2OQJB

Crystal structure analysis of fab 2g12 in complex with peptide 2g12.1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
b'EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12 light chain
publication title A peptide inhibitor of HIV-1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB01
2BX5A 5KG9B 1BGXH 2RR3A 1HHJB 3TFKD 2DIBA 3W11C 1JPGA 4O00A 3OAUL 1S8DA 1NGYA 4UILH 1CQKA 3R1GH 5E5RB 4WW1B 4PGDA 2FB4L 1KCVL 5EZIL 5LKNA 4LARL 2EXYC 4LP4A 1IL1A 4K9EC 4LLAA 4JRYD 4NZTH 4LCWD 5F93C 4Z8FL 3Q0HA 3RA7L 4RAUB 2Q8AH 4FFVC 2ADGB 4RNRB 3GIZH 3DURA 4P4KD 4QHMA 1KIQB 3QWRD 1L7IL 4GH7B 4L3ED 3CSYA 2UVFA 1BBDL 4RDQG 4MA3B 1RUQL 5IWLA 5L2KD 3HG1E 3BPCA 2JK5A 1I1CA 1KXVC 1OSZA 3VXMB 4JQVA 1U95B 3PGFL 5CZVH 1AY1L 4ZD3H 3ZT7A 5J56B 4PJ5D 2DJUA 5E94A 2VQ1A 3UX9B 4O51A 1NDMB 4XP4L 4GRLB 4U05A 4DEPB 4I3GA 5K9JL 3VXRA 3S3PA 3MGOB 5BO1H 1G9NL 4NKDB 4TUOB 4OKDA 2ED8A 4XC3L 4ZAKA 4TVSa 3GMLA 4WU5A 5CIPH 2JJUA 1EJ6A 4MAYC 4XCNA 3GIVA 5GSRA 3L3JA 4P23D 1I9IH 1AO7D 4PP1D 2DRUA 5D7IB 4AG4L 3HLAB 5T1KB 2E7CA 2P4AB 3JV6B 5TE6H 4HWBL 3NA9L 3OV6A 2B20A 5DHXB 3B6SB 2R2BB 2ARJB 4CVZB 4KK9C 3PL6D 2AJUH 5B3NA 4KZEL 1BZ9B 4F9LA 4K3DL 5ICYB 1D5MA 2DJSA 4PRHE 1N4XL 5E2UH 2NZIA 4JY4B 3CVHA 2EDLA 2H32H 1U3HC 4PJ7E 5D2LE 1EBPA 4OF5A 3SN6N 3HC4H 1SEBB 2V2TB 4PJBE 1XGQA 5D2NB 4HJGB 1PG7L 5E2JA 3NIDF 2ZOLB 3GB7B 2APBA 1P84J 4MQ7A 4P2OC 1HE7A 4PJHE 1ULVA 4HJJH 1FH5L 1I85C 2WBWB 4WI8A 3V4VH 3AM8A 4RX4D 1QSFB 4NN5B 3UXFA 1NCUA 5KAQF 2B8OT 1QFWH 4EIGB 1FVCB 2EIZA 2YPLD 4OD2A 5LCVL 2KBGA 3QNXB 4JFDE 3HI6L 2VN7A 3HNVL 4ZTOH 3TESA 5ESVA 4MLIA 2ILLA 4AL8L 4PS4L 5I19H 4LCWB 3QHFL 3TBWB 4TVPH 1P4BH 4MS8D 4TSBH 3P4NA 1HH6B 1KJ2H 2VTFA 2QKIA 3RWFA 4L3EB 4W4NA 5F8QC 5C0BD 6FABL 4IIQB 4U1HB 1OF2B 2FGWL 1LNUA 1ZKAA 2VDKL 4M9OA 4M4PA 2JJVA 3VI3E 5D1ZA 4RMWA 3FFCB 1ZLUK 1GZPB 1BVLB 5C9JA 1IGJB 4GMSH 1G0YR 1A1NA 2BNRE 4ZYKA 1R5IA 3H3PH 4X4XB 3ILQD 4IRJB 1DBBL 1U8HB 5EBWA 4LPYA 1RU9L 3S6CA 1NBZA 4U1SB 2WBKA 4P9HL 1U8OA 1FZMB 3SCMB 3CJJA 5DSCB 4KGJA 4PJEF 1QFUL 3RVXC 5IMMA 4JFFA 1YUHB 3RZCB 3KYAA 3BPLC 2LVCA 4X98B 4IMLB 3T4AA 4S1QH 4OZGF 1E4XI 3L7EB 2VYRE 1WV7T 1K4DB 4R97B 2NY4D 4PUBL 1UZ8B 2ZSWA 4O2EA 3PUCA 1U41A 5MHSE 3P11L 5C70A 1YEJL 1CZ8L 2AABL 1T1WB 2GT9A 5CLTA 2IPTH 3IETA 1G6RH 2VH5H 4V1DD 1OP5K 1S7WB 1A7PL 1A9BB 3IDJB 5EU5B 5HJ3B 4JFYB 4UBDD 4O5LL 2VLKE 2G5RA 5LAXA 5HGDA 3DO7A 1T7ZA 2Y6SD 3DSFH 4IOFC 3MRDB 4NQSA 2DQJH 3IJHA 1L6ZA 3IU4H 2NZ9C 3OGCA 1CD0A 1NCWL 5I1JL 3O3BB 4FS0A 3HN3A 1N3NB 3CVIH 4KK5C 3RL1B 1QOKA 2UZYB 2YPLB 5CBAA 3GSXA 2V9TA 2EH8L 5E5MA 4U1IB 3S4SG 4MWFB 1CGTA 4GBXA 2LAAA 2XIDA 4M93B 4IRZL 3EZJB 4XPFL 1OOAA 4BFGA 1U93B 2ZUQB 3VFUB 2EKSB 4MHHG 1MVFA 4MD5A 1MUJA 3RVWD 3MRPA 2VXTH 3T2QA 4CJ0A 2J88L 5HGGS 2C5DC 5D1QA 3WNLA 1NC4D 4N9GB 4ZXBB 3VRJB 5CFHA 1HWHB 3GJEB 3VFTB 1BF2A 4EDWL 3UTTA 3LCYA 4Y4HB 3I50L 1JMZA 1A3RH 5T3XD 4C83B 3KPMB 4FTVE 2H3NB 2H41A 4OZHE 3GJFB 4IS6B 3CFJB 2A1WH 1FSKB 4ZPVB 1W72H 4LEOA 4D2NA 1F5WA 3EO9H 1QBML 5FYLL 1E27B 4LSTH 2DTSA 3UP1A 1GHFL 3PWPE 2AGJH 2ICWB 4XHJC 2PO6D 3O81A 4QRPB 5B39A 3U7WH 3V4PL 3PQYE 2QSVA 1FZJB 2B2XH 2KKQA 1QZ1A 4LMQI 1WEJH 2P5EB 3FO9A 2QJDA 4XVUC 3ULSB 4L1HA 5JQ6H 1ZGLB 2F53A 5DVKA 1KOAA 5J11B 1ORQB 1CFVH 1U8NA 3VFPB 3ULVC 1YYLL 3OBAA 5AZ2H 3LV3A 3U4EB 3ULUE 2UUDK 4WWKD 5EUOE 5BQ7B 2BERA 1U8IB 3JWOC 3LN4B 3Q1SL 3CK0H 3LS4L 1D3CA 3TJEL 2BVPB 3ROOA 4TQEH 4LSQL 2VLRD 1JGVL 5DJ8A 5H2BB 3LKQA 3L3GA 4P2RD 3MOAH 1UCBH 3VXSE 1BIIA 3KYKL 4LLDB 5INCB 1FC2D 3C5ZD 5JLZB 5ESQA 2AK4D 2OL3B 3C6SB 1TQBC 3L5WB 1W0WA 3IAGC 1U92A 2V2XB 2QTEA 1QFHA 2F54B 5T1LD 3AC0A 5IW1B 3ILPB 4L5FH 5IEKB 4R90H 3E0GA 4QGYA 2A0LC 1LEGA 4BQ6A 2A6IA 1G9MC 4M8QA 2VDLL 5E2WL 4K71C 3TCLA 1HYRC 2HFEB 4LIQL 4DW2L 5I2IB 1NEZB 1UWEL 4NZRL 3OKEA 4EXKA 3VJ6A 1MFDL 4TUKL 5HYSA 3H9YA 1UACL 4LGPB 25C8L 1PBYA 2XQBH 5D7IF 2D7OA 2O5ZH 1S5HB 2YUXA 1MCRA 4Z7QE 4XP5H 3DMMB 1LGVA 2EC9T 1EGJA 1KJVB 1UKQA 1J18A 4JDTH 1T4KA 5D7LD 4B7IA 1T1ZB 2MFNA 3IGAA 1FQ9C 2OSLA 4ZS6C 2K7QA 3QCUL 5CCKH 3DIFB 2OJEB 4HDIA 2HRLA 5E6ID 3P3YA 3ZYOA 1CIDA 3AY4A 2C4XA 1LO0L 3CX2A 3SGEI 1RD6A 4XH2B 1FYTE 1IILE 3K0WA 3CPLB 3TZVC 3ULUC 1BJ1H 4XC1L 2XTLA 1YEEL 2IPKB 5I71B 5DD0L 1OAQL 2HKFL 3SKUD 2KL6A 4IBLT 1C5CL 4QHUA 2XTJC 4XMPL 1G0DA 5IBTH 1V3JA 3PNWB 3I02B 4FZEH 2A6DB 3SOBH 3JTTB 3TYGH 5BV7B 3RHWF 4PP2A 4XCEB 5EC2A 4OLVH 1DSFL 4XCFL 4QY8A 5EOTB 1Q8MA 4IOIB 4LRNL 5FOBA 1IGTA 3ZMRA 5FO7A 3BQUD 4WWKB 3EO1A 1K85A 4FQCH 3ZTNL 4U4BA 1P53A 2GTWA 1R6VA 1MJJA 2DQCH 1LK3H 1A7QH 2DL9A 2F74B 4R26H 1C5DA 4X5XA 4BQ8A 2X4RA 1OAYH 2DYPD 4WHCA 4F9PA 1QFOA 4XPGH 4OUUB 5I1HH 3QEQE 5DEZA 2R0ZH 3KPLB 4JO4H 3D69A 3HI5H 3OWEA 5IV2B 1B4RA 2AP2A 1NJ9B 4MDJA 3S3JA 5GS1A 3IXTB 5DMIH 2G9HB 4JPVH 1T04A 4JFXB 4KY1L 3MV8A 4YK4C 5KW9L 4Z5RB 4NNPL 1SBSL 1X5XA 5CP7A 1RUKH 3WFBH 3I6GB 2NW2B 2J3SA 5DJZB 2EDNA 1MQ8A 3VWJD 3PF2A 5C0CB 5HVWA 2DMCA 3TO4D 1FZKA 2QHLA 5JUEH 2YKLH 3K80A 3KPSB 3U0PB 1NBYB 5IB1A 4UQ2A 5C9KA 2K9UA 2R0WL 5E1AB 4NBXB 5BZDB 3BAEL 4PY8I 3IVKB 2M2DA 3V0WH 1WBZA 4UDUA 1MF2L 2FWOB 3V8OA 1VGEH 5BVPL 1FGVL 5EZLA 6CGTA 4XNQA 4FP8L 2JCCE 4ZFOA 1J0IA 3U36B 4KVNL 2YN3A 3SDYH 4DOHE 1UM5L 3CMGA 1ACZA 4X9FA 4JN1H 4Z7OF 5C0JA 2LU3A 3K8MA 2YD7A 4U1JB 1DN0B 3SDCC 4DUWA 1WTGT 3QDMA 3FB7B 1MWAL 4XNYL 3BWAA 2PW1A 4NGHL 4Y19A 3VFRB 2E7HA 2HN7B 4MYWB 4JN2B 4HULB 3VFVB 2W60A 3GNMH 3FOMB 1FAKT 5F6IC 4GSDH 5IQ7H 5TE4H 3O41A 4ACPA 5ALBH 2FBOJ 3EOTH 4HXBL 3SO3B 3TC9A 4PJDB 5C09A 4YNYB 4XXDA 1WITA 4OGYL 2XN9E 5JO5B 5DA4A 3QSKB 4X7SH 3X3GL 5FM4A 1PSKL 2AI0L 4KVCL 2EH7L 5EBMA 3VXRE 1U3HA 1HHGB 1KPRB 1ZHNB 1KN4L 3CLEH 3V6FA 2AJZA 2EIEA 4QRTB 3X11A 4Y0GA 1W8NA 5DWUH 3UYRH 1INQA 1D6VL 3T0AA 3F5WA 3RP1A 4HS6B 2ZUYA 5C08D 4KKLC 3T77B 4UIKH 2HFFA 3FO2A 4MB3A 1HHHA 3CFDB 3MNWA 1XF3A 2I5YL 3B5HA 3CAFA 3CUPB 3N0PB 2BSRB 2HRPL 1OGTB 4X80L 4UTAL 4KK8C 1UWXH 1WGOA 5FYJL 3TIDA 4I5BA 4OB5L 3Q6GL 5B38A 4XCCL 2PXYA 3JVGA 3M07A 3THML 5I8KH 4Y16A 3P9WB 5AWNH 1BPVA 4QYOA 1BEYL 4N0YH 4LLYB 1M05B 1UFUA 1II4E 3DROB 3BD3A 1TZGL 4FQLL 4PJ9D 2ZCKH 1SVZA 4J3UA 4HBCL 4M7KH 3P9MA 3BH9A 5JMOC 5JHDD 1RJYA 4WVRA 3EDEA 4HC1A 5TGBA 1MHEA 2FATL 1KB5A 1TPXC 1HZHH 2DQIH 3RNKA 4YDLC 4NHUA 3H9HB 2Q3ZA 3BO8A 2P8LB 5DD1L 3G6JB 1FZOA 2PTTA 2ZCHL 4OZFG 3IFLH 1JGLL 3SQOL 5I16B 1JV5A 4H1LH 1AP2B 1KPUB 4TNWF 5CZXC 4HIHB 4PBXA 1A1OB 2AEPH 1YEGL 2X4QB 3RY5A 3FONA 4OAWA 2Z31A 5HYFA 3L3DA 1BFTA 4ZPTA 3ARBD 1D5ZA 3I3EA 3QISA 4N1CA 3VXOB 4YDIL 4I0KA 3VGFA 2B0SH 4KJPC 4MHHI 2EDKA 4UUJA 1OHQA 3HZVA 1M4KA 3Q2CA 5ACZB 2HLAA 3F7YA 1N7MH 1FAIL 1R3KA 4Y7MA 3CCHB 5IFHL 4GS7C 3QXTA 4WFGE 1AQDA 5FF6B 3QDGE 4JFOA 4HKBA 5FGBA 3RDTD 4X6CA 1QPXA 2B1AL 2BVOA 3IT8D 4QRRE 2XZZA 1JI1A 2ARJQ 3P0YL 3HPJB 4AEHH 2P5WA 2FX8H 5CMAA 3GMOA 4OF3A 3SDAA 2FZ3A 4JFFE 1U2CA 5IK3A 4OF7A 4MJIB 4NDMA 4XB8A 1NAMB 2IEPA 3O8XA 5D5MB 1I1YA 3D18B 1T0NA 3NH7H 2F5AH 1O7SA 2IFGA 3H2WA 1BZ7A 1A4KB 5I1EL 3EJZC 1NC2A 1H9VA 1T6VN 3HNTH 4J6RH 5DD6A 1AC0A 1AD9A 3FFDB 3O2VH 1MAJA 4CVXA 3ME0A 1ZHKA 4R3SB 3U7YH 5IR1A 1XIWB 3O4OB 5BVJB 1ZV5A 5JOFA 2CGRL 1IC5L 3IDIA 5IESL 2EXWC 4EDXB 5H37G 2EICA 2OTWA 4NOBA 4U1KB 4IM8A 2VLME 5DEFB 3DRQA 3RY4A 4LU5H 2VWEE 2YA0A 3ZDYE 4KDTC 1BFOB 2NY0B 4XMKL 3CDGA 2R1XA 4NJ9L 5J8OA 2RJMA 1H5BB 3DV6B 1YEIL 5IM7A 1DBML 3QCVL 3RX8A 3M8OL 3UZEA 3LN5A 3FO1B 1YMMB 5EZJB 5JHDB 1BJ1J 1DUZA 2OI9C 4YHKH 1Q72H 4WGWB 5LG1A 4HT1L 3VGDA 3W81A 4C4KO 4NFBA 3GMRB 2VDOH 4LAQH 3AREA 5L2JB 3RUGB 4P4RB 5J3HD 5IEHB 4QNPE 5F7FA 2BY2A 2VAJA 1RHHB 1EFXA 3GSQB 4TSCL 2FHCA 5C0AA 2ZCLL 4AY0A 5IBLC 5H35B 3VXNB 4FXGB 2ESVD 2X9YA 2C3GA 1FNEA 1QSZA 5ISZB 3MJ9A 4UQ3A 3CH8A 1J0HA 4YGVA 1I9JL 3QUZC 1Q94B 1A7RH 5BZWA 4JPWL 4D8PA 4Z77B 3B9DA 5T1MB 5B3JE 5I1DB 3K4AA 3MLUH 2GCYA 4Z0XB 4GRWE 2YZ8A 4G42A 4FHBD 1RUAL 2ZNXA 3FRPG 3SDXB 2QSCL 3S37H 3DV4B 4KH2A 1OAKH 4ZO9A 3WKMH 3D85A 4K7FB 3I3BA 2HH0H 3FT2A 2DM3A 1OQOA 2ARWA 3RDTB 5C2BL 1KG0A 1URLA 3CSGA 3KLAA 2Q6WB 5I1AB 5DXWA 3ARTA 2YD2A 2GUOB 3G5YA 4NPYA 2QQLL 3BOVA 3ZE1E 1HCVA 2FJHA 4U6TA 1IGFH 4AEEA 5AUMA 3MRGB 5HGHA 3B2UC 5K9KA 4Z7NF 2VWEC 4DGYL 4DZBB 1KNOA 3CVHH 5EUKB 1SJXA 1DE4B 1OP3K 2GKIA 5BW7A 4R4ND 5F1NA 3NAAL 1FVEA 4XZUB 3K8LA 3TYFA 5I0DA 4RGMC 3G9AB 1IJ9A 3IB4A 1ZS8A 1KJ3L 3SO5A 3GHBL 4DJMA 3I2CL 4I2XE 1F8TH 4GAGL 1NFDF 1X5HA 4D3CH 1U3YA 2Z8RA 3KPQB 4UIMA 4ZSOB 3KS0H 2G2RA 1J1XL 2AJSH 4GKNA 4EVNB 1OTSD 1RFDH 5KVGH 4LKCA 3VH8B 4OLWL 4P99A 4HX1A 1SHMA 5KSBA 1YN6A 1AKJD 1ZA3A 5KVDL 1H0DB 3WNOA 1UXWA 4YPGA 5MENE 3CC5A 1S9VB 2YD4A 1MHCB 4PJDF 3QFJD 2CMRH 1A6UH 3OXRB 4HWEL 4Y5VC 4DGIH 1D7FA 3O3AA 2Y25A 4PIRF 5SWZE 2VZ1A 1UJ3A 1EO7A 2ZOKA 1OGAA 1J1OH 1E4XH 4N68A 4RIRA 1HXYB 5C0EA 2CIIB 4RSVA 5JR1H 2LV4A 4OCYL 4Y4FC 1YZZA 5FO8B 2IGFL 1MLCB 3IFPB 4XBPB 2ESVB 4HEME 4NQXB 5GGSY 1FNGA 2DDQL 4LSSL 1PG7W 4KTYA 4QHLB 3MJ7B 4P5KA 3Q48A 3WFHA 1MAMH 5DK3A 4ALAL 1JHLH 9CGTA 4HCRL 3LN9A 4PD4J 5AYQA 1AQKL 4UAOB 4AM0A 4NJAL 1KUMA 2EYSA 3OKMA 1Q9KB 3EYUL 4K8RC 5T3XL 3WFCL 1JZ5A 1AGDB 5E8NB 5FUCE 3S8WA 3C2AL 4G3YH 5I1LA 3MLTB 4E41A 2CUIA 2EC9U 3LKNA 4LQFH 4M00A 5GJTH 4F7TB 1XR9B 4FFZH 4PGBB 3C60C 5FGSA 1P5UA 1BECA 5MEQB 3B2VL 1I7ZB 2X1OA 4UT6L 3GMMB 4U31A 1CGSH 2YPVL 1Z6JT 2NY6C 5BRZE 3T0ED 3WNNA 2G75A 2VLJA 5EO1B 5DS8A 4FQPA 5E4EC 3BP5B 4D9LH 4NKOB 3LDBB 2PYEA 3MXWH 1QACA 2PTVA 3OSKA 1X7QB 3RTQD 5C7XL 5IJVB 2VDQH 3F58H 4OTXL 1HYSC 1D9KC 1B90A 1PKOA 3GMPA 5I75B 4RZCB 5MEPA 4HS3B 3NA4A 2Z93A 5DDHB 2Y4SA 1T7YA 4QHKJ 4X5LA 5HHOB 4M43L 2D0GA 4KUCD 3JV0A 4K07A 3GSNH 4DVRH 1AKJB 1XR8A 4RAHA 2DQUH 2Y5TB 1KGCE 5I1KL 2FO1A 2X70B 4YHNB 2A6KB 2WWMD 1SM3L 5D6DC 5C0ND 4C55A 2IH1A 1ZVYA 3QFJB 4KMQA 1UZ6F 3AAZB 3N9GH 4MA1C 3G04B 4FQJL 1IGIL 3OJ2C 5HHQA 1TXKA 5SX5H 5DMGD 2BOCA 5DK0B 2Z8VC 2P8MA 4NRXB 3RGVA 3R06B 1XZ0A 1F11B 5FUCC 1LHZA 1T66C 5LWYL 4OZFA 3FTGA 2XY2A 1A6PA 5K9OA 4ENEC 7FABL 1QRNE 1NH6A 3NBNA 4JFQA 1IAMA 2ZP0T 4GRWH 4L8CB 3K2UL 4KTEL 1WCBB 2AQ1A 1IGCH 2PR4H 3N06B 3MLSH 4Y1AE 1VEMA 1QR1B 3JV4A 2X89D 3KPPA 5IB4A 5C07B 1JF1A 5F88A 4S10A 5C6TH 1CE6A 4X6DE 4WFHD 5E0QA 5GRJH 3O11A 4N8VG 1B0RB 5F9OH 5EB9A 2RFXB 5JIHA 4Q0XH 2HT2D 1J0JA 4JM4L 4ODHH 5DJYB 3ARDD 1XH3B 3D9AL 1DLFH 1DBKL 3KPRB 2PW2A 1F3DH 2A6JA 4K55A 4EUPH 1GIGH 3QULB 5IT2L 4M1GL 4Z7WB 4WCYL 1J8HE 3LKSA 4EI5B 3BMWA 1TJGL 3DVNA 5E08H 3QI9C 3KR3L 3G5XB 4HUWA 3IKCB 4R2GC 4YZFE 1QEWA 1CTOA 4JGUA 4XVTL 4LAJH 1CF8H 4DGVL 4X6BB 1NDGA 3RUGF 4KRMB 5BS0A 2LE9A 3GSVA 4KHXH 5DURD 3TVMC 4JQIL 4XNXL 1XCTB 3FB5B 3WLBA 2RGSA 5IVOA 1QVOB 2XWJA 5A1AA 1Z2KA 2VITB 3O6LH 4XAWH 3SGEH 5TH2A 4OD1H 4PV8A 3U0WH 1YMHB 1VEPA 3RBGA 4PV9A 1N59B 2WZPD 3U0TB 1UEMA 2BSTB 4PJEA 4FXKA 2IAMD 2HT3C 4HUUB 1CYGA 4YX2L 1WIUA 1S3KL 3C5SA 5FKPA 5HI5D 1VACB 4MNHA 1I8IA 1M7IA 2WBJA 4OIIH 5TQ0H 3V6ZA 2HTKD 1XGRA 2CK0H 4U6VH 1G0XA 3G6DH 1PKQE 5HHVH 3TJHD 5CD5D 1CFQB 3SDXF 5DMJB 5C0GA 2X2YA 5T5NF 3HHRB 3H42H 4GG8B 4Q2ZA 4PJ8C 3VE0B 4CW1A 3SY0A 3VRIA 2YSSB 1CDHA 1S7TB 3QUXA 1KBGL 4TRPH 3RAJH 5CJXA 5DHVB 2Q76B 4F7EA 4G6AC 1EGJH 5JOPD 5JHLH 5I1CL 2WWKO 1BD2E 3D2UD 3GK8H 4OLXL 4MZ2A 4ELKA 4NQDD 3LQMA 1PY4A 1GGBH 3WJJC 2GQHA 5E2TL 4JRXE 1BOYA 4K94C 3QG6B 1VFMA 5EO0B 4XVSL 4X4MA 1L4IA 1R3LA 2FDBP 2V7NA 1NLBL 4LOUC 3EFDH 2EDYA 2VLLA 2BSSA 2F19L 4JFHD 3LKOA 5DRWA 1S7SB 1EEZB 3DNKA 5T1DH 3ARYA 2ED7A 3BPNC 4HGKC 4MJ6B 3W2DL 3P0GB 4XTRD 1IC7H 1MQKH 4HXAH 1FHGA 2P47B 3VFGH 4LP5A 1OM3H 3S5LA 5CEZD 1IGML 3BEWB 2ADFH 4S0TD 3UJTL 1I1AA 3WN5B 1KC5H 5J1TC 2JIXA 3DOSA 4G8IA 2W59A 3DRTB 2GSIB 4DZ8A 3O6KL 4HKZB 3WHE1 5SV4A 4F2MA 3UPCA 3KS0J 5KSAB 1YEKH 4R96B 1QFPA 3NCYS 4KC3B 3HE7A 1IAIL 3SJVA 4QXTA 43CAA 4UV7L 1BQLL 3W0WD 4P48A 3U46A 2DQHL 2HWZH 4OM0H 2PCPA 1JFQH 1EHNA 4MB4A 4U6YA 5I30L 1Z5LB 4ZDHA 1PZ5A 1R3JB 3D39D 2OR8A 1M7XA 2DIJA 4CRPA 1OL0A 5DK2B 5DRZA 4JPIA 1EK3A 4L9LA 3MOBL 3DX7A 2OM5A 1SEQH 5CHNB 3TN0A 2XZCH 5B8CA 5I8CB 1EMTH 2OQJB 1HHJA 3JWNC 1F4WL 4DAGH 4G80A 3C2SA 3MA9L 5IROC 2BC4B 1TQCC 3MFFB 5JA8B 1A47A 4TULL 1CL7L 2IANA 5KOMC 5GGSB 1NEZG 2DF3A 4O9HL 2OP4L 4Y4KC 4RAUA 3SDDD 3FN9A 1MFNA 1FIEA 4UINH 1DQJB 2ADGA 4RNRA 4OM1L 5EORL 1KIQA 5T3ZL 3LHPL 1WIPA 4RFNC 4MXVE 5GGVH 1QNZL 3D2UB 5J12B 2K7PA 4NKIL 3QDAA 5GRZA 5D6CB 2X4NB 5IVXF 1AR1C 1WLHA 1BGXL 3VXMA 2OJZH 1U95A 2XXMB 4UILL 3R1GL 4CKVX 1NGZB 4MXQD 1A9EB 2MCPH 3QIBD 4GRLA 1JRHI 1A7BA 4ZUUB 2L7JA 1Q9WB 3IXAB 1B88A 4K94H 4DTGH 1JE6A 1V3LA 3MGOA 3H3BC 4TUOA 1IAIM 2APXA 4HIEB 4NZTL 5TF0A 4S1RH 5DTFA 4EN3D 2BCKB 2Q8AL 3GIZL 5D7IA 1QLFB 3CXDH 3HLAA 1XF5B 5T1KA 2YD1A 2J6EH 5EIIB 3F7VA 5GZNC 1PFCA 5D7JD 4M3JA 3B6SA 4XAKE 3HR5A 3ARXA 4CVZA 5CZVL 4LKXB 3HRPA 4ZD3L 1BZ9A 1XF2B 5HHMD 5ICYA 4HG4K 4JY4A 1YA5A 3W0WB 2AEIT 2BVUA 3ARGC 5IF0B 5BO1L 1F90H 4POUB 5DZOA 4KV5E 4W4OA 3D39B 1SEBA 4X6EB 5E6YA 5JW3H 1CBVH 2V2TA 4HJGA 4KKCD 5J1SC 2ZOLA 3GB7A 4H20H 3HUJB 4N0UB 5HYJD 1I9IL 4MVBC 2C1OB 1J5OH 4Z76A 2SEBB 2AK1H 3T1FB 5TE6L 2IFFH 5EOQH 1S5IH 5FA4B 4CMMB 1QSFA 5DJCA 4I9WE 4I0PD 3T0WA 3TH2T 1FVCA 4MQXD 2AJUL 5FHBH 3QNXA 5FK9A 3WIHA 3V6OA 4L4JA 3E8UH 4FQ2H 1CDIA 5E2UL 4JHAH 4POZD 1G9NC 3P77B 4WUUB 3TBWA 1ZLVK 5KSBE 2XKNA 4U7KA 1WIOA 4Q74A 3HC4L 5AAMA 4HC1H 3F8UB 5B21A 1HH6A 4XP1H 1KB5H 1OW0A 1CD8A 4WFED 3QUYC 3LRSB 2DB8A 3CXHJ 3QDJE 2BFVH 2BRQA 4QT5B 4RRPG 4HJJL 4Z7WF 1OF2A 5C0DB 1N64H 1OB1B 3JV5A 3QG7H 4OFIA 2NQCA 1H3WM 1T20B 2J8UB 5ICXB 3V4VL 3FFCA 3ARFC 1GZPA 1BVLA 4I8DA 4L4TE 1UQSB 1KIUA 3RKDC 1QFWL 4F7MB 4PJAE 4X4XA 2XZQH 3RVVC 4PRIB 4ZTOL 1QO3A 3GSWA 1ZAGA 4IRJA 1F3DJ 2A9NH 1EEQA 1U8HA 4HKJB 4U3HA 5I19L 1HQ4B 4I13B 4EN3B 4TVPL 3UAJD 4JZJB 1P4BL 4HGWB 4U1SA 5IB2B 3H9SE 3TM6A 4TSBL 4R9HA 5KVEH 3TNMB 1BFVH 1FZMA 1KJ2L 4HV8B 5DJAB 3SCMA 3VXPA 5DSCA 1OTTC 4AEFA 1YUHA 3RZCA 4RGNC 1BFSA 4X98A 2WNGA 3OAZH 3UC0H 1LP9E 5D7JB 4ZAKD 3HB3C 4QXGH 1EHLH 2NYYC 3BZEA 3C5JB 1D9KA 1UZ8A 5FYKE 4HLZG 1CLOH 5HHMB 2F8XC 4GMSL 4YBHA 1MLBB 4NUJB 1T1WA 4OFVA 3H3PL 1CVRA 4APQC 3UTPD 1DQMH 3IDJA 1SY6H 5IVNA 5HJ3A 4JFYA 1F2XK 1WCQA 2VLJE 3MV7E 5A40E 4B50A 3MRDA 2PUQT 3BP6B 3RWCB 5JXEC 3LEYH 1RJLA 4FZ8H 1JMXA 4XWGH 1Q1JH 3JUZA 3CFCH 4FQXC 1ZT1B 5FYJU 4KROD 2H2SD 4HMEA 2X6MA 3R0MA 3FQXA 3O3BA 4S1QL 5F44A 8FABA 4XP6H 4I0PB 3RL1A 2X4OB 2FJGB 4YHPB 3X14B 3V5KB 2Z35B 1RK0A 3C6LB 3J7HA 4U1IA 1FPTH 3BIAX 4MWFA 1CGUA 5D96B 5AEAA 3VI4F 1JZ3A 3VDBA 1TTUA 3K1DA 2N4IA 2IPTL 1R3IH 5DC0A 1U93A 4KU1A 1G6RL 2VZ3A 2VH5L 2F5BH 4UOW0 1INDH 2EKSA 1SYSB 4P9HC 4FABH 1FFPB 1NSNH 3LPGA 4N9GA 3VRJA 4ZXBA 2WUBH 2YPKB 3DSFL 3GJEA 2A74B 1HILB 4LVNB 3VFTA 1U6AH 3GMNB 1IL1B 4M3KB 4JM2C 4Y4HA 3FKUS 2VNCA 2DQJL 3X12B 4C83A 3IU4L 2C9AA 5D1XB 5I74B 3KPMA 5MEOB 1VESA 3GJFA 4IS6A 3CFJA 5FYLE 3DURB 2L7UA 2E27H 4ZPVA 3CVIL 3P0VH 4LDEB 1RZJH 4PB9H 1X9QA 1XF4B 4FNLH 3RIAK 3NCFB 2VQTA 2MWCA 4H0GA 1OSZB 1LO3H 2WP3T 2NX5E 4LVHB 4Q6IC 4PY8J 3W5MA 4QRPA 5D7KE 5D1ZD 3GZKA 3QIUB 1FZJA 5E94B 3EYVB 2CJUH 2Y7QB 2VC2H 2VXTL 3QH3A 5E8DH 2P5EA 5DQJA 1BAFH 1TVHB 3ULSA 1ZGLA 3S35X 1UGNA 1FFNB 2DLGA 3IRZA 3GO1H 4YBLC 1KEGH 1ORQA 2CLZB 1A3RL 1FL5B 2XI9A 3VFPA 3BKJH 5D93B 3U4EA 5GSRB 2BVEA 1U8IA 1FIGH 3LN4A 2A1WL 5EU4B 3TVMA 1W72L 2BVPA 5D7SH 5M95B 3V52H 3I85A 3EO9L 2R0LH 5CEYB 2B5IB 5H2BA 3HNSH 4LSTL 2WK2A 3MREA 4HUKB 1GOFA 3HR6A 2AGJL 1ADQA 2F58H 4LLDA 5J7CC 5INCA 3WO4C 4JG0H 3U7WL 5JLZA 4UB0H 3CFBB 1FFRA 1LK2B 4CDHA 2B2XL 3C6SA 1T2QH 2V9RA 5IGXH 3L5WA 1A6AB 1WEJL 3V2AR 2XQYK 2V2XA 1TDQA 2LVEA 1TLKA 4A6YB 2F54A 5JQ6L 2RBLA 4M5ZH 1CIUA 5IW1A 1VSCA 3ILPA 4I18B 5GRUH 2DKSA 3BD4A 5IEKA 3NVQA 1MSPA 2YC1B 3NIGF 1A2YB 3ZL4H 1OP9A 5GZOD 1CFVL 3K1KC 3G5VB 2LTQC 3MRRB 4QHNB 5AZ2L 1J7VR 5CGYD 2QL1A 4MNGB 4Z9KB 2ADJB 5FUOH 3CK0L 4O02H 2HFEA 4OBRA 5I2IA 4TQEL 5IW3A 2QEJA 2Z8SA 4KK6C 2BNQE 3UJIH 5I1GH 1A6TB 3MOAL 1N0XH 1UCBL 4MZ3A 3QIWB 3MO1B 4OD2B 4UTBH 4KRPC 4G9FE 3DMMA 1DBJH 5ESVB 1KJVA 4GBXD 2QADD 4TYUA 4JFEE 4WW2B 4GMTH 1T1ZA 1WT5C 4I77H 5ACLA 4G8GE 3MBXH 3DIFA 4L5FL 4R90L 4YFEA 1KLGB 4D9QE 4O58H 4XH2A 3OQ3B 5D1QD 3VD3A 3CPLA 1UB5B 2AW2A 4YQXH 3UTTD 4IDLA 2IPKA 1LNUB 3PGCB 3HE6C 2CLRB 2IF7A 3QXAB 1KLUB 4UMGA 2AEQH 3EYSH 5D1ZB 1T5XB 3HUJF 3C8DA 4JO2H 4YH6A 3IF1B 3LD8B 2XQBL 3PNWA 4M7JH 2O5ZL 4X4ME 1A1NB 1IC4H 1KXTB 3I02A 5FYKH 1R5IB 2A6DA 4H8WH 4XP5L 3SPVB 4F37K 4XCEA 4GW4B 4Z95H 4JDTL 4HGMA 4M7ZB 5EBWB 5EOTA 2JJSA 4IOIA 2UZIH 3V79C 1NBZB 1QRKA 2ERJB 2H2PC 5CCKL 3MRLB 1U8OB 3MA7B 1IFHH 3GI9H 4RWHA 3T09A 5IMMB 2F74A 5JA9A 2F53D 4NC0B 3T4AB 3B9EA 3TA3B 3MRHA 4OUUA 2IH3A 3PV6A 4OGAD 2CKBB 4LDLB 4HIIA 5IV2A 2ZPKH 1CGVA 1CT8B 5IBTL 5GGQH 5CD3B 4E5XB 1NJ9A 3BD5A 3IXTA 4HZLB 2GT9B 3SEPA 4FZEL 3LMJH 1MFEH 2OCFD 3IETB 4JFXA 3SOBL 3TYGL 4Z5RA 2VZTA 3E3QE 5GGTH 4OLVL 5C1MB 2NW2A 2P48B 4Z6AT 3QZWG 4LCCC 5DJZA 3ELAT 2JJTC 1QUNA 5SX4I 1E4KA 4U6HB 5C0CA 1CICA 4PJCB 4L29B 3EBAA 4ZNCD 4FQCL 3HPLB 4HK3N 1ZLUH 1NUFA 3KPSA 3U0PA 1NBYA 3D3VE 2AERT 2DQCL 5E1AA 1LK3L 1A7QL 2VZVA 4R26L 5DVOA 4OI9A 3MJ8B 5BZDA 4PD4K 3IVKA 1OAYL 2C3VB 1MRCH 1A0QH 1WK0A 4XPGL 2FWOA 5I1HL 1PX4A 1S9WB 1FYHB 2R0ZL 4JO4L 1WBXB 2V7HA 3HI5L 5CJOH 3U36A 1ZE3C 3BKCH 4GBXB 4U1NB 5DMIL 5DUBB 4CAGA 4OZFH 4JPVL 3TBSB 3BESR 1PY9A 1C16A 1DN0A 1RUKL 4FG6D 5DUMH 3IJSB 4WWID 4MD5B 3WFBL 1MUJB 1NFDA 3FB7A 3MZTA 1PQZA 4C56E 4HAFA 3PHSA 3VFRA 4KUZH 4TSAH 3EOBB 4GJTB 1UWXK 2HN7A 5JUEL 3PDGA 2YKLL 4M6AA 4JN2A 3V9FA 1S78D 5K9QI 3VFVA 2Y1VA 2EZ0D 3FOMA 2YEZB 4IHOB 4JR9H 4CMHC 1L9NA 1ONQB 5D72H 5JTWA 2VL5B 5F6HI 3V0WL 4PTUA 3TP4A 1VGEL 4HF5H 4PJDA 4HH8A 4YNYA 4BYHA 3HMWH 5JO5A 3GKWH 2JTDA 1IKNA 5E9DE 1YJDH 3SDYL 3HC3H 1ZWIB 5FA3B 4JN1L 3DX9B 5B39B 1HHGA 1KPRA 2VAAB 1FO0B 1ZHNA 3ARGA 1PX3A 3E3QC 1RV6X 3S7GA 4QRTA 4LLMB 3SE8H 3NIFE 4E9LA 5AG8A 2W9LA 3FRUB 3ZE2F 4YLQT 2NY3C 1P6FA 5L6YH 3GNML 4M7LT 3B5TA 2ZG1A 1DCLA 4GSDL 4HS6A 5IQ7L 1GRWA 3BHBB 5TE4L 4NQCB 2HYMA 5ALBL 3CFDA 4HH9B 3EOTL 3LQZB 3CUPA 2BSRA 4HJ0D 5DJ8B 5FYJE 1OGTA 3ROLB 3TH4T 3NPSC 2R9HD 3LKQB 3AB0C 3BFOA 4K2UH 1YQVH 4X7SL 5LVEA 3SE9H 5D4QA 3ZT6A 4CN4A 2ICES 2NNAB 5DQDH 3LPWA 1EA9C 2RQ8A 3VCLA 5ESQB 2XFXB 3W11D 1KT2A 3MV9D 1WAAF 3CLEL 4TTDC 5D2NE 1AI1H 1T2XA 3MV8D 3OHXB 5DWUL 3UYRL 4LLYA 5EC1A 1M05A 2JLLA 4HMCA 3DROA 1LEGB 2A6IB 4HWBA 4Y2DC 5F7LB 5FKAB 1PD6A 4PJGE 2X41A 4UIKL 4P5TB 5JIIA 1CFTB 3RI5K 1FE8H 2HJKB 3ZDXE 1S9XB 2BHYA 3QR2A 3VJ6B 5HYSB 3H9HA 2P8LA 2R0KH 3ZE0E 4JRYE 4LCWE 4HPOH 4Z7VF 4J4PC 3U4BL 35C8H 5I16A 4JVPA 1KPUA 3FN3A 4WFFD 4HIHA 2W65B 5CIPB 1A1OA 1E0OB 1T4KB 3C09B 5I8KL 4L3EE 5AWNL 4I3RH 5IKCA 2X4QA 3BN9D 5L0QB 4N0YL 3U9PH 3CU7A 3QDMD 1JYNA 3WNKA 5L2KE 3JTSA 3VXOA 4MSWB 2ZCKL 4XWOD 5C0RH 2J4WH 4M7KL 1BX2B 4MAYD 4Y19D 2DMBA 5DJ6B 4PJ5E 4YPJA 2H9GA 1X4XA 4RISH 2MCG1 4MJ2A 1HZHL 2DQIL 5HXMA 3CCHA 1GGCH 4QHUB 1CI5A 5FF6A 4ODVH 4M9PA 3W82A 1CDJA 3IFLL 3EKCA 5C09D 4J2XA 3UEZA 1UCTA 5M94B 3HPJA 2G5BB 1AO7E 1RUPH 1W2KT 2AEPL 4ORGB 4PJFB 4MJIA 4U2YA 1U3HD 3HAEB 1NAMA 1J0YA 4ONFH 5F9WB 1SMOA 2HT4C 3EHBC 1EAPB 4NQUA 5C0FA 4WW2F 4Z7OE 3D18A 3NGBB 4JO3H 1BOGB 2B0SL 1R24B 4CN1A 5I18H 4E42B 1C5DB 3ZDZE 4XPTH 4YHZH 1JPST 4JVWA 1N7ML 1L7TH 1T89A 3FFDA 2FO4B 1CN4A 4CUCA 5HYIA 4R3SA 1XIWA 1QSEB 5EOCH 5BVJA 5J89A 3MV9B 2EEDA 4EDXA 3H7BA 1JRHH 4U1KA 3D5OF 5DEFA 3EIFA 5C3TA 4AEHL 3E6FB 2FX8L 2BP3A 1KJ2B 1BFOA 1T80A 4CVUA 4P4KC 1H5BA 3VFWB 3WXVH 3ZLQC 1WFUA 1T6WA 4IIQC 1YMMA 3B4NA 2PXYD 5EZJA 5JHDA 1NKRA 1TETH 2CRZA 2YPLE 4Y16D 4MDIA 3NH7L 2F5AL 3TBVB 2I9LB 2X9XA 3QB7C 2D2OA 1LO4H 3GMRA 1A6ZB 5L2JA 3UTSA 4LASH 3RUGA 4P4RA 3HNTL 4J6RL 5IEHA 2V5RA 3O2VL 1RHHA 1JZ2A 3GSQA 1U0QA 3U7YL 3MCG1 1IEBB 3VXNA 4FXGA 1V7MH 4LU5L 5C0BE 2UY6A 3UPRB 5ISZA 4P23C 4PP1C 2P8PB 3DBXB 5JXAH 3ARUA 2N56A 3FOLB 4Z77A 4LRIC 3VFNA 5T1MA 5I1DA 4MAYB 3BGMB 1F6AB 2VIRB 2CUMA 5DYOB 3SDXA 4YHKL 3UBXB 4M61A 3PL6C 4QOKA 1Q72L 1V7NH 2E7MA 4R97C 4N1HB 4K7FA 2ITCA 2Z31D 4PJCF 4PJXF 2VDOL 4LAQL 1E4WH 3QPXH 4S1DD 3RDTA 5C09B 2XQYG 2Q6WA 5I1AA 4FFWD 1MCDA 1WUNT 2ADIA 2GUOA 4H5SA 3OX8B 3AFLA 3SGKC 4XXCA 3WIFB 3MTRA 4XT1C 3U30C 3MRGA 5LBSH 1U3HB 5AD0B 1U8LB 4DZBA 5EUKA 1DE4A 2JB5H 1A7RL 4XZUA 5DJ0B 3OTTA 2M8XA 3DI3B 2P5WD 3MLUL 4MCYA 3SQBA 4H26B 4P2OB 4IOFD 3S37L 3KPQA 1NUDA 1OAKL 4V1DE 4ZSOA 3WKML 2HH0L 3WJLA 4OV6F 3T2PA 3O8XD 4EVNA 3VH8A 1UA6H 4H25B 1XF3B 2HLFD 1W0YT 4RBPH 2ZUQC 4ZFFB 3HG1B 5F9DC 3FHAA 4MS8C 1H0DA 1T2JA 2W38A 2GJJA 3AS1A 2D7TH 1CU4H 5DO2D 1IGFL 1KTDB 5DFVD 3WIHH 5FHAH 2F54E 2J8OA 3TT3H 4Z7UE 3CVHL 3OXRA 3PE9A 3MUHL 4JZOB 4NFCA 4QYOB 1F8TL 4CJ1A 2VMFA 4D3CL 1HXYA 2EYTB 4GXUN 5I6XC 2CIIA 5IG7A 5KBNC 4ONHB 5GS0H 1Q9LB 2HMID 5TF1H 3ILQC 2AJSL 2CXKA 3WUWB 5KVGL 1RFDL 5FO8A 1MLCA 3IFPA 4XBPA 2ESVA 4NQXA 3UTOA 2E8YA 4NHUB 4XPBH 4QHLA 3NFPB 2AV7B 3QNZB 4KWUA 5JW4R 3FMGH 3ARED 4KKBC 3R0NA 2E5EA 5T3XE 1H3PH 2PTTB 4PRHB 1KN2H 4F8TA 2WMPA 1EFXD 1I3GH 2CMRL 3SGJC 2EEBA 5C86A 1A6UL 1NCBH 1Q9KA 2O93L 5C0AD 4DGIL 5E8NA 2BVQB 5CSBA 3MACH 1CLYH 3MLTA 2GITA 2NY4C 4HSQA 4PJBB 3LQAH 4OV5B 4I3SH 1J1OL 4OAWB 2DWEA 3BPLB 4IEFB 1E4XL 1KSRA 3L3DB 1XR9A 2DI9A 4ZPTB 1MRDH 4OCWH 5SX5K 5MEQA 1HCFX 1I7ZA 1BBJB 3ULVD 5JR1L 3GMMA 1VENA 3HC0B 2BZDA 1KJMB 4OQTA 1R3KB 3STZB 5IVXA 4UBDC 1AXIB 1MHHB 5IJKC 5EO1A 3D85D 2Y6SC 3V0VB 3BP5A 5FV2A 1I9RH 4HKBB 5A3ID 1MAML 4X6CB 1JHLL 3GM0A 3WFEH 2BVOB 1X7QA 3VXUD 1CS6A 3V5HB 5IJVA 3GMOB 3B5GA 3DUSB 2FEDC 3BZ4B 4G3YL 5IK3B 4RZCA 3P4OB 4LQFL 4RCAA 5GJTL 2VE6B 5HHOA 3O8XB 3CXHK 3VG9C 4EIZC 4FFZL 4QXWA 1DQLH 4PGZA 4WO4A 3UZQA 5A2KH 2AK4E 2Y5TA 1BZ7B 1BWWA 4LNRB 3OPZH 1CGSL 4JVUA 2X70A 4YHNA 3MLZH 3QFJA 4G6FB 1NEUA 1ZHKB 3AAZA 5IR1B 3B3IB 3TWCH 4D9LL 3G04A 1EHXA 3MXWL 3CLFH 5DK0A 1MJUH 4NRXA 2EE6A 3P9LA 5KTEH 3R06A 2VDQL 3ESVF 1F11A 3F58L 5IM7B 3WIIH 5CWSB 1M7DB 2X1XR 3SBWC 3D1MC 3L1OH 5ADPH 4BZ1H 3QP3A 2KH2B 4AYFA 3D0VB 3FQUB 3MGTB 3RBSA 5IMKA 3IDYC 2FLBT 2AKRB 4KMLB 3GSNL 4PJFF 4DVRL 2PO6C 4Z7NE 4L8CA 3ZKXC 2DQUL 4LLVB 2Z4QB 1WCBA 1OGAD 1WFOA 4PG2C 5D7LE 1RIHH 3VFMB 4TN9A 1ZA6B 4L8SC 4OD3H 1CQYA 1SMAA 1QR1A 2GTZB 5BV7C 3N9GL 1IRAY 4G7VH 4BH8B 3QO0B 4BFEA 3BWUC 1R5WA 5GGRY 5C07A 2DLFH 4H1LG 2NXZC 4JDVB 4QCIA 4EEEA 3A6BH 3STLB 2KQNA 1B0RA 2VLKB 4X4ZA 3ZSSA 4YGVB 2RFXA 5DJYA 1XH3A 4JREB 3KPRA 3HZMB 1UB6B 3QULA 1JTTA 4E41D 5FYKD 4Z7WA 1AGCB 3C5ZC 3D85B 4EI5A 4DN4H 1IGCL 2PR4L 5EOCJ 3MLSL 1KG0B 2PF6A 4R6UA 5ANME 3IKCA 3VXUB 1MWAA 2FL5B 4X6BA 5E24E 1TQBB 2FJHB 2OL3H 4DVBB 3CSBA 1GL4B 5C6TL 4NN7C 2VLJD 5HGHB 1J0ZA 5GRJL 3FB5A 1NCTA 1UC6A 4OIAA 1KNOB 2A9MH 1QVOA 4FQQB 2QSQA 2VITA 5F9OL 5CSZB 4OJFH 2PYED 3BXNB 1FCCA 1FVEB 4Q0XL 4RAVB 4ODHL 1A02N 1ZS8B 1AGBB 1N59A 1DLFL 3U0TA 2BSTA 4K71B 1MRFH 1W0VB 4HUUA 4OZHB 4NBYB 4IMKA 1GIGL 3QO1A 3V6BR 1BLNB 3A6OA 4M4RA 1QTYT 3LKRB 1T03H 3RWEB 2ATPB 1CFQA 5JORB 3PJSB 4PGEB 4GG8A 3PWPB 2GYSA 3VE0A 5E6IC 2YSSA 1CF8L 1S7TA 2D4DA 4K3JH 3LY6A 4ZNEE 4H0HB 4CVWA 2Q76A 4KHXL 1MHPH 1CGXA 4WU7B 1MI5A 4HBQA 4X9GA 4DKDC 1MELA 3PDDA 3O6LL 4MXWH 1TCMA 4XAWL 5GSVB 5GRWA 3SDCD 4OD1L 3U0WL 3QCTH 3IS0X 2AXGB 2CR6A 1UWGH 2MSPA 3RGVD 3QG6A 5FGCB 5EO0A 1OGAB 2GAZB 3A67H 5DRXB 3TZVB 4N5ED 4GUPA 5T33H 3SO3C 4POYA 2Y72A 4XBGB 5C0EB 4OIIL 5TQ0L 3G6JE 1EEZA 1FFQA 2CK0L 4GKSA 4U6VL 1DZBA 2XTJB 1OP3H 5C0IB 3G6DL 3BZFA 4MJ6A 5HHVL 3QA3B 3RRQA 1GGTA 3H42L 3BQUC 1C1EH 1Q38A 1A7OH 2FEEI 3WFHB 4TRPL 1TFHA 2BNUA 1BQHA 5BV7H 5SX4H 3MMEB 2X4SB 1EGJL 4AM0B 3PABA 5JHLL 3WN5A 4I0CC 4ZO8A 4TOYH 3X13B 3GK8L 3QQ4B 3DRTA 1NUGA 1GGBL 3MROB 4LCUB 2GSIA 4E41B 1RZ8B 4HKZA 1G9EA 3IAQA 5KSAA 2CRIA 1B0WA 2LQRA 2CRYA 4R96A 5IOPB 1QLEH 3EFDL 1AD0B 1RJZB 1B6UA 5FOJA 4D0BA 5ALCH 3TN0B 5T1DL 3SKJH 1YY8B 4LLQA 4KJYB 5F7EH 4OF6A 5DMYA 2M1KA 3QNYB 3VW3H 3G08B 3VWJC 1IC7L 3TO4C 1Z5LA 1AHWC 1R3JA 1MQKL 4W6YB 1KCSH 4YK4B 4HXAL 1NMAH 3VFGL 1OM3L 2ADFL 4G9DB 5C08E 5CHNA 5D5ME 5I8CA 2OQJA 5HGBB 1KC5L 4ZOBA 5BS0D 4DKFH 4KPHH 4JZNA 2X7LB 2NCMA 1QA9B 1YECH 2Z93B 1FYTB 4PJ7F 3DUUB 4OBSA 1YEKL 4F15C 5D2LF 2BC4A 3MFFA 5EU6D 3S35H 2EDWA 4ODTH 4PJBF 1KCRH 3CX5K 2XKUA 3KYOB 1Q0XH 2HWZL 4PJHF 2FNBA 4OM0L 1JFQL 3T4YA 1DQJA 1I8KB 2C4FU 3SDCB 4OZIE 3QXUA 2BOCB 2NLJB 4PG9B 5E6ZA 2X4NA 1SEQL 2WIMA 5LXGH 43C9B 2XZCL 5JHDE 5IMOB 1EMTL 2LFGA 3SE4A 5CZXD 1XZ0B 1NMCC 1QP1A 3QUXD 5IBUG 4HLJA 5LQBH 4DAGL 3OB8A 3RWGB 4IJ3C 1J88A 5L8JB 5K9OB 3TBYB 1NGZA 2IBGA 5F6IB 3BRGC 4IRSC 5DHYB 3V0AC 3NFNA 2AXHA 1IE5A 4ZUUA 4YO0B 3EJYC 1Q9WA 3IXAA 5GRXG 4HIEA 4RA0C 2WAHA 5FO9A 4ZFOL 4TUJB 2BCKA 5L88H 4UINL 5I1IH 3VD7A 4Y89A 5DQ9A 1QLFA 5GGVL 1XF5A 4YC2C 2VXVH 1LMKA 3ZYJA 5EIIA 5E4IA 4HD9A 5BOZG 1EX0A 3IAPA 2OJZL 4LKXA 1OT2A 2B4CH 1I1AD 4R7DA 3G6AB 5JDJA 1CG9B 3OR6B 2BVTA 2MCPL 1HNFA 3I84A 2JIXD 4K94L 4DTGL 5E70A 5IF0A 3VGBA 1TJIH 3LKSB 5CBEA 3D39A 3RY6C 4S1RL 2JCCB 4OKVB 3EDFA 5C92A 2QQKH 2VR4A 3NCMA 3SKOB 3HUJA 2DKUA 2I26N 3ZHLA 3KJ6H 2C1OA 3HE7D 4XX1E 2SEBA 3SJVD 3T1FA 3CXDL 2J6EL 3T3ME 2APFA 5TDOB 3VGGA 5BS0B 3ES6B 4PJ9C 5FA4A 3V4UH 4CMMA 4PRPA 1MCPH 3T2OA 3QUKB 4FN0A 2JJWA 1MH5B 4M62H 4N1EA 1HI6B 5EU6B 3OAZK 1TVDA 3TN0D 3KLHD 4HWBH 5F72S 4ZQKB 4XPHH 2ZKHH 3P77A 4WUUA 1OAUH 2HFTA 3ZKND 1MVUA 1YEHH 1TPXB 4OZGB 1F90L 2W07A 2FHFA 3D25B 4BSVB 3ULVF 5JW3L 4YDLB 1CBVL 1OT1A 3LRSA 2ICWJ 3OAYK 4H20L 2DN7A 4RGOH 4WEMB 4KI5C 2FBJH 4QT5A 1J5OL 5GGRB 2IAND 4KXZI 2AK1L 4GLRI 1DP0A 3SGJA 4CNIB 3IDXH 1AFVH 4X7EC 2IFFL 3ARBC 3QUXB 1T20A 2YXMA 5EOQL 4OFPA 5ICXA 4BSWA 1S5IL 4CU6A 1OY3B 4ELME 1YNKH 4EOWH 4F7EB 1RY7B 1UQSA 1UKSA 3WDIA 4K7PY 2WINB 4F7MA 5FHBL 4PRIA 4MQTB 5IQ9B 5F7WC 3E8UL 4HKJA 4FQ2L 2ITDB 4JHAL 1HQ4A 4EN3A 3VXMD 1BREA 1R3LB 2ESVE 2VKXA 4HGWA 5IB2A 4HC1L 4MD0B 3TNMA 4XP1L 4PLNC 1YY9C 1Y18A 1KB5L 4HV8A 4QEGA 5DJAA 4GS7B 5DRWB 5INDB 4GRLD 4N8CH 2VDPH 4OZHF 2FECI 2XZAH 2NMSA 2BFVL 1PVHA 2C3HA 3HRZB 1N64L 3S96B 1PAMA 2X1WL 3QG7L 5B39G 2X10A 1MAKA 4O4YH 3C5JA 4N90D 3BIBX 1X4YA 1C7SA 3BX7C 5DF0A 1VKXB 4NRYB 5IB5A 4NUJA 4LHUA 1I8LC 1NAMH 4W81A 3QUMB 2XZQL 4CU7A 3TIEB 4AK1A 2A9NL 5J1AB 4F2MB 1RZKH 3RIFK 4X7TB 2DLHA 4GG6B 2FR4A 5KS9E 2IALB 2F8VA 5KVEL 3PGDB 3HE7B 2CDFB 1BFVL 3BT2H 1K8DB 3BP6A 3RWCA 5HBBA 4G6JH 4YHOH 1KTKE 2W0KA 1FL3B 3AUVA 1T0MB 3ULUF 2R1WB 5EUOF 2XWBA 1ZT1A 3U46B 3O4LD 4JG1H 3VXTB 3ZT5A 2PCPB 3UC0L 4I0PA 4QXGL 1EHLL 2FJGA 3V5KA 5BXFB 3C6LA 5F1IB 1U36A 4L9LB 3ZKQD 1CLOL 2GHWB 5B8CB 5DA0B 4X4YB 4LSVH 5J3HC 1I4FB 2OI9B 1DANT 1DQML 4JLRA 1SYSA 1QSFD 1SY6L 4X99B 3L95B 4G80B 2N7BA 3QXWA 1FFPA 4OCXH 4PG2A 4UZGA 2X9WA 2YPKA 4ODUB 3QFJE 5SWSD 2A74A 1HILA 4ZFZA 3GMNA 4L8SA 3T3PE 4PR5B 2VJXA 1KFAH 2AS5M 1QYGH 2IANB 3LEYL 5GS2H 1XGUB 4FZ8L 2ZUSA 2VDRH 1Q1JL 4XWGL 3X12A 4WI3A 5D1XA 3CFCL 5HYSG 5MEOA 1MREH 1P7QB 2V2WB 3L9RB 3OKDB 5DEGB 4XP6L 3U48A 2E7LC 4QRRB 2JB6A 5C6WH 3RVTD 4OLUH 4G6MH 1FPTL 3QUZB 1WAAA 3NACH 4AH2A 1XF4A 5GS0D 1QQDB 4Z7QF 2BDNH 1R3IL 3FO0H 4YFDB 4ESKA 2F5BL 4L9DA 5I17B 1INDL 3FFCD 3QIUA 2VXUH 3EYVA 2Y7QA 3GRWA 4FABL 1ND0B 1NSNL 2YXFA 5ID1B 2IG2H 2R69H 1TVHA 2WUBL 1MNUH 2J2ZA 3E2HC 3G5ZB 1U6AL 4IRJD 1FFNA 3I9GH 3O9WC 2CLZA 1A22B 1FL5A 5DTFB 1CD9B 4R4NC 1R3HB 5DD5H 3ALXA 4KJQD 4YXKH 1FGNH 5EU4A 3SCMD 4Z7VA 2E27L 4J8RA 5L8KB 2AXJA 3RZCD 1LEIB 3P0VL 5CEYA 1P7HL 3LH2H 1RZJL 3F7VB 3K81A 4PB9L 4RGMB 5DI8B 4FNLL 3HR5B 3HAEG 1LO3L 1OTSC 3CZJA 3GSNB 1EO8H 5F6HJ 3T0EE 1HYSD 1D9KD 2VZUA 1LK2A 3CFBA 5SWQB 3O3DB 2CJUL 4IDJH 2KPNA 2VC2L 1A6AA 5CJ5A 5E8DL 4D0DB 1BAFL 4OCNC 5EG6C 4A6YA 2UWEB 1L0XA 1ITCA 3O4LB 4I18A 4JY5H 1KEGL 4FMFA 3GO1L 1U9KA 2YC1A 4LSUH 1A2YA 3OKOB 3BKJL 2VUOA 3G5VA 2Y36H 3MRRA 2MTPA 4QHNA 4U0RB 4MNGA 1A4JA 2ADJA 1P9MC 4WI2A 1FIGL 4Z76B 4WIQA 1PJ9A 5D7SL 3V52L 3GHEH 4Y5VB 2R0LL 3WNMA 3HNSL 1A6TA 3OXSB 5HI4D 5DJCB 4DUXA 4O2FB 5E8EB 3FHQA 2F58L 3QIWA 4OGXH 3MO1A 5TFSH 4JG0L 4UB0L 5H94B 5SWSB 5FK9B 1T66D 3O6FC 3PV7A 1T2QL 2R4SH 5IGXL 5TDNB 5F1KC 4WW2A 4ENED 4M5ZL 4Y4FB 2XKNB 2V6HA 4GAYB 5GRUL 4MB5A 32C2B 3K3QA 4WTZA 4R7NB 4R4BB 3ZL4L 1KLGA 3S88H 2ZWLT 4NO2B 4JKKA 4Q9RH 4ZXBD 3T2NH 2P46B 4FMKA 1UB5A 4LNVA 1XGTB 1IM9B 4NNXB 4BUHA 5FUOL 1U8MB 4O02L 4Y4HD 1KULA 3WE6B 2JCCF 3GSOB 3PGCA 2CLRA 2VDMH 3QXAA 3K46A 1KLUA 1B6DA 3UJIL 1T5XA 2BXZA 3N1QC 5I1GL 1N0XL 3IF1A 1TJHH 4EUPB 4KDVA 1PYWB 1A3LH 4I2XB 2X1PA 3T0EC 3SPVA 3C60B 5FECB 1QO3B 3GSWB 4AEIH 4GW4A 5JPNA 1OPGH 4GMTL 1RULH 1P4LB 3MYZA 4P5MA 2AXFA 4I77L 4QRPD 3MBXL 3VI4E 4WFHE 5A16A 1H3GA 3MRLA 3RTQC 3VXPB 3MA7A 4OQTH 2P5ED 4O58L 5E4EB 5I76B 1P69B 1CGYA 1SYVB 3QHTC 5MENB 2GIYA 5K93A 3HMXA 4YQXL 1GGIH 3TA3A 5KVFH 2OR9H 3WFDH 4HPYH 4F58H 3BZEB 1HXMB 2CKBA 2AEQL 3EYSL 4L3CA 4JO2L 1D9KB 1ZLVH 1CT8A 5CD3A 4E5XA 4M7JL 5SWZB 3TVMD 4AZ8A 5M7QA 4HZLA 1IC4L 2CH8A 5FYKL 2IBZY 4H8WL 5C0NC 4PLJD 4H0IA 2HTLC 4Z95L 2HVJA 2ATKB 4KQ3H 2R56H 2UZIL 4U6HA 1WWBX 3JZ7A 4PJCA 4L29A 3HPLA 3SE3A 1IFHL 1RJLB 4P3DA 2F54D 2MNUA 4MA1B 1J0KA 5IVZA 3WL9B 3MJ8A 4PGCA 5FDWA 3FQXB 3CFIC 8FABB 5EPMB 2C3VA 1A1MB 1S9WA 3ORJA 4NIKB 4F3FB 5B38G 2BY0A 1UVQB 1WBXA 1RK0B 3WEXB 2ZPKL 1UXSB 5GGQL 3D48R 4G6AD 4U1NA 2LABA 5KANI 5DUBA 1MCSA 3LMJL 4IRSA 1MFEL 3TBSA 4PLKD 5GGTL 4Z18A 3IJSA 3KXFA 3P73B 4LHQB 1K5NB 2E6QA 1WVZA 2H26B 2DQTH 3DMMD 3EOBA 5JOPE 2NY5H 5BRZB 5TPWH 3H0TB 2ZSVB 4NQDE 4GG6F 1I1RA 1T3FB 2YEZA 4IHOA 4M1DH 2HT2C 5GRVK 1ONQA 3ARDC 2VL5A 1MRCL 2AVGA 1A0QL 5DZLA 4LPVA 2WLZA 4MJ5A 5CJOL 3BUYA 4JFHE 4EQ3A 2EDRA 1MFCH 3BKCL 1ZWIA 5FA3A 3DX9A 3JWDH 2DI7A 2VAAA 1FO0A 3DETC 5DUML 1ZK9A 3JXAA 3MGAA 1QKZH 4R4FH 3QH3B 4NO5B 1IAII 1ZMYA 3DGGB 5DQJB 1ZVHA 4M6MH 4LLMA 5CEZE 4KUZL 3FRUA 4TSAL 1A6VH 1VPOH 3QI9B 1JGDB 4R2GB 1Z9SA 3B43A 4JR9L 1RZ7H 5C2UB 3BHBA 4NQCA 2Z92B 5D72L 3RQ3A 5DVNA 2EIDA 1RMFH 4HH9A 3TVMB 4KRLB 4HF5L 3LQZA 2IAMC 4ISVB 4OCSH 4JB9H 3HMWL 4ODBD 3GKWL 3WS6C 3ROLA 5C3LD 5HI5C 1YJDL 3MREB 2XT1B 3VD5A 3HC3L 2NY2D 3O3EB 2HTKC 1IGYB 3W0WE 4CADB 2NNAA 4X6FA 1QRNB 3TJHC 2FH6A 2DLIA 2XFXA 2WP3O 1WISA 3PWUB 4BK4A 3D39E 2HAZA 1F02I 4Y5YC 3SE8L 4N0UE 1X5ZA 3OHXA 2H6PB 4Y1AB 3MUJA 5F3BA 4WHTB 5L6YL 4PJ8B 3RGHA 1T21A 5C0CD 5FKAA 1CICD 1K4CB 2X4UB 4P5TA 3FQWB 1CFTA 3RVUD 3KPSD 2HJKA 5DHVH 1MFBH 2E9IA 1RI8A 5JQHC 3C8KB 1S9XA 3LRHA 1V8HA 4TNVF 4K2UL 1YQVL 3SE9L 1ZXQA 1JZ4A 5I73C 4CBPA 1AR1D 1JNHA 5DQDL 4PBWD 3GI8H 4PJIE 4XTRC 5GRVL 2W65A 5CIPA 1AI1L 2V17H 1J8HB 2LU4A 2YD9A 2R23B 2EECA 3BGFB 5FUZH 1G1YA 4GKZA 5A2JH 4OI8A 3OKYA 1CXHA 4MSWA 3KDMB 1GGUA 2J8UE 1BX2A 4U3XA 2UWEF 5DJ6A 1FE8L 4QNPF 1KIRB 3RX7A 1IT9H 2R0KL 1CK0H 5GZND 2H32A 2OMBA 3D6GA 4HPOL 3W9EB 4GFTB 35C8L 1VFAB 2G5BA 4J1UA 1S7RB 3B83A 3RU8H 4ORGA 2APWA 4PJFA 5B3JF 2ICEB 4I3RL 4PLOB 3HAEA 4GRWF 3O45A 2VB5A 3ARGD 1PKQB 3U9PL 1QPPA 1HIMH 1EAPA 4HFWB 1BOGA 1MJ8H 5C0RL 2J4WL 1R24A 4J3SA 3LS5H 4E42A 3S4SB 5F21B 5HHME 5CS7A 4RISL 2NY2B 4KJWD 5TDPB 3MRHB 4BFBD 2IH3B 3PV6B 2FO4A 1GGCL 4HIIB 4FQHB 1QSEA 4XCYB 4ODVL 4Q6YA 2CIKB 3MV9A 4I4WB 3UTQB 1HSBA 3E6FA 3SDDC 5HYJE 1KJ2A 1TQCB 2VISB 5KVMC 1RUPL 3VFWA 1DVFC 1EPFA 2R29H 2XA8H 2W1NA 1LE9A 2Q1EA 1CICB 4Y4KB 1NCDH 4FOMA 3U83A 4ONFL 1F4YH 3LIZH 2Y07H 3L5IA 4JO3L 4RFNB 4HG4J 4W6XB 3TBVA 3IDUA 3F7QA 3QUYD 2I9LA 5I18L 5DFTA 2WLYA 4XPTL 5BCAA 4YHZL 3RFZC 1A6ZA 2RIKA 3T0DA 4MXQC 3QIBC 4FXLA 2HJFA 4WV1C 1L7TL 3BYTA 2V7HB 1AIFB 3GSUB 5EOCL 2FLRT 2FX7H 2E9JA 1IEBA 1JRHL 4WFEE 1A8JH 4XNZC 3UPRA 1BJMA 5JW4Q 3RVVD 3UPAA 1C16B 2PYFA 4RMVA 4L8DB 2P8PA 1NFDB 1KXQE 3RHWK 3WXVL 3DBXA 3BIKB 4PBVC 4RBPK 4ZUSB 3FOLA 3BUTA 1PQZB 3BKYH 1DANU 4YHLH 4MAYA 1H8NA 3BGMA 1F6AA 3PWVB 2VIRA 1FNFA 5CEZH 5DYOA 3KWWB 3UBXA 3T65B 4RGND 1N6VA 1LO4L 4LASL 4PTUB 3B8YA 4ZUWB 3QHZH 3U79A 1JBJA 3HB3D 4QRSB 1X5GA 4RDQF 3OX8A 1SJHB 3MRCA 5IIEB 3T0XA 3WIFA 4WHYH 1V7ML 1T83C 4OCMC 2XG5A 5AD0A 1HN1A 1U8LA 4RQQB 4U1MB 1GYAA 1DQDH 1HEZB 1OVZA 2DQEH 3ARGB 4APQD 1S7QB 5JXAL 4WI5A 4OQ1A 1MCEA 5DJ0A 2A77H 3MNVB 5CINH 4H26A 4KXZH 4GLRH 1ORSA 4P2OA 1PW3A 2CQVA 1JTOA 2ZUXA 2EDBA 4MJID 1V7NL 1I85A 3B9KC 4GAJH 1CTNA 3UTPE 1MJ7H 3UBXI 1E4WL 2RHEA 3QPXL 4H25A 3BRFA 3ABZA 4POZC 1BHGA 15C8H 3PP4H 4ZFFA 3ARVA 3HG1A 5ITFB 2WV3A 3FB8B 1JGUH 3LEVH 2O5XH 2J5LC 3ARQA 4Z78B 3FCTA 3O6FA 4MD4B 1KTDA 5F9JA 2Q7YB 5LBSL 2MKLC 3VCLB 1XIWD 1KT2B 2JB5L 1Z0NA 4JZOA 3C08H 1F6LL 3TBTB 3L3IB 3QUYB 2NY0D 1NMBL 5EC1B 2EYTA 12E8H 4ONHA 1JJUA 1Q9LA 2ZNWA 1YMMD 2Q7NA 4F7CA 3WUWA 5IWLC 1UA6L 2MQ0A 3ARFB 1JWUB 5HDBE 4JKWA 4JQVC 3UAJC 4DFIA 2GJ6D 2AV7A 3I75B 3NFPA 2MOVA 3QNZA 2CRMA 2D7TL 3UTSD 1CU4L 3WIHL 2C1PB 5GS2D 5FHAL 3S34H 4PRHA 4AQ1B 3TT3L 4R0LC 1N5AB 4PJ7A 1WWCA 3NN8A 4OLWH 4PREB 1JZ8A 5EA0H 2BVQA 1MY7A 4H88H 4ZAKC 3JSSA 3VWKC 5J0BA 4JCMA 1IVLA 5IKCB 3NCBB 3ECBB 4PJBA 4OV5A 4RGNB 5ISZD 4J3XA 2WWKT 2FX9H 1JVKA 2DLEA 3JTSB 4PJHA 5KAQG 1BBJA 3WHXB 1TITA 5GS0L 5TF1L 5IW6B 2H9GB 3HC0A 4WGVB 2GY5A 1KJMA 4AIXA 4QOKD 3STZA 1MHHA 4XPBL 1ZHLB 3V0VA 1IEAB 1GAFH 4F9LC 3AS0A 2COQA 3FMGL 3PHQB 5T5FH 4APQB 1ZGLP 1S7UB 5HPMB 4F33B 3PWNB 4JFDA 3GJFK 1H3PL 4X6DF 1KN2L 5D8JH 1C7TA 1I3GL 3OF6A 3VRLE 4KROC 2H2SC 1NCBL 4OLZH 1YC8A 3V5HA 2X44D 3MACL 3TT1H 3DUSA 4HWUA 1CLYL 2V5YA 3BZ4A 3BP7B 3MCKA 3P4OA 1ZT4A 3LQAL 2VE6A 1OQXA 4FQXB 4I3SL 1ZVSA 4LVOB 3DXAB 3QDJB 1MRDL 4OCWL 4EKXA 5C0FB 3P30H 2IQ9H 2NTSP 1MCHA 3QQ9D 3Q6FB 4LNRA 3AM8C 4JFZH 1A3QA 3QRFM 4HHAA 4L4TB 4YZFF 1XT5A 5DVLA 2OXGA 2Z8WC 4PJAB 1I9RL 3B3IA 5EO9B 2QR0A 4LSDA 3H7BB 3W39A 3WFEL 1FRGH 1F42A 4PJCE 1MCCA 2PNDA 3X3FH 3BEVB 5EZOH 5IFAH 4TNWK 3H9SB 4OZ4A 2Y9RT 4JM2B 5CWSA 4NCC1 1M7DA 4M03A 1KV3A 1AJ7H 1DEEB 5HY9B 3D0VA 3FQUA 3MGTA 1JGEA 2VZSA 1I7TB 4LQ1A 2AKRA 1LP9B 1DQLL 4MDIB 2GJ6B 4LLVA 2Z4QA 2NR6D 5HGAB 3OPZL 3UTSB 3VFMA 4LMQE 1ZA6A 3DO3A 5A43C 3MLZL 4Q6IB 2GTZA 5DJDB 3AU1A 3TWCL 4BH8A 3QO0A 4LK4A 4KQ4H 3CLFL 2ICCA 5KSVB 1MJUL 4MA7H 1KIPB 1NGWB 4JDVA 3GRWH 5KTEL 3LVEA 2OLDA 3STLA 3UTTE 2VLKA 4CGTA 3QPQD 3VMPA 4YBLB 1OARH 2V5SA 3VXQB 3WIIL 3BSZH 5I9QB 5ADPL 3L1OL 3DWTA 4BZ1L 3VFNB 2H2PD 1KEMH 1WZMA 3HZMA 4LPUA 1UB6A 4M61B 4QOKB 5AYUH 1AGCA 4JKPH 5FM5M 3PG2A 2ITCB 3S5LG 4FQIH 1RIHL 4NC1E 4OD3L 3LEXB 1V3KA 3VXUA 2ADIB 4H5SB 3WO4B 3VG0H 3L7FB 4G7VL 2FL5A 2WQ8A 2DBLH 5GZOC 4DVBA 2DLFL 2F53E 4NQED 5CGYC 1CFNB 1CLCA 3A6BL 3EYOB 2IMNA 4FQQA 4WI7A 4A6YH 2D0HA 5CSZA 2D3VA 3BXNA 4RAVA 1H3UA 1UM4H 2LTQB 3S36X 1AGBA 4MCYB 4FTVA 1MCKA 4FA8A 4S1SH 1W0VA 4OZHA 4PTTA 1GCFA 1XCQA 3DX6B 3FQRB 4OI7A 1BLNA 3U4AA 5HHOD 4DN4L 3LKRA 4GBXC 4PGJA 2QADC 3BDBA 2ATPA 1J1PH 3I6KB 3RWEA 5JORA 3PJSA 4WO4D 4UV4H 4PGEA 3SHSA 3PWPA 2NX5B 2O26U 4KRPB 4AT6B 4NT6B 4ETYA 5IHZB 2OL3L 5ENWB 5D1QC 3WMSA 4WU7A 3BZDA 2A9ML 1M6OB 5GSVA 4OJFL 1PZUB 2AXGA 4X8JB 4X8XA 4XVTH 1KYOK 1NAKH 1VHPA 1KCUL 3MLRH 4NRZB 1WZ1H 2GAZA 1MFAH 1MRFL 5DRXA 5DJ2A 3TZVA 5EUOA 3OKNB 4XBGA 4HK0B 5IG7B 3HE6B 2E9WA 1H3TA 3ISWA 3KNBB 3P4MA 1T03L 4WENB 5C0IA 3GKZA 3QA3A 3VXSA 5L7XH 3DECA 5GRYA 1QHOA 2ZUTA 2NXYD 4MXVF 4K3JL 3HZYB 3L3HA 4ZG1A 3EJJX 5IMLB 3NCEB 3MMEA 2X4SA 1MHPL 3SGDI 4PYHA 1UM6H 4MXWL 4KFZC 3X13A 4HS8H 4PRNA 3REVB 3QCTL 3QQ4A 4KI1A 5C07D 4LCUA 3MROA 3PIQB 2K3TA 1UWGL 1RZ8A 2D03H 2GITB 4OGAC 1CR9H 4S2SB 3A67L 3WS3B 2DWEB 1NFIB 5EN2A 5ITBL 5T33L 5EWIH 5IOPA 5F96H 2NY3D 3HMXH 1AD0A 3BN3B 1E4JA 1RJZA 2DQGH 3CZFB 5KN5A 2BNQB 1YY8A 1D5BB 3KPRD 1B9ZA 2CKBH 4KJYA 5EU3B 3QNYA 3N85H 3G08A 2X42A 5IVXB 5AAWA 4NQEB 1Y6MR 3UTZB 4EI5D 1C1EL 1SJVA 1A7OL 4G9FB 3SKMB 5BV7L 4YIQB 2ID5A 4LCCB 4JFEB 4G9DA 2YWYA 4TOYL 1ZT7B 3U7AA 4PRBB 5HGBA 4G8GB 1RURH 1NQBA 1ODAA 2X7LA 1QA9A 1MPAH 5L9DH 1XMWA 3AMLA 1FYTA 2D9QB 3DUUA 1JWMB 4ODXB 4F57H 4O2CB 1QLEL 1K6QH 4UDTB 4MNQD 4WO4B 5FXCH 4KV5F 2DD8H 1CFBA 1Q0YH 3IS1X 4YFLF 5ALCL 2R4RH 3LSOB 3QQ3B 2DM7A 3MV9E 1OTUC 5MP6H 3KYOA 2FRGP 3SKJL 4HIJB 5F7EL 1MCWW 4MJ4A 3VW3L 3MV8E 5HHXH 1I8KA 2AJVH 1KCSL 1NMAL 4U7SA 5J13C 3SDCA 5FIEA 4P46C 5C8JB 1KTLB 2EZ0C 2NLJA 4PG9A 3MR9B 3MRBB 4EXPX 43C9A 4OCRH 3P9LB 3GMQB 5I8EA 5IMOA 4AJ0A 4EI6A 4DKFL 4KPHL 4NO0B 3FZUD 4V2CB 3RWGA 1CDGA 1YECL 4M1CC 2RCSH 1MI5D 1F3JA 2XPGB 3NZHH 3MYJB 3TBYA 5DHYA 1G6VK 3ZYZA 5IMKB 4CMHB 4YO0A 3P2TA 2GJZB 2KUTA 3S35L 3QEQA 4ODTL 2NXYB 1KCRL 4WFFE 1IQWH 2VRAA 1EVTC 2HJLB 1Q0XL 4JGMA 1T7WA 4TUJA 1GGYA 1EV2E 2OS7A 2OTUB 3QDME 1U8PB 1I7RA 1R5WB 4Q9CA 1A64A 1FO0H 1EAJA 3RPKA 4Y19E 3MXVH 5LXGL 2UYLB 4QCIB 2Y06H 5IHLB 4PJAF 3VDAA 4LSRH 1WJ3A 1UG9A 2YRPA 5HD8D 5KZCB 5KJRH 2NY3B 5LQBL 5BMFH 2W0PA 3D3VB 4HJ0C 1HQRB 2R9HC 3G6AA 1CG9A 3OR6A 1JPFB 1UYWH 4GRMB 3MLPA 5CP3A 4F9PC 5C09E 3EHBD 1R0AH 4JM2F 5F71A 1I8MB 3QXVA 5DFWH 5HVGB 5DGRA 1MCOH 5KSAD 2JCCA 4JQXC 3NPSB 4OKVA 4NQVB 1N6UA 3AB0B 5GS1C 5E00A 3SKOA 1JF5A 5FYKU 1LP9F 5L88L 5I1IL 1NGXB 1MWAB 2VXVL 4CDGC 4NUGH 5TDOA 5HSFA 4Y5XC 3ES6A 3T8XA 1HINH 3QUKA 1FL6B 5HVHC 4C56B 4YHYC 2XRAH 5GGUB 1MH5A 4WTWA 1WBYA 3TPKA 1HI6A 1TVBB 3BYYA 5EU6A 2C7UA 2B4CL 4BUGA 4MNQB 4Y2DB 2VSDA 4ZQKA 1LQSR 4NYLA 5ECJE 1WF5A 5ERWA 1RQ5A 3QO1B 1OLLA 4OZGA 2MKWA 1TJIL 3D25A 4BSVA 3JUYA 1L9MA 2XN9A 2QQKL 1D6EA 4JHWH 5E9DB 1RSFA 3KJ6L 5GGRA 5JZ7D 3BN9C 4CNIA 5C6PB 1WWAX 2CXGA 4R0LA 4NFDA 3DARA 4Q97A 5A2LH 3VMNA 2R2HA 3VWKA 3V4UL 1MCPL 4XWOC 2DKMA 1MI5B 4BH7B 5FB8B 4EQ2A 2WINA 2CLVB 4M62L 1XGYH 3QAZC 4JANB 1HKLH 5IQ9A 3TV3H 5F3HB 4PYGA 4XPHL 2ITDA 1KELH 3EZ8A 2ZKHL 3U2SA 1OAUL 1T1XA 5JPMB 4GUPB 1YEHL 1VGKA 3IFNH 2D7PA 3AROA 4MD0A 5INDA 4GKSB 1D5IH 1YYMH 3BZFB 3BP4B 1ERNA 4RGOL 2FBJL 1AC6A 1YNTB 3HRZA 4YE4H 1CD1B 2DBJA 1AFVL 3IDXL 3S96A 2BNUB 3C8HA 1BQHB 1YNKL 4EOWL 5FFLA 4NN6C 2DIAA 3PABB 1VKXA 3DGCR 4NRYA 4ZTPH 3MUGA 5ETUB 4LL9A 2NY1D 2R2CA 3HAEH 4JPKH 2AJXH 3QUMA 3TIEA 2BVYA 5J1AA 4X7TA 3W9DA 4GG6A 4PJGB 4Q58C 2IALA 4G6KH 5ILTH 3PGDA 4LVEA 3CNKA 2CDFA 1JP5A 3KJ4C 1K8DA 4D0BB 4N8CL 4X6CE 1FL3A 1Z3GH 1T0MA 2VDPL 1EDQA 4LLQB 2R1WA 3O0RH 2XZAL 3VXTA 2RB8A 4JRYB 4L8BB 2P5WE 3AVEA 1DQQB 3UYPA 1RZGA 2PXYC 3JVGC 3K8KA 4KDTA 1C12A 1FP5A 4P4KB 5BXFA 5F1IA 4O4YL 3QXDB 3Q5TA 4Y16C 2BK8A 3DTXB 4K9EH 3QEGH 1NL0H 4X4YA 1NAML 4YHMH 4JZNB 1I4FA 4PRPD 3ZKMD 5L2KB 3NABH 4NBZB 4X99A 1RZKL 3L95A 4L4VD 1VFBB 2VL4A 1JI2A 4X7CC 4BKLB 4PJ5B 3IJYB 4ODUA 1E6JH 4PR5A 3BT2L 4G6JL 4YHOL 1U91B 5GISL 1XGUA 4UNTA 4MMXC 4WUUD 1GC1C 1KENH 3QDGA 1F45A 2IWGA 4JG1L 1A6WH 1P7QA 1WTLA 2V2WA 3L9RA 3OKDA 4HFUH 5DEGA 3N1MC 3RPIB 3T4YB 5JW5A 4N8VB 5I15H 1FORH 4QRRA 1MCFA 5JW4N 4C58B 4P23B 1JWSB 1AO7B 4ZFGH 4KKBD 5FCUH 4YEFA 1C5BH 1DLHB 3QUZA 1IMHC 1QQDA 2Z31C 4S1DC 4LSVL 4ZOAA 5I17A 5CUSH 4FFWC 4XB7A 2YOCA 3PL6B 4URTB 4WY7H 2W91A 5E1HB 2EDQA 3NFNB 1ND0A 4OCXL 1YQ2A 2AQ2A 5ID1A 4M7LH 4PRID 3NCJH 2R1YB 3G5ZA 1H3XA 2OZ4A 1KFAL 1QYGL 5IP4A 5C0AE 1JHTB 1P7KB 4K7PX 1M71B 2VDRL 3FB6B 5FO9B 5FGBC 1N2RA 1R3HA 1MREL 3RWJA 1WZLA 4XVJH 4JGJA 1F58H 2UZXB 3U30B 2DTMH 5DQ9B 4XP9H 1SQ2N 3SDAC 2NY1B 1LEIA 4OLUL 1ZLSH 1Y6NR 2IJ0C 4G6ML 3MODH 2ZUVA 2WUCH 3ULVE 3NACL 5DI8A 2ORBH 3O8XC 3INUH 2BDNL 3FO0L 1N5YH 3GSNA 2HLFC 4ZS7H 5HI3D 3V95A 4KKAC 5J9PB 2YBRA 3MRJB 2FEDD 2VXUL 5SWQA 3O3DA 1IBGH 3LB6D 4R7DB 5HHNA 4D0DA 2YHGA 4LHUD 1S7VB 4U1GC 1IEHA 2IG2L 5DO2C 4XHQA 2R69L 5FCSH 2UWEA 5DFVC 1MNUL 1UEYA 3O4LA 2BRRH 5E95B 3VXUE 4B53A 3I9GL 3OKOA 5CBEB 4LPTA 5DVMA 2JE8A 4XMLH 5DD5L 4YXKL 1FGNL 4D9RD 1U58B 1JL8A 5C0BB 4U7MA 2HVKB 4Y5VA 4YXLH 2XYCA 1WFTA 4QRUA 4X9HA 5J6HB 3LH2L 3AS3A 4PRPB 3OXSA 3N50A 2QSTA 3Q3GB 5L8LB 2HMIC 5ADOH 1AXSB 4O2FA 5CJQH 5E8EA 5K9QG 1HDMA 4KMTH 4L4VB 4QWWD 4BQCA 4UOJA 1EO8L 3C6LD 4YHIB 5H94A 1FN4B 5SWSA 4YWGH 3VGAC 3QWQB 1JHKH 4IDJL 4MX7A 4QLRA 5I6XB 5AG9A 5TDNA 2BOBB 3F12B 3AREC 1ES0A 4WDIB 1EZVY 3OZ9H 4N0FB 4Y4FA 4GAYA 1MVUB 4JY5L 32C2A 3CGTA 4R7NA 5F7NC 4LSUL 1SVCP 3R8QA 4R4BA 3BKMH 3GUTA 2OBGA 4ONGH 2Y36L 4MQSB 4NO2A 4GXUM 2BY3A 4YXHH 5JOEA 1MY5A 1LD9B 3ARPA 1H15B 1XGTA 4LFHD 1IM9A 4M02A 1GC1H 4JAMB 4NNXA 1U8MA 2GFBB 3WE6A 4HAGA 3GSOA 1RZJC 2HKHH 4DKEH 3GHEL 5D1XD 4JJ5B 1RZIB 4BSWB 2V5TA 5FGCE 3B9VA 1OGAE 2NXZD 2NY4B 4EUPA 1PLGH 4JREC 4OGXL 3C87A 5TFSL 1PYWA 4I2XA 2DWDA 4P2QD 5FECA 3C60A 2R4SL 2VR9A 2LU7A 2XTJE 1PEZA 4V1DB 1K2DB 4J12A 5A3IC 1P4LA 2CR3A 3QIUD 3L5XH 4Y88A 1BZQK 4N0CD 1Y18B 3QRGH 1TZIA 1QHPA 3S88L 3NOIA 2IC2A 3WHE0 5I76A 1J8KA 1JPSH 4UNUA 4Q9RL 3T2NL 1SYVA 2EEAA 3GSRB 3U1SH 5MENA 2EDXA 2VDML 4Z7UB 1FNHA 1RK1B 5BW7C 1HXMA 5F7MC 4E41E 1T7XA 2EYRB 5B4MC 4WNQB 1DBAH 1ETZB 1TJHL 5GJSH 5SWZA 1N0LA 3OKKA 5IB5B 4LHUB 1YNLH 5F89B 1HHIA 1A3LL 3VG9B 1MCNA 3OAYH 1AR2A 3M1BB 1JPTH 2CDGB 4AEIL 1OPGL 2ATKA 1KB9K 1RULL 3NIFF 3NTCH 4OUOA 2FR4B 1OLZA 2XICA 3O2DA 4LCIH 5D6DA 1HOCB 1RUMH 3ET9F 1S7XB 1NC4B 4OQTL 5EDXA 1I3RA 2PYEE 2XWBB 4GXVH 1NCCH 3CH1B 4P46A 3WL9A 1FV1B 1GGIL 5EPMA 4K3EH 5KVFL 3MRMA 1A1MA 2OR9L 3WFDL 3VFSB 4HPYL 1GOGA 4F3FA 4F58L 5DJXB 1T22A 1UVQA 3WEXA 3CMOH 2FYYA 1UXSA 2HG5B 2Z0BA 1ZANH 1UJ3C 2QQQA 2O61B 1QFWM 5IHBA 5I66A 3WSQH 3IDYB 3P73A 4JLRB 2PO6B 3ZKXB 1K5NA 3DYOA 4WUKH 4KQ3L 4KZDH 2R56L 3QIWD 2H26A 5IB3B 4ZFZB 2VABB 4L8SB 2WIIB 3OG6B 4P0DA 5BRZA 3T1WA 3H0TA 1YEFH 2ZSVA 1CDCA 4PJGF 1T3FA 3HA0A 5TJWK 3R8BB 3ZDXF 1HKFA 4HUMB 5JDSB 3MBEC 3SKNB 2NXZB 4P49A 4PY7B 2JB6B 1NANI 3VMOA 3HCVA 3ZE0F 3MJ9H 2FIKB 1JZ6A 4P2QB 4H8WC 4AH2B 2VLRB 1G7PB 1X6LA 2P43B 3N1GC 3NIDE 4P2RB 5J57B 3WD5H 3ULVH