2OQJB

Crystal structure analysis of fab 2g12 in complex with peptide 2g12.1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
b'EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12 light chain
publication title A peptide inhibitor of HIV-1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB01
4K3EH 3HAEA 1DN0B 2VABA 3LRSA 1CL7H 5FCUL 2A6DB 3QO0B 3QQNA 4DGYH 3DUHA 5F7EH 3QDGD 5HXMA 3G5VB 4K8RL 3K2UL 5HYSA 2GHWB 5C0RL 4IOFD 1MIEL 4PLOB 5BV7C 2NY4D 4AK1A 1A0QL 5GS0D 3SGJC 5LBSL 1TTFA 1U8QA 5HI5D 3B83A 3QPXH 3T3PF 4LCWB 4MVBD 3TBYA 3ZE2F 1A14H 3L3JA 1DBAH 3Q48A 5FA3A 5F6HI 3DV6A 3OXRB 3MYJB 4TVPL 1Y6NR 5C0BA 1L9MA 4M43L 4RFNC 5EU6D 5IR1B 1IARB 3QIWA 5JPMA 2JF1A 3U9UB 4G8EB 1H8NA 3FRUA 1KIPB 5FHBH 5D1QB 3DXAA 4ZUSB 5TE7H 1TDQA 3BZFA 1MQKL 1HHJB 2ZUVA 4M61A 5DVLA 5IB5B 4MA1C 1WWAX 4IDJL 3EBAA 5HYJE 4PJ7F 2FLRT 5JNYB 1G7LB 1T04A 1W0WB 3KPRA 1U93B 2W65A 3LMJL 4PJDE 1ZA6B 1NDMA 5L2JA 3GNML 2V2XA 4JY4B 5EN2A 4C83A 4OZ4A 1MCNA 4GKSB 4LVHC 1HILB 4WI5A 1DN2A 4X7CC 3BH9A 2Q87A 1U8OA 4X99A 3MA9H 3N50A 5GISL 2GTWB 1ULVA 3ARBD 3QEGL 1HSAB 1EBAA 5F6HJ 5IB3B 1I1AA 3SDCD 3HE7C 1AP2A 5C0GB 3E2HB 3AC0A 4JKLA 4JFOA 3UPCA 3LKPB 5F72S 4RFEB 5F7FA 5AD0A 2HWZH 4Q6YA 2UWEE 3RP1A 4Z9KB 1JYVA 2ZUQC 1T66D 4X9GA 4NPYB 1NMAH 2BNQD 2X1PA 4ZO9A 1A6VH 2EH7L 1OOAA 3X14A 1PLGL 4HJ0C 4P4KC 3CD4A 1UKTA 3GSWB 4JRXA 4MCYB 4U3XA 5KZCB 3WSQH 4JO3H 3NMEA 1NAMA 3PWUA 3T0WA 3BKYL 3T1WA 1NH6A 5AAMA 1Q0XL 3MLXL 4F33B 1I9RH 4YHPA 4RDQG 3LVEA 5BVJB 4LKXB 3OB0H 1FV1A 1QLFB 3L5XL 1S9VB 4JJ5A 4NDMB 3ZYIA 4KY1L 4OIIL 3VW3H 2I24N 3CFJA 3H0TA 3MJ6A 2LTQC 4G7VH 3C60B 1LO2L 3KJ6L 1LO0H 2BRRH 1DN0A 4NCC2 1J11A 2Q76B 2A6DA 3QO0A 1AE6H 4TYUA 3FB6B 1PVHA 5JUEH 3OGCB 3WLWD 4JY5H 4R26L 4KTYA 3UTPE 5EZOL 3MOAH 1V3MA 1ACYL 2BC4A 4M7JH 3SKMA 5JW4R 1KNOB 4PYGA 2DBJA 2WLYA 4BQ8A 5D7KD 2Y7QA 3WHE1 1ZLVK 4LCWA 1S7UA 1MUJA 5FYJH 2NX5E 5E6YA 4CU6A 4K7PL 3MYJA 1FLRL 1CQYA 3WIHH 3PUCA 3QNXA 4Q9QH 4EXPX 4X7SH 5J57B 5FOBA 4YQXL 5IR1A 1YEGL 2FX7L 2D31A 4IOSD 5DLML 3U9UA 5L0QB 4G8EA 3PE9A 5FGCE 4LSVH 1KIPA 3MRRB 5D1QA 4KPHH 2KQMA 4ZUSA 4Z7VB 2IAND 4RWYL 1ITCA 2ZCKH 5IB5A 4MAYB 3TZVD 3WDJA 5JNYA 1G7LA 2P4AB 1W0WA 1II4E 1JPTH 4WHCA 2QQNH 4H8WC 4H1LH 4XGZB 2R15A 5KN5B 1ZA6A 4QOKB 4YHYC 5KS9F 3BEWB 4JY4A 1P7KA 3MXVH 4ZMAT 1W0YT 1FYTD 4UV4H 4GKSA 5E5RB 1HILA 3JWDC 2GTWA 3QCTL 4ODHH 3FAXA 1HSAA 2R1WB 3C6LC 4L4TD 3V0WH 5IB3A 5BO1H 5D1XD 3CXDH 5C0GA 5IMKB 4RAUB 3LKPA 3B9KD 4RFEA 1ACZA 3MRMA 3C9NB 2BOBB 3DHMA 3MRBA 5CJ8A 4PBXA 1U8PB 3RVWC 4BFIB 4NPYA 3JVGC 2BJMH 1I8IB 4NQDE 5LXGL 3QDMD 3GSWA 4MCYA 4Y4KC 4HH8A 3ZTNH 1L0QA 3RY4A 4F33A 1N5YL 5BVJA 4LKXA 1JGDB 3SEPA 1QLFA 3QEQB 1S9VA 4NDMA 1HHHB 3C2AH 1HINL 2YD5A 1GYAA 1QEWB 5I1KH 5GJSH 4GG6E 3KPSD 1PD6A 3IFLL 3EO9L 5K9JH 1YNKH 3K7UA 1PEZA 3I9GH 4QRTB 2Q76A 3MRGA 3L1OL 2HT2D 2F5BH 3TJEH 3OGCA 3PWNB 1FGVH 1SMOA 1F8TL 1MFEL 1J05A 1RZJH 3CLFH 3V6OA 5IT2H 1V8HA 5EIVA 2C3XA 4XT1C 4OCWL 1KNOA 4RFOL 4F7TB 1CR9L 3VXRE 2CK0L 3GBNH 3JWOH 3NCYS 4S1DD 4M8VA 4OB5H 4NOFA 3GI8H 1IBGL 1DJSA 3H3PH 4LDEB 4BZ1H 4LSTH 3TT1L 5CHNB 2CQVA 2XPGB 3TVMD 3T3PE 5IBTH 3WXVL 5CEZD 3SBWC 3O8XA 2YS4A 3HMXH 4N5EC 3BQUB 3MRRA 3VFGL 3WEXB 3T08A 1LP9A 1U9KA 2OZ4H 3HHRB 1KB5B 3OXSB 4MAYA 3HN3A 5IMOB 3IAQA 1TMCB 3QDGE 3VXTB 1WZLA 4GRLA 3RPIA 4MJ5B 4XGZA 1N5AA 5KN5A 4QOKA 5BW7A 4EI5A 5GGTH 1GPOH 3RTQC 4K23H 1FNAA 5DURB 4PJ7E 1Z0NA 3S97C 5KVEH 4OFYD 2R1WA 4OT1L 3SDDC 5JQ6L 1TIUA 2QQKL 5JXEC 1HZHH 1V7ML 5IMKA 1YUHB 1Q0YH 4RAUA 3ARPA 1C1EL 3LV3A 5C08E 3MLWL 3BW9A 5SWZD 2VNCA 3ZT5A 4ZAKD 4U05A 3QISA 2WBKA 1MREL 1U8PA 3BVNB 1IAMA 4JFEE 4HGMA 4BFIA 5MENE 3NAAH 3OJMB 1I8IA 2DLGA 1JNNH 4HD9A 2CKBH 2MJWA 3T09A 4LU5L 4Q6IC 3QQ4B 5HVWA 1UKSA 5F9OL 4P2RE 1CF8L 5EU3B 3U36B 3LKNB 2A0LD 2J6EH 5E95B 1L7IL 4DW2H 1EJOH 1WTGT 4LASL 1JGDA 3C8DA 3QEQA 4OV6F 1HHHA 3U0TB 3QI9B 1R3JB 2YUVA 1QEWA 2XN9D 1AIFB 1YEIL 3KLAB 3NPZB 4OQ1A 4QRTA 4XRCB 5E2UL 4YHZL 2OM5A 5EZIH 3PWNA 1MEXL 4JFDE 4W6XB 2PXYD 2QQLH 1UM6H 3E2HC 3RI5F 5DWUH 2DI7A 4DEPB 5D2LB 2BNQE 3SOBH 5SX4H 4BQCA 5TPWH 1G9MC 5F7KC 4K8RD 4OCYH 3BT2L 4F7TA 3RX5A 3OKEB 4RGNE 1W72B 2EDBA 4WI7A 1JWSB 3ZLQC 4X7TB 5CHNA 5E6IA 3IDYB 4G6AD 5SWSD 2XPGA 2KH2B 4MNHB 1OB1B 3OMZA 3C09C 2DLFH 3SE8H 4TVPD 3BQUA 4KUZL 4MSWB 4K2UL 3WEXA 1AD9B 2BVQB 1FP5A 1REIA 2N7BA 2IMMA 4XCEB 2Q7YA 1KB5A 3OXSA 4FXLA 1KIQB 3C60C 3EDEA 5HPMA 5AZ2L 5IMOA 4HLZH 4HV8B 4PJGF 3RDTB 3EHBD 3VXTA 4K94C 5IBLC 4MJ5A 4S1RH 3VD4A 2HAZA 1VGKB 3QG7L 1WLHA 1FAIL 1Q72H 5I8EB 5HVHC 3FT4B 4HQQL 1WWWX 5KS9E 2NPLX 3F7YB 5C0NC 3RGHA 1QBMH 1G1YA 1YUHA 2B1HL 3U7YL 1T1ZB 4F8QA 1VADB 3DURB 1A6UH 3KHOA 2W92A 3IFNL 2BOCB 4U1KB 2E27L 3QNYB 3BVNA 1CGUA 2DD8L 1NGXB 4NN5C 2IANE 1MCPL 4JFFE 2WQRA 3ET9F 4I13B 1XZ0B 4Y19E 4XNXL 1DLFL 2A9ML 1KYOK 3ZHLA 3HNSH 2VN4A 4ZXBC 3TN0D 3BRGC 3MBXH 3QQ4A 4JQVA 1PDKA 1C5CL 3KG5A 3Q3GB 4YLQT 4HKBB 3LKNA 3U36A 3U4AA 3SO5A 2EIEA 2EZ0C 2QSTA 4NRXB 3FFCB 1P6AB 3K1DA 3QI9A 3U0TA 5DFVD 1YJDC 4HIJB 4Q58C 1R3JA 4H8WL 3QZWG 1AIFA 4I9WD 3BH8B 1EUUA 3KLAA 2EE3A 4ORGB 5I1CH 5IGXL 1G9NH 3B43A 4NCC1 3C8KB 5KAQG 1BD2A 4XMLH 2X10A 3N06B 1I9IL 4NKMB 4LGRB 3DETD 5TF1L 5D2LA 1UKQA 2D7TL 4KAQL 1C7TA 2ZSVB 3EOTH 5LCVH 3OKEA 5D6CB 3GO1H 4UNUA 3QXAB 3VU2A 5F6IB 5KOVC 4IMKA 4DTGL 1W72A 1WT5A 4FQPA 2EO9A 2YRZA 2O93L 2VXQL 1S78D 2P8LB 1JWSA 4X7TA 4PLJD 3SO3C 4GMTH 5KVGH 4OLXL 2P43B 1OB1A 4PJ9D 4KHXL 5KAQF 2X70A 5JOPE 2VXVH 4MSWA 2BVQA 1NANI 3DPBA 4KK8C 4XCEA 3R0MA 1P53A 1KIQA 5J6HB 5IHUH 3KLSA 4HV8A 5JHDE 5E8PB 3MO1B 2IPTL 1VGKA 2RJMA 3LEVL 4PLKD 1TENA 3CNKA 3QDJB 1HXMB 5ACLA 3V0AC 5I8EA 4UZGA 3QG6A 1G84A 2YRLA 3FT4A 1RSFA 4YJZL 1SYVB 4L4VB 1PKOA 3QAZB 2R0LL 4L5FH 4PREB 4OFKA 3F7YA 4U6XB 3T0AA 2EYTB 2IGFH 1NFIB 4PJEF 1A1MB 5MEPB 3KLHD 3OL2A 2E9IA 4ZFFB 1S7QA 1VADA 5DD1H 3DURA 5DUBB 3MV8A 4QO1A 2BOCA 4U1KA 5J06A 4Q9RH 5DVMA 1EFQA 3BD4A 3QNYA 5DMKB 1OAYL 1UWXH 4OCSL 1NGXA 4PRNB 4K9EC 3DRQB 4R3SB 4C4KO 1XZ0A 2B4CH 4XXCC 2OQJB 2Y23A 4NT6B 5DJCB 2AQ1A 3QWRA 5HYIA 2NY5C 3Q3GA 4HKBA 4FN0A 2P8PB 1EFXD 4OGYH 2VUOA 2VDKL 5DYOB 1IGCL 2WUBL 1QOKA 5D8JH 1QZ1A 4NRXA 1MI5E 4E5XB 5BOPA 4NWUL 4BA8A 4HIJA 1TJHH 1E0OB 3MBEC 3BH8A 4F9PA 4ONHB 3WV0A 3O3AB 3T2NL 2ZOLB 1HHKB 3MV7E 1OSPH 4ORGA 5ID0B 3KVQA 3C8KA 5C0CE 5HPOA 3FO0H 3VI4E 4NQXB 4NKMA 2HJLB 3OR6B 4NQSA 2AI0H 2HJFB 5JPNB 3LIZL 2ZSVA 3SKJH 1NFDF 4UINL 2EKSB 4WUUE 1AJ7L 2DBLH 4WUKH 1U3ZA 3ILQD 3QXAA 5I73C 4LKCA 3FO2B 4OI8A 2OR8A 3LHPL 1PQZA 2P8LA 2AK4D 4KHTL 4EBQL 2DDQL 5HDQH 3U79A 3C2SA 3ZTJH 2IAMD 3H9SD 4YDLB 1XH3B 1CIUA 1FNSH 2AXFB 3H2WA 1MFDH 3HAEH 4L3ED 4L8BA 3FOMB 2NXYB 5I1EH 4BFBD 3WLBB 5J6HA 3GHBL 1CE1L 1M7DB 1E27B 4EIGB 5GGVH 5E8PA 3MO1A 2HT3D 1OPGH 1N4XL 3K8MA 4KKNA 3CVIH 1F02I 1KJMB 3QDJA 1HXMA 1IGJB 4JG1L 4DEPC 4AY0A 1TPXC 1YEFL 1SYVA 4L4VA 5CJOH 3PHOA 4PREA 4U6XA 2EYTA 1BEYL 1MCSA 1NFIA 2OMBA 5MEPA 4UNVA 2R0ZL 4ZFFA 3VJ6B 1ZS8A 1WT5C 2GYSA 5DUBA 2N1KA 4F2MB 1QFWM 4TVPE 2UUDK 2HFTA 5DMKA 3IDYC 3CDFA 1BWWA 2Y4SA 3DRQA 4R3SA 2VKWA 5D1ZC 3QH3A 2NY3B 2H2SD 2OQJA 2OP4H 4NT6A 1DBBH 5DJCA 4I2XB 3FONA 2XICA 5LKNA 1YEEH 2VZSA 1CTOA 4FQHB 3BI9X 3GMNB 3WUWB 2CDEB 3GEWB 3RDTC 1RPQA 3RJDA 3DMMC 4E5XA 1EA9C 3UTSD 3B8YA 4BK4A 2B5IB 3WIIL 3D3VD 1NKRA 4K94L 4AH2B 4WEBH 3A6CL 1CICB 3Q5TA 1ORQB 5EORL 3O9WC 4ONHA 5EOTB 4BSVB 4MLIA 3O3AA 4LHUG 2ZOLA 3U82B 1HHKA 5ID0A 5FOJA 4OGAC 4G6JH 4GKZB 3D9AH 1KBGL 4U1GB 3VRLE 5C07B 3KJ4C 4CDHA 1R24B 2CLVB 1XR8B 2B2XH 4FQCL 5E7BA 1IQWH 4OLVH 5ISZE 2HJLA 4WI6A 3OR6A 2HJFA 3FRPG 1XGUB 2H8PB 2EKSA 1HN1A 4LRNL 1FIEA 4NFBA 3O4LE 3FO2A 4KXZI 1NAMH 1RZKH 2WINA 3GSQB 3HE7D 4H0GA 4E42B 5E8NB 5D7IF 5IP4A 1RFDL 2E7CA 3GM0A 3HNTH 3N1MC 3UTTD 1OCWL 1MFBL 4BH7B 3EO0B 1N26A 2QHRH 1XH3A 4WCYH 5JOFB 2AXFA 3VH8G 1WZMA 4C59B 2NZIA 5IOPB 4PS4L 4HJ0D 4P4KD 1J7VR 3KXFA 4MXWL 4R96B 1M7IA 1M7DA 1F4YL 1E27A 1GOFA 4P9HH 2AAVA 3CXHK 1D5MA 2X09A 4G6FB 1S9XA 1YJDL 4LF3B 3IDNB 4RMUA 4G6KH 2J8OA 1HDMB 1BVLB 5JO5B 2APBA 2ESVE 3UZVB 1UQSA 2R2HB 2VB5A 4JM2C 1KJMA 1IGJA 5I17A 1SEBA 2VDRH 4GAJH 3S4SB 5JIPA 2RCSL 1RZJC 2UZYB 5FM5M 3LN5B 2DQIL 4WJ5B 5GPRA 4NJ9L 1QSEB 5TDNB 1ES0B 3BPLB 2J8UF 1EJ6A 4N8VG 5F6IC 3VJ6A 1KG0B 2X6MA 1TQBC 4Z0XB 2DQCL 4YDKH 4OM1H 4C58B 2NYYC 12E8L 4PJEE 4EUPB 1MRDH 7FABH 4Y16C 4GAYB 4PJCF 1XEDA 1K6QH 2PR4L 4I2XA 1R0AH 2VDPL 4D0CB 1HCVA 1WIOA 4FQHA 3UO1L 3GMNA 1UZ8B 3UC0H 3VXMD 3WUWA 2CDEA 2XTJB 5JXAH 2EE2A 1U8MB 1D9KB 3AS0A 5IUSA 1TVBB 4QXTB 2KQNA 1JF5A 3VXQB 4XCFL 3SGEI 3GIZL 4Y4HB 2O26U 4R8WH 1UEMA 3AY4A 4Z95L 4AH2A 2E7LA 4K3EL 1CICA 4KROB 4KJQC 1ORQA 2Y5TB 5EOTA 4MHHI 4BSVA 1CL7L 4JO4L 4M8QA 2QSCH 2XKNA 1OAUH 1GVIA 5F7EL 3TIEB 1JHTB 5F9JB 4GKZA 1WK0A 1CDYA 4HIXL 2EYSB 5C07A 4WGVB 1R24A 2CLVA 1XR8A 4IRSB 3LAFA 4JQXA 3T0EB 1C5BH 4PGZA 2VZTA 4RX4D 1XGUA 2H8PA 1WFTA 3QPXL 1K9TA 3WO4C 3C6LD 3D5OF 1NSNH 1DBAL 3O3UN 4E42A 3NCFB 1MY7A 3O3BB 1FSKB 4BH7A 5JOFA 1NLBH 4P9MH 5FHBL 5IOPA 4YPGB 4P2YA 5TE7L 2XQYG 4CVZA 5C09B 1OGAB 3ZMRA 4Y4KD 4R96A 4P59H 3FQRB 2Q86B 5GZOD 3LZFH 4EN3C 3IDNA 1BVLA 2YUXA 5T3ZE 5JO5A 3TM6A 5DJYB 3BOVA 4UT7H 2R2HA 4LNRB 1IAOB 3BKJH 3DGCR 3FO1B 1EK3A 1A6WH 2L7UA 3K1KC 5IJKA 4M7LH 4NQEB 3S4SA 1NUGA 1IRAY 4S1QH 2RIKA 1JZ3A 4JGJA 3LN5A 3KPQA 1AKJD 4M6AA 2P44B 1QSEA 5TDNA 3VFMB 3WJLC 1ES0A 1YNTB 4U1JB 1EEQA 4LNVA 1ORSB 4LQ1A 4OZGB 5EFIB 1KG0A 3SJVD 4C56B 5I1LB 2FCBA 3H9SE 4M6NL 4RNRB 2CO7B 2DQEL 2P5EE 2ID5A 1RIHH 3ZDYE 1NMAL 4EUPA 4WY7H 4L3EE 3MTRA 5EIIB 4DVRH 1ZOXA 3VFTB 3WSQL 4YWGH 5F7YC 1J1OH 5C2BL 4QWWC 3AGVA 4D0CA 4RZCA 5I75B 1IILE 1YMMD 1P1ZB 1I9RL 1UZ8A 2AJVH 4N0YL 3TH2T 3G5YB 3B9AA 1TVBA 4QXTA 3VXQA 4PGCB 3VW3L 4N5ED 4Y4HA 4G7VL 4LPYA 2F15A 3L3DB 4X5LA 1JZ7A 4C55A 4J4PC 4ELKB 2Y5TA 1B88A 5J13C 3D39D 4HEPG 5HDLA 1D5BB 3K81A 1ZHNB 1JHTA 1J86A 4XPFH 3TIEA 5F9JA 2EC9U 5E4EC 2EYSA 2EXWC 3RTQD 2A6IB 3IRPX 4IRSA 1TFHA 1QFWH 2J88L 3T0EA 4Y5VB 5I0ZA 1J87A 2ICEA 2WZPD 2IFGA 4FQXC 1CXHA 2FO1A 2DTMH 2XRAH 2BNRE 3T4AB 3SDDD 4BJLA 2YBRB 5JXED 2NY3C 1KN4H 1KIUA 3WIHL 4MQXC 2APTA 1JPSL 1YN6B 4X7SL 3O3BA 1IC1A 4QRSB 2VQUA 3V4VH 1PSKH 2VWEC 3QP3A 1IL1B 4EJ1C 1VEOA 5D7IE 3EIFA 1EGJL 4BQBA 3DYPA 1B6UA 2B5IC 1OGAA 5C09A 1FRGH 2O5YH 2AP2A 2EDQA 1QLEH 2VE6B 2NY6C 1CICC 3FQRA 1VACB 4FQIL 2JJSA 2Q86A 2AJYL 2QQNL 4OI7A 3MLUH 5D7LB 3EYUH 3HZKB 5DJYA 3MODL 1NEUA 1IAOA 4LNRA 3FO1A 3NCYP 4O2FB 1I4FB 2L4OA 4U1GC 4UV4L 4XAKE 5J4MA 4FFYH 4YGVB 1KTDB 3OKLB 4JAMB 1RUMH 4U0RB 3PF2A 5C6WH 1BFOB 3VXSE 4ODHL 4Z7UF 3HA0A 3V0WL 3GSUB 1IM9B 4XP1H 5BO1L 4HG4J 3CXDL 3UAJC 4HXAH 1YNTA 4U1JA 3UTTE 3HZVB 1ORSA 1T2QH 5EFIA 1E4WH 4I0PA 1ZAGA 5I1LA 4LFHD 4RNRA 3RBSA 3RHWK 2DJSA 4XCCL 5A3IC 4HS6B 3BKML 2BJML 3MLTB 3NCBB 2J8UE 4V1DE 4JO1H 1Q94B 5EIIA 4YXKH 1ZTXH 1F4WH 1KB5H 3VFTA 3VFUB 3LQAH 1QNZL 4NQCB 1B4JL 3ZTNL 1YEKH 1AGEB 4UB0L 1P1ZA 2PYED 4PJCE 3G5YA 2Q8AL 4FQQB 4UTBL 3BGFB 2DL2A 3C2AL 4ZYKB 1WBZB 4OZHA 4PGCA 5DD3H 1F58H 2VLJE 3QHFH 5BS0A 3F7PC 3L3DA 4HUUB 5GJSL 4JGMA 4RSVA 4ELKA 4HS8L 1YNKL 3GUTB 1RIUL 3I9GL 1D5BA 5D93C 1ZHNA 3TJEL 5IBLD 3Q6GH 3GHEH 1FGVL 4LQFL 5ECJE 5D96B 1RZJL 3CLFL 4YDIH 5D2NC 5IT2L 1IQDB 3LD8B 3BPLC 3F7QA 3ZHKA 3BDXA 4PV8B 5CWSB 1VFAA 3T77B 4GBXB 5CSBA 4PG2A 2FZ3B 5DI8B 5FECA 5I2IB 4HWZB 3GBNL 3JWOL 3T4AA 5C0ND 3B2UD 2YBRA 3LSOB 4OB5L 1BVKB 5TFSH 4LSTL 2MHAB 4YDVB 1YN6A 2WUCH 5DQJB 2ZG2A 2MQCA 4CU8A 5CLWA 2YXMA 1VPOH 2ZOKB 5IBTL 2EDKA 1VEPA 3HMXL 1CGTA 3I6GA 1L9NA 4JPWL 1D9KC 1IL1A 5F3HB 4MZ3A 4W6YB 1JP5A 4ZXBD 4OD3H 5HVFB 2R1YB 3P0GB 2VE6A 4KROC 2VZOA 1FG2B 1VACA 2AXHA 2DL9A 3V8CA 3BIAX 3CCHB 3V7AG 3TNNB 1F6LL 5F7WC 5D7LA 4ZO7A 2EZ0D 3HZKA 5GGTL 1GPOL 5I76B 1QSFD 4K23L 1BOYA 1G7JB 4Q97A 3ULVH 4O2FA 1I4FA 1OGTB 1IGFL 1CDBA 4YGVA 3IKCB 1DQTA 1KTDA 3RL2B 3OKLA 4FOMA 4Y5YC 4JAMA 5FDWB 3WMSA 5KVEL 3T0EC 3S6CA 1BFOA 4F37K 2A6JB 4WV1C 3ULSB 3SPVB 3MA7B 4APQB 2GJ6B 4JJHA 1W72H 3GSUA 1IM9A 1NBYB 3VDBA 4X7DC 1RZFH 1HZHL 1J8KA 1Q0YL 2A9NL 1WZ1H 1U6AH 1ZXQA 4Z7VF 5KANI 5J89A 2QQQA 3P30H 4NM4H 2EE6A 4PUBL 3HR6A 4HS6A 1FSKC 3W5MA 3NAAL 4OIAA 2JE8A 3MLTA 2D7MA 1JNNL 3I50H 1CFNB 1Q94A 3DXAE 5B3JF 3VFUA 1MVFA 4NQCA 1DLHB 3G6AA 2VLRD 2ADFH 2NY2B 2QLVB 1OP9A 4G8GB 3RY6C 1GAFH 1AGEA 1BGXL 3X3GH 5CEXB 3VGFA 4Z7WF 3MLRH 1DBMH 4I18B 4M6OH 4FQQA 4ZYKA 1WBZA 3U0PB 4IBLT 5HBBA 3S36X 4KK8D 4HUUA 3OF6D 4XPHH 5BVPH 3BPOB 2C4FT 3GUTA 1YECL 5KSVB 4OLZH 4JO2H 1SY6A 3VXUB 3SJVE 3GMRB 2R39A 4AL8H 4P48A 4GFTB 4WI2A 1HHGB 1UM6L 5DWUL 2Q7NA 1ADQA 1FO0B 1FZMB 4PV8A 5CWSA 5L8LB 4OCYL 3T77A 4GBXA 1IMHC 3TYGH 4R4BB 2YEZB 4EQ2A 1MRCH 5DHVA 5I2IA 4DVBB 4HWZA 3LY6A 1T7WA 1XF3A 3MXWL 3TJHC 3TBSB 3MLVH 1WCBB 1LVEA 4FFWC 4ETYA 1YMME 4PTTA 2MHAA 4M6MH 5DQJA 5CJBA 3ZYJA 1P9MC 1YY8B 2QR0B 2ZOKA 4Y4FA 2AXJA 3SE8L 2F53D 4TSCH 5F3HA 1B3JA 3RWFB 4LP5A 3D39E 3VFNB 5IB2B 5DD5L 2R1YA 2V5YA 2YKLH 3QHZH 5DJ8A 1JNLH 3CCHA 2X1QA 1MQ8A 4YR6B 1EO8L 4KKLC 3CUPB 3TNNA 3WBDA 5CD5C 5I76A 4GRWB 4QRPD 3QUML 3AM8A 5HD8D 1KEML 1NC2B 4OZFB 5D7JB 3WFHB 3MBED 3IKCA 4KZEH 5DURD 5FDWA 2OJZH 4Y5VC 2A6JA 3ULSA 4KMTH 2WW8A 3E3QC 3RQ3A 3MCKB 3MA7A 4APQA 4P4RB 5JW4N 2VC2H 2GJ6A 4LCWE 5HYFA 1YPZA 2C1OA 3TH4T 3LEXB 5T1LA 4EQ3A 3SQOL 4CDGC 2E3VA 2X05A 1A6UL 5FF6B 5GS3A 4DK3A 4Z7UE 3P0VH 3MC0A 4KGLA 1CD9B 3ZE0E 1DQQB 3CFEB 3V6FB 4PJAA 5CZKA 1UJ3C 4HCRA 1RQ5A 3S3PA 1CFNA 5IF0B 1Z9SA 3HMWL 3HNSL 2IH3B 4NNPH 1DLHA 5IBUG 3MBXL 4ZOCA 1T4KB 3JTTB 4G8GA 2XFXA 5H37H 1A5FH 5CEXA 3MR9B 3O4OC 4I18A 4HUKB 1QTYT 3TBTA 3TLRA 1URLA 3L7FB 2IQAB 4U2YA 1I1RA 3DYMA 4X6DB 2VMFA 3MLZH 1J8HD 3T2OA 2X89A 3GIVB 1CXLA 4WTXA 4Y1AB 5KSVA 4KJWC 4OTXH 5I1CL 5TE6H 1G9NL 3NH7L 3UJTH 3OKMA 2ED9A 3VXUA 2FEDC 3KYKL 2NY7H 4P2QB 1HHGA 2WIIB 4PD4J 1JGLH 1OD9A 1FO0A 4EOWH 1FZMA 3BRFA 5IROC 4W4OA 2YK1L 3RIAK 1N6VA 3CJJA 4R4BA 2YEZA 4L3CB 1WAAF 3EOTL 4DVBA 3GO1L 3WFDH 3LS5H 1WICA 3FAWA 1NUFA 3TBSA 1OLZA 3CFCL 1WCBA 2VTFA 1EAJA 1KN2H 1TZGH 1FE8H 1JK8B 4HPOH 4XNMB 5L9DH 1JPST 4GMTL 8FABB 3W0WB 3CLEH 5KVGL 1YY8A 4HT1H 3FOLB 2QR0A 4FFVC 4YX2H 1T7VA 2AEWA 3PQYB 1OT2A 1LQSR 4LPTA 2VXVL 3BN9C 1BQLL 4ACPA 1I7RB 1Q9OB 4XP5H 5D1ZD 3RWFA 4I5BB 5IFJB 2CD0A 2OXGA 3VFNA 3S5LG 2BNUA 5IB2A 1U3YA 4PB0H 3P40A 1NEZB 4X9BA 4HKXB 1LMKA 2AJUH 5EUOB 5I8OH 5HYJB 4F9LC 4YR6A 3FKUS 3CUPA 1GHFH 4GT7A 3RDTD 4PJDB 3DMMD 1R6VA 4S0SD 3V6OE 4OZFA 4CJ1A 4NRZB 5D7JA 5LJYH 1X5FA 3O9WD 4H1LG 5A1AA 4NJAL 3MCKA 1KGCE 3VXPB 4GBXC 4L5FL 1SQ2N 3T3ME 3LH2H 3AREC 3LEXA 5CIPB 3MACH 4P2OA 5DD1L 5FF6A 3P77B 4Q9RL 5F7NC 1DQQA 1MRFH 4PB9H 4QHLB 3CFEA 3V6FA 5HHNB 3QUZB 1K8IB 2JJWA 1EVTC 3BSZH 5IF0A 3VWKD 2FR4B 4Z7VE 2ED8A 3V7MA 2IH3A 5B21A 4ODVH 4WEMB 1T4KA 2D4DA 3MLYH 2Z8RA 1JE6A 3JTTA 1OAKH 4QXGH 4OGYL 4NRYB 3MR9A 5E94A 1TCMA 4PY8J 5B3JE 2EO1A 4R0LB 3L7FA 4ETQB 3BWAB 2QADB 2HVJB 4ZSOB 4X6DA 1TJHL 5EBGA 3UJJH 3OSKA 3LS4H 4KDVA 4LCCA 4W68A 2IPKB 3SCMA 2KDGA 1PG7X 5FYLH 4IRZH 3SE4C 1OSPL 2BFVH 1PKQB 2WIMA 4APQC 4HWBL 4HW6A 3NTCH 1SM3H 2G60L 4P2QA 1A8JH 2WIIA 4JM2D 4HKJB 4KV5F 2UY6A 5ILTH 4MJ2A 1NCDH 1VESA 3QB7C 4L3CA 1EHLH 2DBLL 3H42L 1KPUB 3L7EA 1XF1A 3JV5A 2NX5B 3T8XB 4X7EC 1JK8A 4XNMA 3ALWA 3W0WA 1LNUB 1GC1H 2CK2A 4U2ZA 1UXSB 3FOLA 5HHOB 2LVCA 5EBWB 1FNSL 1P7QA 2NYYD 3QEQE 5HYEA 1I7RA 1OW0A 4MHHG 4Y16D 1L7TH 1N2RB 4GW4B 4JM2F 1LD9B 1T3FB 5IFJA 3G5XB 1CG9B 1KFAH 5I1EL 4HJJH 1NEZA 3BPOC 4HKXA 5GGVL 5EUOA 5HYJA 1UC6A 1YYMH 3WNOA 4ZNEE 1KJVB 1ZK9A 1OPGL 4DZ8B 1W8NA 4ZOBA 4PJDA 5FM5O 1NPUA 3TA3B 4RISL 2D9CA 4NRZA 3WYRA 2JK5B 2JCCB 3O2VH 4P46B 2FSEB 1U8LB 1MFAH 4KJQD 2OTPA 4KZDL 4NHCH 1MHHB 4MNGE 5CJOL 3DX7B 5CSZA 2V5SA 2EIZA 1Y18B 1J1XH 1G1CA 4CN4A 1LE5B 3MQIA 2I26N 3DVIA 3T2QA 4WTWA 2D0HA 5LGJB 1W0VB 3P77A 3TF7C 2PTTB 5LWYH 2UWEA 4IRJC 4QHLA 4YC2C 5HHNA 5KSAA 1KJ2B 5F1NB 5IG7B 1K8IA 5DSCB 2D7PA 4NC0B 4YE4L 3F65A 4HHAB 4CGTA 2FR4A 2OP4L 2NY0B 1DBBL 4U1MB 5JOEA 1YEEL 5HHXH 1H3VA 5MI0B 4R9HA 1C12A 4HPYH 3REVB 3HPJA 5E9DB 5ESVB 4R7NB 1NCUA 4R0LA 3P9LA 4ETQA 3BWAA 3MOBH 1FJ1B 5DMGC 1MSPA 2F8OA 2VR4A 3DVGB 4ISVB 2ICWI 2IPKA 4GG6B 5LQBH 2YSSB 1SHMA 1WTLA 1GGBH 3VFVB 3GSRB 3TCLB 4EN3D 1I3GH 4G6JL 3VGGA 3D9AL 5LAXB 2VO5A 2CGRH 2B2XL 4HKJA 4OLVL 1FNHA 4JVWA 5GRJH 5DGQA 4EUPH 1MAKA 3BDYH 5D6DA 1HQRB 3D25B 1BJ1H 3MRPB 1DUYA 1KPUA 4Z78B 3AS3A 3VXRB 3BMWA 1NAML 1RZKL 3GK8H 5C71A 2NX5A 3T8XA 4MJIB 1CZ8H 1WAAE 4BZ2H 1LNUA 1UXSA 4KTDL 5HHOA 3MX0A 5EBWA 4WCYL 2G5BB 2NY1B 3LRGA 1RV6X 2ICWJ 1N2RA 4GW4A 1HHIB 1FGNH 1XCTB 1OM3L 1LD9A 1T3FA 4M3KB 3G5XA 1CG9A 2NW2B 4J3XA 2R8SH 3M8OH 5EO0A 5I9QB 1OARL 3UBXA 1EZVY 4MD5B 5GGQH 4ODWB 3QDGB 4G6KL 3WJJA 1KJVA 3DX9A 4DZ8A 5SX5K 3TA3A 4HZLB 4MAUL 5I15H 4OBRA 3ULVE 1DSFH 4PJ7B 4P46A 4YFLI 1J1PH 1U8LA 4J4PD 5IFHH 3GMQB 2I5YH 1EEYB 4UT9H 4XNUL 4PP1C 1RAMA 4ZFOB 3DX7A 1Z9MA 1TVHA 3NOIA 4LEXL 2BVTA 2FB4H 1Y18A 3RNQB 3NACH 1ZE3C 3D1MC 1LE5A 2EXWD 5LGJA 5A2KH 5EU6B 4YDKL 5F9AC 4QRUA 1W0VA 1JI1A 4OM1L 3H8NA 2PTTA 4TSBH 5FV1L 4FQXD 2NQCA 7FABL 1KJ2A 1E4XI 1VFUA 5F1NA 5DSCA 5IG7A 3R4DA 4HHAA 1K6QL 3JWNC 1R0AL 5ICZB 1IAKB 4MQXD 2ATKB 2OL3B 3UC0L 2HVKB 3CFIC 3REVA 5JXAL 5E9DA 5ESVA 4R7NA 1QLRA 4LMQI 1Z3GH 3TBWB 3KPOB 2HKFH 1FJ1A 1LDSA 4NKDB 3DVGA 4ISVA 3QIUD 4F3FB 4QXWA 3OG6B 5CGYC 4GG6A 3TNMB 2YD6A 2YSSA 2ZZUT 2NY6D 3RI5K 1OAUL 3NCJH 1T80A 1UWEL 3TCLA 1RURH 3SDCB 4N9GB 5MEOB 5IVXF 3C5ZC 5LAXA 3CGTA 2HTLD 5GRVK 2FIKB 1BAFH 3C08H 4D9QD 4QY8B 1IC5H 2VDQH 4XXDA 1Q1JH 1GXEA 5IEHB 2BNQB 4U49A 1HQRA 3LEYL 3ESUF 3MRPA 4X5WB 2A83B 1IT9H 4Z78A 3QUZC 1NSNL 3VXRA 4O2EB 1YY9D 3AB0C 3VRIB 2ARJB 3UAJD 3G08A 1T22B 3DECA 4MJIA 4PRPD 2CRIA 5CFHA 1RMFH 3O0RL 2G5BA 5A3ID 1DQMH 2X4TB 2GSGB 1S9WB 5J12B 2W0FB 3GMPB 1NLBL 4P9ML 3FFCE 3IDXH 1N7MH 4AQ1B 1HHIA 5FFLA 1A3LH 2NW2A 1H3TA 5HHMD 2GK0B 3LKQB 4P59L 4XCNB 1LO3H 1T83C 3WKMH 4MD5A 4ODWA 3QDGA 4F58H 2D7QA 3EJZD 1X5ZA 4P57B 2C7UB 4UILL 5D5MF 2XZQL 2YPVH 2FRGP 4YBLB 3CC5B 4HZLA 1X6LA 1XIWC 5HGAB 2WSKA 1A6WL 4LLQA 4M7LL 2H26A 4PJ7A 2C26A 4LRIC 3GMQA 3QUKB 4S1QL 1I8MB 1IAIM 1EEYA 5C0AD 5JZ7C 2YD9A 4ZFOA 2CJUH 4S0TD 4HXBH 4OFPA 3RNQA 5ICYB 4LAQH 2JJTA 1MLCB 1RJYB 5EU6A 5C08A 4KJPC 5GS1B 1B4RA 4P23D 1MJJB 2AV7A 1SJEB 4J3VA 4OI9A 2J4WH 4WY7L 5B8CB 2IANB 1EERB 4ODSH 3TZVB 4YWGL 4OAWB 4GQ9L 5ICZA 2FDBP 1IAKA 3JV0A 2EDNA 3QDAA 4M1CC 5DD6B 2ATKA 1F3JB 2OL3A 3DIFB 4P2RA 1FAKT 4YHKH 4PG9B 1UEYA 4X6CF 3DI3B 1BQUA 3KPOA 1WV7T 1FYTB 1ZHBB 4NKDA 1KOAA 3QDJE 3TA3C 3M17B 3CAFA 2V7HA 4PJ5D 4F3FA 3OKDB 3ARBA 4GMSH 3TNMA 1G7HA 2G75B 4L4TB 3ZDXF 5DQ9B 5T1KD 5D1XB 1GIGL 3QJHB 3SDCA 1SVZA 4N9GA 1IKNA 3UZEA 1KCRH 5KANG 5MEOA 4ELMF 3B9KB 2Q8BL 4JFDA 2FIKA 4QY8A 2BSED 4M93C 2BNQA 2HP4A 4WO4C 4L1HA 3O3DB 3EFDH 3O2DL 2N56A 4X5WA 2DKUA 3QDMB 3PDOB 3V9FA 1AC0A 4O2EA 5GGRY 2H3NB 2ARJA 3W39B 1XGYH 5BRZD 1T22A 5GS2D 2R23B 3WS6A 5I1GH 5MI0C 3BD5A 3Q6FB 5SWQB 2X4TA 1S9WA 1MWAB 3GMPA 1Z6JT 5EOQH 4AM0A 3KNBB 5IW6B 2GSIB 4FS0A 4K3DH 4X6EB 3HI5H 3KPSB 1FRGL 2O5YL 2GK0A 4X4YB 3CFKB 1QLEL 4MDIB 3LKQA 3MJ9A 4XCNA 4WI8A 1TCRB 3B5HA 5HJ3B 3QUYA 1SY6H 3MLUL 3GJFB 3EYUL 4P57A 2DWDB 1ADQH 1FPTL 3CC5A 4KGJA 5HGAA 5FO7B 4FFYL 5F7LB 2F19H 1RUML 5DHVH 1I8MA 2WK2A 5EIQA 4R97B 3Q5YA 1UYWL 4NQED 5EU7C 4XP1L 1NCWH 2MCPL 4HXAL 2M26A 3LKSA 5ICYA 1FLTX 5CMAB 1E4WL 3C8HA 4W6WB 1MLCA 1RJYA 3TVMB 5GS1A 2DWEB 1MJJA 5EUKB 4C56D 4IS6B 4TTDC 1SJEA 5KOMC 1UZ6F 5B8CA 2CIIB 5HGDB 1ZMYA 4CKVX 3WFCL 1CK0H 4K7PX 2IANA 4JO1L 3VD5A 4M02A 3TJHD 3TZVA 4OAWA 4FFWD 1YEKL 5DD6A 1F3JA 3DIFA 4PG9A 2DQHL 1K3IA 4M7KH 4YNYB 2L7JA 4MB4A 4OJFL 5I1AB 2CDFB 2P46B 1S7WB 1FYTA 1F58L 1ZHBA 5DD3L 3QHFL 4Z77B 2R56L 5F9WB 2X4RB 5GS0C 2DQGH 4H26A 4OZGF 3OKDA 2MNUA 1F4XL 1E4XL 1E4KC 2G75A 5HI5C 3CPLB 4JZJB 5DQ9A 5D1XA 3QJHA 4KKLD 3B9KA 4YDIL 5CD5D 1DZBA 5SWZB 4TUJB 2QSVA 4PRBB 2XT1B 4O02H 4ZAKB 1JYWA 4FZEH 2B8OT 4GS7C 3VRJA 5C6PB 2YA1A 5DRNB 1AGDB 2R69H 4HCRH 4WHYH 1JVKA 4P3WA 4DKAA 4NO3B 3O3DA 2JB5L 1A7OH 3V6BR 3QDMA 3PDOA 4BFGA 1PYWB 3MSPA 4I2XE 4YBQD 5MHSE 4LIQE 3RRQA 2R23A 2EC9T 4H5SB 4JRXD 1VPOL 2VWEE 1MIMH 3Q6FA 3FMGH 5SWQA 1NCBL 1AD0B 2I60H 2YPLD 1PW3A 3PGCB 3KNBA 5IW6A 2GSIA 4UDUB 4HWNA 4M03A 3KPSA 4JPVH 2XN9B 5DQDH 1BP3B 4OD3L 2ZPKL 4X4YA 3CFKA 4MDIA 5FIEA 1TCRA 4CN6A 4XWGL 4LSRH 5HJ3A 5MERB 3WN5B 3L3IA 3L3GA 1PY4A 4D9QE 5FGBC 8CGTA 2PXYB 2YWZA 4NGHH 1MCKA 4W70A 2VL5B 2QJDA 5FO7A 4DGIL 4I0CC 1CFTB 4ZOEA 1FDLH 3MNZB 4X80H 2Z8SA 4PJGB 4YAQB 3IU3B 3ULUC 5D5ME 4Z8FH 4GO6B 4LVNB 1PEWA 1W72L 2WP3T 3MNWB 1NMCB 3BZDA 4KJWD 4XNQB 1EXUA 1RZFL 4LPXA 1D5ZA 4PRPE 3BP6A 2FEDD 1X5KA 2ENYA 2W1NA 1Y0LB 3B4NA 5SWSB 3TVMA 3P30L 2DWEA 4NM4L 5EUKA 4F7MB 3RZWA 3WS6C 1NCCH 4KMLB 2CIIA 2Z0BA 2NZ9C 1KB9J 1RHHB 1CDIA 5HHME 5HGGS 3DO7B 1HSBB 1CI5A 4ESKA 2ADFL 4U1NB 4QHMB 4L3AA 1TJIH 4P5MB 5J3HC 3X3GL 4YNYA 1KENH 1SVCP 4FFVD 4M6OL 4J2XA 5GGRB 5I1AA 4V2CB 2APXA 1S7WA 2OTUB 4KRPC 3BN9D 3NIGF 1M7XA 4OZFH 3IDIB 4YHOL 2KL6A 4Z77A 5FYKH 5BVPL 3ARVA 5C0AE 5GRUH 1FC1A 4OFYA 2VDLL 2ZKHH 4JQIH 1BZ7A 3CPLA 4JZJA 5CILH 2XKSA 4U31A 2BVOA 2GAZB 4KC3B 1IC7H 5D2NE 4CNIB 3DVNB 4YFEA 5JHLL 3NIFF 5SWZA 3N85L 1AR2A 4TUJA 4ZAKA 5I1HH 2YUZA 5KTEL 5E0QA 3ZDXE 3IDMB 3HNVH 5D7SH 4ELME 4NO3A 4L1DA 2KPNA 3K0WA 5F88B 1FVDA 3TN0B 4WENB 1LEKB 1NGYB 3ARED 3LKRA 5C0DB 3TZVC 1J10A 1UENA 1QQDB 4H5SA 2VXTL 1AGBB 3G6JF 3UYOD 4GLRI 2XTJE 5IESL 4H20H 3SE3A 3PGCA 3RUGF 4UDUA 4F7CB 1IGYB 4XVJH 3U7WH 2XN9A 1CU4H 2YD4A 5HYQB 2YKLL 4QKXB 4J3UA 3QHZL 4I3GA 1Q9KA 4XNYH 1VA9A 4J3WA 3RVTC 5MERA 5ESQA 3WN5A 4Y5XC 4FQLL 1W8OA 4MLSA 1IE5A 2X1WL 4ALAH 5C7XL 2VL5A 1ZHLB 1EDQA 3MV11 1CFTA 3MNZA 3T0EE 4PJGA 5ITBL 4M7LT 3SDAA 5KW9H 4YAQA 4PPTA 3WE6B 1M6OA 1B0GB 2VC2L 1I7TB 3MNWA 4XNQA 3GSVB 5TDOB 4DFHA 1FORH 4MA8H 5SWSA 1Y0LA 5AWNH 4F7MA 4JG0H 4PJ9B 2YMXL 4OUOA 1OT1A 5J11B 4HEME 4PJEB 1RHHA 3L5JA 5IM7B 1RD6A 3CZFA 1OAZH 3DO7A 4P3DB 1N64H 3O8XD 5C09E 1OGAE 1BZ9B 1KC5H 3NFSH 4U1NA 5JMRA 1UZ6E 4QHMA 2OSLB 1A5FL 2GQHA 3QWOB 3ESVF 2HT2C 2H32A 3OAYK 5GGRA 3V52L 1XGRA 3FTGB 2F74B 2OTUA 2VH5H 4NZRH 4PJHF 4GRLD 3IDIA 2A73B 4DFIA 4QHNB 2M1KA 1UACL 4NQEE 3IYLW 4HMEA 4OTXL 4L8SA 5TE6L 5E99H 3UJTL 3D87B 1RU9H 2GAZA 5DHXB 4CNIA 1F90H 1GJIA 3DVNA 4S1DC 3ZKNC 3GSNH 2QEJA 4OZGE 1JGLL 1F3RB 1OSZB 4M5ZH 4C56E 1M1SA 5I16B 3S35L 4Z7OF 2E5EA 3IDMA 3TVMC 4BQ9A 4Y8DC 2ZUTA 3V95A 1WCQA 4PGJA 5I18H 4GRMB 3BE1H 3TN0A 1FL3B 3MCLH 4DUXA 1NGYA 4XNZC 1LEKA 5C0DA 1KN2L 1TZGL 1KTLB 4I3RH 2D0FA 2Z8WC 3M07A 1QQDA 4X4ME 3MPCA 1AGBA 1R5IB 4HT1L 1NFDB 3S36H 1BJ1J 1CVRA 4IRJD 4YXLH 1EHXA 3QZWA 4XP5L 4F7CA 1IGYA 1GGCL 5HYQA 2F54D 4ODXB 3L9RA 4TRPH 4LLWA 3VFOB 2AJUL 3ZYZA 3F7VB 4G5ZL 2PNDA 3NGBB 5DRZB 3E0GA 1RULH 1GHFL 2K1MA 3ROOA 1K8DA 2V5RA 3U30C 4O58H 1DR9A 5E8OB 3U6RB 1SBSH 5HHQB 5I1IH 1JTTA 4U6YB 5DMGD 1ZHLA 1N59B 5IEKB 3WNKA 1J0HA 4ZAKC 3JUYA 4NSKB 3E3QE 4JHZA 4Z7QF 5CINL 3WE6A 2EDDA 1MCOH 1B0GA 4AIOA 2MKLC 5I71C 3GSVA 5TDOA 3LH2L 4G3YH 1JMXA 1E28B 3FN0H 1X5JA 5ITFB 5J1AB 2AK4B 3MACL 3N1GC 2ZCLH 3RVVD 3GSXB 1FFRA 1G7PB 1T2JA 4MWFB 4KDTA 1RJZB 2BHZA 2IAMB 3H9SB 2YPLE 5SV3A 1MRFL 4FTVD 4PB9L 4XMKH 4L8CB 4OKVB 3S98A 1F3DH 3OHXB 4QYOB 5E6ID 4PJEA 2LABA 3TESA 5IM7A 1A3QA 1NGPH 3SE3C 1QD0A 4P3DA 4ODVL 3RZCC 4GRWF 2DS4A 1BZ9A 1CGSL 1U8IA 1H5BB 1RIVH 4QXGL 5SV4A 3QCUL 3QWOA 2YZ8A 3BN3B 2BHUA 5D7LE 1LHZA 3EOBB 4TULH 3X11A 2F74A 3HZYB 3EJYD 5TDPB 2PXYC 3HB3C 3LS4L 2A1WL 3KPNB 4QHNA 5K9QI 2OK0L 4C54A 5F96L 4HC1H 5IV2A 5JA8B 1X5GA 1U2HA 3IFPB 4PY7B 3NIGE 2AGJL 1G7IB 1WFUA 2FATH 4LVNC 3HG1D 3NTCL 4Y1AD 5DEZA 1NMCC 1F45A 4NQVA 3FT2A 4AT6B 4JPIB 5DUPH 1OSZA 2BVUA 3JXAA 5JW3L 5I16A 1F11A 3QCVL 2FO4B 5CUSL 1T0PB 5I19H 4G6AC 2V6HA 5ILTL 3QXDB 1KJ2H 1NCDL 4YFLF 3RA7H 1MCWM 3NIFE 4D0DB 4GRMA 3KYMB 4CJ0A 4JPKH 5EO1B 1FL3A 4B41A 2BRQA 4XX1G 3KDMB 4HK3N 4S1SH 1KTLA 1EFXA 4RFNB 4DN4H 4X6BB 1GC1L 1R5IA 1NFDA 3EHBC 2EDEA 5D9SB 3UTSB 3FO9A 1JRHH 4JR9H 3MRKB 3D3VB 1B0WA 4D0BB 1AFVL 3O81A 4ODXA 5DRWB 1KFAL 4ZTPH 2FYYA 1IKFH 4MA1B 4HJJL 1YMHB 3G6JE 2P7TB 4ZOAA 3VFOA 3UYPA 3F7VA 3EDJA 5I1JL 1HIMH 5E8OA 3U6RA 2H2PC 3K4DA 4U6YA 2R1XB 1QKZH 1DQLH 1N59A 5IEKA 3PL6C 3O2VL 4LVHB 4NSKA 5F8RC 1BD2D 2DYPD 2FL5B 5CGYD 4NHCL 3NA4A 1BFVH 1UA6H 1NCAH 5IVOA 1CLZH 3HE7B 1A7QH 4U6VH 4U7MA 1E28A 4P99A 1J1XL 4ONGH 5J1AA 5ITFA 3KPLB 5EA0H 1ZV5A 2F8VA 3C5ZD 3GSXA 1G7PA 4MWFA 3BISA 4IM8A 1RJZA 1QFPA 4JFZL 2IAMA 3H9SA 5LWYL 1BF8A 2ZUQB 4L8CA 4G80B 4OKVA 5ALCL 2HTKC 2P5EA 3RU8L 3OHXA 4K71C 5C2UB 4HUWB 2GT9A 4P4KB 4L3EA 2J8UB 5DFVC 2QKIB 4NM8H 3WHXB 3UMTA 5FAAA 4NHUB 1H5BA 1P4BH 3V6ZB 4XVUC 1EVUA 3EOBA 3U46B 3PDDA 3MOBL 1F97A 4OCXH 3K74B 3KYNB 3DJ9A 2AS5M 1MCJA 3PIQB 1A4JB 1UJTA 5LQBL 1N3NB 1GGBL 3D0VB 2PETA 3IFPA 2HFEB 4LDLB 4PY7A 1I3GL 4N8VB 2XV6B 4PJHE 1XF5B 5KSBB 4LLMB 1JFQL 4PGDB 4I3SL 2AJ3B 2CGRL 4JPIA 1XIWD 3QA3B 5E08L 4N0RA 5BMFH 4YDJB 5GRJL 2FO4A 3PV6B 4PLJC 3SGJA 1HKFA 4HIHA 2X7LA 3BDYL 3QXDA 4PJ9C 4OCRH 3CXHJ 3MV8D 4LARL 4UQ3B 4XI5C 1DCLA 4D0DA 1K5NB 3KYMA 5L2KD 4UIMB 5EO1A 4FQ1H 3PABB 4F7PB 4Z7OE 3KDMA 4LLVB 3RVXD 2OL3H 4WFFD 1CWVA 4G8GE 1QR1A 1EO7A 4X6BA 2R4RL 3TV3H 3VXMB 4KJPD 2AQ3A 3NPSB 5D9SA 3UTSA 1A9BB 1PG7W 3MRKA 3D3VA 4XP9H 1PG7H 4PLKC 4D0BA 4DAGH 3F6IA 1FL6B 3EGSB 4LHUA 2CDGB 5CJXA 2P7TA 3UX9B 1JYNA 4M1CD 4DK6A 4LCUB 5H35A 3VXUE 1IEAB 4YHYB 4AIXA 2R1XA 2YN5A 4YEFA 5I8CA 1CGXA 3FRPA 2HJKB 1J1PL 5JIKA 5IFHL 4S2SB 2FL5A 1CDHA 2MFNA 1S7SB 3UCRA 1UCBH 3DRTB 4TSAH 1SJXA 3C6LB 2MPAH 1A6AA 4I1NB 4M3JA 4HFUH 3HE7A 5T3XL 3WFZA 1VFOA 3QJFB 3HCVA 3KPLA 3UTTA 1BF2A 4Z7QE 5DZOA 3VH8A 4TSBL 3DROB 1FBIH 4NWTH 1ZLSH 1I1CA 1ONQA 3IETB 2VITB 3WD5H 4WO4D 1MCFA 4HUWA 1DQDH 4P4KA 2J8UA 4V1DA 5CP7B 2QKIA 3WHXA 5A16B 4Y4KB 3MJ9H 1JNHB 1JUFB 1D6VL 4NHUA 4JN1H 3VFRB 1Z5LB 5C0EA 5TGBB 1T0MB 1AQKL 1WC7B 2JCCF 3BHBB 5ESAA 1XFPA 3ZYOA 1G6VK 6FABH 4PJCA 1I85C 3U46A 1Z2KA 2IPUG 2HKFL 4GRWE 3THMH 2FBOJ 2UZIH 3KYNA 3DSNA 3TH3T 1P7HL 1A4JA 5FYKE 4GQPH 2PO6D 2E9WA 1AKJB 1HE7A 1N3NA 2HFEA 5KG9B 4LL9A 1RURL 3B9VA 4N8VA 5E2TH 1UB5B 1CLYH 4BM7A 1G0YR 1XF5A 4OIBA 4LLMA 3Q1SH 3SJVB 3C08L 1XR9B 4PGDA 4Z0BL 3QA3A 4FTVE 3QNZB 4YDJA 5F71A 3PV6A 1Q1JL 4O5LH 1FCGA 2EDLA 4UQ3A 4U7SA 4G7YH 1K5NA 5IB1B 2E6PA 2L0DA 4UIMA 2DQJH 2NW3B 1G0XA 4K07A 3PABA 2YPKB 4F7PA 1UM5L 1AHWC 3A67L 4LLVA 1YQVH 1QO3B 2DIAA 4XAWH 1CLCA 1YMMB 3VXMA 1RMFL 4GW1B 1H5BC 4U7KA 4TTDD 3SKUD 1ZVYA 3C5SB 2HT3C 4RAVB 2ARJQ 2IQ9H 1A9BA 1BMGA 1N7ML 2X4OB 4HFWB 4ONOA 1A3LL 4X6DE 1TNNA 2C3HA 1Y6KR 4NKIH 2CDGA 3D39B 3PP4H 4MGXA 5FUCC 1RZGB 2FBJL 3WKML 3DNKA 2HKHH 4Y1AE 1PZ5B 4LCUA 4F58L 1TNMA 5T5FH 2WWMC 1IEAA 3VE0B 2YPVL 3RTQB 4MA3A 4P2QE 2EEDA 5ABDE 4J8RB 2WM0A 4D94A 1JHLH 4RX4A 3OKNB 2H1PL 1S7SA 4XX1E 3DRTA 1A7NH 5I6XC 2CJUL 3C6LA 2EH8L 3SDDB 5B22A 4EDXB 4LMQE 5GGUB 4HXBL 1U42A 3IXAB 3BAEL 4RGOL 2H2SC 3QJFA 4E0RB 4LAQL 2HMIC 3LB6C 2VJXA 5CJQH 3JV6B 1IEBA 3W0WE 3DROA 4G8IB 4Z7UB 5F1SA 5J1TC 2J4WL 3JVGA 3PQYE 3IETA 3OTTA 5H8DA 2VITA 4QTIL 2DOCA 5CKGA 5HVGB 4G9FD 3KWWB 4ODSL 4PP2B 5CP7A 4JANA 1UCTA 4Q6IB 4Y4KA 4GAGH 1JNHA 3B2VL 1EHAA 1JUFA 4PJIF 3VFRA 3VWJC 4FA8A 1Z5LA 4F57H 1M71B 5EUOE 5CJXC 4YHKL 3GRWL 1T0MA 3SGDI 5FUOH 2VSDA 3HKFA 3F58H 5HDOA 1C16B 4ZS7H 5DUMH 2YD2A 3ARZA 1G7MB 1F00I 2J5LC 3MV9D 2X4QB 4ODBD 3BUYA 3EOYG 4GMSL 3ARYA 1AKJA 5TQ0H 3MGAA 2GJZB 5KG9A 2PF6A 5TQ2H 4JDTH 1TTUA 1UB5A 1U0QA 3PGDB 4UIKH 5IMMB 3EW3B 3SJVA 2O5ZH 1XR9A 4ZG1A 5SX5H 1GCFA 3HC4H 5DS8B 1H3PH 3QNZA 5IMLB 3DWTA 1VFBB 5BJTB 2GJJA 2Y07H 1A1NB 2W9DH 1KPRB 1MOEA 1S7XB 3ULUD 1R3LB 43C9B 4H0IA 5IB1A 1U95B 2NW3A 2YPKA 1XGYL 1QO3A 1YMMA 4LLYB 2PYEB 5I1GL 3C09B 1MPAL 5AZEL 3SBWA 4PIRF 4HGKC 3VFPB 2BSSB 4KJYB 4BKLB 2X4OA 5HY9B 2NZ9D 4HFWA 4RAHA 3IXTB 4ZSOE 4B50A 2V17H 1VGEH 3S37L 3D39A 3VI3F 1RZGA 2B1AL 3ZKSD 1SY6L 1PZ5A 2NR6C 5J3HD 3ULUF 1U8NB 3A6BH 2BDNH 4WRLA 1CXKA 1PKQE 3IU4H 3VE0A 4CMHC 3RTQA 4UNTA 3G5VA 5T33H 1E6JH 4EIZC 4KRPD 4J8RA 3CDGB 1JGVH 2VXUH 3OKNA 5HVHB 1WITA 4RDQF 5L2KE 1JBJA 5C0JB 1JJUA 1KLUB 3SDDA 1DL7L 1NCWL 4EDXA 5GGUA 5JXEA 3IXAA 3VGHA 1N6QH 3D2UD 5DJZB 4E0RA 5F8QC 3NCCB 1V3LA 1AY1L 3OXRA 5EDXA 5EBLB 4B5EA 1QPXA 3JV6A 1CDUA 4G8IA 3MZTA 3UZQA 1UH2A 5HHOE 4Z7UA 1AXTH 4BYHA 4NN5B 1T1WB 3NPSC 4XHJC 1CK0L 2Y6SD 3KWWA 4IIQC 3PG2A 4P0DA 4PP2A 4Q6IA 4ZXBB 1J5OH 4D9RE 1GGIH 3RX7A 1ZT7B 4MMXC 1HHJA 3WXWH 1MNUH 5CAYB 1OWWA 1U93A 5LGHH 1QSFB 3CX5J 5FCUH 5AUMB 1C16A 1U92B 4TOYH 4M4PA 3QSKB 1A21A 3P73B 1G7MA 5DT1L 4K8RH 3K2UH 4O4YL 3QDHA 2X4QA 3QULB 1MIEH 2JCCE 3TIDB 3B3IB 4Z7WB 1TQCC 3O6LH 1CT8B 2GJZA 3QWQB 5JTWA 3RVTD 3ZT7A 1DBKH 3PGDA 3C6SB 4J6RH 4LAJH 4O02L 4XBEL 3FB8B 4TVPH 1VFBA 1BJ8A 2R69L 2GUOB 1A1NA 4HCRL 1H3UA 1KPRA 4M43H 1VKXB 1A7OL 4UDTB 1S7XA 3TYFB 1R3LA 43C9A 5C86A 1U95A 4P5TC 2C4FU 2VYRE 2VLRB 1OAXH 4YFDB 3FZUC 3PDGA 2HH0L 3E6HB 1XAUA 4LLYA 1MQKH 2PYEA 4HWEL 3SO3B 1I3VA 3D48R 5GZOC 2H32H 4OF0A 3FMGL 5KVDH 4OD2B 4YGAB 5E9DE 5JIIA 5HY9A 4BKLA 2BSSA 3IXTA 3JZ7A 4JPVL 5ANME 3GNMH 3ELAT 3C60A 3F8UB 3FN3A 4OBSA 4LSRL 1YC7A 5GXBB 1TXKA 3RWGB 2YRPA 3FB6A 2WBJC 1JGUH 3MMEB 5EU5B 4ENEC 3BXNB 5BCAA 1FDLL 4TUOB 4X80L 4AMKH 1QA9B 4NC1C 4Z8FL 3KPPB 1KLUA 3ARWA 4MNGB 2KUTA 5DJZA 2ZP0T 3ZKND 1FNLA 1DDHB 1HWGB 3FQUB 4MJIE 1UGNA 5EBLA 5FM4A 5DJAB 5T3XD 1EV2E 3WCYA 2F53B 3ZE2E 4XVSH 1T1WA 4YXHH 2RAMA 1JPFB 1HI6B 3L5XH 3JUZA 4ZXBA 4Z7VA 4OIIH 1ZT7A 1LO2H 1TJIL 3KJ6H 3SDXF 2C9AA 3H9ZA 2APVA 4OV5B 5F97E 4KI1A 5AUMA 5FXCH 1U92A 4QRPB 2ZUYA 4PJIE 3P73A 3VMOA 3BEWA 3MBEB 5GRUL 3QULA 4XCYB 3TIDA 3B3IA 4R26H 4Z7WA 1A6TB 2HT4C 1CT8A 1ACYH 5CILL 4HLJA 1IC7L 4HX1B 2LQRA 1KEGL 1N8ZB 3C6SA 1P4LB 2BSRB 1YEHL 5I1HL 5EU6E 3FB8A 3HI1B 2FJFB 1EO5A 4K7PH 25C8H 2ADJB 3C9NA 5FUZL 2BOBA 2E8ZA 2GUOA 4G9FE 4N90D 4NO0D 1VKXA 2Z31C 4AEIL 4Z76B 5I30L 5IBUB 1CBVL 3O6MH 4UDTA 5I73B 1YEGH 3FB5B 3TYFA 5DLMH 2CKNA 2Y36L 1QYGH 4EDWH 3E6HA 4MXVF 1RUPL 1MVUB 5ADPH 4L8DB 4R90L 3OJVC 5K9QG 4N0UB 1X9QA 1ODAA 3IGAB 4DKEL 3O45B 3W9DB 2P5WD 3OF6A 3U7WL 1IGMH 1J8HB 1OAQL 4UBDC 2EDWA 4QRRD 3RZCD 4JEGB 2EC8A 3RAJL 4K3JH 3P11H 4XNYL 1TZHB 1DEDA 4IMLB 2K9UA 4QCIB 4UT6H 5FYJU 5F89B 4NBZB 4ZNEA 3RWGA 4ALAL 4F8TA 5ERWB 2FECL 3VI3E 3CMOL 5EU5A 3BXNA 3TFKC 3HB3D 4OGXL 4TUOA 5KW9L 3KYOB 1TPXB 3ULUE 1QA9A 3KPPA 4U3HA 4Z7NF 4MNGA 1RZ7H 2OX5A 2NTFB 1DDHA 3FQUA 1B6DA 2AERT 2H45A 4FABH 3SDYL 3ARUA 2IWGA 5AWNL 2X40A 1DVFC 5DJAA 1DP0A 1ZGLB 5D1ZB 3S5LB 4HG4K 1VB9A 1JPFA 1OAZL 1HI6A 4XXCA 1FNFA 2APWA 4HUVB 3I2CL 4P2CG 1NJ9B 2DQTL 1HYRC 2PTUA 3IFLH 4OV5A 5HHVL 2AVGA 5T3ZH 3DMMB 2HFGH 4QRPA 3L1OH 4NZRL 5KVFH 3MBEA 4H1LB 1MFEH 4LCIL 4XCYA 1BREA 3SGKC 3O9WB 4KRMB 5EOCJ 2GKIA 2R29L 5D7KE 4G43B 4OCWH 1RU9L 4HX1A 4PYHA 3B2UC 3GSNL 2CK0H 3FHAA 2H2PD 3IDJB 3KJ4B 3BYTA 4A6YH 4M5ZL 3RFZC 3STBA 4RGNC 1NC4D 3HI1A 2FJFA 1WFNA 2ADJA 1H3WM 3DUUB 3PL6D 5E2WL 2AJSL 4P5KB 3DSFL 4Z76A 5EG6C 3EFFB 4LVEA 3VWKB 3FB5A 4LLAA 3BE1L 2BP3A 2X4UB 3VFGH 4EKXA 5JR1H 4I3RL 2UZXB 1RUAH 2V5MA 5LGKA 2HN7B 1MVUA 2Z9TA 5EU3A 1WAAA 4N0UA 4YXLL 2HTKD 1QBAA 3O45A 3W9DA 1FYTE 1J8HA 5EZLB 4P3CL 3F5WB 3HE6C 4HBCL 4JFXB 4TRPL 1S5IH 2ZG3A 1TZHA 1HK6A 4IMLA 3L3OB 2DRUA 4L4TE 4QCIA 1RULL 4XRCA 2P47B 4XVUD 2FEEL 5BV7H 5F89A 2HRLA 1R3HB 3BPNC 1SBSL 5ERWA 3UP1A 4JM2B 5I1IL 4KMQA 3QXTA 5JQ6H 1CFQB 2Q6WB 1OTTC 2FD6H 2KZ1B 2R4SH 5L8KB 3LRHA 2JELL 1C1EH 3MLWH 1MREH 2RFXB 3WUZA 2XZZA 3QDME 2XOTA 2YUWA 2R2BB 2ZCLL 2NTFA 4KRLB 2WMPA 1TQBB 4LU5H 2W9LA 3JTSB 5AEAA 3TP4A 5K33A 4EVNB 4XMKL 3INUH 1KIRB 1CF8H 4MNHA 3U48A 3WIHA 3RGVC 4Y16B 1ZGLA 3VGDA 5D1ZA 1L7IH 3S5LA 1EMTH 3DTXB 4XI5D 2KKQA 4LASH 3OPZH 4Y4FD 3KPSE 1AD9A 2XG4A 1IC4L 5HTSA 1RIVL 4PJFF 1NJ9A 2W0LA 1YEIH 1EGJA 3U4EB 1CXIA 3UJIH 3RDTA 3DMMA 4Y2DC 3QPQC 4TULL 1T03L 4YBHA 4OGZA 4MD4B 5E2UH 2DQUL 4R4NC 1YA5A 1MEXH 4H1LA 3SDXE 1H0DB 3W2DH 3O9WA 1NBVH 5FGRA 5A2FA 4HC1L 1N0LA 3G04B 4G43A 5HHPB 4ZFZB 2FATL 3O11B 3GBML 3IDJA 5C6TL 1T20B 1YEDB 4L29B 3MFGB 2FHCA 4FG6D 5T3XE 1T1ZA 4ZUWB 5I19L 3OG4B 4QTHB 3DUUA 3LPFA 3TPKA 2D7NA 5CEZE 5L7XH 1S8DB 4P5KA 3RA7L 1UVQB 1JF1B 1I8LC 5FA4B 3EFFA 3VWKA 3WO4B 1QRND 1CL7I 4JPKL 1CDCA 2X4UA 4S1SL 4K2UH 1P69B 1LE9B 4I8DA 4C57C 2P49B 2VDMH 2DLTA 4JR9L 1T5WB 3FFCA 4MXVE 3QG7H 2ZG1A 5EZLA 2VXSH 43CAB 2AV1B 5HD8C 1IKFL 2JB6B 4DJMA 1G6RL 3WNMA 2XZAH 2OYPA 2VDNH 1T6VN 3VDCA 3L3OA 4EN3B 4ZFGL 5AG9A 4WWKC 1HIML 4HQQH 4Y8AA 2VDOH 3OAYH 4JM2A 5E70A 2VUYA 1RJCA 5SWZE 3R0NA 1G9EA 1QKZL 1DQLL 4LSSH 1CFQA 3N1QC 4N90E 1P5UA 2AK1H 3BFOA 3HRZB 3U7YH 2EEAA 3BDBA 4X9IA 1A7PH 2K3TA 1BFVL 4GH7B 3GGWB 4MS8C 1NCAL 5B39G 2RFXA 2E27H 4R4FH 1A7QL 4U6VL 5D6CA 4ONGL 2R2BA 1MCPH 1MJUH 3RIFF 3V4UH 4ZNCD 2A9MH 4AJ0A 3WO3B 3JTSA 3QT2A 4Z7NE 2JIXD 1KIRA 2R0WH 3KLDA 4Y16A 4HF5L 1U8HB 4QRRE 2DI9A 2CRYA 4XHQA 3AMLA 4NM8L 5EWIH 2XN9E 2Z4QB 5I8KH 1IGIH 5EOCL 4H8WH 5DMYA 2W38A 3GMLB 1CGWA 3U4EA 5ID1B 4JKKA 2XYCA 1SBBA 4MD4A 5IGXH 3JWDH 1RZIB 1H0DA 3OKKB 5J1SC 4PJGE 5J13B 1T21B 2MCG1 3G04A 3QUMB 5TF1H 3PJSB 4KAQH 3QR2A 4M62L 1V05A 4NN6B 4BUGA 2WWMD 5E4EB 3O11A 1A1MA 5D72L 4OLUH 1T20A 4L29A 1FVCB 2BVYA 5GRZA 5SWSE 4DTGH 5BMFL 4HK0B 4ZUWA 2VXQH 4QTHA 3ARSA 4ZS6C 3HFMH 3O6FC 1X7QB 4FQXB 1S8DA 2H6PB 1JF1A 3B8SA 5FA4A 3OKOB 1YZZA 1MFCH 2K7QA 5IVXB 2ORBH 4PRNA 3OBAA 1I1FB 4FQ1L 2NXZC 3MJ8B 2XWJB 3L3KB 5DTFB 5GGVY 5MP6H 4PD4K 2Y5EA 1KELH 5L88L 2HMID 3LB6D 3TV3L 1WFOA 2P8PA 1YC8A 5B38G 1INEH 1JHKL 5DYOA 5F93C 3O3EB 1LK3L 4XP9L 1PG7L 1T5WA 4DAGL 3M1BB 2IPTH 3QIUB 4R2GC 43CAA 2AV1A 4OQTL 2JB6A 4RBPK 2NY6B 3VWJD 4EN3A 4ERSL 1PJ9A 4HDIB 4WW1B 3SCMD 1B0RB 4NP4H 1R3KB 3NZ8B 4RWHA 2NMSA 1MJ7H 2R0LH 3KYAA 1Y6MR 5K59F 2WWKT 2IJ0C 4KTEL 3P4NB 4U6TA 5BOZG 2E8YA 5E56A 3HRZA 4NQXA 1C08B 4JREB 2ZUSA 2MOVA 1UCBL 2OI9C 3GGWA 3KAAA 5JPNA 4KUCD 1V3KA 2MPAL 1OAYH 4HFUL 2CLZB 5D5MB 3WJLA 3MUZ1 4JVPA 4LEOB 3VWKC 3OAZK 4J23A 4O00A 5B4MD 4PRPB 3L5WB 1FBIL 4CRPA 1ZLSL 3SKNB 3WD5L 1U8HA 2VDKH 1DQDL 1IGCH 2WUBH 1TJGH 1U36A 5HHMB 4AEFA 4I9WE 2Z4QA 1P7QD 3MJ9L 4KWUA 2VIRB 3FOMA 1OTSC 3NFNB 4FMKA 3EYQD 3WLBA 2A6KB 3GMLA 4CAGA 3HZMB 5ID1A 2OLDA 2HG5B 1GZQB 3THML 4D9LL 2UZIL 4KK5C 3RWIB 1RZIA 1YEJH 4PJFE 3OKKA 3H7LA 4J4PA 3D0LB 4WEUD 5C0AB 2J2ZA 3ARDC 2E7MA 3QUMA 4X6CB 2BXYA 2IF7A 2NR6D 3L95B 3LIZH 5D93B 3MRDB 5E00B 5D2NB 3GMMB 1KJ3H 2R2EB 5IKCB 4FP8H 2FGWL 1FVCA 4P23B 4XC1L 5DJ2B 4KHTH 3JWOC 3TWCL 4F2MA 4FQXA 4XMPL 3EYVB 1YNLL 3OKOA 4KK6C 4ELMB 5IVXA 4I77L 5C1MB 5EZJB 1I1FA 3GDBA 4L9LC 4LGSB 3MJ8A 2XWJA 3L3KA 5DTFA 5F1IB 1XT5A 5HGBB 5KSAD 4ZTOH 4XAWL 4MMZC 1F6FB 1NL0H 4ZD3H 3QXUA 4G6MH 4MD0B 3QIBC 4OZIB 1FZJB 4DWHA 3GHBH 3O3EA 3U7AA 4XHJD 3EO1B 3M1BA 4GXVL 4LSPH 1N4XH 3MFFB 4RCAA 4PJ5B 4AEHL 5KSBF 3ZL4L 2EDXA 2I9LB 3CVHL 4NKIL 3QXVA 4WFED 3MREB 4MX7B 4JRYB 3QUXC 4JG1H 5LG1A 5T1KB 4PJBF 4WW1A 1B0RA 4KVNH 4DGYL 3MOQA 4GKOA 3LDBB 4GXUN 1BEYH 4MB3A 4I0KA 1G9MH 2R0ZH 4Y5YB 3ALPA 3X12B 5E4IA 1QRNE 4WV1B 1A7NL 4XBGB 1TVDA 4IJ3B 4QGYA 3ECBB 3UTPD 5D5MA 1JIBA 1T2XA 35C8H 4LEOA 2DM3A 4LSQH 2NTSP 5BRZB 4FFZH 1FFQA 4PRPA 1A14L 2JLLA 3GSQA 5FKPB 4HKZB 3L5WA 5E8NA 1LK2B 1NFDE 3EO0A 1EAPB 1UG9A 4TUKH 3SKNA 1ZGLM 2YXFA 4GG8B 4J3SA 2EIDA 5IB4B 1B9ZA 2ZJSH 3ORJA 5CGMA 4P5TD 2CH8A 2VRAA 1AH1A 5ICXB 3FZUD 2VIRA 3HPLB 5IVNA 4K94H 4F57L 3QRFM 2A6KA 3A6CH 4BH8B 1DUZB 4G9DB 3MV01 2HG5A 4LF3A 3HLAB 1HDMA 4ZS7L 5DUML 2C3GA 3RWIA 5HYSB 4BFEA 5IWLC 5ELIA 3D0LA 3H7BB 5C0AA 5TQ0L 2LV4A 3MA9L 4X6CA 1E4JA 5D71H 5FEBA 3L95A 4WJ5A 3C87A 4UIKL 1T1XB 1AGFB 4WU5B 4PFEA 5E00A 2AK4E 2O5ZL 5D2NA 3TBYB 2WBJD 3GMMA 4MDJB 2R2EA 3HC4L 1FL5B 5TE4H 2HWZL 5DJ2A 3DV6B 4ENED 4RIRB 4Z0XA 1XGPB 2Y07L 3CSYB 3ME0A 1RFDH 2W9DL 3EYVA 5ETUB 1OCWH 4ELMA 5EZJA 2DMBA 4WNQB 2P48B 1A6VL 3ARGC 1BQHG 1DFBH 4GAYA 5F1IA 5HGBA 32C2B 4PS4H 4JO3L 4K55A 4XPBH 4BZYA 4NQDD 4OZIA 1FZJA 1C7SA 4MXWH 5E7FA 1F4YH 1WUNT 2X9WA 1T04B 3RVUC 3RKDC 5SX4I 1YJDH 1T5XB 1U8MA 4PBWD 1D9KA 3EO1A 3CIQA 4J3OC 4Q0XH 2V17L 3MFFA 1F2XK 4JB9H 1VGEL 4PJ5A 5FUCE 2I9LA 2V2XB 5CLTA 3TO4C 3UPAA 3MREA 4MX7A 1LO0L 2BRRL 4MQ7B 5T1KA 5JA9A 3EDFA 2RCSH 3A6BL 2BDNL 1XF2B 1AE6L 2X4SB 5JUEL 5T33L 1NANH 4NJ9H 4JY5L 3L6FB 4NN6C 3PP3K 3CSGA 5INDB 3MOAL 2UVEA 4HWBA 4Y5YA 3X12A 4M7JL 4WV1A 2DQCH 2HT4D 4DGVH 3ECBA 2VZ1A 12E8H 4AYFA 1N6QL 1NBZB 2G2RB 4LLDB 5BRZA 5AAWA 5FYJL 4MQTB 4WW2C 5FKPA 4LVOB 4PJ8C 5GRVL 4HKZA 3BX7C 1HNGA 1QVOB 4JRXB 3U4BH 1JV5B 3AAZB 1J88A 4Q9QL 4YHLH 2VDPH 3ZKQD 1AXTL 3VDAA 1EAPA 1L6ZA 2YPLB 1UJ3B 3UTSE 4I48B 4GG8A 2Z31D 3D3VE 4LSVL 5J56B 2X1OA 1FV1B 4KPHL 4YPGA 1GGIL 2CRZA 1T89A 5BQ7B 3QIUC 3CFJB 3HPLA 2ATPB 2ZCKL 4XCFH 3RY6A 1MNUL 4BH8A 1DUZA 4G9DA 3PHQB 3O4OB 1JPTL 3H3BC 3HLAA 3QO1B 3RPKA 5LGHL 4JO4H 1B2WH 5HI4C 4KKCC 1HYSC 4TOYL 3MLSH 2HTLC 5E1HB 3MXVL 4HIXH 4L9DA 3T1FB 4UBDD 3H7BA 3R8QA 1A2YB 1G9NC 1AR1C 4NQEA 3O6LL 3VGAC 3BD3A 2BC4B 3SKMB 4JREC 2XWTB 1DBKL 2NCMA 4URTB 1T1XA 1AGFA 4WFHD 4WU5A 2Y7QB 1YY9C 3VFMA 4J6RL 1S7UB 4MDJA 1MUJB 1FL5A 1GRWA 4OZGA 3RIAF 4QXUH 1OY3B 3T65B 4C56A 3TFKD 4JZOB 4RIRA 1XGPA 4K9EH 3CSYA 3QNXB 5ETUA 3VXOB 4DUWA 4LFHG 1LEGB 5FOBB 5C08D 4MJ4A 1QFHA 5DK2B 2JTDA 2OMNA 2D31B 1ZANH 4WNQA 2CUMA 1OAXL 2NY5H 3OX8B 5DO2C 3DHJA 4JFED 32C2A 5MEND 1H8OA 3E6FB 4GOSA 1P9MA 2IALB 1VHPA 4X4MA 1DVFD 5KVDL 3EJZC 1QHPA 4BK5A 1T5XA 4P2RD 5GHWH 3N0PB 2WANA 2IC2A 2IEPA 4WTZG 5DRXB 4YUEH 5I1KL 1P7KB 5K9JL 1P84J 3G6JB 4E41D 4MQ7A 1KSRA 1MCHA 2ADGB 3Q2CA 3RUGB 1XF2A 4BQ6A 2X4SA 2F5BL 1JGUL 5KSBE 3E1F1 3GZKA 2EEBA 3L6FA 4U4BA 1NKOA 1RUQH 2A6IA 5INDA 2CUIA 4AMKL 4PJBE 4P23C 5DXWA 4JFDD 1R5VB 3MRMB 4Y5VA 4M6NH 2DQEH 3MRBB 4HK3J 4TNWK 5J8OA 6CGTA 5EULV 1ZVSB 3AREB 1NBZA 2G2RA 4LLDA 2VLKD 4HULB 1R5WB 3GI8L 1QVOA 1H9VA 3H3PL 1JV5A 4BZ1L 1J12A 3AAZA 3VXME 4RGND 3W9EB 5C2BH 2B4CC 4QRSA 2YPLA 2EE9A 3UDWC 1UJ3A 4XVSL 3IJYB 1UADC 4I48A 4YXHL 5C8JB 2BVEA 4N0YH 2DKSA 4WFEE 2VOTA 4CVUA 1MCDA 2RBLA 3MROB 5BQ7A 2ATPA 2OZ4L 3KPTA 4ODTH 4KVCH 4XWOC 3PHQA 3QO1A 5CS7A 3V4PH 3MRGB 3CDYA 3WL9B 4NC2B 5HDBF 3QUYD 5CBEB 1F42A 3X3FH 3T1FA 1J05B 3LDBC 4QHKI 1A2YA 3HE6D 2YD7A 3IB4A 2J88H 2WQ8A 3OB8A 4LHQB 2XWTA 1Q9WB 4IJ3C 4PJHB 3HZVA 1JZ4A 5IROA 3T65A 5CBAB 25C8L 1OTTD 4JZOA 1X4YA 1JPSH 1N6UA 2FHBA 2OR7A 3VXOA 1LEGA 3O6ML 3WNLA 5DK2A 5C0FB 2CKBL 1FQ9C 1BPVA 3O8XB 3OX8A 1QYGL 4EEEA 4EDWL 3LN4B 2A2QT 1MHCB 1LP9B 3MRIB 4JFFD 3EZ8A 1T89C 1EGJH 3E6FA 5ADPL 5F9DC 1K3ZA 2IALA 4Y19D 5JMOC 3G5ZB 2J6EL 3TO2B 2EYRB 4DW2L 1EJOL 4FQIH 4RMRA 4W81A 3TCXA 2AJYH 4GRLB 3RGVD 3RPIB 4KXZH 1PFCA 1N5AB 2W60B 1IGML 4QHKJ 4EI5B 4NNXB 1MJ8H 4X8XA 3MODH 5DRXA 1ZGLP 5C70A 1CFVH 4K3JL 3P11L 1A47A 3G6JA 5J7CC 3P4OB 2IMNA 3CFDB 2KZWA 2ADGA 4F9LA 4J7RA 4UT6L 2ARWA 3RUGA 2LE9A 5EZIL 4Y2DD 3QPQD 3G9AB 1X5IA 1Z9LA 1O7SA 4R4ND 1IQDA 2QQLL 4UU9B 4NC1E 1QRKA 3LV3B 1R5VA 2CR3A 4XPTH 3BW9B 5AYUH 3SOBL 3S88H 5TPWL 4OCLC 4XCCH 2FZ3A 5DI8A 1RZ7L 1ZVSA 3BKMH 2F8XC 3AREA 3QIWC 1MHEB 1WSST 3LSOA 1R5WA 3QFJD 1BVKA 1X5LA 3ZSTA 1QNZH 4FABL 5DA0B 4ODUB 1B4JH 2Z93B 2ICWB 4S11A 4YDVA 3W9EA 4NBXB 5FV2A 1AO7D 4IRJB 4YC2B 5JDSB 3IJYA 1C5DB 1WEJH 2CUHA 2DLFL 4UB0H 5C8JA 3GKZA 2F54B 3Q5OA 2Q8AH 4UTBH 3MROA 4JKPH 1QFUH 3U1SH 5JOPD 5DMIH 3DYOA 1RJLB 2DMCA 1KCUH 1FG2A 4HS8H 3SE9H 3ARTA 5T3ZL 1RIUH 5F7MC 3EDKA 4S1RL 2HFGL 3WL9A 3F6LA 5JHDD 2A38A 3ZSSA 4LQFH 4F15C 5CBEA 1A1OB 1G7JA 5KVFL 1OGTA 1I1AC 1Q72L 2I9TB 4PRHD 4D3CH 2JJUA 4AEEA 3SE4A 3RL2A 3WFEH 3SPVA 1Q9WA 4WWKD 3CX2A 5D70H 4PJHA 3SGEH 1NBYA 5KJRH 3I6KB 2OR9H 2IPUK 1QBML 2DMKA 1ZWIB 4A6YL 4YBQC 3ZKXB 1QSVA 4OF3A 5CBAA 4LVOC 4FTVB 1RUKH 5E6IB 1RZKC 3BMVA 4MS8D 4PR5B 5C0FA 2D03H 4Y0GA 1CXEA 3LN4A 5JR1L 4JPWH 1LO4H 1MHCA 3MRIA 1KXTB 1RUAL 1RZ8B 2Q7YB 3LKOB 1P6FA 4PJXF 1NGWB 3G5ZA 4X5XB 5HPMB 3BJLA 3TO2A 3CH1B 2EYRA 5T1MB 1OF2B 3FN9A 2GTZB 3I02B 4NBYB 2W60A 4P9HC 1NDGB 3U0PA 1CVSC 2R0KH 2X42A 4M00A 2UV3A 4NNXA 1IVLA 2W59A 2YWYA 1MI5D 1S5IL 3MRLB 3IRZA 1IGFH 3P4OA 1ZEAH 3CFDA 2MWCA 1KUMA 4WFHE 3HG1B 5BV7L 5CKAA 5DEGB 4PV9B 1K2DB 3EKCA 4K7FB 3P4LA 3U83A 3GMRA 2C4XA 2VZVA 3MV7D 2FD6L 4XMLL 2R4SL 4UU9A 2A9NH 5C0CD 4Y2OA 1ZLWH 3MRQB 3OZ9H 4IEFB 1R3IH 4PUBH 1K85A 5LCVL 3EAKA 4KQ4H 1MHEA 1HNFA 2YN3A 3S35X 1BFSA 3O2DA 4WUUD 3VG9B 3PHSA 5D1QC 2PYEE 2I25N 1GOHA 4ODUA 2Z93A 2ICWA 4KRNA 1IM3B 4KU1A 3INUL 4ONFH 4IRJA 2Z92B 4ZS6D 4C4KT 3O6FD 5TJWK 5FYJD 5JDSA 1C5DA 1CE6B 1FZKB 1BGXH 3BGMB 1EMTL 2HLFC 3S96B 2F54A 3OPZL 5GQBA 5EBMB 4E41E 2NXZD 1F5WA 4KI5C 1ZLUH 3D85D 4UV7H 1RJLA 5IHUL 3NCEB 3UJIL 3VI4F 4TNVF 3HC3H 1BBDH 4DKFH 1KB9K 1YECH 4M7ZB 3QXWA 1A1OA 4PY8I 3PV7A 4R2GD 3W2DL 1BD2B 2DYPB 2I9TA 1NC2A 2Z35B 1NBVL 3WFHA 2XQBH 1MH5B 2VLKE 5HDBE 4QEGA 4P4RA 3SDAD 3C5ZB 3I6KA 2IGFL 3V5KB 5K9KB 3N9GH 4LP4A 1ZWIA 2MSPA 3MXWH 1O7VA 4PRDB 1FNGB 5KBNC 4FTVA 3K3QA 5L7XL 5IHLB 4N68A 3RWDB 4FRWA 2P45B 4PR5A 1UH3A 3RBGA 3AB0B 2X70B 2B4CL 4J3TA 2YZ1A 3V7AE 1LWRA 1RZ8A 2X4NB 3HUJB 3LKOA 5DD5H 3TT3H 4X5XA 1NGWA 3K46A 1BECA 1O5DT 2I07B 3CH1A 2VDML 5T1MA 5J6GB 1OF2A 1QSFE 4RMSA 5D8JL 3S34H 2GTZA 3I02A 1EO8H 5FO8B 1NDGA 2IQAA 2VXSL 3FJTA 2OXHA 2XZAL 3QUMH 3MRLA 2VDNL 1KEMH 4Z7WE 1OTSD 3EDDA 3V6OC 1U3HD 3QG6B 1A02N 3GIVA