3ILEA

Crystal structure of orf157-e86a of acidianus filamentous virus 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
b'VVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEARTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ileA00
3ILEA 3ILDA 3II3A 3II2A 3VB8A
chains in the Genus database with same CATH superfamily
5B8CC 3KYMB 3N40F 3F01A 2Z8SA 1Q9WB 4I9WE 4AJWA 3A23A 4NQVA 4YWGH 3MBXH 7PAZA 4U49A 3HNTH 4PJFE 4MNGB 3QHZL 5HYQB 1CGUA 4X9IA 2WLIB 2PO6A 3SEPA 3D48R 3D4GA 5LG6A 4OLXL 1A3RL 3T2OA 4P2QD 4FQCL 3NAAL 4B41A 3FOMB 5L2JB 1DJWA 4G8FA 1NAKL 5D4IA 1BZOA 5L4JA 1XO8A 2R23B 4G3YH 4C57C 2WGXA 4JN1H 2DLFH 3CH1B 3V0HA 5BVJA 1F45A 1GGYA 3EGXA 3N04A 3SOTA 3UJJL 3FN0L 1TEGA 3VSUA 1AKJB 4R7DA 1NGQL 2GI0A 5TD4A 4GW5A 4XI5D 5EF0A 5I75B 5JUEH 1XF4A 4XBMA 4XAWL 4TRPL 1JZEA 2BCKA 3NG5A 4WWNA 1OF0A 3X1EA 1KN4L 1DYZA 1GYVA 2CO2A 2YD4A 1YNKL 2NZ9D 4KQ3H 5I5RA 5IFJB 2BRQA 5C07D 2R7EA 2Q10A 3LPWA 5AKVA 2WMPA 4FMFA 5ADOH 4W68A 4N5EC 4Z77A 1CE6B 4MHHI 4P8QA 1P5VA 3ATAA 3GMMA 3MACH 3PWLA 3VXUB 3CFNA 4YQXL 3A6BH 2VDOB 4IQHA 1R0AL 2DKSA 2KMWA 3LV3B 2H6PB 2VZOA 5F6HJ 4LOVA 4LLVA 5AW0B 1JPST 3GXMA 3EAKA 3BH4A 3QFJB 5A40E 2X4UA 1IL1B 3E9UA 4HPOL 3L16A 2NDGA 2OZ4L 4AXWB 3BSZL 4GXUN 5I8OH 3H42H 3LIUA 3F6IA 1BIIB 3ILDA 3QUXD 2AXJA 3MX0A 4PG2C 5TFSL 4M7LT 3UTTA 3QYMA 4WK4B 1HILA 4U7SA 1T7XA 5KTEL 4F7PA 1QUPA 1DJZA 3FRPA 3KYKH 4P48A 1BV8A 4CC4C 1CDYA 5D1ZI 3OHXB 3FN3A 3WDJA 1OALA 3ZDWA 3WKNA 4BBWA 2DQDL 5K93A 4YDLC 1W0WA 3B3BA 3RE0A 5I2IB 3V5KA 2AXGB 2E46A 4W9ZA 1BF8A 1QACA 2DYRB 2CKBB 1DQQB 3UPCA 3CG8A 2DBLL 1EHLL 1CLVA 4LO9A 1N2RB 5L0QB 1M71A 4ZX5A 1T66C 1KB9J 5I16B 4E9SA 4KITB 4XN2A 1H8NA 4KRMB 1YN6A 4M1GL 4Z7NE 6PCYA 1GA2A 3D4ZA 5A7EA 3OAZK 3S2AA 4MD0A 1HCVA 1R3LA 1ZS8B 2UY7B 1E28B 4GRMB 3JSSA 1UACH 2YN5A 4Z5RB 5M95B 3UTZA 5I1AA 2CXGA 4ONHB 1GPOL 4BQBA 1NCDH 4HYTB 1NPNA 5ETUB 3GBNH 4I3GA 2R2EB 5D1QE 2JI2A 2H3NA 3GM0A 5F9WB 1N68A 4M93C 4P2RB 5E99L 5C2UB 4Y1AA 3CPUA 5IBLC 4JY4B 1G94A 4HKZA 4HQQL 2VWEE 4IMLA 4J3OH 1PLGL 3FB8B 4PS4L 4WDIB 4YC2C 1AC0A 3O4LA 1CF1A 5FM4A 4AEHL 2JI3A 1N0LB 1JZ6A 1HZHH 4JCWA 5TPWH 4S1RL 3CFMA 5E2WL 4PWIA 3HNVL 2CGRH 3LB6D 1DFBL 3X1GA 2HKAA 4TLKA 1PKOA 1WYJA 2QQKH 4K71C 2C9RA 2B2XL 4FI6A 3VGBA 4ZMAT 3DO4A 3NZ8B 5EU4B 4XP5L 1SY6A 1IC7H 3AU1B 1SY6H 4L4TA 5BZZA 1OGTA 2EDYA 4AQ1C 2BP0B 5KYWA 4TM9A 4KROD 2VN7A 2X4QA 2PW2B 4OGXL 4UTAA 4KK8C 2K7PA 1XTMA 1DBAL 1X3DA 4NBZB 5F7EL 4Q9RH 3TBWA 4JX0A 4PJ5D 5GRWA 4UTAH 2PXYB 4OF8A 1ND0B 4XBPA 2Z4TA 3T0XA 1A7PL 4L23A 1IGFH 4MD5A 3VGAB 4K5MA 5C0ND 3TNNB 1KGXA 4Z8FL 4D9QE 1UXLA 3B2UC 1RAMA 1ZT4B 2OYLA 3SDYH 2R0ZL 4HLZH 5I26A 3T2LA 1FCGA 4MNQB 4EIBA 5EZLA 3DJ9A 1AQDB 1IU1A 4TTGA 4J3BA 1RU9H 4IKNA 4IJ3C 4OFVA 5CZXD 4M3HA 7FABL 4PJBA 4N1EA 3GTNA 1DQIA 2NNCA 4XNMB 4P5KB 2YSTA 5FYKD 3VYNA 4DQOH 3SGKC 1XGRA 4ZDHA 4GBXC 1HT6A 5GXBB 3OAUL 4L05A 3LN5B 5FYLD 1NCHA 1JG9A 5HVGB 1CXFA 1A1OA 4S0SD 4HWZB 1RHHB 3X17A 3CN3A 4Y4KA 5LNGA 2GBAA 4MAYC 5DI8A 5DHVA 5E6IB 1UJTA 2HT2D 3ROOB 3TO2A 1YUHB 3Q1SL 5DHVH 2H41A 3QEQD 5DVLA 4BFIA 3RGBA 4A66A 3IN2A 2QSTA 5HPMB 3EXLA 2L0DA 1TLMA 2FECI 2OR9L 4HX1B 3RL1A 2NXZB 4K55A 1Z9SB 2Y7NA 5J3HC 1BQRA 1KMGA 2CHDA 2XXFA 5EDXA 1T21A 1AXTH 4TULL 5CFAA 3QRLA 3HC4H 1NGZA 4NQDB 1IEHA 2XPYA 3HLKA 1IFGA 2CDEB 1ZEAH 5FK9B 1FL3B 2YD5A 3BX7C 1VKXA 2JJWA 3VI3E 3ZTEA 1VACA 2X4SB 5EB9A 4ANKA 5I1GL 3KW7A 3P9MB 1BLNB 2HFGH 3BESR 4HK0B 4PLKC 2OMWB 5CU5A 1QUNA 4ALAC 4GG6F 1KCBA 3TT1H 5T3ZH 1TZIA 1WD9A 2E9GA 3U4EB 4UU9A 2NY5L 4OZ4B 3PAZA 3GFUA 3LEYH 3OKEA 1GYWA 2VDQL 5FWQA 1AZCA 3N55A 3NBNA 5LN4A 1INEH 1RZKL 5LUMA 2EYTA 3BW9B 1JVLA 3DHMA 4JHAH 1O9ZA 5C0CB 3NN8A 5D4JA 2AQSA 3S98A 4QHUB 2JKXA 2JKRM 4D7PA 4E41A 4JY5L 1BQHB 2QLYA 3G3LA 3ZUCA 1N8ZA 3EH3B 4AQEB 5BV7H 5KBKA 3TEWA 3OF6D 1PNCA 3MO1B 5HHPB 3E8UL 4HKBB 3IMVA 3VG0H 2JLPA 5C0RL 1FP5A 5ISZE 5IESL 4JFFD 2OSLB 3FUMA 2XHNA 3MNWB 4JRXD 3HJEA 3TN0B 2QADB 3ZO9A 5LCVL 3QUZD 2ZCKH 4J3OF 3U9UB 3DPDA 3PWPB 2H47C 3PY9A 3FYEB 4PRPA 1G0XA 3TU6A 1QA9A 3RWIA 3NABL 4U1LA 1U36A 3DDGA 1MFBL 4U3SB 3TOPA 1C8PA 3PV7A 1XF5A 3P4NB 5EEYA 3H53A 1DUYA 2YAQA 4I2XB 5IHHA 2EIDA 3L5WA 1EFXA 1BEXA 4LL1A 1N3NA 3C9NB 4W4NA 3US9A 1OGAB 2Z91B 3O2VH 3HE6A 1ZY9A 2UWEA 3ZKXB 1MCPH 4X6FB 1KYFA 3DSNA 3IFLH 3KLHD 3T04D 2YPLB 2YGNA 3AXLB 4ORGB 3FTYA 5LBGA 2OMXB 3MLYL 5KOVC 2F8OA 2PCXA 3MV01 3GBLA 1HWGB 5I75C 3UPRB 1OTTC 1G84A 5EIQA 1G7LA 1L0YA 2CO1A 1WCBA 4R2GD 1T6BX 1XMWA 5E24E 4PVMA 4ZX6A 1FLRH 3RQ3A 1UQSB 1J0IA 3KPSB 3ULVC 4WENB 4F1ZA 4N6RB 3BIBX 4EDXA 5BQ7B 4M62H 4PGZA 4B7IA 2FBOJ 3ECBB 4P5RA 4EEEA 3RDTA 1T03H 5GS0D 2BX5A 4R26L 5IVXE 3RFRA 4FHKA 2YMOA 4MMYB 2DEXX 5C1MB 3ABMB 1UOKA 2BVPA 4H8PA 4BZ1A 3CFQA 2NRDA 4AVIA 4P5MB 4BZ1H 1ORSB 4KKNA 2XJKA 3OKMA 3I2CH 5IG7A 4HJEA 1JJUA 2NTFA 2ADIB 4QTHB 3NSFA 2GJJA 3Q9QA 1J1PL 4XVOA 3KPNB 2A6DA 4NZJA 5I0DA 5IT2H 3BVUA 5DZOA 3MRBB 2RIKA 4APXB 3B5TA 5LB1A 1U92A 3BIAX 3VDAA 4Z78A 1MLCA 5C0BE 1UB5A 3QQNA 5IKCB 3OHXC 4K23L 4ODSH 2UYLB 1PW3A 4HT1H 1N59B 4K7FA 1E2WA 3LQAC 4X4YB 4QRPA 2YBGA 4IBQA 4X6BB 5CGMA 3QQ3B 5ICYB 5KG9B 3ATBA 2X9YA 4J12A 2XOTA 1XWVA 3EXJA 2BC4B 5FECB 5JHDA 3LZPA 5L0QC 4A2LA 3ZT7A 2K45A 1HOEA 4WNQA 3UIZA 5DSCB 1VEMA 1E5YA 1E8YA 4WW2B 2V9UA 2EYSA 1GGIH 1M3JA 3CH8A 3PHOA 1OM3L 2WZPD 4G6FD 2R69L 3L5XL 1MKFA 4G80B 4G6JL 4FYQA 1ACXA 4P2YA 3S36H 4LCYA 1RD6A 4L0ZA 1KIUA 1RZJL 3MGAA 1NGPL 4KTDH 4YBHA 3S36X 2QHRH 3EDDA 5F9OH 1UJ3B 4Q8BA 3QJRB 4TLUA 3UTSB 5F9WC 4Z7OB 3L3HA 2IO5A 1FN4A 3UBXI 2FGZA 1F3JA 3PLYA 5DURB 3VXOB 1DZBA 1UH2A 1QRKA 3QDAA 3ZTDC 3HN5A 1XF2A 1F4WH 2YKLH 3QHZH 5TE7H 2DD8L 3OB8A 3WKYA 4EI0A 4KKCC 1MJ8L 1KJMA 2XXGA 3QDMB 4Y2OB 4OLXH 1NMAL 4XVJL 3CZGA 1P7KB 2O5XL 2J1XA 2NY4B 4FQCH 4Y16B 4ZUVA 1NFDE 1QR1B 2VH5H 1MG3C 3S9DB 1NAKH 3O6LH 3PGDB 3VXSA 4PJIB 1OE3A 3QRGL 4NZDA 5MEOA 3F7KA 1TVBB 2P8LB 4NFDA 5F7FA 4F8NA 2X10A 2R56L 3FN0H 1GY1A 3JYCA 1EHXA 3JWDL 1NGQH 2VUOA 3F8UB 2GSIB 5FF6A 1IKFL 3UZQA 1A64A 3JWOH 3DUUA 3HHRB 4MXVF 4CRPA 2JKTM 2XWRA 2PXYC 4JDEA 3W37A 2GJRA 2RFXB 4YAQB 4N8VB 1PF3A 1AOHA 1C1EL 1MCSA 3WELA 4N2OA 3S4SA 3VGAC 1AS8A 3IPEA 3I84A 5E95B 5CD5C 4LL9A 4EQ2A 3LKNA 4YQXH 4DNLA 1R0AH 4PRIA 5EUKB 3BVDB 5D6DA 3OKNB 5C6PB 2F18A 4XCCH 1KULA 3BSZA 1UXMA 4NQCA 5D7EA 3ARQA 4F2MA 4HPOH 3IVKA 5GZOC 4B53A 2F54A 3BSZH 5E9DD 1AGDB 1RVFL 3H54A 4WEEA 2Y2WA 5E00A 3LDBB 4OZIE 3VFNA 3ZKSD 1OAXL 5EEUA 5KTEH 3HG2A 3QC6X 4QRUA 1GYUA 2XIDA 3BE1L 5AUMB 4Y2DA 3N43F 5TE6L 3DECA 3R8BB 3NCWA 2C3VA 5E6IC 2DQDH 4AMWA 2HTLD 5DQ9B 2WQ8A 4PGCA 1R1CA 1LO3L 1NBZA 2TRYA 3FQ4A 4RETB 4UM9D 3SKJL 1UWGH 3SQBB 2F8IA 2VMDA 2HJFA 2NXYD 3OG4B 2DBLH 4RSVA 1EHLH 5KVGL 1MCBA 1AD0A 2ZOKB 2W8CA 1DEDA 2VAAA 3S8GB 1J1XL 2O6PA 2NXZC 4HHAA 2J8UA 4PJEA 4H20L 4NQXB 4JM4H 4BH7A 2B3RA 5FCSH 3MRFB 3IGKA 2FEEI 4L1BA 3BWUC 1SNRA 1O7VA 2C1OB 2NY0D 3LVTA 4ISVA 2BSDA 3C60B 4DGYL 2HJKA 2GTWA 2Z7ZA 1DTUA 3DXAD 4Y8AA 1TZAA 3ESVF 2Y1YA 1HEHC 2ZYRA 4GKLA 2KYIA 4B5EA 4TQPA 2VLKA 4HUUA 2CR0A 3AM8C 2V4LA 3ATDA 4X7DC 2XIIA 3ZRCC 5E99H 1ZHLB 3WXWL 2AK1H 1R17A 4NKMA 4ELKA 4X0NA 3M7FB 1SJXA 2A9BA 2B1HL 3D5OF 1U8MB 3TL5A 1KLGA 2AK4B 4LCUA 4PS4H 1VGEH 3REVB 1QTSA 2IJ0C 3GTVA 3HZVA 1DO6A 3H3BC 4S1RH 3QPQC 1W16A 3ZDZE 4GUOA 1QTPA 3HNVH 2DIBA 1DFBH 1U95B 3VG9B 4KC3B 4JE0A 5CN1A 2B2XH 3UH8A 4L3CA 4LB8A 4ZFGL 1XT5A 2VUYA 1U2HA 4XP5H 4OY9A 5CJ8A 3FTSA 1E4JA 4B5ZA 1MFNA 2Y6SD 4PJDE 4X6DB 4NBXB 4XP6L 5LN8A 1OE2A 1TYRA 3EDFA 2APFA 5HVHB 1KDIA 1XZ0A 3DO7A 1Q9OA 3HLAB 4IBYA 1CDGA 1DBAH 4BFEA 5KYUB 5F7EH 3FH8A 2QADC 4NKDA 4JHWL 3V0FA 4HS3A 3DBSA 3OJ2C 4HUMB 5JIHA 2HFEA 4M6AA 3CUPA 3L4XA 4OB5L 1A7PH 1V55B 4PN6A 1HJCA 4YSTA 2VC2B 4Z8FH 4CMMA 1Z7JA 2P28B 4GSDH 2R0ZH 4Z7UE 4CVXB 1BZ8A 3BKJL 3CDZA 3ZYZA 1Q9LB 4U6YB 5E08L 1HDMB 2CXKA 1RCYA 1HL4A 4JFEB 3E38A 3ZKXC 1Q9KA 3OWEA 4LLWB 4U6HB 3RWFA 4YHYB 4YHNA 4BUHA 5HYFA 2JIXD 1NSNH 5EU6A 1QLEB 3BP6B 2CE6A 1IBGH 5LGJA 1PZ2A 3BUTA 4YX2L 1QNZH 4JFHE 4P9HC 1A14L 1KJ3H 1PJWA 1XV8A 2PYEB 3VFWA 4A39A 1SN0A 3WE6B 1CB4A 2QTVA 4NP4L 2Z35A 1E43A 3B7TA 1O5PA 3KGTA 5F7AA 1DVFA 3CQPA 3Q1SH 4MS8D 3WY4A 1DQML 4PYHA 3W0WA 3FCBA 3C2SA 1P7QD 3VSTA 3WKMH 3TA3A 2PTUA 2PKDA 4ABVA 4L1HA 1FFOB 3X13A 5DS1A 1U8JA 3IF1A 4OIIH 1KEGH 1LMKA 1CF8L 3QAQA 4YO0B 1ZK9A 3PREA 2R4SH 8FABB 3AT0A 3M1BB 1ZT7A 4KFZC 2W0LA 3OKOB 5E1QA 2YD1A 5D2NE 1FG9C 4BHUA 5FM5O 3HFFA 1T1XA 2HKFH 4C4KT 1NCIA 4JRYA 1NDMB 5EN2B 3CBJB 1S7UA 1YPZB 2NYKA 5DD5L 5AVTB 5I1GH 4NZ8A 5INCA 5CNHA 5GGQL 1KZYA 2UZXB 2P80D 4XN5A 2JH2A 2RB8A 3V0WL 3LOWA 4X98A 4M7ZB 4N2NA 3N9GL 4AL8L 4BFJA 4LNVA 5C0JB 5E7FA 4ZNEE 5ANHA 1MVUB 3O45A 4KO6A 4P06A 2CCLA 4LAJH 1GC1C 4PY8J 4WI0B 1Z3GL 4JW3A 5DA4A 3ZTNL 4R84A 1YYML 2J8UF 4PJEF 2Z4QA 2WNWA 4I5BB 5HI3C 4L8DB 2FJFA 1DN0A 2BDNL 2WB1A 3IJ7A 4BCYA 5E1HB 3ZDYB 4WW2C 5AAMA 4JY5H 4C56E 2IAMC 4NNYB 3S8WA 1CDBA 3HC0B 4JLRA 2MTAA 5TF1L 3E8UH 1HYRC 3B9VA 2AABL 4WU7B 4U4BA 3OMZA 2QVTA 3WEXB 4O5LH 2COQA 4KHXL 4YUEH 4I0CC 3S37L 2XVLA 3QG7L 2ADJB 1E4WL 3EOYG 4QJ3B 2YWZA 3ARWA 4C83A 1GL4B 1NCGA 2Y5EA 4JL1A 5D1QD 3NABH 4ZAKD 4ETQA 1V54B 5C9KA 4YNYB 3U0PA 3KJ6H 5DMJB 1X6LA 2OSYA 1OPOA 3MNZA 3P2DA 4HUXA 4K5PA 4PJFF 1U58A 1GGTA 2QPEB 1J8HE 3ZIYA 4Y16C 5BUAA 4PP1C 2NY4C 2OJ1A 1HAWA 3T8XA 2BHYA 3T2PA 5EPMB 5FLVA 4UTBL 5IQ7L 3U48A 1AD9A 1R33A 1I7RA 3D34A 3EJZD 4C4UA 2AKRB 1XB6A 2BVOB 1W80A 5EU3B 4WY7L 3VFSA 2AJXH 3L6FA 3MLYH 3OBAA 4NCDA 1JNLH 2CZNA 2VERN 4PB9L 1S7QA 3RNQA 2WLHA 3OG6B 4EO5A 1RFDL 2IV8A 2G4EA 5KSVB 4GQ9L 2BOCB 2JV6A 4AENA 4B60A 4XNQB 3MOAH 3VFPA 3OZ9H 3EYQD 4B3VA 5LQBH 2NCMA 3V8CA 2J73A 5F7LB 4KU1A 4PRDB 1E67A 3N2JA 1MCJA 2EVJA 3IS1X 4R26H 2XPGA 1EAOA 4PGBA 2K70A 1WJ3A 1JPGB 3QIBB 4FS0A 3S35L 3IJYA 3IXTA 5AW2B 1LEGA 1OTSD 4D9QD 1MREH 2D31A 1FV1A 2YC1B 3HHSB 3OKLA 1RJLA 2ALAA 4X7CC 3TJPA 4HPHA 3F7VA 3VWJC 1MRFL 3QR1A 4U6VH 5AL0A 5EUOE 3B8YA 3LDBC 3QBTB 2X6CA 1U6AL 1J1PH 3GHEL 2B5IB 3IWUA 1ZV2A 4G8AC 4IRSA 1P1ZA 2LGNA 2YPKB 1AXIB 3I6KB 2FYVA 2DQJH 4FI8A 1TQUA 3EFFB 4HJGB 4L29B 1D3CA 4O4YH 4ERSL 1EUUA 2NR6C 4LLDA 1BZDA 4UQDA 4UT9A 5BCAA 1DCLA 4EOWH 3SE6A 3QUYD 2BVYA 4JCMA 4UT9H 2FL5A 3PWNB 4LGSB 1MLBB 5JXEC 3AQYA 3FH5A 2NLJB 3KLLA 1RJCA 3OGCA 4OLUL 3SOBL 2WZAA 3JWNH 1VENA 3MCLL 3HZKA 2EUXA 3V55A 3DIVA 4DKFL 1T6VN 4OR1A 1YEIH 4JZJA 2CLVB 3A0OA 4X50A 2K4AA 2JQAA 5AW1B 1OM3H 4EAEA 4Z7NF 3L08A 3VFUB 3OZLA 1KELL 3L5XH 3FTUA 1MN4A 4XMKL 5DMKB 3C60C 3V9FA 35C8H 5DD0L 5IB3B 3BZ4B 2LTQB 5B4MC 3HC2A 4TQ8A 2XG4A 5JPNC 1MCKA 5EN3A 3G04A 5EZPA 5FKAB 4O51A 2PCFB 3RUGB 2XICA 5AVXB 2JB6B 4XN1A 3VH8A 3CX5J 2Y2YA 4IBUA 1UVQB 3IRCA 3FB6B 3CDCA 3MJ7B 3MRRB 4OJFL 4HAGA 3EFOB 2E59A 4P59H 1TCRA 3MR9B 2A5UA 1SJEA 4RDQF 3WCYA 1G9MH 1QSFA 2AQ3A 4FYSA 4XVJH 3RWEB 4YBQC 4GIAA 3K72A 3VG9C 4QYAA 5F9AC 1S5HB 2NYYD 3F6JA 2F15A 1XH2A 2LAGB 3S5LA 2EC9T 1T1YB 1MCRA 4IOIB 4KKLD 5ICXB 2R56H 5L88H 5FA3A 5K9QG 2MHAB 3JWDH 2K6ZA 5T5NG 5HVHC 1DZ0A 5TTRA 2OFQA 3KCPA 1IKFH 2XWCA 2LU3A 3Q3GA 1FF5A 5CBAA 4LVEA 1TTRA 1I8KA 2OMTB 4OCYL 5ISZD 1WSST 5E8EB 1KWKA 2A4EA 2HA1A 4IBLT 5HGBB 1C1EH 2XWJB 1ACZA 4YFLI 4GRWB 3U0WH 1FGVL 1IB5A 2P48B 1WISA 2VTFA 3RPIA 2DL2A 2NY7L 2OL3A 1KGWA 2OP4L 3N91A 2ED6A 2C4FT 2X42A 2NSXA 2QBWA 2LU5A 1CC3A 2OL3H 3FS9A 5AB2A 3CVIH 15C8L 2IQAB 3FQTB 4U1NA 3V95A 4YHYC 4F20A 2XKNA 2J2ZA 4JFYA 1OANA 4OFIA 2OK0H 3ES6A 1RVFH 4XZ4A 3T9WA 2NX5B 3DI2B 3BN9D 1OAXH 4JVPA 2EDWA 5D1ZA 3SDCA 3HS0B 2TRHA 1T7ZA 3Q8FA 4NEHB 2ZQKA 3LEXA 3K6DA 4MDRA 4H8QA 3BE1H 5MHSE 1MI5E 4TUUA 2FYYB 3SDAD 3D39E 3CSTA 3IGAB 5L6YL 1T0NB 1YDPA 3BH8B 4KJPD 4YSCA 1U8OA 3VMPA 4RMVA 3TC9A 3PJSA 3P3RA 2DI8A 1LO3H 1N5YL 1S7WB 5F89B 3SKJH 1QTYT 2IFFL 3NIDB 1A3LL 3BKML 1KIRB 4F24A 4DH2A 5EIIG 3BQUD 2P8MB 1CDUA 1CFQB 4PJGA 4WFGE 3TEZA 3D0LA 1B0WA 4UTCA 5GPRA 2FR4A 2E9BA 2CLRB 1OXYA 2XN2A 1R3IH 1H5BA 3IU3A 1GYAA 1QFHA 4BD4A 2AANA 2RQEA 3SPIA 4K3HA 3FU8A 2FE0A 1NIEA 3PP4L 3NCYP 4XN9A 3BCFA 3FO0H 2X05A 2R0WL 2DY2A 2Q8BL 3KXFB 4BUQA 4LCWA 2ZG3A 4LNRB 3UTPE 4N0FB 1T3FA 1JK8B 3VI3F 1L9MA 3FKUS 4B50A 4ZFOA 3WXWH 1ASQA 1VZIA 3AWEA 5D7SH 3U79A 4M7ZC 3BJLA 3O41B 4FABL 2B1HH 4FTVA 5C0BD 4P2OA 1ZS2A 4PJ9C 5FYKL 3TWYA 5I5MA 5JORA 1J5HA 5DRNA 4G1MB 1DL7L 2GJ6D 5KJ4A 1WBYA 5FYLL 1MWOA 3KL0A 4Z7WB 4YN3A 2HVJB 5GRJL 1N6UA 4K4KA 1UG9A 4RAUA 3HG4A 1XD1A 4MNGE 1F1DA 5KSUB 1MDTA 4AYBA 4ZFGH 5DD3L 5I1CL 5GS1B 2MKLC 2HKHH 4GPVA 3PABB 1T83C 2HXAA 4PWEA 4XP6H 1EBAA 4HKJB 1MEXL 3A6CL 3O6ML 4EZKA 3DBXA 3ECVA 3ZKNC 1ZANH 1U8IB 1JWMB 3AG2B 2OR7A 4HV8B 1LL1A 3T09A 1KCVL 3CZKA 2UUDK 1K8DB 4WI9A 4ZPTB 1WIPA 4D0DA 4U31A 2B4CL 3BVNB 4M56A 5BW7A 5J1TC 3LYRA 4W6XB 3T0EB 1MFCL 3R4DA 2DWXA 4ANUA 2F5AH 1OF2A 1BXUA 4ADIA 1LP9E 4E9QA 3K6SA 3ARDA 3S5YA 1S7VB 3DX7A 3ULVE 4P49A 3V4VA 2F7PA 1NANI 5E08H 5B1CA 3V4VH 1NKGA 4HS8L 3SE4A 3IU4H 2ZOWA 1ZD6A 2HH0L 4GOSA 4XNAA 3QFDA 2BIHA 4L1SA 3L4CA 5IB1A 2WIIA 3K1DA 4JAMB 4BSWB 3B9KB 3WJMB 4NT6B 1QBLH 1UWEH 1A14H 1FPTH 1GIGL 1QYGH 4BA0A 2VM4A 3QFJE 2JCWA 5KBPA 5IV2A 4GFXA 2H0EA 3MLWL 4UT7H 3BZEB 4JFSA 2FJGA 2QQQA 1AJ7H 1WTLA 3B9EA 4NP4H 4JHBA 4HIPA 3V7AE 3DIFA 1WC7B 4W9LC 2QL1A 1NCBL 1DQMH 3G6AA 3DX8B 2A6JA 3LNFA 2AJ3B 2IBZX 5HHVL 4OSUL 4G82A 4AK1A 1CF8H 2R2HA 3HJ0A 3O0LA 4KXZH 5FO7B 1D5MB 5TDOA 1P2CB 4IM8A 3U1QA 3VCLA 4A67A 5I1DB 2KLSA 1NAMB 3QULB 2GHWB 4XOBA 1QBMH 4LASL 4F5CE 2B5IC 2DW5A 3MV7D 2K8QA 2XG5B 3QDHA 4KJQC 2O5NA 4URKA 4TLTA 3G5VA 3QXUA 5DWPA 2EILB 4UUJA 3TBSB 1QABA 4RRPA 5I1IH 2XQYK 3EFDH 1K4DB 1GR7A 4PJ7B 5GGQH 4U1KB 3VXMD 2OAAA 3V0WH 2WWKT 4Z76B 5D5MB 4FNQA 4DKTA 1T2QL 1XH3B 3N9GH 5CSZA 4AL8H 4FQJL 5IHWA 4U6XB 3ORJA 3F64A 3V0VA 4ES8A 1RZ7H 5DJXA 4NI3A 1K2DA 1Z3GH 2G2RA 3V0EA 1NLBH 1S9YA 4OUUB 3FQRB 4P2RE 5G4MA 2XZCH 1G7QA 2IBBA 3VRJB 1PVHA 2D3LA 3TO4A 3FFOA 2KQMA 1MCHA 2YAMA 2BDNH 1RJZA 2EDOA 3SGJA 5I18L 4RNRB 3L3KA 3AG4B 1X5XA 4AYMC 1TJGL 3O3DA 1OP3H 5TF1H 4MXWL 2DJMA 5GS0L 2LTQC 1SJMA 1ET8A 2WTRB 5JNYB 2X1OA 1MQKL 2ZAHA 3GS4A 2HAZA 3B34A 3E8VA 3S37H 2BPBA 3PQYA 5I6LA 3QG7H 1TSRA 1ZHKA 3FHQA 4K5NA 5ID0A 1PIFA 5E8OA 3TYFB 1JGLL 3BAYA 1A7NL 2IXQB 4Z23A 2K6YA 4OI7A 3MROA 32C2B 4JVWA 1TJHL 2EQDA 3PWJA 1EEZA 2Z31B 4UTBA 3W11D 2FH8A 3C5SB 5MEND 1F6AA 1NFDF 2P43B 3FRUA 3H8NA 4UTBH 5CGYD 2AJYL 4Z7UA 1OZTG 5IQ7H 2DJUA 1BZ7B 2C1PA 1AFVL 5SWSB 4L18A 1SOXA 5LG1A 5HP5A 4NUPA 4M8VA 3D2UA 4WY7H 1EX0A 3RY6A 3UIYA 2G3ZA 3MHZA 1CQYA 4FQPA 3MV9D 4MNQE 1P4UA 2WXLA 4AVJA 4PRNA 1RL1A 1JNHA 5CKGA 2VRQA 4NO5B 4YGVA 1RFDH 2V8MA 2VDOL 5JW4M 2FO4B 1SBSH 3IDYB 2X5PA 4HJJL 4B9IA 1HQ4A 3UAJD 2R9HD 3A47A 1B0GB 3QDJA 1DSFH 4DP1X 4OF5A 1CD1A 1PG7L 2EE9A 4M6NL 4PRBA 3KJ4B 1T22A 2CGYA 1ZE3C 3UZEA 1ZA3A 1FNSL 3K6FA 4G8EA 3S35H 1AE6L 3L95A 4K3JL 4N0YH 2XPZA 1XB3A 2UX6A 1J48A 5LGKA 2CLZB 2AQQA 1SGKA 3WJJA 4NC2B 5B38A 2AITA 1B6DA 1WICA 1U6AH 3ATEA 3GHEH 1EPFA 1A6WL 1TETL 4OZIF 1M6OA 1H3TA 3HS0C 5E5LA 5F6IB 4W9EC 4DCQB 4KZEL 5C8JB 4ZPVB 4TNFA 3VQLA 2ZYIA 2VE6A 4JFHD 1AZBA 4QHNA 1TKWB 3SCMB 1TQSA 4NUJA 3DYMA 2EAEA 3BKCL 5DMGD 4GSUA 4NQDE 5I5JA 4AM0Q 4YSDA 4O02L 1BVLA 2WN3A 4I18B 3NJMA 4O58L 5IJKA 2D7TL 4B27A 4LPYA 2HFTA 2E7LA 4OLUH 3SOBH 1AHMA 2P52A 1RIHL 4YFDB 4DKFH 2ENYA 4PY7A 3CFBB 2X3CA 3WDHA 1MFDL 3A22A 4GRLC 1T2JA 3FAXA 2YA1A 3FOLA 4GLRH 1HXKA 2DQUL 3CFDA 4NXSA 2MWCA 1FLTX 3P0YH 1KG0B 3MRQB 4OZFA 1G1CA 1KELH 4TQIA 1HEZB 4XMKH 4EKJA 4S0TD 3TBTA 1NC4D 5DD0H 1I1FA 1XQ4A 1WF5A 4OZFH 2D0FA 1Z9PA 5ANMB 2CUAA 3C6EA 3UBXA 3L17A 1SJHA 1MCIA 1ZMYA 1MH5A 3LN4A 3T3PE 3QA3B 2B8OT 3HTLX 4H25B 5D1XB 4CU6A 1M4KA 3Q7JA 4PU2A 3QIUD 1F02I 3I02A 1G0DA 2FJSA 3P30L 2FQFA 4Z0BL 4HXBL 4OJFH 2R2BB 5TQ0L 3T1WA 3EO1A 4ADGA 1MZYA 2F7OA 3S7GA 3VFVB 3HEIB 1RUQH 1AHWB 4PBWD 2YRPA 4HGWA 5GSVA 3PWPE 4I0PB 4E42B 3RWJA 2UVFA 4IIQA 2I26N 3GIVB 1A25A 4AZ8B 4UDTB 4BFBD 3VDBA 2NSMA 3WS3B 4L4VE 2OJEB 1YY9C 3GMOB 4JPVL 3C6SA 3T4YB 3HPLA 2XWBA 2YFNA 4PJDF 4P4KB 1R5IA 4C56D 3QCUH 1BAGA 5DJDA 1OGAE 4NKIL 1S5IH 3QWOB 5E6SB 8PAZA 5C0AB 2BY0A 2ZJSH 4KDWA 4PSPA 3VXNB 4YK4C 1XGYL 5IMKB 5KUKA 1E9QB 4OCMC 4HCIA 1N19A 2E27L 2QGCA 3D8MA 3WG7B 4H1LA 5SX4I 4RZCB 3LXUX 4CNIA 3T0EC 3ZTCC 3BWAA 3CHRA 4H1LH 1MNUH 4PG2A 5DFVD 1O9VA 4ZFFA 2AHIA 1QQDB 1I8UA 1XCTB 1H0DA 2NY7H 1AO7B 2BWIA 5C2BL 2HRLA 1KXQE 2OP4H 3LN9A 4UV4L 2WCPA 5F7MC 3S3DB 4L2LA 2OXHA 4Z7UF 3BDYL 5GZND 1I9JL 4DPBX 1NGYB 1UM5L 3RIAF 3V0JA 2O5ZL 15C8H 2G75A 1RZPA 4XXWC 4HUVB 4XO9A 4MD4A 3TCLA 3ARFD 3LPFA 4JFPB 4HFUL 1J05A 3TJEL 2R1WA 3GINA 4FNSA 5DWUH 5F7NC 2EIZB 5J6GB 1IE4A 1SLXA 1HH9A 1WFJA 4WCYL 5TH2B 4FQXB 1FE8H 3B9KC 3MA9H 4HH9A 2E47A 5EUOA 1I8IB 1WS8A 4KKRA 1VLXA 2VR6A 1QLRB 2C3WA 1NGWB 3GSXB 3L48A 3TXAA 2WXKA 2VZVA 4JK0D 4PWFA 5L6YH 1FVEB 4G7VL 5SX5H 2OX5A 4RIRB 1HYSD 1FDLH 3C6LB 4FXGB 1PQZA 4DETA 3DOSA 3UG5A 2HVBA 4CADB 5LHDA 3MNVA 3VTTA 1N5YH 2IALB 1YMHB 5F72S 4XPGL 1A3LH 3BKMH 3DURB 4Z1PA 4Z95L 4MVBC 3TBVB 3BCDA 4CVUA 1RSYA 2DMCA 2XQBL 1E9OB 4N0UA 3EBHA 4NQSB 3ZTJG 2A1WH 5KSBB 5BZXA 1SFDA 3FPXA 2FIKA 5DHEA 3ESOA 3LNGA 1EVTC 3Q6GL 2OMZA 2VXVH 5KYXA 3K4ZA 4FZ8H 4XNBA 4RDQG 4DZBA 4AGNA 4FA8A 5IWLC 1FH5H 3PP4H 2WAHA 1NCNA 4IRJB 4RFNB 4XAKE 2R0WH 2Q8BH 4BSVA 4U1HA 4ZMYA 4F58L 1ZTXE 2HT3C 5FOBB 3DVNA 1JYWA 1AZRA 1T66D 1CGXA 3VXPA 3X1NA 4ILDA 1D6EB 5TE4H 5H35B 4ODTL 4XPHH 4QT5B 3EDEA 4MAUL 2NSQA 2WM0A 5CEZE 4F7MA 5A3ID 1NFAA 5C0FA 3MUGA 1UD8A 4RESB 2ZF8A 4OLYL 2NY2B 1TVDA 1EHNA 2VDLH 2VMCA 3E1F1 4UQIM 3SZ6A 3TT3L 2CHZA 1LDSA 3MRNA 3GJFK 1Z0MA 2BXYA 4FX5A 1HSAB 1PZUB 5I1CH 5AOLA 2FT6A 5DRWA 5HYSA 1E4KA 3QDME 4NO0B 5IROD 1B9KA 1SF5A 1BREA 3QUGA 4ODUB 5ABDE 3QNZA 1KB3A 1SDAB 3A6CH 5C86A 3BPNB 3NCFB 5IEKA 3JXAA 4CJ0A 2OMVA 4PJIE 5F7HA 1B4JH 1S3RA 3B7UX 3TYGL 2BNQA 4IHOA 3BGAA 4NQEA 3SDXA 1HXYA 1D9KB 5D8JL 1KCVH 1I1RA 2NY1D 3L9YA 2B4CH 4FDWA 2KKQA 5D9SA 5E6RB 1P4IH 3AT9A 4HEPG 3SGKA 3Q1EA 1SOQA 2ROYA 4GBXA 4LSTH 4OGAC 5B3NA 4B9JA 1BBJA 1MXGA 1I7TA 1N4XL 2Z31C 3CVBA 5CUSH 4P9HL 2ICWB 5IBUG 3ZR5A 2WXIA 4HUWA 2X3BA 5IMLA 4BINA 1S78D 4HS8H 1JZ5A 4MAYA 3D69B 4ACTA 2DQGL 2HH0H 2YLKA 3H7BA 4JY6A 2VSCA 2V9RA 3NIFE 4YDVA 3THML 4KDVA 3AS1A 3QISA 2Y5TB 3ATFA 2OYKA 1BHGA 4B9YA 3M8OH 1EO7A 4XHJD 1QPKA 2GFBA 3MFFA 1GIGH 4NRXB 5JPMB 3QJQB 1VFOA 5C9JB 4UQAA 4XC1H 3IDYC 2GJZA 1JUFB 5B3JE 1QBBA 1MI5A 4DP5X 2X2UA 5B1KA 2M2DA 4DN3H 4UB0L 2ATAA 5H37G 3FO9B 2OMYA 3IJEB 2I5YL 4KUZL 2LE9A 1II4E 3KJ4C 5TDNA 3EJYC 2HLAB 2ICEB 4OSUH 5I6OA 1DE4A 2R29L 3ARZA 2O6DA 4U1JA 3QWRA 4PUBH 2F1EA 3KGRA 2ZSWB 3P3YA 5T1JA 1XCQA 3EW3B 5CHNA 5DTFB 1UTDA 4WKZA 4CKQA 4WI4A 1PD6A 3TTSA 2Y36L 1K4CB 4I1NB 1QLFB 1GMEA 4LASH 5EUOF 4YHIB 3Q6FB 5A2BA 5LLIC 1DEEB 1CZ8L 2WGNB 3ARGB 5F6IC 5K1JA 2ENJA 1CD8A 4N3TA 3VXRD 4N2CA 1VFBB 3SCMC 2YD2A 4QYOA 4AQ8C 1I7ZB 5T1LA 2P7TB 4XCNA 1T2QH 5MHSD 4I18C 4M8QB 3D39D 1U8LB 1AS6A 1IBYA 1FZMA 4JREB 2J8OA 5BVPL 1ACCA 3ZW3A 3BJ91 1KN2L 4M02A 5LAXB 1CE1L 3VSQA 4WAFA 3KYMA 2KL6A 4JKWA 1LM8V 1Q9WA 1OAQH 1TO4A 4O2EB 1TTBA 5DD1L 2I24N 4UINH 2PPDA 4WFGD 4JQVC 5D7HA 5B39G 3VVWA 1FZOB 1J9CT 4MNGA 1TJGH 3MUZ1 5HYQA 1PBYA 2WLIA 3IPBA 2RH0A 3OX8A 4ODVH 4DGVL 1MQKH 4Y7OC 3AW5A 3FOMA 5L2JA 3GJFB 2DIEA 5D1XC 3ZR6A 1KNOB 3AFLA 3GC3A 4HCRL 7PCYA 3HAEG 5HPOA 1JGLH 4GT0A 2F53B 4M29A 4X6DE 4Y2NA 1A7NH 2IFGA 3UTPD 3FCTB 3NUKA 1X9QA 3CHPA 1AKJA 2Y07L 4IU2B 2YQBA 3ULSB 1TJXA 1ZIBA 1AHWC 3ME0B 2ZNXA 3Q06A 1DO5A 4I0PC 1IM3B 4MHHG 5F1OB 2FQEA 1QEXA 1IFHL 3GPEA 4K7PH 5K59E 3IXAB 5KVEH 4RDBA 1FFTB 4K7PX 4WHYH 1T2XA 5IFJA 4BKLB 2ITCB 5HHNB 4HVBA 3ULVH 2BNUA 3VGHA 5C0IB 4BK5A 3WXVH 2KC0A 4C47A 1CE6A 1PZSA 3JTSB 3QCVL 1RIVH 4P4KC 1BMWA 1S9WB 3VXUA 3MOBH 1FGNL 3LV3A 2H6PA 4JFEE 5AW8B 5FHBL 2VDOH 2CJUL 1CG9B 5DZNA 4QOKB 3QFJA 4OLWL 1G43A 2HLFC 1IL1A 4Q9CA 1YCSA 4AXWA 2EVIA 3SKNB 1BIIA 1PG7H 1RIUL 2XQ0A 4TMPA 2WWNA 3PHQB 5C09E 4HWBL 1T7YA 2I60L 4RMSA 5IJVB 3JUZA 3VYOA 3QT2A 3WTTA 3FXIC 1FNSH 2P3YA 1OTTD 1KJ2B 5K33A 3OHXA 4GSRA 4AGQA 3D06A 1MXDA 2O93L 2ZXGA 2DWDB 3FFCB 3N3EA 3SKOB 4QMEA 1KFAL 1D6VL 3U0TA 2AXGA 4QXUL 4OM1L 4FQXC 4GAYA 1TETH 5CGTA 1DQQA 5GGVL 4YZFE 1CD9B 4F5CA 1KB5B 4PSRA 5TGBB 1CFNB 4I8DA 1N2RA 4KZEH 5D2LA 2CNZA 5I16A 4LU5L 5FGCE 4J39A 4FN0A 2IADB 1BVOA 3BKCH 4FXGC 3C6LC 1ML0A 4MS6A 1ZS8A 2UY7A 3CZFB 4GRMA 1E28A 4O58H 4R7DB 4WWPA 5AVWB 2D7TH 4JJ5A 1YPZE 1RERA 4ONHA 1T7VA 5I6NA 1XF4B 1A7RL 4MB1A 3OJMB 1Z6JT 5ETUA 4KDTC 2QKSA 2R2EA 3U4AA 1GJWA 2CUMA 1U21A 5D93B 5I1LB 1S3KL 3GXUB 4P2RA 2SEBB 3E6FB 1JF1B 1NUDA 1GOGA 2DQUH 3QCTL 2R15A 2P5EB 3CBKB 4WDIA 4Z77B 3O6FD 3L9BA 4IW4C 1CBVL 3QDGE 4AEFA 3IKKA 4Y9FA 1N0LA 5D7KE 3SDDB 2D73A 4IRJC 4RFNC 5AZEH 2IANB 5IMMA 4Y7MA 4HZLA 1Z32X 5HVWA 3MV11 3ZDYE 3II1A 4YEFA 1DQKA 2FD6L 4YE4L 4PLNC 3APFA 1CR9H 2H32B 3GSNB 3KLAA 3ECUA 5EU4A 4Z0BH 4HXBH 3MX0B 3AU1A 1RULH 1SMOA 1HILB 4YBLC 3P11H 2X2JA 3APCA 4B9ZA 2OXGB 2BP0A 2MNUA 2NY2C 1CFBA 1F2XK 1RZQA 1ZHNA 1KBGL 3FW6A 4FXLA 3LRKA 4YSPA 2BRRL 2MQ3A 2EH8L 5KSAB 2ADFH 2PXYA 3CHOA 4FFVD 4P5TA 3DUSB 3WUWG 4LLMB 4W4OC 3QS2A 4APQB 2P45B 1DQVA 4LARL 1QATA 3VFOB 3I74A 4OZGA 1G1KA 2Y06H 3TNNA 1JE6A 1UB6B 1R24B 2DMGA 3OTTA 1ZT4A 3VXQB 1A8ZA 3BPNC 3BAKA 1LE5B 4S1QH 2BNRB 1KUMA 4GSXA 4HULB 2PW1B 4NOFA 4TOYH 3W57A 3BI9X 5AYQA 1A7BA 2ZX9A 1AQDA 2V3EA 2YLHA 4TUKL 4X8JA 1J86A 1J12A 4AEIH 3CXDH 3MV8D 5EZJB 1KXHA 1R3LB 2E27H 1AI1L 4XNMA 4P5KA 2B0SL 3CMOH 4XVTL 3UTZB 3CK0H 3WHXA 4HAFA 5CF3A 5I1AB 1GJIA 4OGZA 1FC2D 1QLEL 4FQQB 1UOVA 2G3NA 3BFOA 1F0LA 1SJVA 1J9RA 1QI4A 3E2HB 3H3PL 3CC5A 2K1MA 4BQCA 3Q43A 1LP9F 4QXVA 3BDYH 5F3HB 4Z3JA 3ULVF 3MRCA 4HKZB 1RHHA 4HWZA 1UM5H 4UZSA 2FCBA 4IMLB 1X5AA 3TJEH 3ROOA 2XCMC 5E6IA 1M57B 3O4LB 4KVCH 4LVOB 1YUHA 4WNJA 1AR1B 3PAVA 3BXNB 4RMRA 4PRHE 5AL8A 3AS0A 5HPMA 5CD5D 5JPMC 3MLUH 4J3TA 1MIML 2VLJB 3BP5B 4HX1A 1TQCB 4MNQD 1Z9SA 3ZMRA 3ALXA 3ARBB 1EZSA 4G7VH 4FLSA 3GHBL 1T0PB 1KCUL 1YNTB 1L7TL 3RA7H 4L4TB 5GZOD 2IH1B 1OL0A 1CL7I 2MIZA 4NQDA 4YS4A 2X4QB 4XPGH 3BH9B 3WMQA 5KZCD 4A7GA 4Z95H 5FK9A 2CPUA 1FL3A 1N0XL 4QRFA 5DHXB 3UCQA 4EQ3A 3P2TA 3P9MA 1BLNA 2XQBH 4HK0A 3K91A 2OMWA 3AM8A 5FB8B 1V7NH 4ACPA 1JFHA 1CFSB 3KPPA 1CN4A 5I8KL 4GI8A 4QRRB 3Q6GH 1QKZL 3AZUA 3U4EA 4IK6A 1IGYB 4MD5B 2CO6B 3OAZH 4OZ4A 4Z7VB 3RPBA 3VW3L 4AEEA 1J5CA 4LHUD 3HKZA 4DW2L 2ESVB 1HAUA 4QIRA 1UKQA 3KWUA 2B9BA 3ARGC 3BW9A 3SBWC 5L2KB 2QSCL 4FQLL 1Z66A 3IGUA 4PW4A 4QTFA 3WY1A 1TG8A 3G6DL 3OKDB 4B0MB 4F58H 1DP0A 5C0CA 5FUCE 3RVUC 2EUZA 1T4WA 1UUSA 4MJ6A 1IC4L 3ZE0E 3DA0A 4FFWC 4ODTH 1BQHA 4DVBA 3HNSL 2H0FA 4AQEA 1GS7A 2YD7A 3GKZA 3F7QA 3MO1A 4JREC 4HKBA 5DRZB 1VDGA 1SDDA 4PHZA 5JA8B 2D7QA 1MCOH 1RXLA 2OSLA 3RUGE 3D6GA 3TN0A 2WO3B 3OWRA 1MWAB 5MEQB 4R7XA 3U9UA 4A2EA 3OD3A 3PWPA 5DI8B 1KACB 2XN9E 3BAWA 3QQ9C 4EI5B 4PLJC 4U3SA 5HTSA 1FO0L 4XMZA 1K8IA 2KPWA 3WFZA 4CSTA 3MLSL 3P4NA 3BGMB 3ZZ1A 3QO0B 4FNLL 3QJVB 4I2XA 4A6YB 3F7LA 3MSPA 2IDSA 2A4CA 1LQBC 3C9NA 3TYGH 4WI2A 1OGAA 1J18A 2Z91A 3GNML 4OUOA 2NW3B 3ILPB 1M56B 2EXYC 1TF4A 2B7DT 3GDBA 4L8SB 2YPLA 4FQIL 4AJ0A 3AXLA 4ORGA 3OMAB 2OMXA 4FLOA 4M1CD 4NKOB 4PGDB 5AOMA 4LPTA 3K4AA 4WUUB 4XBEH 3BUPA 1QG3A 1T1WB 4TQEH 1A6TB 3SN6N 1NANH 3KPTA 3UPRA 3CHQA 2ZAGA 2XTJE 4P9HH 1UQSA 1KXQA 1TXKA 2NNXA 3KPSA 4KO5A 5FFOA 1MVYA 3SJVA 5J89A 4N6RA 4QJ5B 5BQ7A 4KK9D 2AQRA 5FO2A 2X0UA 3BUIA 3ECBA 4ZXBD 1XFPA 3GUFA 3THMH 2WSPA 5DMYA 3DJTA 3IDJA 5ITBL 1UH3A 1DJIA 4L4VD 5DEZA 2FECL 3RVVD 5T33L 1T1ZB 5BRZE 3NOIA 4JZOB 3O0RL 1NCWH 4X80L 2OS7A 4YFLF 1QSZA 1ORSA 4XH2B 4E9LA 4TVPH 5I1JL 2ZPKL 4LEBA 1JZHA 1N8ZB 2AEPL 4UIKL 2ADIA 4QTHA 3WIHL 1REIA 1JGDB 4JHVA 3KPNA 4DP4X 1IGIH 3I50L 4LE8A 1KJVB 1SQ2N 3F58L 3MRBA 4XOAA 2EYRB 4HF5L 4APXA 2EDBA 3MBEB 2JB5H 3WFBH 3WMPA 1BWMA 3JYBA 5IKCA 3MZGB 1MAML 3RWIB 1YMMB 4LSRH 4U1LB 2UYLA 2R59A 3NIDE 4J4PA 4X4YA 3GMRB 5HI4D 5HYJA 1KYDA 1DUZA 5KG9A 5F3BB 4X6BA 5ICYA 3OZKA 2CQVA 5HHQB 2AI0H 5J12B 4OAWA 1CZ8H 5FECA 1ZLDA 4OCWL 5KJRL 4KKBC 1KXVA 3V9EA 3LKQB 2Y0SA 3R4RA 4Y0GA 2P49B 5LBSA 4AYFB 4ICXA 5DSCA 4FLRA 3HI5L 4WW2A 4E9VA 3ZQWA 1QHPA 2F7RA 1LO4H 4CKVX 1U8NB 4UMGA 4G80A 5F0PB 3KXFE 1AZNA 2PWFA 5M94B 4BWTA 5T8IA 4BWUA 1KN2H 4B6ZA 1WCBB 5CEZH 1NOFA 1CE1H 2J88H 4N2GA 3WTUA 1UJ3A 3HKFA 2H6UA 4Q4IA 3HR5B 5D93C 3UTSA 1KV3A 2RGSA 4RWYL 5CCKH 3NIGB 4F2EA 4HGMA 2AEWA 4ODBD 3VXOA 4MJ2A 2VITA 2VW7A 1YEEL 2X44D 4TTDD 5GGTL 5DD1H 5C97A 1J5OH 2ZXBA 4S1SL 1QFPA 4FAAB 3AJ7A 4K8RC 3SDDC 4IMKA 3H85A 4XWGL 4Y2OA 4Z7WE 4Y16A 2VZ1A 1P7KA 3IFNH 1QR1A 2WINA 1KDJA 4HCRA 4DP8X 4P0DA 3PGDA 5HI3D 5IG7B 3T3PF 4HCRH 5CINH 2Y7SA 4OD2A 4ZD3H 2NTFB 3QJOA 1QZ1A 1ED3B 2P8LA 5ADPL 1CICB 2IAMD 1ILUA 3DX2A 3IJSA 2XVBA 2Y07H 2OTUA 3O8XD 2EUVA 4A37A 4KZDL 1MCCA 1U92B 1TLKA 2ALWA 3SQRA 2GSIA 5GISL 2CBQA 2ZUVA 4PR5B 4N4YB 1IFHH 3QHTC 1FYTB 1T0MB 4OFYA 4NPYB 4G6KL 3BIKB 2EXTA 2R0LH 2RFXA 3NA9L 4N8VA 3T0EE 3UTOA 3LTVA 4APQC 3B5GA 3UBGA 5BS0B 3MJ9A 5CEXB 2A7BA 2WK2A 3C5ZD 5AVSB 3LKRB 1WBZA 3MJ9H 5E4EC 5LXGH 1D2OA 4M43L 4IGBB 3NA4A 3QDMD 1FGNH 4PP1D 1QFUL 1E3ZA 5E8NA 5EUKA 3VD5A 1DBJL 2CJUH 4NZUL 1BQSA 4JR9L 4OLWH 4N2AA 2X89D 1AGDA 4H7VA 1BIHA 1RIUH 3JV5A 3QZWA 4RMUA 1IM9B 1IBDA 4YHKL 1RP9A 4ELME 4NYLB 3N44F 2NNAB 3E2HC 4LMQI 1GCYA 1AQKL 3L3HB 1AP2B 1B3IA 1EAPB 2NR6A 3AXHA 4HBCL 5FOJA 3VJ6B 4HHGA 4DO6A 3L4WA 3D85D 1KGCD 5KS9E 4N20A 4BFRA 2XI9A 4LVOC 5DQ9A 1AR1C 3TJHD 1KFAH 4FLHA 3R0NA 5JXAL 1RZFL 3SQBA 4QXUH 4BZ2L 4WV1B 3UDWC 3FHEA 4JFXB 2LLNA 4WHTB 2ZOKA 3VGEA 1TQCC 4GQRA 3QQ4B 4NQXA 2WOBA 1GRWA 4FF9A 3IAQA 3ARBC 5HBBA 2ZOOA 3MRFA 2NQDA 4FG6D 3LZLA 1MRCH 2C1OA 2XIBA 2XTLA 5CS7A 4F7CB 3VWJD 3CDFA 2VXSH 3L3JB 3PHSA 3C60A 5EMYA 4PTUB 1H3VA 1V8HA 1OLLA 2ZWZA 4X4ZA 4JDTL 1B2WL 2JQZA 1MHPL 4NIYE 4LZKA 1MF2L 4NUGH 2DLHA 1JMXA 1OB1A 1ZHLA 2XZQL 4X9FA 1MZZA 3S4SB 4HSAC 1U8MA 2KERA 2AK4A 2CR6A 5J4MA 5LXVA 1CBVH 4TF4A 2EC8A 4XX5A 3LS4L 1NGXB 1WWBX 3BP4B 2NY6B 1G7MA 4LKXB 1U95A 4JPKL 4MJIE 4NQCB 4PGEB 2FD6H 2HYMA 4H0HB 4TSAL 4YE4H 4G8GE 2F54B 4BXVA 3T6ZA 3U4BL 2WBXA 2G0KA 1HKFA 3X3FH 1K5WA 3LS5L 1F13A 4XNXL 2DQHH 4UCFA 3AC0A 4UI2A 3ZPDA 4QRUB 3MGTB 2KI6A 2YQ2A 1BZQK 1DCEA 3HLAA 4Y2DB 2ZUWA 1BYOA 1H3PL 2ICES 5KYUA 2BRRH 2EH8H 4OV5B 3CXFA 3RNKB 2C3VB 1DVYA 3I3BA 1M1XB 3DX0A 3B2VL 2GI7A 1X7QB 1NBZB 3GXPA 2AJSL 4EI5C 5F8RC 1B9ZA 3KWWB 3D0AA 4YXLL 4YDKH 3S34L 1UENA 4QHKJ 5JW3H 5LNDA 1FYHB 1IEAB 1AD0B 3VWKA 3QEHB 3QEUA 2VAAB 4JB9H 1HWHB 2ATPA 5IP4A 1PS3A 1D5BB 1V05A 1Q9LA 4U6YA 4PJIF 4YBQD 1J0JA 4Y4HB 4JFEA 2X4TB 1AZZC 1Y07A 3HB3B 2DQMA 4LLWA 4U6HA 5DQDL 5SX4H 2ICWI 4F3FB 4L8SC 1WH0A 3UEZA 3Q5YA 1AI1H 4R5XA 1UM4L 3BP6A 5E8PB 3K4DA 3VFTB 3F85A 1QLEH 3L2NA 3ZZLA 4BKTC 4UOW0 2PYEA 5BO0D 1ZSDB 4HC1L 2JJVA 3HBGA 3WOVA 1HN1A 4OCSH 1KLGB 2PUQT 4D0BB 1Y18B 1S9XB 4V1DB 4HSQA 3BD4A 3DPBA 3O4OB 2PMZA 3WHE0 1ERNA 1BOGA 1L7IL 3NIFF 4Y19E 1XGTB 3B83A 5F0LB 1FFOA 1RPKA 1BF2A 1OPGH 1PYWB 4Y4FB 1SHSA 3CN0A 4GKZB 4YO0A 2YJQA 3DVGB 3V6OC 1UURA 1Q1PA 4JCLA 1CGTA 2A9ML 8FABA 4X4KA 3GF8A 1KCUH 3M1BA 1RJYB 5L9DH 1L7TH 5T1KB 5B3JF 3OKOA 1OOAA 4OBRA 5D7LE 2N3JA 2MPAL 3DO7B 2WN2A 4XMLH 5FDWB 1RZIA 3LZFL 5B1AB 2EDLA 2OKMA 3AQZA 3MBEC 5EN2A 4NKDB 4DGIL 1YPZA 2IBZY 5C09D 2UZXA 2DH2A 5J1AB 4Q9BA 1RLBA 1SM3L 1QR4A 2VJ8A 1RI8A 5C0JA 1JDAA 2X3AA 4NERA 3CFJB 1MVUA 3GKWL 4K3GA 5I6KA 5FFGA 3LHPL 5C7XH 1OP4A 3IMRA 2DQIL 1KB9K 1FZJB 3GMLB 4N2IA 4WI0A 5J12C 2QSCH 3G6DH 4OCXL 3B2XA 4I5BA 4FNRA 4L8DA 1Q9KB 3SY6A 2B20A 1W6LA 5EU6B 3OAYK 3NT0A 1P1VA 2VM3A 3QJHB 1JN6A 4NNYA 5ENWB 3QIWB 3HNSH 4B9KC 3HC0A 3TCXA 4P5SA 5KVFL 4QRQB 1E2ZA 1T83A 5ANME 4Y5XB 3UO1L 3JZ7A 4DFIA 4TSBL 2Z7UA 2DQFB 3MUHL 4WEBL 4WU7A 5D1XE 2CBTA 2E9JA 3WEXA 2HMID 2AXFB 2QPFA 4EXKA 1VGKB 1K3ZA 4NP9A 3NH7L 2ADJA 4I87A 2GSMB 1G6RL 1I8LC 4UOZA 4MRBA 3X14A 3VO0A 1QW8A 5KAQG 5GRYA 1UD3A 3P9LB 5D7IB 1PAZA 5BPPA 4KPHL 1IZJA 1T7WA 3GDCA 4N0CD 4YNYA 3LH2L 4PJ9D 3NCJL 1CI5A 4NWTL 4FNLH 4ANVA 4JO4L 4RGOL 3QDGD 2F68X 1E27A 5EPMA 3QJUB 5AG9A 5J56B 4PH8A 2ZP0T 4MXQC 2BVOA 4E5XG 3L4UA 5EU3A 1CICC 1IAMA 4X6DF 3WFCH 5FYJD 1HHHB 2G9HB 2HX9A 4TYUA 1S7UB 2EABA 2UZYB 3KDPB 4P2CG 4UOQA 4YZWA 5K9JL 3TBCA 2H8PB 4LPXA 3MNDA 5KSVA 1IEBA 2IWFA 3ZKND 4JM2D 4XNQA 5SWZB 5K59F 5DS8B 2VDQB 1NBCA 2XN1A 3V7AG 3MLVL 1OTUC 4UIMB 4F9PA 1RZGB 1YYLH 4PRDA 2APWA 2Z92B 3GO1L 1AO7E 1M3IA 4AGLA 4HDIB 3AREB 4IGBC 5ITBH 3LRSB 3PUCA 4JQXC 1A4BA 3EYFB 1JPGA 3QIBA 4HIHB 1DN0B 5JHMA 3CVHB 3H2PA 2W95A 1U2CA 3EGDB 3O0RH 4W1TA 3HHSA 4X80H 4M61B 5I1JH 2NYZA 4LMQE 2L7JA 2ZPKH 4G42B 4JFDD 4UIKH 1ZLSL 2W9DL 1NEZG 2L8AA 4HP5A 3RTQD 4KI5C 2KDGA 4L3EB 2VZ3A 1JPFB 3CCHB 2JSFA 3I50H 3RU8H 3F58H 2YPKA 3I6KA 1ZIAA 3LNDA 5F0JB 4A7TA 1V10A 3EFFA 3PGFL 3T0VA 1MAMH 4JO1H 4CAGA 4FJZA 2BZDA 4PJHE 4XB7A 2VKWA 4HA1A 4GAGH 3GMNB 3P0VL 1Q4NX 4HUXB 2WQSA 1MLBA 2VO8A 2Q20A 4WV1C 2M26A 2NLJA 4TQHA 5KANI 4TVUA 1F1GA 4H44C 2AQ2A 5MENA 4PRHD 4YZFF 5KJRH 3KVDD 4IBTA 5KOMC 4ZI8A 2APBA 1TU2B 3PWUB 1BMZA 3DTDA 4S1DC 5AB9A 2CLVA 4FEMA 4XVUC 3K6IA 1Y1UA 3ECWA 2JFCA 3HI5H 1ZV5A 3PDGA 3L6FB 3VFUA 1IAKB 5DMKA 5ILTL 5EOCJ 4PJCB 3SE9L 5IB3A 2EXWD 3BZ4A 5I1HH 3ZKMC 4KJQD 3SE8L 1YPZF 5DC2A 1XAUA 2H26B 5FKAA 2PCFA 4FYRA 4DGUA 1JZ8A 3RUGA 4P05A 3H56A 2Y69B 1YEEH 4RFEB 1UVQA 2J8HA 3FB6A 3MJ7A 3MRRA 4X8GA 5CR1A 4S1SH 3NK3A 1ZA6B 3EFOA 3S97C 2YN3A 5HHMB 5HHOE 3MR9A 4Q7DA 4XWGH 3D0VB 4F15C 2DTSA 3IDNB 2ZWKA 3IDGA 2X1XR 3RWEA 4I89A 2NY6C 2R8SH 2D31B 4WJ5B 3OKLB 4XCYA 2F0CA 4XRCB 4QWWD 1RJLB 4NWUL 4W6WB 1S5HA 2EDHA 2TAAA 3J8F7 5B7MA 3ZDYF 5DJAA 5HDBB 4KZCA 2EDFA 2EEBA 1T1YA 3FUNA 3KYOB 4XX1E 2Y24A 4IOIA 2IPUG 5ICXA 4OFDA 2CJSA 2MHAA 4MQXD 2XETA 3QWNA 4HEMA 2Q9OA 3APDA 4Y2DC 4AMXA 1AACA 4GO8A 5FW8A 1C5DB 4JBSA 1E40A 4EUPG 2XKUA 1Q94B 2OMTA 1ZWIB 3FUJA 5E8EA 2KZ1B 3MDJA 2K7QA 3L7EB 3NA9H 2ED9A 1M05B 1AMYA 1SQMA 4KNSA 5D71L 3TFBA 2XN9D 1GAFL 1JAEA 1OGPA 2VMFA 3INOA 5HGDB 3SYCA 4GRWH 4HHWA 4Q0XH 3LKOB 2N56A 3JZYA 4ZT1A 2K3TA 3OJDB 5FGSA 2OCFD 2IC2A 1QFUH 5GJTH 1A6ZB 1X9UA 5D70L 1ZE3H 4NZUH 4LHUG 4UV7H 2JK5B 4Y4HC 5L7XL 5F1NA 4BK4A 4JG5A 2IQAA 1JCVA 4ZSOB 1WFOA 2DRUA 4UQBA 1NIDA 3LNIA 4U1GB 4F8TA 5TJWK 3TIEB 2NX5A 3CDGB 4E9YA 1Q1JH 4RSYA 1MFVA 2Z64C 1EO8H 1RMFL 2JWYA 4YHKH 5T3XE 2W38A 1N10A 3HS0A 4QXWA 5BRQA 5DU7A 5IVNA 4DPCX 1JZ3A 4QAWA 4N85A 2FYYA 4HBCH 2X0WA 3IGAA 2BZCA 2EADA 1T0NA 4J2QA 5C08B 3AQXA 5ALCL 3BH8A 1INQA 2XTJD 5EOQL 5KVDL 4BZ2A 3GBMH 5JXAH 1S7WA 1RZFH 5F89A 3VA6A 3O4OC 4BZ2H 4AW7A 4Y5VB 2W0KA 2PWGA 4JEGB 3K72B 3H4FA 2P8MA 3ZYOA 1CFQA 2BWDA 3HA0A 3S5LB 2CLRA 5BRZD 3N1PC 2V7NB 3F7YA 4FFYA 4LAQL 3Q01A 1XGZA 1A6AB 3GB7B 2Q6WB 4FFYH 3SHSA 3AADB 1BEYL 4WTWA 2VN5A 2V2XB 3KXFA 4FCAA 1B2WH 5DQJA 4LNRA 4HWNA 4N0FA 3T6VA 1MHPH 1JK8A 4RGNB 1MF2H 2NQ3A 4UYPA 1M2OA 3IMWA 4HW6A 2XZQH 2Y5QA 3H0TB 1F42A 1GVIA 3O41A 1BXAA 2G3MA 4I48B 2O72A 3OGOE 1LO2L 1PKQB 1SXZA 4BDVB 5A6IA 5HJ3B 1SYVA 2D2CC 2VDNB 2CCWA 4WO4B 4G1MA 1A3ZA 2XC8A 2ZYSA 4R5TA 3CLFH 1HX0A 4JANB 2HVJA 1AIZA 5FXCH 4JPKH 4U1NB 4JO5A 4RA0C 3UG4A 3ARFA 4EMZA 3ES6B 3U4BH 3TVMB 2ARJB 4ZYKB 5GS1A 3QIWC 4GRLD 2R1YB 3CV5A 3ZE0F 2FLRT 2MMXA 1OV8A 3PABA 4UOW1 2BY2A 4Y5XC 4G9FB 4HKJA 1N5AB 3FO2B 3MAWA 3ESNA 2NQCA 1IAOB 1H3PH 3X11B 2WO2B 5JLZB 3R7QA 2F53E 3RUGF 2MQ0A 4R97C 4HV8A 4XCFL 3WHE1 4EDWL 1QWUA 1K8DA 2WLJA 3B2VH 4M48L 4ZPTA 2AJSH 3ZE1B 4MZ3A 3BVNA 3T3MB 3CGTA 4QTIL 5GIRB 2VR8A 5AD0A 4POZD 2E5EA 1WDAA 1CGSH 2X87A 5AALA 1P6AB 1EO5A 1V7ML 4LRNL 3NQIA 1S7VA 2E75C 3D0LB 3IEAA 3U25A 1GH7A 4JKKA 1HCFX 1I53A 1Q0YL 1VJSA 2OM5A 5HJGA 5AYUL 3N50A 5JR1H 3DETC 2EVGA 4XXWA 2XNAB 4K9EC 5DQDH 3EHBD 4JHZA 1H3GA 2AQPA 1FFNB 1HINL 2RQ8A 3KNBB 3RZWA 1UM4H 1YY9D 4JAMA 1PZDA 4BSWA 3B9KA 3WJMA 4GG8B 5E8DH 3ZYIA 1T3FB 2E6PA 4AIZA 2DYPB 3BLKA 5DZLA 1WZLA 2NY5C 5DK0B 1WQVT 3QXWA 5DHDA 4MYPA 2OA9A 3VGGA 4C4BA 4P2OB 4PBDA 1UOLA 5EOCL 5KYYB 1RZKC 1OP3K 1WC7A 2HPTA 2Y2TA 2FH6A 3O2DL 4P46B 3DX8A 1BFOB 3T0ED 3AREC 5EULV 1WAEA 2FX7H 2RHEA 3JUYA 4BGDA 3TPUB 2GBVA 1HEJC 1SXSA 3HMXL 1JOIA 3L9RB 3VFRB 4CJ1A 4J3VA 4NNXA 1I3UA 3V5DA 3RVTD 1XIWB 4KUCD 5FO7A 3II2A 1P2CA 2D03L 5I1DA 1NAMA 1CL7H 3QULA 3RX8A 1ACYL 3SYOA 1VFUA 2WXQA 1NAMH 3KPLB 5IWLA 1XBRA 3K3QA 4M5YL 2MPAH 2EIMB 2XG5A 3B5HA 3LZFH 1F86A 4YLBA 3B9DA 4PWKA 3TBSA 4N28A 4H8WL 1TQBB 1TFPA 1TZHB 2C3GA 4ATWA 1K4DA 1ITBB 4PJ7A 3RKDC 3VFGL 3WY3A 4U1KA 3KW8A 4IKJA 5F2FA 1M1SA 4WRLA 1SM3H 1SMAA 2VDRB 4I3RL 5D5MA 5F9DC 4Z76A 3GLEA 2MNWA 1XH3A 3P4LA 1IMHC 3NIDF 2L04A 4U6XA 1BPVA 1FSKB 4AGOA 3X3GL 3K71B 2DPKA 2R0KL 3GHPA 2DQIH 2ZF9A 4OUUA 3FQRA 4KTYA 5I76B 3PRZA 2IGLA 1SN5A 1QFWI 5L4IA 3EZ8A 2O5YL 4LGRB 3VRJA 3U30B 3HG1B 2IV9A 2MSPA 1SLVA 3DSFH 1HHGB 2XA8H 1X5HA 3V4UL 2P9RA 2JJSA 3BO8A 4DAGL 2IANE 1JXFA 2CO4A 3LXBA 3UO1H 4OD1L 2WTRA 2QFPA 2DQ6A 5DD6B 1XTLA 2UXFA 1LK3L 2G5UA 3UYOD 2BIOA 3OVUB 5E2TH 3NH7H 3TYFA 5FUOL 1X5ZA 1MAKA 4ZOAA 3UTTE 5CLZA 2IXQA 4N2HA 3SO5A 3CJJA 2J44A 3PL6B 32C2A 2AEQH 1QAWA 3RJQB 2KLTA 4ZW7A 4FXKB 5I19L 1IT9L 2EDTA 1RUMH 4M7KH 4Z7WF 5CJXA 2Z31A 5AG8A 1CVRA 3C5SA 4FJ6A 4HH8A 2GAZB 4YSEA 2V6HA 3PPSA 2HRPL 3MQIA 2OTPA 3WJLA 1BZ7A 3HFML 2UUDH 5SWSA 2YMXL 3C8HA 2YXVA 4OGQC 2H7WA 4MJID 2YOCA 4AYEC 4G8GD 4W9KC 4DTGL 4XBGA 4OQTL 3IDMB 3KHOA 3NJJA 1BZEA 1JBJA 4ZTEA 2X4OA 5I66B 1GYCA 3INUL 2FO4A 1IGML 2OW6A 5IHUL 5DA0B 2WB7A 2YD8A 4PV1C 5DJ6A 2AJVH 4LIQL 5CSZB 3HI1B 3LH9A 2A6KB 2I25N 1RURH 1OOWA 2AZAA 2BERA 2ZKWA 3JWNC 4K7PY 3GO1H 1CXLA 2SODB 2D3VA 2E4TA 4OCRL 3NDZE 4Y1AE 4XPFL 1YY8B 1WGOA 4H40A 5D4QA 4PJ8D 1OK8A 1YEFL 3O4LE 4D8OA 1UA6L 2EDEA 3WV0A 4TUOB 4LDEB 5LJYH 2CDGA 2CLZA 3T0WA 1ZLSH 1RZJC 3OXSB 4U1GC 3MTRA 2VLJE 1ODUA 2WKLA 3UPAA 1ID2A 3EDKA 4X6EB 4XTRC 4ELMF 3FN9A 4LSVL 1OT2A 4AE0A 4OIBA 4DCQA 3PGFH 1KB5L 4ZPVA 4L4TE 1J8RA 1TKWA 4AQ8A 3SCMA 3ZIMA 3EO0B 1T5XB 1DBMH 5EORL 1WFNA 2VJXA 3MROB 4J8RB 3IDIA 2WYTA 3O9WB 4I18A 4NZRL 5GGRB 1BM7A 5C6TL 5KS9F 2APXA 4OLVL 1UM6H 3S5ZA 4Y5VC 1PG7W 4K3DL 2XQYA 2IWKA 1LE9B 2XA3A 3SPCA 3OKKA 5E23A 3FU5A 4HZ1A 2M8XA 4Y19D 5CCJA 3CFBA 2QHLA 1IKOP 1NCAL 3JWDC 2ESVE 5MERB 4JQVA 3WTVA 1CVSC 1KG0A 3MRQA 4M5ZL 3HOGA 4QRAA 1HEZA 2A0LD 3WEAA 3SE9H 2CK2A 4K8RL 4OBSA 5HVFB 3SE8H 1BOYA 1S7XA 3QORD 4HFWA 4PJBE 5D7LD 1LEKB 4RGNC 1JZDC 1JXGA 1UWXK 2VL4A 3C5JA 1HU8A 4CVZA 2QR0B 4PMFA 2MOGA 2WXGA 4KZ0A 4Y1SA 5AW5B 3H9SD 2R2BA 4MLIA 4MA7L 3UC0L 1SVBA 3AMLA 3VFVA 4WO4C 3UGXA 1F3RB 4G8EB 1AHWA 5A16B 1B4LA 3QRBA 3CFTA 1KY6A 4I0PA 4E42A 4YHZL 5FW6A 3UG3A 1RK1B 4NWUH 5LDSA 1ITCA 3IFOB 4L4JA 3GIVA 1XGQB 4NHUB 3TVMC 3V2AR 5B38B 3WS3A 3TA4D 2OJEA 3GMOA 4K0OA 4KHTL 1M6OB 3T4YA 5A2LH 1G5AA 4P4KA 5E4IA 4EBQL 3MRLB 2VE6B 1XMEB 2J72A 2XDHA 4HS6B 3QWOA 4NO2A 1U3YA 5IMKA 5C0AA 3FB5A 2NDFA 5I9QB 2H3KA 5D1XD 3TNMB 3VXNA 1E9QA 2F8XC 3RPKA 4NN6C 2AFNA 4U3XA 1IE5A 1U8PB 4WUUE 3SBRA 2ZWSA 1YLBB 1A1MB 2GY7B 4MZIA 4RZCA 1CLYL 5T3ZE 5D71H 4ZS6C 1GAFH 1QQDA 1XCTA 3U1SL 1AO7A 4ZBJA 1E8ZA 1ZXQA 2FTAA 1UGNA 1NGYA 3MRHB 3ABKB 4M9OA 1H5BC 2BMKB 4W70A 5C07B 5L7XH 3FOLB 1KLFB 3H7LA 2K9UA 3CFDB 4HUVA 1NMBL 4JFPA 4PS8A 4FHBD 2LW3A 3TBTB 2EIZA 1I1FB 3LCYA 3S3PA 5TH2A 1RMFH 2FX9L 4FQXA 4J6RH 4KWUA 5FYKU 4F80A 1SJHB 2EO7A 4E41E 1QLRA 4G11A 2XLLA 3EJPA 3V6OE 3GSXA 3DHJA 4S2SB 5FDYA 4L9LB 1N9PA 3RAJL 3NACH 3GWJA 4WSGA 3KVQA 1FVEA 3AB0B 3QUXB 4RIRA 2FEJA 4P2OC 5GS3A 2HLFD 4FXGA 3C6LA 4WEUD 1J0YA 5EOQH 3TS8A 2NT1A 5KVDH 3EOTL 1TNNA 1YMHA 2IALA 3PGCB 4P46C 4BM7A 1MY7A 1TSHA 2ZSVB 3TBVA 1O6TA 1EHKB 3RWJB 1A4KA 5HDQL 5JZ7D 1HNYA 4OKVB 1XL4A 5GRUH 1E9OA 4NQSA 3FSVA 5KSBA 2JKSA 4DP0X 1NC2D 1SOKA 3C6SB 3HZMB 1MFAH 3RG1C 2XWBB 3L3DB 3M45A 1BEYH 3SO3B 3NCBB 4IRJA 2UWEE 5DFTA 5CP7B 5F96L 3GBDA 3DOHA 1TQBC 4F91B 5FOBA 3EJCA 1RPQA 3U9PL 4DP6X 5EEZA 3N6YA 1D6EA 1Y6KR 4U05A 1KC5L 2AAVA 5H35A 5BW7C 4QT5A 3V5HA 4CNIB 2YZ1A 2PPAA 1FFPB 1BD2A 3FFDA 1SRDA 3MJGX 5GSRA 1FSKC 4YLCA 2H4EA 4BUGA 4Z9KB 3KHQA 3ARDC 4JQIL 3FQYA 3WO3B 2DLGA 3VXTB 2OXHB 3NIGE 1DJYA 5DUBB 1LK2B 4GG6B 1E5CA 3TM6A 1CIUA 3U30C 2WBJD 3SKMB 3CMGA 1MWAL 5IGXL 1HSAA 4X99B 3ULUL 5IOPB 6TAAA 4G6AD 2ILLA 3MRKB 4NO0A 1JGVL 4ODUA 5CM1A 1EWHA 2YAPA 1GW6A 1JGIA 2C9PA 4JO3L 3UYRL 5KWYC 5FHAL 1MIEL 1UASA 1ZLWK 4A6YL 1I1AA 2BSRA 1D9KA 4XCFH 2GBUA 5GGSB 1NBYB 4EDWH 4ZMWA 3CFEB 3OLEA 4H2AA 1X5JA 3NJXA 1VRSA 4I7ZC 4KROB 4QTIH 3GI8L 3WIFB 3GMQB 1RZ8A 2QVIA 2AW2A 4GXUM 5HDLA 3TURA 2AV1B 4UNUA 3RRQA 3GTTA 4FXKC 4PJ5B 1SYSB 1U93B 2OZNA 1V7MH 4LRNH 4N0UB 1EBPA 2F19L 5IBTL 5HHOD 4IYKA 4WGVB 4QRPE 3TPKA 3MVSA 3WI9A 5KYXB 1FZKB 1L9SA 3D69A 3WEOA 4DZBB 5DVPA 1E65A 1HINH 5JHDE 3WFEH 1KXTB 3PNWB 2Y5TA 3JBG7 3Q2CA 3QEGL 4RFOL 1RHFA 1C7SA 3MMEB 4P23D 2WLYA 4NRXA 5C9JA 3VXPB 3M1OA 3K74B 5D6CA 4AL8C 3ETBJ 4XWOC 4F7MB 4NC1E 4KQ0A 5EOCH 4FQHB 2GSGB 3MUGB 4BYHA 4ORZC 5LNEA 1IQWL 3FO9A 3IJEA 3O2DH 4ZW6A 2HG5B 3HMXA 1Q0EA 4AYGA 5F6HI 2HLAA 2ICEA 1VPOH 3HMXH 1OD9A 4TNGA 4WKXA 3DVFA 2WLMA 2ZSWA 4M1DH 2X7LB 1ETJA 2DN7A 3D4YA 2D03H 3QS3A 4OLZL 4LF3A 3QEQB 5DTFA 3KYAA 4A7VA 1K4CA 3QNZB 4U1SB 1QLFA 2CU9A 2OR8A 3CWGA 1M2VA 4WWKA 3BT2L 4YHIA 3VXSE 3Q6FA 2OMVB 1BM3L 5HD8C 2V17H 4X8CA 3SBWA 1DEEA 2ZXCA 4H8WH 1DANT 2YXMA 5F1IB 3AROA 1VFBA 1E50A 1I7ZA 2P7TA 4RA3A 4I3RH 1U3HD 1KPRB 2Z34A 1LNUB 4PJHF 2IWGA 4M8QA 3LRLA 1U8LA 4TVSa 4HWUA 2GG1A 3E3QE 5FYJL 4EN3D 4QY8B 2R0KH 3FO1B 3D2TA 3WL9B 5LAXA 1RPUA 3ELAT 4YXHL 4XOEA 5EFIB 3B7YA 3B56A 4O2EA 3HN8A 4JY6B 4M6OL 5KN5B 3RY6C 1Y6NR 5IM7A 3QJFB 3V4UH 3TZVD 1MW1A 1FZOA 3EZJB 4GW1A 4DAGH 1HHJB 4WU5B 1R5WB 3F12B 4MKTA 1FJ1B 4NQCE 4ZMLA 3ARGD 2F54E 2VN6A 3GJFA 1HL9A 3APMA 3QH3A 1XSKA 1KNOA 2BM3A 2CD0A 3QGVA 3GJFH 3U7YH 3UGUA 2CMRL 1KCKA 2XXMB 1M7UA 3A4FA 4IRZA 2EZ0C 4FFWD 5EG6C 2FAUA 1SUHA 2IDCA 2EEXA 4G7QB 2YRZA 4JFFB 5EWIH 3NCXA 4H8HA 4RAVB 3BRFA 2YEZB 5CBEA 1IT9H 4HJIA 3QUZB 1NLDH 4U1JB 2NUPA 3FU9A 4FA6A 1QSEA 3CZLA 4JFOB 4QNPE 2ICCA 5EIIB 3IXAA 4YXKL 3EBGA 5J0BA 4DEWA 1TQWA 3OSKA 5MP6H 4BKLA 2ITCA 2BOBB 3EO9H 5HHNA 3Q8AA 3QQ9D 4YJZL 1CFMA 5C0IA 4PLJD 3ISRA 4DTGH 2CK0L 2W5PA 1UXSB 3F05A 1NEUA 4NJ9L 2VXUL 2WUCL 4LCCA 4JG9A 2IOIA 3INUH 1IQDB 3JTTB 5GS2D 5IHUH 1CG9A 5T1LB 4DGWC 4QOKA 4MDJB 5I9QC 1ZDQA 4LIQH 4WUKH 3NSYA 2B39A 1FUNA 1X4ZA 2EXYD 5IJKC 3SKNA 4XI5C 2CA3A 3T1FA 4DQAA 4QGTA 4A2DA 3A3YB 4LP4A 1BVZA 2ENQA 4MBRA 4NJAL 4OCRH 4WTZG 1ZVYA 4R2GB 4A7SA 1YVLA 5IJVA 3RI5K 4XPFH 4ZFZB 5DEFB 2FX8L 2NZ9C 4TNWK 1YEFH 1IM3D 1KJ2A 4MA3A 3SIKA 3QJXA 1V27A 1UA6H 3L5IA 2A6IB 1MFUA 1KJ2H 1OAKL 1WAAA 2DWDA 2VISB 3BAEL 3FFCA 3SKOA 2ZCHL 3OX8B 3VD9A 4M8RA 1OAUL 4LCVA 5CSBA 4CN6A 4JM0A 3H55A 1KB5A 2ZX5A 5TGBA 1CFNA 1UATA 1KB5H 4L9LC 4XPAL 2IADA 3LXAA 4BQ8A 3BEVB 3AB0C 3QUXC 5AAPA 3PXJA 4HUNB 2B3IA 2DQEH 5EORH 2Z9TA 2I07B 4NZRH 1VEOA 3CZFA 3GSRB 3NPZB 3ASNB 4K94C 2WANA 4K3DH 2QQLL 2JJTC 4KAQH 2H1LM 1T04B 4IIQC 4BIKA 2KH2B 5DC9B 5DR5H 5CEYA 5I1LA 2VLRA 4FG0A 2YD9A 3PJNA 3WUZA 4HIXL 2SEBA 3E6FA 3WD5L 4DEUA 1JF1A 2BNUB 3VI4A 3I6SA 2D7NA 2P5EA 3BN3B 4M5ZH 1I82A 3SDDA 3SO3C 2PO6D 3ETSA 3S0PA 4K8RH 2IANA 2PP8A 1USZA 1HHKB 5EU6E 1F1AA 4N9OB 3EYSH 2C26A 4OJAA 3VRIB 3BRDA 4G6FB 1KEML 3Q05A 2ZYHA 1NICA 2H32A 3GSNA 3NFSH 3EG9A 1LDPL 1EEUA 2H32H 3GSNH 4RMWA 3P1VA 4MA7H 5EHFA 3BWSA 2OXGA 3UC0H 4M6ML 3BAXA 3UJTL 3SPVB 4YHZH 1B90A 4OLEA 5KSAA 3HE7A 3W0WE 1WWWX 3DUSA 4LLMA 1UYWL 1INDL 4APQA 3U0TB 3CTTA 3FCSB 5DEJA 1GGCL 3VFOA 4GAYB 1P7BA 2BVQB 5BJTB 3TV8A 2YO3A 1UB6A 1R24A 3VXQA 3KWTA 1SVCP 3X1FA 3LB6C 5IQNA 1LE5A 4I88A 4U4IA 2BNRA 1J5IA 4LOUD 4EBQH 1FNLA 2PW1A 5D2LB 4O02B 3K5RA 4WNSA 4FEIA 5DO2D 2YHGA 1WD8A 5EZJA 4JRYE 2A74B 2DYSB 2X41A 4JJ5B 4KROC 1A7QL 3UTTD 2WJ5A 4KTEL 1YJDC 4FQQA 5FA4B 4P3DB 3QR0A 3U1SH 5JMOC 2CRIA 2BP8A 1BQKA 2V9TA 2WKGA 5F3HA 4JJHA 5D96C 3MCKB 2VYRE 1HC1A 1AGFB 2VRKA 1YC7A 2VSKB 3BMWA 3NFNB 1U91B 4TL5A 2Z93B 1NMBH 5D7JA 5C0NC 3RL2B 5FUZL 4FG2A 2J55A 1NUNB 5EU7E 3BXNA 3DC0A 2FX9H 5A7BA 5IMMB 3UDWA 4HZLB 1E6JL 2CBMA 1OAJA 1WFTA 2HT4D 5IMOB 2VLJA 3BP5A 3P77B 3FT1A 4FFZA 1UD4A 4KKAD 5CZXC 4DOHE 3RAJH 5E9DB 3ARBA 3KLAB 4FFZH 2O26U 1CPUA 2YPVL 1YNTA 3BFWA 4L3EE 3EF4A 5B7EA 2IH1A 3T08A 3QNFA 1H19A 4H8VA 3BH9A 5CZRA 1NTDA 3SYPA 1ZHNB 1IC0A 1N64H 3V6ZB 1UC6A 3IMBA 5F1KC 4IOSA 2AS5M 2Y25A 5FB8A 1Z5LA 2BS8A 4P5TB 2HT2C 1CFSA 1QOKA 2KS0A 4Y1AD 4J3OD 1A6VL 1QX1A 4QRRA 5KW9L 4UM9B 1E4KC 1IGYA 2IG2L 2CO6A 2X38A 4G9DB 2NXYB 4OZGB 3A4AA 4Z7VA 3O4LD 1EDHA 3LMJH 2GPZA 1AR1D 4X8XA 2ESVA 1TZ8A 2OJZH 3HIZA 1YEJH 2VZUA 1AAJA 3QI9A 3KEDA 4NGHL 1HOCA 4DVRL 1F97A 2AGJL 5L2KA 4A63A 5EBLB 5F96H 4X4XB 1PX3A 1ZLVK 3OKDA 4HLJA 4Z7QE 3WEMA 1FRGL 2B4CC 4X8JB 1ONQB 2NY0B 3JVFC 3QZOA 4QKXB 4LQFL 4F37F 25C8H 2OPCA 1HWWA 1G0YR 4J3UA 1JDDA 4N6QA 2HJLA 3DXAB 3CFCL 4UBDD 2UXGA 3WHXB 2A73B 4JQIA 1I9EA 3IK2A 4L4TD 4MB3A 2FHCA 5DRZA 2DKUA 4JQIH 3CC5B 5DYFA 1KYOK 5KJ7E 3UX9B 4DN4L 4FQ2L 4EI6B 3W56A 3MRCB 5J1SC 1MWAA 5MEQA 4G7YL 1MWAH 3ZQXA 5IGXH 1OCRB 5J6HA 1JVOA 2ORBL 3ULUH 1NUFA 3J2PA 4EI5A 1MUJB 3B4NA 1PZCA 4TV3A 1JGVH 4BE6A 1JPEA 3X12A 3BGMA 3RJDA 3QO0A 5BXFA 3T65B 4A6YA 1GJUA 2NOYA 4JO3H 3UYRH 4G1EB 5FHAH 4GMTH 3SY0B 4DK6A 4A6YH 1OD7A 4KXZI 5E70A 4ZUUA 2NW3A 2JELH 3ILPA