2OQJB

Crystal structure analysis of fab 2g12 in complex with peptide 2g12.1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 2G12 light chain
publication title A peptide inhibitor of HIV-1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 224
sequence length 224
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB01
5T3XD 5DGRA 2CGRL 4GKNA 2C3XA 3AREA 1XIWA 1BF2A 4YQXL 2AV7B 2W9DL 3SKJL 5IHBA 3P30H 1RMFH 4BSVB 4XPAH 3QDGD 3PWPE 2DDQL 4XNQA 4GG6B 5GRVL 4LCCC 4ONFL 4QCIB 1S7WB 1VFUA 1JGUL 2BOCA 4LMQI 4U1IB 5CSZA 5I19L 4P46A 5IM7A 3ZE2F 3RVWD 3V7AG 5JDSA 3RGVB 1HINL 1VERA 3WLBA 1KUMA 2KQMA 4WFED 2NYYD 2PR4H 3DBXA 3P77B 1CDIA 1S9XA 2MPAL 4IIQC 1G7HA 3QCTL 2RBLA 3TIEA 5CJXA 2OP4H 1SJHB 4OCSL 1XCQB 2HJKB 4DZ8B 3T77A 4U6YB 1NBVL 4ETQA 5J13C 3GMPA 4OQ1A 5IMOA 1NFIA 3OPZL 4MAYB 3F6LA 4EOWL 4OLUH 1IBGL 4PV9A 5C07A 3QIUA 3VWJC 5DURD 1A02N 4CVUA 4M1CC 4KKAD 4WFGD 4PG2A 4S0SD 5D72H 1JPFA 2EEDA 3T3PF 1EEYB 1D6VH 3L3KA 5FYKD 3K1DA 1I9IH 3MOAL 3JTTA 1OTTC 2LV4A 5T1LB 5CBEB 4MA1B 1XEDA 5JZ7C 1M71B 2VDLL 3U4EA 3HG1E 1AIFB 4J2XA 3WFHA 2VABA 2PCPA 1CGUA 1ONQB 4OB5L 2P5EB 1MJ8H 1HIMH 1QZ1A 1JWUB 1EAPB 3LKQB 3OXSA 4L3EB 5DVMA 5FHAH 4YWGL 1YPZB 1U41A 2QQNL 4MLIA 4Y16A 5HJ3A 1A1NB 3VMNA 5KAQG 4O58H 1R3JA 3EDFA 4UIMB 3QG7H 4YUEL 4KK5C 1MPAL 1WQVT 1WWCA 1LE5B 1JYWA 4JFFD 4ODVL 5KZCB 5ENWB 4W70A 3VXSD 1UH3A 2FX8L 2MOVA 3T08A 1WEJH 3MUGB 4MXQC 3GRWA 3G08A 3MA9H 2CXGA 4LCYB 5T3ZE 3RKDC 2UYLB 3K8MA 4CKVX 3NFPA 5F3BA 4D3CL 1F00I 4WUUA 5B3JF 5HHNB 3ZYOA 5IW1A 5F3HB 3OKKB 4M7ZC 1KF9B 1XGPB 5C0GA 3RWDA 2FIRT 2BVQB 4LHUA 4PS4L 1X7QA 3DYOA 3LEVL 4MX7A 3MODL 2E7MA 4QRRB 4YXKL 3GSWB 2A6JA 1P4IL 2HT4D 3MXWL 4OCRL 2DMBA 3JUYA 3BIKA 5HGBA 2ICWJ 5E4IA 2HG5B 4FZ8H 1NDGA 1PFCA 1MCCA 4LLYB 1BHGA 4BQ9A 5K9JL 3WHXB 4NRXB 5C0CA 1JGLL 1HXYB 2EECA 3BPLC 2VLLA 5IFAH 2IBBA 4OZGE 1IEAB 1AGDB 5JA9A 3QIWC 3I2CL 1ADQH 4OV5B 4Z8FH 3TPKA 1R5IB 1A1OB 4X4MA 1AQKL 1K6QL 5AWNH 4H88H 4QXTA 5EZOH 2F53D 5DVLA 2OMBA 4AT6B 4WHYH 4YJZL 5M7QA 1DQLL 1N0XL 5I8OH 3VDBA 4PRHD 2X09A 1IM3B 2CRZA 4ZMAT 1K8IB 4M7LT 1QLRB 1MHCA 2JKXA 5HYSG 1S8DA 4X9FA 1O7SA 1KN2H 2JB5L 1WTGT 3VWKD 4PPTA 2DM7A 4CBPA 1JN6B 5E70A 1QHPA 2H32H 4M7KH 4PLJD 4XCEA 4KTYA 1LO0H 4JZJB 3MRIA 2WBJD 4NKIH 1BM3L 5HHME 1HYRC 2AEPH 1KACB 3WSQL 1YYLH 2AJUH 3HFML 1RJZA 1LO5A 1LEKA 3VFTA 2ATPB 2JCCF 5F88A 1QOKA 3OHXA 1CL7H 1F4WH 3K80A 3K2UL 4FFWC 1FL3A 4ZSOA 2AAVA 1UM4L 4LAQH 5KW9L 3CZFB 4UT9L 3O2WL 1J8HE 4RIRB 3QUXA 4J8RB 4F2MB 4P5TB 3VH8G 4LPYA 5I0DA 3ZKND 4PJ9B 4X80H 4P49A 1F6LL 2ZPKH 1MCPL 3QO1A 2ADJA 2CLVB 3ROOA 2JLLA 3JV4B 3EFDL 4PRPA 4I0PD 5TE7H 1Z6JT 3QZWA 1JPST 4MJIB 3EKCA 4LQ1A 4MD0A 4J23A 4XTRC 3TFKD 2GT9B 4C55A 4HEPG 5EIVA 3S35H 3ZT6A 4N8CL 3ZSTA 3LS5H 2VAAB 1MFEL 4HAGA 2APVA 4R3SB 3FL7A 4LCWB 1IC7L 1NAMB 5A3ID 1NUDA 3IGAA 1FO0H 4Z78B 4LNRA 3HMXL 3OX8B 1AGCA 3ALWA 2R2BA 1W8OA 4BK5A 1HKLL 3AAZB 2A0LC 4DAGL 2X4QA 4JREC 3IJSB 4DVRH 4X6EA 2EDRA 4N0FA 3ULUF 1TPXC 3BESR 2L7JA 3QI9C 4F37K 5C0BA 5KSAC 2NR6C 3FZUC 1YEEH 3HLAA 3IAPA 3B5HA 4C59B 4QOKB 3BXNA 2DI9A 4R2GC 1MUJB 2NXZB 4Z7OF 4AH2A 4KRPC 5I8CA 1MWAA 12E8L 2B1AH 2WIMA 4LSUL 4YX2H 5D7LD 1DANT 1JPGA 4RAUB 2DM4A 5DFVD 1S7XA 5C9JB 3L3IB 1OY3B 4C56B 3GMMA 1ZTXH 3CFKB 1HSAB 5HHQB 2M26A 3K74B 3HPLA 4TSAL 5E8DH 1I7TB 2VQ1B 4P2QD 5ALBH 4IRJD 5CILH 4Y2DC 5LQBL 1N59A 2EO1A 1Q9LA 4ZS6C 2VDPH 1R5VB 4NC1C 5F7MC 4EDXB 3H2WA 1PZ5B 3GIZL 5HYSA 3UBXI 3RZCC 2F58H 2BNRB 3D85B 1IGTB 1PVHA 1CDHA 4WO4D 3KPOB 3C6LD 2NY3C 4QYOB 4NKMA 3ZE0E 1EBPA 2KL6A 1HI6A 4TTGA 4FN0A 1KB5L 2GTWB 2VISB 5FUZL 2W0FB 3I9GH 3FB8B 1A7RL 3ZE1F 4MNGE 2G60L 1MLBA 1RD6A 2F54D 3WNPA 3OAZK 3LQZA 3U9UA 4UTBH 5DVKA 5J89A 5L8KB 1F42A 4L29B 2GCYB 4M1GH 4YDJA 1RHFA 3QDJB 2ICEA 5I1EL 2DWEA 5DK0B 5GHWL 4X8JA 5C09B 1N8ZA 3AREC 5DRXA 1XIWC 4Z6AT 5AAWA 3FONB 4F9PA 2D0HA 1LWRA 4A2MA 1BFSA 1RZKL 3M17B 4NQTA 4YHZH 3M45A 2YUWA 5JQ6L 4OCYH 1NCBH 4EQ2A 5IF0A 1QPPA 3RGVD 1WJ3A 4XMKL 4BH7A 1AY1L 2JELH 2EYRB 2B4CH 3JSSA 1BX2A 4HUKB 4GRWH 1E28A 4NNYA 4XX1E 2I24N 5EO0B 1SEBA 4KZEL 5BV7L 1MAML 3MUJA 5SWQA 3O41B 3V4PH 4R26L 5J6GA 3LKRA 2FR4A 1ERNA 5CJXC 3C60D 3PXJA 5I1JL 4PJCB 3PDOB 1OSZA 2P5WB 4MAYD 5IUSA 5L6YL 1ORQB 3D3VB 4NRZB 2PNDA 1AD9B 1WZKA 3MLUH 1IEBB 3TO4A 2OZ4L 2FJHB 5DJZA 1WWBX 3PL6A 5SX5K 2EH8H 4U0RB 3KPRE 1A9EB 1WCBB 4ELMA 4JPIB 3QIUC 1LD9A 5ICZA 3DPBA 1YNTB 3H9ZA 4PG2C 3DURA 1BVKA 5T1LD 3UDWA 3OAZH 5E5UB 5FA3A 4I0KA 1C1EH 1PG7W 2P5ED 4DGIH 1GZPA 3RVUC 1QNZL 2EDJA 1HHKB 2XTJC 3FFDA 4QY8A 4HMCA 3B6SA 1DQJB 1I9JH 3S3SA 4GRLB 3LKSB 2HRLA 1B2WH 3DO3A 4NPYA 4Y16C 8FABB 1C5DB 3WFDH 1TVHA 3Q1SH 5TPWH 4JHAL 2CLZA 3MGTA 2CUHA 2H2PC 4MB3A 2XXCB 3HRPA 3LH2H 3F7VA 1O7VA 1TJIH 4OIIL 4JM2B 4ZUWA 5EN2B 4HXBL 3IFNH 1OARL 4L8CB 4KKCC 1MFBL 4KTEH 1A5FH 1PLGH 5TGBB 1UYWH 2OJZL 5FGCE 5HVWA 4ACPA 2VDML 1FSKC 4M61A 3OQ3B 4FQ1H 4YDVB 3PGFH 1S7SB 5ACZA 2NY5H 4NFCA 1B0RA 5TDOA 3TBYA 1YNKL 4L4VE 1MREL 4TVSa 5EU4B 1Y6MR 4KXZH 1P7KA 4K7PH 1FZMB 4R4BA 2P45B 4TULH 2EXWC 4HZLB 4PGDB 3OKNA 5TJWK 3STBA 5FUOL 3BPOC 3H9SB 1H5BA 1FVDA 1T89A 1CFBA 4LL9A 1UJTA 1Z5LA 2A6DB 1VFAA 3S37H 3NOIA 2ZOLA 2WWMD 3OF6A 4YPGB 4HFUL 1OL0A 1WBXA 4YHML 4JKMA 3N85L 1MCQA 4K7PY 1IGML 3GGWA 3EO9L 2B2XL 2OI9C 5EORH 5F9JB 4HHAA 4ODXA 4ZDHB 4FABH 1P7QA 1PG7X 3U4BH 3T2QA 1D9KB 2HKHL 4F15C 3V5DB 1GGBL 4PREA 3D1MC 1E4XL 2NLJA 4LVOB 4ODBD 2GSGB 4PJ8A 1OAXL 2EIZB 2IH3B 4YH6A 2ZSWB 2ZOKA 2DQEH 3DV4A 4I2XE 3HHRB 3FO9A 4LEXL 5I1AA 2R0KL 4Q9RH 3QXUA 4OLEA 3CVHA 4YLQT 1IGIL 4RFNB 1JMZA 5KANG 1QFWL 2ESVE 3SY0B 3BAEH 2F9BT 2GJZB 1INDH 2BP3A 4PBXA 4OAWA 2VITB 1NJ9B 3BMVA 1CE1L 3MLWL 3BYYA 4HS8H 2F53A 1T2JA 4MJ6B 4GBXB 4ZOCA 2ZUUA 4JGUA 1NC2B 3LS4H 4PRHA 2IFGA 5JHDA 3HUJA 2AVGA 3BT2L 5IROA 2FJFA 5HI3C 4G43A 1G84A 2MWCA 1Z9MA 4LF3B 4HBQA 3ARQA 3GI8H 1OQOA 1JNLL 2AQ3A 3QXAA 1URLA 4HH9B 2IAMB 3VXUA 5A43C 4IJ3C 1Q8MA 2DJSA 1T1XB 1RK1A 3U79A 3T4AA 4P5TD 1RURH 2WBJA 4PJ9D 5ACMA 1A1MA 3CXDL 3QUXC 4X6DE 1J5OH 1U8KA 1PEZA 1S9KC 3VJ6B 4R7NA 1FNLA 4GG8B 5EU6B 1V05A 5D1ZD 3WIFB 1MQ8A 2G2RA 2PTTB 1BJ1J 2Q20A 5CD5C 4Y4KB 4FQCL 4NO5B 4KMTL 1AJ7L 4HT1L 5TH2B 1D5BB 4M6NL 4MJID 3CDCA 2F5BH 5D4QA 2EDDA 3DXAE 3MRCB 2XWTB 4GW4A 4YC2C 4C57C 4Q9QL 1T1YA 3MRGB 3NIFE 2CDFB 1D5IH 3QXWA 4FXKB 5L2KD 4LMQE 1HHIB 2A73B 2WP3O 1H15A 4OKVA 1A7NL 1TVBB 4LCWD 3G6JB 3KJ4C 4X9BA 3CFEB 2E3VA 4EXKA 1M7DA 1MRCH 1O0VA 2LAAA 4XBGB 4UNUA 1I1FB 4DCQA 3T0EA 1UQSB 4N90E 3SGDI 4RRPG 4BH8B 1EHXA 2D03H 4ZOEA 3SKUD 1G0DA 2AJZA 3PWPB 3QQ9D 3C5SB 4LVNB 5DD0L 5A2LH 1QG3A 1NKRA 3MV7E 4PJAE 1NLBH 1QTYT 1HEZB 1B4JL 2XA3A 1F6AA 4HKXB 3WIIH 5BO1H 4TVPH 2R0LH 4QOKD 4JAMA 2IPTL 4AIXA 2NXZD 5DEZA 3L5WA 3MLPA 1CBVL 3O4OB 2Y23A 3DWTA 3GM0A 3WS3B 4P59L 1CLZL 1U8IB 4PB0L 1ULVA 1JV5B 1OAYH 4U3HA 1FVCA 2VIRA 3PWJB 2BCKA 1CK0H 1YY9D 1AQDA 4WENB 4UTAH 1BVLB 4LLAA 5B39B 1RZIA 1WZ1L 1IC4H 1IC1A 1IRAY 4KUCD 1KEMH 3NCJH 3W11D 1CGYA 5ID1A 3OB0H 2R69L 5KSUB 3T0DA 1ZHBB 2BNQE 3O2DL 4NJ9L 4NP4H 3ARSA 4FZEL 3HNVL 5C08A 3L1OH 3UJIL 1YUHB 5D6CB 5A2JH 5F8RC 1I3GH 4MA8L 1E6JL 1YQ2A 3DSFL 4D0DB 7FABH 2BNRD 1EV2E 2OR9H 3MRKB 3D85D 3PWUA 4HKBA 1GGCL 2DN7A 3X14B 4EDWH 2PXYB 4I3GA 1T6WA 1R3KB 1NGWA 5EUOA 4J3WA 4UB0H 3TA3B 2HVKB 1V8HA 3S34L 2X4OA 4XVSH 2ATKB 5HYIA 1JZ3A 5DRWA 3C8DA 3ZE2E 5ANMA 2NY2C 3RVTD 4P2QA 4MDJB 3ARGA 1J0IA 2VDKL 3OAUH 4IOSD 1PJ9A 3LN9A 3ARBD 4HUMB 5TDNA 2OLDA 4MB5A 3L3DA 3LPFA 3QDJD 3P9LA 5DJAA 5DJXB 2W1NA 2Z8SA 5T5NG 3TNMB 5HDQL 5GPRA 4FQIH 5C09D 2DLTA 4PJBA 2EXYC 4Z76A 3QB7C 5KVGL 1MNUH 3FMGL 3OKEB 3MLZL 4OCNC 3DVGA 3NN8B 2F5AH 3S88H 5D2NB 2GJ6A 1UG9A 5DD1H 4F9PC 4WWKB 4QHMA 1HCVA 1FC1A 5DTFB 5EZJB 3T0WA 4CADA 2V5RA 4QRPD 3BGMB 4TN9A 5GRWA 2EH7L 4ZFZB 3FRPG 5CCKH 5ILTH 5BCAA 3GUTA 1ADQA 1N26A 3T3PE 4ZNEA 2UUDK 4P3WA 2OTUA 5KVFL 4MCZB 4WW2F 1JL8A 4MXVF 5K93A 2Z35B 1S7WA 5I71C 3MBXL 4U1IA 3EHBD 2P5WD 3LEYL 4XP6H 5D5MF 3DI3B 3QDHA 4NC2B 4S1QL 4YDIL 3IDXL 2GK2A 3PABA 3WFEH 3MJGX 1PKOA 3U7AA 1MSPA 5DUML 1R24B 4Q0XL 2R2HB 3BWUC 2W65B 1ZT4B 3TO4C 4UINL 1QRNE 2H32A 4OZGB 1I8IB 1VFBA 3PL6C 4K7FB 2XXMB 3B2VL 1XCQA 3QFJA 4LDEB 4TUJB 2HJKA 5DJCA 1IAIM 3X12A 4DZ8A 1AFVH 1T2XA 3NVQA 3LKPB 4S1SL 4EEEA 4ETYA 2BY0A 2RB8A 5F7UA 4RMUA 5D8JH 3DIFB 2OL3L 3ARTA 3UDWC 2IPUG 4LLWB 3SE4A 1I9EA 1TQBB 2A74A 4O5LH 1RJCA 4UILL 5GGQL 4U49A 5B3JE 2JB6B 3O0RH 1R0AH 3LPWA 2I9LA 1S78C 1NUNB 1N2RB 5IQ7L 1UB5A 5C6TL 1T2QH 4I9WD 3SQOL 4KKAC 1AH1A 1N6VA 3DTXB 2R2CA 3QUZA 1DEEA 1M71A 1AP2B 3GSNL 3NZ8B 5GGRB 1AIFA 5K9OB 3V7MA 3NFSL 1ONQA 4KDTA 2VXUL 4Y88A 1NPUA 5ETUA 3LKQA 4L3EA 4DW2H 4QEGA 5KG9B 5HHMB 1YPZA 5E6IB 2CUIA 2LFGA 2UUDH 4UIMA 1MI5B 4NT6B 3EYUH 3S98A 5DD5H 1VACA 3SOBH 1LE5A 2H3NB 4GFTB 1DQML 5TFSL 1A6WH 1WSST 1KCVL 3WO4B 3ZT5A 1FORH 1LP9B 4JFZL 3MRHB 3IKKA 1XGUB 1TXKA 4ORGA 1WC7A 5LAXA 3ZHKA 3MUGA 1PZUB 1A9BA 4LCIL 4M6OH 3JTSB 5FOBB 4LCYA 2UYLA 4H0IA 2XWJA 3BVNA 4TVPD 3H9SD 5DJDB 2WUBH 2R9HD 1FO0A 5I1LB 3UTTE 5HHNA 1CD1B 3OKKA 1KELH 3EJZC 1CFSB 1XGPA 1IGYA 1H5BC 1T89C 1EJOL 1EERB 2XZQL 4WW1A 1XFPA 4CN4A 2AI0L 4EI5B 3RPIB 4NJAL 4PJ5A 4QRRA 43CAB 3GSWA 2G75A 1M7XA 1JZ6A 1XGQB 2P44B 2ZNWA 1BBJB 1EFXB 3PWVA 3BDXA 4OI8A 2VDRH 1DUYB 2AKRB 5T3XL 2HT4C 4J4PD 1U8LB 1U91A 3BO8B 3WHXA 5J1AB 1A14L 1LQSR 3T65A 4DGYH 1HXYA 1NGQL 2JCCE 4PJ8C 4UT6H 3BN9D 4F7CA 1RSFA 1AGDA 1C5CL 2DQHH 1WT5A 4MD4A 4P9ML 4OV5A 2P43B 1R5IA 4KKNA 2D31B 2ZG2A 3VFNB 1DLFL 15C8L 5FO7A 4AT6A 2YD6A 3VA2C 5KSBF 1NC2D 5F7WC 4LSQL 4FMFA 4U2ZA 3DETD 4LBEB 4CN1A 1I1AB 3PP4H 4PP1D 2R0WL 3HI6L 5MHSD 3QUML 5K9KA 3HAEH 1P6FA 3CMOH 5IROC 5IGXL 1XF5B 1N0LA 3DX6A 4YHPB 4PP2B 1R3HB 3Q6GH 4HIIB 3ULVH 3IF1B 4F8TA 1TCRB 4JZJA 3RX5A 4X6FA 1KPVB 2XPGB 3LQAL 3S4SG 1ZKAA 3CVIH 1WBYB 1XMWA 1JTPA 5D7KE 4AMKL 2OSLB 4ZXBB 4PJFF 2ITCB 2VDNH 1MFAH 3TV3L 5IQ9B 3A6BH 4E5XB 2WBJC 2ATPA 1ZLSH 5B3NA 1T0NA 2A83B 1F4YH 4WGWB 4Y4KD 2DQTH 4JEGB 2VOTA 4ODTL 5FYKL 3OJMB 3IU3B 1NH6A 3BD5A 3O81A 3OJ2C 3GJFB 3MXVH 4J8RA 4GQ9H 3KJ6L 1KB9K 4YHLH 4P5TA 5E7FA 3ULUE 3TN0A 5IVZB 3BN3B 3PQYE 1FIGL 1JWMA 3ESUF 1LK3H 4OI9A 4MNGB 3A67H 4O4YL 4F33A 1CGTA 1GOGA 3BDBA 3HS0A 2FB4L 4UAOC 2HP4A 4U4BA 3ZL4L 4ERSL 5FYJL 2C3HA 1SYVB 4Z7OE 4BKLA 3JV4A 2QQLL 1CCZA 2XKSA 1M7IB 5D1XA 1VFOA 3EOTL 3U0TB 3I3BA 2XZAL 3T0EC 4ESKA 3IT8D 2XT1B 1UWEH 2OJEA 1N5AA 4L4JA 3WXVL 5F7HA 4H20H 4Y8DC 4PRIE 2A77L 1KIUA 1I7ZB 2Z93A 4R3SA 5DD3H 3RUGB 3SKMB 4PGEB 3IFOB 4MS8D 4NUJB 3GB7B 5IEKB 5E08H 3OX8A 1QFOA 1L7IH 4DKFH 5A3IC 2APTA 3AAZA 2VXTH 3UTSA 3CFIC 3SGDH 2EEBA 4HUUB 4JFOB 4Y89A 5TE6H 3KVQA 1AC6A 5AEAA 3T1WA 1A3LL 3AROA 3GJFK 4G6JL 3BRFA 1VCAA 5CKAA 4ZG1A 5IB1A 3EUUA 3W0WE 4HXAL 3KPQB 3MREB 1QKZH 3ZE1E 2O5ZH 2D3VA 5I30L 5HHOD 5DQ9A 3X13B 1P5VA 2APFA 4FFVC 4RBPH 2ZUSA 5DDHA 5DUPL 3VFSB 5HGGS 1MUJA 2V2TA 5E99L 5IESL 4XPFL 1AHWB 2Y7QB 3GSVA 2MKWA 1T83A 1ZXQA 4OM0H 3V6FA 2PXYD 3KPRB 4RAUA 3RWHB 1IQWH 4IRZH 3HB3C 5C9JA 4OSUH 4MNQD 4XNXL 4C56A 3BHBB 4H0HB 4KUZH 3CFKA 3BZ4A 3VXPA 4XRCB 1HSAA 5HHQA 4JZNA 1WWWX 1BIIA 4G6KH 3S36H 3HG1D 1RV6X 1DN0A 1F5WA 3B9DA 3SO5A 1S7TA 2P8MB 1I4FB 2VQ1A 4WNQB 1JJUA 3ILQD 4L5FH 2YA1A 2UY6A 1R5VA 3LEXB 1PZ5A 4M3JA 1N6QL 4P5KB 4PLKD 1H3TA 3T0BA 3ARGC 3UC0L 3MYJB 3D85A 1IGTA 2GITB 4XNZB 3O6FD 5AUMA 1DLHB 2AK1H 1PSKH 2GTWA 4XAKE 3QIBB 3LDBC 1MCEA 5DS8B 2W0FA 5IBTL 1DL7H 5JW3H 3D2UB 4WWKD 4NZTL 4L8DA 4MA7L 1LK2A 1QBMH 3EAKA 5F97E 3TYGH 5EOCJ 2J88H 2ORBH 3GMOA 1F90H 5T3ZD 4NQEB 1K5NA 2AK4D 3QDJA 3D69B 1EHAA 4A2LA 3JZ7A 5D7JD 2Q8BH 1XAUA 1FFNA 4N9GB 4X6CA 3O6ML 3GJFH 3RJQB 1NSNL 3LRSA 2NY0B 4Z95L 3FONA 4HKJB 3IAQA 1KLFA 4LIQL 1QLFB 5EIQA 2HFEB 1Q9KB 1ZEAH 3TLRA 4OLWL 4KGLA 3VE0B 3IS1X 1MCOH 3ELAT 4H1LH 3V6BR 4I3SL 5EO0A 5EDXA 4J3OC 2XWBB 5GISH 1GXEA 3BW9A 1IAKB 4G8EB 4BZ2H 3P9MB 5D2LF 2PTVA 1FNFA 2MNUA 4HGWB 2EYSB 5EOCL 2ENSA 1S9VB 5KSVA 4PJCA 5DWUH 4KY1L 2D7PA 5DJ0B 1FJ1B 2QADB 3D3VA 4NRZA 4OLUL 4I48B 3VXRE 1OAKL 2HN7B 4FP8L 2R1YB 1D5XB 3TIDB 3BPCB 2FJHA 1T5XB 5D72L 3FB7B 4KVNH 1RUQH 3UBXG 1A9EA 4N8VB 3MROB 4QRQB 4ZPTB 2HJLA 5DMYA 1WCBA 4I2XB 2W91A 3SE4C 1LO4L 4U6XB 2LTQB 5EIIB 1YNTA 3VD3A 2ESVB 4NN7B 4OD3H 2X1PA 3UTQB 2IH1B 4MMZC 5IHZB 4EQ3A 1DUZA 2MCG1 3QUZC 1UZ6F 4MA1C 4D9RE 5M95B 2VQTA 3U46B 4Y5VB 5HHMD 1B9ZA 4J3XA 5IVXF 4ALAH 4TPRH 2IEPA 4KDTC 5IIEA 3GSOB 2D7NA 5E8EB 3DGGA 1JPTL 4GRLA 3LKSA 4RA3A 4JFQB 3WFCL 3S6CA 1V3KA 2J3SA 4M1DL 2AGJH 1FC2D 2IBZX 4OJFH 5A40E 3WFBL 1YY8B 1A6AB 1AE6L 3RFZC 1WAAA 1J8HD 5B38G 1OTSD 4JM2A 5GJTL 3B83A 1A4JB 2HFGH 5D6DA 4DUWA 3MA9L 5BQ7A 2VR4A 5KVDL 3LMJH 4EN3A 4J6RH 3U7WL 1CIUA 3EYVB 4X6DB 2R23A 5FUCE 1G9MH 5EZLA 5DHYB 5INDB 3BKJH 5JXAH 2X4RB 3NCMA 4QXUH 1EFQA 4YDVA 4NNXB 1S7SA 4CGTA 4H5SA 3O4LE 1E0OB 3WXWH 4EI5D 1PY9A 1V7NL 2NMSA 5ALCL 5C0IB 1DCLA 3DXAB 2P7TA 4J12A 2B39A 4KGJA 5I18L 3F7PC 3I84A 1EFXD 4HZLA 4PGDA 4G7YL 3MJ7B 1ZVYA 1PQZB 4XHJD 1MELA 2FEDD 4RGNE 5I1IL 4O9HH 1FH5H 4CU8A 4YPGA 1BQLL 3RWCA 1G6RH 4JVUA 1U93B 5F9JA 3CX2A 1RFDH 3FT4B 5BZWB 1G0YR 2FHFA 3PGDB 4ZDHA 3RNQB 5CEZE 1FDLL 5EZOL 2IPUK 1OOAA 1D9KA 1XH3A 3GMRB 4P2RE 2VLME 2YKLH 5HY9B 4JY6A 1A7OL 4U1NB 4NSKB 4F3FB 2GSGA 5IMLB 2EIZA 5INCB 1JWSB 2IH3A 1I1AD 2ZSWA 3ILPA 3NH7L 4PJAB 3Q3GB 4S1DC 4YHYB 3SDDA 5E6ZA 3D0LB 1BZ9B 1TTFA 1NGPH 4M03A 1ND0B 4XH2B 1VADA 5IT2L 2HFFB 2FX9H 1NJ9A 2VN7A 4NKIL 5CKGA 2BFVL 1DVFB 5CIPH 3VFPB 4WI2A 4MJ6A 4GBXA 1QBBA 4R4FL 4JZJC 1KSRA 2Y07L 1KIRA 1NC2A 2AJUL 2FGWL 3QNZB 2P4AB 2ARJB 3O9WB 1IAMA 3DX8B 3ZO0A 5BS0B 4GW5B 4WU7A 4AJ0A 3ZKMC 1SYSB 4KHXL 5L8LB 2A9ML 3BH9A 2BNQB 4LF3A 1ZVSB 5L0QB 2DQDL 2YZ8A 3EDJA 4HH9A 2IAMA 1LILA 3NTCH 4N0CC 3UBXA 2X9XA 3P0GB 3FAWA 2Z4QB 3D25A 1LEIB 4G9FA 1F97A 4X80L 4WDIB 2YR3A 4TSBL 4K71C 1FE8L 3VJ6A 2G5BA 4P5TC 4HZAA 3SGKA 1DBMH 4GG8A 3TN0C 3VDCA 3CPLB 2MQ0A 1MCWW 5EU6A 3C08L 2X89D 2GKIA 4KMQA 3WIFA 4OLZH 4ZFOL 2V2WB 4NO5A 3O3EA 4XP1H 4D8PA 4L8BA 3QHFL 1D5BA 5TH2A 3VRJA 4NCC1 3GK8H 3JWOL 5IFHH 1R3LB 3MRCA 2XWTA 5C71A 3TZVB 1U42A 1AXTL 3KLDA 2IAND 4FXKA 3LS5L 5D1XC 2CDFA 5BOZG 1WBZB 4PV8B 1HHIA 1AO7B 1G9NH 5I17B 1TVBA 3G6JA 4DGVL 1R5WA 3CFEA 5EU5A 1X5YA 3H9HB 3ALPA 3NMEA 1S7VB 4ODUB 3SDAB 4XBGA 4Z0XB 1I1FA 3WN5B 5BVPL 1NUGA 5SWSA 1K3IA 4DN3L 4QXGH 1J0KA 4N5UA 1F58L 1NCNA 4YE4H 3PWPA 3PV6A 4MQSB 4CMMA 2HJFA 1YEKH 5C6WH 3GBML 5KJRL 5BMFL 4JPVL 1OSPH 3INUL 2BHYA 2VXQL 4U33A 4MJ5A 3QQ9C 4HS6B 3WNMA 4PJXF 3RL1B 1F3JA 1P2CB 4YNYB 3KR3L 1M6OB 5DI8B 1OB1B 1JV5A 4QHKI 2B1AL 4XWOD 5FAAA 1XF3B 3KPRD 3PWJA 2CGRH 4U1HB 2ED8A 3E3QE 4MA3A 1KFAL 4IHOB 4YQXH 1T83C 2DLGA 4LRNL 3GEWB 2NTFB 3SKJH 3P40A 5B39A 2XNAB 1AXSB 3HC4L 1Y18B 4OZIA 2Y6SD 2OTWA 5ALBL 1XGRB 4P2OB 4ONFH 1JGUH 5HHXL 5KSUA 1ZHBA 2VDPL 2YEZB 5I19H 3RA7L 1IEHA 2R1XB 3R8BB 1YUHA 3ME0A 1HINH 4GJTB 5DHXB 4D0DA 1SY6L 2MPAH 3F12B 1FGNL 2C9AA 3QCTH 4GO6B 1R3KA 2UY7A 4MZ3A 3EBAA 5F44A 5EOTB 1FP5A 3BD3A 3QIBD 3TA3A 2HH0L 3MLTB 3I9GL 4MXVE 3P0YL 4X7EC 4UBDC 2HVKA 1JF1B 2NY5C 4OCSH 5F89B 2ATKA 3RQ3A 3D2UD 2DI8A 4NUGL 5D5ME 1NBVH 3I6GA 4Z7WA 3FB6A 4RZCB 3OPZH 3RY5A 1H8OA 4KH2A 1UB6B 5B4MC 2APBA 5FB8A 2YUVA 5DJXA 4EOWH 3TNMA 2OM5A 1IBGH 2XQYG 3R0MA 2NY0D 2DWDB 2ZUQB 5GIRB 3H7LA 5K59F 3BZEB 5D2NA 3MOAH 3U2SB 2XKUA 4L4VD 1G7PB 1I9RL 2GSIB 4BZYA 1KBGL 3HZYA 3SGEH 4DVBB 2VDLH 2VL5B 4X5LA 5EZJA 5IV2B 2CKNA 4KJQD 1NQBA 5FM4A 3QSKB 5I8EB 3BGMA 2Z91B 4GRMB 5FF6B 1OP3H 1IKFL 3GMLB 3JWNC 4OB5H 5DD6B 3V4UL 1TMCB 3FKUS 1SQ2N 4YWGH 4EI6B 1IKNA 2QQNH 2PETA 1RIHL 3G9AB 1OM3L 3PJSB 1EGJL 1RHHB 4XHQA 4YUEH 3UO1L 3IFLL 1MPAH 3WMSA 1KNOB 3B5GA 4BYHA 5CJBA 3R06B 4ODVH 2QADD 3N50A 4PJ7B 1NAML 3KYKL 4ZFGH 2OMNA 2FX8H 3WL9A 3OAYK 3SQBA 5EA0H 3CCHB 2YPLD 3B9AA 3HAEA 3MR9B 2R2HA 2W65A 1ZT4A 3MV8E 4JQIL 4ENEC 3VFGL 1T66C 1U0QA 4F58L 4JANB 3EGSA 4W4NA 3DMMB 4QNPF 4OZGA 1I8IA 4OBRA 4K7FA 4PTUB 4U0RC 5DJ8B 5FCUL 3H8NA 1A2YB 1EVTC 3AUVA 3QWOA 4L3CB 5J0BA 4AZ8A 1GZQB 4PS4H 4KJPD 3TEUA 3LEVH 3MODH 2QR0A 4YXKH 3ORJA 2CD0A 5JW5B 1UADC 2DLIA 5EC2A 1H8SA 4QHUA 1P4IH 3MXWH 3CXHK 4OCRH 4LLWA 1NBYB 1I9JL 3ZZ1A 4YDKL 2PW1B 2JB6A 4Q6YA 1T03L 1XT5A 2YRZA 4FTVA 3IFPB 3Q1SL 1Q1JH 1KENL 1QFWI 4GRLC 4POZC 5C0JA 4OKDA 1AP2A 1TJIL 4G8GB 1T1WB 5K9OA 2W60B 3I2CH 4NQDE 5CMAB 5LGKA 4HF5L 1AQKH 3BGAA 1A5FL 2EZ0C 3NFNB 3SKNA 4JM2C 5KG9A 3WYRA 1D7FA 1IAIL 3MCKB 5E6IA 2EDWA 5D6DC 5F7EL 1N0XH 1EMTL 3VXTB 5HSFA 4EN3C 1MI5A 4NT6A 4N5EC 2QSCL 4WWID 3KLSA 1B6UA 5JW4M 3S9DB 4KV5F 2H3NA 4RSVA 4HIXL 4JQVA 5HD8D 2JB5H 5I6XB 1LP9A 4X99B 3MRHA 4K7PL 3N9GL 3VFVB 1I3RB 1OF2A 3CDFA 5KVMC 2FX7L 4X7FC 4R4ND 2VERN 5AD0A 3DRTB 1A7PL 3A6OA 5KSBE 5DO2D 1G7QA 1KB5B 4YHOL 3PQYB 5FA4B 4JRYE 1BM3H 3S37L 5HGHA 4XMPH 3WSQH 3HFMH 4M93B 4DOHE 4WI8A 2R9HC 4AM0B 2KPNA 4FABL 2BK8A 4N90D 5T1KB 2HLAB 5F1IB 3RPIA 3ZKXB 1MF2L 3CU1A 3KYNB 4QGTA 4X9HA 3WUWA 5KW9H 3K4AA 4UT9H 3O2WH 2D7TL 2AQ1A 1A3RL 4JM4L 3WIHL 1EAJA 3RDTB 1DUYA 2AKRA 1D9KC 4PJFE 5GS3A 1KLGB 1KJ2L 4G8FA 1U8LA 3MV7D 3BO8A 4LVOC 4HJJL 5HBBA 5H37G 1MCPH 2UZIL 1L6XA 5C0AD 3U36B 1HOCA 2GFBA 1FRGL 5M94B 1M05A 2EDNA 4KJWC 3PUCA 1VPOH 3BN9C 4P3DB 2J7LA 4L3AA 3WV0A 1DVFD 3EFDH 4NQCA 4H25A 1KG0B 3MLRL 4OIBA 3LS4L 4HDIB 1HSBA 4OM1L 4YO0B 3VFRA 2DD8L 1HQRB 5GS2H 2YSSA 3O9WD 4LBEA 3W0WB 1I1AA 2C3VB 2MKLC 4GBXC 2EIBA 2DIAA 4N8CH 5FECB 2VLKB 3V6OE 1U8PA 1YMHB 2BNQD 3BUYB 4OFKA 5CHNA 1IC7H 4YHPA 4PP2A 4Y19B 2JTDA 4PP1C 4JR9L 1R3HA 4BQBA 4WTWA 2PO6B 3HMXH 5ADOL 1TCRA 2XACC 2XG5A 3CSGA 2NCMA 3UZEA 1HKLH 2IAMC 5E4EB 4DAGH 5C0EB 2Z8WC 4BSWB 1A7QL 2OSLA 3SKOA 4ZXBA 3H3BC 5IQ9A 4B0MM 4E5XA 5FYJU 3MA7A 4XAWL 3IAGC 4BJLA 4ONOA 4JN1L 1UT9A 4FQQB 3MFGB 4XVTL 3VFUB 5BRZE 1QUNA 4FQXB 4NKDA 2IBGA 3OR6A 3SGKC 3TCXA 5TE4L 3HZVB 3GJFA 9CGTA 4HG4K 4Y4KC 2DQGL 4PYHA 12E8H 1VKXA 2E9IA 2WUCL 4P23D 1U8OB 4LSUH 1I1YB 5IVZA 2Z31A 4PGCA 4G6AD 4H1LA 4JDTH 4N0YL 1TCMA 1T4KB 4IEFB 1MVFA 3SDAD 4BFEA 4TSAH 3GHEH 5ITFA 1SYVA 5LQBH 3LOWA 1F4AA 1X5GA 3GSQB 1M7IA 2VXVL 3IDUA 5FO9A 5J1SC 3KXFE 3GIZH 3KPNB 1UKQA 2NQCA 3DYMA 1I7ZA 4GS7B 4RMRA 2UV3A 4K8RH 2NX5E 1D6EA 3VGAB 1FYTE 1KB5H 4TVPL 4YK4B 2QTEA 4HUNB 3RUGA 2RGSA 1OAZL 1YNLL 3FQXB 3IFOA 5EZIL 4IOIB 5FUZH 4PGEA 3GHBH 3EDKA 3SCMA 1A7RH 4XCCL 5TDPA 5JPNB 3ZYZA 2G60H 4K07A 5IEKA 3MRJB 2IFFL 4S1RH 3FO1A 3O6LH 1L9NA 4XCNA 4QRTA 4JB9L 1NC4B 4KFZC 3C87A 3O4OC 3PWLB 4EVNB 4HUUA 4JFOA 4UDTA 5I1EH 4KK9D 1HNFA 3OKOB 3V0WL 1WFTA 1QRND 3LB6D 4GQPH 5GHWH 1KIQB 4I1NB 3HRZB 3BOVA 2RHEA 3MREA 2CRYA 5HI4D 3QYCA 4P2OD 3HE7D 1RZKH 5IW3A 3ZTNL 3VG0H 1BJMA 5JQ6H 3DX7A 2ENYA 1I3GL 4G42A 2V5YA 4XMKH 5DT1L 2WV3A 7FABL 2EKSB 5D1QB 4KJYA 3RWHA 4YEEA 1X5KA 4Q7DA 3BHBA 1ZGLB 4KZEH 4KVCL 1MAMH 3FO2B 5BV7H 4XRCA 3S35X 3ARDA 3TBVB 1LDSA 4U6HB 1XF1A 4I0CC 5IEHB 4R26H 3BWAB 3TA3C 1BQHG 1I4FA 3GSXB 4WNQA 2BRRL 3RKPA 5IR1B 5I1JH 4HGKC 2C4FU 5D7SL 4F7MA 1TZGL 4FQIL 4YDLB 2LU7A 1MCJA 5KN5A 5LJYH 2GITA 3NCBB 2OZ4H 2P48B 4RX4A 3ZDZF 3MLXL 5BZDB 4PLKC 5D2LE 1RZJL 4GMTH 3OR7B 5DJ2A 3L5JA 3OKLB 3F5WB 2LE9A 1FPTL 3DX9B 3E6FB 3D2UA 4PLOB 1CXIA 1FFOA 5D2NC 4KK6C 3PXHA 4NQEA 1QNZH 3D69A 3UTTD 4PD4K 2K7QA 4N9GA 4ELMF 4N0UE 5IFJB 1G6RA 2BSSB 3I6KB 5CBAB 2I07A 3OWEA 1QLFA 3DYPA 3OBAA 2HFEA 1IKNC 3O4LB 1XF2B 3VE0A 4JHAH 1OQXA 4LPCA 1UZ6E 2BVPB 5C2UB 3QCUH 2X4TB 4OIIH 4YBLC 4OZFB 1OARH 5IVXE 2CXKA 1MFBH 2XWBA 1BOGB 1FL6B 1TQCB 4JFDE 3DMMD 5IB2B 2CO7B 2VDMH 5GRUL 4FFYL 1I7RB 4WTXA 1T21A 5CIPA 2DQFB 4K3JL 4TTDC 3B2UD 3ULVC 5CZKA 1L4IA 5DLML 6FABH 1FJ1A 4UDUB 1U2CA 1YNKH 4P2RB 5MI0B 5MEOB 1MREH 2FJGB 1MIEL 2HN7A 2YD4A 1D5XA 5GSRB 5E5MB 3BPCA 3HNTL 2HLFC 5BW7A 1EEUA 4N8VA 4QRQA 2DKUA 3LKOB 1LNUA 4I2XA 5FUOH 1QSFE 2VKXA 1TQBC 3IXAA 4PJIB 5DHVH 2DMKA 5EIIA 1N7ML 1HDMA 1NGXA 2PYFB 1AGBA 1U3ZA 2ESVA 5TF1H 1QR1B 5BVJB 2YOCA 4HFUH 1PGRB 4YHMH 3N85H 2IH1A 1IGMH 4M7JL 5IHZA 3EO9H 2B2XH 3EJJX 1DFBL 2K7PA 4U7KA 2XQYK 4GLRI 3U46A 4Y5VA 4Y5YA 2HKHH 5HYQB 2XTLA 5D7KD 5EFIB 3TVMB 3FT2B 1E4XH 3VFMB 3GSOA 4P5MB 4HJGA 5E8EA 1OAXH 3DUUB 3MC0A 1JNHB 3IYLW 1EH9A 5E6IC 1XZ0A 4PJEA 1N5YH 1A4KB 2Q7YB 2V7NB 2R0KH 4IRSA 3CK0L 1QFWH 1YY8A 3VXMA 1NBZB 1CG9B 4N1HB 3TPUA 3DGCR 5I2IB 3BKCL 3TBSB 4FHBD 1YEFL 1A4JA 2D0FA 3CLFH 4YZFF 4JQVC 3WO4C 3ULUD 1MHHB 3MLWH 1KTRL 2WUBL 1OTUD 1KLUA 1OTSC 3PQYD 5ADPH 1MJUH 4M8VA 5INDA 5L88H 1P4LB 4FFZL 2X4RA 2P24B 5KS9A 1Q0XL 3EYQD 4NNXA 4GXVL 1S7UB 4G6ML 4HWZB 4DKAA 3NBNA 5EOQL 4NRYA 3QNYB 5B21A 43C9B 3DXAA 3VA6A 1JNLH 1NKOA 4KROB 5GGTL 2V7HB 3E8UH 3MJ7A 4HPYL 3CFDB 2H9GB 4PRID 3O8XB 3HUJF 5T3ZL 1ZLUK 1MEXL 3B9KB 3ZSSA 1QLEL 4OZHA 1NFDA 3FOLA 4N0RA 5DRZA 3HC0B 4HAFA 3UTZB 4O51A 1U58B 2AJYL 3UCRA 1QA9B 3FT4A 2IMMA 3PGDA 3HE6A 3RNQA 3QRGL 1BD2E 1AJ7H 4KMTH 4HT1H 1KTDA 4WJ5B 4GKSA 3GMRA 1AGEB 4M6NH 1CLYL 4NSKA 4F3FA 1JWSA 4K2UL 3W0WD 1NL0H 4L8SA 4PR5B 4Q9QH 5TF0A 5ITBH 1OP5K 1TNNA 3EW3B 5GRXG 3Q3GA 2DRUA 2ZUXA 4DEPC 1A7NH 1I1AC 5ID0B 4GAGL 2M2DA 3D0LA 1BZ9A 4XH2A 1ND0A 1A64A 2CJUL 3UEZA 2XN9B 4OFVA 1GGUA 1CXLA 3MACL 2AJXL 2HFFA 4K3DL 4K7PX 5IJVB 3MRRB 1MHPL 3RVXC 1X6NA 3QDMB 3ESVF 3A6BL 3QNZA 1U8QB 2LVCA 3O9WA 4PJGA 5DD0H 2X9WA 3DX8A 1BJ1H 5BS0A 3S37X 2DQTL 4ZXBC 2XZZA 3QA3B 4FQXD 3L7FB 1B4JH 2GTZB 4BELD 5GZNC 1ZVSA 3O45A 4RA0C 4NQVB 3SEPA 2IPTH 4FXGB 1CBVH 3A6CL 5JNYB 3EYFB 5E1AB 4CU6A 4YHLL 2Z4QA 4AIZB 4P59H 1CLZH 1LEIA 1LE9B 2IGFL 3QUYB 2HT3C 5J11B 4TSCH 5C7XL 3MBEB 5L9DL 4FQHA 4Y1AE 4XAKD 4WW2B 3RWGB 4V1DE 3M07A 4X7SL 3Q6FB 4QRUB 4WTZA 4TOYH 3GSNB 2Z92A 3CPLA 1WZ1H 1Q9OA 1Q9WB 3W9EA 4NC1E 4PJXE 2WIIA 4X5WA 2AXFB 5D5MB 3BZDA 2V2WA 3L3JB 1FL5B 2R69H 2X42A 3O2DH 4NJ9H 1YMMB 2PTUA 4FZEH 2BVTA 3UJIH 1AGFB 4APQA 3M1BA 5CD3B 4MA8H 1CXHA 1E6JH 3TZVA 3UPRA 5EBMB 4OCMC 3DSFH 3EZJB 4DQOL 3MUHL 1AKJB 3UTOA 1DBBL 1KB9J 1WBZA 1G7MA 1AO7A 5I17A 3K8KA 2VWEC 1WZMA 5C86A 3RWFB 2IPKB 3H9HA 3ARRA 3S34H 4ODUA 5KOVC 3QJFB 4Z0XA 1QEWA 3WN5A 2CUMA 4JFXB 1A8JH 2NZ9C 1J87A 1CDCA 2E7LA 1EUUA 2BVYA 2VDKH 3SCMC 2R56H 3P4MA 1NC4D 4D0BB 1MCIA 2X7LB 4MLSA 1UVQA 4MWFB 4IMLB 1G7IB 2VTFA 5HDQH 2EE3A 1NEZB 5EUOF 1ZHNB 4RAVA 3HZKB 3C9NA 3RIAF 5KVGH 2FCBA 3FMGH 1CICD 4H8WH 4HS6A 3CJJA 3RL1A 1P2CA 2H45A 4YNYA 3VXRD 2O5XL 1A47A 1M6OA 5D1QD 5C8JB 4OM0L 1OB1A 4BZ1L 2I5YL 1XF3A 4O02H 5EG6C 3MV8B 2ED7A 4PJBF 2EH7H 2NTFA 4R7DA 5K59E 3NCFB 4G6KL 4LCUB 4R96B 5I74B 1AXSA 5FYLD 1GC1H 1Y18A 1E27B 5KVFH 1BBDL 1XGRA 1QP1A 4JHBA 5T5FL 1OT1A 1W0WB 4EBQL 1GIGH 2YEZA 4L5FL 5GGSA 1G7JB 4D9RD 2R1XA 2Y6SC 1KCUL 3LEYH 5C07E 4S1QH 4YDIH 3IDXH 3GNML 3P11L 2BZDA 4HWBL 3MRMA 1G9MC 3QUMB 4WEBL 1FV1B 5DUMH 4Q0XH 3V0AC 1EVUA 5EOTA 2KKQA 5CGMA 3MLTA 3P0VH 2GY5A 1DL7L 4UINH 4FNLL 1JRHL 2ICWA 3B2VH 4FRWA 4HCRL 2VLJE 1BZ7B 3QIBC 3U6RB 4NQDB 4S1SH 4BUHA 2AEQL 5DC0A 4RZCA 1UB6A 4UQ2A 5A2FA 1QPXA 3FCTA 2OL3H 2E9JA 4XXDB 5LBSL 2EDYA 3RU8L 5GQBA 1GJIA 5ICYA 1I1RA 4UILH 3QFDB 5DMGD 4JFEE 4JRXA 4QNPE 4OFYA 4P4KB 2DWDA 1ZEAL 2FNBA 2H41A 5IQ7H 1U95B 2FDBP 3O4LD 1CI5A 5C6TH 1NBQA 4PY8J 3SQOH 1MCOL 3CUPA 1G7PA 2GSIA 4NIKB 5IBLD 2AQ2A 1YC7A 4WFFD 5LGJA 3GSNH 3VFWB 4OGAD 3NFSH 3GSUB 1SMAA 2Z91A 4GRMA 3GMLA 1HYSC 2VXUH 5DD6A 1RAMA 4RGND 4WHCA 3ULSB 5CEYB 3QRFM 1CXFA 4X0KB 3PJSA 4DOHB 1RHHA 5IBUG 1KCKA 3E6HB 2E9WA 1KNOA 4JFFB 5CEZD 5I15H 2R4SL 3R06A 1DQMH 4U0QB 3AS0A 5TFSH 1IGCL 1RZFL 4PJ7A 4NO0B 3VXSB 1KCVH 4P2RD 4GH7B 2CIKB 1MLCB 2VLMD 4JFZH 1WIPA 5GS1A 4QRPE 2QADC 4XVUD 4GXUM 4PJFB 3MR9A 4Q6IB 4HJ0D 2DBLL 2NY6B 5C0CE 1SJEB 4EIZC 1LEGB 5HHPB 4JN2B 2EDEA 2OQJB 4NWUL 5BW7C 3AMKA 3HMXA 4KV5E 5DJ8A 3RTQD 3VXNB 2EC9T 1A2YA 2FZ3B 4M48L 2LTQC 4DKDC 1GZQA 1CFTA 2F8OA 1EJOH 2XZQH 2AI0H 4NN7C 4Z5RB 4PJDF 5JOFB 3V52L 2ADIB 2VNCA 4G3YL 1CGVA 4NJAH 1IZJA 4MVBD 4ALAL 2EDBA 4KJPC 1NBYA 3GIVB 5ABDE 1CD0A 1JK8B 2PW1A 3IU4L 4XP5L 3RWEB 2UZYB 4AL8L 3V7AE 1HH6B 4Y5VC 1EO5A 1AR1D 3QXDB 2Q8AL 3IFPA 1T7ZA 1A14H 4Z7VA 3UAJD 2L0DA 5IJKA 1BZQK 1X5FA 3BQUB 1C5CH 4G8GA 5T5NF 1KJVB 2W60A 4BFGA 4GKZA 4GAJL 1QSEE 4P9MH 3TBWB 4GAFB 2GUOB 1KC5L 4IRSC 1DLFH 15C8H 4XT1C 5I1CL 1RI8A 3MCKA 3P3YA 3MRBA 3LIZL 3BKJL 1G9NC 4IBLT 1D5ZB 2YMXL 5H94A 4JJ5B 5H8DA 4LSQH 5HHVL 2YPVL 3GMQB 4UI2A 3MNWB 2R2EB 5E8NB 4FXLA 3PDDA 4WHTB 2R0WH 5F9OL 2C7UB 1YEDA 3QUMH 4ZSOE 3DHMA 1SJXA 3VWKB 5IGXH 4X99A 1RULL 3VGEA 3VFVA 1I3RA 1Z2KA 4QTHA 2X4SB 2NY1C 3IDGB 2I26N 4QHNB 5HD8C 3DRTA 1ZA3A 3TJEL 1KB5A 4B7IA 3LQAH 3PQYA 5FA4A 5FV2A 1K85A 3UMTA 4W68A 4KI5F 3B9KD 4KTDL 4AMKH 5A1AA 3STZB 3EO0B 3TV3H 5JR1L 1IC5L 3AFLA 3DI2B 4AM0A 3MMEB 5T1KA 2XRAL 5FYKH 3L5XL 3KYNA 4Z7NF 4U3CA 5AG8A 1NEUA 2CSPA 2JK5A 3ARFD 4IS6B 1OGAA 1T0PB 3CIQA 4Y4HD 1QYGL 3O2VL 3KJ6H 3RDTA 4O2CB 4OV6F 4U7MA 4UOW1 1OLZA 1ZHKB 1ZT1A 1IAOB 1FYTB 4K3HA 2YRLA 1DQQB 1FIGH 4L8SC 3GKZA 4O4YH 3SPVA 2FB4H 2FO4B 2A6KB 3D6GA 5A16B 4PUBL 3ZL4H 4ERSH 3MJ6A 2DQJL 4YHYC 4I0PB 1ZT7B 4F37F 1IL1B 4ZTOL 2DQIL 2AXJA 1KG0A 2QQLH 2VSDA 2FD6L 3DVNB 3EOTH 4X7TB 2XZAH 3QAZC 1NFKA 1HQRA 3T0AA 3RX7A 2AXGB 3WXVH 5JW4N 2C3VA 5C0BE 3KWWB 5CZXD 2R4RL 4RGOH 2A77H 4ZAKA 2VLKA 3KPLA 3GO1L 1EUTA 1YMHA 4NDMB 3BUYA 4GRWF 2VLRA 3O9WC 4JQXA 4Y19A 1UXWB 3V6ZB 2OZ4A 2PO6A 5E9DE 4JFYB 2BMKB 4MQ7B 2DM3A 5L0QC 2DTML 3MJ8B 3QUYD 2NPLX 1BQSA 2P49B 2EYTB 5J13B 2DQUL 5KVEL 4BSWA 4HUVA 4M4RA 3DLQR 1A3LH 3MO1A 4HXAH 5DMIL 3VFUA 3LHPL 4PYGA 5CP7A 1U8JB 3VWJB 4A6YB 5I30H 2YN5A 3GJEA 1H3XA 5DUPH 3QO0A 1VDGA 2AJ3B 4UMGA 4YBQD 5E99H 3S5LG 3WFZA 5IESH 4XPFH 1KCSL 5GS0H 2YUXA 1X5ZA 1JYNA 1RU9L 2C3GA 2OBGA 1U8OA 4LLMB 1I1YA 3IDNB 1DTUA 4APQC 2VE6B 1C5BL 4XNXH 2BSTA 3TZVC 2H2SD 5CEXB 1KPUB 1KN4L 1T4KA 4P4RB 4C54A 1DBJL 2I25N 1VESA 4LFHD 4AQ1B 4JPWL 3WN5C 5DMKB 1FZOB 2E7LC 1ITCA 4DZBB 2UWEB 3UC0H 2GK0A 4N0UB 4WO4B 3C6LB 3C8KA 2B5IB 3BZFB 4XBPA 5IG7A 3TNNB 4E42B 1ORSB 4E9LA 2HT2D 1PKQB 3ECBB 3MRLB 3FQXA 2XY2A 5IBTH 1I1CA 5JPNA 3B8YA 4MA7H 1CR9L 1HE7A 2BC4A 1UCBL 3DO7B 3FHAA 4NZUL 1QFUL 5DHVA 3MV8D 3KYAA 2V5TA 3PWLA 4EVNA 3ZDZE 2FEEI 4NKQB 5H2BA 2DYPB 4JFDB 2JJUA 3OKOA 5MENE 5FKAB 4KDVA 3QISA 4CUCA 3O6MH 4XCYB 1NSNH 3B3IA 2ITDB 3DRQB 4Z95H 4LIQH 2DI7A 4CVWA 5IMKB 1KGCE 4OLWH 3C5ZB 5FK9A 5HI4C 3IS0X 2EKSA 4DN4L 4HUXB 1SJVA 5F9WB 4AYFA 4E0RB 1NCUA 2V17L 3IVKB 2GW5A 3QEHB 1RIVL 4I3SH 3F8UB 4ELME 4X6CF 2QKIA 2D4DA 3L5HA 1QSFB 4TRPL 4LGPB 1ZGLA 3VRIB 4CVXA 5F96L 4XGZB 4U6HA 1JHTA 1OPGL 4RMVA 3BWAA 4NQDD 5EOCH 2J8OA 5CJ8A 5FKPA 5HHOE 3C60B 1YC8A 3TJHC 3DROB 1BGXL 3HI1B 4KY1H 5CFHA 2FECI 4JO2L 1NGYB 1FFQA 3IRZA 1MCNA 5EC1A 1OAKH 2FBJL 4FP8H 3W82A 4EUPH 1BWMA 5BZDA 3MRQB 3V8CA 4P4KD 1B88A 2C1PA 1L0XA 4MNQE 5GZOC 1G6VK 4OZ4B 2PKDA 3OR7A 3F5WA 2Q6WB 1LO4H 4MNHB 2ARJQ 4FG6C 4LHQB 5EPMB 5LCVL 2FHCA 2ZUQC 4U1MB 4PJCF 4P3CL 2QLVB 1J7VR 2RIKA 4HWUA 1HZHL 5F9DC 1PAMA 2V5SA 1F13A 5HGDA 1E4KA 3TYFA 5I1HL 2AV1B 2A6IB 4KK8C 4OF6A 4JDZB 3ZLQC 4RISL 5DF0A 4JRYD 2GI7A 3ES6B 3QZWG 4Y4FD 3D48R 5IFJA 4AENB 5I66B 4ZFOB 4ZD3L 4DK6A 1JPTH 2OK0L 5CBAA 3ZKSD 4QF1A 3T4YB 3WFCH 5ESAA 3S36X 3S5LA 1XF2A 4KXZI 3RBSA 4M1DH 4ZFGL 2YXFA 4NO0D 3WFBH 5F1KC 1AE6H 3VGDA 4JG0L 2BVPA 5EA0L 3OGOE 2X4TA 1BPVA 2DTSA 5E2VL 3G5ZA 5GJTH 1KPRB 1UA6L 3R4DA 5F7NC 1KYOJ 2X44D 2BOBA 4ZUUB 5KVDH 1IM9D 2NY6D 2AK4E 35C8L 1BOGA 3DVFA 5GS1C 1ES0A 5I76B 3U7WH 1FG2B 3D39A 1CFQB 5IB2A 5FHBL 2P8LB 4HK3N 1I75A 3C09C 3MLSH 1T5WB 1HQ4A 2BSRA 4O2FA 2FBOJ 2RJMA 2DQFA 3DMMC 4P2YA 1T0MB 3RRQA 1WAAF 2YPKB 1CF8H 1BD2B 4JM2F 3OGCB 4YZFE 1GOFA 1V7NH 4P2RA 4NGHL 5MEOA 2ZZUT 2FJGA 3EYOB 5ALCH 3LN5B 4ELKA 1NLDL 5E5MA 5I18H 4G7YH 1J1XL 1JHKL 1IILE 5HDBF 3MZGB 3LKOA 1Q1JL 5I1IH 2EIEA 4PJIA 4TUOB 4JDVB 1RUAL 4RNRA 3KLHD 1IQDB 2D4FA 4WUKL 5GS0D 3BQUD 1QR1A 1VGEL 4RAHA 5IHLB 1LDPL 2RR3A 5DEGA 5BVJA 1BQLH 5LGHH 2X9YA 2F74B 2V5MA 2H6PB 5IJKC 1ZOXA 2ZWLT 4HS3B 5MP6L 1FDLH 2E7CA 1PBYA 1CFVL 3IXTB 5HYQA 3CH8A 5EFIA 3TVMA 3FT2A 5JHDE 3HUJE 2Q76B 1A7OH 3CXHJ 1JUFB 4P5MA 1TDQA 1BJ8A 3LV3B 3DUUA 1JNHA 2XIDA 5MEPB 3SE9L 5KTEL 5E03A 1YN6A 5BRZD 3TWCH 3NH7H 3O2DA 4XB8A 3WLWD 2Q7YA 1J05B 1HNGA 2X05A 4M00A 5F6IB 5AYUH 1NBZA 4J1UB 3VXUE 1CG9A 5I2IA 2P8PB 5E2WH 3TBSA 3CFBB 4HH8A 4NWTL 2QBWA 5DJYB 2R29H 4JG1L 3PWNB 5IT2H 1MHHA 4BA8A 2BFVH 1TENA 3EYSL 4Y1AB 4AG4H 3VG9B 2YBRA 4R4FH 2Y07H 4XMPL 2EE6A 2FGWH 4K8RC 1MFNA 1J0JA 3FQWB 1P4LA 1ETZB 3QPQD 4NBXB 2P24A 1OTUC 4PJXB 1DBKL 4OQTL 3WD5H 4E41E 4KHXH 2A9MH 2CK2A 5HYFA 4M93C 5J06A 2Y06L 4LPTA 1CU4L 1YDPB 2DQDH 4UUJB 3KXFD 3WJLA 2Q86A 3EOYG 1EHNA 1E6OL 1U8HB 3O8XA 2ZUTA 2NX5D 4TSBH 1FYTD 1FYHB 1FE8H 2CLRA 2BJML 3RDTC 2FO1A 3CZJA 1RZKC 5D1ZB 2HVJB 3C08H 1VPOL 1U58A 3CLEL 3T0EE 1QA9A 4GKNB 2XA8L 3AREB 3EJYD 4WJ5A 4P0DA 3QHFH 2UZXB 1V3MA 2DL9A 3JWOH 3FQTB 2SEBB 2CIIA 4M5ZL 4FQ2L 3BISA 3KPSA 3WS6A 1W72B 5BV7C 1AXTH 5L2KB 2BOCB 1QSVA 5CSZB 1IT9H 2EE9A 4KQ3L 4PRNA 4P46B 1TLKA 4RGMC 1L7TL 4L9LA 3L3GB 4DGVH 3WLBB 1N4XL 4ZAKC 1G9EA 4F7TB 1D5MA 1DBAL 2X4NB 3O3DB 2XN9A 5F6HI 5BVPH 4JQXC 1G7LB 3X3GL 1C16A 3FAXA 3OMZA 3MRRA 2PO6C 1BFOB 4DN3H 5HPMA 5IJVA 5FXCH 3UJTL 1TFHA 3QDMA 1F58H 2N7AA 3T77B 5JXED 4ETQB 3GBMH 5KJRH 2ICES 4R8WH 4KRLB 5BMFH 4JPVH 5IMOB 3QA3A 3VWJD 3KNBB 3L7FA 3INUH 4LEOB 2C1OB 2OL3A 2VXQH 2GTZA 4NNPH 4M1CD 1CT8B 5C08E 4PJHB 4WEUD 1F8TL 4NQVA 3CU7A 5C07B 2WINB 3EYFA 5E1AA 3KR3H 1ZMYA 4AIZA 1LE9A 3QUYA 5JZ7D 2FL5A 2B1HH 3MBEA 5EUOE 1J18A 5ESVB 1ROWA 1KFAH 4JDTL 3RWGA 5CJOL 3O3UN 3JTTB 4BM7A 4LRNH 1VEMA 5HTSA 3Q6FA 3GSNA 1YZZA 3U4EB 1ODAA 1Q9WA 3HC4H 2VLJB 5DR5H 3GHEL 2PCPB 2AXFA 4U3XA 5D5MA 3L3JA 5HHXH 3G5XB 1LO3L 1BVZA 3DOSA 3RA7H 1YMMA 1CLCA 1Y6NR 3EOBA 3ARUA 1A6TA 4KK5D 1AGFA 5J6HB 4JO3L 5HJ3B 4AEFA 5CD3A 4HG4J 5EBMA 1SY6H 4PJBE 4X4ZA 1AKJA 4JFEB 1FGNH 4K8RL 3ULUL 1UJ3A 4RQQB 4OZIF 1GGYA 5GGVL 4OF3A 2HH0H 3RWFA 3GHBL 2IPKA 2GJ6E 2QQKL 3P0YH 3KPPB 2OCFD 5SWZA 1C7SA 3RKDD 3H0TB 2VR9A 4GS7C 3QJFA 4S1RL 3VGAC 5C0NC 3O6LL 4YK4C 1AD0B 4NUGH 2CKBL 1QVOA 2DLEA 3ARBB 4ODWA 3SDXB 1FSKB 3GI9L 1UACL 4D0BA 1OD9A 4BSJA 3QWRD 5F3BB 4MWFA 4XPHH 2DYPD 4JFDD 4IMLA 1G7IA 1QBLL 5IOPB 5C0GB 4ZNEE 4NFDA 1NEZA 2IANE 2X4PA 3D87B 4LHUB 3U0PB 3HZKA 2X2YA 1ZGLP 2ZSVB 4MX7B 3VG0L 3C5ZD 4CNIA 4Z7WF 1X5LA 3U7YL 1I9RH 1T1ZA 4HV8B 1KBGH 3BIKB 1LMKA 1YN7B 5HGBB 4QRPB 5HVHC 2WQ8A 1KJ2B 1NDGB 3MJ9L 1HXMA 2XI9A 5J9PB 3QIWD 1IKFH 3MV8A 5C0CB 3V4UH 1K4CB 1QSFD 2OI9B 2VLLB 3P73B 1IFHL 1EK3A 3QUKB 3O3AA 2IC2A 3QDGA 3QFJE 4LCUA 3TH3T 1A3QA 1RIHH 1E27A 1OM3H 1P4BL 3SGJA 1EGJH 1MIML 2YHGA 3I6LE 1KJ3L 4LLDB 4MQXC 1W72H 3UO1H 3P9WB 3DV6B 3IFLH 1HHGB 4QXTB 3K7UA 1NAMH 4MSWB 4LVHB 3KYKH 3RWJB 4UIKL 2IF7A 1MHCB 2EDOA 3PIQA 4WI6A 1Y0LB 3QUMA 1FV1A 1CIDA 1NANH 3IDJA 4GMTL 4JQIH 1PX3A 4YDLC 5DQJA 3VFGH 4CW1A 4F58H 4XNMB 1MFDL 3Q5OA 5E56A 2ZCKL 4XCEB 2R1WB 5FCUH 1KJMA 3U6RA 1QSEB 2HYMA 4W6XB 5E94A 1NAKL 3SBWA 2WLYA 2ZG1A 4YGVB 1WICA 5CUSL 4WY7L 3GMNB 4L3EE 4OCLC 1JVKA 1RJYB 3ZKQD 2X70A 1OAUL 3BUTA 1E4KC 1LEKB 1LO5B 3QFDA 2VZSA 2VC2L 4YDKH 2DB8A 5F88B 1EO8L 3OHXB 5D93B 3ULVF 1T03H 3TT1L 3G04A 1FL3B 1U95A 2FYYB 4ZSOB 3MRNA 4NBZB 1KENH 2VRAA 4WU5A 5DMGC 2CK0L 4U05A 5F93C 3QCUL 3QUXB 4PJDE 3VFWA 3REWB 4HF5H 4ZUTB 2VSCA 3ULSA 3HCVB 4OGAC 3TM6A 1IAIH 4NO2B 5F7EH 4X0KA 4PD4J 1CGSL 3IETB 4G5ZL 1EMTH 4MMXC 4ZYKB 2QSCH 4XTRD 1WIUA 3ROOB 3TC9A 3BI9X 3HR5B 4JFFA 6FABL 3MGOB 4PJ5E 2P46B 2QSQA 1BD2D 1OWWA 4QRRE 4ZFFA 3VXSA 4HIXH 3WE6B 3KLAB 2CIKA 1MLCA 3N9GH 3LPGA 2O5YL 3L95A 2FX7H 2J2ZA 5SX5H 1QFPA 4PJFA 1A7PH 4B41A 3OJDA 4YHOH 3NGBB 1LEGA 5HHPA 4ZO6A 4LSRL 2OQJA 5JHLL 5TF1L 1HWHB 1KTLB 3AXLB 5E2UL 5DK3A 4JCLA 2FZ3A 2VMFA 3ZHLA 1GGIL 3LCYA 1LP9F 1K8DB 3GM8A 1EPFA 1FAIL 4OUUA 2HTLC 2J8UB 1F11A 4HIJB 4QKXB 4Z5RA 2X4QB 2B7DT 2ADIA 1L0QA 4X6EB 1MF2H 4XI5D 5KSAD 4JGJA 3FZUD 1FN4A 3MQIA 2EC9U 4ZS7H 2E27H 3GIVA 2D7TH 1UEMA 1JK8A 1A3RH 2YPLE 4JM4H 4KI5E 3WIHH 3FQRB 1HH6A 5C0BB 4URTB 1N5YL 1NGZA 3QXDA 1KJ2H 3TVMC 2EO9A 2EC8A 4QTIL 1CLOH 4HJJH 2E8ZA 2P1YA 5I8CB 1MWAB 2Y4SA 2UZIH 1KJVA 5E9DB 4Z7NE 3CLFL 1FRGH 1FCGA 5F9AC 3LN4A 1JPGB 4JFPB 5ADPL 3UZVB 1MJUL 1JZ4A 1GAFL 3GMMB 4XC1H 3MLRH 2YN3A 4Y1AD 5BJTB 4V1DD 1U92B 1CDYA 4XPTL 4Y2DD 3L9RA 5L88L 4RMSA 4OM1H 3QEGL 2GAZB 1LHZA 4ZS6D 1D5ZA 4X9IA 2DD8H 4MD5A 3GMQA 5E8NA 3VFOA 4D0CB 4WHTA 5B22A 1N59B 2C7UA 1Q9LB 1QACA 3UTPE 3VWKA 3MLYH 4NO3B 4Y8AA 5HYSB 3AB0B 4JR9H 4GXUN 5DYOB 4F7EB 3P4LA 5ADOH 3IDGA 3E8UL 1UXSB 1S9WB 2B0SL 5DZOA 4HMEA 4RWYL 3WJLC 2NY2B 5EUKB 4PIRF 4KROC 1A7QH 3STZA 3U48A 3EO0A 1MLBB 4H8WC 3O8XC 4GRWE 1DDHB 4XAWH 3LRGA 4JN1H 2C4XA 3H7BB 3B9KC 4XVTH 3ARED 2CDGA 1XIWD 1MY7A 2ICEB 2MHAA 1TTUA 2EDQA 3OTTA 5TE4H 1MQKH 1OT2A 2DWEB 4W6YB 4CU7A 4IS6A 3JWDL 4FQLL 4WHYG 2DQGH 1NL0L 1G0XA 2EDKA 5ITBL 2WUCH 1PEWA 3BYTA 1ZHKA 1GC1C 4P46D 5E6YA 2PYEE 1DQQA 5T33L 1CS6A 4TNVF 3WS6C 2BX5A 2D7OA 1EEZA 4N0YH 4NZJA 2JF1A 2Y36L 3VH8B 5J8OA 4BH7B 4L9LC 5GJSL 1RUPL 2FO4A 2A6KA 3P4NA 5A16A 4IOFC 4NNYB 4B50A 4I0PA 3UTSE 1SEBB 1ZT7A 1IL1A 5CEZL 3VXQA 3DVNA 2YC1A 2CDEB 4POYA 3SO3C 2VXVH 5MENB 1FCCA 5SWQB 1XF4A 1MJJB 5F7YC 1VGKB 4M3KB 1JFQL 2FR4B 3BRDA 3EFFA 1I3UA 4CDHA 1WCQA 4KDWA 4XVJL 1U6AH 5EZIH 1OAZH 1YNLH 5GRJL 1Z3GL 5CZXC 1UXWA 5C07D 1S5HB 4XCCH 5C0AE 4H0GA 3V6ZA 3QIUD 1V3JA 4EUPA 2HTKC 2IFFH 4JFYA 2BMKA 5DJZB 4M6AA 5EBWB 3PL6B 4TSCL 3F7YA 1CVSC 3OSKA 4JB9H 4ELMB 4HIHA 5JOEA 4C56E 2EYTA 2MTPA 1XCTB 1ZAGA 5HGAA 4TOYL 3V0WH 3DURB 1BVKB 5CGYC 3QUYC 3ZYIA 2C3WA 5J11C 3RVUD 3MBEC 5JXEA 1CDJA 2VLJD 4K94C 3RUGF 3AVEA 4WW2C 5FA3B 2DKMA 3RWIA 1U8JA 5HHOB 4J3SA 4AEIL 3ZTNH 3FFDB 1BREA 4WV1B 2AJ3A 4HUWB 5DT1H 1FNSL 5I9QB 1MVUB 2PF6A 4JFED 2H2PD 5D7LA 3IDNA 2NW2A 4Z9KB 4MNQB 2VE6A 1TVHB 5IB4A 5CEXA 3BRGC 4KVCH 1JRHI 2CLZB 4KKCD 1KPUA 1UC6A 4JCMA 1J10A 4JO1L 3HG1B 4P4RA 3F7VB 4ZUWB 1UJ3C 3I85A 2C26A 7CGTA 5D7IA 4PGZA 4JJHA 4IRJA 2R56L 2BRRH 4XNUL 5E2JA 4I77L 4WUUD 2NY4B 5D7SH 1TZGH 1FZOA 2AP2A 4DZBA 4X6CE 2UWEA 4WO4A 3C6LA 4L1HA 2LU4A 3O6FB 4LHUD 3MLXH 4UOW0 5ACZB 4H8WL 1YYML 4E42A 5TDOB 1B0RB 1ORSA 1RZJH 1PKQA 3NACL 3MRLA 5FOJA 3PHSA 1FPTH 3D0VA 2F54A 4YHNA 4B5EA 4JFHE 3BEVA 1QFWM 4FMKA 4D9LL 1ZLVK 5D96C 1ZA6B 4O02L 1J0HA 1H5BB 2AK4B 5C0CD 2AV7A 4OIAA 1Z5LB 4JFDA 1X6LA 5D7JB 5FKAA 2ZOLB 4BSVA 1GC1L 4XWGL 1WBXB 4GG6A 4XCYA 1TJHL 1JBJA 3P2TA 1EHLL 4QCIA 3O6KL 2ITDA 3DRQA 5ICXB 4HHAB 4JO4H 1GIGL 4PJCE 2X6MA 5IMKA 5I74C 1P7QB 1FLRL 1SM3L 4LKCB 3C5ZA 4J3VA 5HDOA 3RGVA 3SGJC 4F57H 4KZDL 4PREB 1K3ZA 1F2QA 5I1GL 3CMGA 3D9AL 3BKYH 4PJ8B 3P77A 2YD3A 4HUXA 3RVWC 4E0RA 3F62A 3PDGA 3IVKA 2ZOKB 3QEHA 1QQDB 4J3TA 3DV4B 3EZ8A 5LG1A 4JKKA 5I1AB 2NYYC 3FO9B 3P0VL 4DUXA 3ARVA 4G6FD 1SJHA 4P57B 3HN3A 4XGZA 4U6YA 5GRUH 5JIKA 4FFYH 1QSED 1L9MA 3MV11 4LKXB 4Q58C 2R0ZL 3C60A 4K3JH 3DROA 4MAYA 3HI1A 2B8OT 5DLMH 1ZLWK 1BQUA 1NGYA 3SBWC 4DTGL 3LQAC 5JHDB 1MIEH 4LK4A 4NCC2 1HWGB 3HNTH 5AG9A 3MRQA 3WNLA 1EEYA 4OZ4A 1XR9B 4RMTA 4K94L 2Q6WA 4MNHA 4JY5L 1N7MH 1DZBA 1A0QL 2FATH 5T1LA 5CBEA 3VXUB 1WAAE 4U1MA 3KS0J 3QUXD 1EXUB 4D94A 1ZLVH 2ZCLL 4M7JH 2XV6B 4XBEH 2P5EA 3Q5YA 1M1SA 1JWUA 1DFBH 1EAPA 1U8KB 5HDBE 5CD5D 5C2BH 1A1NA 1J1OL 2FLRT 1IARB 4AENA 5I66A 4ZFOA 4DWHA 2G2RB 4WHDA 5DQDL 4E41B 3T4YA 4EJ1C 5I15L 3HR6A 4NCDA 1A21A 1EJ6A 1VENA 3B9EA 2XICA 5ENWA 3KPMB 1XGTB 1MJ7L 3CK0H 4HPOL 1J8HB 1KCLA 3U0WL 4GW4B 3BKCH 3IDYB 1GSMA 1T1YB 1YEFH 1KPRA 3CFCL 4LU5L 4LSTL 3RL2B 4JY4B 4OKVB 4UAOB 5I76A 5E95B 2VO5A 3K8LA 1CFQA 5F3HA 3RGHA 3E2HB 3BX7C 1N64L 4PJEF 2P8LA 5AZEL 2ADFL 2R15A 3NIDF 4FFZH 4DCQB 2BVQA 1TJGL 1Q0XH 2L7UA 4GXVH 5DVOA 2G9HB 2YPKA 4G6MH 4N9OB 1NMCB 5EOQH 3OGCA 1TIUA 4KPHH 5TQ0L 1ZLWH 3EYOA 3LN5A 1SVCP 4RFEB 1FHGA 2E6QA 5ERWB 1OVZA 3WNNA 5GGTH 2HG5A 5I75B 4HPYH 5C0BD 4LLYA 1F02I 1OCWL 4NRXA 1F6AB 3QEUB 5T3ZH 3BSZL 4JDVA 4JAMB 5KS9F 2DBJA 1IEAA 1IQDA 1MEXH 5I1KL 1QLEH 5J3HD 5IHUL 4LRIC 4TNWF 1LO2L 5E9DD 4L4TE 2BXYA 2F74A 1A1OA 5EU3B 2H6PA 1FVCB 3KLHC 2ED9A 2AJYH 5GS0C 4HS3A 3FRUB 1AQDB 1YEIL 3QRGH 3IXTA 3QULB 5E8PB 1P6AB 1RZIB 1IM3A 1CLYH 1JUFA 1K8IA 1QLRA 3LV3A 4F8QA 4K2UH 5MEPA 2DIBA 4OF7A 4OZHF 1NFDF 3GBNL 1JGVH 1J05A 3LAFA 2NZIA 1JTOA 5C08B 1HKFA 3RBGA 1JN6A 1WLHA 4GAGH 1SY6A 4XP4L 5F7FA 2P8PA 3MLVL 3TBTB 25C8H 3CFBA 4M43L 4G9FE 4HKBB 5DJYA 3VWKC 2CJUH 3MACH 2AJXH 3T8XB 2JE8A 4K3DH 4PLJC 5EUOB 3GZKA 2NY2D 1MHPH 4X9GA 4Y2OA 5FM8A 3RP1A 4M62L 1ETZA 4FQJL 4BFBD 5JOPE 1ITBB 2FLBT 2X10A 1TETL 2F19L 2VDQH 2EXYD 3GDBA 3L3DB 4RFOL 3P9LB 5DJAB 3CZFA 1A22B 4UUJA 4MHHI 4RIRA 4UQ3B 5C70A 3A6CH 4LDOB 4F2MA 5DC9B 4PJBB 1MCLA 1MCHA 5C0RL 2IGFH 4PJ9A 5C7XH 4MGXA 5L9DH 4PJGF 4Z0BL 2XZCL 2YD9A 4X7SH 4OCWL 1BAFL 5D1ZA 3ZKNC 3U30B 1GCFA 1RJLB 2HVJA 3ARWA 4CADB 3MTRA 2CLVA 3NCYS 2OXHA 5GGRY 4ZO9A 1MH5B 5SWSE 4MJIA 3MCLL 2LAGB 5MEND 3FQTA 3GUTB 1INQB 5I16B 2SEBA 5BXFB 1JF6A 2GT9A 1EGJA 3EJYC 4I0PC 1W72A 2IANB 2OTUB 4DQOH 5L2KA 4RGOL 2VAAA 1DBBH 4KI1A 3AM8A 4PY7B 2J6EL 3TFKC 3L3GA 4LCWA 1NAMA 4P9HL 4HW6A 1KGCD 3Q48A 4WI5A 2EDTA 3RIAK 2E6JA 4Z78A 3PABB 4X4XB 3TO4D 4F7TA 4XCFL 2X4NA 3O3DA 1UM5L 3PL6D 4KWUA 1G7LA 2AJVL 1CQYA 1FGVL 4F7PB 1BFOA 3IJSA 5EU7E 1Q72H 2M8XA 5LWYL 3B43A 5IW6B 2H32B 1VFBB 3QFJB 5DJCB 2WSKA 3X12B 4OZIE 3LZFH 2ADGB 2X5PA 1H3PL 3KNBA 4LEOA 3WO3B 2C1OA 4IDJL 4QOKA 1CT8A 5JXEC 4PJHA 4G7VL 2YUZA 2DQCL 1S78D 2BSED 1FNAA 5GS0L 4QWWD 2IQ9L 2WINA 2F8XC 2A74B 2O5XH 1Z9OA 2R8SL 4BZ1H 1WVZA 2I9LB 4KRNA 2I5YH 3T2PA 2DICA 3STLB 5ESVA 3L3IA 1P5UA 1UB5B 1DQDL 3OJVC 2C4FT 4GW1B 5CJQL 3QUZB 1DEEB 1SBSL 5DFVC 1PG7L 3PNWB 2X40A 5L7XH 2VLJA 1I7TA 3QXVA 2D7MA 1BBDH 4Z7WE 5T5FH 5ETUB 3G5XA 4EBQH 4CMHC 2VN4A 3TGXA 4EDXA 5FEBA 1KCUH 2NY4D 5C0FB 5J6HA 2W59A 4XB7A 4IRJC 5EWIL 5HI5D 2VXSH 1NCAL 4GOSA 2BNRA 3GNMH 8CGTA 3P11H 3KPOA 4QYOA 3WHE1 4JFEA 4HWBH 3TT3L 1EO7A 5FYJD 5JORB 3VDAA 2GIYA 1VACB 4WEBH 4RQQA 4HSQA 5D2NE 2VAJA 2VISA 4WO4C 3C6LC 3SGEI 3FB8A 1JNJA 2B5IC 4I18B 3U1SL 3KPPA 3SDYL 4FNLH 3H0TA 1JRHH 2CRIA 4ORGB 1WC7B 4PJDB 1S5IL 5DFWH 5LAXB 4HCRH 1AD0A 5IB3B 1A9BB 1C12B 3QXTA 3MV9E 2AEQH 4L29A 2IALB 3ARBA 3EJZD 2GCYA 4W81A 3SDXA 2XWJB 3BVNB 1FO0B 5DK0A 1MRFH 5FGCB 5IOPA 5C09A 3RIFF 1IGYB 5LBSH 3RU8H 3OF6D 4S11A 3U0PA 2H26B 1YEJL 4WW1B 4PB9L 3M17A 2ZSVA 3FQNB 4PJ5B 1P7QD 2G75B 4L4VB 1GRWA 4HV8A 1KCRL 3WIHA 3CAFA 1SEQL 4PJ8D 2A9NH 2EYRA 1YN7A 3GKWL 3PWVB 4QRPA 2AW2A 3C5ZC 1KJ2A 1ZV5A 3MUY1 3RGVC 5J9PA 1U91B 3T65B 3DO7A 4YHKL 1K4CA 4DUVA 5F9WC 4F7CB 1LGVA 3P73A 3QUKA 3ULVE 3O41A 1ZANL 1TZIB 4MD4B 2UVEA 1VEOA 4MZ2A 4LLDA 2ZNXA 5JPMB 3K3QA 1JI2A 3DV6A 4M8QB 1YQVL 1HHGA 3PDOA 2P5WA 5FO7B 1ORQA 1UFUA 2R4SH 1IGCH 1RZFH 4NHCL 1AD9A 1V3LA 3G5YB 4MSWA 2RCSL 4JVWA 4AEHL 1TZHB 1IEBA 3C60C 4Z77B 5JHDD 3RWJA 4MAYC 3S96B 2YPLB 3X11B 1Y0LA 4FTVE 2DBLH 4JPIA 5K9KB 4YAQB 2Q7NA 5EBGA 4U6VL 2QV2A 1TVDA 3DX6B 1T7WA 1MCWM 3MOBH 4NWUH 4XNMA 5L2JB 3UYRL 2LABA 5FYLE 2BRQA 3VXUD 2R1WA 4DK3A 1DJSA 1RZ8B 2VR5A 1QSEA 4PJ7F 5IVNA 4X6FB 4M48H 4YGVA 3TCLB 4HIEB 4A6YL 5FGBA 1N3NB 1HHKA 3GMNA 3AS2A 1C7TA 1JCKA 3V52H 4G3YH 1RJYA 4Q9BA 1DQJA 1RUMH 1MI5E 4NKOB 4TQEL 3IU4H 4X8XA 4XP5H 5F72S 5DXWA 1T0NB 4AL8H 3BH8B 4BQ8A 4C83B 4EKXA 8FABA 1C5DA 4E41D 2Q8AH 2FYYA 1HCFX 3BGFB 1LP9E 2QHRH 2ICWI 2MFNA 4K71B 5EN2A 4GAJH 4AQOA 3JWOC 4L8CA 4X6BB 3TN0B 4M7LL 1KC5H 3REWA 4ZUTA 4J7RA 1A6VL 5TGBA 1JWMB 1KT2B 5I1CH 3HCVA 4WFHE 1NMBL 1MCRA 4GAYB 3LIZH 4NO2A 4RDQF 4F33B 1YECL 4OF8A 3IETA 3MLSL 3HS0B 2YMXH 5HHVH 4GRWB 4ZYKA 2ZUVA 4Z7VF 5T1DL 2YPVH 3QCVL 4M4PA 1ZE3C 4U1JB 3T0ED 2DJUA 4BKLB 1CF8L 3HR5A 3MGOA 5F9OH 3VGFA 5D1XB 3N1GC 1K4DB 3RI5F 3WE6A 4HULB 5EU4A 2QSTA 1RULH 3KLAA 1UCTA 4WFFE 1FZMA 1UM6L 5JQHC 2OJEB 4LHJB 1N5AB 2R39A 3C2AH 2WW8A 3TJEH 2CMRL 3PV7A 2Q3ZA 3HC3H 2V6HA 2Z93B 3H9SA 1H8NA 5I8KL 2PYEB 3Q5TA 1PX4A 2A6DA 2WQRA 3GFUA 4KTDH 1JGEB 1KTLA 3AXLA 2NW3B 1DR9A 2CH8A 5LGHL 1XGYL 5JR1H 5B39G 1IC5H 4AY0A 1K8DA 2X1WL 4XPGL 2J8UA 2WWMC 4HIJA 3UTSB 4NQCE 2XRAH 3AGVA 3L5XH 5E7BA 3V5DA 2X1QA 3OV6A 5CLWA 3K81A 4FFVD 4ZTPL 5IB1B 2O93L 3KYOB 1QYGH 3O2VH 3FQRA 5SX4I 3TWCL 4J4PA 4XI5C 1MRDL 3MV7B 4ONHB 2FH6A 5DQ9B 2K9UA 4J3UA 2Y5EA 1G1YA 5DDHB 5AYUL 4ODHH 5C08D 1JPSL 4ODSL 2V2TB 4HD9A 2VKWA 3SY0A 5E2WL 3HB3D 5C0AB 2OX5A 3FT3B 1OD7A 3DARA 4NOFA 3NZHL 4LLQB 5ELIA 3GSVB 4CAGA 2GJZA 5E9DA 2R29L 3WNOA 3V6FB 4OBSA 4PUBH 5F6IC 2VITA 4JFPA 2DQJH 3EDEA 4AG4L 3VGHA 4ZTOH 2DQIH 3BZ4B 2FD6H 3VXPB 5BJTA 4YBHA 1U92A 4JHWL 4JZNB 1P1ZB 3DUSB 1BIIB 2GAZA 5I0ZA 1DN0B 1S7TB 2DM2A 2ZJSL 3FTGB 3WD5L 3VG9C 4D0CA 2Z8VC 3ARGD 2R4RH 1E4WL 4AK1A 3GO1H 3CC5B 1GOHA 4NO3A 3H3PL 3X3FL 5DYOA 4XZUB 4F7EA 3ZDXF 1T1XA 3VD9A 2NY7H 1UXSA 1S9WA 5AUMB 2DTMH 4QHKJ 5JIIA 3TESA 4QXWA 1FBIH 4ORZC 5EUKA 2DQUH 5KVEH 2GJ6D 1T7VA 1W0VB 4PJ9C 4L8DB 1KULA 3S4SB 1LK2B 1DDHA 4MDIB 2PTTA 4NN6B 3H7BA 3VI4F 5DMIH 2EDFA 3LHPH 4Y4KA 3GMOB 4OGYL 5D1ZC 4CRPA 1K5NB 3PP3K 2J4WL 2X41A 4PRAB 3VI3F 4XPBL 3OKDB 1FFNB 3BP6B 4X6CB 2VWEE 1KCSH 3LRSB 3WKML 3MRGA 4P23B 1RU9H 1IT9L 1U3HB 2A73A 4G80B 4NQUA 3UZQA 1C5BH 2BDNL 3RUGE 3HAEG 2G5RA 5EO1B 2WM0A 5B8CB 1KN4H 3VH8A 3AM8C 4CDGC 4P46C 1IGJB 5JLZB 1DBJH 1WZLA 1UQSA 2V9TA 1L6ZA 1PY4A 1P53A 4BH8A 5E00B 2BNUB 1EX0A 3BW9B 3DUHA 3NA9L 2CDEA 4JPWH 5HPOA 5MENA 3QFJD 3C5SA 1MJJA 1VGKA 1X3DA 3I6LD 1VEPA 3KG5A 4R8WL 4UT7H 5KSVB 4ZODA 3ZMRA 2GHWB 1HEZA 4NNPL 2GY7B