3QIUD

Crystal structure of the 226 tcr in complex with mcc/i-ek
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
242
structure length
238
Chain Sequence
b'MKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPADSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K alpha chain
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 50
structure length 238
sequence length 242
ec nomenclature
pdb deposition date 2011-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuD01
5C09E 4G8GD 3H7BB 4HPOH 4RQQB 1QSVA 2KUTA 2P5WB 3DX8B 3W39B 3X14B 5T1LA 5E08L 4JZJA 1GRWA 2V2TA 2X4NB 3U7YL 4MXQC 4OF7A 3U0WL 3WLWC 5BRZD 3BH9A 3WO4B 5CFHA 2B1HL 4A2LA 2OX5A 1NBVL 5ANMB 3K8KA 1C5DA 3S98A 1J0KA 4FTVE 2Y06L 2AEIT 2Z92B 3AUVA 3WO4C 3QG6B 2WMPA 3HMWH 3KAAA 2AK1H 3TC9A 4JRXA 1IAIH 3L3JB 1MFDL 3D85A 4YK4B 3G5XA 1ACZA 3C6LA 2I60L 3J7HA 1JMXA 5A2IH 5IMKA 4CBPA 3TH2T 4XCFH 5IHZA 3HZYB 1KB5A 4YK4C 1KJVA 3RKPA 3B9KA 4E41A 5ID1B 2JIXB 3BHBA 2CR6A 2GSIB 4OZIB 1UXWB 3QR2A 2CR3A 4ZG1A 1AXTL 1CWVA 1I1RA 2IWGA 3MRJA 3IRPX 5IM7A 2DRUA 5FYLH 2BVYA 4EI5A 2VTFA 4JFQB 4MDIA 1LEIB 5C0CB 4M5ZH 2ICES 3S34H 2KH2B 1ZHLB 4HWNA 4FS0A 3MBEB 4G8GE 5E8EA 1WISA 1SY6L 1MUJA 1YDPA 3UCRA 3LEXA 5E4EB 4B41A 5DMIH 3F7YB 4N0UE 5ERWA 2UZXB 3L3IB 3WKML 4X5XA 3MBEC 2V2WB 4MXVE 4RA0C 5E4EC 3IAPA 4QRUB 3CK0H 4CMMB 5KSVB 3TCLA 1J8HD 1OCWL 4IDLA 2VXUL 1MHCB 2PCPB 3MV7A 2HFEB 3K2MC 5INCB 4S11A 1DN2A 1SJEA 3KG5A 4YBLB 3U4EA 3QWOA 4KTEL 2ZUVA 2ZCHL 4TN9A 2DJ4A 1K85A 2FO4A 4RAHA 1M05A 5T1LB 4JZJB 2V2TB 2LFGA 5BXFB 4YBLC 2F5AL 3BH9B 2VABA 1C12A 1Y6NR 4JN2A 1EBAA 4YFLF 3GJFA 1CLZH 4JZJC 3IETA 3EYVB 4TYUA 1F4XH 1C5DB 4CU8A 3KPQB 4L3ED 4GRMA 3L95A 2FBJH 2FLRT 2VXVH 4MQTB 4D8PA 4JRXB 2WP3O 1G0DA 3D85B 3G5XB 3OAZK 2AJVH 4ZO6A 3C6LB 4YZFF 2HKFL 2E9IA 4Q0XH 6CGTA 5ACLA 5IMKB 1OF2A 1DBJH 2DYPA 5IHZB 5KAQF 2J6EL 4RDQG 1KJVB 3B9KB 4TUOA 4E41B 3C6LC 5EULV 3BHBB 5TE7L 1XF1A 3NFNA 1AC0A 4IM8A 3ES6A 1FORH 5EO9A 1L7TH 4K7PX 1EFQA 3B9KC 4R8WH 5IM7B 1NUGA 2VZ1A 3P9MA 2VITA 3ARVA 1ADQH 4FQHA 4JFDA 4MDIB 5GS1A 3VGAB 2VDPL 1LO5A 5IUSA 2WWKO 1LK2A 3ALPA 5E8EB 3V4PL 1KCRH 5FEBA 4NM8L 1CS6A 1YDPB 5K9OA 1S7VA 5IGXH 1DUZA 3LEXB 4HLJA 2F53D 2NYYC 1OAZH 3VGAC 5ERWB 4PUBL 5FYKU 1CICA 4X5XB 3WS3A 5JMOC 1GXEA 4HFUH 5F7EH 4HD9A 2YOCA 1FZJA 3NCYP 3TWCL 1BBDL 4JO3H 3TCLB 1YY8A 1QSEA 1NGQH 4C55A 4L3EE 2R4RL 3MV7B 5L0QB 4DW2H 5FM4A 4PRPD 1SJEB 3U4EB 3T0BA 3QWOB 3QZWA 4MZ2A 2JE8A 2FO4B 2HVJA 3UTTA 1JWUA 2YXMA 5L0QC 4XP6H 4UT9L 2HMID 1U92A 3PV7A 5DJ2A 4JN2B 2VABB 1C12B 2F74B 3GJFB 1X3DA 5FO9B 3IETB 4NJAL 5DUPH 2OZ4H 5F97E 4KU1A 3DUSA 3KLSA 5C0RH 4GRMB 3L95B 4OFYD 5CSGA 5DMYA 3DYMA 4H5SA 5J3HD 2HG5A 1PDKA 2BHUA 2VAJA 4JVWA 4D8PB 4OTXL 2VUOA 4LVHB 2AKRA 4QOKA 1VPOL 1AY1H 1UA6H 3TO2A 3W11C 5E99H 4JRYD 1J1OL 1MAML 2DYPB 2W9DL 4H20H 1IT9H 4LVHC 1EDQA 2F53E 4LAJH 3TYFA 4BH7A 4Z7VA 4QRQA 4FMKA 1A1MA 4L4TD 4AQ1B 3NFNB 5EO9B 3ES6B 4L1DA 4XH2A 2ED7A 4Q9CA 5EDXA 1JUFA 4NCC2 4ETQA 3BAEL 1DBKH 3FMGH 4MCYA 2VITB 1T03H 4JFDB 4JLRA 1WFUA 5GS1B 2EXWC 2YMXL 4JFED 1JBJA 3PWLA 1LO5B 1LK2B 5DHYA 1MCOL 4OZFA 4DQOH 2XZAL 1S7VB 5K9OB 1DUZB 5GS1C 1J1XL 1BFVL 1CZ8H 4KXZH 1NLDL 5J89A 1CICB 3WS3B 4HDIA 5A3ID 4UAOB 1I8MA 1OARH 4MJID 1FZJB 2XY2A 3I85A 3NIGF 3VWJD 2BCKA 5FHAL 4HG4K 1WZ1H 1WWWX 3P30H 4P9HL 1BVKA 1QSEB 1YY8B 5CSBA 1CICC 1FJ1B 3HR5A 3GGWA 1U2HA 1KTRL 3HE6A 1YNKL 4UAOC 4P4RA 1EUUA 1QO3A 2ICWI 2CLVA 4P99A 3BEVA 2H32H 1RHHA 4Y8DC 3QZWB 2C3WA 3RVUC 2HVJB 3UTTB 5GS0L 3BSZL 4JDZA 1JWUB 2HT2C 4JRYE 3MLVL 2VERN 1G84A 1G7QA 1GGCH 2D7OA 3PNWA 5FCSH 5DJ2B 2Z91B 3EDJA 5DRXA 1RI8A 4L4TE 2ZG3A 1S8DB 4UNUA 2H41A 3DUSB 2HRLA 4UB0H 3VE0A 4F7PB 1VESA 4H5SB 2HG5B 1NDGB 1HH9B 3MXWL 2E27H 3QI9A 4YHZH 2AKRB 3VXPA 3IU4H 4JFEE 3TO2B 1R5IA 2I07A 5EZLA 5ALCL 1LGVA 4RWHA 5F44A 2W92A 3N1PC 3MLZH 5I76A 2HLFD 1CVRA 3TYFB 4EI6A 4Z7VB 4BH7B 4U1LA 5D93C 5GXBB 1U2CA 5GGSY 4XH2B 2EO1A 4M6MH 3H6JA 1JUFB 4ETQB 5IEKA 4MCYB 4PJXA 3QUKA 1GAFH 3O2DH 3QDGD 2V5TA 3PWLB 4UT6H 3RA7L 3U46A 5DHYB 3WIIH 4OZFB 1CDJA 1F8TL 3WFDH 4LU5H 4HW6A 2BP3A 2PO6D 2XA8L 3IT8D 2XACC 2DL2A 4P3WA 4WW2A 4HDIB 4UV7H 2YKLH 2GTWA 1I8MB 3AS2A 5E2JA 3FN9A 3SCMA 2BCKB 3N9GL 3RX5A 5M95B 1T89A 1U8KA 2AI0L 1BVKB 2ERJB 2YZ1A 3HR5B 3GGWB 4P4RB 2R2EA 5A40E 3DROA 5BZDB 1QO3B 5JPNA 1P4IL 2CLVB 3BEVB 2GJZA 2C3VA 1RHHB 1XMWA 4KQ4H 1OHQA 4XBPA 3SDXF 2ERJC 4JDZB 5E8DL 4I0KA 5JUEL 5HHMB 3FO0L 3GUTA 1EJ6A 1G7QB 3CFCH 3PNWB 5DRXB 1IGFH 4YQXH 4KK5D 1U3YA 3UTSD 3UJIH 1S7RA 4G7VL 5F6HJ 5D2LA 5I0ZA 1KSRA 4WHCA 4L8SA 2UYLA 5T1MA 4YH6A 1GGIH 4MZ3A 5HD8D 3QI9B 1QLRB 3L7EB 1HK6A 3QDGE 5EZJA 1N64H 1IEBA 1R5IB 2I07B 3N1MC 5EZLB 1IAOA 3HMXH 5B3JF 1SJHA 4TULL 4GRLB 2VC2H 5HI3D 3QI9C 5I76B 2F54B 4EI6B 3MLRH 4GMSH 4U1LB 2GY7B 5EOCH 5FV2A 3STZA 3DSFL 3DHMA 3QUML 4ZSOA 4M43L 5E2VL 2FD6H 4M00A 4GRLC 4R90L 2NR6D 5FUCC 3VD7A 5IEKB 1MJUL 4PJXB 1H3PL 3KPSD 4RMRA 4PFEA 2X4PA 5E9DA 4IOIA 4MHHI 1U8QA 1XF5A 1OM3L 2B1AL 1PBYA 4NDMA 3TLRA 2Z8VC 4OM0H 2IBBA 1UB5A 1F4AA 1KC5H 4XCCL 3U46B 3H3PL 2X1PA 4ZTPH 4F57H 3TV3L 4FXGA 4QRPD 3KPMA 5D1XA 1HNGA 2Y6SD 5FO7A 2AV7A 5KSAD 1IBGL 1QFPA 4WW2B 1JWSA 4LDEB 2GTWB 3UTSE 1A0QH 2Z93B 3SCMB 1HH6B 1N0XL 5D7LD 3U0TA 5E00A 1U8KB 4HZAA 4WW2C 3WIHA 5IQ7H 2R2EB 2HN7A 3DROB 4KHXH 3SCMC 3E6FA 1PZ5A 5JPNB 5DYOA 2AEQL 4BFGA 5DURB 1WITA 2GJZB 2C3VB 3WFEH 4KUCF 3QRFM 1T89C 1MFEH 1Q9WA 4XBPB 2BVTA 4MD5A 2M26A 1BQHG 3BFOA 4G7YL 1FO0L 3GUTB 4M93B 1G7HA 5HHQA 3RVXC 4TVPD 1NCBL 1S7RB 2XXMB 1MLBA 5D2LB 3IB4A 4FG6D 4U6XA 4M93C 3LQAC 1PKQE 4L8SB 5IBTL 3DXAA 4RGMB 5T1MB 1TJIH 3KPSE 4JO1L 2FX7L 4LAQL 1G6VK 4IJ3B 4JFZL 1IEBB 4BUHA 4L8SC 4RGMC 2AEPH 1IAOB 1MEXL 1SJHB 3D39A 4NHUA 4IJ3C 5FDYA 1HSBA 1JMZA 2RIKA 2H26B 5D7LE 2XA3A 4NO2A 1OP5K 1BFTA 3ZYIA 3TNMA 4XVTL 1XGTA 3RWJA 2X4PB 2DQHH 5E9DB 4H0HB 2BSRA 4IOIB 1U8QB 1QSFA 4HFWA 4BZYA 4MNGA 5GGVY 3HNVL 1UB5B 3LCYA 1EHLH 3S9DB 1L0YA 1XGYH 2DD8L 4FXGB 3EIFA 5DD3L 3KPMB 5D1XB 5FO7B 2AV7B 3EGSA 1JWSB 1CT8A 4TVPE 4YC2B 3U0TB 4KROD 4FNLL 5D1XC 5E00B 1DE4A 4NT6A 3X3GL 3O8XD 3TPUB 5HPOA 4HH8A 1Z0NA 1FRGL 4PGZA 5FM8A 3MV01 4W68A 2HN7B 4YC2C 1OTTC 1PZ5B 4OSUL 2OMNA 4LLAA 5DYOB 3JWDL 4NPYA 1D6EA 1YEHH 3CSBA 1NLBH 1INEH 3GI9L 4MD5B 4I13B 2VDQH 1IC4H 1GGBH 3RVWD 3GKWH 4YDLB 3SDAD 1G7HB 4AJ0A 1N5YH 1YPZA 2NQCA 3IFPA 1MLBB 1TVBA 2BX5A 4OFVA 4N8VG 4YDLC 4U6XB 1SQ2N 1YECL 4GRWF 1BEYH 5KS9F 3DXAB 1PYWA 5I1EH 2X89A 2I26N 3O6LH 2R9HD 5IW1A 3E8UH 3EFFA 2WV3A 4OIIH 1MRDL 1TZIA 3SGDI 1B3JA 4MS8D 1TQBB 4NQDD 4F37F 4ODTH 5MENA 3D39B 2W91A 3DMMA 4XRCA 1QFUL 3LEVL 5FDWA 4WENB 3FT4A 4P46A 4NM4L 4HBQA 1K4CA 5ABDE 1TQBC 1HSBB 4QTHA 2PXYD 4I3SH 4DTGH 3PWUA 2BXYA 4M8QA 3TZVD 4WTWA 1CGSL 4NO2B 5IESL 1DQLL 3QAZB 3TNMB 3ZKXB 1XGTB 3MXVH 1QTYT 3D3VD 2UVFA 2BSRB 1QSFB 4QHMA 4HFWB 3U1SL 2F5BL 4MNGB 4KPHH 4OZ4A 1PAMA 3QAZC 3ZKXC 1UVQB 1JPGA 4JY5H 1JL8A 2JELH 4K94C 2OK0L 4U7SA 3HHRB 3EGSB 4GKZA 5FCUL 3U9PH 5I16A 3MLXL 1B2WH 1CT8B 4K3EH 1P7QB 5DS8A 3BGAA 3QIWA 2BJML 1CD1B 2X4QB 4LVOB 5EFIA 5B21A 1DE4B 1RZJL 2D7QA 3CFBA 4NT6B 3P3YA 4BZ2H 4X6EA 4KV5F 5A16A 2XN9D 1CFNA 4LASL 4S1RH 1GPOL 4XBEH 1MIEH 4AYFA 4NPYB 2CRMA 4LVOC 1D6EB 2E7HA 1Z6JT 1OP5H 4NQDE 3HG1E 5I73B 2NY0D 5FB8B 2BSTB 1X4XA 1ZVYA 4EUPG 3U36B 5F7WC 1F5WA 4FZ8H 3HUJA 1TVBB 4Q6IA 5I73C 3GBML 1DANU 3C2AH 5AZ2L 1FLTX 1PYWB 1WAAA 5IROA 3VG0H 3D3VE 2C9AA 4U1HA 1QFHA 2G2RA 1IAIM 5IW1B 3EFFB 4GXVL 1AQKH 3IKKA 2CPCA 2A6KB 5ITBL 1TZIB 1BLNA 3U2SA 1BQLH 3ARXA 5MENB 5SV3A 5LVEA 3DMMB 4EBQH 4XRCB 1LO0H 4FP8L 5HHVL 5FDWB 2G60L 3FT4B 4P46B 4G42A 1K4CB 4FFWC 4GG6F 4QTHB 4S1DC 4CVZA 1IGIH 3DMMC 1AGEA 2BC4A 4M8QB 3GHBL 2AXGA 4J23A 1P4LA 4JE4B 3P40A 4H88L 2YRZA 2K3TA 5K9QI 4P46C 8FABA 5IHBA 1W72H 3O3EA 1MRFH 3SGJA 3NABL 2VXSH 3LH2L 1YNLL 4KMTH 2XN9E 1SJVA 3ARDD 1SM3H 1FG9C 2VDOL 4WCYH 4QHMB 12E8L 1UKSA 1YQVH 5IVXE 4OZ4B 3VJ6A 2N1KA 4WTZG 4D94A 5C0BA 1CYGA 1JPGB 5JORA 1IQDA 1EEYA 3GBNH 2IQ9L 2YD3A 1CXFA 4P5MB 4N8PA 4K07A 4GKZB 4NQVA 5I16B 2EC8A 3WXVH 2ED9A 2FJFB 5DS8B 4Y4FA 3QIWB 4FQ2L 1CGWA 5EFIB 3L3GB 2N7BA 3CFBB 3TH4T 4EXPX 5CGTA 4S2SA 4X6EB 2VDNL 4ZOCA 5A16B 1D5IL 4HG4J 5KBNC 2ZUQB 3ZKND 1OGAD 3MPCA 3VH8G 3QIWC 5CGMA 4GXUN 3FONA 2UZIH 4ZO9A 4KJQD 3GRWL 3O11A 2BSSA 2ZUQC 3MMEA 5DJ6A 2A0LD 1P69B 2HKHH 2DBLL 4LPYA 4XHQA 3LSOA 3BMWA 1CFQA 4YHLH 1BJ1J 1OD7A 2CK2A 4PY8I 3HUJB 4ELMA 4Q6IB 2C4FT 5D7IE 2DI7A 3HC4L 4FN0A 4Z7OE 5DVKA 4J7RA 3RVTC 3EJYC 4HIHA 1CU4L 2LABA 4U1HB 2G2RB 1G9NC 3EYSL 4Q6IC 4QRRD 2HTKC 1BLNB 3U2SB 1OAKH 3HZVB 1CLCA 3V6FB 3B5GA 1BBJA 5A2KH 3QO1A 1KNOA 4U6VH 5EB9A 3LZFH 4G42B 4HPOL 1E27A 1OVZA 5JHLL 1KIUA 4V1DB 4OF0A 3X13A 4CVZB 1AGEB 1K8IA 2AXGB 1P4LB 4R96A 4XNQA 2F19H 8FABB 1UWGL 3O3EB 2ZWLT 1WVZA 1MJ7H 1JGVH 2WIIA 4PV9A 1KJMA 3VJ6B 3V6OA 4KJWD 3SKNA 5JZ7D 3SGJC 5JORB 1IQDB 2DQEH 2HRPL 1EEYB 3MRNA 2LU3A 2D03H 1JVKA 4NQVB 2KZ1B 3EDFA 3LEYH 5KSBA 1VGKA 2NX5E 4Y4FB 1A6WH 4OF8A 1I9IL 2I27N 2HAZA 2PTTA 1AJ7L 4MNQA 4S2SB 5B4MC 3MRQB 3BP7A 4Y4FC 1LO3H 1SJXA 1XEDA 3TEUA 2AJSH 3FONB 4ONGL 3BT2H 4L5FH 3FQWA 5DK0A 5FYLL 2C5DC 1VFUA 3O11B 4XCEA 3FFCD 1DLFL 2BSSB 1AKJA 3MMEB 3JUZA 4M5ZL 2P49B 4EDWL 1C7SA 3LSOB 4X4ME 1CFQB 4I1NB 1AR1C 5CILH 5I1GH 3GSRB 3K2UH 1OAQH 4PJFF 4ZUWA 4O00A 4ELMB 5JPMA 3AFLA 3HLAB 1PQZB 2DQIL 4HIHB 4QY8A 3ULUC 3P2TA 2X7LB 5DEGA 1BFSA 2CIKA 2JJWA 3RZWA 5CJQL 2VKXA 4GSDH 3I50L 4LKXA 3CXHJ 4NQUA 4KKAC 4YX2L 5MI0B 1KNOB 4OGYH 2R23A 1BQHB 2FEDD 1ES0A 3X13B 1X5JA 3QUXA 1WCQA 2E9JA 2QBWA 1K8IB 2OR9H 4HHAA 4R96B 2VXQL 3OBAA 5MI0C 4XNQB 2DQUL 1Y6MR 1LILA 1N7ML 3OKNA 2Q6WB 4ODXA 3DIFA 5GQBA 3MJ6A 2IPTL 2WIIB 5JQ6H 4MQXD 4PV9B 1KJMB 1YC8A 3SKNB 1NGWA 5D72H 1HIMH 4LGSB 1D5ZA 3FFCE 3MRNB 2H2SC 4XT1C 1FFQA 3F58H 5JHDB 4MLIA 4QYOA 3V6OC 1HSAA 5KSBB 1VGKB 2BRQA 3UBXA 1JGUH 3ULVD 4N1EA 1I4FA 2PTTB 3EO9L 4MNQB 1MCBA 3BP7B 2V9QA 1KJ3L 1RUMH 4O58H 1F2QA 3FHQA 1RURH 4EXKA 3FQWB 4R8WL 3ZDXF 4P57A 3O41A 5DK0B 4HUWB 4KGJA 4XCEB 1ADQL 1AKJB 1ZTXH 1WIPA 3UTPD 1XGQA 1A7RH 2WW8A 2EDWA 1LD9A 3T3PE 4XXCA 1EVUA 2YWYA 2YS4A 5IGXL 4ZUWB 5JPMB 4F7MA 5ACZA 3MLYL 4BQ6A 1Z9LA 3ZKSD 2VN4A 4QY8B 5D71H 4RCAA 5DEGB 4EN3A 2CIKB 4DKEL 5TFSH 2VSCA 4WHYG 4J3UA 1CF8L 2E7LC 1BM3L 1G7PA 3H0TA 4LKXB 4F15B 4BYHA 1FLRH 3QG7H 1QFWI 4C4KO 3QIBA 4GMTL 3LV3A 2R23B 1DL7L 1N6VA 3CSYA 1NQBA 2ICWJ 4G9DA 4P0DA 4F15C 1QBLL 4HHAB 1QRKA 3OQ3B 4PJ9D 1CL7H 4U1MA 5T3ZL 1NANI 3EW3B 3OKNB 3VGBA 5L7XL 4ODXB 3DIFB 3OKEA 3EHBD 4UT7L 4YFEA 1U8OA 5DUML 1J0YA 4DGVH 1YEEH 2J5LB 1NGWB 4KJPD 5J1AA 3WDJA 1BZ7A 1D5ZB 1FIGL 3Q6FA 1FDLH 1UJ3A 5HHPA 5FUOL 3UTPE 4CADA 2J5LC 3BUYA 4LHUA 4QYOB 4CRPA 1HSAB 1Z9OA 4O51B 4PY7A 5L2JA 1FAIH 3UBXB 1JI2A 4AK1A 1X4YA 3EYQD 1VHPA 4QCIA 4MA7L 5GZND 1I4FB 4NJ9H 3ULVL 2Z8SA 1A3LL 1UWEL 5GGSA 4ZTOL 4PJEA 5DWUH 2FCBA 3WSQH 5HHNA 3CX5J 2QKIA 1A7OH 2W1NA 2JB6A 2RAMA 3ARBD 1UCBH 3CDFA 3FN3A 1MVFA 4P57B 3O41B 4HLZH 4W70A 4P2RE 3NFSL 4OT1L 3R06A 3HB3D 2QQLH 1WEJH 4WTZA 1XGQB 1JFQH 4HUUA 3HNTL 4I77L 4XC1H 1T1WA 4F7MB 5DVLA 5ACZB 5F7MC 2QSVA 2Z4QA 1ZLWK 4MB3A 1MPAL 5GS2D 3GO1H 1EEUA 4ZPVA 3L6FA 1OARL 1HHIB 4JCLA 3VGEA 5B22A 4EN3B 3NCMA 5ADOH 3KPTA 5KVEH 2J8UE 1G7PB 4U6HA 3H0TB 2HWZH 4Q2ZA 3VH8A 4G80A 4HK0A 4TNWK 3QHTC 3QIBB 4EN3C 4LMQI 2YRPA 4BKLA 3KLAA 3LV3B 3S3SA 3CSYB 4MXVF 3VD4A 3EFDH 4G9DB 1UENA 3DI3B 3SPVA 3V4VH 4HF5L 3QIBC 4NNPL 2RHEA 5DF0A 2BNRA 5IW6A 4U1MB 1RZKC 4EUPB 2PYED 5KSUA 3NH7L 4PJ7E 3OKEB 1U8OB 3BN9D 2VRAA 5FA3A 1BIHA 1QFWL 4XPTH 2N56A 3OSKA 1IC5H 3LMJL 5J1AB 3K8LA 3GSNH 1BZ7B 4XNYH 3DO7A 4F33A 4YNYB 2E27L 4JVPA 1UJ3B 4XVSH 5HHPB 4EZMA 4JVUA 1QACA 4R26L 4CADB 5ID0B 3BUYB 4LHUB 3WFCL 1N6QH 5DUBA 4PY7B 5L2JB 1MCJA 3B5HA 4QCIB 1FP5A 5HI4C 1I7UA 1UJ3C 2ATKA 4XAWH 4TUKH 2H6PA 1N4XL 1F4WH 5GGSB 4PJEB 4X7SL 5CD3A 2CMRH 5D8JH 3U7WH 5HHNB 2QKIB 1X5FA 1JHLL 2JB6B 3IKCA 1OP9A 1N5AA 2KQNA 5LQBL 3MCLL 1QBBA 3X12A 5EPMA 3R06B 1U3HD 3OXRA 1GOHA 3B3IA 1BJ8A 3K46A 3K74B 1FFNA 4PG2A 1ZSDA 3QO0B 1XCTA 2FECI 1I9JH 4OZGA 5JXEC 4N5UA 4NRZA 1QVOA 4E42A 4WI3A 4JM2A 1AO7D 5IBLD 3KGRA 2Z4QB 1JGLH 4G8EA 5DK3A 4D9RD 1JF1A 3HI6H 5EBLA 1EA9C 4ZPVB 3L6FB 5BCAA 2ARWA 3RKDC 5KTEL 2CUIA 4TPRL 3U4BL 1PLGL 4XAKD 4POZD 4U6HB 3WLWD 4KZEL 4Q2ZB 3VH8B 4G80B 4HK0B 5KOVC 3SGKA 4BKLB 1P53A 1ZANH 3KLAB 1WIUA 1JZ5A 3O45A 3ZE2F 1H3UA 1WBYA 1WFTA 4KFZC 2YPLA 1FPTH 5GZOD 3OTTA 3SPVB 1TTUA 3CLFH 2EIEA 5B38G 5D1QD 2BNRB 5IW6B 1T0NA 2VZUA 1IGFL 5KSUB 4KHTL 1KLUA 1QLEL 1RZGA 2NY1B 1V3JA 3BIKB 1B90A 5DJ8B 4BFEA 3VW3L 5FA3B 1KJ2L 5EU6A 3MOAL 3HZKA 5CUSL 3ZTNL 4XC3H 2IF7A 1CDGA 5KAQG 2NY1C 4XP4H 4FHBD 1OOAA 2JKXA 4YHPA 3PP4H 4M5YL 1N64L 2LV4A 4X4XA 5DUBB 1NFKA 1S5IH 3Q5YA 5GGTL 1HQ4A 2GEEA 1I7UB 2ATKB 3MRPA 4PJBF 4LHQB 2O93L 1MJJA 2H6PB 3V0AC 4D9RE 2EDHA 4HK3N 3MJ9A 4L3AA 2WNGA 4Z0BL 1TVDA 5CD3B 4HJGA 4WW1A 4PBXA 1U36A 3NACL 3JWOC 5GRUL 4OCNC 5C0CD 5GPRA 4XAKE 5EPMB 3MBED 3AREB 2C1PA 1FFNB 1ZSDB 1XCTB 4LSQL 3QCTH 5BOPA 4OZGB 3PHOB 3RVVD 4HPYH 4NRZB 1QVOB 4E42B 4L4VA 4MJ4A 4X9FA 5E1AA 4K2UL 3AREC 3QSKB 4G8EB 2MQ0A 3F7RA 4PG2C 3B2UD 3OG6B 1JF1B 1RVFL 4CU7A 4P9ML 3GI8H 4WUKL 1NMCB 1MCKA 2OR7A 4S0SD 3RIAK 4XNXL 1SYSA 4MD4A 1PG7H 4M6NH 3B4NA 1NMCC 4LRNL 43C9A 2MPAL 4OCSL 3FQXA 5T1LD 3O9WA 1XCQA 3O45B 4QXGL 2YPLB 3VFNB 2YN3A 1Y18A 1F00I 3SGKC 8CGTA 3DRQA 1U8JA 1DBBH 3UO1H 2D2OA 1I8IA 3O0RL 5SWSD 3ZTJG 1IGYA 3LD8B 1KLUB 1RZGB 4PGEA 5JXAL 3ILPA 1Z2KA 1CDBA 5GJTL 3HZKB 5DQ9A 3D85D 2ESVA 5DC0A 5C0CE 3U7AA 4FQCH 1IGMH 3PWNA 4CW1A 2WWMC 2GJ6A 1KBGL 1K4DA 3LY6A 4YHPB 1GGUA 4M48L 4E41D 4XP1L 3C5SA 1YA5A 2CQVA 1HQ4B 2FL5B 2V7HA 1T7WA 3MRPB 1U9KA 4GJTB 1MJJB 3RFZC 3MRDA 2FH6A 2QV2A 3PG2A 1YYLH 3RX7A 4RSVA 4HJGB 4WW1B 2C3XA 4EI5D 1KXVC 5I1CH 1YEGL 4QXTA 4PGDB 1KIRA 4WWKA 4HMCA 3T0DA 3P0YH 1MREH 2ED8A 2DQHL 4K9EH 1NSNL 2C1PB 2VOTA 2X4RA 3RAJL 1UM5H 2VQTA 1KFAL 4L4VB 4OB5H 3SE9L 3UC0H 5GGQH 1QLFA 3OJMB 5SWSE 3GB7A 3MV7D 1SYSB 1TETH 1ZE3C 4X7DC 1QKZL 1Z5LA 4MD4B 2WQ8A 4X6DA 4IOSD 43C9B 3MFFB 4CDHA 1NCDL 3O6ML 3FQXB 2PR4L 3O9WB 1UZ6E 4RGOH 1XCQB 4XMKL 1NLBL 4RWYL 5LXGH 1A21A 1OTSC 1EGJA 1Y18B 2ZJSH 4E41E 1GGBL 4OLYH 4S1QH 3VFVA 3DRQB 5C2UB 1U8JB 3O9WC 4DWHA 2YZ8A 2H3NA 1ACYL 1I8IB 5SWQA 2HT3D 1T2QH 1IGYB 2VLKA 4PGEB 4UNTA 3ILPB 3A67H 1MCPH 3EZJB 4O2CA 4J3WA 1JPFA 2APXA 3RWIA 5DQ9B 2ESVB 3FT2A 5E4IA 4XBGA 2XZCH 3PWNB 4YDIH 4CW1B 1C5CH 5D70H 2GJ6B 1K4DB 2R0LH 4NC2B 5GHWH 5I8CA 4M61A 4ZAKA 4WI6A 4OIIL 1ZLSL 5BV7B 1QPPA 2FR4A 2BVOA 2CKNA 2A73A 4N0YH 4ODTL 1SYVB 3IS0X 5DGRA 4AEFA 3D2UA 2V7HB 2MMXA 5FHBL 3ZHDA 2EXWD 3CLEH 3MRDB 3Q1SL 5BV7C 1TZHB 5DJXA 4CDGC 5IFAH 1I3VA 4X5LA 4LLUA 5DDHA 5GS2H 2H2PD 3UYRH 1FNGA 1WZLA 4JFDD 1CFSB 1LK3H 3CMOL 4WHTA 3EO0A 5IEHA 4MQ7B 4QXTB 1KLGB 1KIRB 4KDTA 4TQEL 4WWKB 3DHJA 5CZXC 1K3IA 3BKJL 1JNJA 2R2CA 5I1JL 2VDKL 2X4RB 4B53A 1TQCB 4GQPH 3GMPA 4WWKC 4PRBA 4OV5B 1HWGB 4UINL 4KI5E 4M7ZB 2BOCA 2KPNA 3TBTA 3HE7B 3VRLE 3U9PL 1BIIA 1QLFB 1LO2H 1TQCC 2PYFB 2BNQE 1J5OL 2NY5H 1QSED 3GB7B 2OM5A 4OCLC 4M7ZC 1JPSL 1Z5LB 3HE7C 4B5EA 4X6DB 1Q38A 3WKNA 5T5FH 4S1RL 5HVGB 1T5XB 3LHPH 2H9GA 3UTTD 3VXRA 2L4OA 1F2XK 5JA8B 4GKOA 5KANG 4Y89A 4MA8L 5FECA 3VFVB 4A2MA 3E6HA 4DK3A 4S1SH 2H3NB 5SWQB 3OXSA 4D9LL 2VLKB 4PREA 2EDBA 2NY7H 3QHZL 1WK0A 1T7XA 3P9WB 2E6QA 4TSBH 1JPFB 4G6ML 4PY8J 3SJVA 3RWIB 3FT2B 4Y8AA 4QOKD 4XBGB 2VXTH 4OLVH 1UC6A 3P73A 4PB9H 4M61B 4ZAKB 4FQQA 2H1PL 4LCUA 3TYGH 2FR4B 1NCWH 2BVOB 2Z9TA 2GFBA 2A73B 5HI5C 1P4BH 1RZIA 2CDFA 2X4SA 1D7FA 4I2XA 5E2UL 4N8CH 3UX9B 2A9MH 1S5HA 4F3FA 4ZAKC 1RJYA 2FBOJ 4LLUB 3QFJB 3AY4A 5DDHB 4ZXBD 1QSEE 1FNGB 2VR4A 2YD6A 4WHTB 3EO0B 5IEHB 3OKMA 1W72L 3QXTA 4NBYB 4JDTL 2VXSL 2VKWA 1MJ8L 1ROWA 3K1DA 3C6SA 2VDMH 3T4YA 3UTTE 5IHUH 1MCHA 2G9HA 1KB9J 1FN4A 3MV11 4XPBL 3GMPB 4PRBB 2YC1A 1UG9A 4OLUH 4Z7NF 3FRUA 4WUUD 5I0DA 5I2IA 3HA0A 3TP4A 1OL0A 5BVJB 5CJ8A 2BVUA 2BOCB 3TBTB 4KMLB 1BIIB 4H26B 1MFBH 2YD9A 3KR3L 2B20A 4UQ3A 3HE6D 5EBMA 3A6CL 2YUXA 3T0EE 3L3OA 5FUZH 4Y4KA 3LPFA 4QOKE 3VXRB 1UJTA 2H9GB 4LDLB 4NBZB 3MRHB 5HHMD 5HHOE 3ARYA 4LFHD 4NZJA 3PL6D 4P2YA 5FO8A 5FECB 1MLCA 4K23H 2OLDA 3E6HB 2DQDL 1J10A 1G9MH 5I1HH 1I3GH 3OXSB 2NMSA 5I8OH 4PREB 3C87A 1KLFA 4Z0XA 3MBXL 4XNZB 1TDQA 1R3IH 2VZSA 1WTGT 3QI9D 3HZMA 1MAJA 1HXYA 2M2DA 1JPTH 2FDBP 5HGGS 4EEEA 1D9KA 3P73B 4JG1H 2GUOB 4XNZC 1IKFH 4FQQB 4NKIH 3EOTH 1KCKA 4LCUB 4IOFC 5A2JH 4JB9H 3GSXA 4KVNH 1CE1L 2GFBB 2XIDA 1RZIB 2CDFB 2X4SB 3P4NA 3VXSD 1T66C 4WUUE 2DM4A 5JW4Q 1S5HB 2AJZA 1RJYB 3ILQC 1CG9A 5B38B 3MCKA 4PJHE 4PJDF 4JFPA 4F58H 3QUZB 9CGTA 1RIUH 2QQKH 2XY1A 2F19L 3CJJA 3OKMB 4U33A 2FWOA 1KG0A 1AGDA 4JKLA 4LOUC 3QUZC 3C6SB 3T4YB 4XP9H 1JHKL 1JGVL 1NMBL 1IC7H 2G9HB 5HHME 1FN4B 5JNYA 1L7IL 3VRIA 5CZVH 4OZHA 3FRUB 5CEYA 4W81A 4NNXA 5DR5H 1EO8H 4MA3A 3SCMD 4X80L 3U83A 4L8DA 4HH9A 1HKFA 3MO1A 3QCVH 2R2BA 1M1SA 4UQ3B 4P23A 1TTGA 3MUHL 5EBMB 1PX4A 3QPQC 2W07A 3UYPA 3W82A 1TJHH 3L3OB 4Y4KB 4DAGL 1NGZA 4IHOA 3DNKA 4X9GA 2AJSL 3V0VA 3VI4E 3U6RA 4JZNA 4Y4KC 5BVPH 3DVFA 3VD5A 4X5WA 3VXSE 4GG8A 1KB5H 1DEEA 1MLCB 3KPOA 4X98A 4EOWH 1MFAH 3SDYH 2WUBL 3GNML 4XHJD 5DT1L 2APBA 5K59E 3JV0A 5CILL 5DEZA 5C9KA 2NW2A 2RCSH 4X6CA 4PJXE 4Z0XB 3LN5A 1BAFH 4MXWH 1BOGA 4DN4H 3MREA 4R7DA 5D2NE 1HXYB 2I9TA 1A4JA 1NCTA 1D9KB 3A0OA 4I18A 5IBUG 1YMHA 2W9EL 4D3CH 1E6JH 2E8YA 1J0HA 3GSXB 3P4NB 1CFVH 1YJDH 4DK6A 2ZUSA 1HHKA 1D9KC 1NBYA 1E4XH 5T1KA 1ORQA 1CG9B 3KLHD 3MCKB 3QWQB 4JFPB 5F9OL 3G04B 4HS8H 2FX9H 3QA3A 3R8BB 3OX8A 1OAYL 1MHPL 5J4MA 1NAMA 3ZMRA 1KG0B 5I18H 1I8KA 4Y5XA 5HPMA 5IQ9A 2QQNL 4KK8C 5JQ6L 5FOBA 2Y5TB 3TCXA 5D1XD 5JNYB 3VRIB 2WAHA 4OZHB 5ADPH 1R3JB 2D7MA 5CEYB 1D5BA 2ICCA 4NNXB 2AK4A 4CJ0A 4L8DB 1T0MA 4HH9B 4LK4A 2R2BB 1JYWA 1CLYH 4UIMA 2IG2H 5IVXF 3UEZA 3ARFA 4UV4L 1CXHA 2B4CH 4Q7DA 2XRAL 3UP1A 4LSUH 3QUMA 1NGZB 2EE9A 4IHOB 1P6FA 4LRIA 5KVGH 2VDRH 4KZDH 3BE1L 3V0VB 3U6RB 3L3KA 4JZNB 2WSKA 2QQQA 4X5WB 3TT3L 5KW9L 4GG8B 1A47A 4TRPH 3KPOB 4X98B 1A5FH 4ZSOE 1KPRA 1JF5A 4ZODA 2NW2B 3FZUC 3UJJL 4X6CB 3DXAD 3LN5B 1RK0A 4FQ1L 1BOGB 3MREB 1I7TB 5AYQA 3P4OA 4R7DB 4LCIL 5F96H 3DX9A 5AYUL 2DN7A 2I9TB 4EQ2A 1A4JB 4A6YA 1OW0A 4I18B 3QJFB 4Q74A 3D39D 5SWZA 5AAWA 1HYRC 3RHWK 4N9GA 1HI6A 3N50A 3BKYH 4ORGA 1U58A 4FQJL 3QQ3A 4DZBA 4M1DL 3KXFD 4MNHA 1HHKB 2X40A 3OPZH 4I18C 5DJAA 1KT2A 5T1KB 5IOPB 4LPXA 3P0VL 4LQFL 4Y4HD 5F8RC 4YUEH 3ETBF 1UQSA 1EO5A 3O2WL 1KTLA 3OX8B 2YSSA 5HYQA 1FG2A 3MNWA 5FYKD 4APQA 1QSFD 3BKML 3RWGA 1NAMB 4OD1H 5AG8A 3TN0D 1GIGH 3EJZC 4UTBH 5GGVH 1I8KB 4Y5XB 4RMSA 5HPMB 5IQ9B 3IXAA 2IH1A 3WXWL 4OD3L 2OXGA 2D7TH 4OJFL 1II4E 4Y5XC 1D5BB 1GL4B 3S35L 4GQ9L 2AK4B 5DJ0A 3CVIH 4RNRA 3IFOA 3BZDA 2CJUH 1T0MB 4PJAA 4Q9RL 1N8ZA 4YXLL 4U3HA 4UIMB 4POYA 3CFDA 3ARFB 2X10A 2Q76B 3RY6A 3DXAE 4NJ9L 4EVNA 1Z3GH 1CXIA 3WIHL 3VGHA 2HFGH 2BFVH 3JTTA 3L9RA 4XMLH 4Z7UA 3QUMB 4PLJC 5DWUL 3B83A 3WSQL 3Q3GA 5H94B 5CKAA 3ARFC 2OJZL 3B9DA 2P8MA 4RFOL 2BVQA 3TJHC 3L3KB 3V52H 3Q5OA 2FB4L 4JHAH 5KVDL 4QHNA 4XB8A 3KXFE 5EU4B 3LS5L 4LRIC 1KPRB 4FZEH 4G43A 4DOHE 1NC4A 3DUUB 4I9WD 4QNPF 2Q8BH 2GTZA 3TIDA 3NA9L 3PGCA 5KVMC 3P4OB 1LQSR 3C9NA 5FYKE 3DX9B 1QSFE 3GO1L 4KAQH 4WHYH 4KK6C 15C8H 4P59H 3I3EA 4MNGE 4A6YB 2P44B 3SDXB 3OAUL 4S1DD 3VFUB 5MEND 3JXAA 1INDH 3AROA 5SWZB 2FYYA 4N9GB 2CKBA 1HI6B 4ORGB 4OZFH 1U58B 3S36H 1KEGH 4J3TA 3QQ3B 4P46D 4DZBB 5JW3H 4XTRC 1UZ8A 35C8L 4MNHB 1OW0C 1NCCL 5DJAB 3OKOB 5GRYA 1UQSB 1WSST 5EORL 4JPIA 3V4VL 2CRYA 4G9FA 2EEBA 4HKZA 2YSSB 5HYQB 3L3HA 1FG2B 3MNWB 4APQB 3RWGB 4Q9QH 4ALAH 3DTXA 1A9BA 2BVPB 1V3MA 3IXAB 5CMAB 2ZOKA 1YEIH 3KYMA 3VXOA 4W6YB 1IC5L 1QQDB 2IH1B 1DQML 4APQC 3EDKA 3FB6A 5JOPD 3OGCA 4RAVA 2P43B 1DBAH 1YPZE 2O5ZH 4HMDA 4RBPK 4RNRB 5DJ0B 3IFOB 4ENEC 5E5UB 5F7YC 5J6HA 2P5EA 3QIWD 4PJAB 5IG7A 1ETZA 1FFOA 1TITA 3RU8L 1BZQK 1N8ZB 2VSDA 3BXNA 3D25A 2VLRA 1YN6A 3CFDB 2D9CA 3FQUA 4EVNB 3VGFA 4I8DA 4LSPL 3AS1A 5SX5H 3L9RB 3JTTB 4Z7UB 4I0PA 3UMTA 1F3DJ 3Q3GB 5KOMC 2Q8AH 2APVA 1U91A 4HWZA 3RY6C 3RNQA 1GSMA 3MSPA 4EJ1C 2P8MB 2BVQB 2DQFA 2MHAB 3FB7A 5F88A 2QADD 3EJYD 4BZ1H 4GKNA 2CLZA 4TNWF 4QHNB 1TJGH 4ONOA 1XR8A 5AD0B 4G43B 4E0RA 1OT1A 3IU3A 3UZQA 3QNXA 4PJ8C 5LJYH 2GTZB 1J18A 3TIDB 3PGCB 5ALBL 3SDCA 3T3PF 3QEQA 3TM6A 5A43C 2CKBB 3LQZA 3OV6A 3CAFA 5E1HB 5JOPE 1ED3A 5C0FB 5DHXB 5CD5C 2EDRA 4UI2A 4WI4A 4NSKA 4FQXA 3PWPA 1RSFA 2Z8RA 1Q9KA 4D2NA 4JPIB 4JPWH 4G9FB 3AXLB 4J6RH 3CIQA 3RPIA 4HKZB 3TO4A 1FV1A 2OL3H 4LLDA 1ZLUH 1KCUL 5KS9A 3L3HB 4Y2DD 1NMAL 3VXQA 4NO0D 3MRIA 1C1EL 4OCXH 4YXHL 3DTXB 1A9BB 2OTPA 5C0BD 1EJOL 4LL9A 2GT9A 4N1HB 5EBWA 2ZOKB 3MLUL 4HZLA 3VXOB 5IFJA 2CDEA 4D9QD 3FB6B 1FBIL 4FFYL 3ULVF 4NC1C 3OGCB 3X3FH 1ERNA 3M8OL 1AC6A 4RAVB 2ZZUT 1LE5A 2XWBA 3LQAH 5DD5L 2A83A 2P5EB 5CJXA 2RJMA 3KYAA 4PJGA 1ETZB 1FFOB 3HUJE 4XVUC 5DFVD 3BXNB 3B9AA 1KCVL 5EA0H 4YXKH 3D25B 2NY3D 3V4UH 4P3DA 5HDQH 2VLRB 3F6IA 4U49A 3THML 2V5YA 1NBZA 3EBAA 3FQUB 4O5LL 5FYJD 2R0ZL 3MUJA 5DRZA 4ZOEA 3M1BA 1FFPA 3IDXL 4YDVA 1AR1D 1FH5L 4HWZB 3RNQB 1J05A 5I1LB 1ZXQA 4C4KT 1OGTA 5F7HA 3CDGA 3HPJA 3FB7B 3QHFH 4LSVL 5F88B 3RIFK 2QHRL 3U82B 4GKNB 2CLZB 4B0MM 4TSAL 3MYJA 1XR8B 2CIIA 2CRZA 3GMMA 3FRPA 4E0RB 1G9NL 4BQCA 1UCTA 3IU3B 3WYRA 5M7QA 3ULSA 3QNXB 1HNFA 4GT7A 1LEGA 3EJJX 3ZSTA 5ESVA 4RIRA 3N06B 1D6VL 5F7NC 1S9WA 5KVFH 1JZ3A 4YEFA 1KEMH 2KDGA 3SDCB 5C0BE 3QEQB 2X44D 3LQZB 4KDVA 5C6TH 3VXUB 4M6NL 3NCFB 4ETYA 4DFIA 4D9QE 3W5MA 2MSPA 3E3QC 1ED3B 1FL5A 3O4LD 1JP5A 3SDCC 3ZE0F 3G5VA 4NSKB 4GAGL 2GKIA 1RFDL 5ETUA 4FQXB 3PWPB 1Q9KB 4NZRH 3RPIB 1SEBA 3TO4B 1FV1B 4LLDB 4PRIE 5KS9B 2J8UF 3VGDA 1DTUA 4NO3A 4HT1L 4MMXC 1BZ9A 3MRIB 5C08A 4FQXC 3WO3B 4BQ9A 2X41A 1VERA 3LKPA 3F5WA 5L6YL 2GT9B 1FCGA 3TO4C 2VH5H 5EBWB 3VCLA 4HZLB 3MODH 5IFJB 3FN0H 3ZL4L 1WF5A 2CDEB 3OB0H 2BVEA 5E2WL 4FQCL 4BUGA 5IBUB 1LE5B 4R4FL 1B0RA 2XWBB 3ROLA 2A83B 4C83A 4PJGB 5F9AC 2XQBL 4LARH 4P3DB 4MNQD 1NBZB 4AMKH 4O02H 3KYOA 3QWRA 1YZZA 5CJXC 1G7LA 4ZPTA 5DRZB 5FYJL 4YDKH 1FFPB 4YDVB 5KG9A 3RIAF 3EYOA 5I1CL 3WIFA 1OGTB 3T8XA 3CDGB 3HPJB 5L9DH 1CQKA 3SDDA 3WNKA 1M4KA 3O4LE 1DFBL 2EXYC 2CIIB 3MYJB 3ULUL 3GMMB 4YBHA 3FTGA 1Q94A 1IAMA 2PTUA 4J8RA 3GJEA 2QSCH 3WNOA 2R4SL 3GMQA 5IT2L 1OSPL 1LEGB 4PYHA 2EIDA 4RX4A 4Y16D 5ESVB 4RIRB 1KPVA 3U0PA 3Q6GL 2R56L 1WV7T 3N85H 5DGQA 4JN1H 2AJXH 4ODUA 4J12A 3R8QA 2XNAA 3Q2CA 1EVTC 5FYKH 3QXVA 2YRLA 4NHCL 2FSEA 1X5AA 4JY4A 1K6QL 2NXYB 4G6JH 2R69H 4MJ6A 4M7KH 5MP6H 3FT3A 3DPBA 1FL5B 4UTAL 5EUKB 4J3SA 3QUXD 2Y9RT 1V05A 2NXYC 5ETUB 4NP4H 4PLOB 3IDIA 1SEBB 2MWCA 3OZ9L 3QQNA 5EIVA 1S3KH 4YBQC 3RDTD 3UBXI 1CK0L 1A7NH 1RULH 4NO3B 4JFHD 1BZ9B 4M9PA 5C08B 3LKPB 4HGMA 3F5WB 2CK0H 4MJ5A 3F12A 4QXUH 3PGFL 4ZFGL 2IQAA 2WBJD 3CVHB 4J2XA 3LB6C 3I9GH 4ZQKA 4YDIL 4OGAC 2EDLA 2OTWB 2YPVH 4I0CC 1B0RB 3ROLB 4AT6A 4Z76A 2R0WL 4C83B 3TA3A 1HOCA 1QYGL 1VCAA 1WGOA 2V9TA 5EUOF 1G7LB 1FGNH 3TJEH 2ARJA 3M07A 5DMGC 5KG9B 4HIXL 2K9UA 3EYOB 2FGZA 3T65A 5I9QB 3WIFB 3BDBA 4OF6A 3T8XB 2AJYH 1ZA6A 1ZV5A 3W9DA 4NWTH 2RQ8A 1YEJL 5I9QC 1W0YT 3FTGB 1Q94B 3HC3H 2AQ3A 3GJEB 3RJQB 4XCYA 4K8RH 3GMQB 1BD2D 1X9QA 3KJ6L 4ZO8A 2ADIB 3U0PB 5T1DH 4EN3D 3BIBX 4JFHE 4LEOA 2OSLB 3MA7A 4ODUB 4HIEA 2XNAB 4D0DA 4NGHH 2KL6A 2FSEB 2PN5A 4MJ2A 4JY4B 4AIXA 1TZGL 3QIBD 3O3BA 2V7NA 4MJ6B 3IDYB 1NL0L 3FT3B 4MVBC 5T5FL 2J8OA 4AIZB 5EZOL 4P5TA 2BY2A 1F42A 5CJOH 1MCWW 2ZSWA 1ADQA 5I30L 4CN6A 1IFHH 3IDYC 3IDIB 1U93A 1AHWA 1GC1H 4Z8FL 1A6UH 4KKBC 2FHCA 5AZEH 2D31A 2P45B 5BQ7A 3C5ZA 2D0FA 2LTQB 4MJ5B 4OFPA 1Q0XH 2EH8L 2VR9A 1RIHL 3UPRA 2LTQC 4ZQKB 2PW2A 4LHUD 3B2VH 3X11A 4HIIA 4AT6B 4Z76B 3HNSH 1AFVH 5EBGA 1QHPA 3M45A 2XFXA 1HOCB 3ESUF 4MA1B 4KY1H 4M1CC 2QR0A 1HILA 1BD2E 4DVRH 3CU1A 4ZS7L 2IANA 2AGJL 2YD7A 4XVJL 2ARJB 5DA4A 5GRXG 4MA1C 5IB1A 1F58L 2W60A 3B9EA 1TCMA 4UQ2B 3T65B 4ZS6C 2X1OA 1ZA6B 1PY9A 3T0AA 3W9DB 2ZPKH 5HYEA 1CFBA 2OZ4A 4DVBA 3RKDD 2FATL 4XPHH 2X5PA 4BM7A 3SGEI 3IFLL 1UWXK 1WZKA 4XCYB 1NC2A 2J88H 3WJJA 2DTMH 4HKJA 1KCLA 4ZOBA 4N0CC 4LEOB 3MA7B 2R1XA 4D0DB 3V9FA 1MRCL 5EU3A 4ORZC 4PB0L 3FHAA 3RTQA 1MFCH 1J1PL 3DVNA 2V7NB 3HC0A 5H37H 2XKNA 5FUZL 5DD1L 1CE6A 2VL5A 4OM1L 4P5TB 5C2BH 1CDUA 1UYWL 2G75A 3P77A 2NZ9C 3BJLA 5FOJA 2ZSWB 2ZCLL 5D5MA 2VWEC 2GHWB 4WU7A 3GMLA 5F6HI 1AHWB 1FYTA 4P5TC 1T21A 4PJEE 2D31B 2X1XR 5TH2A 5BQ7B 1P2CA 3A6OA 1A6VL 3C5ZB 3QDJA 32C2A 5I1IL 5LGHH 5DFTA 1UZ6F 1P5UA 1Z9SA 1AE6H 1AHWC 3L1OL 4LCCA 5B39A 5HVWA 4GG6E 3C5ZC 3UPRB 1DSFL 2DF3A 2PW2B 4HUKB 3X11B 5CCKH 4HIIB 1G6RH 1CXLA 5JW4M 3PDDA 4KKLD 2XFXB 4KVNL 3S3JA 3JV6A 1C5BH 1N3NA 3I2CH 2QR0B 1HILB 1NCAL 2H32A 5F6IB 2IANB 4DUVA 4UILH 4JJ5A 2A9NH 2DICA 5IB1B 1A7BA 4L8BA 1H5BA 2CH8A 2W60B 4PPTA 1Q1JH 5I17B 5F6IC 4LSTL 3TT1L 1A3RH 1P1ZA 4LSSH 1DVFD 1NFDE 4KQ3H 5TE4L 3EAKA 1F97A 2DBJA 3G5YA 4DVBB 4JM2D 3KPPA 4FTVA 4H1LA 5TJWK 5LBSH 3DI2B 2ITCB 4WEBH 1N0LA 2FGWH 1NC2B 3W0WE 4BQBA 4HKJB 1OB1A 5TGBA 2R1XB 4K7PH 3OJDA 1U8IA 5EU3B 1B6DA 1WWAX 3ARGB 3WJJC 3RTQB 1ZT7A 4ZUVB 3WNPA 3DVNB 3HC0B 4ONHB 1JNHA 2XKNB 1EZVX 4HEPG 3FB8A 2VL5B 3TGXA 1X6LA 3VRLF 2YPLD 3ARGC 2G75B 3P77B 3RTQC 4GBXA 3O2DA 5D5MB 5D7JA 2X6MA 4WU7B 1MELA 1PY4A 3GMLB 1FYTB 4HWEL 5CKGA 1T21B 1QA9A 1NUNB 1MFAL 2WWMD 3BH8A 3S35X 5TH2B 1P2CB 1JIBA 3QDJB 5EU6D 32C2B 4G8GA 3ZT7A 2XTJD 3CNKA 4Y0GA 2RCSL 5DD6B 1YC7A 2QSTA 1L4IA 1MQ8A 1UWXH 3B43A 4LCCB 5B39B 4DN4L 4N0UA 3TESA 3NZHL 1LO4L 4IIQA 3ESVF 1LVEA 4MAUL 3BZ4A 3KPRD 3L5XH 1JZ7A 4E9LA 4LCCC 1JI1A 2Y5EA 3JV6B 2D7NA 1N3NB 2HH0L 3JWOL 3AVEA 1B0WA 1YJDL 2VUYA 1U41A 2H32B 1E4XL 3FQRA 3BN3B 4JJ5B 4JPVL 4L8BB 2XV6B 1H5BB 3B8SA 4LCWD 4LEXL 4P4KD 2XI9A 3UTOA 1BGXH 1P1ZB 1H5BC 3HAEA 5DD0L 1J12A 3G5YB 2O61A 3KPPB 4BSWA 4FTVB 2IPUK 4H1LB 5HHXH 1CBVL 3KYKH 2BOBA 3RL2B 1BFOA 5EO1B 5ACMA 5TF1H 1Q0YH 3T77A 4XPFH 4KRMB 2W0KA 1OB1B 4JM4H 1VGEL 1RUPH 5TGBB 2N4IA 4IDJH 3HMXA 3OJDB 1YEFH 1CLYL 2JB5H 1U8IB 4JANA 5EU6E 4W4OA 1KN2H 3KDMA 5BMFL 2XTJE 1QSZA 2OYPA 1ZT7B 4AIOA 4PGJA 2B4CL 2BRRH 1JNHB 4LIQL 3O9WD 4LSUL 4NQCD 1I7ZA 5FGSA 3F6LA 3FB8B 2HT4D 1R5VA 3FO2A 4IRZH 3KPRE 5I8KH 1JZ4A 5JR1H 4DZ8A 5KVGL 5MERA 2DQTH 5C71A 3ZYOA 5D7JB 1IGTB 3QXUA 2B0SL 3QCUL 3HI5L 3D1MC 3LOWA 2WUCH 1OPGH 4IRJD 5EC1A 5T3XH 2P8LA 3T2NH 1QA9B 4C54A 3BH8B 1UM6H 4YWGL 2GSGA 3BRDA 4KVCL 4E5XA 5D7JC 3V6ZA 5K9JH 4G8GB 2EKJA 2ESVD 2Q86A 4LCWE 2OCFD 4N0UB 2GJ6D 3MLSL 2NY4B 2VZOA 4IIQB 1I7RA 1FYHB 2O5YL 3WDIA 3BZ4B 3MV8A 3O81A 4QHUA 3MRGA 3SY0A 1WBXA 1BPVA 4DEPB 1I75A 2DQJL 1NGPL 2NY4C 4IIQC 1DCLA 4HAFA 3BGMA 1I9RH 2Y36L 2AJUL 3FOMA 3FQRB 4LBEB 3W2DL 4DEPC 3ZSSA 4OCWH 3PIQA 3JVGC 3UJTH 1F3RB 4MHHG 4JREB 4NQCE 5DK2B 5GGVL 3HAEB 4WJ5A 1RZKH 5EOQH 2O5XH 2O61B 3V2AR 1U42A 4BSWB 3IDJA 2E7MA 2W65A 1A6ZA 1OAUL 2BOBB 4O9HL 1BFOB 3QQ9D 4JREC 4JKMA 3T77B 4R4BA 3QRGH 3CVIL 1J9CT 4JKWA 4LPCA 4OFKA 2PW1A 1RQ5A 3GDBA 4YHML 3LKOA 4JANB 4DGYH 6FABL 3KDMB 3LQMA 3WBDA 5BW7C 3RZCA 3BDYL 2F53A 1DBMH 2IBZY 1I7ZB 1ZS8B 1P7KA 4ERSH 2IFFL 2ZNXA 1T83A 1R5VB 1SBSH 5FGCE 2DM3A 4DZ8B 1K9TA 1BQUA 4JFQA 3QUYD 2QHLA 5MERB 3RHWF 3CZFA 1LEIA 2BY0A 1OQXA 4JGMA 5EC1B 2P8LB 2ARJQ 2VLKD 1RMFL 1YY9D 1S9XA 5EC2A 2GSGB 4E5XB 3C8KA 3V6ZB 2VDLL 1MF2H 2ZKHH 4RISL 2Q86B 7FABL 1U8PA 3NCJL 5E5RB 3K80A 1A22B 3VI4F 2C3GA 2I25N 1OP3K 4JG0H 1FNFA 3EUUA 3T4AA 4KAQL 4ZAKD 4BA8A 4NZTH 5KSVA 4OLXL 3MV8B 2XG4A 4NWUL 4QHUB 5K59F 2HJKA 3MRGB 4L3CA 1MHCA 3SY0B 1WBXB 3RX8A 3UAJD 5C3TA 3D2UD 2IGFH 5EZIL 1IKNA 5HY9A 4PJXF 3ZKMC 2J4WH 4OFYA 4XPAH 3BGMB 2GYSA 2Y07H 1MWAL 1JNLH 3FOMB 3RQ3A 3T2QA 4H0IA 1T1YA 1CFTA 1R24A 5BXFA 2MKLC 4JRYA 5CINH 5JIPA 3PIQB 1C16A 2OTUA 5DMKA 2DLFH 1D5XA 3EYVA 1L9MA 5C7XL 3KPQA 4WJ5B 5HJ3B 4JGUA 7CGTA 2ORBL 3IDJB 2W65B 1A6ZB 5LCVL 1JZ6A 5I1DA 5JDSB 4R4BB 2I5YL 1DBAL 3BRFA 3ET9F 2PW1B 3MRCA 2HYMA 5A1AA 3FAXA 4JFEA 3LKOB 4K3HA 1EIBA 1F90L 1S78D 1WZMA 3LAFA 4BK5A 4W6WB 4ODHL 5C86A 2IFGA 4PYGA 3RZCB 4YDJB 2F53B 4M1GL 5KN5A 1HINL 1P7KB 5HYSA 4ODWA 3WN5A 3D5OF 2Q8AL 3VRJA 2AXFB 1FE8H 1EGJL 1JNNL 1UADC 1T22A 4OGXH 3RZCC 3CZFB 1N59A 4HXBH 3OF6A 4BZ1L 1T83C 3QJHA 1EMTL 1TJGL 1S9XB 2BY3A 5EC2B 3C8KB 3INUH 4TUJB 1YYML 3SJVD 4IOFD 1U8PB 1V8HA 1EPFA 1RU9L 4LGRB 1ZLVK 5BRZE 1V5JA 1BVZA 1RZFH 1JRHI 3T4AB 3RGVD 2JJUA 3ILQD 4OCYH 2HJKB 4L3CB 5I15L 1MI5D 3OKYA 3S4SG 5GRVL 2F9BT 5ILTH 5HY9B 2BDNH 5F7FA 4EKXA 2WQRA 5K33A 4R9HA 1QR1A 1VADA 1I1AD 4BQ8A 2XQYG 2A6DA 5J7CC 2D4FA 1IKNC 1T1YB 1CFTB 1R24B 4JPWL 5D7SH 1UFUA 4JRYB 1C16B 1GVIA 3TNNA 2F74A 4HULB 5FO9A 2OTUB 2V9RA 5DMKB 4AENA 1D5XB 4PJIE 1MY7A 4M6OL 3T3ME 4U3XA 2JJVA 1ND0A 4OGZA 5MEPA 1JV5A 1QPXA 4L4TB 5TE6L 4G8IA 3NAAH 3L3DA 4ODSH 2XZQH 4WFED 5I1DB 1I1YA 1OP3H 1QRND 3T0VA 3MRCB 4JFEB 4PS4H 3VMOA 5FF6A 5DHVH 3SJVE 3NIDF 5BO1L 5FGRA 4Z95H 1GH7A 3MR9A 5KN5B 3H9ZA 1AI1H 2YD8A 5HYSB 4ODWB 3WN5B 3VRJB 4EIZC 1HKLH 1J8HE 5SX4I 5ICYA 4OD2A 5DQDH 1T22B 3VWJB 1MI5E 1R0AH 1W72A 1N59B 4I2XE 4JFXA 5CWSA 4HLZG 4M6AA 1MAKA 1SEQL 1DQDL 3WN5C 4U6YA 5CIPH 3QJHB 3G6JE 4YHKL 3VWJC 4JFYA 1T6VN 2QLVB 4LVNB 5F3BA 2EDQA 4XP5H 2FX8L 1O7VA 2E6PA 1S7WA 4IEFB 3ZE2E 5DI8A 5AEAA 4LVNC 3SE3A 5KVFL 4QRTA 1FJ1A 3DETC 1WIOA 5I19L 4BFBD 1AD0B 3PUCA 4M7LH 2F58H 2VLMD 4RMQA 4H8WH 3STBA 4OQTH 4WFEE 4ODVH 5GS0D 1KN4L 5DLMH 1QR1B 1EFXA 1VADB 5I74B 4TOYL 1QRNE 2V17L 2A6DB 1REIA 4HXAL 4KK8D 2CGRH 3KWWA 5GISL 1QHOA 1JRHL 2Z91A 5K9QG 5F7UA 4XWGH 5DC9B 3TNNB 5I74C 4OLZH 1A14H 1WFNA 5KJRL 4AENB 4ONFH 3PXHA 1ND0B 5MEPB 1S8DA 1JV5B 1FVDA 1E6OL 4PJBE 2VH5L 4F7PA 3K0WA 3S37L 4G8IB 4BJLA 1NDGA 3FN0L 1HH9A 3D0LB 3L3DB 1PKQA 1W8OA 4YE4H 1ZLVH 3RIFF 1I1YB 4JCMA 3KPSA 4YGAB 2FJGA 3NA4A 4NNYB 3MRBA 4P23D 4LARL 4LLQA 5FF6B 1UACH 1KCSH 4FFZH 3AS3A 4BFIA 2ZOLA 2PO6B 3VFOA 2OP4L 3MR9B 3CGTA 3R1GL 3IDNA 3MZGB 1YPZF 5JQHC 4YHOL 5ITFA 2NTSP 2RB8A 5ICYB 1CDYA 5BZWA 4OD2B 4ZYKB 3FZUD 1W72B 2PO6C 4HS3A 5CWSB 4JFXB 4S0TD 5GRJL 4Q58C 2VLME 4JFOA 4PRPE 4JHZA 4Y5VA 4U6YB 4JGJA 1T2XA 4X6FB 4XB7A 4JFYB 5E08H 4X9IA 3U7YH 5F3BB 2QSCL 3U0WH 1HE7A 3IJHA 2V2XA 3CH8A 4R4NC 3NTCL 1S7WB 2V6HA 4URTB 2PUQT 5DI8B 1FGVL 3V6BR 3OAZH 2B1HH 1NBVH 2MQCA 4QTIH 4DKFL 1MSPA 1URLA 3UTSB 4QRTB 4N9OB 2C3HA 2Y06H 2YWZA 4OZHE 5BZDA 1H3WM 3O2VL 1HZHL 5MP6L 1IL1A 5T1KD 1MFDH 3SE3C 1FZKA 1EFXB 2I60H 1TCRA 5JIKA 3DRTA 4P2QA 3KWWB 4ZMAT 1YEKL 4ACPA 1RJCA 3OR7A 2QTEA 1JHTA 1ZA3A 4HBCH 4ZUUA 1AXSA 4OKVB 1JZ2A 1AXTH 4RAUA 1FVDB 2OJEA 5C3LD 4XNUL 5HI3C 2B8OT 2A2QT 1GZQA 1EH9A 1PKQB 1QLRA 2AK4D 5IJKA 3L7EA 2NW3A 3KPSB 2FJGB 4PLJD 1CR9L 3D18A 1ZK9A 2DLHA 5D93B 3MRBB 1SY6H 3GIVA 4GRLA 4LLQB 2E8ZA 2NR6C 3PV6B 2F54A 4BFIB 1RZ8A 4QLRA 2ZOLB 1E4WL 5DXWA 3WKMH 4FQIH 1MIML 2E6JA 3VFOB 4MJIE 3IDNB 5CLWA 2FIRT 5ITFB 1ORSA 4HWBL 2JJTC 5E94A 5BZWB 3HUJF 4KI1A 1OCWH 1CTNA 2VXUH 4HS3B 2Y6SC 5LWYL 5KSAC 4X0KA 1EEZA 2CO7B 4JFOB 4Y5VB 1WAAF 3L5IA 2IMNA 4KTEH 2ZCHH 4OLWL 5J9PA 3SOBL 1RUAL 2D7PA 5D7KD 4K8RL 5KANI 4Y5VC 4C56D 3IJHB 2F5AH 2V2XB 1QBML 2ZCKL 5CLTA 4XTRD 2Z93A 5DRWA 1HH6A 3SDAA 4RGNB 4O4YL 2R0KL 3B9VA 4JAMA 1Q72L 1IL1B 1W8NA 2AK4E 5C0IB 4LLMA 5F89A 1FZKB 4RGNC 4M7LT 2VYRE 1K8DB 1TCRB 3DX7A 3DRTB 4P2QB 5FYJU 4HQQL 1IFHL 2J6EH 3OR7B 2DIBA 4NQDA 1JHTB 1ZA3B 1GC1L 1WC7A 4ZUUB 1NAML 5TE7H 3HG1A 1AXSB 4GKSA 4ENED 4RAUB 3RPKA 2AAVA 2OJEB 2XG5A 4JO2L 2PXYA 1EAJA 3TPKA 1G1CA 1Q0XL 5EO0A 3TZVA 1GZQB 3CXHK 1CDIA 4WRLA 2DDQL 2NW3B 4QKXB 5JW4R 2VDPH 2GK2A 3D18B 3V4PH 3NCBB 3W9EA 5IV2A 3GIVB 4NM8H 4HGKC 5IJKC 2WINA 4HUMB 3GMOA 5D7KE 1RZ8B 4YO0A 1DQTA 4PUBH 4C56E 5CEZL 3H9SA 4IRSA 2O26U 2X70B 5IMOA 3WMSA 4MAYD 5KZCD 2W59A 2H26A 5ISZD 3TWCH 3UXFA 3ZZ1A 3DOSA 1ORSB 4PTUB 1BJ1H 5E94B 3S88L 4ELMF 2R4RH 4KROB 3BP6A 4X0KB 1EEZB 1EERB 3NPZB 4JO4L 1I1CA 1NC4D 3ZHLA 3BMVA 3SKJL 4FRWA 5J9PB 4KROC 1BP3B 4UT9H 4OQ1A 1IM3A 2B2XL 3RUGE 2IAMA 5CHNA 5DRWB 3SDAB 4A6YL 1RUKL 4NJAH 5HTSA 3TPUA 4FABL 1MFCL 4JAMB 1IQWL 3SDAC 2YK1L 3BESR 5DSCA 2L0DA 3GHEH 2EDKA 4LLMB 5F89B 4PJAE 1VPOH 1BREA 4G9FD 1J1OH 1A2YB 1MAMH 3DX7B 4X7TA 2ADFL 2W9DH 1EHAA 3MGAA 5FXCH 4NQDB 1WC7B 3BUTA 25C8L 4M62L 3HG1B 2G5BA 4GKSB 2R9HC 1TNMA 3C60A 5ISZE 5KSBF 5DEFA 4MS8C 3BAEH 2PXYB 3DGGA 5D7IA 5EO0B 3TZVB 4RMTA 2BY1A 3HCVA 2X1QA 2AABL 2YMXH 3S4SB 5IVNA 2PXYC 2VLRD 3ARDA 3PDOA 1CIUA 3W9EB 1CDHA 1IZKA 1MCOH 3S6CA 5IV2B 3TZVC 2DIJA 2XZAH 4QRPE 1X44A 2XXCB 2WINB 1J1XH 3GMOB 1BFVH 4YO0B 3P9LA 3VXMD 1NLDH 5MHSD 4I0PD 1P5VA 3H9SB 4IRSB 3OKKA 3VDAA 5IMOB 2ITDA 4Z7NE 1LE9A 5AWNL 5FHAH 4WEMB 4AH2A 4P9HH 1Q1JL 1X5HA 1F4YL 3D87B 4IRSC 3DSNA 1JN6B 3BP6B 3S8WA 5E24E 4ZFOB 4PGBA 1UVQA 5GS0H 5IVXB 1JZ8A 3MLVH 3GSNA 1IM3B 2FGWL 4HS6A 2J3SA 4PP1D 1J86A 3ARZA 1P7QA 2IAMB 5CHNB 3SDCD 1CD1A 5TPWL 2X4QA 3G6DL 4HCRH 3CX5K 3LN9A 5HGBA 1FL3A 2NX5A 2R1YA 4NKQB 2CKBL 2EH7L 1A02N 2YA0A 2IAMC 4TSCL 3MXWH 5DSCB 3MLTA 1D5MA 2Q7YA 4FQXD 3PWPD 4XPGL 2FHFA 5ALCH 3BPCA 3H42L 2VLRE 3TO4D 4X7TB 1NCUA 1U3JA 3O6FA 5FB8A 1B0GA 2BSTA 2ZG2A 4K3JL 1ZEAL 3VXME 5MHSE 5J1TC 2G5BB 1S7SA 3U36A 4JPKL 4X4MA 2BMKB 3C60B 5L8JB 4GAFB 1FVCA 5DEFB 1U6AL 3TVMA 3WHE0 3DGGB 5D7IB 3ZYJA 3VFGL 4Z7QF 2P48B 1K5NA 3C60C 3HCVB 4LHJB 1ZHNA 3O6KL 4PJDE 5C0JA 3MACH 2A6KA 2CUMA 1KIQA 4XX1E 3FFDA 5IK3A 1X5KA 3RA7H 3ME0A 3ARDB 3PDOB 1JGEA 4KDWA 4U1JA 4PD4J 1F8TH 3SQOL 5JOEA 5INDA 2XA8H 3P9LB 4F9LA 5C6PB 3OKKB 3ARDC 3V8OA 2DLEA 2ITDB 4WI8A 2EXYD 1LE9B 2X9XA 3NFPA 2E7CA 1X5LA 3N9GH 1T7YA 4AH2B 3HFMH 3G5ZA 3PP3K 5DJYA 4PRDA 2YD4A 4OI7A 1P4IH 3CPLA 3MOQA 1AGFB 4PGBB 3PWPE 5JUEH 3KYKL 3FO0H 3GSNB 3D6GA 4H25B 4P5MA 3K7UA 4HS6B 3EDEA 2D0GA 4JHBA 4XPFL 2FJFA 4JM4L 3ZKNC 1IZJA 1NAKL 1RUPL 1QNZL 2WBKA 3L3GA 3T2OA 4DJMA 5HGBB 1FL3B 2NX5B 2NXYD 2R1YB 4X99A 2HA1A 3G9VA 3GSOA 1ULVA 1T6WA 5C70A 5H35A 1HEZA 4DGIL 3MLTB 1D5MB 1GOFA 4GLRI 4HJJH 4PJGE 2Q7YB 4AL8H 5E8OA 3BPCB 1F3JA 3AM8C 4TULH 3O6FB 3SO3B 2DQCL 1B0GB 5T3XL 4R2GD 4ISVA 2C1OA 5IFHL 1ZT1A 4PJCE 4OGAD 1S7SB 3DSFH 4M43H 1FVCB 2LAGB 4R90H 3O6FC 3SO3C 3TVMB 1H3PH 4UDUA 4P3CL 3MJ8B 1K5NB 1ZHNB 2GAZB 5C0JB 1RUQL 1OM3H 1KIQB 1I8LA 3FFDB 4PJEF 5IK3B 3TVMC 1KV3A 4UU9A 3HZVA 1QEWA 4OIAA 4XCCH 1JGEB 2A6JA 4AQOA 3H3PH 3V6FA 4U1JB 1IGCL 3O3DA 3QT2A 3QWRD 5INDB 1I1FA 5H2BA 1H0DA 1IBGH 1VFOA 1IAII 4V1DA 2P24B 2GIYA 1XR9A 3T0XA 3NFPB 3C5JB 4NYLA 4V2BA 5JZ7C 4F9LC 3G5ZB 1YMMD 5DJYB 3SDDD 3VMPA 4PRDB 4ZD3L 3HR6A 4LKCA 1XT5A 1BMGA 1MNUL 3CPLB 2AEQH 4RFEA 1BWMA 5E2TL 4KRPB 1KOAA 5E7FA 4RX4D 1FFRA 4EDXB 1CCZA 1FO0H 3EOBA 2DMCA 4KUZL 1NFDF 4KRPC 3NMEA 1YEDA 2VL4A 5LKNA 1KACB 2YR3A 4X99B 1A7QH 3MRQA 5IBTH 4WGWB 3GSOB 5H35B 4KKBD 1HEZB 2FX7H 3CFJA 4QXWA 3LN4A 3ALXA 1AD9A 5FYLD 4JFZH 5E8OB 1G0XA 1F3JB 5L88L 3WLBA 1H15A 3DVIA 1MEXH 4KJYA 3PP3H 3V0WL 4MB5A 3CD4A 4ISVB 4P2RA 2C1OB 3RWHB 1ZT1B 3GSRA 4Z7WE 4UIKL 3B6SA 2IH3A 4KK9C 3HLAA 1PQZA 1MF2L 3CVHL 5I1AA 4AEIL 2E3VA 2R8SL 4M1CD 1GZPA 4UDUB 1V3KA 4QO1A 1YMME 4XVTH 2VISA 2X7LA 4JG0L 4PJ9A 3LKRA 2K1MA 2FEDC 3TA3D 4UU9B 1QEWB 3BOVA 3HNVH 2CD0A 2A6JB 4CJ1A 2DD8H 3O3DB 3QEGH 4ZS6D 1Y6KR 4U05A 3LKNA 1I1FB 5H2BB 1H0DB 1BQHA 1I8LC 2Y07L 4NKOA 1XR9B 3QFDA 5IB5A 4HAGA 4MQXC 4FNLH 4NYLB 2UZYB 3E1F1 4ZNEE 3X3GH 4L8CA 4JM2F 5GSVA 5FGBA 3KNBA 4FOMA 2Q6WA 4LKCB 1FRGH 4U3CA 2C26A 1OGAE 4N0CD 4OSUH 3JWDH 4PJ7A 4TTDD 4RFEB 2H45A 3GI9H 1EX0A 3HMWL 2OS7A 2AK1L 1IAIL 5F9DC 3ARBA 4OBRA 3G6AA 3LRGA 5JHDA 3EOBB 3QNZA 1K3ZA 4U1SA 2DWDA 2NXZD 4P5KA 1YEDB 4XCFL 2W9LA 4TVPH 3O3AA 1YECH 2ZUTA 1HHGB 5IB2A 2L7UA 1EXUB 4P5TD 3CFJB 1BQSA 3LN4B 5F1SA 4QNPE 1AD9B 4QRRE 3RWDA 4GXUM 1MRDH 4HUWA 1U8HA 5C0AD 5ICZA 2Y4SA 1FQ9C 3S37X 3WLBB 1H15B 1DEDA 4F80A 3JZ7A 3S34L 1K2DA 4KJYB 4ZUTA 1QFUH 3C5ZD 3LEVH 4P2RB 5HXMA 4NM4H 4FQPA 5DZOA 3B6SB 2IH3B 1B6UA 3DJ9A 3VGGA 1AGCA 3OAYK 3INUL 5DMIL 1JJUA 5IESH 5I1AB 2E7LA 2BERA 4K9EC 3Q5TA 1DQLH 1GZPB 2X1WL 2VISB 3I6LD 1TPXB 2GY5A 4PJ9B 4HGWA 3I6KB 3LKRB 2VZTA 3CK0L 3U1SH 4LCYA 2F5BH 3EOYG 4LDOB 4OUUA 3BP5A 1TPXC 2NZIA 4PJ9C 1ITCA 3LKNB 2OK0H 1PGRB 5FCUH 4NKOB 3MLXH 3OB8A 3QFDB 5IB5B 4UNVA 5T3ZD 2BJMH 2DM7A 1RZJH 4L8CB 1HYSD 5GSVB 2RBLA 3KNBB 1BF2A 1CLZL 1NFIA 3FCTA 2JCCA 3ZDZE 4N8VA 3T08A 4LASH 1F4XL 1GPOH 4PJ7B 2FBJL 2PETA 2OR8A 2VXVL 1L6XA 5FGBC 1NC2D 3QZWG 5C0AE 1I3UA 1NCNA 3ARBB 5GZNC 3G6AB 2AJVL 1RPQA 3QNZB 4O51A 4U1SB 2DWDB 4Q0XL 5HDLA 4P5KB 3KJ4B 3E2HB 1DBJL 3M17A 4PS4L 3ARBC 3MJ7A 3O3AB 3U9UA 1TNNA 1JTTA 1NPUA 2XZZA 1H3TA 5AZ2H 5IB2B 3KJ4C 1FORL 3E2HC 3I6LE 4KXZI 1L7TL 2CLRA 4F2MA 4GXVH 1IGJA 3RWDB 1ZMYA 3N1FC 3MRLA 1HKLL 2EDDA 3MFGB 3I6GA 1TMCB 5ITBH 1U8HB 4M9OA 4XWOC 5ICZB 5J57B 1IC1A 2MCPH 1K2DB 4FP8H 4ZUTB 5HHVH 1W0VA 2G60H 3FKUS 3QDJD 1KCRL 3VDBA 2MCG1 3O4OB 3OMZA 1AGCB 1OAZL 3GHBH 5T3ZE 4KKNA 4H88H 2VZVA 4KKCD 3BQUD 4NIKB 5C07D 4HFUL 5F7EL 5D1QA 1HHIA 3NABH 3SGDH 3O4OC 3LH2H 1YNLH 4HGWB 1MCQA 4R97B 2P7TA 2VDOH 4JO3L 4LCYB 12E8H 1NGQL 5F7DA 3VFMA 4OUUB 3BP5B 3OG4B 4M7LL 4DW2L 4N5ED 2VLJD 4R97C 2DTSA 1A1OB 4OZFG 4OQTL 2IQ9H 5C0NC 4XXDA 4WI2A 1OTUC 3V79C 3GMNA 4XP6L 2RFXA 3ULVE 1I3RA 4CN4A 4FQ2H 3WDHA 4P2OA 4EUPA 4O2FB 1CXEA 1NFIB 2VDNH 3FCTB 2JCCB 4OLZL 4N8VB 1D5IH 1T5WA 4NFBA 1ZKAA 2LU7A 5DUPL 4K3GA 2OZ4L 4U0QB 5HGHA 5C0RL 3DECA 3BPOB 5D5ME 3GRWH 3OAYH 4YNYA 2AV1A 5IR1A 2BHZA 4NN7B 2DBLH 2ADGA 1AY1L 1UA6L 5ID0A 4PV8A 4LFHG 5E99L 1Z9MA 3BPOC 3QDJE 1QR4A 4TTGA 5J11B 3M17B 4H20L 1IT9L 3MJ7B 1KXQE 3KPNA 4K3DH 4NN7C 3HC4H 4FFZL 3U9UB 3ZO0A 2Y7QA 5C07E 3K3QA 3MGOA 3A6BH 3S7GA 5J11C 4NZUH 3BDXA 1CU4H 3EYSH 2CLRB 1ZAGA 4F2MB 1IGJB 4GBXD 1CGXA 1DBKL 1Y0LA 3FMGL 3MRLB 3I6GB 3L7FA 2DKUA 5JXEA 1T03L 1KB9K 5I75B 5IBLC 5CP3H 2VLJE 1W0VB 4MB4A 1CXKA 3LDBB 3SKUD 3QO0A 1WQVT 4KTDH 4DQOL 5I75C 5JHLH 5LGKA 1HWHB 2NNAA 1CZ8L 3CH1A 4POZC 4U4BA 3ZE0E 5BS0A 3LDBC 3GSWA 2NY4D 1UWGH 2EC9T 5D1QB 1SHMA 3IF1A 3ALWA 2P7TB 1WZ1L 4QTIL 3P30L 1N26A 3BP4A 4OF3A 5SWSA 3AC0A 5F7DB 3VFMB 3DBXA 5GZOC 4QHKJ 3VXTA 5D1QC 1P84J 2OXHA 5J13B 5E5MA 2HRPH 4WI7A 1J87A 3WHE1 4ESKA 4XXDB 4FA8A 1SBBA 3GMNB 2RFXB 5J13C 1BWWA 3CCHB 4KH2A 1GGCL 1I3RB 1I9IH 4P2OB 3FOLA 1AJ7H 4HBCL 3T1FA 4NRXA 3PWVA 3BIKA 4X8JA 4L9LB 2QSQA 5DJ8A 4B7LA 5BJTA 1T5WB 3CFIC 4UB0L 4YPJA 5IB4A 4ONGH 2X9YA 4P2OC 5HGHB 2EEAA 5TDPB 1G9MC 4L9LC 4YHZL 1DLFH 1FL6A 2AV1B 4YFDB 5IR1B 4EDWH 2ADGB 1A7PH 3IU4L 3LKSA 4PV8B 4F8QA 2C7UA 5IMMB 2YD5A 4PJIF 3T3MF 3IFNH 4NQTA 4HC1H 3SO5A 3MLZL 3MA9H 3KPNB 4WFHD 4GAYB 5A2LH 2DQIH 4HUXA 2Y7QB 4OV6F 4FQIL 1LP9A 4BK4A 3TFKD 1PZUB 3MGOB 1MCSA 1YNTB 4M6ML 1JTOA 43CAB 3L5WA 5CJQH 1Y0LB 3RVVC 3I50H 1HDMB 1GAFL 2HJLA 3L7FB 3O2DL 1AGBA 3MV9A 5FA4A 4YX2H 3AREA 3B2UC 4P2CG 4UT6L 5IIEA 2YN5A 3WIIL 3PHOA 3FQTA 1IMHC 3ZHKA 3WFDL 4LU5L 5L2KD 2NNAB 1HCFX 2VXQH 3CH1B 1WJ3A 5BS0B 3GSWB 4UV7L 5FK9A 3ZKMD 2DQUH 2YKLL 2PYEE 1N7MH 3MV8D 3IF1B 2XTLA 4K7PY 3BP4B 4LMQE 2IPTH 5SWSB 4CGTA 2BNQA 4MXQD 3CX2A 3G6JF 2WP3T 3DBXB 1PKOA 4JQIH 4J3OC 3VXTB 2P5WD 5E5MB 1AIFA 4HJ0C 4JHWH 4IBLT 2Q20A 4KQ4L 1G9EA 2P42B 3VFNA 1C08A 3PJSA 1XGPA 3QEUA 2J12B 1V7NH 3CFCL 1KB5B 3FOLB 4YQXL 3EO9H 4WFHE 3T1FB 4NRXB 4NQEA 3UJIL 3PWVB 5BJTB 4X8JB 1KJ3H 4PLKC 5T33H 5IB4B 2G5RA 3MRJB 5EU7E 3VFWA 5EUOE 1QUNA 1GGIL 1ZLWH 2WWKT 4EI5B 1FL6B 4C59B 3LKSB 2C7UB 5E56A 3HMXL 2JIXD 4C58B 1MUJB 2VC2L 4EI5C 1AO7E 2FL5A 5L2KE 4R6UA 3RZCD 3MLYH 3VFPA 4Z6AT 4HUXB 3MLRL 4GMSL 5EOCL 1LP9B 1O0VA 2FD6L 3MV8E 5E6IA 3W5NA 3L5WB 4DKEH 1YJDC 3V8CA 4PGDA 1OAXH 4JR9H 2HJLB 1CF8H 1BM3H 3ECBA 1AGBB 3MV9B 5FA4B 2P5WE 4OCRH 4PBVC 4OM0L 5IIEB 4GMTH 1B4JH 1KC5L 1DL7H 4ZTPL 3EYUH 4F57L 3FQTB 1DLHA 1M05B 2QEJA 3ARWA 4NCC1 1QBLH 5C0DA 1MVUA 5FK9B 3D69A 5ANME 1IM9A 5T3ZH 2FH8A 1UT9A 1A0QL 5L7XH 1VENA 4UT7H 2VAAA 1A6PA 3IDGA 5DUMH 2BNQB 5DJDA 5IQ7L 3MFFA 4KI5C 3T0EA 4KHXL 3KS0J 2WZPD 1FIGH 1AIFB 1E0OB 3I3BA 4PR5A 3WFEL 3GHEL 1MFEL 2CSPA 5FUOH 2HT3C 3QXDA 2ZG1A 1C08B 3PJSB 2B4CC 1XGPB 3V5KA 1T1ZA 5HHOA 2A74A 3QEUB 2WANA 1OF2B 3VD9A 4OZIE 4MA7H 3ULVH 4OZHF 4TUOB 1A3LH 1EEQA 1MCCA 1UWEH 4NQEB 4ZTOH 3QQ4A 1R6VA 4JRXD 3GMRA 1BX2A 2UY7A 3VFWB 4ZXBA 4YPGA 1TJIL 3C6LD 2YA2A 3P9MB 4O2EA 1VDGA 3I84A 4FQHB 3NFSH 4OT1H 4Y1AA 2EICA 4JQXA 4CVWA 3B9KD 2AEPL 1SYVA 2YXFA 3HNTH 2H2PC 1G1YA 4I77H 4IMLA 3QDMA 3VFPB 2EIZA 1MWAA 1TZHA 3MCG1 4I3GA 4OFIA 4WUUA 1MPAH 1T0PB 4D0BA 4F7EA 2CXKA 5E6IB 1CFSA 4PJHA 3GFUA 4MQ7A 1KLGA 2NYYD 2ZUWA 3OF6D 3RWFA 4X6CF 2NY2B 3ECBB 5E6IC 1HXMA 4OLEA 4K55A 2R39A 1EHLL 2UWEA 1OSZA 4DKDC 4OV5A 3GBLA 1XGYL 2NY2C 1DLHB 3DETD 4HF5H 5C0DB 4W4NA 1C8PA 1U92B 3PL6A 4NNPH 1MVUB 3HE7A 3D69B 1IM9B 1CLOH 5JIHA 1MHEA 2DLTA 2PYFA 5CBAA 3NH7H 4LF3A 4WY7H 4M7JH 2VAAB 3IDGB 4HCRL 2VNCA 5C92A 1QFWH 4JRXE 5DJDB 1DR9A 1J8KA 3LMJH 4H1LH 3T0EB 4P49A 4WWID 1T5XA 5JTWA 1MCEA 4PR5B 3VU2A 1YEHL 4OBSA 3QXDB 4PGCA 1INEL 4QOKB 4R26H 3WFCH 2VDQL 1IC4L 3V5KB 1T1ZB 5HHOB 2A74B 4JKKA 3T0EC 1NANH 3GKWL 1N5YL 4AM0A 3VXSA 4QRQB 1N4XH 3WUWG 3QQ4B 1A1MB 3W11D 4X7SH 2DKMA 2MKWA 3IXTA 1W0WA 3GMRB 1BX2B 1JHLH 1BEYL 4ZXBB 4YPGB 5I1EL 5LQBH 4O2EB 3MCLH 3ORJA 4JLRB 2C4XA 3O6LL 3E8UL 5D2NA 3MACL 2DYPD 1AP2A 4FFVC 4GH7B 4Y1AB 3QEHA 4ZXBC 1NJ9A 3VFRA 4IMLB 2RR3A 3QDMB 4KMQA 2EIZB 1MWAB 3VWKA 5TF0A 1XZ0A 4WUUB 4JQXC 4MWFA 4D0BB 4F7EB 4I3SL 4DTGL 3QFJA 2WIMA 3UZEA 2EDTA 3H7LA 1UKQA 4K7FA 1KELH 5FFLA 3MV7E 5KTEH 4PJHB 4TPRH 2OL3A 2BNUA 3MXVL 3HFML 3U4BH 1PLGH 3RWFB 3HE6B 5B3NA 4KZEH 4R4ND</