95B 1CD9B 5DI8B 3IAPA 4N1HB 2Q8AL 1LDPL 4OKDA 3CZJA 1Q9KB 5IVXA 3ULUL 3Q6GL 6CGTA 2ZCLL 5EZOH 4Q9BA 4DGVH 1NFDB 3UTPE 3O41A 3TT1H 5H8DA 3ROOB 3CNKA 2JELH 1BGXH 3UTSD 3I6LE 1CE6B 4FG6D 3WIFB 2D7PA 5D9SA 3WXWH 3WMSA 2FHBA 5FUZH 4U1MA 4JFXB 4LPWA 1B3JA 3GMQB 4JVWA 5F44A 1VFAA 3BP7B 5T1KD 3SCMD 3FRUA 3KGRA 3B6SB 4M02A 4MXVF 4UV4L 3GSXB 5CINL 4K9EH 2VDOL 1CFTB 2VLJB 4XP1L 4PREA 4CN1A 1YEGH 4MZ2A 3T0XA 1JZ4A 3H7BB 1TQBB 4HMEA 1J8HD 1MCCA 1MHPL 5ALBL 3RI5F 3SE8H 1RZIB 3WUZA 1ES0A 2ZSVA 3LQAL 3KPQA 3CVHA 2YUVA 4UBDD 2DS4A 1I75A 5EIIA 5CJ8A 1IAKA 1OWWA 3FB8B 1UACL 4HF5H 5KS9F 3OX8B 4YFDB 3D25B 3BT2L 5DF0A 1G7LA 1OTUC 2OTWA 3N1MC 4U1IB 3HHRB 3ARDB 3OR7A 5C8JA 1PZ5A 3IJHA 3P30L 3KPSA 1P6AB 3CAFA 3P9MA 4F58L 1GC1H 3O4LA 2VITA 5KTEH 2E6PA 5C0BE 3LS5L 5AG8A 5ESAA 1YJDL 4KI5F 2WP3O 3VI4F 4BFIB 3UPRB 1T2QH 1IM3B 5F9AC 4Y4HC 4PJCE 3EYOB 1B0WA 3HG1A 2J12B 2DWDA 3DBXB 3GIVA 4TNWK 5E94B 1FL3B 4G8FB 3SQBA 1KC5L 2ADGB 4NZTL 4GS7C 4OF8A 5I19L 3CDCA 1A9BB 5FYLD 1AGCB 5I73B 2LU4A 4JQIL 2BVTA 4A6YH 2EH7L 2ADFL 1AO7E 3G04B 3L9RB 5ID1A 1CL7I 3OAUL 4RA0C 2LE9A 3MV11 5EA0H 4KTDL 3S4SA 4PGDB 3VXOB 1SJVA 1LNUB 4OM1H 5T1DH 4V2CB 4MXWH 1S7XA 2O5XL 4ZYKA 3FQTA 1JYNA 5HD8D 1A5FH 3Q3GA 4JFED 2J8UF 1CBVL 2C1OA 5D7IE 2OTPA 4LPTA 3QJHA 2JJSC 2JF1A 4BZ1L 2RQ8A 3ARDD 2R29L 2NPLX 1JI2A 1RUAL 4YHZL 5IQ7L 1PQZA 3VG9C 4GXVL 4KK9C 1NJ9B 5CD3A 3HZVA 3BISA 4U0QB 5KAQG 1WC7A 5A40E 3GB7B 2X40A 2EDQA 2Q3AA 4LFHG 4XRCA 3BKYH 5J12C 1L9MA 2DTML 3FO9A 4FS0A 5CGTA 4ACPA 4LAJH 4M93C 4MAUH 1ETZA 4LSSL 1MOEA 3WFCH 4PD4K 4L4TD 4MS8C 3ECBB 4QRSA 5C0BB 3F8UB 4B7LA 1EAJA 2Q76A 1PSKL 1JZ5A 3ARUA 3DGGA 3EOBA 1WFTA 3VGGA 1YUHA 4JFFE 3RX8A 5GJTL 1EPFA 4PBXA 1NAMB 2A83B 4PJCB 3RL2A 4M03A 4ZDHB 4DK3A 1I8LA 3ESUF 2DLEA 3GIZH 2AP2A 3REVB 2EDTA 5HHXL 5BW7A 5KJRH 5BQ7B 3RL1A 4HIHB 1KNOB 2PYEA 4ZS7L 3ZE2E 5ESQB 3IDYB 3UC0H 1LO5B 1RJYB 2F54E 2IG2H 5KVDH 4RNRB 3W5MA 2PXYB 2IBZX 4QGYA 2V6HA 2BNRD 4Z77A 5E8DH 5CLWA 1K3IA 3TBVA 2WANA 1S7RB 2EDEA 5T3ZL 5IJVB 1S5IL 4LSTH 3AY4A 3EDFA 4H8WL 2FLRT 3QDAA 4J7RA 4LF3B 1EBAA 3RWCA 1YEJL 3BHBB 3Q1SL 2VABB 3D18A 5HI5D 3DXAB 1S7QA 1ONQA 5F1NA 4XMKL 1JWMB 1ZT7B 2BVPB 3IRZA 4PLKD 4QXGL 3ZSTA 3O6ML 3EW3B 4LVEA 1F00I 3MA7A 5KVMC 2GJZB 3MCLL 5C3LD 3F7PC 1N0LA 4FXGA 2HWZL 1NCCL 2R0WL 4N0UA 5DD5H 1MJ8L 4YNYA 4NZUL 3W0WA 3CSGA 3AU1A 3U30C 5F8RC 4OB5H 5LGJB 4P5MA 4HT1L 4NM4L 2ADJA 3VXPA 3ULUD 2DQDH 2R2HA 2X4NB 4JFFB 1RHHA 5GGRA 5IBLD 2AQ3A 3D48R 2DQTL 3H9SA 4ZNEA 5DXWA 4EI5C 5I15H 4XP4H 1S9XA 5D71H 2PXYD 1L7IL 3KS0J 4OFIA 1NFDF 2H45A 3QI9A 4GG8B 3JWNC 1JTOA 4PRBB 2PW1B 3EFDH 4UAOC 2AV7A 4ZXBB 2CDFB 3TBSA 3H8NA 4YEFA 3QXVA 2MWCA 1V3LA 4ZPVA 5H37G 3MNWB 4WHYH 3F7VA 1CZ8H 1DTUA 2OZ4A 5FA4A 4PRHD 2HVJA 1KJMA 3S9DB 5IJKC 2NXZB 2XZCL 1ZHKA 4GRLB 4XMLL 4H0HB 4YHIA 3QHZH 3B9AA 3F6LA 1IM9B 5CZXC 4R96A 1DQJB 4R0LA 1IEAA 4KY1H 4Z76B 4LLDB 4JB9L 1AXSB 5E24E 4YDKH 3HZMA 1IEBB 2HFGL 3HE6C 4CVZA 1NEZG 4AIZB 3CMGA 3O3EA 3T0VA 2AVGA 5GGSA 3UJIL 3OKKB 4JO1H 1U8OA 2HFTA 4MMXC 3PGCB 3V5DB 3GO1H 1TCRB 3OKLA 4QHUA 5DS8B 5CJQH 3V6OE 1P2CB 5J11C 1HILA 1TDQA 4UILL 4XCNB 1ED3A 2J8OA 5DJXA 5CP7A 3HMXA 5DK2A 3I75A 5IVZA 5EOCJ 4ZXBD 5FF6A 3QEQB 5AAMA 4YPGA 4M6AA 2IWGA 1U3HA 3ARYA 3PJSA 3CXHK 4HXBH 1AY1L 4Y2OA 3TNMB 4HKZA 1J11A 1UEYA 4NNYB 4WO4A 1OM3H 4QRRD 1EJOL 1H3PL 1ZTXL 1Q1JH 4LU5H 4GRLD 1A6UH 1S3KH 1A4KA 2ORBH 4HLZH 3WXVL 3U6RA 3KR3H 2C3VA 1A1MB 3WDHA 3S34L 4HWZA 4MXQC 1D6VL 3QQ3A 2B4CH 1U93A 3EYVA 5EOTB 1J1PL 4D94A 1RZ8B 1LEIB 2X42A 5DJAB 4Z7WA 3HI6H 1EO8H 5EU3A 2EDLA 3QRGH 5FYKU 5JQ6L 1NH6A 4FMKA 4KDWA 5FIEA 2V5SA 4PRAA 2HT4C 1ZHLA 4WJ5A 4Y4KA 3B83A 3D2UD 1NLDH 2VDLL 3QEUB 2HG5B 3SGJA 4HAFA 3GI8H 1KLUA 4OZGF 4P5TC 4EOWL 3MYJB 4WFGD 1GOFA 2VKWA 3BN9D 2C1PA 1QQDB 2Y72A 4FQIH 4K94H 1J0ZA 2VLRB 3ROLA 5TJWK 9CGTA 5DURD 1XF5B 1CI5A 5CGYD 4X4XB 5IMKB 5CSZA 5KSAA 5EBMB 2MOVA 5EU6B 2GTZA 5K9KA 2HFFB 1MWAA 4OZFG 1HKLH 1JF1A 2AJSL 1YNLH 1CIDA 2BVEA 4XH2B 4JFDD 4PJCF 5F3BA 5CGMA 4C83B 4EN3C 1K5NA 5DQDL 1G9NL 4HIXL 3H42L 4QHNA 3ULUF 3I6KA 4BZ2L 3UTTE 1A47A 3AS0A 3KPRB 5HYJA 5IEKA 4HUVA 1ZT4B 1I9JL 5IHUL 4GMSH 2GUOA 5HSFA 2ENYA 1XH3A 1LGVA 3UEZA 4HUWA 2DQJL 2DQCH 3OAYK 1S7VA 1QLEH 4WI4A 3THMH 5T3ZD 3OR6B 5CHNB 5BVPH 3IJYA 3CSYB 3V4UH 3MRDA 5LBSL 4IIQB 3FOMA 2FO4A 4JO2L 1SM3L 3TN0B 1MFDH 1I3GL 4K71C 3IFLH 4MQXC 1LO3H 5C07E 3TM6A 4L4JA 2D7TL 3EYFB 3OB0H 4POUB 4N0YH 4X5XB 1WBXB 2CK0H 4P5KB 1FVCA 3V2AR 2VLRD 5DTFB 3N1FC 2HKHH 5EPMA 4I3SH 5E6ZA 3V6ZB 1I8IA 5EU6D 1EGJA 4YHML 1LILA 2AK1H 4PTTA 3S37X 2VXTH 5BZDB 2BMKA 2DIAA 4IMKA 1RAMA 3WE6B 5TDOB 4P9ML 5IBUB 2M8XA 5TDNB 3E2HB 3DLQR 1ROWA 2DLFL 4QLRA 4YGAB 1A64A 3AS1A 3DARA 1CLOH 3LY6A 3K7UA 2GFBB 3KPRD 3BGFC 5I1KH 3QUZB 5DWUH 2JJTC 1W2KT 3CH1B 1W72A 1ACZA 3ZE2F 2ITCB 1MLBB 2PN5A 2MHAA 3UTTB 1MPAL 3MLXH 4XTRC 3SBWA 4F15C 2X4RB 4WW2F 4NUJA 2E3VA 2Q87A 1KIQA 1OF2B 4RZCB 3PQYD 1PLGL 1FVEA 1ND0B 1JPFB 5E5MB 3QWRD 1P7QA 3L5WB 4R90H 2KZ1B 3C2AL 3R8QA 3KJ4B 5HDQH 3KPTA 3CDFA 4YDJA 4QEGA 5SWSA 2YK1H 3Q0HA 3IU4L 3O2VH 3MJ8A 4WTZA 2DM3A 4NT6A 4DFIA 4Y2DD 5AZEH 3VRIA 2YBRB 2OR9H 3MRPA 5DEGA 3P73A 3V6FA 4YBLB 4PJ7F 3ILPB 5DYOA 4EXPX 1KJ2A 2FSEB 1HWGB 1DN0B 1YPZB 3RWFB 3FQNB 1OAYL 5I18L 4XAKE 4ZTPL 3C9NA 3QIUD 3KYKL 3MUJA 5KVEH 3UTOA 1JV5A 4FQHA 3DUSA 1C7SA 2YC1A 3RVUC 4Z78A 3L3GA 3RJQB 3RDTB 5JDJA 2XKSA 1A22B 1CICD 1MRCH 3L95A 2H9GB 1HINL 3BQUB 2X09A 1HHGA 5DJ0B 3ZE1E 4KVCL 3RHWK 4JR9L 4KZDH 4HC1L 4LCYA 4YWGH 3S97C 2JIXB 4LSUH 2XA3A 3P77A 3TH3T 4BSWA 2ADIB 3D5OF 3DO7B 4TUJA 5JW5B 5E2JA 5KVGH 5EN2A 4NHCH 3U0TA 4I77L 3SOBL 4C56A 2DQIH 6FABH 1ZMYA 4Z7NF 2DD8H 2H8PB 4OLWL 4AEEA 2I5YL 3ZT6A 4FA8A 4Q74A 3NPSC 5E2UH 3GMQA 4XZUB 3JV4A 4DFHA 3O3DB 3GSXA 3ZTNL 5E1AB 3QJFB 1HEZA 4JHAH 4O02L 1HSBB 3NN8B 4E0RA 3MRHB 3K2UL 1R5IA 3RGVA 4PG2C 1IQDA 3HC3L 2VUYA 1O5DT 2EYTA 1KYOJ 3WFDH 3DMMC 3ARVA 4YC2B 1P1ZB 1IGML 4UIKL 1DQQA 3ET9F 3HMWH 4LBEA 4OI7A 3DX6B 4MQ7B 4G6FB 1Y18B 2BC4B 4JANA 4PV8A 3TT3H 1MREH 4AH2B 2F5AH 3QDGA 1QSEE 4J12A 3FB8A 3TJHD 1QSFD 1RK1A 3B2VL 3MV8E 5D5MA 1LO0H 4U1NB 2AJYL 4UQ3B 3NCCB 3L3DA 3RA7L 4H25B 4JRXA 1LD9A 1RFDL 2DLIA 2H1PL 1A14L 2NW2A 5I17B 4J1UA 5IQ9A 3BGMA 3GSOB 3HB3C 4IRJB 3LEVH 5ADPH 3TH2T 3C60D 4HW6A 4I0PD 3AXLB 5MEPB 3BWUC 3L3OB 5T1MB 5TH2B 4HFUH 1R3KA 1DQLH 5HYQB 5LCVL 5FCUH 3DBXA 4G3YH 5IIEA 2F74B 3VXUE 1X5YA 3HC4H 5D7JA 4KKAD 2V2TA 1VGKB 5EO1B 4Q6IB 3OJDB 3QG6B 3IETB 2Z8VC 5D7KE 5HGDA 3U46A 3G04A 2C4FU 3L9RA 5ID0B 5CCKH