3QIUD

Crystal structure of the 226 tcr in complex with mcc/i-ek
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
242
structure length
238
Chain Sequence
MKVIQTPRYLVKGQGQKAKMRCIPEKGHPVVFWYQQNKNNEFKFLINFQNQEVLQQIDMTEKRFSAECPSNSPCSLEIQSSEAGDSALYLCASSLNNANSDYTFGSGTRLLVIEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPADSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of specificity and cross-reactivity in T cell receptors specific for cytochrome c-I-E(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, E-K alpha chain
total genus 50
structure length 238
sequence length 242
ec nomenclature
pdb deposition date 2011-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qiuD01
2HAZA 5HGBA 1LMKA 1EZVY 3QNXB 2Q3AA 1X4XA 3WFHA 1YMMD 5D71H 1S9VB 4LPXA 3QIBD 5KVDL 5T3XH 4XPHH 2BNQE 1N5AA 3MUJA 5FYJL 3UTTB 3VGAB 1DLFL 4JO2L 2E7LC 1OL0A 3O6LH 4XPHL 1N59B 4Z0BH 5EWIH 5FIEA 1U8QB 3JZ7A 2FR4A 1S7UA 5A43C 3ARDC 3O6FC 4HUKB 1SY6A 2XWBB 2BC4B 4K8RD 3GNMH 4R3SA 2FX8L 1PW3A 4GG6E 4M93B 1A6AA 4JFDA 1V7MH 1QRKA 4Y16D 3THMH 2GSGB 3A6OA 4DUXA 2IFFL 5AYQA 2PXYA 2WINB 4FG6C 1F6AB 3MRNA 1OTTD 4QGYA 1TQCC 2HRLA 5TDPB 1KJ2B 4G6AD 3PJSB 2KDGA 3I3EA 3TWCH 4G8EB 4GBXB 4JHZA 5IESL 4P59H 1ZT7A 5JNYB 2FGZA 2JIXA 5C09A 3ZHDA 1MUJB 1JV5A 1JTOA 4P0DA 2PXYD 1BWWA 1C5BH 2ERJB 1IGCH 2IAMB 4Q2ZA 3K8KA 2FBOJ 4FQJH 4I13B 4G8FB 1T1XA 3I84A 2F5AH 1OGAE 4HIEB 3QIUC 5GIRB 2JIXD 2WQ8A 2EZ0D 3AB0C 4YHML 1K6QH 4O4YL 5HYQB 1CFNA 2M1KA 5DUBB 2Q7YB 3A6CL 3UC0H 4J3XA 4TNWF 4TVPH 1NDMB 1T6VN 3GEWB 5L2KB 1CL7L 2FJHB 4XVUC 1MRFH 3P11H 3I6GB 4GSDH 4XWOD 3C9NA 4HJJH 3UXFA 5SWSA 4HIXL 4OD1H 3JV6A 4U6TA 1U8IB 1I9JL 1MF2L 3U0WH 2R0KL 1A0QH 5J12B 1EH9A 5CBAA 4HDIB 4BA8A 3AREA 4L8CA 4JQVA 1UADC 1SJVA 3WFEL 1L9NA 5ESQA 1BQHB 1T2XA 1G0YR 1PKQB 2B20A 1R5IA 3FRPG 3NCJH 2L0DA 1UXSB 4LBEA 1JIBA 5CD5C 4JB9L 2YD4A 5CSBA 3HA0A 4I4WA 3DUSA 4NM4H 5BCAA 4TVSa 5ACZB 2VDNL 1YN7B 2H32A 3O6MH 5FKPB 1W0WB 3IDYC 5J1AA 4LLQA 4CDGC 2NW2A 1MEXH 5IHBA 3KLHC 2NW3A 3AS2A 4A2MA 1MEXL 1WZLA 3O2WH 1Q9WA 3UJIH 4L4TA 4KROC 4UT9L 1SJHA 3BPOB 4P4RA 4UT9H 4Q6IB 3Q1SH 3LS5L 1BQHG 4RCAA 1BFOA 5I74B 1T0MB 4J3OC 1VFMA 4O00A 1XGRB 2BVQB 4ODWB 3CDGA 4F15C 3PUCA 3L95A 4LAQL 1JVKA 1T1WB 5D2NB 4NZJA 1A7QL 2HWZL 1EEYA 4RFEA 2EKSB 3ULSB 3ULUH 2ATPB 2O61A 3IDJB 1NCDL 4ODBD 5KVGL 3KPRE 4XPGL 1MVFA 2O93L 4NQUA 2VLRE 5IG7A 2LV4A 1TJIH 5DRZB 1AH1A 2IALB 3BP7A 4PLOB 5F93C 3JV4A 1QFOA 4NFBA 5CD3B 3RY4A 2E7BA 2H9GB 2VMFA 3JBG7 1AR2A 3OKNB 5D1QA 2EIZB 4U7KA 1KCLA 3IFLH 4CW1A 3E6HB 3FHAA 3V6OE 4DFIA 1M7XA 3V5KB 4NIKB 3O2VH 3RVUD 4P9ML 1C5DB 2EO9A 3RWHB 1U8PA 4F3FA 4QXUH 1FL6B 2A73A 4QHNA 3MUGB 5HVFB 4AL8L 2VXSL 3EJYC 1MIML 4MDIA 1HWHB 2MCPH 1I85C 3BYYA 3BWAA 1BQLL 4Q0XH 3B3IA 1IZKA 2WQRA 3ARDD 3MXVH 4OLUL 4PJCE 2X09A 3VFUB 5DLMH 1U8HA 2IH1A 2Y1VA 4O2FB 2I26N 1NBYA 4QRQB 3MREB 3V6OC 4E42A 4NUJB 4Y5YC 4AQOA 4YC2B 5D6CB 4JN1H 4GSDL 1DQLL 4ZDHB 2X4SB 2VDQH 4ZPTB 2W07A 3TJEL 4LU5L 1UG9A 2Z4QB 2HKFL 4GAFB 4TQEL 5DRZA 3HLAB 3NCYS 3TJEH 1F6LL 3BN9D 3E0GA 1CBVH 3KYOB 4Y5VB 3HUJE 4IRJB 1AIFB 1FLRL 1S7TB 1ZLVH 3VRJB 3NA4A 2D7TL 4HX1A 3H2WA 1NGPH 4L9DA 2CO7B 4LPTA 3QIWD 2QHRH 3BRGC 2G2RB 4LCCC 4H88L 3L3KB 2GUOA 4CBPA 2CKBB 4HCRL 4WI4A 5JW5B 3QEQD 1GOHA 1AO7A 2IPUK 4EN3A 2AGJH 4M6NH 5HPMA 4KU1A 3HAEB 4H8WL 1RZKC 1ZMYA 2VXTH 2IANA 4FQXB 5B8CC 2XOTA 4LCWB 5E00A 1H0DB 4NRYA 3N85L 4E5XB 3LVEA 4AMKL 2DMBA 4ZAKB 4WI9A 4QGTA 3BZ4A 1NCCL 3L7EB 4AMKH 3NFPA 4HWEH 4M48H 1BVKB 1ZHKA 3VGDA 5IB2B 5T1DL 2HKHH 4AYFA 4ZFOL 5F7EL 2J88L 1X5KA 4QHUB 4Q9RL 1PKQA 1BIIA 4U1SA 1DEEA 3MLTB 3PIQB 4H25A 3G5YB 5M95B 5SX5K 4XNZC 4BQCA 5J56B 4WEBL 3MRLA 1I7UB 2VISB 4MD4B 4R4ND 1WISA 4XVSL 3MRJB 4UTAL 2WWKT 3JV6B 1FGVL 4X6FB 1OY3B 4LDLB 5GS0D 3U46B 1NUGA 5DO2C 1B90A 1L0XA 4ZUWA 4BZYA 5JPMB 3ULUC 2FECL 3NGBB 5EOQL 1FVEA 4PUBH 2CLZA 2VL5A 2DQEH 3KR3L 3U4AA 5B3JF 3PHOB 1HSAB 4LLAA 1S8DB 4HPYL 2Q76A 1XR8B 2BNQA 3T3MF 3BT2L 5CMAA 3MJ7B 3OKLB 5C09B 1RFDL 2J5LB 3KJ4C 1F3JA 5JXAL 1X5AA 3VFSB 3PJSA 2BY0A 3HHRB 3MXVL 4OLUH 2W1NA 1W8NA 3KLAA 1UXWB 1MSPA 2PXYB 5INDB 3QDMB 1XT5A 2B1HH 4GAGH 4DUWA 2I07A 5IHZA 2KL6A 5HJ3A 1QVOB 2OI9C 4FFVC 4LPYA 3C5ZC 4XNQB 4JFFA 3V0WL 4UBDD 1A3LH 1X9QA 3LMJL 4RFNB 3WO3B 3IDGA 4G8GD 5HHVH 5GS0H 3UCRA 5ITFB 3QUYA 4HGMA 4X6EB 3QI9B 1IM9A 2GAZB 1D9KB 2YWZA 43CAB 5JO5A 4N8PA 5HHOA 1G9EA 3O8XC 5GGSY 3ZKQD 1G7QA 2J4WH 5JXEC 1CDUA 4PREB 4M1GH 5IMKB 3NACL 5I15H 4CVXA 2EXWC 1P4IL 4OIAA 3EYUL 3BWUC 1FAIH 4IIQA 5DFVC 3OX8B 3WJJA 5MP6H 5I6XC 4OZGF 1BM3H 3RFZC 1RUQH 1EERB 4YDKL 1VFBB 4ZPVB 2OTUA 4P5TB 2QSQA 2LTQB 1WTGT 5ALBL 4OLYH 1XIWA 4F8QA 4K3DH 3I02B 3VGGA 2OJZH 3OXSA 2FCBA 3ARED 1CXLA 1IC5H 3E6FB 2F58H 2CUMA 4JKPL 1BZ9A 4LEOB 5F7KC 3O3BB 5A2IH 4CN4A 1SM3H 3BPCB 3HRZA 3EUUA 5DJ8B 4PRDB 5IM7B 1TZIB 1G1YA 4NCDA 1VEOA 4LMQE 2GT9B 2NPLX 3LN5B 1A7NL 4PGZA 1M71A 2AKRA 1NCTA 3GJFA 5KSAC 1MJ8L 1H8NA 5CJOL 3CDYA 4YDVA 2ARJQ 2HLAB 1I75A 1WEJL 2I60L 5DJXA 1H3UA 3U1SL 3T0ED 5I1LB 2XZCH 3QDGE 3OGCB 5E8DH 3ECBA 2SEBB 2XKSA 5TF1L 3AXLA 1G9MH 3PV6A 1UACH 1PD6A 5TDNA 2J7LA 5IW6B 1MRDH 1S9XB 5DRXA 5JDSA 1ETZA 4X9BA 1F2QA 4PIRF 1UA6L 3SY0A 2B4CL 2DI9A 2PCPA 1NEZA 4XPTL 1F2XK 2B4CH 2WUCH 1MCLA 4J8RA 2X44D 2Y36L 5KVFH 5KG9A 3D2UD 1J86A 4ZTOL 2GTWA 2Z91B 3TNMA 1I8MB 4F7CB 1HZHH 3A6BH 3PP4H 3QJFA 1INDL 1UM6H 1ZHLB 3FB7B 3QFJE 2B1AH 3OR7A 4JR9L 4OUUB 2YPVH 2VWEE 2FO4B 3FT3A 4XC3L 1NC4A 4PD4K 3HNSL 3U4BH 1K3IA 3DMMD 2YD7A 3MUZ1 4HS3A 1YMHA 3QIUA 5T1LD 4KWUA 4QT5B 2OMBA 3N06B 1OSZA 1FZOA 2P5EA 4QCIB 3RL2A 3UTQB 3AY4A 5F97E 1OPGH 5D6DA 5C0EB 5C0FA 1ZLWK 1MCJA 4EUPG 1J0YA 3BZFB 3MV7B 2AJZA 4E41D 1WTLA 2IC2A 2VXQH 1JZ2A 1I8KA 2PW1A 3TVMA 3QNZA 2CIKB 5HI4C 5EUKB 1FZMA 5SX4H 1A1OB 5C07D 3ES6B 3L3GB 4FFZH 4JQXC 4NBZB 4RSVA 4O9HH 1X3DA 3U4EA 3EHBC 2VLRD 4Y4HA 3RTQB 1MHCA 1UJ3C 2OSLA 4UUJA 5DS8A 3RWDA 3S36H 4Z5RB 1JN6B 3WO4C 3SBWC 2EDNA 1YEIL 2CLRA 5C07A 3NIFE 4U05A 4X6DB 4JQVC 1BM3L 4D9RD 4WFGE 2WMPA 3ARBD 4KRPD 4M43L 2R0KH 3BKML 1HILA 1A2YB 1TTFA 1IAMA 1V3MA 3AY4C 2ZOLA 4R7NA 4YFLF 4MWFB 1HOCA 2ESVB 1OD9A 4HEME 3VH8A 2VR5A 1M6OB 3PWLB 4WENB 3IJHB 3I9GH 3AU1A 2H2SC 4OLEA 1SYSB 3L3IA 4U4BA 4PJ5B 4XXDA 4H0GA 1G7IA 2AXGB 4WI3A 3LQAH 3LKSB 1XGUA 4U6HA 1IKFL 2A6JB 1BP3B 3VWJB 2ZJSH 4Z7OF 3TNNB 5CJOH 4Y19E 2ZUQB 4XCEA 5BO1H 5BOZG 4G9FE 4KK8C 2VIRB 2ZUSA 1MLBA 5BS0D 4U1NB 5KSUB 3DHMA 5E8DL 3TN0C 1JFQH 4EDXB 5B38B 2J8OA 2YZ8A 1K4DA 1X6NA 1DLFH 4JO2H 4LNVA 1KFAH 2DLTA 1BFSA 2EE3A 2A2QT 5KVDH 4K7PH 4NQCB 5D5MA 2HVJA 1NLDH 1JE6A 1ORQA 3LKRB 2HJKB 2JELL 2G75B 5B21A 2X70B 1XEDA 2JE8A 3ARFC 3MLWH 3VXPA 3T4AB 3GK8H 5IF0B 5AD0B 2HJLB 3MACH 3W39B 3NN8A 3HUJA 3LKNA 5F6HJ 1RUKH 4NSKA 5F8RC 2GJ6B 4ZO8A 1N3NB 5EN2B 3THML 2FX9H 2AEQH 2WW8A 5DMIL 3HNTH 5HGHA 3O9WA 4HK3N 5FV2A 5AWNH 5CIPA 4U1LA 4BZ2H 4PBWD 2EDXA 5E0QA 3DMMB 4NM8L 3IGAB 3T3PE 4LHUB 5I75C 3D3VB 1QFUL 3W11D 2OL3L 1MCCA 3CU1A 5EIVA 4JAMB 5I8OH 4HS6B 1HHJB 4FQHB 1VPOH 2IQ9H 2MSPA 2VJXA 1QRNA 2F5AL 2W9DL 5TF0A 3KWWB 1ZLUK 4JO3H 1MLCA 2HP4A 5ESAA 1OWWA 1EHAA 5GSVB 1YY8B 2PO6A 1DE4A 2O5YL 3QFDA 4IDJH 1J88A 3BKCH 1IC7L 5C08E 3BPNC 1UEYA 4JM2D 5KOVC 1JHLL 2GY7B 1T5XA 2GFBB 5C08B 4YAQA 5DHVA 1T7XA 3LEVH 2ZUYA 1ZVSA 2A6DA 2CR3A 1F4XH 4I3GA 2R23A 3WD5L 5IJKA 3GSUB 4GKSA 1B3JA 3RWFA 3WFEH 4JGJA 1W72L 4U6XA 3PWPD 1KCKA 1KTLB 2XY2A 1OF2A 5E6IB 2PW2B 3TA3A 1M7IA 4OSUL 5H2BB 3S36X 1EDQA 3NPSC 5I17B 5FM4A 3GRWH 4PJ8C 1T0PB 2V6HA 4MJID 1YEEH 5CGYD 3NMEA 4MNHB 3ARDA 4G6JL 1UWEL 4YK4C 5IVZA 4P23C 1G6RL 1U41A 3FQWB 3TO4D 4BSWA 5C92A 5D72H 3W11C 4O2CA 4D3CH 1DBKL 1KEMH 1U58A 5JIKA 2DI8A 5I19L 3REWB 3MLVH 1E6JL 1ULVA 3RX5A 1MI5A 5EIIB 2W65A 4P99A 4Q97A 3ULUF 1MHHA 1OGAD 4Z18A 6FABL 3KWWA 5BVPL 3ZDZF 3OR6B 5A2KH 5BVPH 1M1SA 3VFWA 1HHJA 5FA4A 2R2EA 1JGLH 2AEPL 15C8H 3B8YA 4P5KA 5DJ2B 4X5XB 1HSBA 2YMXL 1ORSB 2IPTH 4YUEH 4FQIL 4BQ9A 3GM8A 1AC6A 2A0LC 2AJVH 3BH8A 1KIRA 2V2WB 2ED7A 2NY2D 3DVGB 1F6FB 3S97C 5FYKL 1HYRC 3H8NA 3MV9A 4F9LA 4C54A 3R0NA 2AEWA 4JPKL 4DCQA 4WHCA 2YRLA 4OFIA 4YEEA 4C56E 1HHGA 3DX6B 1PLGL 3QCUL 2AEQL 2IQAA 4Y4FD 1TPXB 4J4PA 1PG7W 2E9WA 4F7MB 4AH2B 5C9JB 3Q6FA 3BVNA 3W39A 3ZKXC 2HJLA 1C7TA 2AJSH 4HKXA 4JZJB 3UO1L 1IGFL 4PP1D 1YC7A 5B22A 5FB8B 4Y4FA 4R0LB 4Z7WB 3UJJH 5SWZA 3LKRA 3J8F7 4KQ4H 3BIBX 1KJVB 3NA9H 4PJ7F 3ZE2E 1QD0A 1Q0XH 1IZJA 4WHYG 5DQJA 3Q48A 3RWCA 1OAXH 1MWAA 4PJAB 4OM0H 5CBEB 5F72S 1MHEB 5DHYB 4TNVK 1C12A 4EEEA 4XP1H 3DX7B 4GS7C 5H94B 2EYSA 2AJYL 2QV2A 1BPVA 3HG1E 4N90E 3VI4E 4H1LB 4HG4J 3PQYE 1MCOL 1P7KA 5BMFL 4HMEA 4UINH 3QIBC 4QXTA 2VDQL 4EI6B 3OJVC 2JK5B 2VR4A 1DQLH 4I0PA 2P5ED 2VNCA 5F9AC 4ZUSA 3FT4B 1CLCA 1FZKA 3CK0H 4G9FA 2ARJA 5J1SC 3WIHL 1IL1B 3TBVA 3NFNB 4Z78A 5GGRB 3FOLB 2RFXA 1QPPA 4L9LC 1FL5A 4XXDB 4L29A 1LGVA 4R4NC 3TZVB 1EBAA 1JP5A 4IIQC 1GHFL 5DC0A 4K9EH 2VB5A 5KSBA 3LRSA 5BVJA 5F7WC 4J7RA 5F44A 3RVXC 3TPKA 1N26A 1OP5H 4LL9A 1WWBX 4NN6C 4PRBB 5J3HD 4HCRH 3PWNA 1NCAL 1ZS8A 1CGWA 5F7YC 3VXUE 4JEGB 2FWOB 4M6AA 2D7PA 4X6CB 5GRXG 1CFTB 3QT2A 4A2LA 4APQD 5CP7A 4KRNA 3D69B 1S78D 4PJ7B 4I77H 1CE6A 4NN7C 1A7PL 1F00I 4YIQA 2RJMA 3QCVH 5INCB 3LN4B 1R3JA 4X4YA 5KW9H 5F3HA 4CJ0A 4PV9B 3OHXB 4MVBD 4MS8D 3K7UA 3QUXC 5AZ2L 3BDYL 4G8GA 4I1NB 4LF3A 4LCYB 1JHKL 3GGWB 5ECJE 3S5LG 1HNGA 5IMMA 2B8OT 2VQ1A 3QXDB 4UOJA 3QWRA 3DO7B 4LARL 5BJTB 5K9QI 2GY5A 3L3DA 4PTTB 1HYSD 4TSAL 1NH6A 4XP4L 4GRLC 4YHKL 4GG6A 2CIIA 4OIIL 1MJ8H 4R8WL 3QH3B 2YPKB 4OB5L 4PJCA 5E6ID 1GC1C 4PRAB 3VXME 4UTAH 3QQ4B 1MQKH 1ZT1A 3OKEA 4ZG1A 5L7XL 3C6LB 2C3GA 2OBGA 5C0RH 3AMLA 5EU6B 2WWMC 3VRIB 3L7FB 1NC4B 1WJ3A 1QR1A 1AD9A 1MIEL 2RBLA 3WFCL 1ZHLA 1MRDL 3ESVF 4Z7NF 5JW4Q 1E4JA 5B3NA 1GGYA 5JHDA 1VGKA 2FIRT 5F1SA 3QJHB 3CFEA 3F62A 2IAMD 1IGFH 1EX0A 1C08A 3CMOL 5F1OB 4L3EA 1S9KC 3PWJA 3QO1A 1KIPB 1NBZB 4Y19D 3IAPA 4YBHA 4XHJD 1PQZA 3FO2A 4UDUB 5C0NC 5EU5B 4WI5A 1U3YA 1NCUA 3OJDB 4KPHH 2VDLH 3D3VD 1U8KA 1AKJD 3B6SB 3IYLW 3MLZL 4GW1A 5BW7C 2CDFB 3CFJB 7FABH 2F5BL 5E9DA 3HE6B 5TH2B 4MJIE 3EYOB 4P9HC 5DWUL 5EZIL 2H3NB 5FOJA 4ZOEA 4IDLA 1HH9B 5HHVL 4KTDL 4PLJD 4QTIH 2B2XL 4NCC2 3ZDYE 3NIGE 5IV2A 3O3BA 5TJWK 5AG9A 2RAMA 3GMRA 3MRRB 4LIQE 3OHXA 4PY7B 3K74B 5IP4A 5I1GH 4UILL 3KYMA 5LGKA 4YXLL 3LZFL 3ZHLA 4DGYL 1OOAA 5I1JH 1XIWB 3LHPH 4X7SH 3NOIA 3LCYA 4ENED 2NY7L 3MBEA 4JM2A 2AAVA 8FABB 4U3XA 4HC1L 4U1IA 2X4RA 2BX5A 3MRBB 5IB4B 4Y2DB 1B0RB 4N9GB 3TYFB 4XPBH 1ZS8B 5LQBL 2YD1A 4HXBH 1F4HA 3QUZD 3GMMA 4KTEL 4MQXD 5LCVH 3OTTA 3BDYH 2FJFB 1KB5A 5D7LD 3PL6D 4GW5A 4YWGL 5IBLC 4X9FA 4NO5B 2A9MH 4X6EA 3NFNA 2XZZA 4JLRB 2ARJB 1DVFB 1L7TL 3ZE1E 2D9QB 2EDKA 3O6FA 3D85A 3QDJE 1DP0A 2QADB 3JV0A 4JFZH 4QXTB 1YC8A 1OAYL 2OJEB 4D2NA 4JPWH 1TDQA 4J1UA 1IGYA 1VACB 4ORGA 4PGDA 1IAOB 3KLAB 4LQ1A 4QRRD 4HFWB 1JZ6A 3LH2H 4JFHD 4P2OB 4CJ1A 1KFAL 1GRWA 5FYJH 2PF6A 3MRPA 1UA6H 5ICZB 2OZ4L 4XPTH 3LPWA 3PWPE 2I24N 5IKCB 4N0CC 2WP3T 3RRQA 4NPYB 2VLRB 4OCRH 2AK4D 4S0TD 4AM0A 4KAQH 4PJCF 4R0LA 4KJYB 4WTZA 2H32H 4B41A 1S7SA 4BQ8A 1XF2B 2FX8H 2MPAH 2EDJA 3VXTA 5JPMA 2DBLH 4ZFZA 4WWKD 1FGNL 2YA1A 4F7MA 5C9JA 2VO5A 4QOKB 1KTKE 1CLYL 1SMAA 4X6FA 1HHGB 2BCKB 3RWIB 4WCYL 3C60B 1HH6B 1EFXD 1RZJH 1IEBB 3U4BL 4R9HA 2GJ6D 3MRJA 2FD6L 5J3HC 2D7MA 3EDDA 2C3HA 2H41A 5T1LB 5MHSE 1KIRB 2V2WA 3GSRA 2G5RA 3OWEA 3G6DL 5FHBH 1BD2B 1QFWH 3KPPA 2YD6A 3MA9H 2N56A 5FO9A 2DKSA 5JUEL 3H3PH 1TVHA 3GSNA 4UI2A 4FFZL 5I0DA 4JVPA 1A5FL 4HKBA 2DM2A 4JO3L 3TGXA 4MXWL 2CRIA 4YDIL 2Q86A 3D39A 4Z7NE 4HXAH 4OAWA 5GISH 3FQXA 3QUML 3VXMA 5IJVB 1QO3A 1UB5A 4HXAL 4G42A 5E7FA 3MROB 4X7SL 5IHLB 1VESA 3WJLC 4LRNL 4ZXBB 3NCMA 5EH1A 1CIUA 2OXGA 1I1FB 4LCWA 1BVZA 1QSFE 4JREB 1E4WL 5IVZB 5TFSL 1KCSL 5TDOA 4HC1H 4G8IB 4MAYC 1VFOA 1W0VA 5DMGD 3L5JA 1MFDH 3GBNL 4X99B 4EN3B 4GRWH 5JW5A 5H2BA 3SCMC 4DK3A 4K3JL 5DFTA 4ZD3H 3W0WB 3QQ9C 5DEFB 1OF2B 1MAML 4PP2B 5I73C 4M7ZC 1XGQB 3G5VA 5LBSL 5T1MB 4QY8A 1S9WB 4JZOB 2XA8H 3MXWH 3PDGA 2PN5A 3KYOA 4PTUA 1VEPA 4U1GB 1YNLL 1NGWA 2DWEB 4G6JH 1S7QA 1MFEL 2ORBH 5F7FA 2CLVB 2LQRA 1M05B 3QA3A 1YNTB 3OGOE 4JPIB 3RDTC 3MV9D 1KEML 4NUJA 2V5TA 2R69L 5CKAA 5L6YL 4NZRH 1UB5B 2A74B 4WY7L 4PJ9C 2BVEA 1A6TA 3FONB 4OZHB 3FQXB 2R69H 4ALAH 5DC9B 4HZLA 5E99H 5KTEL 3I2CH 5FGBC 1OW0C 1QSFA 4G9DA 4PRHA 1OLLA 3VGHA 4QRTA 1XF3A 4HWZA 3O6LL 2UVFA 4HKBB 1NSNH 1YPZE 3IFPB 3GSWB 1TVHB 3GSNB 4X9IA 3C2AH 4JAMA 2YD2A 4E41B 3W9EA 2DQTL 3BIAX 2XN9D 2XWJB 3T0XA 3MNWA 4LP5A 3QIBA 4XPGH 2A73B 4LHUA 2DKUA 2X1XR 3B2UD 1PYWB 3QCTL 5ADPH 4TTGA 1AQDA 3MACL 5IW1A 5F7HA 2A1WH 1BVLB 1U8PB 4U1LB 2Y72A 1HNFA 2JB6A 2X7LA 4RMVA 2V7NB 3O9WB 3ZDYF 1K8DB 4LVNC 2BCKA 3RWIA 3RDTD 1YQ2A 5HXMA 2YPLE 1JWMB 3W9DA 1H5BB 4BFGA 1XF5A 1U8OA 2D0FA 3JUYA 4QHKJ 3RZCD 1LVEA 2DD8H 4OGAC 2IALA 4ODHH 5F71A 2DD8L 4XX1E 4D8PB 4HAFA 4NM8H 5HHPB 5LXGL 3BRDA 3RWJB 5FHBL 4AM0B 1KCUH 1QBLH 4NPYA 2XFXA 1ORQB 3HS0B 3ARGD 1UYWH 3SE3A 4ZNEA 3GI9H 2VLMD 5ICZA 2DB8A 4FQQA 1R3LB 1A5FH 1HXMA 1U8LA 5HYJA 2YA0A 3CFDA 1IEHA 1EMTH 4FS0A 4MQSB 5KSUA 1SVZA 2I5YH 1JHLH 1MLBB 1Q9WB 3STLB 4NO0D 5IFAH 5A16A 5JORB 3KS0J 2Y9RT 3O0RH 5IW3A 4XNXL 3ZT6A 1F4XL 5J1AB 2Y5TB 2YPLA 3ARQA 4JY5H 3BJ91 3WIIH 3QPQC 2C7UB 2DOCA 4R97B 2VABA 3LKQA 3T0EC 1YEJH 3TT3H 4OLZL 2QHRL 3V9FA 1UXSA 4LBEB 3E3QC 3BGFC 1JPGB 3CFKB 2ZKHH 3EO0B 1RY7B 1BQHA 4QHMA 1K2DA 4E0RB 3RY6A 4ODSH 5J9PA 5EA0H 1KPVB 5BS0B 1L9MA 2R39A 4YX2L 2GJZB 1ADQA 4ZSOB 1TCMA 3MRBA 5IB4A 3QA3B 3U79A 4Z7WF 2AK4E 1CDCA 5LGHL 4JFXA 3QEGH 1IGJB 5D72L 3LQMA 4X6DA 3QEGL 5EBMB 4YQXL 5J8OA 1QKZH 3WNNA 4L5FL 5AZEH 4POYA 4NQDA 1F13A 5E2UH 3H9SE 1NDMA 1MHCB 4S1RH 2LVEA 1BEYH 1B0GB 3EOTH 3TLRA 3CSYB 1WIPA 3HMXH 1MHPL 2EXYC 4KY1H 2A6IA 4OTXL 5KS9F 3QNZB 2ENYA 4K7PY 5IK3A 1T1XB 3PDOB 1MCKA 2DDQH 2X4PA 2NZ9D 2XACC 2D03H 2HN7B 1W0VB 1YECH 3TN0D 3WIHA 5C0FB 1MY5A 4NRZB 4HF5L 1GGIL 2A38A 3VXOB 1AFVH 4HF5H 4NDMB 4LSRH 4XVSH 2VAJA 1X4ZA 4XBGB 3CU7A 3MROA 5D5MF 1A02N 3O8XD 3C5JB 4HEPG 3BMVA 1JCKA 3B9DA 5HHMD 2GSGA 5HHXL 4GW1B 3LS5H 2I9LB 4PG2A 4LIQL 3OL2A 5CSGA 4LGPB 3FB5A 4UT6L 1I8MA 3CX5J 4EOWH 3VFTA 2HFTA 4LAJH 4OBRA 1NGYA 1RUPL 5F9WB 4NQCE 3MV7D 5DJCB 1UEMA 2VLJE 3KPPB 3KPMA 2PCPB 5EUOE 4LSVH 1OVZA 4JDZA 1NCDH 3ULVF 4S2SB 3UTTA 2HFEB 1EEZB 1A9EA 1KTDA 1U93B 1VSCA 3MRHB 1I3RA 5DVNA 5F3BA 1IEBA 4YO0A 3TFKD 4KPHL 1MCEA 3TV3H 1NANI 1ZK9A 4ONFL 2WNGA 3SDAC 4MNGE 4QOKA 5ISZD 5MEPA 5A3ID 5HGBB 2AS5M 3V6FA 3T0BA 2BSRA 1LE9A 1X5FA 3CFCH 2P1YA 1R3IH 5DWUH 3CLFL 3DRTB 2F54B 4K3HA 4MA1C 4IOIA 2DS4A 5HI4D 1DJSA 3VXOA 3DX8A 4XMKH 2NXYC 4YHOH 5GS0C 4UDTA 5C0CE 3EIFA 1JNHB 4U6VL 4DGVL 3PDOA 3NCEB 4QTHA 4U6VH 5JXED 2VQ1B 3QXDA 2MCPL 2HG5A 2VZ1A 1ZA6B 1WFTA 3GGWA 2VH5L 3P77B 3TT1H 4F7EA 4YDLB 5E08H 5F9DC 3B5TA 1X5YA 4ONGL 5DQ9B 2ADIA 2BVOB 4XT1C 1I1YA 3BKJL 3OXSB 4JFED 3MLXH 1JTPA 5A3IC 1URLA 3C5ZD 4CMHB 4M8VA 3ZDZE 3D69A 5IJKC 5HGGS 3L3HA 3N1MC 2YA2A 4I5BA 1J8HA 2IPKA 5GGUA 4P57B 3TYGH 3FQTA 2Z92B 3RX8A 1H3GA 3QXVA 1RIHH 4RGNB 4LOUC 1GJIA 2H1PL 3QR2A 4HV8B 4H26B 5IROA 3LPFA 2H1PH 3SGDI 4BJLA 2ICWB 2X4QB 4IEFB 4Q9RH 4DAGL 3SKJH 5IT2L 1DSFL 2Q1EA 4ZOAA 4YC2C 4KMTL 4YWGH 1BFTA 3QIWB 1ES0A 1RK1B 4ZYKB 5SX4I 3QXAA 2ZNXA 2OMNA 5EORL 3LKQB 4DK6A 1BMGA 2ZSWA 4UT7H 5LG1A 3VXSE 4Z78B 5EORH 5IBUB 2VWEC 2UZIL 1TLKA 4PRNB 3MV8E 1B4JH 1RZJC 4JFFB 3IKKA 5I9QB 1DBML 1FPTH 2F53D 1B4JL 1KV3A 2NXZB 2VDML 4X7TB 1J5OL 4YHZH 1P4LB 1S5IL 3KLDA 3D48R 3EYSH 5INDA 4WI7A 2BVOA 1EGJL 4OZIB 4OF7A 3O11B 4KKBD 4LLUB 2Y5EA 3VFSA 2ZUUA 4QRPE 1WUNT 3HR5B 4UAOB 5IR1A 1KXVC 3HS0A 5I8KH 3L3OA 4PYHA 4OCSL 3MBEC 1E0OB 1YEFL 3NZHH 1CE1L 3HCVA 5D7KD 4I0CC 1WT5C 1FVEB 2C4FU 2XICA 2GJ6E 1UM6L 1AHWB 3WFDL 2C3WA 5D2LA 1IAKA 5HVHB 4YR6A 2F53E 1IQWH 3WFBH 1GGTA 3HNSH 1H5BA 5E2WH 4R2GD 3EJZD 3DX6A 1LK3H 3T04D 1PSKH 2M26A 4GUPB 4Z95H 1I3RB 2VKXA 2X1WL 2V7NA 5C1MB 1EO8H 4RWHA 2JJTA 3M07A 2AI0H 3MMEB 2VISA 2FYYA 2DQEL 2HVKA 3VXQB 4L3EB 3KPMB 3HC0A 3FRPA 5DJ2A 2AK4B 4U1SB 1B2WH 3H3PL 5CUSL 1CYGA 1MELA 5IVXE 3QPQD 32C2A 4W4NA 5AEAA 5KSVA 4KK5D 3TH2T 3VFTB 2ZUXA 3P40A 3QUYD 1T22A 5T5FH 5D7SL 5MI0C 4K07A 4YNYA 4HC1A 3DV6B 1AD9B 1JGVL 4XTRC 4KI5F 2X9XA 5EC2B 2ZCKL 2A74A 5D8JH 2YD8A 5GGTL 1ZT1B 1UT9A 3OKEB 4KHTL 2OYPA 2I9TA 4HUUB 4M6OL 1M05A 3QH3A 1JZ5A 1WC7B 5GS0L 4IRSA 5TQ2L 3ZTJG 4ZTPH 1T7WA 2XG4A 4YXHH 3U0PA 1JZ3A 3S35L 1LEKB 5E8NB 3STBA 3NCFB 4L3CA 3G5VB 1M7DB 1RZKH 4NO3A 4G3YL 2VLJA 4Z7OE 5LCVL 4KRLB 3ZKSD 4PP2A 2MQCA 3CSYA 1GIGL 4JGUA 4M02A 2QKIA 2HFFB 3L3JA 3RA7H 4KUCF 5F1IB 1BFVL 3EDKA 1A22B 4X7CC 1CI5A 3DXAE 4Y5VA 4NQDB 2HTLC 3RJQB 2EDRA 4JFYA 1HINL 4OJFH 1HCVA 3HLAA 1OD7A 2BNRA 2Z4QA 4RNRA 3FAWA 4NZTL 5CINH 8CGTA 5EULV 4PJ8A 3WNPA 4CU8A 3X3GL 2XTJE 1FO0A 4QLRA 5D6DC 1OB1B 4MX7B 2JKXA 4NO0B 1YDPA 2BFVH 1OQOA 4AIXA 3WCYA 5DJ0A 3D39B 4QHMB 3LRSB 5BVJB 1KIQA 2ZSVA 4FQ2L 2DLEA 3C5SB 4RRPG 4F7PA 1IT9H 2DTSA 1BBDH 4XVUD 3UEZA 4C4KO 3KXFE 4WIQA 5FYJE 5FO9B 2K7PA 4N0CD 2JELH 2MQ0A 4P3WA 5GGQH 4WV1B 3SE3C 4OCRL 3VE0A 5DJZB 2BNUA 3LSOB 1LQSR 4KTYA 3QIUD 5T1LA 4NQDE 4XCNA 3FO1B 3ALWA 5T1KA 1CVRA 4O02L 3D87B 3DXAA 5E6YA 5F7MC 3K1KC 2EYSB 5B4MC 1YEKH 3V5HB 3CFDB 1DQJB 2BDNH 1YJDC 1N3NA 5EN2A 5DHYA 2IG2H 4MD0B 1N7MH 3BPLB 2HH0H 1EO8L 1RD6A 3FB6A 3ABZA 3SPVB 3UTSD 5F7UA 5FO8A 1JZ7A 1HKLL 3VFGH 4PJHA 3I85A 4PJIB 1T1WA 5FGRA 4OD2B 4D0CA 4MHHI 1CGYA 3UTTD 2WBJB 4HKJA 4X4MA 4OZHF 4RGOL 25C8L 4GO6B 3PP4L 2HA1A 2VDKL 1RURH 3H3KA 1EMTL 3SGJA 1IAOA 2R4RL 4LFHG 4X6CE 4H1LH 5E5RB 1VACA 3MJ6A 3DURB 4LRNH 1TZHB 4GXUM 2P44B 4M7JH 3MNVB 2VIRA 4WUKL 5FUCE 2FEEI 1DUYB 3ULUE 3H9ZA 3O6FB 3TWCL 4YHYC 5DJZA 1LD9B 5EZJB 5C0DB 3GBNH 3ILPB 3MNWB 3UYOD 4JLRA 2XWJA 2Q8BH 3DUSB 2DIJA 4NQCD 3GSWA 5JW3H 4UQ2A 3IFPA 2ZKHL 5SWZE 1OSPH 1NDGB 5FUZL 5HHQB 3ZSSA 5I66B 5TE4H 4PRHB 2L4OA 3HI5H 5GRZA 4HZLB 5EC1B 3WLWC 3O4OC 1MI5B 5D2LF 3AREB 4L8CB 3REWA 2CRZA 3CPLA 3BX7C 4DOHE 5HDQH 1CD8A 3GSQA 1XGYH 3SO3C 3DECA 4JZNA 4Z0XB 1EJ6A 4K71C 1BAFH 4OD1L 4TNWK 4PJIF 3MRGB 2G60H 2DM4A 3O3AB 2BNRB 2FSEB 4V1DD 1UM5H 3WV0A 4OM1L 1MFAH 5FKAB 4NZRL 4PJAF 3QAZC 5B3JE 2VDRH 1U3HC 3WS3B 4K7PL 4MAUH 4HIEA 2APXA 4W81A 1Z3GH 3OBAA 4LASH 1T6WA 3HFML 4PS4H 3RIFK 4X99A 2GSIA 4Q2ZB 2AJZB 3H9SD 3T2NL 3U0PB 1KENH 2V5MA 3P4OA 3BDBA 3TF7C 1MCRA 1MUJA 5D96B 4G8IA 4P2RE 1JPFA 1ERNA 5F88A 2DIBA 4O5LH 1NAML 3UTQA 4MD5B 4Y88A 2I9TB 1KJ2A 4NJ9H 3TO4C 1K8IB 1TVDA 1FZOB 2HYMA 2NZIA 2P5EB 5BO1L 2V17H 4JFPB 3KLHD 5E56A 3RWEB 2VXVH 4NQEE 2XQYG 4O02H 3QFDB 3B5GA 1WGOA 2WUBL 5JHLH 4QOKD 4JFDB 1MLCB 1QSZA 5BRZA 4NNYA 1TJGH 1BBJB 4I48A 2AJSL 4HLZG 1Y18A 3SHSA 3MLYH 3UZVB 3V4VH 4HBCL 4BFEA 4NQXB 4ODHL 5HDBF 4RAUA 4FQHA 4RIRA 4UDUA 1L7IH 1RU9H 1MCNA 3T2OA 3VWJC 2AK4A 1KIPA 1NBZA 3VG0H 2WIMA 4XI5D 3HC0B 3S8WA 4XWGH 2HVKB 4U1HA 5LKNA 1C08B 4HHAA 3BQUC 1Q9LA 3GBLA 3GK8L 1VGKB 1PG7H 1A21A 1GH7A 4HUVA 1PJ9A 4XWOC 1ZOXA 3DTXA 4NZUH 3GHBL 1FAKT 2GW5A 4W70A 1QRND 2GJ6A 4KRPC 1LK2B 4R26L 2NY5L 4UINL 1FRGL 3ARSA 1DUZA 5HYSA 5EU6A 2NY5H 4WUKH 3GHEH 1ITCA 2BSTB 3ARFB 1KJ2H 3HPLB 5C0AA 4PGCA 12E8H 2ED8A 3P0VL 5CGMA 4PV8A 5DD0L 3QUKA 4BK5A 5IKCA 5BXFB 1YEJL 3TT3L 5I1DB 1PKQE 1IEAB 5DD0H 2BRRH 1MCPL 3VU2A 4HWBL 4XGZB 4YHLH 2XWTB 5HI3C 4L8SC 1IKNC 1RUAL 4K8RL 4BFBD 4LDOB 1T66D 2Z31C 4KKNA 1EFQA 4B53A 1EO7A 4OZ4A 5B38A 3UC0L 4OZIA 5DK3A 4HCRA 5F3HB 2Q7NA 3P4MB 4JDTH 1XCQA 1OGAB 3MLXL 2FL5B 4XP9H 3PWPA 3QNYB 4YIQB 5FYJD 3DX9B 5LGHH 1CE6B 4PJ7A 4WFHD 3WXVH 4P48A 5J06A 4S11A 5J11C 5I16B 3OXRA 3E3QE 5ISZA 1MREH 4OKVB 5SV3A 4LU5H 2D2OA 2OTPA 4L5FH 5AZEL 3BSZL 5CKGA 4JFEB 4FMFA 1UWGL 5CLTA 1AE6H 1RK1A 4ZYKA 3CVHH 4OTXH 4P4KC 1HEZA 3L5WA 4C55A 2EDTA 15C8L 4W6XB 3VGEA 4FNLH 4MWFA 4TSAH 5HI5D 1IKNA 4M6NL 5ANMB 5DUPL 4PP1C 1FYTB 4DVBA 3FO0L 1DBMH 1FPTL 3MYJB 5I16A 3OKOB 1LDSA 3V0VB 1D5IH 3N85H 5BV7B 1RZ8B 4XVJH 3RHWK 5IQ9B 5HD8D 3MA7A 4X9HA 1P7HL 1WFUA 4LCCB 5KS9A 2FL5A 4H1LA 1AKJB 4MJ5A 3SCMA 1RZGA 1M4KA 5FA3B 1FLTX 5BQ7A 2F8VA 5JDJA 1C12B 5MEOB 3P77A 2C26A 5KSAD 1ZA6A 2Q8AH 1J1OL 3RWCB 2J8UB 2Y25A 3K80A 5GRUH 3EFDL 3GSVA 4U6YA 2Q76B 4BELD 2UWEF 5I1DA 3P4LA 4R2GC 4PGCB 5J1TC 1RFDH 2CLZB 3WXWL 1LP9A 5F1KC 1OSZB 3O4LE 3WFDH 1B88A 2QSCH 1NFKA 5E9DB 1RAMA 3MLRH 4DVRH 5JOFA 3CH1B 1IGIL 4NZUL 1ZSDA 1JF1B 3C60D 3DSFH 4P2RB 3FB7A 1KXTB 1TMCB 3DI3B 3QJFB 3CLFH 4X4XA 1QNZH 5GHWH 3MGOA 5C6PB 3UTPD 5EZIH 4W6YB 1KJ3L 2GTWB 4S2SA 5A2JH 2MNUA 2R9HD 4FQLL 5E2JA 1OTSD 1NBVL 3BAEH 4Y5XB 5DD6B 2OK0H 1OAKH 3VXRE 2B2XH 3KR3H 2W9LA 5J89A 4XMKL 2JTDA 5ADOH 2J4WL 4GAJH 4JQIL 4BKLB 4RAUB 4RIRB 5CAYB 4NQXA 4HKZA 3FB5B 4IOFD 3QQNA 1QSED 2GEEA 3NGBC 4L4VE 5KANG 3MC0A 2F8XC 3S5LA 3L9RA 4OF5A 3D0LA 4PJAE 1FYHB 1TJHH 4N0UE 4ZAKA 3N9GL 3VWJD 3QQ4A 3HMWH 2BNRD 5D1XD 4HIJA 3UTSE 2YSSB 4NRYB 3GJFB 4Y1AE 1M71B 2YPKA 4N0YL 2QADD 5E6ZA 5JR1L 3MV8A 2CIIB 4WUUD 3CK0L 4FQXA 5C0GB 1CCZA 4HXBL 5HGAB 5IM7A 3KYKL 3BSZH 3V4UL 4HJ0D 2V7HB 1FFOA 2NR6D 1BZ9B 5C7XL 5DSCA 1M7IB 5IMMB 4UTBL 5ILTL 3IDNB 3T09A 1OLZA 2IPUG 5ILTH 2ED9A 1Y6NR 2HT3C 3BW9A 3HG1D 3LN4A 2XTJD 3GSUA 5FUOL 3FT2B 4ISVA 1FNGB 3F7VB 3Q3GA 3SE8L 4UT7L 4QRRE 3IU4L 3KGRA 1ZVSB 4BSJA 5EBMA 2P5WE 4ZDHA 5JHDD 2P8LA 4I77L 1MIEH 3MREA 4G6KL 4XVJL 5BS0A 2DJ4A 1R3HA 3PWNB 4L8BA 1DE4B 4TRPH 2MMXA 4Z77A 1EGJA 4YZFE 1P7QB 2Y6SD 5CP3H 5CJ8A 4Y1AA 5IB1A 2WV3A 1BZ7B 1KLGA 1RULH 1CXIA 3BWAB 4OZHE 4YBQC 4PB0H 3ZL4H 2XYCA 5C2BH 4L29B 1P5UA 3ARGB 3HE7C 1EJOL 4I0PC 4G8GE 5ITFA 1EJOH 4IMKA 4XP4H 4YHKH 3MYZA 2HFGH 1CU4L 2AXHA 4PJXE 4YHIA 4ONHA 4KVCL 1G7LA 3A6BL 1B6UA 2VERN 2BERA 4IJ3B 4EUPB 5HJ3B 2XZQL 1IAII 3U36B 1U0QA 1CT8B 4ZO6A 3WUWG 3GB7B 5E03A 5ENWB 1IQWL 2EIZA 1IGIH 2XXCB 3JWDL 1OW0A 5L2JB 1ZV5A 4PRPA 3ZE0E 5HYJB 5BRZD 1BF2A 1KB9J 2VLLB 1MCIA 4ZFFB 3VDCA 1R5VB 4KTDH 4KI5D 1HKLH 3VFGL 1X4YA 2R1YB 1QLEH 2G75A 2A9NL 3PDDA 5K9JH 3TIDB 4RX4A 4WO4C 2FB4H 2W0FA 2Q6WB 2YOCA 3BT2H 2HVJB 3L95B 2NXZD 1DQQA 1CGXA 1H8SA 3NAAL 4JJHA 1JYXA 4GH7B 2FJGB 3RVVC 1U8OB 5D7IA 1RIUH 5I1JL 1WT5A 5DR5L 5IQ7L 3MRCA 1EAJA 1KBGH 1KG0B 4C56D 3BKMH 3QEHA 3GBML 3MRLB 3C6LD 4XRCB 1AXSA 1UFUA 2JJUA 1UM4L 4G6ML 2A6JA 5F6HI 1WZKA 2BNUB 1V7NL 1OPGL 4Z8FL 3U9UB 3DGCR 4ELME 2LU7A 2VITB 2VZTA 1KLUA 3PL6A 4Z7VE 1V7NH 2DQUL 4NBYB 4R96A 2ZWLT 1S7WB 1G7IB 3RY5A 3HB3C 3DETC 2XIDA 5I1EH 2PETA 5T3ZD 5BV7L 2GIYA 1FSKC 4ZS6D 1A4JA 1R6VA 3C5ZB 1NUDA 2P45B 5C0BE 4HG4K 1HOCB 4L8SA 1WK0A 3FONA 2B39A 1ZXQA 3RGHA 1GL4B 4EXKA 1J18A 1YNKL 4HWNA 1FFNA 1IBGL 3DRQA 1H0DA 1IBGH 5CJBA 1HHIB 2CLVA 5DJYB 2QJDA 3VRLE 1KCRH 3ZYZA 2BFVL 5L6YH 3O81A 1MFAL 1JFQL 4ALAL 2A6KB 2XG5A 5AG8A 5LQBH 4G5ZH 2J12B 3LEXA 4UNUA 4UOW0 3BUYB 5C0IB 3L3KA 2Y07H 4M9OA 2MKLC 1WBYA 2J2ZA 4MAUL 1KTLA 1B6DA 1M7DA 4NO3B 4WFFE 4L3CB 2WBKA 3O4LA 3T2NH 5T3ZE 4K23L 2R23B 5MHSD 2ITCB 3V2AR 3N1QC 5JIHA 3E2HC 3R0MA 4P3DA 1SBSL 4Q9QL 2X4SA 3VDBA 1I1FA 4HUUA 4AJ0A 4JO1L 4KDVA 3GIZL 2EIDA 2VXVL 1EUUA 4M4RA 1AJ7L 3R1GL 3GIZH 1CDJA 5FOBA 3FQRB 4G42B 4JFOB 5DMIH 2IG2L 5E5MB 1NMCC 1EEUA 2FD6H 1YY8A 1UACL 1EHLH 1U95B 1AQKH 4AG4L 1JGEA 5JPNB 1PY4A 3TNMB 1DVFC 2IBZX 2OZ4H 1NL0L 2R2CA 4OGAD 2E3VA 2ZG1A 4JY6B 3RZCC 4O58H 4X6CF 1UYWL 3D0VA 1FL6A 3BYTA 2V2XB 4OZGA 1AXIB 3GNML 2ARWA 3HE7A 4MJ6B 2PYFB 5GJSL 1UJ3A 2F19H 4KJPD 4N5EC 5GRJL 3SGEH 1RUKL 2P5WA 3O3DA 3PV6B 1U3HA 2X4OB 4QRSA 1I1AD 5FHAL 1Z9SA 4NKMB 4YR6B 4GKNA 3U7WL 3IDMB 1AHWA 3ZMRA 2P5WD 3T77B 2HLAA 3RVTD 1S7SB 3RBSA 1INQA 1EEYB 5KAQF 3L3OB 3MLUL 2B5IB 4HSQA 3WN5C 3OKKB 5FUCC 5CWSB 4V1DB 2UYLA 4LHJB 4WFHE 1ZANH 3KPRA 4OCYH 5FCUL 2X41A 5I1EL 1K9TA 5EA0L 5FCUH 4V2BA 4YDIH 3S4SA 4CGTA 5E5UB 3UJTH 4U1NA 4NWUH 3DMMC 5C09E 3LIZL 1OTTC 2ENSA 4EIZC 3VWJA 1VFBA 4PRHD 4LLQB 1X5ZA 3RIFF 5CEZE 1T0NA 2G5BA 1G0XA 4MNQB 2DLFH 3NIFF 1YN7A 1GAFH 1F8TH 4NKQB 4HFUH 1XGUB 4U6HB 5D1ZA 1GPOL 5E4EB 3S96B 3MRMA 3ARUA 5F1NB 4I4WB 2EE9A 2VDRL 5CEZH 2Z35A 4MSWB 1PX3A 3QEQE 4LLVA 2FJFA 2CRYA 2XPGB 5ESQB 4IRJD 2ICWA 4MA8L 4PGBB 3GMMB 3ZLQC 4H26A 1Z3GL 1A14L 3DYMA 1E4KA 5CZVL 3FO0H 4K3GA 4M03A 4PJFE 3B83A 2HT3D 2ID5A 4U1IB 1NBQA 3BE1L 5E8OA 4KV5E 3KPOB 4JM2B 1RZ7L 4D94A 4AT6B 1IE5A 5C0BB 1AJ7H 3R1GH 5JHLL 1J7VR 4JRYA 3WUZA 1DBKH 2VZOA 4HUXB 3U83A 1UVQA 4AK1A 4F7TA 4LPCA 1PVHA 3HC4H 2W59A 3QBTB 3G6JF 3WEXB 3ES6A 1NCBH 1SEBB 1FZMB 3BP4A 4K7FB 5GIRA 1RUPH 4JRYD 5C07E 3MJ9A 5J13B 3FOMB 3BD4A 4P23B 4K9EC 3BEVB 2IAMA 3RI5F 1QA9B 1JV5B 4KK6C 1BD2D 5B4MD 4G7VH 3RDTB 1F4YL 3DX8B 1ZT7B 4MB4A 1LO4H 4GBXA 2E9BA 4G8EA 3MX0A 4IOIB 2ZZUT 2X40A 2A1WL 4OM0L 1UGNA 3K8LA 4KUCD 4LRIC 1WZ1H 4Q6IC 3U9PL 3FFCB 4AEHH 4KRMB 4UIKL 5EBWB 3SJVE 3W81A 4LVHC 1F3DJ 1QSEA 4X7DC 3VXRD 3CGTA 4BQ6A 3OJDA 3KPOA 4XBPA 5FHAH 4LPVA 2MJWA 1ZEAL 3KPQA 4OCWL 3ZTJH 3S34H 1KJ2L 5J57B 4JY5L 3KYNA 12E8L 1MCWM 3P0VH 1EBPA 4Y0GA 2DMKA 1P2CA 1RZIA 5J6HA 3PGDB 1V3KA 5DK0B 1MCPH 5KSAA 4ERSH 1O7VA 3RP1A 3BJLA 2AXJA 3SGJC 1H15A 2PYEB 3IU3B 3CFIC 1S9XA 5IW6A 3IDIB 4MZ2A 2AV1A 2DQCL 4OZIF 5FDYA 3ROLA 4MJ2A 1Z2KA 2CSPA 1FVCA 1Z9MA 2RGSA 1BVKA 1TQBB 3RUGE 3ECBB 2O5YH 3QHTC 4IDJL 5DJAA 5GS3A 5DMYA 1GC1H 1HHHA 5I1LA 1MCOH 3PL6C 3C5JA 1JNLH 4KZEH 2UWEB 2NCMA 1D5MA 4IRSC 2AW2A 3DOSA 1EZVX 4NDMA 4PJCB 3MCKA 2DICA 2BJMH 5BZWA 5BRZE 1FIGL 2JJVA 4KJWC 3EZ8A 5ETUB 5FDWB 2NTSP 3KPRB 1JHKH 3V95A 2GUOB 4XP6H 4DKAA 5C0AE 4U1KB 5AYUH 3L6FB 3NCJL 4AEEA 4LCYA 4YBLB 3WNMA 4FMKA 3HN3A 2VE6B 3EJYD 1NAMB 4FZEH 1R3JB 3H0TA 2K7QA 5J7CC 3I6KB 1YEDA 4UU9B 2CXKA 2X5PA 4M3JA 3C8KB 4JFDE 3C8HA 3VFVA 3Q5YA 4ZPVA 5CJXA 1G6RH 3OV6A 5C0RL 5IMLB 4GKNB 3PABA 4CKVX 3BE1H 5E1HB 3U0TA 5HHXH 4Y4FC 4H5SB 4D3CL 2QQNH 4IIQB 2VLKA 4HWEL 4LIQH 4GMSH 2VN4A 4DW2H 2NY1D 1BEYL 5GGVY 3U30C 5IMKA 1FJ1B 1I7TB 3GIVA 4PB0L 5H37H 3G08A 4PJEE 5GJTH 1F58H 1Q9OB 1UCBH 5GRUL 5KZCD 3VH8G 4U1MB 1XF4B 1MCDA 4MVBC 2AK1L 1KJMB 1IL1A 3TBVB 3DJ9A 3MUGA 1FZKB 2EC9T 5JPNA 4F33A 4OIIH 3CLEH 2PTTA 3CVHA 3HNVL 5E94B 2QLVB 2IJ0C 2JK5A 1U95A 1UZ8A 3WXWH 3LD8B 3JWOC 5FYKD 1BOGB 1A9BA 1U3JA 1SEQH 3STLA 1GZQA 3FQRA 1IM3A 1PSKL 2P43B 4PD4J 4QRUB 4ODXB 3ARPA 1MFNA 4KJQC 2EEDA 3DIFB 3FQUA 4PJBA 4PJAA 3ALPA 3C6SB 4YE4L 4LMQI 3GJEA 5DQJB 4GRLB 2OK0L 1HIMH 2XI9A 2R9HC 4OLVL 1WLHA 2BNQB 3C09B 3TCLA 2VL4A 4NN5C 1NBVH 3CSGA 3D18A 1XFPA 4QRRB 3DBXB 1AY1L 1MIMH 4I0KA 1WCBA 5DEGB 3RKDD 5D7SH 5ALCH 1YEGL 4O2EA 4PJGB 1BQLH 4LNRB 5JXAH 1CZ8H 1CFBA 1ZA3B 2CK0L 5I30L 3D25B 2DQCH 1T0MA 5IMOB 2QQKH 5L0QB 2C4FT 5EU3A 1MCBA 2JJSC 2OXHA 4ONFH 4PJGE 3D39D 5K33A 2C5DC 4P4RB 3LHPL 3RX7A 5IVNA 1SJHB 5EU6D 1W72A 3N9GH 5DJYA 1OAQL 1IILE 5KANI 1HHIA 3M1BA 3GUTA 5HSFA 3SEPA 3F58H 3MV9B 3VJ6B 3IFOB 1HQRB 4OCLC 3DVGA 2HTKD 2Z8VC 3TYGL 4NC0B 1RIHL 1TTGA 3M45A 5JR1H 3W2DH 5HGDA 3WIHH 4CVZA 1FORL 3C5ZA 4XCCH 1BQUA 1IJ9A 2YXFA 4U2YA 1SY6H 5D9SA 4FP8L 4XCCL 4RGND 5FA4B 1SY6L 4KMLB 1QLFB 2EZ0C 4XPFH 4Y2DD 1DSFH 1GHFH 3VA2C 1Z5LB 5E8PB 1MJ7L 3MGTB 5EZOL 5IB2A 5FM5M 5C8JA 2FHFA 3RA7L 5JOPD 2FHCA 1BZQK 4FRWA 2EE2A 4ONGH 4CVZB 3QZWG 1J05A 5MERA 2UZIH 4MLIA 1FDLL 5DDHA 1CDIA 4L9LA 1KGCE 1L0YA 5GPRA 5E00B 3M1BB 1WQVT 3GUTB 4WFEE 4XNUL 1MJJB 2VZSA 4JPWL 1S7QB 4HS8L 2J8UE 1GGCH 1RJZB 2DWEA 2DM3A 1NGWB 2EH7H 3HPJB 4BUHA 4G5ZL 1HQ4B 4PJGF 4XAKE 1L6ZA 2EH7L 3JWNC 5GS1B 5E8EA 4NN6B 1FFRA 4PJHE 1DQQB 4LNRA 3TA3B 2YKLH 3SOBH 5HYQA 3EOBB 1E27B 1HDMB 4X5LA 2Q6WA 2NY4C 5D9SB 5GZOC 4I3SH 3TIDA 2H8PA 3HE6D 4GKSB 2AP2A 4OCSH 3HZKA 3D18B 5HHOE 5HGDB 3NZHL 3GKWH 3LV3A 1OAUH 3UDWC 3QHZL 3QHFH 4WTXA 4ZFFA 2PTUA 1SBSH 1NMAH 4KFZC 4CADA 2XTJC 4JO1H 4KROD 1HHKA 4HW6A 1CU4H 3TBWA 3JTSB 4DOHB 1W72B 4OFDA 3MFGB 1R3KB 3WFZA 3QDMD 2FGWH 5CGYC 2AABL 2BDNL 1A6VL 1VFAB 2BHZA 3EDEA 1ZA3A 1A9BB 2YD9A 1JUFB 4HJ0C 2X4UB 1ZGLP 4KK8D 5ID0A 1UZ8B 4ZUVA 3OQ3B 1FE8H 3G04A 4YE4H 4J3VA 1YYML 4N68A 1P7QD 4RGMB 1EHXA 5D70H 3R8QA 3UP1A 3MZTA 5I9QC 5I71B 4U1MA 3VG9B 1BD2A 3GSXB 1IMHC 1WWCA 1KLGB 3GIVB 1JZ4A 3P9WB 5D7IF 5IB1B 2ADGA 4FTVB 3BZEB 1P7QA 5ALCL 4NQEA 3KPSE 1JGVH 1T83C 2VRAA 5GRJH 3F7RA 4NFCA 5F6IC 4EZMA 2P8LB 3P4NA 4HUMB 5DR5H 3I3DA 5IQ7H 1LK3L 1QFHA 3BP7B 5EU7C 3BHBA 3QZWB 1AGDB 3F58L 1CWVA 3CVHB 2ATKA 3DNKA 2CUIA 4HQQL 4KK6D 1OP9A 2AI0L 3VGBA 2VN7A 3IDJA 2EICA 1EFXA 3WKML 4G6MH 3NZ8B 4X6BB 3HAEH 4QTIL 1KN2L 3GMLA 2HMIC 4NO2A 5D7KE 4WUUB 5DTFA 2PXYC 4GAYA 3L6FA 5EBLA 3WBDA 2HLFC 2EECA 4UQ3A 5HPOA 5TE4L 5B39A 3DVNA 2HT4D 5D7LB 2VOTA 5KAQG 1J12A 1BFOB 2FDBP 4PRHE 5KZCB 3G6JB 3S6CA 4HFWA 4RFNC 4H5SA 1I9IL 5BZWB 4ZAKD 2YSSA 1YMME 1A6WL 5CGTA 3VRLF 1E4KC 2YXMA 4WU7B 5GGSA 1D9KC 3QPXL 4KH2A 4OZGE 3D0LB 4UB0L 1NKRA 3H0TB 2H32B 4WY7H 1QSVA 2VTFA 1KCRL 4XPBL 2VZ3A 5HHOD 1YPZB 1PEZA 5CEZL 1CICD 4LGRB 4U1KA 2MFNA 4NQSA 3VGFA 3SOBL 3OPZL 5FXCH 3IJYA 2BOBA 4XNYH 3PNWA 5ETUA 2GK0A 5EFIA 1A14H 2C1PA 4R4FL 5EU4A 4ZXBC 1KENL 1JF6A 4JHWL 5F7LB 3CSBA 3PGDA 4QHLA 3N0PB 4JREC 2YEZB 3FHQA 3LQAL 4XZUA 2OR7A 4P46B 4J3TA 4EUPH 1D5MB 3KYNB 9CGTA 4QO1A 2CO6B 4IMLB 2X4RB 2Y7QA 2KQMA 4NHUB 2ZJSL 4FQ1L 4NWTL 4EN3C 8FABA 3QUYC 4NWTH 3X3GH 2F74A 3V6ZB 3ZE0F 2FATH 1CD9B 1JRHH 1D7FA 4NQTA 1JBJA 5ICXB 1II4E 1KT2A 5CSZA 3RTQA 2CKBH 5FYLL 4M93C 5T3XL 3IDIA 3O3EA 1PEWA 5T1KD 3P9MA 3RAJH 1OCWH 4PY7A 3I2CL 3L3GA 2R29L 2W60A 5CHNB 5MEND 3TVMB 5KSAB 2BNRE 3T0WA 3B2VL 5LWYH 1IQDA 1ZLWH 3MV7A 1QSFD 2GQHA 4OF8A 2FLBT 4M5YL 1FCCA 1LO4L 2XY1A 4O58L 4G80A 4KAQL 2H26B 4RMWA 1E4XH 5IHUH 3UDWA 5GJSH 1I1AC 1PG7L 5BQ7B 3P9MB 4G43A 4KJPC 1T2QL 4HS3B 4OT1L 5DEZA 3I75A 1N8ZB 2ILLA 1F3DH 1UH4A 3MRQA 3FT3B 5L8LB 1FRGH 2F74B 3U7WH 3T4YB 2R0ZH 2XN9B 1S5HB 1TCRB 1WIOA 2ESVE 3HNTL 4IS6A 4P49A 2O5ZH 5EU5A 3F6IA 4PFEA 4CN6A 1LE5A 5J0BA 3REVB 4FQJL 2YEZA 2CK2A 2DWDA 1QFWL 5IWLC 4K2UL 1CICB 1J1XH 1NFIB 3P0GB 3WHE1 5FECB 3EJZC 5JHDE 2GK0B 3V7AE 4V1DE 5CHNA 3TIEA 5IOPB 4HMDA 5DHXB 3X12A 2PO6C 5JHDB 5EDXA 3O3EB 1U2HA 3K4ZA 4YZFF 2DJUA 3AXLB 4GMTL 3RGVC 2VDKH 1EVUA 1T4KA 1QR1B 4DEPB 2SEBA 4AT6A 2LU4A 1IC7H 4JFHE 5FGSA 5E8OB 1I1RA 1JI1A 2VQTA 4MA7L 1A6WH 4NHUA 4M7KL 4MMXC 2NY3C 4XMPH 1MH5A 3T8XB 4XMPL 2D7QA 1XCQB 2AQ2A 4PPTA 2FBJL 4D9LL 3GRWA 3L5XL 4TNVF 3CVHL 2OCFD 3L3DB 5DA0B 2WIIA 1FNFA 4KMQA 4OGYL 3RVWC 3GJFH 2WP3O 4NM4L 2D0HA 3MCLH 1LWRA 4CMMB 1NUNB 5TE7L 3BP6B 3BMWA 2YBRB 3NZ8A 1IARB 2APWA 4X4YB 5I1IH 5JW4M 2G5BB 4XB8A 1AFVL 4WW2C 2APFA 1YEEL 2B4CC 3ARBB 4WU7A 1NLBL 3IDMA 1J1PH 1NLBH 5FM5O 2WUBH 1PKOA 2VR9A 4HUVB 3IKCB 1NCBL 4CVXB 2DLGA 2KZWA 4HBCH 2Q8AL 4L4TD 3H42L 3ET9F 4XAWH 1HXYA 5DTFB 4NKOA 4ZODA 1VEMA 5TGBB 1DBBL 4KXZH 5TPWL 5EWIL 3FQNB 4JKWA 4LSVL 4B50A 2AQ3A 2IPTL 5JOPE 3TBSA 3RUGA 1V5JA 2XRAL 1X5JA 2R1XB 1PZUB 5KVMC 1I3GL 4HIIA 1TVBA 5GRVL 4UIMA 4WNQA 1R0AH 4WWKB 1CLZH 4L3AA 4M61A 1FG2B 3RVXD 4S1QH 1CLZL 3LRHA 1JGDB 2X4UA 3GHBH 4S1QL 2W38A 3OSKA 4JFOA 2XV6B 3BH9A 2BXYA 5DFVD 3LQZB 3RL1A 3RIAK 1R3IL 4MJ6A 5GHWL 4QXUL 1F02I 4LPUA 1A6PA 4D9QE 3VFOB 2V2XA 3W5MA 1HIML 5IEKB 3GSXA 1KPUB 2NY2B 1RK0A 3LV3B 2LAGB 2ITCA 4LDEB 1CK0L 4ERSL 3UJJL 5F9OL 4MZ3A 4Z7WA 3SDDA 1AD0A 2ICES 1DQDH 5IBUG 3G04B 3K46A 4GLRH 4IRJC 3WSQL 4N5ED 3T3ME 5K9OA 3D3VE 3KNBB 4M6MH 1T1ZA 1XGTB 3PHSA 1DZBA 1U6AL 1I1AA 5F96L 4AEIH 4DKDC 1NCWH 1CL7H 3B4NA 1U8NB 4RMSA 2F9BT 2I5YL 1OGTB 5IFAL 2VLKE 1MJJA 4LKCA 3U2SB 1XCTB 2QR0A 1F11B 4RGNE 4TPRL 5F89A 4MA7H 2IMNA 3O0RL 4N0YH 3ZZ1A 4ACPA 1CGTA 4U0RC 2EDBA 4P2YA 1ZHNB 5TQ0L 5D7JB 2KH2B 4MJIB 2MTPA 3SDXB 3ZDXF 3I6LE 2RB8A 5I66A 4XPFL 2R2EB 4WVRA 4DGVH 3VFWB 5IT2H 4H0HB 4K8RH 4KRPB 4H88H 3MODH 3QDHA 3LEXB 5E8EB 1FCGA 5EO9A 4C56B 1MHHB 3G5XB 1FNEA 2VITA 1QRNE 2ZUTA 2A0LD 1U3ZA 5C0DA 1RJZA 5JXEA 4XXCA 1DUYA 1YJDL 2Y23A 3DHJA 1UWEH 3WS6C 3FTGB 4L9LB 4GKZB 1FG9C 2HJFA 3KVQA 3DURA 4DWHA 3T0EE 2LAAA 3EYSL 4CDHA 5IB5A 3VD4A 1OGTA 4G6KH 1V05A 3AS3A 4L8SB 1U8NA 2Z31B 5HPMB 4EI5C 1EEQA 1O7SA 2K1MA 2X2YA 1A1MB 5K9OB 2WANA 5GJTL 4X8JB 5AZ2H 5C3TA 1RVFL 4WFED 3DROB 1KLFA 4OCNC 3EFDH 4YK4B 1AD0B 1T7ZA 4LAQH 1NEUA 1OQXA 2VDOL 3DBXA 4MJIA 1J8KA 2HRPL 5E1AA 1GZPB 1ZHNA 2A6DB 3QRFM 1GGIH 4Z9KB 4UV4L 3VJ6A 4Q74A 1WFNA 4LEXL 4YAQB 5C08A 4PRPB 1N5YH 5C0ND 4MXQC 4RDQF 5L7XH 3LDBB 1I9RH 3WFBL 2J5LC 3KJ4B 1FGVH 4IOFC 3DETD 3D9AL 1IM3B 3O6KH 2XA3A 4O2FA 4F15B 1ACYL 4I18B 1T1ZB 1XGTA 5GSVA 2ZPKH 1WSST 2P42B 3FKUS 4F33B 4DQOL 4ZNCD 3CJJA 3FO9B 2DI7A 2A9NH 3DO3A 2R2HA 1ED3A 4PR5B 1IAIM 4Q58C 4FFWC 1RK0B 3G6AA 2JCCB 3C87A 4RWYL 2NNAB 5I18L 5E70A 1W0YT 2ZSVB 1BGXL 1FJ1A 1I7TA 2DRUA 4MNQE 5CIPB 3RWHA 3TBYB 1R24B 3NAAH 3SE9H 4XVTL 4KXZI 2BNQD 3CDFA 1CZ8L 4XVTH 3X3FL 2ZCKH 4F9PA 3MRDA 4Y16A 4LGSB 4WWID 3WUWA 1SQ2N 4UAOC 3X11A 3H9SB 4M6OH 5E94A 3NN8B 2H45A 1CDYA 4TPRH 2PTTB 1TVBB 4OQTA 5IF0A 4JFYB 2WSKA 3Q3GB 1FNGA 3F7VA 2YN3A 1KJMA 1OAKL 4HT1H 4RFEB 3U82B 2X89D 3ULSA 2E6PA 3MZGB 4JHAL 3UPRA 3PXJA 3BD5A 3EJJX 3G08B 5D5MB 1BOYA 4OQTL 1BHGA 1XGRA 4P5TD 5E8NA 2L7UA 4APQC 4OKDA 1QZ1A 1JGUH 4L8BB 1WIUA 1R3HB 1BFVH 2FH8A 1TETH 4LSQH 3EYUH 3GMNB 3SGKA 5LGJA 1G7PA 43C9A 4L4TB 3T8XA 4D9RE 4NYLA 3VFMA 2D3VA 2J8UF 1YJDH 3KPLB 3LKOB 5FF6A 4G9FD 3NFSH 4EBQH 4XX1G 1QPXA 4UB0H 4Y7MA 1MVUA 3TPUA 3I6KA 2YBRA 4YDLC 5E9DE 1T4KB 4ODUA 2VE6A 2CDEB 3QEQB 5L9DL 1DBAH 3SJVD 4DN4L 2Y06H 3S35H 1T22B 3FL7A 2AV1B 1BF8A 3BISA 4LLMB 2VSCA 3CDCA 4MHHG 1A47A 5F7EH 1BBDL 1JNJA 3O6FD 4PJ5E 1HE7A 3GMQB 5GSRA 4X5WA 4WJ5B 4JDVA 5I2IB 3NABL 2APBA 4JJ5A 3MCKB 2ZOLB 4R7NB 3NABH 5F70A 1NQBA 3MMEA 1ZGLM 5DJDB 3V6BR 4FQ1H 1NMAL 1ZAGA 4GJTB 4ODVL 2I60H 4AENB 3ALXA 5HYSG 3C9NB 5DJAB 3QQ9D 3S5LB 3MRIA 1NC2D 1U8MB 2Z8SA 1SMOA 2FJHA 1WVZA 3MRQB 4W68A 3OF6D 5EBWA 1FVDA 1I7RB 5ABDE 5TF1H 1SYVB 3DI2B 4EI5A 2AERT 5DJ6B 5IBTH 2HH0L 3HB3D 3SDCA 5EBGA 4LLWB 3X12B 1YYMH 1RHFA 2H26A 3NVQA 1ROWA 5A2LH 1QLRA 2ICCA 4POUB 1CICA 1NFIA 4U6YB 1WZMA 2HT2D 1RZIB 3C6LC 4JPVL 1T89C 2PYED 3IJSA 1ONQA 2E7HA 3RBGA 5I18H 3M8OL 3BP4B 4K7FA 4AEFA 4LLUA 5FA3A 2F19L 1T2QH 1S5HA 3F7YB 4P2OC 4MJ5B 1ZSDB 1YMHB 3QIUB 4KC3B 4OUOA 4P2CG 1UENA 4LCCA 5C3LD 2QHLA 1N0XL 4XC3H 1N8ZA 4X7TA 2FO4A 2JB5L 2AXFB 4C59B 2APTA 1ODAA 1IGTB 4HQQH 3ARGC 3SDYH 1LP9B 2LABA 1FFPA 1PGRB 5IESH 3DXAD 5DC4B 1P6FA 4C4KT 5C9KA 3WYRA 4OGXL 4EVNA 3EGSA 5AUMB 1T1YA 2DQJH 4QHLB 3BUTA 3IF1B 2J8UA 4JM4L 5EFIB 4JM2F 5ITBL 1B2WL 2CGRL 5J12C 1H3XA 3IJYB 1I7ZA 3SDDD 5MEOA 3HI6L 1MPAL 5HYIA 4LLWA 3QUMA 3SDCB 4KV5F 1AGEA 4TVPL 2QQLL 3FN0L 4X4ZA 1AKJA 3JWOL 4Y4HC 3S36L 25C8H 4LCWD 1WCQA 1JGUL 3KDMA 2V5SA 1YNKH 3CSPA 5F1NA 1ZGLB 4HUXA 4ODTH 1C1EH 1ZLSL 2HTLD 2HLFD 2R4RH 4OKVA 4HIXH 3GZKA 3BGMA 3VWKC 5C0JA 4M43H 5GGSB 5CD5D 2FNBA 5DJDA 1FO0L 4P46A 2Z93B 1GPOH 3K2UH 3PWPB 4TUKL 4A6YL 1I1YB 3CVIH 5GZOD 2OJZL 3LN5A 3K2UL 3MV11 3QUZC 2GT9A 4PRDA 5L9DH 3BPCA 3HRZB 4LLVB 3GSNH 1HEZB 5B39B 2F58L 4MSWA 3RWGB 4LEOA 2IF7A 5I6XB 4LASL 4R4FH 3OPZH 1IEAA 1XAUA 2P5EE 4UDTB 3MRMB 2NLJB 3S7GA 1MQ8A 4ETQB 2A83B 4YHNB 3H7BA 1A7NH 4K94H 1MVUB 3OXRB 3TPUB 3WE6B 4OJFL 4WO4A 5FM8A 4BYHA 4NJ9L 4ELMA 4KKCC 3LKOA 3KPLA 4RQQB 2UUDK 5K9KB 1CGSH 4HUWB 4NKMA 4NZDA 3AS1A 3P4NB 1TZGL 1K3ZA 3KPSA 5KOMC 5HBBA 1C5CL 1TZGH 4OGZA 5DYOB 1LO5B 5D71L 4DUVA 3SCMD 5D7LA 3VXUD 4V1DA 4F37K 4YLQT 4HHAB 3CX5K 5DMGC 1NSNL 1TQCB 3MQIA 1G7QB 3GMLB 3TH4T 2R0LL 5JO5B 4XBEL 3QI9A 5DMJB 5C0AB 1TTUA 2BSTA 3ARFA 1REIA 3T77A 5DI8B 3QCTH 4GKOA 3SBWA 2MPAL 3MR9B 1C7SA 1BBJA 4ZS7H 3H9SA 3K4AA 4ZUVB 4NNYB 1QVOA 2IFGA 1U3HB 1JUFA 3ARFD 3IFLL 2DQFA 3CH8A 2XXMB 3DTXB 4Y16B 1VFAA 5DD3L 4E9LA 1UKSA 3EYQC 1OP3K 2EDWA 1N0XH 5FOBB 4PJDF 2EDLA 1NEZG 1TJGL 1AI1L 3JTSA 3GHEL 3TBYA 2V2TB 3DV4A 3P2TA 5BS0E 4P3DB 4PLKC 1F42A 3E2HB 2NNAA 3O2DH 2R4SL 4QYOA 4OZFB 3G6AB 4JG1L 3QSKB 3D6GA 4L8DA 1ED3B 1UKQA 1JPTH 1IGCL 3HZKB 1PDKA 3PWVA 1OP5K 4YHLL 4J4PC 3FO9A 1CFQB 2CGRH 1RUAH 2Z8RA 4GRMB 4NNXB 4OI8A 5H35B 2W9DH 1B0GA 4WGWB 4O4YH 3BUYA 4M1DL 4D0DA 1QQDB 3CIQA 4XB7A 5E5MA 4I18A 4XP9L 1RURL 1WWAX 3RNKA 3ZYJA 4C58B 3VMPA 3CC5B 2E5EA 1YEIH 3STZB 1P6AB 3I6LD 1X7QB 2BMKA 1KB5H 3LB6C 4KVNH 4MNGB 1RIVH 1BECA 4IRSD 3IDYB 4FQXC 5EO0B 2YR3A 5TFSH 4GQPH 1I4FA 1U36A 3P4OB 5CJQL 2C4XA 4F58L 3CPLB 3BQUB 2GSIB 4LSDA 1NGPL 5EC1A 1W72H 1K2DB 4PJBF 4E0RA 4ZAKC 2NMSA 4MA3A 4KROB 3MLUH 1K4CA 3QG6B 4GG8B 2FBJH 5C8JB 3EO0A 4ZD3L 2BVPB 2EIBA 2WWMD 1S9YA 3Q5OA 4QOKE 4X8JA 1U8JB 1ZANL 4FNLL 3MRKA 1ZWIA 4OCYL 4P5MA 1HCFX 2AGJL 2DLIA 3HI5L 5HI3D 1S7WA 3GRWL 5GS1A 2GKIA 4R96B 3AGVA 3P0YH 5CZVH 1KNOA 3HPJA 1FBIH 3U9UA 3QDJB 4BM7A 1YNLH 1SJXA 4NWUL 5IB5B 4MMZC 5HYFA 1CLOL 1KC5L 4UZGA 4CVWA 1DCLA 2D31B 3RZCA 3FTGA 1RZ7H 3ARWA 1HQRA 4QWWC 5EU7E 2VDPL 4XNZB 5DDHB 5C08D 1I9EA 1QUNA 4M48L 3O2WL 5B39G 3EYFA 1VADB 1A4JB 4M7ZB 3MFFA 2HKHL 1C5CH 4L1HA 1HXMB 1U8LB 4I8DA 3VXNB 4FQQB 1A3RL 2WBJA 3DUUA 4HKJB 1T03H 3Q2CA 4UQ2B 1TPXC 1E4XI 1MI5D 1VENA 3FJTA 3VCLA 5TPWH 4DKEH 2NQCA 1N0LA 4MXQD 3QEUA 3HZVB 4YUEL 3ZYIA 3VRJA 3ILPA 2OL3A 5HHPA 5KVGH 5D7JA 1OM3L 3ULUL 3FFDB 4XRCA 4D8PA 1VDGA 3K2MC 3LEYL 3DWTA 3VXRA 3WJJC 2CMRH 4JPKH 3IFOA 3KAAA 1QBML 4MQ7B 3WLBA 3FQUB 2XQYK 4PJBB 5FYKH 5DFWH 4F57L 1I9RL 4PJDE 1MCSA 5L2JA 2N4IA 5I74C 3W9DB 5CEXA 1QBBA 3D9AH 2GITA 3WDJA 1J8HE 1MAJA 3WHXB 3D2UB 3BXNB 1J0HA 3PGCB 4ONOA 4FHBD 3OKYA 2MKWA 5ACLA 3O2VL 4NQVB 5ICYB 3VFUA 4EI5D 2E9IA 3H9HB 4N0RA 2YK1L 4Y5YB 5I76A 2VSDA 4EQ2A 2W0FB 3CD4A 3VE0B 4NUGH 4XCFL 2R4SH 5LXGH 2R1YA 2VC2L 4TSCL 4BZ1H 1YMMB 2VC2H 4WFGD 1UH3A 3CMGA 3RQ3A 4RX4D 2PKDA 3JUZA 3NA9L 5DK2B 3MUY1 4J3WA 4QRTB 4G9DB 1H5BC 3HI1B 3SE9L 2JJSA 2YWYA 1J0ZA 4ZFOB 4ZO7A 4DVRL 3BOVA 2VLKB 4FTVE 4MX7A 1LEGA 2DQHH 3BI9X 4NQDD 5J13C 2GCYB 4QNPF 4KUZL 1HKFA 1T04A 3V0WH 3HG1B 3MBED 4X0KA 1G7JB 1V3LA 4Z7UA 2R1XA 4WV1A 4TQEH 5FO7B 1MRCL 5ESVA 2X4NA 3FT2A 2EKSA 4EN3D 1D5ZA 2FIKA 2HFFA 4KKCD 4K9EL 3RPKA 5ADOL 4GS7B 1FV1B 3VWKD 3SGKC 5FK9B 4HWBH 4TOYH 3SJVA 3OJ2C 5SWQB 3BESR 5DVMA 1BZ7A 1HXYB 4YFEA 3IDNA 3V5DB 5DSCB 3W5NA 2VH5H 3TT1L 5E08L 1FFOB 4DKFH 2R2BA 4ZNEE 1OP3H 4DKFL 1A1NB 4MCZA 1NCAH 1I8IA 4KK9D 4QRPD 2C9AA 1X5HA 2B0SH 4PJHF 3WXVL 2B0SL 1X6LA 4KZEL 3QDJD 4RAVB 2NW3B 3D5OF 2NW2B 4XMLH 1N2RA 1A6ZA 3TESA 4ISVB 4LCUB 5EC2A 1UQSB 1T5WB 5EOTB 3L3JB 1D9KD 4GW4B 1GGBL 1UCTA 4LLYB 4QEGA 2ADJA 2EKJA 1NFDF 4KKLC 1TQBC 2AJXL 3HMXL 5T1DH 2OQJB 1DQMH 1H15B 3KPTA 4JKMA 5D1QC 5CEYB 5C0CD 1WV7T 5GGRY 2G9HA 1EVTC 4DZ8A 4ETYA 2BY3A 3KPNA 5J6HB 3BIKB 3WL9A 5CBAB 1DN0A 1Q1JH 2BHYA 4HIJB 3S37L 1I3UA 3IU4H 4LSUL 3AS0A 3O41A 1O5DT 4LSUH 1D6EA 3CNKA 4MQTB 5JLZB 3C8DA 1G9NC 2RQ8A 2NY0C 4I3RH 3L9RB 3I6GA 1YZZA 1A6VH 4OV5A 4I3RL 4KJQD 2BXZA 4YNYB 1IAKB 1AGCA 5EPMB 1JWSB 3MJGX 5EOQH 3V7AG 4X80H 2J6EL 2WAHA 4N0UA 32C2B 5KSVB 3LQAC 2EYTB 3CMOH 3UTZA 4G8FA 2VZVA 4P2OD 2P8PB 1HI6A 1QA9A 1NKOA 5HDBE 5HVGB 4Y1AD 3BEVA 1YYLH 3HR5A 2BSSA 3ULVL 1YEFH 3SQOL 2CD0A 3MRPB 4H8WC 3QI9C 3HNVH 3H6JA 4X4XB 5FEBA 1YPZF 5EUOF 3WEXA 3MNZB 3DGGA 1T20B 3T4YA 4JZJC 1Z9OA 4ORGB 4Y19A 5DGRA 3ZKND 5CZXC 7FABL 1Q94A 1PX4A 5IQ9A 3VXMD 1EA9C 2F5BH 2DQHL 5IROC 3IETA 5L88H 4R0LC 1T3FA 4G43B 2XQBH 3SDYL 4BUGA 3V0VA 1KUMA 3WO4B 3QXTA 1P9MA 1ITBB 1FYTA 3RNQB 4G80B 1JTTA 5ANMA 1FC2D 4YHOL 2LTQC 2VXQL 5JIIA 3VXSB 1ES0B 5IFJA 3VXUB 3OKMA 5HHNA 4B7LA 1F5WA 3BN3B 5CUSH 1MJ7H 2XKNA 4HK3J 3B9EA 4NKIL 3RGVD 1E28B 3JWOH 4RA0C 4BSVA 1RZGB 4GLRI 4S1DC 2X9WA 4M1CC 2GJJA 3EOAB 5ICXA 1P4LA 2PO6D 4JRYB 3S96A 2UZXB 4N1HB 1J11A 1WWWX 4RBPK 4MNQA 2IPKB 5GGUB 5MP6L 5I8EB 3NPZB 3QWOB 3VFPA 5LVEA 3U6RB 5DVOA 3EZJB 1N4XH 1CDGA 3F8UB 4ZUUB 4WU5A 2WWKO 4OLYL 4H0IA 1OGAA 3QCVL 1OAZH 3P4MA 3AAZA 5EU4B 3V4UH 1KXQE 4QWWD 3PNWB 2BOBB 4XTRD 2BRQA 5JZ7C 4QF1B 1N6VA 1SM3L 3L5WB 2X4QA 2E7MA 5HHNB 4XH2B 2DLHA 4JKPH 5JA9A 1V8HA 2Z35B 1GIGH 3TEUA 5DMKA 4WEUD 3TC9A 3QFJD 5BXFA 3RNQA 4GRWF 2OR9L 4P5TC 4PV8B 4J12A 3IXAA 3WMSA 2IGFL 4Y4KA 1R5WA 5ISZB 2AJUH 4NN7B 1A7OL 2ICWJ 1CR9L 2F54A 4HZAA 2XNAA 5ANME 2AJUL 3FCTB 1KEGL 1VKXB 2OP4L 1XZ0A 1KEGH 3T1WA 2FGWL 2VDMH 5LAXA 1Q94B 5EOCL 5EZLA 4IBLT 1G9ML 3B6SA 1AC0A 4N9OB 2ADIB 1U2CA 3QUXD 3R06B 2CKBL 5FYLH 3T3PF 1DLHB 4F7EB 4PYGA 4HGWA 2PYFA 4QTHB 3GSOB 2EDOA 2COQA 1KB9K 3DVFA 1JNHA 4QNPE 3PP3H 3X13A 1GVIA 3FRUA 5SX5H 2RCSL 4CNIA 2Y36H 2XKUA 3T2QA 4GBXC 2CJUL 3TO2B 1TNNA 1FNSL 3Q6GH 1EFXB 4GG6F 3Q6GL 4XCYA 2YRPA 2YUXA 1DEDA 4RZCA 2P8MB 4PJEB 1AGCB 4I48B 4NC2B 1ZTXH 3PF2A 3FMGL 5KJRL 4WGVB 5DD3H 4O51A 4TN9A 2X4OA 4QRSB 2DKMA 3O3DB 2IH3B 2P5WB 4K94C 3SQBA 2BZDA 1NGXB 1LO0H 5B38G 4Z95L 5FGCB 1KTDB 1Q9LB 3HE7B 4NQEB 1DN0B 3QDGD 1RJYB 1ZKAA 1NJ9B 3WL9B 4WV1C 3A67H 1Q9KB 3EYQD 1C5BL 2OM5A 3W0WE 4DZBB 4OGXH 5ID1A 4S0SD 2FEEL 1NGYB 2V9TA 4QXWA 3L5HA 1BJ8A 1MPAH 2JCCE 1Y6MR 1K6QL 5H8DA 1JMZA 1F97A 4MXWH 3SDAD 4PV9A 2I9LA 4OCXH 4R4BB 3CZFA 5C0IA 1FH5L 4O9HL 5INCA 1ZLVK 2VXUH 2YZ1A 2A6KA 1N2RB 5FCSH 1YN6A 2DYPA 4TUOB 1LNUB 3MRFB 1CFTA 3WKNA 4KHTH 3HZMB 3IXTB 3B9AA 5GZNC 1WITA 3VG9C 1CIDA 4CADB 1UM4H 3R8BB 4M7LH 5DQDL 1JI2A 4Z8FH 4PJEF 1FN4B 2ZG3A 2XN9E 1FHGA 3RTQC 4NBXB 4KGLA 2W91A 5HHQA 3SJVB 5KSBB 1RZKL 4PJ9B 4PJ9D 2DIAA 1B9ZA 1MAMH 2DQGL 4YPJA 3MBXH 4M00A 2FEDC 4M8QB 3UJTL 2BOCA 4G9FB 3SO5A 5GRWA 2NZ9C 1D6VH 3INUH 3LAFA 4EI6A 3LS4H 1J87A 3VI3F 1JRHL 2GJZA 5IEHB 3F65A 4KI5E 1KPVA 2W0KA 1QEWB 1GAFL 4P4KA 5J9PB 1MCHA 3CZJA 5D7IB 4J3UA 3LH2L 1JPGA 2Y07L 4U1JA 2FECI 1XMWA 2EH8L 3ARRA 1QLFA 3WNKA 3SO3B 5IGXH 1YMMA 5DRWB 5IGXL 2ZCHL 4G7VL 3K81A 3HFMH 1H3VA 2X4TA 4PS4L 4K23H 4XBEH 3IS0X 1AO7E 3LEYH 3SPVA 5DHVH 4PJ8D 3SKUD 3FB6B 1UJTA 2ERJC 3T65A 2ZCLH 1A7RH 1N6QH 1QBMH 1I3VA 3VA6A 3KS0H 1D5BB 3BXNA 1SBBA 2Q3ZA 4LKXB 5DRNB 2DL2A 4OFKA 4OF3A 3T08A 3MRCB 1ZTXL 4X83A 3AB0B 4YBQD 3BD3A 3GB7A 1K8DA 1CLYH 1BJ1J 4N8VA 3VDAA