2OQJB

Crystal structure analysis of fab 2g12 in complex with peptide 2g12.1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDYADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVTVSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A peptide inhibitor of HIV-1 neutralizing antibody 2G12 is not a structural mimic of the natural carbohydrate epitope on gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 2G12 light chain
total genus 41
structure length 224
sequence length 224
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2007-01-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oqjB01
2WBKA 5ABDE 5KSUB 1A6TB 1K8DB 1PLGH 4ETQA 4E42B 5FB8A 3EYQC 1T03H 4XXDB 5C2UB 1EXUA 3P77B 4QT5A 5ADOH 4GXUN 1CFQA 5F6HI 3GJFA 5MHSD 3D39A 2ESVB 3O3DA 1IKFH 5MERB 2VSDA 3AVEA 2B20A 5DGRA 1ZK9A 2EE6A 3T2PA 5JXED 2ZOKA 5KZCD 1F8TH 2D03L 3DYOA 4DZBA 1Q9KA 3V0AC 3TVMC 4Y1AA 1IE5A 4OLZL 3DO3A 3TO4C 3WD5H 5E56A 1WWAX 4LLWA 4Y4HC 5I75C 2VOTA 1OGTB 5C0DB 2EIZB 5C6TL 5ITFB 3DLQR 1UQSA 3PQYD 2Z31D 4MJIE 1AC0A 1T66C 1YEHH 3MNZA 3RPIA 3I9GL 1BFVH 1N59A 1RZIB 3LKNA 4AG4H 4Q6YA 1GZPB 5GQBA 4LPTA 1RUPH 1KCRL 4QXGL 2YRZA 1A6ZA 1NFDE 1W0WB 4F8QA 3I3BA 1IMHC 1B3JA 1R5IA 4YDVA 4HK3J 2XZCL 3KPSE 4ORGA 3RU8H 2PW2A 5LGHH 1IKNC 4YDJA 5A2IH 4U1MB 2OR9H 2KKQA 4M3JA 1YEGL 3LKPB 4ZD3L 4PJ9C 3CFEA 1XGPA 4KUCF 4RZCA 5DZOA 5F3BB 2KQMA 4J3SA 5IGXH 4OGXL 4HJ0D 4IMKA 3EYSL 1GGBL 5D4QA 3UC0L 5CIPB 5T3XL 3UYRH 4NJAH 4XX1G 3OSKA 5C8JB 4GOSA 2BSSB 4Z0BL 1FNAA 4MJ6A 4N0CC 4WW2C 3I3DA 4FP8H 4PJ7A 1L7TH 4NRXB 5EZLB 4XB7A 4HUUB 4IRSC 1J8HE 1YNKL 2EYSA 4UZGA 1A9EA 2EKJA 2EXWC 4DN4H 5T33L 3TH2T 1E4WL 4KPHH 1IQDA 2VN4A 4NNYB 3RWIB 3REVA 2LAGB 2XFXA 2DJUA 3DGCR 4BSVB 4AEIH 43C9B 3D3VB 4K94C 3BMWA 1UKSA 1NDGB 1DUZB 3L7FB 3B43A 3VXOA 4HGWA 1I3GL 3D0LB 1MLCA 4POZD 5E5MB 5I19L 2V2XA 3QUYB 1T1YA 4GG8B 1WITA 3HTLX 3O6KH 4G9DB 4IRSD 1WZ1H 2AK4B 4NFCA 1U8HA 4IEFB 1G7QB 3RDTB 5EU4A 5C3LD 2MHAB 4G8GD 3TT3L 1YEEL 4LASL 1FC2D 5D5MF 4JO2H 1UEMA 2K7QA 4FFWC 4S1RL 2R1XB 2W9DH 1YN7A 1B90A 4K8RC 1PEWA 4MCZA 4MMXC 1A14H 5I1DB 3L1OH 5DJ2A 3SY0B 5I8OH 5I8EA 3VFTB 2YA2A 2Q7YB 2CRMA 3ULUL 3HNTL 3V0WL 2VRAA 3MLYL 3PWPB 1TZHA 4F58H 4G42B 2ICEB 4D9RE 1B0RB 1MCLA 1QBAA 4HH9B 2IH1A 3B9VA 3KYOA 1I1RA 3C09B 4G6JL 4X6DB 4KDTA 1D6VH 2I27N 3GJEB 4JFPB 1MNUH 5BS0D 2BOCA 2EH7L 3LAFA 4PD4J 3KYNA 4MVBD 2FX8H 1X4XA 3SQBA 3KPMB 5DJDB 5KJRL 5C3TA 2DWDA 2A0LC 4WJ5A 5MEQB 1JZ4A 9CGTA 1J8KA 5CEYA 2GJ6B 3E0GA 3HG1E 1LO4H 4QYOA 4JM4L 4NZTH 1QFUL 1WAAE 4PGBA 2H2SD 4DUVA 3HFML 5GS0H 1AXIB 1MJ7L 2D7MA 3EJZC 5JUEL 3P4NB 2EH7H 1PAMA 3PL6D 3BXNB 4R4FH 2WIIB 2NY5C 3G9AB 4LHQB 1GAFH 5D7SL 1CBVH 2H6PB 1H3PH 1I8KB 5CHNB 2VLJA 3HUJF 5F9WB 1JGVL 5DRZB 2A74B 4DTGH 3QXAA 4JJHA 3JWOC 4YEEA 4LKCA 4HWZA 1J0YA 4DUWA 4MNQA 4Q2ZB 5BZWA 3V5HB 2H32H 3WN5A 5L6YL 1EZVY 4LVHB 4PV9B 3WKMH 3GIZH 3T4YB 4HGWB 4QRRB 1ORQA 4TNWK 2UUDH 5E9DE 2P46B 5GGVY 1NGPH 3LMJH 5BVPL 5BV7B 5DQDH 3D0VB 4QOKE 5D1ZC 5EWIL 2EDWA 1AD0B 1EEUA 3OGOE 4HIIB 4LKXB 4NJ9L 4LBEB 1N3NB 2YK1H 1IGML 2YUVA 4KKLD 2R4RL 2DQUL 3KWWB 2DL9A 4EUPB 2IWGA 3T0ED 2X89D 2AXGA 4NQSA 2DQGL 2VDOL 2AABH 3Q5TA 4KHXH 4O58L 3VFWB 5E99H 4ZQKB 5MENA 4KK9C 5E08L 4GAGL 3DSFL 5HHVH 4P2OD 4FQPA 4JKMA 1I9JH 3O3AB 5BJTB 1OF2B 5BZDA 5H94B 1ACZA 3BWAB 4JQXC 3MRNA 4WRLA 4ERSH 4GQPH 1MIML 1NCWL 4R96A 4D9QE 1ULVA 3GMNA 4ZFGH 4JHZA 1OAQH 2DLEA 2K1MA 3CU7A 4K94H 1JHKL 4LSRH 2ICWA 1JNLH 4G6MH 1PZUB 2QR0A 1KB5H 4GAJL 2OTPA 4UB0H 4U1LB 4FZEL 3QEGH 1QR1A 2AXJA 2OXGA 4MD4A 3HC4H 3JV6B 1XGUB 4KKAD 5C6PB 5I15L 3ARUA 3QUMA 1IJ9A 3MACH 1X5YA 5EIIA 3D69A 3MUY1 3MGTA 3GJFH 5HYEA 4JHWH 4NN5C 2ZCLL 1JGVH 4LCUB 3F65A 1EPFA 2AVGA 4NQCB 5FGBA 4PBXA 5J11B 2VMFA 4P2RB 5T3XD 1REIA 3R06A 5I18H 4C56A 1K85A 4JZJA 3T0BA 1A7NL 1TNMA 4TSAL 5MP6L 4AQ1B 2R69L 3QZWG 3HAEG 5KJRH 4QRRD 4KTDL 3V9FA 3WSQL 2OTWA 5K9KB 4U1JB 3HE6C 4I8DA 3G6DH 3STZA 3FOLA 3QUYC 3W0WB 2QSTA 1YDPB 4D8PA 5ILTH 1EXUB 3SE9H 2QQKL 3ARQA 1T2XA 3KPNB 4LSDA 2DQJH 4U1GB 5EOQL 5IEHA 2A2QT 1XF5A 2ZSWB 4H20L 3ETBF 3RZCC 5J12C 4XPBL 5FUOL 2ADFL 3SKJL 3WXWH 4CADA 3V4UH 3QDAA 1YY8A 3DRQA 1JCKA 2FSEA 5JZ7D 3GK8H 4C54A 3S98A 3V6OE 3BN3B 3MZGB 4H5SB 2EC8A 2ARJB 3ZDZF 4OUUB 1XF5B 4AIXA 5KS9E 3DX7B 4MGXA 2FX7L 3TESA 3ARZA 2QLVB 1E6OH 1IAIH 3H9SA 2F54A 1T22B 2AJZA 3QCTL 5F7LB 3I6KA 4N0YH 5ACZA 2FBJH 4EOWH 2Z8WC 4H26B 4Y5XA 5BOPA 3HE6D 3LEXA 5HVHB 2X4SA 4PRID 2YD3A 4LDOB 4PJ9B 1WBZB 3MLTB 4PRDB 4OAWA 4S1QH 3U83A 1EHXA 3ARWA 5JQ6H 4M3KB 4JJ5A 1T0PB 2E9WA 2JF1A 2JCCE 1EAPB 4BZ2H 4J8RA 4C83B 3SDDB 3D6GA 4LSUL 3GSVA 3TA3B 2X4PA 1S7WB 2EKSB 2R56L 2DLGA 1C08A 5GGSA 4E41A 5IROC 1IEBA 4XI5D 3MQIA 3LKSA 4BELD 3VRLF 3VXRB 5EUKA 1GPOH 5CIPH 1WICA 1A6AB 3MV7D 4KUZH 3UDWA 3KYMB 3VWJC 5T3XH 3TA3A 4HLZH 3T3ME 1EFXA 2IH1B 1C1EH 2M8XA 2ZSVA 1T7VA 2LVCA 4B41A 1RJLA 4Q9BA 4E0RB 5CEZD 1J0IA 4QO1A 5K9KA 3IT8D 3O2WH 4GT7A 4NRZA 3STBA 1NMCB 2CXGA 5D7KD 2AEIT 2W59A 3QG6A 4BQ8A 5IBLD 2NY2C 4P2OC 3TFKC 3O8XB 5EBGA 4M61B 1BWMA 1PJ9A 5BMFL 2XWBB 1VA9A 3U0PB 3MLSH 3RJQB 2DL2A 5IOPB 3PNWB 2MPAH 1OCWH 4OZHA 4LNVA 3T0EC 5JXEA 3EIFA 3EOBB 1CU4H 1A2YA 5DT1L 4GLRH 1AGBA 4JN1H 3TO2A 2ZUTA 3HE7A 4PRPE 4KXZI 1R3LA 3VGAC 4NO2A 3RPKA 2IPUG 3RY6C 4JQIH 1I75A 1YUHB 5ILTL 1NFDF 4PJGA 4RIRA 4F7CA 1AGFA 2BSED 3I75A 3GSUA 1YMHB 1PY9A 3ZKQD 1MFCL 4K7PX 5ETUB 3S36X 2ZOLB 4BK5A 5B3NA 1QZ1A 3D48R 1P53A 4X6FB 5E00A 4PJGB 4RIRB 2WINB 3H9SE 4PR5A 3RA7H 3CDGA 3O6FD 4AMKH 2DM3A 4DEPC 4PGZA 3KPOB 2EDRA 1D6EA 3NCJH 4NO0A 5DJ6B 3DX8B 2H2SC 1L7IH 4XWGL 1QSEA 1IAII 4MNGB 2FL5B 2X9YA 1MREH 1MQKH 2A0LD 2XI9A 1Q9OB 4WW2F 1YEJL 2JB5L 3U9PH 1T3FB 5E1AB 5TQ0H 1UC6A 3NH7L 4DZ8B 1ZA6B 3KXFB 5D72L 3HZVA 3LKQB 4FQLL 1N0LA 3SDXF 2FIKB 3WJJC 1MCPH 1JFQL 3QIWB 3GMPA 3TWCL 1AHWC 3JV6A 5DO2C 4X5WA 1BVLA 3KPRB 3SKUD 1XZ0A 3QNXB 1JPFB 3K46A 4LCIH 5CJ8A 3VXMD 4X9FA 4D0BA 5J56B 4M7JL 4GRLD 1T4KB 2F5AL 4PJDE 1U8PB 3U4EB 1U8LA 5A3ID 2R1YA 4U1SB 1HWHB 1P7QA 3N50A 1IEAB 3P4MA 2DQTL 3RY6A 4OI9A 3LEYH 5C0IA 2ZCKL 5BJTA 3RDTA 2F58L 2IAMA 3FQUB 4QTHB 1YMME 1BOGB 3C5ZA 2AGJH 1GGIL 4U31A 5C6WH 4HIEA 4UQ3A 3VXRA 3MX0A 4OZGE 1FRGL 4HZLB 4Y4FD 4NCC1 1FLRH 1DLHB 1QSFD 2DJ4A 2X5PA 2Q8AL 5LBSL 4JN2B 4ZS7L 5FB8B 4OF6A 2H2PC 3NA9H 4PJHE 4MNHB 1F6AA 4QHNB 5GISL 2I60L 1EJOL 4JPIB 1RZJH 4M7ZB 4LMQE 5J3HD 1NKOA 2J2ZA 4KK9D 3WFCH 1DVFD 4YH6A 5TQ0L 3UTZA 4CAGA 1FL3A 4ZSOE 1AQDA 1QA9A 1TETL 4M48L 3MRBA 4JDZB 1EK3A 3LS4L 5C0AB 3W0WE 3IF1A 2DD8L 2HT4D 5DLMH 1MCFA 5B4MD 2ORBL 2WWMD 3OR7A 4D9QD 5KN5A 4XBPA 3NCJL 1EFXD 3L3JB 5EOTA 4Z7WB 4IRJA 2DS4A 5IG7A 5ID0B 1AGBB 3KVQA 1JHTA 3IDMB 4MS8C 2CLVA 5D7LE 5EU4B 1HXYB 3V7AE 1U8HB 4R8WH 2BRRH 3JWDL 1K8IB 3B5HA 4NWUL 4W70A 3E8UH 4FQIH 4X7EC 5GRVK 3WFHA 2CUMA 1FL5B 1C5CL 1J1PH 3VXMB 2XWBA 3U0PA 5IHUL 3G6JE 1OAXH 4OLEA 2NW3A 3SPVA 4ZS6D 3VW3H 1NDGA 4XBEH 4ZDHB 3ARGB 4HS6A 4MQSB 4YHPA 3QO1A 4NC0B 2QKIB 1U8NB 5K9QI 2C9AA 4FQXC 3Q6GH 3FZUC 3V0WH 3JVGC 3HNTH 2Q1EA 2XWJB 1FJ1B 1HZHH 2Q3ZA 4F15B 4X7CC 1JWSB 4QRRE 3IFPA 3DYPA 3PGCB 2IMNA 3FT4A 4F9LC 3DI2B 1A6AA 5TDOA 3GZKA 3FTGB 4YC2C 3TO4D 3BRDA 4IOIA 2EC9T 2J8UE 5JDJA 1ETZB 1Z9MA 3QEHB 3MC0A 3W9EB 4P5TD 3W82A 3VCLB 5CP3H 4CNIA 4WFFE 4G7VH 1JI1A 4UUJA 2UWEB 5J13C 3EYQD 1CD1B 3K74B 1LP9B 5IW1A 2XTJD 3PGFH 5JIHA 4YNYA 3CDCA 4CJ1A 4WHYG 3P0YH 3RBGA 3I2CL 4XAWH 3TPUB 5ITBL 4HKZA 2QR0B 1UVQB 2HP4A 1ZMYA 1PFCA 4YUEL 2W60B 5IMOB 3V4VL 2NY6D 3SDCB 2YOCA 3LQAH 3EOBA 4KROB 4LFHG 5C07E 4ZAKA 3CH1A 4Y4HB 1MCOL 5EPMA 3MRQA 5D1ZA 1MFEL 3LS5H 4GKZB 2DMCA 3DX7A 4IOFD 3WYRA 4FFZH 1ZVSA 3G5YA 3SCMA 1KC5L 2ED8A 2HRPL 3RIFF 3PWNA 3C5SB 3UC0H 3UYRL 4LEOA 4Z77A 5SWSE 5GZND 1MFAL 4DGYL 1W72H 2BMKB 2X7LB 4PGJA 5IEHB 2FX7H 5L2JA 2I5YL 1VFBA 1DUYB 4UILH 5T1KD 5HDQL 3FAXA 4OLVH 5ELIA 4TPRL 4N5ED 1FH5L 1X5HA 2QQQA 1WFUA 3MCKB 4L3AA 3BPLB 2FD6L 4CVZA 1N5AB 3OG6B 3BHBA 2NY0D 3NFSL 1Y18A 2ESVD 5CMAB 5EC2B 2IMMA 4GG6A 2H9GA 3ZSTA 3MUZ1 5EB9A 4F2MA 3UTZB 5CWSA 5H35A 3OB0H 1UCTA 4YDJB 2A6IB 4MB3A 4YDKH 1WVZA 4EDXB 1XF2B 1HILB 1G0XA 3RWEA 3CSGA 5JIKA 2Y6SC 4MD0B 3CSYB 1OHQA 3DWTA 5IB1A 1B4RA 1LO2H 2E7CA 5IV2A 2VKWA 4NQEE 1JUFA 3DTXB 1GSMA 4TSAH 5CD3B 3S8WA 5DK0A 3MMEB 3R0MA 4G8GE 4QHKJ 2VZUA 1DLHA 4WWKD 3WIHL 3RWEB 1C5DA 3MYJB 4HIHB 3MODL 4XPTL 3VFSA 2PTTB 4UAOC 1U3ZA 1URLA 3U46B 3N1FC 2E6JA 1CLYL 1D5XB 1OGTA 1TMCB 1DQMH 5TGBA 2O5XH 1ED3A 2B4CC 4GQ9L 5E8OB 2O93L 2OSLA 1FFOB 2OCFD 3SE4A 2R23B 4LAQL 4I0PD 4KI1A 2DWDB 4WJ5B 5MEQA 4PY8I 1T66D 1F3JB 3O6ML 3MLRH 4OCSH 4LHUG 5IVZB 3BE1H 3CGTA 3SDCD 1X6NA 2BC4B 1YZZA 1DQQB 3QUKB 4ZODA 4HUWA 4L29A 5HXMA 3HC4L 2D4FA 2V9RA 4OJFL 4ZNEE 1DBBH 5HYJD 3ZE2E 5JA9A 4TSBL 3VI4F 4DKDC 1KJ3L 1HEZB 3DURA 3V8CA 4KKBD 4PS4H 1Q72H 3ARGC 4KUCD 3PDGA 4FRWA 3HNSL 5JXEC 4OCNC 4Y5VA 3MRDB 1XAUA 1QFWM 2NNAB 1JHLL 5I17A 3P3YA 3BMVA 3HZVB 3LKQA 2YMXH 5I71C 4OZGA 5K9JL 4L4JA 4UIKH 4NUGH 3B9KB 4LP5A 1QLRA 4JM2D 5EO0A 3HG1D 3DJ9A 3IVKA 5J9PA 2WBJA 2NYYD 3QXDA 4P3DA 4WGVB 4U2ZA 4DAGH 4KH2A 5K9OA 4PR5B 4RMSA 4HWZB 1QA9B 1H3VA 3VWKD 2FEEL 1AQDB 1SMAA 3LQZA 1P5VA 4R97C 1XIWB 5C71A 2J4WH 3QJFA 2GJZB 5DEFA 3PHOA 3GHEH 3CDFA 5IVXA 1MAKA 2X4OA 3UPCA 1QSFE 3DV6B 5ICXA 3EYOB 1MCPL 2PKDA 2FR4B 3AGVA 5JQHC 5L8KB 4Z95H 4JGUA 1OP3K 1BVKA 2IFFH 4NNPL 1OAZH 4PP2B 1YJDH 4Z5RB 1FGNH 3QCUL 4L8CB 3QUXB 4MXQD 4Z7WE 3X13A 3ZO0A 4Y89A 3LKOA 5MEOA 2HVJB 4PV8A 2YPVH 4HS6B 1AFVH 4PGDA 1D9KC 2DOCA 4AMKL 2JELH 4FXKA 1FAKT 5L6YH 3FMGL 3ESVF 5IQ7L 3G5VB 4JFQA 5BS0B 5L7XL 2YKLH 5EZOH 5F7FA 5FUCE 4OIAA 4JZNB 3P0GB 2X9WA 1R3HA 2GJ6D 1NC2A 2G5BA 2V17L 2BZDA 3BH9B 4PJBA 4G6FD 2XACC 4LLYB 1BJ1H 3MCG1 4G42A 3O0RL 5HBBA 1QEWB 4GSDL 3EDEA 4FTVE 4I0PC 3GJFK 1UM6L 4K3DL 1KN4H 3L5JA 4QRPE 2VQ1A 3M17B 3A0OA 1K8IA 4I1NB 3MODH 4XPTH 5KBNC 4PJHF 3EZJB 3BIKA 1IGYB 4TYUA 1UACH 3QUZA 2DLFL 4XBGB 4R3SB 1MAJA 1KB9K 3L7EA 5FECB 5F7EH 5EO1B 3MJ9H 1J1XH 2VUYA 3TYFB 3BUYA 4R2GD 5DJXB 3N06B 2O61A 2MPAL 4NQVB 3QDJE 4OLXL 3KR3H 1K4CA 4X8JA 4JFEA 2FIRT 2C3VA 2IANE 1QG3A 2R0WL 5JXAH 1HI6A 1GH7A 3BJ91 4K7PY 3LN5A 3N1QC 4RRPG 5DR5H 5HPMB 3PV6A 4X4ZA 3ULUH 2VLKD 5EU6D 1LEKB 3ZKND 1K2DB 2XNAA 1AY1L 2YUXA 5GGUB 5IFJB 5JZ7C 1BZ9B 1MHPH 1OSZB 2IPKA 3VFVA 4JRXB 1LK3L 5L9DL 1CK0L 3UZEA 4LOUC 3MRPB 4RBPH 2R1WA 4PJFF 4HBCL 2EH8L 4YHOL 3IDYB 5F1IA 4PJCF 5F21B 5HI5C 1F4XH 3BZ4B 4N5EC 1RUML 4NBYB 3VD3A 1VEPA 1UWEH 4JRYD 1WAAF 1CG9A 5ADPH 1J05A 2P8LA 4PJ8D 3QFJA 3VFOB 2YWYA 3OGCB 5JORB 2NQCA 5IR1B 3BPOC 4O51B 4FNLL 4GBXD 4Z8FH 1FO0A 1TTUA 1XH3B 4XHQA 2J88H 3QNXA 5HYJA 3MGOA 2ZUUA 4HX1B 4BH8B 4G6AD 3HPJA 4OCWH 4R4BA 1V7NL 3MR9B 3BAEH 1EHLL 4XX1E 1PKQE 2A6IA 2DBLH 5I6XC 1DR9A 4ODTH 2IFGA 2WBJC 1T6VN 4BFGA 2I07B 4PTTB 4OQTH 1ZXQA 4LVEA 5DJYB 4Y5YA 1ZT7B 5FIEA 3ULVD 4MNQD 5CINH 4H8WC 3RWFB 1D5BA 3MLVL 4AQOA 3D5OF 4WY7H 3U7YH 5LGHL 3L6FB 4PGDB 3T09A 1N7MH 1R3IL 2FECI 4ZTOH 5DJAB 3AAZB 2IC2A 4JZJB 3C6LD 1C5BH 3LQMA 4XVJL 3UTPD 3VFNA 1BFVL 4RFEA 3TVMB 3VWJB 4JFHE 4HG4J 1AR1D 4YDIL 3VU2A 1UB5A 2Y7QB 4TOYL 3VXOB 1NDMA 4LHUB 5L88L 2M1KA 1NBVL 2W60A 1D5IH 1SYSB 3PP3H 2FJHA 15C8L 3O3DB 2YRLA 4K9EL 3WD5L 4P2OA 2HJFB 2X1OA 4TULH 3T04D 1V7ML 4PYHA 3UTTE 5C0EA 2F9BT 1HKLH 1BFOA 3ZKMC 1AGFB 3I75B 4LFHD 2VXTH 3EW3B 3W11C 4OFVA 3G9VA 4P49A 2A6DB 4YR6A 4HV8A 1U8KB 3D1MC 2BRRL 4JANA 2ZG1A 3HLAB 4JVPA 2CUHA 3B2VL 5EO0B 1C7TA 5BQ7B 3AY4C 3MUHL 5D7KE 5F89A 4MA7H 2B1HL 3RWCB 4HK0A 2VH5H 2I9LB 1CGVA 2HAZA 1ADQL 4MDIB 5D5MB 3EYVB 3L5HA 4PRIB 3QFDA 1DBAH 4NGHH 3P9LB 3MOBL 2AKRB 1KELH 4ESKA 1CIDA 3OAYK 5D93B 5IVOA 2YPKB 1HDMA 3LN9A 3QH3A 4L9LC 3DVIA 3SDYH 5IROA 1MCHA 2VLKA 1OM3H 5IHZB 3DGGB 1NGZA 3QB7C 1ZGLM 5D7JC 5I1LB 4FZ8L 2PW1B 3NIDF 5HVFB 4ZS7H 5ITFA 1KLUB 1IEBB 1ZA3B 1NFIA 5INDA 1PBYA 2NMSA 4GMSL 3MNWB 1O7VA 3SE3C 2Q7NA 4OCWL 1V3MA 1EHLH 2AI0H 4OZHE 1Z0MA 3U0TA 3QBTB 1TTGA 5E08H 3NPSB 2W65B 2IANA 3L3JA 2FGWL 2D0GA 2XPGA 5M94B 3B4NA 4TSCL 3S3JA 3VXTB 3ZLQC 3QNYB 2XRAL 3MGAA 4LEXL 2CRZA 1MH5A 4Y7MA 5ACMA 4JB9L 1XF1A 4L9DA 1WFOA 3PP3K 4M7ZC 2J5LC 3CH8A 1F58H 1T22A 2AJZB 1MFNA 4P2OB 1KPRA 4PG2C 3GSXA 2EO9A 5I16B 1A9BB 1W0VA 3FB6A 3S37H 5GS1A 4GW1A 4APQD 3Q3GA 3ARGA 1I1AB 1AXSB 2OJEB 1CE1H 4ONHB 4A6YH 1SEBA 1IC1A 1IAKA 5FYLD 3IJYA 1UZ8A 1VFBB 4JQVA 3IRPX 1LP9F 5DA0B 2Z4QA 3VW3L 1BOGA 5I1JH 5ENWB 4MQ7B 2J6EH 4ACPA 3O4LD 3OKKA 5F89B 3RJDA 1NCCH 1FG2A 3MO1A 1N6VA 4ZAKB 3DX9B 3JWDH 2WUCL 5HYQA 5I1CL 2A38A 1S78D 4Q9QL 3GKWH 3FHQA 4GG6F 1FGVH 1OWWA 4FQJH 2EXWD 5C9JB 1D5MA 2X4RB 2RB8A 2G9HB 4RAVB 4G9DA 4NP4H 2J5LB 1ORQB 4J3VA 3TPUA 2HH0H 4PTUB 1G7LA 3HN3A 4ZPTB 1HHIB 4JKWA 2P45B 1G0DA 3DHMA 1TPXB 2I24N 4G3YH 2H8PB 4QNPF 1W8NA 4ODSH 2W07A 1RFDL 3HKFA 3W0WD 1TVHB 1QRNB 1WC7A 2AEPL 4KGLA 2VLJB 1MJ8L 2VLKE 4X4XB 4AT6B 5CKAA 1TQCC 1FGNL 2A1WL 4YHIB 1H3WM 3MLSL 5BRZA 4H8WL 1OD9A 5DWUH 2WWKT 4N0RA 4A6YL 2IPKB 3KPSA 3KLHD 5CIPA 2FJFA 3PWLA 1CVRA 2DDQL 4JCLA 2W91A 1ZT1A 5AD0B 5HPMA 1NMAL 3O2VH 3CZFB 4GXVL 5IMLB 4MB4A 4WV1C 3RNKA 2OJZL 1RJZB 5C2BL 3P40A 2JJWA 4ORGB 3GMPB 5CUSH 5HYQB 1S7TB 2EDFA 3GMOB 1S7XB 1UEYA 2ZPKL 3VWKA 4K3JH 2F53B 2EZ0C 3F7RA 3WFHB 5D1QA 5D1XC 3BH8A 4M93B 4HXBH 1EZVX 3C6SB 5A2KH 1RY7B 4HK0B 1V8HA 2XTLA 5DMKA 1IT9H 1HSBA 4Z78B 4FP8L 3ILQD 3L3GB 1J8HB 1FNHA 3OTTA 4XMKH 1TJIH 1XGQA 1H8SA 4CUCA 1P9MA 3TN0D 3STLA 1LGVA 4LSTH 3QQ3B 4M8VA 1CXIA 3U1SL 1QBMH 5E8EA 1BZ9A 1OSZA 4NN6C 1YEDA 1KJMA 5LGJA 1E4JA 5E6YA 5E2TH 5AYUH 4JFHD 4PJIB 3PGDB 2NY3B 5FEBA 3VG0H 4EN3C 1QSEE 1D9KB 4ZOAA 3W39B 3RL1A 3G5ZB 1QLFA 4MJ5A 5EC1A 5HDBF 4PREB 1GGTA 2EEBA 2YBRB 4IM8A 2RBLA 4FFYL 3W2DH 1R5WB 3EDJA 5HI5D 1G7IB 5CEYB 3FTGA 3VFNB 2FZ3B 5JHDE 1XR9A 1T0MA 2BOCB 5IBTH 3C60A 3QIBD 4OD3H 4PB0L 4DKEH 3FOMB 3TN0C 3QUZD 3C08L 3WFDH 2GJ6A 4PJ5D 3CU1A 3ARGD 4Y2DA 4HH9A 3D2UB 2O5YL 5C0CB 2EE9A 4D3CL 5IQ9B 4X6EA 1QOKA 5I30L 4W4NA 5ALBH 3T0AA 1ZTXL 4EI6B 5I1DA 1I9RL 1ND0B 3MXWL 3RVTD 2F53D 2BVPA 4X5WB 2YUWA 3HMXL 2ICEA 2AJUL 1S9YA 2GQHA 4N8PA 3U2SA 5C0NC 3HPLA 3WDIA 2YZ8A 5FGSA 4BH8A 3K8MA 3BH9A 1MVFA 5DD3H 4HMCA 2ZUQC 4A2LA 2XQBL 4JPWL 5T1LA 1U6AL 5I71B 3BP6B 2C3XA 1T0NA 4YDIH 1DCLA 3UJJL 1QKZL 2IQAB 3DSNA 1UQSB 2Y36L 5HHOA 2I5YH 2HRLA 2QL1A 5LJYH 4J3OC 1JV5A 1CDYA 5BRZD 1R3IH 1NCDL 3M8OH 1FNSL 4XC3L 3NN8B 2IPTH 4P99A 3DXAD 5H2BB 3SDDA 3TIEB 3WEXB 2WIMA 5E00B 3MLVH 3ARBA 4GKOA 3QUYA 4JRXA 2H32A 4V1DD 1KB5L 4GAJH 5C07D 3O6LH 1BF8A 4JJ5B 3DV6A 1Z5LB 3GO1L 4QWWD 1TZIB 3STZB 3TZVB 4YHKH 5FYKD 1P4LA 4WTZA 4LSQH 3FB8A 1BD2B 1KJMB 5LGJB 2LVEA 4U1GC 3GHBH 1SHMA 1G1CA 4HH8A 3R8QA 3LQZB 5IFHL 5HHMD 2H1PL 1K5NA 1T1XB 4MJ6B 1M6OB 3G6JA 4BZ1H 4NDMA 5EUOB 4YJZL 2M26A 4Z8FL 3MV8A 1Q0XL 4HUVB 3LV3B 1J11A 3MROA 4CVUA 2VDOH 4R3SA 4RFOL 5HHQA 3NAAL 4ONGL 3QXWA 4N0YL 4OF7A 4IOFC 1JNNH 3GSRA 4UAOB 5ESQA 5IB5A 3MRLA 3ECBB 3KHQA 3QP3A 5DWUL 1HH9A 1UWEL 1YQ2A 2V2WA 3DMMA 1FVDB 1XF4B 3ULVH 1R3JB 1G9MH 4LCIL 1R0AL 4P4KD 3LKPA 3HI5H 3RGVC 4PJBB 1CXEA 5HPOA 2VLRD 3U4AA 4NQED 4NYLB 1EVUA 3RTQB 2H8PA 3VGGA 5KVDL 3S37X 5INCB 4OZFG 4E41D 4WEBL 4X6DF 4JFQB 3SKNB 3QXTA 2YD1A 1OF2A 3H7BB 5BZDB 4XRCA 1NFDA 4PJGF 2IJ0C 3VDBA 4OLXH 1TCRB 5EIVA 1I7ZA 4NWTL 3KLAB 1A6WH 2VL5B 3F62A 4Y16D 1IAIM 1QBLL 5BRZB 3GB7B 3GMQA 4TVPD 1YQVH 1IBGL 1NLBL 2P43B 2EIDA 3T65B 1CG9B 5EU7C 4JM4H 4NZTL 4NZDA 4V1DB 3KNBB 2OMNA 2Y1VA 1QYGL 4J6RL 3BGMB 3QQNA 1XGYH 4GW1B 3SDCC 2ZCHL 1NBYA 2CDEB 2VDKL 4X5XA 3VD9A 4QRRA 5DVLA 5I1JL 5IFJA 3PE9A 1NLDL 2ORBH 3SJVE 2BJML 5HHMB 5KVGH 4M5ZH 4L5FH 4M7LL 4N8VG 4LLDA 1QRNA 5B8CB 5FXCH 4PTUA 3GSQA 4YXHL 4Z76B 5B21A 3DHJA 3MUJA 3BKJL 1T2QL 2NTFA 3HI1B 4IIQB 5LCVL 3BP4A 4CMMA 5C86A 3QISA 2PXYB 5CHNA 4LCWA 1MH5B 5HDBE 4EUPG 4R0LA 1BOYA 5F3HA 1HIMH 2MCPH 2NX5B 5T1LD 1CXFA 1R0AH 2P5WA 5CZKA 1YJDL 3RWHA 3RQ3A 5T1KA 3ZHDA 5J06A 1U8QA 5BV7H 3ZDZE 35C8H 2NNAA 2ED7A 3QDGB 4YPGB 5DJ0B 5DZNA 3V0VA 5DQJA 1S8DA 5I76B 1JVKA 2X7LA 3QO0A 1SEBB 4WTXA 3REWA 1NGZB 3TO4B 4X6BA 3AB0B 3VXRE 4XP5H 2VL5A 1FZJB 4OF3A 2FO4B 2DQTH 4NSKA 2DQGH 3KLDA 1S78C 3HZKA 5E4IA 3MLZH 4KMQA 4POZC 4JB9H 1JPSL 2BDNH 1SBSL 4P4RA 5EU6E 1MRDL 4E0RA 4MNQE 3U2SB 5D93C 5MEPB 2ERJB 3GSWB 1M71A 4Y16B 5BVPH 2DN7A 5CCKH 5BO1L 2BOBB 4NBZB 1T1ZB 1UXWB 2P1YA 5DUPH 5C0CE 4YHKL 3UCRA 3IJSB 4HW6A 1TQBC 5HGBA 5E8PB 3L5WA 5TGBB 3LOWA 3IDIA 5DURB 5E2JA 3ULVF 4UUJB 3VXUA 5E9DA 3QWOB 1I85A 1VB9A 2CGRL 2P8MA 3F58H 2A77H 5LQBL 4F9PC 4XVTH 4APQA 4KQ3H 3QULA 1MCNA 3DTXA 1RZGA 1S7QA 3FRUB 4EBQH 1DBAL 4NGHL 3O9WA 3OAUH 1A02N 4L8SB 2CIIB 1OT2A 5JW4N 2QBWA 3CD4A 3C9NB 2DQIH 3FN0H 1PSKH 3CFDA 3LEVL 2YBRA 3SGKC 4PY8J 4XNXL 1XFPA 1P7HL 2VKXA 2GHWB 2GW5A 3IFPB 2A73A 4DN3H 4F7MA 2ERJC 4O4YL 4LF3A 4U1KB 3DBXA 1YPZF 3P11L 1KENL 2MNUA 1B4JH 2VZVA 1F2XK 4X5XB 2C3WA 3LN4B 1U3JA 4HS8H 4WUUD 5LXGL 5IJVA 3IAQA 4ZDHA 1CTNA 4I18B 3B2VH 5C6TH 1FVEA 2QSVA 5DFVD 1A3RL 1HOCB 4K8RL 1XCTB 1OP9A 5GJTH 1JIBA 4JLRA 4YFLF 3UX9B 4G6AC 1E6JH 1ZE3C 3QWRA 4P57A 4M7KH 1JNHA 1EBPA 1RZJC 2DM7A 3L6FA 3OJDB 4LVNB 4HKZB 1GXEA 5DJ8A 1YDPA 1RIVH 4P9MH 4YDVB 3CC5B 3DETC 1BLNB 5FV1L 1KCSL 4WNQA 3MBED 2BVPB 1KN2H 4I0PB 4JPVH 2XV6B 3WLWC 3ESUF 5F7NC 1FFPA 1VESA 5I19H 4NQCE 4GLRI 2XA8L 1TVBB 4F37F 1U3HA 4C56B 5LKNA 4PBVC 2R4SL 3C8HA 4C59B 3LH2L 1XH3A 5HYJB 2VDPH 1W0YT 3WHE1 2OTUA 1NCTA 3WIFA 3TVMA 2CMRH 1GPOL 5IF0A 4HKXB 5GRWA 4LSVH 5DHXB 3B8SA 4QTIH 3QQ9C 4FNLH 2P8LB 4WFHE 3VMOA 3GIVA 2PF6A 4KV5F 4R7NB 3BN9D 3LQAL 3V5DB 4AM0B 1SJEA 2HFEB 3QZWA 1IEHA 3P4OB 3TFKD 1N5YL 3ZYJA 2XWJA 4JY6A 3NZHL 2CMRL 5CGTA 2ZPKH 3KPRE 4ETQB 1U8PA 5GRZA 1HI6B 3I02A 3BGFC 3K81A 2SEBB 5TQ2H 1YMMD 4YHMH 1P7QB 1LK2B 2WANA 1AR1C 1G6RB 1QR4A 3ALPA 3DRTA 4WUUB 1WZKA 5E7BA 1AH1A 5KANG 1G7LB 3WBDA 1TLKA 4MSWB 3VXQA 3ZKXC 3VWJD 3PWUA 5F7MC 3DOSA 2BMKA 1NCBH 3S5LB 3FB7A 2VUOA 1F4WH 5TDPA 4RGOL 4WCYL 1QNZH 5J6HA 3PQYB 4Q0XL 1RIVL 2B7DT 5BV7L 1JV5B 3OPZL 4OCMC 4XI5C 2XZQL 3FQXA 2ADJA 4YHOH 2EH8H 4CDGC 1NEUA 2DMKA 1A7OH 1H5BC 4OFYA 1D6EB 4R26H 1G7HB 2QSCL 3QFJD 4ZUTA 3OKNB 4WENB 1SEQH 4QCIB 3OBAA 1AGEB 1MF2L 2XWTB 3SJVA 5EU6A 4W6WB 4WW1A 1GGCH 3FO2A 1F11A 4AH2A 1ORSB 1CL7I 3CUPA 3O6FA 4N68A 5DFWH 5DR5L 3QUXD 5C0CA 4HJGB 2DM2A 5FM5M 1JF1B 2OLDA 1P7KB 4Z7QE 1ZLSH 3V2AR 2BJMH 1JGEA 1X5JA 2RQ8A 4L3EE 3CZFA 4QRUB 3U82B 5FA4B 3X13B 2DICA 4JFDB 5HJ3B 1XR9B 2CR3A 4ZFOB 3QDJD 1ZLWK 1EFQA 3IFLH 4HFWB 3H2WA 3BQUA 2WUCH 5HI3C 2P24B 4H1LA 2HTLD 5HI4D 1YUHA 5C0BB 1A6VL 3M45A 4ZUUA 3OKMA 1T5WA 4E5XA 3GUTA 1MLBA 3QULB 4AENB 2ZUQB 1NC4B 3EYUL 2Y72A 3H3BC 2P7TB 4YE4L 1FL6A 3BFOA 3D3VD 3O3BB 4WO4B 1OAZL 1U3HB 4YXLL 3MLTA 4PRDA 1U8LB 3PHQB 5EBLA 5JW5B 3FCTB 4WEBH 4R2GC 2NY7H 1RZKC 3QUYD 2F74B 5D1XD 3H9SB 5D6DC 3G5VA 4R26L 1HQRA 1XMWA 4S1RH 5KSVB 1FSKC 3ARDB 4QWWC 3BO8B 2Z35B 1DFBL 2VLKB 5EU6B 2EECA 4P57B 4LQFH 2WMPA 1IGCH 4IMLB 4X99A 5E8NA 3REWB 3IVKB 4L8CA 1WAAA 1IC5H 2Z92A 4ONGH 4HUXA 4K3HA 1KBGH 4PV8B 2BFVH 4UBDD 5DMKB 5A2LH 1A64A 2VDRL 3PWPD 1CFBA 3CJJA 3U30B 2AJYL 4DZBB 5DQ9B 1FL3B 3QIUD 5ICXB 3BPNB 2EDEA 4PJEE 3EO0B 4L4VA 4URTB 4ZFOL 4DUXA 5DI8B 1F6FB 1I7UB 2RJMA 4TVPE 4ZUVA 2HKHH 2J8HA 3NPZB 3QCVH 1IGIL 4WTZG 1DN0A 4WU7B 3JWOH 1MCIA 1UB6B 1RK0A 1L7TL 3HA0A 4J12A 5SV4A 4FQXA 2X4SB 5F9AC 1J10A 1CGSH 4RSVA 3NCYS 5EOCL 2E6PA 3CFDB 4KWUA 3SDYL 1IGJB 4HWBA 4TVPH 5IFAH 4O9HL 3HS0A 2VITA 1A4JA 4LSSL 4YGVB 3BSZL 3CUPB 4YXHH 1WLHA 4CW1B 1BQHB 4BQBA 4J3TA 3MOQA 5EU5A 5D6DA 4EJ1C 2DJSA 1I7RA 5JOFA 5M95B 4K23H 3U7AA 5IV2B 5MEND 4LRIC 1C7SA 4PBWD 4S1DC 1T4KA 2I25N 5C92A 2Y07H 3IU3A 3BYYA 1SJHA 3FB7B 3DPBA 5DF0A 2FHFA 1MHEA 3BW9B 5E8PA 1MQ8A 4ETYA 5I17B 3T0DA 1RPQA 2FATL 4Y16A 4PGEB 1CI5A 3FOLB 1W8OA 1U0QA 5BW7C 3QI9C 4RGND 1QRND 5IVXF 3NIGE 4KJQD 4JQIL 3QUXC 4CBPA 1PKQB 2C4FU 1JZ2A 1DEEA 3BW9A 1HDMB 3QH3B 1E4XI 1FZJA 1N6UA 4KVCH 1GZQB 1I1CA 3IRZA 4PB0H 5IVZA 1D5IL 3ZE1E 5K33A 1KLGA 2BVQB 2QQNL 3LRSB 5F6IC 1MJJA 2DKSA 2B2XL 4OD1L 2Y23A 3LRHA 4JFZH 5D2LF 1RSFA 3TNMB 1N8ZA 4ALAH 1MRCH 4AIOA 1T21B 5FGRA 2EO1A 2ATKB 5D1ZB 4XVJH 3ARFC 5CP7B 4YDKL 1E27B 4LNRA 4TUKH 3LSOA 2FEEI 3BESR 3DBXB 1CICC 5BVJB 1IGFH 1M7XA 1WZ1L 4ZSOB 4UI2A 3BP4B 3NAAH 2A6JA 2JK5A 3OX8A 1RZFL 3FO9B 2D7TL 1SVCP 2W0PA 4ODHH 1I3GH 1KPRB 1Y6MR 3OAUL 3TPKA 3VH8A 5FO9A 3FB8B 3SGEI 3UBXG 3NBNA 5DRXA 5JO5B 3C9NA 5GRVL 4LRIA 4LHJB 4CVWA 1NGYB 3ARRA 2IG2L 4CU6A 4K8RD 5I1IH 2A77L 2X4RA 5IMKA 2Y6SD 1I3VA 4OUUA 2JJTC 3C2AH 4YFLI 4XXCC 2W65A 5H94A 3WHXA 3BUYB 3TN0B 1CDJA 4K7PL 3UTQA 4IS6B 2IGFL 5I1LA 1W72A 2X70A 4JRWA 4TN9A 4G7YL 4P48A 4P59L 2BDNL 2XN9D 1AJ7L 1RUMH 2GITA 5IJVB 4P2YA 3AS3A 3WLWD 4U7KA 4X9BA 1IVLA 1ZWIB 5FYLH 3ET9F 1NGXB 3MBEC 2EC9U 2AKRA 1R24A 1YJDC 3V4PH 2GCYB 5B39B 5FKAA 5EZJA 4KHTL 2G75A 4L4TB 4LCCC 1X5AA 5BS0E 1CDBA 3O4LE 1AO7D 1L9MA 3G6AB 5AZEL 5DMYA 5SWQB 4EUPH 3KPRD 3Q6GL 3ULSA 3UTTA 1JHTB 3IDMA 4QXGH 3W11D 4CNIB 3OAZK 5IB2A 2DWEB 3QYCA 2CLZB 3VI4E 3PABB 5F1NB 4BUHA 4AENA 4N0CD 3NZ8B 3BEWA 1LP9A 1P9MC 5IW1B 4WI6A 3MJ8B 6CGTA 4QHKI 1DQDL 1ZHNB 3MOAL 4UV4H 5TDOB 4ODXA 1C5CH 2KL6A 1J1OH 4HV8B 5JW4M 3ROOB 4RISL 2HVKA 1ONQA 4GG8A 3TJHC 4LLQB 2QADC 4ODSL 5C0BE 3ARPA 1BFOB 3HLAA 4HPYL 3TGXA 1T80A 4PJ9D 4U1IB 2DQCL 3MUGA 5D8JL 3HI1A 4Y4FC 3HC0B 5HVGB 3P11H 1FQ9C 1MOEA 2BOBA 4YHNA 2DD8H 5DLML 1OP3H 1IQDB 3T0EE 2XNAB 5F88B 1AD9A 4Y88A 4PP1D 3PL6C 5MP6H 5BRZE 1JGUL 3RNQA 1TITA 3LN5B 4HIEB 1AKJD 4YHPB 4XH2B 1AGEA 4WW2B 3ZTJG 4HGKC 3O41A 2R1XA 5DJXA 4MVBC 5C0IB 1NANH 2UY6A 1A0QH 2GI7A 3CXDL 4LU5H 5EOTB 2XWTA 3SJVB 3IETA 5D6CB 1J88A 3NABL 1FLRL 4X99B 1DEEB 4JM2A 1WZMA 2CLVB 4U1MA 2UZIL 3IFNL 2ILLA 5EN2A 1GHFL 1IT9L 3QWQB 4M6ML 1WIOA 3D0LA 1GC1H 2Q6WB 4X7SL 2AK4A 3IF1B 3VA6A 1EV2E 2Q3AA 1NCWH 1GOHA 6FABH 4X7DC 3TIDB 4LEXH 3O6FC 3ZDXF 4HCRL 4KU1A 1TVDA 1M7DA 5B38A 1DQJB 5EFIB 3FHAA 2BVOB 1B6DA 4I3RL 3AS2A 4AL8H 3PWLB 2VDRH 4NQTA 1ZLWH 4WFEE 4JPKL 3SGJA 4M43H 4MJIB 1Q0XH 5DS8A 1BECA 4P46B 2GSIA 1Q9OA 3TC9A 5E2WL 3MRIA 4CN4A 3TCLA 4MA1C 2ZUSA 4CMHB 2EIBA 1LE9A 3OXSB 4ZAKC 3FO1B 5D72H 1FO0H 2DQHL 4QYOB 3T3PE 1A4JB 1A9EB 4YGVA 1QQDA 1G6VK 3DUHA 1X9QA 3WV0A 4KJWD 3EZ8A 3AM8A 2X1XR 1KIRA 1KTDB 4Q9CA 4FS0A 2HG5B 1J8HD 1F6LL 1FZOA 1I1FA 1Q72L 3F7YB 1RJYB 3BEWB 2B0SL 4HUNB 4MQTB 4ODBD 2X4OB 4UNVA 2ZZUT 4PJIA 1WT5A 5DVMA 1N2RA 3L3KA 1RULL 3SQOH 5KVEL 2GY5A 4F7PA 1YEJH 1XR8A 1KTLA 1DP0A 3OF6D 3ROLB 2XIDA 4I0PA 1NKRA 2G9HA 3IDXL 4LCWE 4PLKC 4NQVA 5J8OA 4HHAB 4S2SB 3SJVD 1UZ6E 2WBJB 4XCFL 2R15A 4HPOH 1FFNA 1ZWIA 5D8JH 3RA7L 1EEYA 4UU9B 3MGOB 2Q8BH 2ZKHL 1NCAL 2ID5A 3SEPA 5I1EL 3KXFA 2NY1B 1E28B 4HIIA 2VZSA 3C6SA 3HMXH 4NRYB 1ZVSB 1JWUA 4JN1L 1MFCH 1AO7A 1ZGLB 3UTQB 1QTYT 1CU4L 4KJPD 1D6VL 1A3LH 1CR9H 5MERA 1OB1B 1XGTB 1KIPB 5CEXA 3B2UD 3N9GH 3MRKA 1MCKA 2C4FT 2ZUXA 2CRYA 1CTOA 1R3HB 3EO9H 3SDCA 2JLLA 3ZL4H 2WINA 2R1WB 4TULL 2EIEA 4Q7DA 2BSTB 1RURL 5C09A 5TE4H 2HKFL 4C55A 3KYMA 1MJUH 5DK2A 1ZEAH 5EH1A 4EI5B 1MWAB 1Z5LA 4PJAF 3L3OA 1OCWL 2WAHA 5FYKH 5CSZB 5DS8B 4OBRA 4Y1AE 3OKDB 1JNJA 5JR1L 1OAYH 1BJ8A 1RZKH 5AYQA 3V6OC 1ETZA 2APVA 5DK0B 4HJJL 2IGFH 3WUZA 5CP7A 1WTGT 4XNYH 1HINL 2H45A 1ZT4A 3AY4A 1Y6NR 1S9XA 1DVFB 4MDJA 4XMLH 5B8CC 3IJSA 3QHZL 5JW4R 3DVGA 5FK9B 1KLUA 3GI9H 4X5LA 4NQDB 1P1ZA 3PWPA 5J9PB 3THMH 5D1QD 2VXVH 3BKML 3ZKNC 2H9GB 3BAEL 1V7NH 3HZKB 4F37K 3LEXB 4QEGA 4X98B 1LO3L 5IVNA 5ACZB 3SDXB 2VNCA 4S11A 2BXZA 2V5MA 3UTSA 1CGTA 4QF1B 4H5SA 2X70B 4QLRA 4DK3A 4I3SL 1R3KB 3BD5A 4YBHA 4XNZB 1AI1H 3WDJA 2PYEB 3C5ZC 3TJEL 4LPXA 3PQYA 3RAJL 2PO6B 3QFJE 5JQ6L 4KY1L 1D5ZB 3GSVB 3EFDH 2FSEB 4KJPC 3W5NA 4NT6B 4XP6L 4MSWA 1OD7A 4WI3A 2RFXA 1RZFH 2EKSA 3HUJE 4XNZC 1JBJA 1U8KA 4OD1H 1KN2L 4PRPB 2R23A 1A5FL 2A6DA 1B6UA 4YR6B 3S34L 2VDLL 4EI5D 3V52H 3LIZL 4JFEE 5HSFA 2ZWLT 4O2EA 3IXAB 2AJVH 2R2BA 2DQJL 4U1IA 5ERWA 1XIWA 2J3SA 1A8JH 4IIQA 4JPIA 1YEHL 5GSRB 4NIKB 3C5JA 4LVHC 1UB6A 4E9LA 2JK5B 4G8EB 3E8UL 4FQIL 3ZYIA 3Q6FB 3WS3B 2DIBA 4MXQC 1K4DB 3WE6A 1QD0A 2Y7QA 4I77L 4OD3L 2FBOJ 4RMQA 2XTJB 1JZ7A 2GUOA 4JO3L 5DA4A 5I73C 4K3DH 2BVTA 3ULUE 4WU5B 4TQEH 2DRUA 2HWZL 3L5WB 3DARA 2VXSL 4KJWC 1LILA 5D1QB 1ZA3A 3IKKA 3QDMD 1WBXA 1OWRM 2GYSA 1VGEL 1W0WA 3VE0A 1PG7L 1GZQA 3RVXD 3WJLC 3F12A 5TE6H 4IMLA 4OI8A 3D85D 1DTUA 3OJDA 4RAVA 4Y5YB 1OAKL 1PSKL 3RTQA 1BHGA 1S3KH 1AE6L 1JPFA 1NCCL 1DE4B 5JIIA 2NLJA 1NUDA 4BSWA 4OI7A 3MXVH 4QXWA 3S6CA 3NA9L 4HT1H 1Y6KR 3S36L 4HWEH 3P9LA 2PO6D 4OLUH 3FO1A 5T1MA 3VFRA 5I8KH 3SDDC 1FO0B 3DMMB 5CEZL 3EAKA 4X0KB 4ODTL 1D3CA 4XPAL 1KF9B 1TJGH 5IEKA 3TT1L 4MQXD 1HQ4B 1Q9LB 1EEYB 4UU9A 5C09D 2NR6D 4WUKH 1N26A 4B7LA 2ICCA 2ESVA 3NIFF 4M6OH 3E1F1 5EU5B 5I1GL 2EZ0D 1WV7T 1W2KT 1PD6A 3F7VA 2PYFA 3SDAB 5FO9B 1U41A 3C8DA 4G8EA 4N8CH 2J6EA 5FO7A 5GJSL 4AZ8A 1MI5B 3ALWA 5DRWB 1MPAL 3VRIA 4LQFL 4HUVA 4EZMA 5C2BH 2OJZH 4ZUVB 3AMKA 1U3HC 5A43C 1IKNA 1OGAB 1TPXC 3RDTD 1QBBA 3IXAA 4Q2ZA 3V5HA 5T3XE 3BWAA 2VTFA 3TWCH 4WWID 3GMRA 1CVSC 5F6HJ 2BFVL 3QNYA 4WWKB 3B2UC 3R1GL 4DGVL 1JN6B 4JRXD 4V1DA 1MEXH 4LARL 3D18B 5C0AE 1IGCL 2JB5H 4P5KB 4ZNEA 5EWIH 3OXSA 4OZIB 5I1HH 5FKPA 3GJEA 2OK0L 2JE8A 1YY9D 3FQTB 4QTHA 1WK0A 2XKNB 1KJ3H 4WFED 3VFWA 1MCBA 4OCYH 3UO1L 2K3TA 1MJ7H 5DUBA 3VGHA 1IAKB 3BKJH 2GIYA 5I9QC 4PJCB 4G3YL 3O6MH 3PWJB 4EQ2A 5SWSD 5JMOC 4DGIL 1U95A 4F7PB 2HH0L 3DMMD 2UUDK 5IM7A 4NP4L 4DGIH 2CLRB 4KZEH 5D2NB 1HWGB 2D4DA 2X89A 4MNQB 2FH6A 3MV9B 5J3HC 3T77A 3GSRB 1T3FA 2B4CH 5E1AA 1YA5A 3KJ6H 4OCYL 3VFOA 1Z9LA 5L2KA 2RGSA 3NFNB 4NZRL 3UBXI 2PXYA 1MI5D 1CGYA 4ODVL 4XCCL 4G43B 1A7OL 3DX6B 1I8MA 1XIWD 2YD2A 4HZAA 4JG1H 1OP5H 4GRWB 3NCCB 1HCVA 1D9KA 1MEXL 3WL9A 3RUGB 5I8OL 1EHAA 4DGVH 4OZ4A 3HRZA 5F7YC 4HGMA 3U36A 3P73A 3K1KC 2PUQT 3RWGB 3ZDXE 3S35H 3EJZD 3WKNA 1FH5H 3ARBB 4KZDH 4UQ3B 3QO1B 5GHWH 2AEWA 3MV7E 4WHTA 5J1SC 1HYSC 3ULVL 3U0WH 2C26A 2VYRE 4LQ1A 2VDMH 5DRNB 4CJ0A 5T3ZD 5I74B 2W0LA 4HUUA 5DJ8B 3UEZA 3QEQD 3LPFA 4JVUA 1MFDH 1ONQB 3EJJX 5IMKB 2HN7B 4C56D 4I3SH 3CFEB 3FAWA 4H0IA 2BNRA 1H9VA 3UPRA 3HCVA 4IRZL 1QRKA 3UJIL 3T3MF 5DRXB 3PNWA 4EQ3A 4FABL 3OKLA 4W4OA 4Z7VB 5SWSB 4WFGD 2OBGA 3HC3H 4JFFA 2XTJE 2D0FA 1GGBH 3EYSH 1X5KA 3BH8B 3LQAC 2SEBA 4PTTA 3FZUD 4L29B 3MV8E 4ZFFB 5GGSY 3RNQB 5EZIH 3MXVL 4QTIL 1FORL 5FFLA 1BQLH 2PNDA 1MRFH 5JPNB 3GI8L 4R7NA 5CAYB 4XC3H 2CKBB 1NGWB 1RIHH 4HXAH 3H42H 3X3FL 4Y4KC 3BE1L 1OAYL 3KPPA 2UZYB 2WM0A 2HFFB 1NAKL 4OZIA 3KS0J 3I9GH 4FHBD 4KTYA 3PHSA 1IFHL 1FNEA 5HHNA 4MX7A 3S35L 5L2KB 4ZFOA 4QHLA 4N9OB 1S7WA 2DTMH 2MWCA 3EDDA 3VFUB 4G8GB 1HZHL 3ZZ1A 1KCSH 5IF0B 1NUNB 5B4MC 5GPRA 4Y2DD 3FO0H 5CLTA 1ITCA 3EUUA 3WIIL 3HZMB 2APXA 4JG1L 3PABA 1S9VB 5F93C 4CVXB 3ZKMD 5DSCA 3WNMA 3WN5C 4UDTB 4XXDA 3F6LA 3HI6L 1TVHA 1QR1B 3CMOH 4HLJA 4JRYB 4KRPC 3MA7A 5ADOL 5LGKA 1Y18B 2D7QA 5T5FL 4L8SC 4Q6IA 3RPIB 2GUOB 3DUSA 3QIWC 3WNNA 3BHBB 1DBKL 1VFAB 2V6HA 1LQSR 1BBDH 1AP2B 1EBAA 4OM0L 1BFSA 1FFRA 5IBTL 4XMPL 1JPGB 3IDJA 1CLZL 4JFDD 4M93C 1EEQA 2Y4SA 1JNHB 5GIRA 4M61A 5KS9F 2CDGB 5JTWA 4NNXB 3BKYL 4DN3L 5DEGB 5DQJB 1TTFA 1M7IA 3BD3A 5CBAA 1HOCA 2IH3B 4NO0B 3O4LB 2Y06H 3P0VL 3QT2A 5KVEH 5H37G 1G6RA 1U8QB 3DRTB 4WUUA 3TH3T 2ZSWA 1RUAL 4AIZA 4CN6A 3KPLA 4CRPA 5A2FA 1U3HD 4QHMA 3U1SH 1MHCB 3JBG7 1AD9B 3TA3D 4OQTL 3V4VH 2LU4A 1KT2B 4OF0A 1IC4L 1UENA 4K2UL 3BKMH 3PWPE 3BP5B 4JQVC 3TVMD 5GS1B 5F71A 4UT6L 4LLMA 3IU3B 3MRGB 3RRQA 5B38G 4C83A 3MUGB 1U8IB 1T1WA 5DHVH 4UOW1 4P5MA 2NPLX 4XCEA 2PYFB 3SDAA 3UTSD 5H37H 4XCYB 4NKMA 3QHZH 3FQNB 1MHHA 3NFNA 3PDDA 3TBWA 1XGRB 2GAZB 1JUFB 2J8OA 3CSBA 7FABH 5DMGD 4K3JL 3BO8A 3IXTA 1H15A 5TE7H 3RL2A 2ITCB 2YD4A 2EYTA 2ZNXA 4K71B 1S7UA 4LCCB 5ESAA 1O0VA 1BFTA 4NKDA 1G9NL 1DFBH 3QUZC 1BLNA 2NY4D 5T1MB 3VFRB 5CSGA 5FYKU 1WBZA 1DEDA 1CQKA 1TQBB 1SQ2N 4M6OL 1MHPL 2I26N 1U8NA 3SN6N 3VXSD 4NSKB 2NY7L 4U6XA 3T0VA 5HYSG 4ZXBB 3FFCB 3MRNB 5MEPA 1R24B 3L3HB 3BYTA 5K9JH 1YN6A 3PJSB 4U1HA 1HYRC 1WBXB 2AJXH 3E2HC 4YPGA 3ZL4L 3PWVA 4XWGH 3GBLA 2WLYA 3AB0C 1P69B 5KTEL 3P30H 1KYOJ 4MZ3A 2NXZD 2VC2H 1FV1A 1J1XL 3CIQA 1YMMA 4LDLB 3EBAA 3KJ6L 1QLEH 4NWUH 2Z92B 1WIPA 4NO5B 2JJUA 4L9LA 3DUUA 3SKMA 4LBEA 1AXSA 2OJEA 3IFLL 4CMMB 3RNKB 2VIRB 3FKUS 4PLJD 4PLOB 4Z6AT 4CW1A 2GT9B 2VXSH 4GW4B 4NUJB 5F3HB 3IDNB 2DI9A 5CBEA 2W9LA 5F9OL 3AU1A 1OQOA 3QSKB 2ZCHH 3O6FB 4KK5C 3EDFA 1P4IL 3KPSB 3WIHH 1T1XA 2A9NL 2Q20A 1BBJA 3RL2B 5CD5C 3AMLA 1T7WA 5EBLB 2CSPA 3QXAB 1I7TB 3B9KC 1KJ2L 1JPGA 3VFMA 1FL6B 3T8XA 1QBLH 5GS3A 1FFNB 3CK0L 3LPGA 1AIFB 1Q1JL 2DQDL 1CD8A 4D0DA 4PJHB 3FQNA 4IJ3B 4NRXA 5EZLA 1RZ8B 2Y9RT 4K3EH 5IEKB 4W6XB 3FJTA 5LBSH 3KG5A 1E4KA 2XZAL 2W9EL 3NGBB 5IESL 1IL1A 2EDTA 3FT4B 4H0GA 3LIZH 2ICWI 3BP5A 4Z95L 4XRCB 4GRLB 1GGIH 5EUOF 1UM5H 1YEFH 3D9AL 5C0GA 2X2YA 1WUNT 4WI9A 2F58H 3V4PL 1B0GB 4JFYB 2E7LC 1CZ8L 12E8L 2FCBA 5D1QC 4YO0A 1U42A 3PL6A 3VWKC 4Y5VC 3F12B 4KY1H 3HE6B 2FGZA 5E70A 5J1TC 2VLRA 3RTQC 3SO3B 1ORSA 1DLFL 4TSCH 3WUWG 2L7JA 4HKXA 4DAGL 4Y4FB 1N59B 3OKKB 4JM2C 4UV7L 3T0EA 3B83A 4FTVA 3VH8G 2AK4E 4Y5XC 2FB4L 2PXYC 1CGWA 2GAZA 2WBWB 5E6IB 1CFNA 1JF5A 3P9WB 2ADJB 1FIGL 3MRFB 2VXVL 4X4YB 4NPYB 5CILL 2IALA 4F57H 1ZLUK 2KUTA 3P0YL 1MQKL 2N7BA 4X6CF 1BQHA 3CXDH 4OKVA 5DJCA 2WUBH 1KTLB 3D3VE 3MA7B 3GGWA 3L3OB 3KPSD 3VFVB 2VITB 2YN3A 1FPTH 1P84J 4LLDB 1AC6A 2ZOLA 3H3KA 1G7JA 1UKQA 4MD4B 4OJFH 4QHUA 4KI5E 5C07B 3RU8L 2A6KB 5J6GA 3G5ZA 3NVQA 1KELL 4JDTL 4OLWH 3H8NA 5CZXC 3CVHH 3GMNB 3U30C 3EFFA 1A7PH 4P2QB 4PJBF 2NY1D 3FL7A 5IW3A 3NCEB 5GRJL 5TJWK 1VFOA 2O61B 3W9EA 3WXVH 1MELA 3QPXL 3VXUE 4D3CH 4HULB 4OTXH 1I8LA 2HJKA 3WEXA 2J7LA 2P5EE 1WCQA 2QTEA 4P46A 3R8BB 5JHLL 3KLAA 5CGYC 2VR9A 4NQDE 4HPYH 3ULUD 3W81A 1ZLVH 1A6UL 4GKZA 5JPMB 2PTUA 5DVOA 1QO3A 1KFAL 1FCCA 5ALBL 4MAYC 4U6VL 3N9GL 2Q87A 2NTSP 1TVBA 2OYPA 2L4OA 5FYJU 5ICYA 4I3GA 5IMOA 3RIFK 4O4YH 2VR4A 15C8H 3JTTB 2NY0C 2BHYA 1MSPA 2CQVA 3FO0L 1FSKB 3HHRB 3L3KB 4I0CC 2VJXA 1KB9J 2MKWA 5DGQA 5HVHC 3ECBA 5E6ID 1RIUL 3SKOB 3CZJA 3QPXH 4PG2A 3GM0A 3C60B 3BN9C 4DKAA 4LLUB 2FHBA 2LAAA 5IB2B 4KMLB 2ZCLH 1C1EL 4JHWL 3QQ9D 1Q38A 2V2XB 1Z3GL 3ZMRA 3MACL 4PJFB 1R5WA 5CILH 2D31A 1UJ3C 4JO4H 2D3VA 1FIGH 4KKLC 5C1MB 2X1QA 3U7YL 4YC2B 4PRHA 4TNVK 1FORH 1QFWH 2PETA 3V6OA 3REVB 4G6ML 4OGAC 3QQ4A 4ZXBA 3VGDA 4QT5B 3OWEA 3UDWC 4GG6E 5SX5H 4H1LH 1FAIL 1YMHA 4MJ5B 2E3VA 5EC1B 3RUGA 4XAWL 1UJ3B 4QNPE 2NY3C 3S7GA 3WJLA 4J2XA 3U9UA 2P42B 2BSSA 3MLZL 4BYHA 1P7KA 5IW6B 1QSVA 2FHCA 2FB4H 2CIKA 4MWFB 5HHPA 4JPKH 4PJ7F 2ITCA 1F11B 2E9JA 4AH2B 4EOWL 5DC0A 4RZCB 1IC5L 4DCQB 4ENEC 2NX5D 5T1LB 5CUSL 4GRWE 5C9KA 5C09E 5DFVC 2Z31C 2JIXB 3VH8B 4UINH 3UTSE 3H9ZA 3CLFL 2QSQA 4GXVH 3CVIH 4GMTH 1NQBA 1ES0B 4JDVA 2EDQA 4K7FA 1YPZB 2J12B 3OJ2C 4MXWH 1PQZB 2UZIH 3KPRA 4FQXD 5E2UH 3UTTD 3LN4A 3WXWL 4QOKA 1X4ZA 1R5IB 2VAAA 5BXFB 2V2TA 1RUQH 3DYMA 1YEKL 3ZTNL 4ZYKB 4L8BA 4FG6D 3QWRD 4Y16C 1NCNA 3X17A 5JNYA 3D3VA 4RRPA 2P48B 3K2UH 1OAUL 3MNZB 2XKNA 4OZIF 1SBBA 4LLAA 2Y5EA 4PB9H 1MJ8H 4MJ4A 3RKDC 2OR8A 3VGBA 1Q9KB 1XGYL 4XGZB 2HJKB 4KXZH 3PP4L 2DLFH 4NM8L 2QADD 4NKDB 4MS8D 3DX8A 5E03A 2B4CL 4FFWD 2DKMA 2JCCB 5C0AD 1I1YB 1MWAH 1C08B 5AWNH 2ICES 3UTPE 5I1EH 2WBJD 4PRNB 1RK1B 5T5NF 3ZE2F 2GSIB 4FQ1L 3GMLB 1A7RL 1A1NA 2AV7A 4JFXA 3V5KA 1ZHNA 2CO7B 2HT4C 4P46C 1MY7A 1MAML 3P30L 3QUMB 4HWBH 4R97B 4O2CA 3CAFA 5IVXB 4GBXC 4G5ZH 2E9BA 1FGVL 5A16A 4YHLL 1IL1B 1HE7A 2W92A 5J57B 1Z0NA 4H88H 4M6NL 5L8JB 1LEGA 1S9WB 4XPGH 3GSOA 2JJSA 1J1OL 3KDMB 3B6SA 1L0QA 1EJOH 1M71B 4FZEH 4PJBE 1AHWB 1F3RB 2HJLA 5F8RC 2J1KA 5E6IA 4UINL 3LB6C 3CX5K 1FG2B 3FB5B 5BMFH 3K7UA 2AJ3A 4W6YB 2ARJA 4Q0XH 3SDAD 1CFSA 5ECJE 4HQQL 5KG9A 5FKPB 2YD7A 2VLRB 3VWKB 4M1GL 5IW6A 2CR6A 1J12A 5DJ6A 1OP5K 2ATPB 4FQXB 2OM5A 2VWEE 3GNML 4I18C 4LGPB 2GT9A 4GW4A 4S0TD 2V5RA 2N1KA 3BRGC 4DVBB 1G9NH 4BZ1L 3FB6B 5FCUH 1IGTA 3QPQD 3HZYA 1GL4B 1LDSA 3GFUA 4G9FB 2FH8A 4UT6H 2AQ1A 5EG6C 3JTSA 3CVHB 4QOKB 3K8KA 2OTWB 4BFIB 4LSQL 3H9YA 5BZWB 3GO1H 1VDGA 4WU5A 4YK4B 3H3PH 2CK0H 1ZV5A 4MAUL 3VXTA 4PRHD 3RIAK 1UWGH 1PYWA 4U1HB 5DMIL 3IFNH 3O3EB 4JO4L 3VXSA 2IANB 3X3GL 4NHCL 5DD5L 2BVUA 3WFZA 1MREL 3O9WB 4Y4HD 1BIIA 1L7IL 3VCLA 4Q97A 5BCAA 4YK4C 4DW2H 5FYJH 5TDNB 5EIIB 5F1NA 1U6AH 1G7PA 1QHPA 1UXSA 2DB8A 1WEJH 4G6FB 1F4YH 2P47B 2D2OA 5E9DB 3HMWL 2V7NA 3QCTH 3QIBC 2XZCH 3TLRA 5C0FB 1UJ3A 2F8VA 3QDGE 4BFEA 4RGNC 2EICA 3KPQB 3QI9D 5E5UB 4EVNA 3MXWH 3BKYH 2P44B 3MFGB 2PR4H 3VD4A 1G7MA 4JHAH 2OXHA 5HTSA 2VXTL 3HR5A 1U58A 2OZ4H 2GSGA 4KAQL 5GRYA 3B9AA 4P5MB 4OKDA 4PJ8A 1CLZH 1UYWH 4EN3D 4MA1B 1SJHB 2D31B 4GS7C 2V5TA 1QRNE 5FYLE 3T1FB 2VB5A 2BNQA 2DQFB 4H20H 5I76A 4JHBA 3CPLB 3IS1X 4ODUA 5TFSH 1GRWA 1R3KA 1T7YA 4OM1L 1UM4H 5HHOB 3NA4A 5IKCA 3QHFH 1KLFA 4ONHA 4X4ME 2FATH 1ZLUH 5CFHA 4HUWB 2WLZA 3PGDA 1G0YR 2Q76A 3ARDA 3QFJB 4XHJC 1PLGL 5ANME 1H8NA 1QNZL 5JO5A 1WFNA 1RIHL 3S34H 2XY2A 2NXYC 1MRFL 2UWEF 3CDYA 5C0AA 5EA0L 4F7TB 3NIDE 4LMQI 1E28A 1HH6B 1JZ8A 1C8PA 3DROB 5F9DC 3WDHA 3MRCB 2CK2A 3ALXA 1A1OB 1AGDB 1C5BL 3RWJA 1W72L 3O9WD 1J0KA 4POUB 5LG1A 5KSAA 4Y19D 3BSZH 5CD3A 4HZLA 1BEYH 1E0OB 1U8IA 1NJ9A 1OOAA 4J1UB 4UBDC 1A4KA 1FG9C 5KW9H 1IRAY 1K4CB 4X8JB 5CINL 2OI9C 4MD0A 1JNLL 2R56H 3BUTA 3QCVL 3VRJB 4HUXB 1EJ6A 3GMQB 4LIQL 3PL6B 5LAXA 5HD8C 1F4AA 4V1DE 2C1PA 4C4KO 5IMLA 3I2CH 1FZOB 4P9HC 4DVRL 5CMAA 3DI3B 5I1AB 4O2FA 1R5VA 5FYJE 2X4NA 2I07A 4PJDB 3CMGA 4M1CD 1TNNA 3BDBA 12E8H 4ELKA 4OCRH 3RVTC 2G60L 2YPLE 1EX0A 1P1ZB 1MCDA 1U95B 3TCLB 2FBJL 4HS3A 1RZIA 4NYLA 4NOBA 4JFOA 1IGMH 5E95B 3RVVD 5L2KD 3SCMB 4LPWA 4N1HB 1ZT4B 3IDGA 2VDML 3MLPA 1F4XL 5JPNA 4H25B 4Z7UE 5CSBA 5CKGA 4X80L 2NZIA 2W0FA 4ALAL 4S1SH 3O9WC 1T5XB 5DTFA 1U2HA 2VO5A 1T5WB 1NMCC 3JV4A 4X9IA 3RZCD 4H1LB 3N85H 4N0UB 3KYKH 4D0CA 1MJUL 1J05B 4KVCL 5LWYH 4DTGL 2IF7A 2NXYD 3OKLB 3BGAA 3IDYC 3T4AB 3FT3A 4L5FL 3G6JB 4M7LH 5FHAL 1BAFH 4KGJA 4Z7VF 3UBXA 1X5LA 3G5XB 4ODVH 3CFJB 4XCCH 3ABZA 5IHUH 1QFWI 3OMZA 3RHWK 3BPCB 1JPTH 5GZOC 3QEHA 2LFGA 4N8VA 2W1NA 4RA0C 4KMTH 4UIMA 5AUMB 5KG9B 4Q9QH 3GSUB 4RWYL 1I9EA 3GSNL 5GGQL 3Q2CA 3VWJA 3A6OA 1JYVA 1NCAH 1JWUB 3QA3A 1QUNA 5FOBA 2CH8A 3NN8A 4NO0D 3TNNB 1JPTL 2COQA 1KNOA 5IT2L 2J6EL 4D0DB 3O0RH 4XAKD 3ILQC 1I4FB 1NAMA 4XVSL 5KSBB 3U7WL 4HKBA 5F3BA 1P7QD 2ZJSH 1UFUA 5HYSB 5LWYL 4LSSH 5I15H 4HD9A 5DJYA 5E2UL 3ROLA 1XZ0B 3K4DA 1VPOL 2YPVL 3Q1SH 2I60H 3HPLB 1B9ZA 2OP4L 3CVIL 1JHKH 4LSRL 4RCAA 4X80H 1QPPA 4FOMA 4NNPH 4LKCB 4OGYL 1XGRA 1HNFA 4KVNH 1MPAH 4MAYB 3DUUB 3SKMB 5BS0A 1BJMA 1A21A 4NKOA 2HT2C 4G8IA 3KLHC 1CXLA 3ARBD 5C0GB 1NCBL 3QZWB 1KEGH 2P8MB 4EXKA 2X42A 2LU3A 4RQQA 5DUML 1FV1B 2ZCKH 4LLWB 1DJSA 2DBJA 2NY4B 4CU7A 5JNYB 4YHML 5EUKB 1IQWH 1EVTC 3U46A 3BP7A 4ZO6A 3WIFB 1MCSA 2PW1A 4XC1L 1KJ2A 4JVWA 4MYWB 1G7MB 1CFQB 4M7JH 1IGTB 1BGXL 4XP9H 5CGMA 1LEKA 4OLUL 3QRFM 5I8KL 1ROWA 4K7FB 4X7SH 5FA4A 3RX5A 1SJVA 2FO4A 3GIZL 4FFVC 2Z8VC 2HLFC 1A9BA 1W0VB 3WKML 3CSYA 3DETD 1XT5A 4JFEB 1QFOA 1RUAH 1OAKH 3TT1H 5ERWB 3ZSSA 5J11C 4YXKH 5E8EB 4PJ5E 1VERA 1Z3GH 2UZXB 2VDPL 4LLQA 2BNQE 5C0RH 1K9TA 4H26A 1INEL 2P5ED 5D2NC 4D9LH 4P3WA 2IBGA 2LABA 4IRJD 3QEQE 4ZD3H 4KJYA 1T6WA 2O5XL 4GQ9H 1XF3B 3P4MB 1HHKA 1KPUA 4L3EA 1TJHL 1M05B 3KDMA 3DO7A 4JM2F 2HTKC 1JGDB 1BWWA 4Z7WF 2H2PD 5AWNL 2NTFB 1D5ZA 2K7PA 3T2OA 4QXTA 3T1FA 1FVEB 2CKBL 5GRUL 2HT3C 4NO3B 4ZUSB 4KTEL 3BT2L 3MRQB 2EXYC 1LE5A 1YYML 4DOHB 1HEZA 1SY6L 2FLBT 4RBPK 1MFBH 4KRNA 1P84K 1ZA6A 1DBJH 1A3RH 4XNQA 1NPUA 1A6UH 1RUQL 2CKNA 5SX4I 4M62H 4F58L 3C08H 1NAML 2IEPA 2BC4A 4KK8C 2YRPA 3MREB 3O11B 3O45A 5GGRY 3RZCA 4WUUE 3TYGH 3ULVC 1MJJB 4NN7C 1UXSB 4GAYB 4RGNE 3EYVA 3QDME 4AEHH 2AAVA 3RI5F 3GRWH 2OZ4L 1DE4A 3WXVL 5TDNA 3RVUC 5HYJE 1G9ML 2P5WB 5FDWA 1CL7L 1VCAA 3OHXB 4ONFL 4J4PC 4YQXL 4WEMB 1MIEL 3OKYA 4XT1C 3L3DB 3RAJH 2HRPH 3SGEH 1VFAA 4PGEA 1LO0H 1HXMA 4Y1AD 3O6KL 4E42A 4L3CB 2FD6H 5SWQA 1X5XA 4U0RC 5CJOL 1ZHKB 2LTQB 5TQ2L 3S4SB 2V5YA 4CVXA 5F9WC 3GMMB 2F54B 3CC5A 1I3RB 3IKCB 1K4DA 4P4RB 3O3AA 3SOBH 4LNRB 5ESQB 5IB5B 4P2RD 2LQRA 5IHZA 32C2B 1HHGA 1KTRL 3CX2A 2R2HB 3H9HB 4KPHL 1N8ZB 4NN7B 1KIRB 1KTDA 4IRZH 2P49B 4FQQA 4ZQKA 5MENB 1KIPA 5CEXB 4GKSB 4NZUH 4H1LG 4YIQB 3DX9A 2YD6A 4XNYL 4LSUH 4E41E 5BO1H 4F15C 4HJJH 3ZE1F 3VXSE 4NRYA 4OZIE 1BD2E 2AJ3B 3D0VA 3BQUC 3U0WL 4NQXB 2NY3D 2HLFD 4PJGE 4OUOA 3KXFD 5EA0H 2D7PA 2OR9L 3ELAT 5F8QC 1RAMA 1VEOA 1U8MB 1A47A 1RVFL 5DJCB 3VGEA 5B39G 1G9NC 2XXCB 3FRPA 1BZ7B 5GSVB 2DLTA 1RZKL 2QEJA 4S10A 1EO8L 4MD5A 1JWMB 3QIBB 1N2RB 1N6QL 2NY2D 3QUZB 3KR3L 5HY9B 1PG7W 2YD8A 3PG2A 4AEHL 3WNOA 2BSRA 2Z35A 5C0CD 3RGHA 3NCYP 3VJ6A 1SM3L 4H88L 4M6NH 3FRPG 5FO8A 3T2NL 4FTVD 2HKFH 4UNUA 1HILA 2Q8BL 1FIEA 1U8JB 5EOQH 3QWOA 4NFBA 5LXGH 4M5ZL 3P4NA 5HGAA 1MFBL 1PKOA 4J4PD 1DQLH 1ZHBB 3MRPA 4X6EB 3JZ7A 4PRIE 1CT8B 4QY8B 5I66A 1KUMA 4UOW0 2R29H 3VD7A 5KSBA 1N5AA 3HRZB 1FYHB 4JKPH 4P9HL 2VISA 2CDFB 2F15A 2R0LH 4F8TA 1NGQL 3T0XA 3OKDA 5INCA 1VHPA 1V3JA 3SBWC 1VACB 3FQRB 4MCZB 1HHHA 2DYPD 1AFVL 4U1NA 3K8LA 3VXRD 5IBUG 2QHLA 2PTVA 3W9DA 4LSTL 2MMXA 1UADC 1CF8L 3MR9A 4EIGB 3TBSB 3NGBC 4TRPH 2AJXL 3KYAA 5HJ3A 2FRGP 2IFFL 3UZVB 2VLJD 5KAQF 1SMOA 5GZOD 4Q6IC 1WCBA 4JDZA 1C12A 3T4AA 3JSSA 4EDWL 3HB3D 4MAUH 4U05A 4F33A 4LCWB 4YBQC 2MHAA 3DIFB 4KRLB 3LEYL 3GGWB 4HIXL 4RFNB 3G6AA 2HKHL 4KKNA 5CCKL 4ERSL 5ICZA 1VGKB 2NX5E 3FCTA 4R0LC 1BP3B 3QXDB 2WQRA 3SGDH 1RHHB 5E5MA 1F90H 4KFZC 3TBTA 5E2VH 1QLRB 5HHVL 2F8OA 3L3GA 4RMUA 3F8UB 3QHTC 2EYRB 4DOHE 4O02L 4PG9A 2O26U 1KNOB 4WI2A 4DQOH 3KHOA 5HDLA 1YECH 2JIXD 3B8YA 2NY5L 3PWUB 1JRHH 2E27H 4QKXB 2ADIB 4KVNL 2HMIC 1MVUB 3GHBL 4HSQA 2MKLC 3CSPA 4K2UH 1Z9OA 3L7EB 3KPMA 5DJDA 1PVHA 2EDYA 3KPQA 4HWEL 4X6CA 3NIFE 4WFHD 1GC1L 1DL7L 3BIKB 3SKOA 3RWDB 4MNGE 1JGEB 3W39A 4AEEA 1NUGA 1G7JB 2ZUYA 3MRKB 3QAZC 2G2RA 3AXLB 1S7UB 2DYPB 4LCCA 3IU4H 5GRXG 5CEZE 3I6GB 2A83B 3P9MA 3S9DB 1EEZB 4JKPL 2LTQC 3SHSA 3SGKA 1OTSD 2Y36H 2A6JB 4MJIA 4OSUH 4EIZC 1KSRA 1U3YA 2GCYA 5E5RB 5IWLC 5F9OH 3H0TB 1S7RA 4K71C 2VH5L 1J0JA 1DQML 5CJBA 1D9KD 3H6JA 3QNZB 1RJLB 2NY6B 3OHXA 2IAMC 5B38B 3ARSA 4O5LL 4P2QD 2V2WB 4I9WE 4G6KL 3ARED 2GTWA 1X7QA 3V6ZA 3C5JB 1BBJB 1AO7E 1G7QA 4LCWD 3O8XC 4BFBD 4DKFH 2C5DC 1CLCA 2BNQD 3CX5J 4UTAH 4FQCL 2X09A 2FEDC 5F72S 4UV4L 4MD5B 4TVSa 5I30H 2FYYA 5SX5K 3NCFB 4N9GB 1FLTX 1Z9SA 5FGCB 3KPOA 2NLJB 3K2UL 1V7MH 2ESVE 1PX3A 3NMEA 1K5NB 2EDNA 1EO8H 4JGMA 4DJMA 3KYKL 3GJFB 4CU8A 3OJMB 1UCBL 1LD9B 3S37L 3J8F7 2BNUB 5L88H 5J7CC 5GGRA 2X4TB 4JG0L 5FYLL 3ZE0E 3QDGD 1WSST 4TPRH 5FA3A 1LE9B 3FO9A 5GRJH 4JO2L 1CFTA 4F7EA 4YHIA 1UZ8B 3TT3H 3M1BB 3GBMH 1M05A 3DO7B 1YEIL 3TBYA 1U93A 2Y5TB 4YBLB 2HJLB 3H42L 3IKCA 4OZHB 5AZEH 4TTGA 2GJJA 1HSAA 5AZ2H 1ZHKA 2R2HA 3H9HA 1IGYA 5E2TL 1HH6A 4HUKB 4QOKD 3HC0A 4P23C 3EHBC 2F5BL 5GGVL 5TPWL 3WCYA 8FABA 2C3GA 4YUEH 4HC1H 1BF2A 2H1PH 4F57L 4AEIL 5GS0C 2DBLL 4EKXA 4KRPB 1SVZA 1JE6A 1LVEA 2KZWA 3RVWD 4FABH 2IQ9H 4JZNA 4FZ8H 3PGFL 1BD2D 4QHLB 4N9GA 1ACYL 5I9QB 1QFWL 3OKEB 1Y0LB 2IADA 1F3DJ 2XG4A 1QSEB 4MNGA 2D7OA 2BNQB 2DQFA 5C0DA 5SX4H 3MJGX 3GBNH 1VFMA 4Z5RA 3JWNC 4YDLC 5GHWL 3E3QC 1Y0LA 1KCVH 3ZHLA 4U6YA 2FX9L 3MREA 4QHMB 3QI9B 3LDBB 2C4XA 2KQNA 4LPVA 2BSTA 1A1OA 1AGDA 1FZMA 4NN6B 2J8UB 3MBEA 4MXVF 43C9A 4UNTA 1FFPB 5IMMB 2VLMD 4HIJB 2WSKA 4P4KB 1W72B 4Y8DC 1BX2B 3S4SG 4EN3B 2RCSL 1CL7H 4NO2B 3QUMH 4M7KL 4NC1C 1MY5A 5ESAB 2WWMC 3OL2A 4PJAE 4JY5L 2VDQH 5IJKA 1U91A 1EGJL 4OZFH 3ZHKA 3RWHB 5EC2A 4RA3A 4FQCH 3ZT6A 4UTAL 4BQ9A 4Y5XB 2B2XH 4YGAB 1LNUA 1JGDA 2DQEL 2E5EA 1OT1A 2EEAA 2ZNWA 4R4NC 4XXCA 5BQ7A 4DKFL 4NFDA 5I74C 4NN5B 4XPBH 1XGQB 5E94B 5HHPB 1RUKL 2A9ML 3TBYB 4IOIB 3S4SA 4XCEB 4N0FA 5IP4A 5FOBB 2EDLA 2DTML 1SY6H 3FONB 3MNWA 4LGSB 2VDNL 1IKFL 4JAMA 3GSQB 4Z76A 1BIHA 1F45A 4Z18A 1U8OA 3PGCA 4AEFA 4J7RA 3P73B 3ORJA 4M5YL 5EZJB 5D96C 4JKLA 3MRMA 1S7XA 3KXFE 4ZPVB 1A7NH 3LSOB 3X3FH 3L3HA 4MNHA 1RULH 4GRMA 3SQOL 4O9HH 1SYSA 3SDXA 3LKNB 3PXJA 4PGCA 5IK3A 4LVOB 1WEJL 4XPFH 5HVWA 5AYUL 5ISZB 1UVQA 3BVNA 5L0QB 3CFIC 1QBML 4MX7B 5EZIL 5F44A 4M03A 5A3IC 4JEGB 1FFQA 5DEGA 1INEH 2VL4A 1BGXH 4Q9RL 3QDGA 3OKEA 1C12B 4P2RA 1MUJA 4FMFA 3HR6A 1WBYA 5JW5A 4XNQB 3IXTB 3CXHJ 5DO2D 1IAOB 1UKTA 5EBWB 1KB5B 1UWGL 2AJYH 3DSFH 5ID0A 3DNKA 1D5BB 2NY0B 3EOAB 2GY7B 5AAWA 1K3IA 1H5BB 4HEME 1WQVT 5JHDB 1VENA 3FN3A 5F9JB 4ZFFA 3GUTB 5TDPB 3U0TB 4XP9L 5HHXL 3GHEL 2AXHA 4WFFD 3VGFA 1F90L 3NACH 3P9MB 4QXTB 2AQ2A 5HGBB 1OPGH 3RY4A 4YPJA 5KANI 3JV5A 4R7DB 4BFIA 1I9IH 1LK2A 5L8LB 4KKCD 4JFPA 4DCQA 3EOTL 5DUMH 1I1FB 4HG4K 4G9FD 1UH4A 3WS6C 5MENE 2BVEA 5DD6B 4OV5B 1SJEB 2HFEA 4UIKL 4P5KA 3IB4A 3D18A 1SYVA 1CDGA 2AXGB 4LPYA 3VXMA 5DQDL 5DURD 1QFHA 3QFDB 3WO4B 3U7WH 5J89A 4IHOA 5DJZA 5F7HA 3QPQC 2BHZA 2DQDH 1Q1JH 1PW3A 3I6LD 3NFPB 3PV7A 3ZYZA 3UTOA 2JB6B 4TUOB 4QHUB 4XPGL 4D8PB 5LCVH 3HFMH 2YC1B 3SKNA 2Y06L 2CRIA 1OW0C 3B6SB 4OF5A 2YSSB 4M9OA 4JQXA 5DFTA 4KZEL 4ELME 5JLZA 4I9WD 4YE4H 5TF1H 3DX6A 1DVFC 3VXQB 3T4YA 1FC1A 1MAMH 1CBVL 4G6JH 2B1HH 3LB6D 1MLCB 4K3GA 4QRQA 2FIKA 2IQAA 1I8KA 4JM2B 1DDHA 3NIGF 3MLYH 3T2NH 1JGLL 3F5WB 1MUJB 1NLBH 4JR9H 2H3NA 5E6IC 3TBSA 4LCYB 4H25A 2MSPA 4R4ND 5DHVB 2YN5A 1F4HA 3C6LC 1LHZA 5EO9B 1FNEB 4PRBB 3DMMC 2GTZA 3H9SD 4XNMB 4U3HA 2B8OT 4K9EH 4LHUD 3B9EA 4U3XA 2DYPA 3V52L 3N85L 3U6RA 2E7HA 3U48A 1A14L 4OZFA 4HCRA 1GOGA 5T5NG 2FJGB 1MF2H 1B0RA 4PJXB 1IZKA 4MAYD 2X4NB 4LVOC 4Z7UA 2H32B 3RX7A 4U33A 3BOVA 4HC1A 5C0FA 4XNMA 4HEPG 4MCYB 3TN0A 4ZTOL 1CLOL 1JMZA 2LV4A 4HXAL 4LPUA 1N7ML 4ELMB 5DDHA 3TJEH 3WE6B<