3ILEA

Crystal structure of orf157-e86a of acidianus filamentous virus 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
VVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEARTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ileA00
3II2A 3ILDA 3II3A 3ILEA 3VB8A
chains in the Genus database with same CATH superfamily
5I6MA 2VDRB 4HIJA 1W80A 5TD4A 3AG4B 3MUJA 1YEHL 2O4EA 5TQ0L 3ZE1F 5IB5B 4APQC 4BD4A 1J86A 1WBZA 4JRXA 3KHOA 2P26A 4MA1C 3UBGA 1ZD6A 2YUVA 1QSED 2K7QA 3PIQB 4X5XB 1JGEA 1BJ1H 1YRKA 3FQ1A 2ENSA 5D9SA 3WTXA 3TEYA 1T1YB 1PCXA 2C4XA 4PV8B 4FFZA 4KHTH 2VDNL 1MHHB 3UTSE 2XWDA 1LP9A 3CVBA 4HCRL 4DZBB 3QULB 4L3EB 2YGVA 1T5XB 1ET5A 4MYWB 4M3JA 4C4BA 3N50A 5ENWA 2FGZA 2OMVA 4QKTA 3UDWA 4BQ8A 1KB5L 5ESQB 2H0EA 5AAWA 4UM9B 3I50H 2FX9H 5F9OL 2ZG1A 1Z9LA 1A9EA 3QUXA 3QIBA 5EU4B 5D1QA 1C1EH 3MRPA 1K5NB 1OSZA 2YXFA 3VSUA 5EEZA 1JNNL 3BKJL 4Q9RL 4ZFZB 1S5IL 1XTMA 3UPCA 3RA7H 1RIVH 4OCYL 4Z3GA 2E6JA 3PQYE 4LO9A 1PKOA 4ICXA 1VGEL 2J4WL 3DBSA 1CI5A 1CU4L 1S5HB 1I75A 2PO6A 1I9JH 4QAWA 1X5XA 2YC1B 4AQOA 4ZT1A 2NY7L 4JLRB 4PCKA 3X1NA 5KYYA 4D94A 3AABA 3AACA 3W82A 1E6JH 1GL4B 1I7ZA 2PR9A 3BSZH 3BIKA 2EEDA 3VXRD 1IQWL 4OZHB 5FYKD 3EJQA 4E41A 4FQCL 2ESVB 4IMLB 1YYLL 1HIMH 2QMJA 2R9HC 1R4XA 3P2TA 4PLOB 1TETL 4L1SA 3MLXH 1OP5K 2IAND 3BJLA 1RZ8A 4F5CA 4FNPA 4RRPG 2XJKA 1YQVH 4PI0A 1ROWA 2CCWA 3MBEC 5DJ0B 3SDCA 2PYEB 3X12B 2VUYA 4IJ3C 5BOPA 3NIGF 3D08A 4UTCA 3DYMA 1EEYA 5G2NA 2C7UB 5F89B 1F42A 3BCFA 5KAQF 1NIFA 5E6IA 2DLFL 2WB1A 4WGKA 5JXED 1CTMA 4PRNA 1BBDH 4NOFA 4ONHB 5EBWB 1OE1A 3VB9A 2C3GA 1H5BA 3UC0H 5HYSB 1H15B 3PXLA 2GUOA 4WW1A 3MUZ1 5FFLA 2GBUA 3HMXL 1KTDA 4R5XA 2H4EA 1XD0A 3VD2A 2IADB 2W60A 3WO4C 4RQQB 3HZMA 4WI6A 4WHYG 1J12A 5FM4A 1DJHA 1DR9A 4IK6A 1WIPA 2VSDA 4E9LA 3MU3A 4ICWA 1H9VA 5I2IB 2YGNA 3CZSA 4YUEH 5D7IB 4WFFD 4GKZB 1ES0B 2MWCA 3C2AH 1A6AA 2Q86B 5I19H 3GTVA 5EU5B 2WCGA 3DIFB 2HLAB 2HLFD 3FT3B 3ZJAA 1CC3A 3K2UL 3QCUL 4P9HL 3KJ4B 3HC4L 4TSAH 2MCAA 3RZCB 2CKBA 2N3JA 5DVOA 1JS4A 1BFVH 4G3YH 4PU2A 1QBAA 2XIDA 3CFUA 2GEQA 1UA6H 2NYZA 3B83A 3AMKA 3H9HA 2Y07H 4E9RA 3VXNB 3HRZB 4L4TD 1XF5A 1HHIA 3FB8B 4Q9BA 5ISZE 4OZIB 2DM7A 1DHKA 2CUHA 1BFSA 2DWEA 1IVLA 5C0NC 3K71B 5IFHH 2FCBA 1EPFA 3VACA 3BAEH 1ZPUA 1VFUA 3EF4A 4K7PY 4ENEC 4XWOD 4YDKL 5M94B 3MBWB 4XP5L 2DV6A 1C1EL 1U95A 4UDTB 1XIWB 3P9MB 4GUPB 4R4NC 1KIPB 4G6AC 3TO2A 4KKZA 1PZSA 2XDHA 1VDGA 1RIVL 3NP4A 5IJKC 3BKYH 4FQHB 4N8VA 3V0EA 3BW9A 4JY6B 5GZNC 3EO9H 4HG4J 2B4CL 3ULUE 3FNKA 1E9OA 3QEQD 4ZMLA 1E5ZA 1Q0XH 4I18B 3RTQD 3OXSB 3DO4A 1CUOA 4HWBH 3KLDA 2VZ1A 1KBPA 4JJHA 1M4KA 1VENA 1OGPA 3BVVA 2WTOA 5C97A 1I8IB 2OMUB 2NX5B 3IWVA 3M1BB 3VSVA 3L1EA 4XWGH 4AXWA 3HI6H 1RLBA 4X7CC 1GHFH 3QUMH 5DDHA 4NQXB 2CZNA 4L8DB 4W9FC 5K9QI 1IBFA 3DK0A 3G5VA 4P5KB 3GBDA 5LJYH 4X99B 4J3OC 1YQVL 3OJMB 2QKSA 5GSRA 3BZDA 1BFOA 3IWUA 1IFRA 5LGKA 4BWTA 3QB7C 3TBTA 3TH4T 4OGXH 4EN2A 4OUUB 1EA9C 4NBZB 1JXDA 1UM5H 4Q58C 1GW6A 1LEKB 3T2NL 4Z3TA 3MN8A 1BBDL 4KNTA 4QHMA 2WWKT 4U1GC 4S1RL 2R8SL 3DV4B 3WUWG 5I1JH 1KTCA 1RK7A 4PJ8C 3UC0L 4FXGA 2OKMA 5CP3A 2FE0A 2BIIA 3POHA 4FLSA 1WHPA 2P43B 3LKQA 4F9LA 3AWEA 4XP9H 5FO2A 2MNWA 1NC4B 1X4XA 5I71B 3ZDXB 2WXHA 3L6FA 1QLFB 5CSZB 2BNQA 3AXHA 1FFNA 1QD0A 2ZUYA 2G75A 3D25A 4BH8A 2GY5A 5EU3A 2GQHA 2R1WA 2X70A 4U6XA 1MCQA 3SDAC 4DGIH 3U6RA 4DGVL 4ZW6A 3LSOA 3C2SA 1ACZA 4X9FA 1B6UA 1CGSL 2YWYA 3FU7A 4E9QA 4PP2B 4TSAL 1D9KB 2IQAA 4G3YL 1ZT7B 3I6GA 5INCB 3PHQB 4ODXA 1SXBA 1XGTA 4O02B 5HHME 2JXMB 4JHAL 1G9MH 4QXTA 2ICEC 5F96H 5ANMB 4E5XA 3NZ8B 2B5IB 3PL6A 4MKTA 3BAEL 1F3RB 3SQOL 5IT2L 4XVUD 2GB2A 3U30B 5IHUL 1PLGH 3AREC 2F7IA 2UUDH 3FH8A 4PLJD 4A7TA 3KBHE 2ZXEB 2E59A 4K7PH 3GIZL 1TZ8A 5BJTA 3MRMB 4IBVA 4GXVH 1C12B 4NC1E 1ZLVK 2DWDA 3MGOA 3B9KA 1Q72H 3DJRA 4GMSH 3L4YA 3RWEA 1C7SA 3MR9B 3BKYL 3HE6C 3QCVH 3UTSA 2NW3B 2R1XB 3VWJC 2EZ0D 1CQYA 2BVPB 2D03H 2WUBH 2A0LC 1RH8A 1IM9A 2VZ3A 1DSFH 1GKOA 5EU6D 2OL3L 1NANI 4HWBL 1I1FB 2QSVA 4OGZA 4G1MB 3ULUF 2E7HA 3FCTA 2KC0A 4CVUA 4F58L 2YD2A 2FQFA 3NTCL 3WIIL 1C5CL 1NIAA 4QNPE 1Y18A 3G08A 4BQCA 2IH9A 1RZPA 1GHFL 2V2XA 3HE7B 4LKXB 4TTGA 1EV2E 1G7MB 3FTYA 4JKLA 4IRZL 1NGWA 1AR1B 4FQ2L 4HLJA 3GPSA 2VR6A 1E4KC 1SYSB 3PQYA 3PU7A 4NQDB 4X8JA 4O2EB 2OYLA 3STLA 2FUTA 4EIBA 4TVSa 4GRWB 2CGZA 4XO5A 1MEXL 4DAGH 1I8MA 1I8AA 2P5EB 1X7QA 3FTXA 4KQ4L 4NQTA 3VA2C 2O6DA 3AADB 5I1JL 1NGXB 2Y7QA 4RMTA 3NJLA 4P2RB 1U8MB 2VC2B 2WOYA 5EDXA 4XP9L 5IFJA 3TT1L 2VM3A 4GG6B 2OZNA 5FDYA 3ZTEA 3NFPA 3QUXD 3WNOA 4H40A 5D1QD 2H6PB 4KKAC 3C5ZC 3QRLA 1JHKH 3QHTC 3RYMA 1X5ZA 5GZOC 5HDWA 1ZDQA 3L9RB 2DMBA 2PTVA 1X7SA 3L17A 3VRJB 3MRIB 4HC1L 4Y9CA 3MX0A 3GS4A 5CN1A 2XTJC 1MCDA 1A7BA 3E7JA 1G0DA 4D2NA 5F3FA 1FIEA 5E5UB 3BUIA 4Z5RB 1CDIA 3FO1B 4YL9A 1THCA 5H94B 3S34H 1WTGT 4N26A 4CVZA 3BQUA 4HA1A 2OMWA 5C7XL 4FG4A 2R2HA 2BSCA 3MSPA 4GO9A 1OIOA 4P4KD 2BP3A 1PEWA 5AVQB 3FO2B 1XAUA 4XMWA 1NBQA 4EPSA 2KDYA 4E2OA 3S48A 2VLJB 3SDXB 2XVBA 3IDMA 4F15B 5KS9B 1KBKA 2NSQA 3H7BB 2OMXB 1P5UC 5T1LA 2YFNA 4PJXB 5E6ID 3QUYC 4PR5A 3QEHA 1J8HD 1INQA 1IFGA 3QCVL 4LCIL 5TTRA 4H0IA 3UPAA 1KCLA 1CMOA 2V2WB 3ESVF 3BRDA 3BO8B 4PFEA 2ITDB 3AS0A 5ISZA 1DSFL 5A3IC 1L9PA 2C3VB 5D1ZB 3C9NA 4G8GB 2ADJB 2VW4A 3RWFA 1SDDB 3BKML 3G04A 3PGCA 5CEZE 3V0DA 5HYIA 1OAUH 5AVVB 1PJ9A 1EEZA 3MCYA 2OV0A 4HHWA 4ONFH 4G6FB 3ARDC 3IM1A 3V6FB 2NPLX 1W91A 5IQ7H 2VDOH 3Q0HA 3T04D 3VTTA 4IW4C 2W0KA 3ARRA 2WZPD 4OI9A 4XPBH 4Y88A 3W39A 4APQB 4B9FA 5DJ2A 1E7VA 5FS5A 2W81C 1W8OA 5GS0C 5C09A 2R29A 3LRHA 4MAYA 4NRZA 3S5YA 2BP8A 1ZHKB 5AW8B 1AS6A 5JW4Q 1X5KA 4FP8L 1VEOA 3TBWA 4Y9GA 4PJ9A 3FH5A 2FBRA 3LXUX 4POZD 2LU5A 3L7FB 1AS7A 1AP2A 1U8QB 2HUHA 4DK3A 1D6VH 3T4AC 1A22B 5B4MD 4OGAD 4OKVB 4TXVB 4V1DA 2G2NA 4KXZH 5IM7A 1KPUA 1SBSH 2A9ML 2BVTA 1V7NH 2ED7A 4NQEE 4UZGA 3KM1A 1OE2A 2VXUH 1JZEA 2F8VA 2OCFD 1GS6X 3N0PB 3ZTDC 1UZGA 1KJVB 4HWEH 1JHKL 4O2FB 1AQDA 4N28A 3EJCA 3C6EA 2GUYA 4UT9L 3JTSB 2Z93B 1DTUA 4MD4B 5D2LB 5D7JC 5DC2A 3P11H 5E1AA 4URKA 3TEUA 3TN0A 2KZKA 3KL3A 1G6RA 4OGYH 4MMZC 1F11B 1V27A 1DLHB 2QADD 2W5PA 2F5AL 3WE6A 4KK5C 2BY1A 1IKFL 1HSAB 2G5RA 2H0JA 2FHBA 2JKWA 5AZEH 4XN7A 3N55A 2VLLA 3FSWA 5BS0B 4KJYA 4N0YH 1BQHA 2FJGB 1YPZB 5MP6H 1AD9A 3ROOA 2OR8A 1DBBH 5IFAH 5JPNC 2QLYA 2X0WA 2DW5A 4UANA 1U8IB 3QZMA 3LEYH 2MQ0A 2YBGA 3OKEB 2WLJA 3JT0A 5GHWL 3VMOA 1E2VA 4A7UA 4YDIL 4XAWH 3MBEB 1IMHC 4TLKA 4FXTA 1XB6A 3QO1A 4ALAH 4XO9A 4IJ3B 1FYTB 3Q06A 4LSQH 3MQIA 1ACYL 2K6YA 2PCYA 4UQCA 4N2EA 2X1OA 1TQUA 5BZDB 1MFUA 4XCEB 4AYDC 5AKTA 2J43A 3ZE0B 4BQBA 1WD8A 3CDGA 1G9EA 3SE9H 1KT2B 3HHRB 1GXEA 1ZK5A 1TSHA 1VGKB 2WLYA 4C55A 2VDOL 1FSKC 1SLUA 3CDCA 2QFRA 3MLZH 1F8TL 4WHTA 1C08A 3QRGL 2R4SH 4ZUWB 1BG1A 5C71A 2V6HA 4WNQB 4NM8H 1E65A 4NB7A 3FN3A 2YOCA 5T33H 5T1KA 5F6IC 3L2LA 5DFTA 3WEXB 1A4JA 3DRTA 4M5TA 2JQMA 3IETA 2VXQA 1T0NA 4N2MA 1PBYA 2DH3A 2GTWA 3DTXB 4A04A 5IEKA 1CN4A 4XPFL 1WFOA 2IOIA 3VFUA 4OD3H 5M95B 1L0YA 5GSVA 1DSWA 2VXUL 5KSBE 2G30A 2BM3A 3IGFA 3QWRA 3GMMB 2ZONA 1WIUA 4XPTH 3KVQA 1JMZA 3V0JA 3T65A 1AXTL 1T21B 3RGBA 2DL9A 3TV8A 7FABL 1PU0A 2FDBP 1EDQA 4XVOA 3T71A 4JG1L 4ZFFB 5J06A 3JQOB 3P11L 4WUUE 4OGYL 3RWIA 4N2IA 3C5JA 1IM9D 2R69H 1I8KA 5LQBH 4K9EH 2LU3A 3KH3A 3IJ9A 4HD9A 4N6RB 4OJYA 4JFED 2AK1H 2WXIA 3MODH 4QHNA 3BDYL 3AB0C 3HC0B 4MDIB 3OKNA 2GAZB 3BVXA 2OM5A 4JUTA 4PJDB 3S3DB 2AQQA 3LH8A 5EU5A 3OQ3B 3FUJA 1ACCA 4GUQA 3TEWA 4ZOEA 4WWOA 4HHAB 1BPVA 1EFXB 2OJ1A 4F9PA 4MMYA 4UBDC 5LDUA 1DBBL 3STZA 1XGRA 5IFAL 5LKNA 3CFJB 4LCYB 3V9FA 1MHPH 4DIXA 3CSPA 1DJWA 1RJYA 1T3FA 1RK0B 1OKEA 4HKBA 1QG3A 3T0BA 3CN3A 3UFIA 1ZVNA 2XWRA 3H85A 4K3DH 3QXDA 1EVTC 4BFIB 2WXKA 5KJ7E 4YSDA 3HN8A 1ZSDA 3K4DA 4FI6A 2AXWA 4D0DA 3K5RA 4X80H 5E7FA 2MTAA 4IBTA 1FAIH 3JWNC 5LB1A 2EECA 3VAEA 2FR4A 1A4CA 4UDUB 3ZKNC 2NQDA 1QX1A 1CG9B 2WVVA 4GEJA 3PLYA 3V4VB 4BH7B 3ORJA 5C07B 2DQDL 4MNHB 2UXVA 1CT8B 1PIGA 4PRHD 1A7PH 5EBLB 3VXSE 4CGUB 9PCYA 1FDLL 2WKGA 5J1AA 2YRPA 4TUOA 2Z8VC 4R96A 2R4SL 4OFIA 1XFPA 3LB6D 5EIIG 1U41A 2NDFA 3N41B 2P48B 4MCYB 4BKLB 4TOYL 5ID1B 3RPIA 3VXTA 1N12A 2FX8H 5LXGH 3QQXA 5T33L 5J89A 3KLAB 1LLAA 2E9WA 3BWUC 4XN4A 3T0DA 2X89A 4GKNA 2K6ZA 2AQTA 3GSQA 1K85A 1BOGB 1G7JB 2V37A 3CSYA 4Z8FL 2Z8RA 1MZYA 1Z7JA 3S4SA 3SPGA 4MZIA 5E8OB 3U0WH 3MRGB 2WYZA 3OZLA 1YNTF 4OQTH 3TIEB 5A1AA 1MW2A 3FRPB 2JI1A 1JRHL 1N59A 1R3HA 2E76C 3R1GH 1U8JA 2AZAA 2X28A 4GAYB 1MI5E 4LSPL 1WO2A 3LPPA 4CMHB 5HHPA 4D9LH 1AZVA 3TO4C 4ZX6A 3SGJA 4L1DA 3WHE1 3HAEG 1EJ6A 1J48A 2XZQH 5EORL 4AYEC 4AIOA 2A74A 3AREB 3G6DH 5T3XL 3IMWA 5T1LD 5KSBF 1KJ2L 3O45A 4XVSH 4AH2B 1BQLH 2A4EA 2A4ZA 3MV11 2B2XH 5CD5D 3VD9A 2R69L 3HE6B 3AM8A 3L2MA 5IUSA 2WLZA 2AK1L 4KK9D 3VWJB 3MODL 3OLDA 4HXBH 4LLMB 2V3DA 2ATPA 1ITBB 2W94A 4GO6B 4RFOH 3HHMA 5JOPD 4K0OA 4NQEA 5C7ZA 2RFXA 2ADFL 4M4PA 3OKKB 3V0VA 1EAOA 4CU8A 2VDNB 2P1YA 4ODTL 3PAZA 5HHNA 2XWEA 4X8CA 1IUZA 2HFEB 2WWNA 4ZAKA 3ECBA 1L9QA 3WMQA 2IALB 3MLTB 2YPKB 1WS8A 5IW1B 4Z7NE 2MIZA 3IS1X 1HYSC 5C09D 1WDAA 3B2UD 1KB5B 1OSEA 4Q9QH 3BPLC 1TQWA 4MHHI 4UTAA 1LHZA 3QS3A 5JPMC 5CZKA 3H54A 5K93A 1IEBA 2A9AA 2BOCA 1Z2KA 3SGDH 4K3DL 3VFVB 3HPLB 4U6YA 4MXQC 3FO0H 3IAPA 4V1DD 2LLGA 2CMRH 2AGJH 4F24A 3B3IB 2FYVA 4YHNA 2EO7A 3ULVE 4G6JL 1FAIL 1IAKA 3L2NA 2F54E 4UT7H 2WBKA 5F7NC 2X7LA 2BVQA 1BM3H 5HP5A 1E3ZA 3G7TA 2NNXA 4YHZH 2EYTA 2ZP0T 3BMVA 1IEAB 5KVDH 1UOLA 4Y4KA 1AG6A 3SO5A 2XI9A 4X0KB 5DZPA 3EKCA 4G7YH 3TURA 3KPSE 2ZOOA 4K23L 4PH8A 1HCYA 4QDGA 2YD6A 3TN0D 2CHNA 5DJ8B 3FH7A 3IJYB 3E6FA 1SEBA 4HLEA 4XNDA 1KWGA 1PKQE 3DVIA 3MNDA 3KPMB 2XTJB 4QRFA 3EGDA 3O8XC 4X6CB 3FQ2A 4MQSB 4QTHB 2XXMB 4MA3B 1IKNA 4LZKA 1S3KL 3FQUA 5E51A 2BSTA 4OIAA 4FCHA 4AZ8A 4C4UA 1XB3A 1R3JB 2VOTA 1AC0A 3V0WL 4PJ5E 2A6DA 3FFCB 3ZE2E 5FA4B 3W5NA 2ZNWA 4OAWA 1HAUA 1SVBA 3OL2A 1ZT1A 1BAFH 4QXWA 3RAJH 4DP8X 4BM7A 4ZW5A 1U33A 4KY1L 3HG3A 4HQQH 4DEWA 5DK2B 5E03A 3PGDB 4URTB 4UOW0 3DYOA 3WAKA 3G6DL 5EA0H 5E23A 3Q2WA 1YEEH 4LKCB 2NR6A 2V5MA 3E6HA 1XIWD 4H8WL 1SN0A 4BFFA 1YNTA 5HYQA 4PD4J 4F8QA 1KLGB 4ZUVB 4FFZH 3DO7B 5M7QA 3K80A 1S7WA 1X5IA 4ZMPA 4L37B 5FA3B 5IB3B 3L9BA 3AQXA 4L8CB 3WFDL 5CF3A 1GCFA 2UUDK 1BEXA 2XXCB 1J1OL 3ES6A 3QHFH 4EZLA 1JFQH 5E4IA 4PRIA 4RWYH 5KSBA 32C2A 5C08E 4MB3A 3AGWA 3FU3A 5JDSB 4P48A 1DCEA 2NY3B 5HI3C 4WDIB 4KMTH 4ZX3A 1L6PA 3SBWC 4YH6A 2ITFA 2VDPH 2X2YA 3ARDB 3GS0A 5GGUA 4CDGC 4ZMVA 4NJAH 2NX5D 3FB7B 2CDEA 1AGEB 4R7DB 3PJNA 1WAAA 5DFVC 1QFWL 2OMTA 4BCXA 1KCUH 4PWGA 4OW6A 4WUUA 5T1KD 2CLRB 5ICXB 3PHSA 1KGJA 1OAXH 3FONB 4NWUL 3WJJC 4Z7NF 1HXMA 1E0OB 5C86A 4PGEB 3DVNA 3O9WB 4ABVA 1XAKA 5DO2C 2AGJL 1KLFB 4YN3A 1QABA 2OSLB 1QLEH 4PAZA 2NY5L 1IB5A 4PVBA 4UT7L 3PGFL 1CXFA 3QPQC 4GW4A 1GJWA 4FQQB 2D3NA 5L4JA 1MDTA 2EE9A 3UTQA 4YHZL 5GGRA 4AW7A 3Q1SH 4M6OL 4I48A 3BYTA 1EAQA 1NC4D 5TE6H 4PBWD 3PXJA 1JOIA 3LKSA 4UF7C 2KDGA 4ETQA 5IEHA 3GSUA 2XBDA 4HISA 2WSDA 5C0IA 5HDBE 5D7JB 3VDAA 2XN9E 1HHGB 4I2XE 2EQDA 3AGVA 1AQKH 3BP6B 1M71B 2YPVH 2QVMA 4XCCH 5T5NF 4DPBX 5TJWK 3O6LL 4TNVK 3UGEA 3LIZH 3WUWB 4LCWB 4UQ3A 1VKXA 1HESA 1TENA 3GSRB 1N3NA 4OBRA 4XMUA 1RERA 5TE7L 4J6RH 4JY4B 2P44B 3O41B 3GQFA 4LL4A 2BMKB 1XGPA 2CM5A 3QNYB 2I32A 3GWJA 5JNYA 3CFCH 3WTYA 4AQEB 4PPTA 3OVUB 3VXSA 4IYKA 3H2QA 4P46C 2DQJH 4AITA 3LZFH 3D9AH 4HQQL 3C6LC 5FUZH 5JPNB 1ET7A 3ZE2F 4P5TB 1E5UI 2HRPL 1UACH 1BD2D 5EA0L 2YZ8A 2V33A 3MRDA 4KO6A 4LPTA 3I6KB 5CJBA 1KTLB 3DUSB 5I23A 1DJSA 1E30A 2Z0UA 4F92B 1A1NA 1S7VB 1EUUA 2DL2A 3TGXA 1BAGA 1VZIA 2YMXL 5E99L 5HPMB 5I6XC 5HHOE 3AJ7A 3NCEB 2CKBH 3OB8A 1NOLA 1U93B 2AJUH 1ESOA 2UY6B 4FMVA 3QDAA 4YDZA 4XMKH 5B21A 5HVHC 1MI5A 2R2BA 5KBPA 1FV1A 5E24E 4HV8B 2LV4A 3V9CA 1MIEL 1PZAA 1E4XI 3FPXA 4GAJH 3EUDA 5A16B 2I27N 2WP3T 3CH1B 3AU1B 4KMTL 5DZ9A 3V6OC 5I1AB 3QJVB 1F97A 2BS71 3CSTA 1W8NA 1T6VN 2AI0L 2R56H 2CO7A 2YKLL 1A7RH 1A14L 2BO0A 4DEUA 3QI9B 3NEEA 3ILPA 5EZLB 2X89D 1ODAA 2XG5B 2XX0A 1BJMA 4ODHH 2DJMA 3VD4A 4PJGE 1BV8A 4HKXA 3PWPD 3RE0A 5CEZD 2IAAC 4FFWD 2D73A 2ERJC 1ZEAL 1EZSA 3NCJL 3VXUE 2VZVA 5JW5A 4B9GA 1OCCB 5IB4A 5I8CA 1JPST 3OB0K 2LLNA 1LWJA 5F9WC 5I6PA 1WWWX 1GZQA 5BRQA 4LLWB 4NO2A 2HVKB 2OL3B 3CAFA 4I1RA 1P7QA 2IWEA 1S9WA 4HMCA 1K4CB 1V3LA 5I8EB 3V7AG 3LKPB 2WLIB 4RGNC 1O6SA 1OW0A 3WLBA 1IIIA 1NFIA 4KTGA 4FI7A 1UXSA 4XCCL 3L4VA 3FB5B 4M4RA 1G0YR 5HDBF 3TA3A 3UBHA 3LIZL 5EFIB 2WN2A 2F54A 4IRSA 2UXTA 5SV4A 4RMQA 5J4MA 2DYPB 2HKFH 2H9GA 3UGXA 3ZN6A 5TGBB 2ZD0A 2V7NB 2KLTA 2O72A 4ZAKD 1KDIA 3GKZA 4LSTH 1JUFA 3CFCL 4BCYA 2VKXA 3CZEA 4PGZA 3ILQC 4YDMA 2AAVA 3MRRA 1NCCL 1R3IL 1L9SA 2DQJL 2FB4H 2ICWB 3D9AL 3KPSA 3LHPH 4QRSB 2CXGA 2EACA 1F3JA 3D0LA 4HGWA 4LSDA 5B1BB 1UACL 2VLJD 5FF6B 2A6JB 1U92A 4XNUH 3RY6A 1FIGH 3D0VB 2EIZB 1T6WA 1KXHA 3DX7B 1OCOB 3FMGL 4KKBD 5ES4B 4R26H 1TDQA 2ZYHA 1E8XA 1KLUA 3IDGB 3QG7H 3HR5B 4LLDA 4UMGA 2AJUL 4Y4HC 1BBJB 1ROCA 3MMEB 1A7NH 3QEUA 1KGCD 1AMXA 3MV01 3OSVA 4P5RA 3RWCA 1I4FA 2ODIA 3ZKMC 3QFGA 2FIKB 4RSYA 4WFEE 3IGUA 4ZFGH 3MV9D 2YD8A 5B22A 4Y4KD 2EDTA 4RDQG 1OO2A 4MAZA 5IB2A 5T1JA 4MB1A 5F3HB 1OQXA 4H5SB 4NZJA 2R56L 4QI3A 2PWEA 4HJSA 5KYXB 1EXHA 4OCXL 4Z7UB 1B2YA 3ZTNH 5FM5M 3WNJA 1BZ9B 1A6TB 5AW6B 4Z7AA 1IGFL 2PUQT 3O0LA 2VISB 4QRUA 2OXHA 2DQHH 1E4KA 1EHKB 1FG2A 3X3GH 4B5EA 3A24A 4PJGF 4PJBB 4BFBD 4FHKA 1XZWA 1DBML 1A64A 3KDMA 4GKSA 5AOJA 3KGRA 1MUJA 4F57L 1HH9A 4BHUA 4GQZA 1X5LA 3PNWB 1AI1H 3BEWB 2NR6D 3OQRA 1G6VK 3FBKA 3GSNL 3ZYJA 5B8CC 3LNDA 4WKZB 4Y2DA 4DUXA 1E6OL 1QHOA 1HI6A 2RJMA 2J8OA 3C5ZA 4CNIA 3E38A 1KB3A 2X1WL 4IS6B 1WWBX 2YD5A 5DYOB 1BWMA 2N7BA 1AGBA 4L9DA 4N0UB 1JSYA 2N4IA 4WQOA 4PRID 2ED9A 4ZMOA 3BGFC 4WENB 3RI5F 3WTUA 2WK2A 4F37K 1HEZB 3OHMB 4Z76B 3K2IA 1K6QL 5F0LB 1FPTL 2YXMA 1ZE3C 2DQTH 4F8PA 2NNAA 3DROA 1NAMA 6FABL 2EVGA 3GMRA 4WK2B 5EO1A 2RHEA 3LKNA 1TJGH 4BYHA 5E8DH 5JIPA 2Y22A 1NH6A 5AAMA 1CXKA 3J27A 5CHNA 3VX1A 2R9HD 2O5ZH 2C4FT 1KXTB 1SXZA 2XLLA 4IBSA 4JFFE 5CIPA 4NN5C 1AO7B 4I2XA 1PDKB 3JV5A 5DI8B 3A4FA 3GXTA 3HIZA 3HPJA 3BPLB 2HA1A 4MJ5B 4QHLA 3WENA 1RFDH 3CHXA 3F12A 3FTGB 1NCTA 3MBED 2VLRD 5H37H 3BP7B 2C9AA 2CDFA 3LQAC 5A6LA 2EADA 3L3DB 2X4QB 3QUYA 5F72S 4FABH 1Q9OB 4MJ6A 3GB7A 2H26A 2QTEA 3OGCB 4JJ5B 5IG7B 5FCSH 1FZOB 3SDDB 3T3PE 2FATH 3UTTE 5FGRA 4O51B 3F6JA 4XNZB 1OGAE 4U2YA 1D5IL 4LARL 2GJ6E 4CAGA 3F3HA 4QJ5B 3N2JA 3HLAB 4K15A 4QRRB 4FLHA 2DI7A 3MOAH 1RUQL 3OZ9L 2O26U 5IK3B 3L3GA 5GGTA 1MQKH 2JWYA 5AVUB 5EB9A 1T0MA 1FVEB 1Y1DA 2QDWA 2WIIB 2XWJA 3O8XB 4HUUA 2EKSA 3DARA 1IEHA 5GRVL 1JTTA 4W81A 3MNVA 3AFLA 4JPVL 1HINL 5CCGE 4OIFA 3GMLA 2W65A 2ZTBA 4F80A 1W0WA 4AKQA 2H3NA 4KITB 4BRJA 4H1LH 1B4TA 1VF5C 4PRPB 4L9LC 4QT5B 4TVPL 3ZDYF 3RFZB 4YR6B 3VFPB 1N2RA 3RRQA 4M93B 4EIZC 5D1XC 5DJYB 3WHXB 1YN6B 2VRKA 4K3GA 1FC2D 1LNUA 2NLJB 4KH2A 4MVBC 5C0ND 5T5FL 2CRMA 1UFUA 3BH8A 1CD8A 1QWNA 3QQ9C 3HKFA 4I3SH 3H56A 1K5WA 3QQ4B 4PJGA 4AQ1B 2VDOB 4P2QA 2NY1C 3ULUH 4X50A 2XACC 3W56A 3HMWH 2BRQA 2ORBL 4G6AD 4PGCB 2OULB 2MTPA 15C8L 3ABLB 3MNMA 2ZJSH 4HZLB 3VXUA 1WTLA 5GZND 2GG1A 5E2TH 1T5WA 3WEAA 5J12C 1SLVA 3Q9QA 4MB4A 2V3EA 4MMZA 1UOVA 4AL8H 5GJSL 1ZHBA 5EBMB 2DMGA 2FLBT 3DV6A 5E8DL 2MPVA 2YA1A 4NENA 3ZHFA 2O5ZL 3NIDB 4XXCC 1E27B 3DUUA 1GZHA 2B0SH 1F1AA 2I9LA 3CFKB 3II1A 2C9SA 3NYKA 4FXLA 4OCLC 3MACH 2WQAA 3N42F 4J3OD 3KXFA 1G6RH 5BVPL 4MAUL 4R7NB 5I5MA 1LXMA 4ZTPL 2WNXA 1EXUB 3BDXA 3WDJA 4JFDB 1CVSC 1AJ7L 2NTFA 5ADOL 2D7QA 4XVTH 2GSIA 1CDHA 3DMMB 4ERSL 4O4YH 1D5ZB 1IC7L 7CGTA 4JVPA 2C8NA 3D85B 1LD9A 2X4PB 5F7EH 1ZLSH 4FABL 4S0HA 4OZFG 5F9JA 2PW1A 2X3AA 3D3VB 4PJ8D 1XCTB 3EOAA 3I9AA 1V54B 1BZ7A 4KQ3H 3P3SA 1HT6A 5FO7B 2NXZC 1UD6A 4KJPC 3BN9C 5I73B 2VE6B 1FNEB 3BZEB 3SQBB 1CE1L 2V9UA 1JF5A 4ODUB 4AEIL 4KVCL 2XN2A 3EDKA 1XGUA 1USQA 3SDAD 2R2EA 4EZJA 1QO3B 5E5RB 4GI8A 4WEMB 2L3BA 3NQIA 5HI4C 3ZHNA 3UACA 3SBRA 1ZAGA 4OF0A 5G4OA 1KXVC 2YJLA 2AQ3A 4PJFE 3ZKQD 2UZPA 3O4LE 2V2TA 1JV5B 4XNXH 3BWZA 3IFLH 4AQZA 2ZAHA 5I76B 3R19A 1OT2A 2ZXQA 3RZWA 2Y2WA 1GZPA 4Y19A 2FJUB 2OSXA 2E6PA 5LBGA 4N3UA 2CR6A 3ZDZE 4PN6A 3ZL4H 1QHPA 3DHMA 3H2PA 1HOCA 4XB3A 2WLLB 4YSCA 3T6QC 1DN2A 2Z31C 1ZS2A 2EDOA 3ALPA 3Q8CA 3L54A 5EIIB 2Y06H 4HMEA 5MHSD 2PXYA 3P4OA 4ZXBA 3KNBA 3K72B 2ZOLB 3MO1B 1SQ2N 3QDJE 4G9DB 3L3KB 1NC2B 5DJZA 3GSOB 4HW6A 1MLCB 3NPZB 3PJSA 3CFDB 3NJMA 5I15L 2VXQH 4JVUA 2D7TH 3VG9B 5ACMA 4OFPA 5G4NA 2DQUH 3EJSA 3VWJD 2J88H 1AS8A 1OT1A 2ARJA 2HFGH 2A0LD 2YBRB 3QBTB 1AIZA 4LHUA 2X4RB 5FYLH 3BP4B 4OLXH 4LNRB 2WY3B 3S8GB 1NICA 3T0EA 1P4LA 2XETA 3HAEB 4G72B 4YSSA 1ZHLA 3GJFA 4XN2A 4U0RB 4ZFOA 5CBAA 1CICB 5E94A 3H4FA 2B0SL 3UIYA 3ZIYA 5MERB 1N6VA 2CO3A 4OUOA 5JHDB 1FH5L 3K4AA 4XBEH 1HZLA 2CO6A 2D3JA 3WAJA 2K70A 1EH9A 3P2BA 4XVTL 1CGWA 1KJ2B 3ZSSA 4L3EE 4GKLA 4PJAB 1MCBA 3OKLB 3EGXB 5AVTB 1NZRA 4IKNA 2LE9A 1NEUA 1TKWA 3VJ6A 5LGJA 5ILTH 3OWEA 4I7ZC 1XCQA 5F97E 2X4TA 2ROXA 3QJFB 2E47A 3CUPA 4EN3B 4OR1A 3IGLA 2F7QA 5AW0B 4JFFA 4LSRL 4KRMB 4KKAD 1GIGL 3GBEA 3C5ZD 5EC2B 3UJTL 3HG4A 2EH7L 1Q4NX 2EYRA 3BRGC 1RJLA 5JR1L 5GZOD 5FKAB 4ZSOE 4D9RE 1SJEA 4M8QB 4XX5A 4WI0A 3VFGL 5JIQA 2Z6FA 1CR9H 5DZAA 1RURL 4IU3B 2XX1A 1HCZA 5KSVA 1MCHA 4XNXL 4HIIB 1ADWA 1YAZA 2X9ZA 4OTXL 2PW2B 5CZRA 4GYBA 1KNOB 3EZ8A 3F05A 3T3ME 4CVXB 4OZHE 4PJFF 4LIQL 2ADIA 3SKOA 2GJ6A 1BCIA 3TCTA 3QRBA 3HTLX 4OLWH 5GQBA 2I7SA 1NPUA 3ZDZF 2YS4A 5DEJA 4ACTA 1X5MA 1Z9SB 4HKJA 4XC1H 4RGOH 3FXIC 1E8WA 1MJ7H 2BCMA 4NYLA 4C58B 5EUKA 3FT9A 1EHXA 2BC4B 4OLVH 1C8PA 2G9KA 3IDIA 3AXLA 2VAJA 4DKTA 5E00A 4WU7B 2F58H 2VSMB 3IE9A 5IJCC 3QUYD 4L23A 4E9WA 3VU2A 1YMMB 3VG0L 5BZWA 2DQUL 3UJJL 4WI9A 5A3ID 2WXQA 3TASA 2WQSA 5FYLL 4NUMA 1MCCA 5BO1H 3ECUA 3OJDB 2OQJA 2IDCA 3N40P 5FLUA 1JZ2A 5A7BA 3MRQA 2G0LA 5D7IE 4Y8DC 3VCLB 1JDAA 4J4PC 1EHAA 2W1NA 3FFDA 4NT6B 3NZSA 3C8KA 4HT1L 3D33A 1CXEA 1OLZA 3CZFB 1S9YB 4KMQA 3CFMA 4U05A 1I3RB 3CMOH 1UT2A 4I0PC 4XCYA 1SYVB 3GUTB 4U7SA 3WIHA 4M1CC 5GS0D 1CFTB 4ZUUA 3TP4A 2ROYA 4OCWH 3S3BB 1AQ8A 3LTVA 1CL7I 5JPMA 4OZIE 5BPPA 4KGJA 3U6XS 1SOXA 1WS7A 2NCEA 3ARBC 3KJ6L 2OSWA 5J13C 4LPUA 4N85A 1JNHB 3GF8A 4WTWA 3TVMB 3GK8H 4BK5A 4DP1X 2A9CA 3EBHA 3LH2H 3MNZA 4X83A 5FHBL 1U91A 4N2KA 2WLHA 4X6EB 4P2QD 1SBBA 1G43A 3LH9A 3RGVC 3WJMB 5B8CB 3QAZC 4UTAH 1KXQE 2OR9L 4KAQL 3EJTA 4G1EB 4F2MB 5K9KA 3QXWA 4WTQA 3T1FB 5HXMA 4JM4L 3TBBA 2H2PC 3VXUD 3W1ZA 3SZ6A 3KCPB 3II2A 3IKCB 5D72H 1KPVA 1DLFH 1SY6A 4ZPVB 3BGFB 2W9DL 4KK5D 4LCWD 4FNRA 2VABB 4L4VE 1T1XA 2DMKA 4P59L 1QSFE 2NY4B 1NUGA 2X4NB 3UTPD 5EO9B 2AP2A 1BZOA 5AW5B 3T3MF 4WGWB 4OZHF 3WLWC 1PQZA 1F4HA 4JO8A 5I8OH 2F8OA 1GJIA 3GTNA 4HS6B 4XC1L 1EAPB 3KXFD 4AQAA 2WXMA 1T4KB 2Y6TE 3RUGB 4NN5B 2IDFA 3I3DA 5JQ6H 2EEXA 5I0WA 3NSCA 3K74B 3NSJA 1MFNA 4EVNB 4Z3JA 4PJFA 4NAMA 4P23C 1ZDSA 3UAFA 2RALA 3UZVA 3D2TA 3BMWA 5E9AA 2AQ2A 2W92A 2B9AA 3QO0A 4I89A 5D7JA 2DD8L 1AGCA 4LPCA 1HZHL 3LKRB 4ODWA 5F1IB 4AK2A 4KK8C 5CCKH 5HJ3B 1HSBB 1A47A 5BO1L 4ONOA 3EHBC 4XP4H 3ULSB 3CFEA 1UM4H 1SEQH 4A2LA 4ZMAT 4QRPB 5TQ2L 3V0AC 3CIAA 3SY0A 4BXSV 4EUPH 5JIKA 5ERWA 4RISH 2QELA 1ORSB 2ZOWA 3QZWA 1W72L 5D7IF 4ABWA 4Y1AE 1UGNA 4FFVC 3ZDWA 1VB9A 3AC0A 3WN5A 3QUKA 2KPWA 3BD4A 3GRBA 4HPOL 3QS2A 3NSDA 4CU6A 2WXPA 3B2VL 4OCWL 2FD6L 2JH2A 4EE2A 2QMKA 3OPZH 1OM3L 4Y19D 2BERA 3P3RA 4FFTA 3WJJA 4KTDL 4JFVA 4KKLC 5EO0B 2IBZY 3MLWH 2XNAA 3WL9B 5ANME 3QIUC 4N9GA 1SMOA 4Q4EA 2EC9T 4ODSH 3S36X 5T3ZE 5IVNA 1F4YL 2VXTL 4OZIF 4HUNB 5F70A 1IC0A 1RZJL 1QP1A 3PIQA 4X5XA 3LH2L 1W6LA 4M7JH 4K7FB 2DF3A 1NFDB 4MXWH 2EYSB 4IHOB 5IJVA 4PV8A 4YWGH 5DXWA 4WWKB 1FZJA 3IDXL 3AU0A 2OTPA 1KCVH 1TFPA 2EDYA 2NY1B 3LV3B 4IIQB 5AUMB 3UP1A 1CFSB 4R5VA 2XRAH 5EUOB 5I1IL 5DK0B 3ILDA 4PWIA 1F5WA 5E8PB 5J3HD 4LHUD 1RHHA 4KRPC 5J12B 1ED3B 4NXKA 3AUWB 4UM9A 5JHBA 5HGBB 3T0ED 4Q6IB 6TAAA 3IJSB 5DA0B 4ANWA 3UERA 1YEIH 4HXAH 4Q74A 4LASH 1UJ3B 1J05B 3GD1C 2HRGA 1FC1A 4XP6H 3QXTA 5I8OL 2C9QA 2J44A 3H53A 1L5GB 3S88L 3WNPA 2GIYA 4H44C 5E4EB 3CHOA 4FQIH 1HILA 3GZPA 5DRXB 3ME0A 3IFPB 4QRQB 4NQDE 5IP4A 4ZSOA 4JKKA 4P46A 4GRWE 4XPHH 3C6LA 4A1RA 2EE0A 1SM3H 3SKJH 2N7AA 2P5EE 1HCFX 2Q8BL 5J6GB 1ZA6A 4DGYH 2HVJA 1NDGB 3F7QA 4PWEA 2GPZA 2X42A 4N2OA 1WZMA 4P2RE 2H2SC 4DVRL 1CGTA 2ZWSA 4OZHA 4TQ8A 4L8SB 2BNRE 3OSKA 4GG6E 1YECH 2D4FA 2DBJA 2DTMH 1R5IB 3DYPA 4GQRA 4M6NH 5C0BA 5C2BL 5CCKL 1AHWC 3WTVA 4LPVA 4NJ9L 2FEEL 5TDPA 2NW2A 1DJIA 2ZZUT 3ZKND 5HYFA 3RIKA 5DMIH 5J9PB 4YXKH 2UY7A 3OAWA 5KSUB 1A1MB 2BHFA 4DKEH 3LNHA 4NIYE 1J0JA 5F0MB 3UBXG 4OV5A 4MQXD 3X12A 4RISL 1SUHA 5HYJE 2ZOKB 3BP5A 2Z92A 4FULA 2IDQA 3EDDA 3ZO0A 4BSVB 2R0ZL 2EDMA 1WISA 1MLBB 4WW2B 4ONHA 1LVEA 4HF5L 4P99A 5EBWA 4B7IA 1RU9L 1ZANH 3WNNA 4HOMA 4J39A 5IUCA 5IESH 3DPDA 2ZAGA 2ZWZA 5ESVA 1FNLA 4NWTH 2G60H 1FVDA 3ESUF 4X42A 1RSFA 2ZYRA 3NAAL 4P5SA 4MQ7B 2JJVA 3ZR5A 4KNQA 5DEZA 3EFDH 1JPFB 1X4YA 1JWUA 1EK3A 4YIQB 2GJJA 2X2HA 1CGYA 3MRCB 3QDMA 4FQXC 4HK0B 4ODSL 5D7IA 1AXSB 3LRKA 5D8JL 4BQ9A 2JKLA 2VR7A 3WY3A 1FNSH 3TESA 2Q86A 1NKOA 4QR7A 2Z31B 3IXTB 3GXIA 3PAVA 4PJ7F 4XHJC 4UNUA 1NCAL 3DIFA 2Q3AA 2HLAA 4M7JL 3TO4D 3ZOAA 4IBUA 1II4E 3FT3A 5FOBA 4M5YL 5KUMA 1G7HB 4NC2B 3GBNH 3LEXB 4PJXE 2XBZA 3KWXA 1HHKA 3RZCA 3QIWC 5ITFB 2XXFA 1KCVL 2ZUQC 3CZUB 4AENA 5FPIA 1HOEA 1NL0H 1FJ1A 2FJHA 3F00A 4DJMA 4OJEH 1SPDA 4ZW7A 5EOQH 3U9UA 1AKJB 1M05A 2WM0A 4OZIA 2X2UA 4U4IA 5I30H 4NKQB 3K71A 2ZSWA 1A6PA 4Y16B 5D96C 1EGJA 5T8IA 3QFJD 4EMZA 1EO8L 1U6AH 4OSUH 3OPUA 4ZMNA 5J1SC 4Y7MA 1QWUA 4YSEA 3RWJA 2OJEB 3B7RL 4R0LC 3MV7E 4K94H 1I1AA 3ARFC 4XBMA 2CJUH 4JZJC 5CSBA 5D7KD 4C56B 2CE6A 1N0LB 3DX8B 4N0FB 1CLOL 4FQHA 1HYSD 4L3FA 4GRMB 3QSKB 1FH2A 5JIIA 4Y5VC 4LU5L 1WZ1H 4R7XA 3SKJL 3GSNB 5E95B 3ULVH 4GRWF 3F7RA 1HQRA 5JZ7C 4L4VA 4JQIL 1KENL 2OMUA 5F7DA 4P2AA 1QSFA 2DTML 1XL4A 4MA7L 5HGDB 1EZLA 4U1MA 3O2DA 4LBEB 4DFHA 5HI5C 4L8DA 5BQ7A 4P5KA 2X6MA 1QRNB 4G80A 4HZAA 4Z7IA 2MQGA 3B8YA 5KSAB 5C9JB 1MDAA 4Z3IA 2FUQA 5D2LE 3JTTA 2H0FA 3OMIB 3KAAA 3W9EB 2DLGA 1HXYB 3SE3C 4AJWA 2OR7A 2KZBA 4ISVB 1VFOA 2AJXH 1NUNB 4KZ0A 1BQSA 1T2QH 1N5YH 2WAHA 2E27H 1ZANL 4OH2A 1YN7B 3F2LA 4XOEA 1C5DA 2KZ1B 3REWB 4F7CA 3O8XD 5CXPA 3I2CH 5LGHH 1T03L 2OK0H 2X5PA 1C5BH 5B1JC 2DRUA 5F1NA 3OAYH 4R5TA 1QLFA 3EFDL 2J8UB 5BS0E 1QW8A 3GMOB 1YPZE 3QP3A 1WEJH 1J5CA 4DWHA 3ABZA 3F7KA 3GSWB 3ZTJG 2VDML 4UQAA 3DA0A 1FNSL 4G5AA 5AZ2H 1UGKA 1K8IA 4K5OA 1I3UA 3WV0A 2WJ5A 4Y1AA 2ZSVB 4TS6A 4XTRC 2K8QA 4HIHA 2G5BA 1D9KA 1HHHA 5F0JB 1ZT7A 2ZCZA 1FYTE 1RHFA 1DBAL 2NY0B 1CLCA 5INCA 4NKMB 1AGDB 2P24A 3PHQA 2QHRH 4S0TD 3ATBA 2JKSA 4ZUSB 1BXUA 4PJXF 2WNGA 3RVTC 4FFYH 3R06A 3D12B 4OU3A 4A55A 1E28B 5ANMA 2WXGA 3NZ8A 4PJ7A 5ABDE 3TIDB 1U6AL 3LNEA 3MCG1 4OSUL 4QKXB 4BUHA 2CBTA 5L2KA 1EZVX 1XVSA 5I0YA 4LOVA 1NDMB 1LK3L 1ML0A 3TH3T 2Z8WC 3PWJA 4YE4H 4OB5H 1NGQH 3NFSL 1XF2B 4K94L 2WBJA 5HI3D 4Q6KA 3UZQB 5C6PB 5I1HL 3FULA 2YGPA 1U36A 1V10A 2IPUG 5E8EA 4CMMB 1PLAA 4AGPA 7PAZA 2VT0A 3BVWA 2R1XA 5JW4R 5DFVD 4H8UA 3MDJA 3CU7A 2BVPA 3EYFB 2FBJH 3VYPA 3O3BA 3Q7JA 3P40A 1KYFA 1U8NB 2PETA 3QG6A 4GT7A 1GGIH 4A68A 1H3WM 4G1MA 4UOW1 1AY1L 3DDFA 1A7OL 4FJZA 3N1MC 3PABB 1G9MC 1JL8A 4NCDA 1BF8A 1OAKL 1HWWA 5DO2D 1TTAA 1PG7X 2A3TA 3AVEA 3D39B 4H8HA 4LLUB 3DWTA 4S1SH 1ZLEA 4C8XA 4MBRA 3EW3B 3LKOA 2QJDA 4QHKI 5GGSY 1Y07A 1RJZA 4YBQC 3VGAC 1BVKB 1NCBH 4NQDA 3HUJB 5CIPH 3SKUD 4JL2A 4OFVA 1IM3A 1LMKA 4Y2OA 1QBBA 2QLVB 2P5EA 2W38A 2AITA 3U9PH 5JUEH 1XMEB 5D2LF 3UAJC 3HN5A 1LO4H 1ORQA 5FYKL 1T1WB 5GGQH 1U8MA 1MRCL 1TJIH 3P1VA 1TQCB 4HH9B 3I2CL 2BNRA 4PJDE 3FRUB 5JLZB 3O3EB 4OZFB 1MXDA 3CLEL 3BC9A 4DOHE 2HJKA 3QZOA 5AOLA 1LEIB 3SHSA 1N6QL 1L9NA 1WEJL 5IHBA 4MA8L 3GO1H 1WBYB 2Q5BA 3MFFB 4FADA 2APVA 4JN2B 3PRZA 3RDTC 1A6UL 2Y5EA 3LN4B 3ABKB 3OM3B 5BRZE 3O4OC 2X0VA 4MD5A 1DBKL 3ARQA 3L9RA 1VEMA 5HYJA 4U7MA 4Y2NA 1WCBB 4PB0H 1LWRA 1FCGA 4P46D 1KN4H 4XGZB 3T8MA 3C6LD 3AY4A 2ZCKH 5GGTH 4ATTA 2NY6B 2A9DA 3FSZA 3CN1A 2RAMA 3FO1A 4UYQA 3BZFA 4KHXH 3SPJA 3V5DA 3DVGA 1P2CB 4PRAB 3GKWL 1QBLH 3UO1H 5F7HA 3TBCA 3NSFA 1BLIA 2F74A 2CLVA 1KJ3L 1CF8H 3JUYA 4NC0B 1N8ZA 3N06B 5E1IA 4Z18A 2H8PB 2VIRA 5IROA 3VVWA 1FN4A 5C0BD 2CA3A 1PFOA 2CHZA 1I1YB 2CALA 5HDLA 3QUZC 4F3FB 3QGVA 4XMLH 2ADGB 3PHAA 1F6AB 3LS4H 3W0WE 3CHSA 4BWWA 3V7MA 1MRFH 3D51A 3DGDA 2ZCHH 5C07E 1U8OA 1MCKA 1VCBC 4OLUL 1M57B 5IF0B 3H7BA 2OMXA 1OF2A 4LRNL 1S8DA 5DYFA 4OQ1A 1JE6A 2DWSA 1J1XH 3MLVH 4ZOAA 5ADPH 1U3HA 4H88L 4JFQB 1K8DB 1ZMYA 2WKLA 3ARTA 3LDBC 1OB1B 2FBJL 2VMCA 1UYWH 2ITDA 4NKOA 4HGMA 1UWGH 5FW8A 1L0PA 2C3VA 4KU1A 5AYQA 3TNNB 3NJHA 4JKPL 4D7PA 1OP9A 3EJJX 4JRYB 5L7XH 4HUVB 1PNDA 1SDDA 3GINA 4P57B 1EJOH 3A6BH 4QF1A 1JPTL 4QOKA 3QDMD 1JNLL 4R7VA 3DTUB 3P54A 5I8KL 4BE5A 1XXFC 5FHAH 3MV7A 1LK2B 1A4BA 2VQ1B 4P49A 1N4XL 1SF3A 1BZ8A 4IJTA 5FYJD 1MCWM 3LVEA 2FWOA 1NCBL 3DIDA 4YDLB 4MZ3A 3EH5B 5IVZB 2PKDA 4I4WB 2X0UA 5DZOA 3C08L 1I8LC 3U9PL 1EBPA 3L7FA 4RGND 4N4YB 2WZ0A 1U8QA 2B08A 2AV7A 5DFAA 4OKVA 4RBPH 5E08L 3WIFB 5F2FA 2NXYD 1LO3H 4M5ZL 5DHYB 4BFEA 4KUZL 3N1QC 2QQLH 2GI7A 1QSVA 3NCYS 1NCWL 1X5GA 4PY8I 4NO3A 3BZ5A 3UYPB 1ETZA 1I1AD 4JHVA 1CLZL 4P3CL 3DSNB 1UATA 1AH1A 3MCLH 5AKSA 3JTSA 5FK9B 4MD4A 3HW7A 3QDGB 5K9OB 3QCTH 1KN4L 1ZOXA 2ZCKL 1XX9C 5GISH 2C1OB 2R83A 4NCC2 3MBXH 1EMTH 1F11A 4ZQTA 4UINH 2BFVL 3LAFA 1QBLL 4Z7VB 3UO1L 4LCCC 5DEGB 1JD9A 2J55A 3RVUD 5BS0A 2P42B 4UIKH 4Y4HD 1X9RA 2VR9A 3UYRL 3O2VL 5HHVH 1IGYB 5DQJA 5DHDA 4MDJB 2JKRM 4K3EH 2W9LA 5I66A 2ZPKH 5SWZD 1CD1B 2X3BA 2XC8A 5KEZA 3ZKMD 4U1LB 4Q52A 2NDGA 1BM7A 2A6IA 2R1YB 4IRJB 3ZL2A 4NQQA 1NKRA 2DKUA 4B5ZA 1J18A 2NYKA 4PB9L 4FD0A 1PVHA 3LS5L 5ESAB 1YY9C 1ONQA 3JWDH 4RMSA 1FYTA 1UD5A 5ADPL 4FEIA 2RA1A 2PWFA 2Y7SA 3MA7A 4X6DB 4X6CE 3VSTA 4NQCA 1BP3B 4KXAA 2APWA 4W4OA 2DDQH 1DVUA 4XCEA 5BZDA 2GK0A 3N41F 2H1LM 4X4XA 4ZW8A 4WF7A 1DVFC 2O6CA 1PX8A 1ZKAA 4P2CG 1ZHNA 2XV6B 3TZVB 1R1CA 2LW3A 4P2OB 1U2HA 2IV8A 3UG5A 4DF9A 5K9QG 1SJHB 2YOAA 3DX1A 5I6KA 1QFUL 3D34A 1X9QA 4TLUA 4QEGA 5FHAL 5C0EB 3IFNH 5EN3A 2XWTA 4FQXB 5CJQH 1Y0LB 2W80C 3DX4A 2ZKHL 4Y1AD 2OCJA 2R0KL 4ZD3L 3WGUB 3NIFF 3WNKA 2FVNA 3L3JB 1GMEA 3K6SB 1A7QH 1K2DB 1MJ8H 1KBBA 3I3BA 4MCNA 1H0DB 4WCYH 5C3TA 4ALAC 5IGXL 1GSMA 4LQFL 4TF4A 3C75A 3B7UX 4FKHA 4U49A 4ZRGA 1GKEA 3RWHB 1QRKA 3BT2H 4KC3B 3D6GA 2VXSL 3BD3A 3X13A 3DTXA 4JO4H 1KBGL 1T83C 2V7HA 4I5BA 3E0GA 4JFOB 1QR1B 3AG1B 5IJBC 1HHJB 5L2KD 2FT7A 3FQNA 1MFCH 1M53A 3QORB 4P07A 2JK5A 1VSCA 2XICA 4E0RA 2JLPA 5D96B 2HRLA 4XOAA 2BW4A 2VITA 3VRLE 4D0BB 3Q2CA 3KL5A 1ULVA 4Q7DA 2WBJD 2LU4A 3MV8B 4OFYA 5DA4A 4YSAA 3OKOB 1OSYA 1T21A 4QD2E 2MOQA 3GMPB 4R0LB 1MFAL 5A6IA 5IHWA 2I26N 1M6OB 4F8TA 4ZFFA 3DX6B 2CK0H 2UZXB 3MRFA 4G5ZL 5KANI 2UVFA 4B7LA 1FO0L 1I9RL 3H42H 3H3KA 3QVAA 4YX2L 3VYNA 1JBJA 1YNKH 4JKWA 3QNXB 5CWSB 3REVA 1GC1C 2EE6A 4DO6A 1LWHA 4UINL 4BDVB 3VFWA 3VFNB 1F90H 4MDIA 4NLHA 5KG9A 2Y1YA 3E8UH 4JDVB 4QXUL 5E9NA 1JK9A 4KWUA 2O5XH 4KKNA 2HKHH 3WMSA 3LNGA 1TOXA 3IT8D 4KZEH 1CYGA 4HUWB 3LOWA 4HHAA 4B9IA 5MEOB 4B95C 3EO1B 1KIUA 1BVLB 1TCMA 1XH0A 1ZVYA 2ZPKL 3DVFA 4Z78A 4ECNA 3B5GA 3IU3B 5BRZA 4LCYA 3FQTA 2WHVA 3QWOA 2Q2EB 5AAPA 3NCYP 4K2UH 1IM3D 1WV7T 3S3SA 1MHEB 4JR9L 2H6UA 2EE2A 4WUKL 1Z5YD 4BBWA 4AEHL 3B43A 5F7MC 3GBMH 1T04A 4A6YA 1HKFA 2OMZB 4S11A 4K9EC 4O58H 4Y4FA 5ABAA 3QXVA 1TZGH 2H6OA 4OY9A 5CBEA 5GS1C 3SKMB 5HHQB 3H7LA 2BNRD 5JXEC 2AQSA 3KBPA 3G5XB 4X2UA 2J2ZB 4Z7QE 3W0WA 3GZQA 3E2HC 4MD0B 2JB6B 5A7EA 3V4VA 4IQHA 2VN6A 5GS2D 5C07A 1UOWA 3KPNB 3OZKA 4UT6L 2LR4A 1I85A 3QZLA 5CJQL 3IU4H 4E9XA 3GSXB 4XN9A 5EOCH 3Q3GB 2XZCL 1I1RA 3QHZL 4DZ8B 4JRWA 2IEPA 3KWVA 5D1XD 4BKLA 1A7QL 4HK3N 4XNMB 4Z0BH 4MVBD 2CD0A 3FU8A 4CSZA 3OMZA 2YEQA 3PP3H 4RSVA 4KPHH 1KV3A 2YEVB 3X3FH 3UCRA 3E3QC 4MNQE 3JWOH 5E8OA 5LBSH 3DLQR 3TIEA 1K3ZA 1M1XA 1TYEB 4GAYA 2CPCA 1MFCL 1W72B 2WWOA 4FC3E 5KVFL 4YHLH 1TUPA 5IV2B 2FTAA 1TCRB 3PWUB 2GT9A 2AHIA 1KACB 2H0PA 2BSED 3EIFA 2E7CA 5E2VH 4DK5A 2XWBB 1P9MC 2I85A 3NK3A 2HZHA 4FXKB 2L04A 4UQEA 2VH5H 5KZCD 3NOIA 5L6YH 1T1ZB 3VRLF 5ALBH 3C87A 4NZTL 3RVVC 1S7XA 1U3HD 3FL7A 4XB8A 4KVPA 3H42L 4LSSH 4W70A 2GBAA 2UZYB 1CTNA 4NUJA 1XMWA 1CE6B 1TNMA 1LDSA 3CZKA 2YSTA 2MCPH 4QO1A 1L7IL 3SY6A 3MYJA 4QOKD 3VTAA 4LLQB 5E56A 2WNKA 3MNWA 1SY6H 2GTZB 1Q94B 4N0CC 1X7TA 4KNUA 3APMA 1NMCC 3PPSA 4P23A 2HP4A 4PYGA 1HU8A 2AABL 3NT0A 5FXCH 3ARSA 4HUXB 4H20H 3MLTA 2KPNA 4E68A 1OTTC 2LTQC 4CW1B 1M42A 4FKEA 4Q8BA 4IMKA 1XR9B 2NXZD 3TXAA 2HUEA 3BN9D 5HDOA 1T7VA 2FZ3B 3FUEA 3UL4A 5IKCB 3VFVA 2AVFA 3HPLA 1A21A 3PDOB 1OHZA 4N8VG 3ZPDA 1SOQA 5EEXA 3ATEA 2HYMA 2Y36L 4CKQA 1CB4A 1ID2A 1CFBA 1DFXA 4FRWA 3DXAA 2EVJA 1U8LB 1KB9J 5AZUA 4ZMQA 5HI4D 1TPXB 4OM0L 5C6TH 5I75C 4M02A 1V3JA 3ZIMA 2E4TA 2X9YA 3FOMB 2QSQA 3X1BA 1KCWA 1VERA 5C0AA 1A5FH 2NZ9C 3LRSB 3APCA 1J88A 2X1PA 2Q0ZX 2AANA 4Z7QF 1JK8B 5HJBA 2AJYL 1B4JH 3N3EA 4RRPA 5EOCL 2O6FA 3S2CA 1GTNA 2Z1KA 4PJIB 1M7DA 1SDYA 5DJ8A 3CSGA 1ZS8A 3O4OB 1RVFH 2DYSB 1M7XA 3UBXB 3US1A 1HJCA 3QIUA 4FZEH 4Z0BL 1R17A 4OJCA 4YNYB 1LEGB 2L7UA 4CILA 1LO2H 1OOAA 3KWWB 4DP0X 5C8JB 3EJUA 2XWCA 5T1MB 4MA3A 5AOKA 3JWOL 3L4XA 3HHSB 1VRSA 5LBSL 1R75A 3UTZB 3FC8A 4OCRL 4EAEA 3MAWA 5INDA 3LQZB 4JANA 4KROB 2HG5B 4AYBA 5FA4A 3IKKA 4KKRA 3SYAA 5FO9B 1E5CA 2D31A 2VDRH 1MCPL 2VJXA 3QUZB 5CKGA 5J5EA 5B7MA 3GRWH 2XQBH 5DK2A 3PGDA 1KCSL 4KDTC 4K5NA 1RMFH 2AJ3A 5IBTL 3G5ZB 3ZKXC 2VH5L 1V55B 2K9FB 3OF6A 1VACB 5KAQG 5L6YL 4MJID 2GSGB 4R4FH 1A3LL 3EOTL 3J7HA 5IMMA 1RULL 3FT2B 4PLJC 4RH4A 4Z7UE 2F1EA 3HZ3A 4R4BB 4ZUVA 4NQCD 4RX4A 1U0QA 2VLKB 4H7VA 2AQ1A 1W0VA 5MEPA 2B1AH 1DANT 2GVYA 3DOHA 3R0MA 2VM4A 4JAMA 2MMXA 1GAFL 4NNXB 4YHMH 5FO8B 4TM9A 4PJBE 3D87B 5JDSA 4V11A 3H9SB 3NCBB 1JHLH 4YSTA 1MCLA 4AIXA 1JV2B 1TIUA 1D7CA 2Z35A 5FGCB 4PREA 4DKDC 3ZR6A 2VM9A 3MLSH 4PJEB 1IZKA 4TQHA 3EOBB 3KL0A 3GIVA 2CLRA 3FQRB 4JGNA 1NM9A 4LLYB 5FB8B 1AHWA 4YPGB 1LJMA 3ELQA 4P0DA 1MY7A 2AKRB 1I7UB 2AJZB 5D71H 3VA6A 1QASA 1N18A 3ZMRA 5JHLH 5IQNA 5HHXH 2W0FA 2PPFA 3MRLB 3DJZA 3QC6X 5JDJA 1OAYL 1FFTB 5C6TL 4L1HA 1UQSB 2Y9RT 5DS8B 3UDWC 4JGUA 4LEBA 4NM4H 4ODVL 5IW6A 4AV0A 3CCHA 4HS8L 5AAWC 1EZVY 4LEOA 1RQ5A 5HYEA 4LESA 4QYOA 1ZVSB 3VXOB 4KJWC 4G2AA 2LAAA 1EFQA 4LCUA 1D5BB 1ZTXH 3QIBC 4LOFA 4JQVA 5D1QC 3BSZA 4LEXH 4GMTL 5GS3A 3NH7H 4JDTH 4JFYB 3PJLA 4FZEL 1GOFA 4X7SL 1GGUA 1UVQB 3SCMA 1KG0B 1QBMH 2P5PA 5AW7B 3O3DB 3SO3B 2D0HA 5C92A 1YHPA 3BP6A 3PUCA 1JN6B 1CI3M 2CCLA 2CCVA 5DRZB 3SE8L 4PJHB 2PO6C 3RL2B 3D06A 3GSRA 3O6KH 4APXA 3O41A 4OBSA 3V2AR 1BA9A 2DIEA 1VZHA 1D7FA 5DTFB 2F5BL 3NUKA 3IGAB 1F4AA 3QNYA 5LNEA 5F88B 4N90E 3WD5L 5F3BB 5BRZD 1SN2A 3HEIB 3GRWL 2XQBL 2IQ9L 1U9KA 3SOTA 1JZGA 3JVGA 3VUAA 3MLYH 1H3TA 5LWYL 4M7LH 2A73B 3QYNA 3WFBL 5FFGA 2QDVA 4QRRE 3SDCC 2FWSA 2IPTL 1S7VA 4YDJB 4LLVB 4Y4FD 1RK1B 1AD0A 5HPMA 4D8PA 1OGTA 4QRTA 1MVUB 2HWZH 4J4PD 1VCAA 1TTGA 4MNQA 2AK4E 4TQEH 4FTVB 4NAJA 3S98A 1IVTA 2VDMB 1WRFA 4M43L 4U1NA 4XP1H 2UY6A 3ARFA 2HX7A 4Z7UF 5EF2A 2P8MB 1Y1UA 4FLQA 1DVFB 4I0PD 1F58L 4OZ4A 1E9QA 4MCZB 2WVUA 2LABA 3W0WD 2GCYB 4M1CD 1UB6B 3CJJA 4IOIB 5A16A 2FH6A 4JX0A 2QFPA 4FQ1L 2EDWA 5B3JE 1JHLL 2JKIS 5I1AA 4ELME 4G8EB 2IV9A 2I9TB 3ARBD 1JERA 5KW9H 3A5VA 3MLSL 3ASNB 4JREC 3QI9A 5I1DB 2JIXD 3NRQA 3OKMB 2XG5A 1FORH 3RL1B 4JM2C 1YUKB 1QSEB 4CL7A 4NPJA 3TT3L 3Q8EA 2AF2A 3RGVD 3X14B 3HB3C 2WQRA 5MI0B 2SEBB 4HSAC 2WYIA 2H2PD 3P0YL 2AJSH 2ZOUA 4JJOA 5CINL 3SE3A 2FGWL 3QH3A 5CUSH 4D3CL 3RI5K 4JO1H 2OCCB 2B59A 1GGCH 3VFTA 5I6NA 2HTKD 4OCSH 5DEFB 7TAAA 1CXHA 4LPXA 2HVKA 5H35A 4HWBA 2ZKWA 1ZTXL 4XODA 2LGNA 1S7UA 4U6HA 5JMOC 2APXA 2AQPA 4KKCD 4RBPK 2BSBA 2FJFA 3MOBL 3NIDE 1FFPA 4U3HA 2EICA 1NGYA 3L5WB 3RWGA 3WLWD 3FS9A 3FPYA 3QUMA 4DK6A 2D0FA 3C8DA 2L7QA 4Y9BA 1JZ3A 1DQJB 4W9HC 1E43A 1SRDA 4HJJL 2Y25A 4JFDE 2GIXA 1SHMA 2WGNB 5I66B 2ZXBA 1MRDH 3FQWB 5IB1A 5KJ4A 3O6KL 3NESA 2OZ4H 3G5YA 2VAAB 2F8XC 5CD3A 5TGBA 2V7NA 3QA3A 2B14A 3BEVA 4P23D 3BXNA 1HDMB 2Z9TA 2OPCA 2FNBA 4YO0B 4JG5A 1IT9L 3LN9A 3VXRB 4XPAL 4QRSA 5CZVH 3V52L 4HPYL 4KK8D 4X7DC 3L95B 4BFRA 5FF6A 3HI5L 3NSYA 2Q20A 2DEXX 5AENA 2A6JA 3C6SB 4JHWH 5E5MB 4POYA 3EHBD 2KKQA 5DRWB 4LLAA 1FZKA 2IANB 1IV8A 4NO0A 2CUMA 4X6BA 5D2NE 5TH2B 2WP3O 3CWGA 2VL4A 3GMNB 3S3CB 1ZGLB 2AEQL 5HVWA 1NWOA 5E9DE 5IMLB 4MSWA 3IDGA 1DBJL 3HR5A 3DXAD 1YY8B 1URLA 2GC7C 5EU7E 5SWSD 1G87A 1BBJA 1ETJA 4BK8A 4O02H 1SJVA 3AT8A 3MJ8B 4AIZA 4FXGC 4CA4A 1FQ9C 2RH0A 4F9LC 4RMBA 5C0AD 4B53A 4HCFA 3IF1B 3TYGH 3X1EA 1NEPA 1LO5B 1BX2A 1EJ8A 3N9GH 5EIQA 3BAIA 1CFQB 2XZZA 1BQHG 2F19L 2H32B 35C8L 3E2HB 2OBGA 3ELAT 1Z3GL 3BUBA 1TEFA 4QLRA 4H5SA 1Z0NA 4GSDL 1DO5A 1U8CB 5D4IA 2DQGL 4KKLD 5F7FA 5GIRB 4MHHG 5FEBA 3F7LA 5FDWB 4XNYL 9CGTA 3QIUD 4Z7UA 4GG8B 5B3JF 4N1EA 5FECB 1DVXA 4F7PB 1U2CA 3JV4A 2QV4A 4ELMF 1NLDH 1RZKL 1YEKH 4NKDB 3U2IA 4YS4A 5DSCA 2ENQA 3T0XA 2FO8A 3K6DA 1Z9NA 1BYNA 2BZ7A 4KI5E 1E50A 3QE5A 4N5UA 3P9LB 5A40E 2OYMA 4GRLC 1MCOL 5A2LH 1TVBB 4QRAA 1A3QA 1SLWA 2P7TA 4ZDHB 1YYMH 2O6PA 1IL1A 4BRVA 2WXLA 3W37A 4JO1L 3PL6C 3ABMB 4L4TB 1GGCL 4UQ2B 4OCSL 4B27A 3W3BA 1BIIB 2JCCB 3HG1E 4GSUA 4KRPD 3PNWA 3OF6D 3CHPA 1IRAY 1KIRA 2WZAA 3WFHA 4L5FH 1QLRA 3FU6A 5TDOB 1V7MH 4FF9A 2W95A 5GGSA 5AOMA 3UGUA 1XGZA 3QRFM 2QQKH 4GRWH 3B9KC 3RIAF 4MMXC 4GO8A 4B50A 3D7PA 3GXDA 5JHDE 3RDTA 2YWZA 2FL5A 3H2WA 5BV7L 2YD3A 3NIDF 5J6HA 4NRXB 2DYRB 4YMPA 2IOMA 5T3XE 2COQA 2VC2H 1HEZA 4L1LA 5AB9A 2I69A 5HGAA 4Z76A 5JOFA 4QCIA 1PZBA 3QEQB 3VGFA 3O0RL 1J9QA 3HCVB 1TJHH 1C7TA 1TT6A 1WFNA 1DUYA 4CN6A 2H2SD 4AQ8A 2DKSA 4XC3H 3U1QA 4GIPD 3GI8H 2LT9A 1P7KB 2LTQB 3J07A 4M8UA 1MCIA 1KXTA 4NN6C 3U7YH 3KM2A 3V8OA 1PDKA 4JFPB 2DBLL 4K7PX 2CK2A 5EN2B 3R4RA 1CFVH 3VFRB 1CZ8H 5KN5A 3SIKA 3BP7A 3DI3B 4UT9A 3X2QB 1DL7H 2UZIL 5CLYA 3L3DA 2X4QA 4MDRA 4CSSA 1MH5A 1ECYA 4TTDD 4XRCA 5I75B 5EZJB 3SDDA 4RNRB 3TYGL 1FZOA 4DPRA 3CV5A 1KELH 3EYSL 5BXFA 1AGFA 3KVPA 2H5UA 1GH7A 3U0PB 2AC0A 2VW7A 4DPCX 1Q0YH 5E5LA 4G42B 3TEXA 3VH8A 5CLWA 2ZOTA 3HLAA 1KOAA 4QRRA 3A23A 4M56A 4BA8A 4FQXD 5K39B 3QQDB 2YXWA 2AK4A 4UWQB 4XHJD 2WIIA 4ANUA 4PLNC 2ZUSA 3ABGA 1AE6L 1PZUB 4WHDA 3BQUC 3BAJA 5F8RC 5J56B 1YMME 3NFNB 3QIWD 3RURA 4KI5F 1JGLH 2MQCA 2VN7A 3IAQA 4OD1L 5ACZA 3M8OH 3NEOA 4YR6A 4HJEA 4PM1A 5K59E 1VAHA 2P5WE 4ELMA 1NGPH 4PW3A 4F33A 5DUBB 1J11A 5DJYA 1YN6A 1AYOA 3PP3K 2NZIA 3FAWA 3VNZA 2QPUA 5EC1A 1DE4B 1JCVA 1NBVH 1JZFA 1BMGA 1OPGL 1RIHH 3CQPA 4KDVA 2TRYA 3MV8D 4L5FL 4MNGB 1V7ML 2OJZH 3RKDC 3QQ4A 4B96A 1N0XH 5CEZL 1EDYA 5FOJA 3ARFD 3MREA 1UA7A 2YD9A 1W16A 2E4FA 5CCHE 3VD5A 3CK0H 4Z95H 2CLZA 3RFRA 3MJ9H 2C9VA 2G3NA 3M7OA 2Z91A 4G8FB 1F6LL 3S4SG 1FL6A 3HNVL 1X9LA 2AEOA 3WXWH 3CQFA 4BWUA 4ZNCD 2X2IA 3UTOA 3NRPA 5EU6B 5IIEB 1JYWA 5CAYB 3DGGB 1UUSA 4DHLA 1RZ7L 2IF7A 4M7ZC 5B38A 5JZ7D 5IMOA 2C9RA 2HKAA 3KS0J 4B0MB 2BPBA 3EH1A 2VSKB 4F1ZA 5HI5D 1E27A 1WBZB 3QJHB 1IAMA 5H4ZA 1E4XL 4KUCD 5AEAA 5C6WH 1GGBL 5C0JA 1I3GL 1JGEB 2OTWA 4NLAA 3AQDA 3T2OA 3ZUCA 4MAYC 1CFVL 5D9SB 3ULUC 1WFTA 4JFDA 1EWHA 4IIZA 4PJ9C 4XN1A 3DHUA 3DMMA 1D5ZA 4NP4L 4GXUN 1ADQL 1FO0B 2YAMA 2Z7ZA 3D09A 4PHXA 3TV3L 1UKTA 3US9A 4PEEA 5ENWB 4AL8C 2YK1L 4LGPB 1ZT4A 1T7YA 5DJXA 3KPQB 2Y5TB 4M5SA 4DTGH 4XPGH 3BZEA 4EJ1C 1A9EB 3QUXB 4JFZH 4JHUA 5D1QB 3GZKA 2VMEA 3MRPB 1OSZB 2NYYD 4IM8A 1AKPA 5D2NA 2VLMD 1A9BA 2XJLA 5E9DA 3KH4A 3TN0C 1Z9OA 1CLYL 5KVDE 4PWJA 1QQDA 5KUKA 4DVBA 5J7CC 4UAOC 3B6SA 3CFBB 4XTRD 1G94A 3R7QA 3VQ1C 2WZ6A 4DH2A 2W9EL 1RZIA 1DQIA 3BIKB 3WFCL 4E41B 5BCAA 3RVTD 2HRHA 2V3FA 1A8JH 1YJDH 3QWQB 5DVNA 1KGUA 4P4KB 1Q9KA 1BGXL 2IFGA 5K59F 2MEJB 4QRPE 4NO0D 5EIIA 5HGHA 3KYKL 1PZ5A 2D7PA 3CU1A 1VLXA 1NC2A 1E4HA 3GSOA 2XVLA 1MREL 1MLCA 3BGMA 4GPVA 4TPRH 5I18H 1XF3A 2VCOA 3CNKA 4XBPB 1JZ4A 1EEYB 3CK0L 5E6IB 3MJ9L 2MRYA 4PRNB 1RKRA 4FAAB 1LQBC 2WN3A 4MYPA 2YBRA 1H5BB 4PS4H 2WVTA 4B9JA 1CURA 2GUOB 4WW1B 1GYUA 4MS8C 5GGVL 2X4RA 2W60B 3BP4A 3HG1A 4DQOH 1HWHB 4HFUL 4Y5YC 5HVGB 1RUPH 1JTOA 4UZUA 1NCNA 4PY7B 1XDTT 2IXQB 5CP7A 3HS0A 3P4NA 2XQ0A 1PJWA 1CICA 1N26A 4FLOA 1A6AB 5D6DA 2BXZA 1NFDE 4ZS7L 1X5YA 4CADB 4JB9L 2HJLA 4YBQD 2Y2TA 4XMXA 4AX3A 1H3GA 1PNCA 1RUAL 5EUOE 1W8EA 1JGVH 1O9WA 3NK4A 3QXAA 3RG1C 3HB3B 3QQ3A 3RILA 3H9HB 1I8UA 5A2IH 2FT8A 3PG2A 3OKLA 1IAIM 1XF5B 1HHIB 3K1KC 1JPGA 1RPKA 1S7RA 1UZ6F 2R69A 5DURD 3UAJD 3ZE1B 4KZDL 1KUMA 2DWEB 4NNPH 2C5DC 2QQNL 3T08A 5DD3L 4EN3A 2N59A 2O61B 4NZ8A 4OIIH 1A3RH 4B9CA 1U95B 5D7LE 2BIHA 1ZLDA 1DP0A 3RDTD 3TO2B 4NUGL 4M62L 4YFEA 3C60C 2VL5A 3SGEH 1MF2H 3M07A 4G9FD 1ASPA 1GOGA 4K71C 4N8VB 1NCDH 3BW9B 3V0HA 5CEYA 3Q8BA 1E9OB 4HOXA 2KL6A 2D9CA 4WSGA 1AFVH 2PW2A 3RNKA 3ZYIA 4XX1G 2ISDA 2EINB 5I1CH 4XBGA 4CVXA 4OZGE 3AQYA 1GJUA 5KVEH 4XCNA 4PQXA 3IJEA 3A47A 3V4VH 4U3XA 3TNMA 4ZZKA 1LGVA 4JG0H 4F9PC 2QZQA 1G1CA 4U6TA 4YK4B 3S96B 3QR1A 5BRPA 5IVXB 3CSBA 3QUZD 5DD1H 5DDHB 3GHBH 1D7DA 2IFFL 2DWXA 1RIUH 5CO1A 3RJQB 4AE1A 3N91A 3JTBA 5DLML 5GSRB 4GQQA 1SMAA 2BC4A 3TBTB 4TPRL 3KBEA 1U8HB 1HNFA 3BGAA 4LL1A 1MCNA 1DN0B 1S7QA 4AV5A 1PG7W 1MZZA 4MS6A 1YMMA 4FI8A 4G6KL 4QHMB 5TFSL 4LK4A 3VXQA 3OR6A 1TFHA 3MXVL 4ORGA 2P5WA 3LKQB 3TC9A 1YEFH 5L88H 3O6MH 3A4DA 3OJDA 3L6FB 5MENE 1RUPL 2F53E 3OXRB 3O6FA 1A6ZB 3H9SD 2G75B 3NIGB 5DHVB 4B9YA 3T6ZA 1IQDB 5EU3B 1A6WL 5DUMH 2X70B 3DOSA 4ZX4A 1Q9WA 1J8RA 2EDKA 4AM0A 3U6RB 1QUNA 3K2MC 5IHZB 3FTSA 1I3RA 3KGTA 3QPKA 3ZQ9A 5LDSA 1E5AA 1ZIAA 1YEHH 4KXZI 3TYFA 4ANKA 5TQ0H 4ELKA 5JQHC 4UIMA 1CFTA 5EEWA 4ENZA 3PUUA 3I6GB 3CFTA 1JGVL 6PCYA 3VGGA 4GXUM 1XGTB 2LHAA 2X4OA 1WWAX 3NN8B 2VDNH 4PRBA 5EUOF 4QXTB 1JNHA 2B9BA 3T5WA 3TVMA 4MJJA 3F8UB 4HCRH 2OX5B 3DPBA 3SGJC 3DECA 1E8ZA 4YSOA 2ADYA 2A74C 4R9HA 4HKZB 4S0SD 1KB5H 4X6EA 2WCPA 5I0DA 5DR5L 4C56E 1P4IL 5BJTB 1HNYA 2FO4B 3FTZA 1FNGB 4G1EA 1B3IA 2DWDB 1CD0A 5F9OH 3MGOB 3B9KB 3RWEB 1G7QA 3PDGA 4N24A 4P05A 3AM8C 2DPKA 3IKCA 1UKQA 1JNNH 1MFEL 4LHQB 1FRGL 4NNYA 4JPIA 3BKJH 4J3OG 4ZO8A 4Q9RH 1IM9B 5KVGH 1S5IH 2ENJA 1AFVL 3LZQA 2DH2A 3L8QA 4JFEB 5IQ9A 4OCYH 5I1CL 5L4IA 1PW3A 5KVEL 2WBWB 5K69A 2IJ0C 1VGEH 2J4WH 2YARA 3FCTB 1MAML 1CU4H 3TWYA 5L0QB 4LGRB 2I60L 4GW1B 2ICCA 1Y18B 2NY7H 3G08B 4OZGF 1IARB 1PSKL 1QRNE 2V2XB 3GHBL 3QJTB 4KV5E 4LBAA 3VD3A 4XMTA 1IQWH 1RIUL 1EAPA 1L7TL 3F6IA 1T4KA 2QVFB 1B90A 4FQCH 5DUPH 1NGWB 1YYLH 3KYOA 1JPSL 2N0MA 4X8JB 3STLB 3N44F 1NSNH 1TETH 1KJMA 3CGTA 1BEYH 2HH0L 1YY9D 4BSWB 3ZZQA 2X10A 1I8MB 4C83A 1X7QB 1IBDA 4AMXA 2O5NA 3LX9A 4N2BA 1RUKL 4LCVA 2Y7QB 1FHGA 1NCOA 2WC7A 4WW2F 1RV6X 2TRHA 4JHBA 4WHYH 5IFJB 1DVFD 4Y5XA 2DLFH 4ZMWA 3STBA 2HMIC 2W07A 4Y4KC 4QRPA 4R7LA 1IGML 4JM2F 3HMXH 2V5TA 1JMXA 1XH3B 1GR7A 1B6DA 2Y2YA 3NJGA 4PVLA 4PRHB 2P52A 4H2AA 3ZW3A 1J0HA 3NG5A 1I53A 3S35H 2ARWA 4AE0A 4F7KA 3BVNB 5A43C 2AXGA 2CUIA 2PTTB 1COBA 2Q10A 3VGEA 1VA9A 1F02I 3ZL1A 4TNFA 3SBPA 1E5YA 1IKNC 1WIOA 1WGVA 4A2MA 3ZK0A 4QWWD 4CVZB 3MRKB 2OMWB 5FWQA 3U25A 3K2UH 2R2HB 3QCUH 4XE5B 5EO0A 3VXMD 5L9DL 4P9HH 3HC4H 2BNUB 4LVOC 5FUCE 2VO5A 2FSEA 3RIFF 4MLSA 1PLCA 1PFCA 3AS2A 4JZOA 1EIBA 2PR4L 1KEMH 3RWDB 3SD2A 2CKNA 4M00A 4GW5A 4UB0L 1Y6NR 4JCLA 4BZ2H 2VN5A 3IDMB 1YC7A 1TQTA 4K7FA 5E6ZA 2NR6C 4TVPE 1WE5A 2GBVA 4N8UA 4WWKA 4ZQKB 4H0GA 3W2DL 1KTJA 3D69A 3UG4A 4KX8A 5T1LB 4YDKH 2J72A 2Y1VA 4PR5B 3TPUB 4IIQA 4DCQB 3QEHB 4XP5H 3MKKA 2FQGA 5EUOA 1BF2A 3LEVL 4W68A 1QYGL 5KVGL 5ISZB 1ED3A 3C9NB 1KYDA 3GNMH 3LZPA 4G7VL 4LSVL 3RWFB 3G04B 4Q6IA 3IJSA 4JFSA 4ZTEA 1P4BH 2B4CH 4B3VA 1XQ4A 4OI8A 5G5DB 1DZBA 3KLQA 3D39E 1EEZB 3QJQB 4NFDA 3PFUA 4YHKL 1G7IA 1OAZL 3L3OA 3FTVA 1TTUA 1HE7A 2PF6A 4UILL 5D7LA 4CGTA 4O9HL 3W39B 1OP4A 5DJ2B 1DZ0A 5DUPL 4EDWL 5HY9A 5C09B 1G7PA 1NSNL 3FT4B 4YLQT 4MAYB 1L0XA 4NRZB 1L6XA 2YPLE 1BEYL 3ZRFC 4QGTA 1UT9A 1NAML 3PAYA 5EDSA 2CIKA 1BQKA 2XVKA 2M8XA 1AP2B 4G43B 4OZGA 2DZEA 3IMSA 4V1DB 3F7YA 3IMRA 3T4YB 1TVDA 1R5IA 4CSTA 2YPVA 3KPOA 3RVUC 5IM7B 1KPUB 3T2NH 4EI5C 1O0VA 3GHEL 5FC9A 3T8XA 2XQYG 3LIZA 5JW4M 4S1RH 4G71B 2R8SH 4FERA 5J9PA 5KSUA 3UPRA 1W9XA 2VXVH 4FQJL 4ORZC 3PHOA 4FKKA 1IBHA 1AQDB 5BOJA 3C09B 4K3JL 1TSRA 5EPMA 1Y7VA 1EERB 3S35L 3P77A 4N5EC 5I9QC 4I88A 1TQSA 5CJXA 2VDLH 4HHGA 4WW2A 3TN0B 2JMRA 4WY7L 4JPKL 1EBAA 2BCKA 2MKWA 2X44D 4YLCA 4DGVH 1F4WL 1HQ4A 3WE6B 5EZOL 2EEFA 1P6WA 3NPSB 4OFQA 4MQ7A 4YQXL 1PS3A 4JM2A 3MRHA 2BP5M 1CGSH 3UZEC 2EO1A 4L1BA 1JPFA 1OSPL 1P6AB 2ZWLT 1J9CT 3APFA 1MFDH 1UWFA 5MENA 2F53A 4YIQA 1B88A 4KJYB 1BQHB 4HK0A 2XYBA 1LQSR 3H3PL 1KEML 3N85L 4DO4A 4YXLH 2GTQA 4O2CA 3ROOB 4HD5A 1TJXA 2E86A 4X9YA 4BFJA 5E1GA 4BZ2L 4JHAH 1P5VA 3E80A 2P80D 1RJCA 4U0QB 5JW3L 1YUHA 1G7HA 4IEFA 3SQOH 4AC4A 1RZQA 3D4YA 5GS0L 5IT2H 2CHWA 3A21A 3HS9A 5F71A 5IHUH 3WEOA 3HJEA 3PWLB 3RVVD 1ZGLP 3KR3L 3GIZH 3IJHB 3HNSL 4RMUA 2E8ZA 4XE0A 4JRYE 1FI8C 1YEGH 4Y16A 1S7SB 3DC0A 3GNML 4LL9A 4L2LA 5F9DC 3HI1A 2X4SB 1P4BL 3CDGB 4HBCL 5DZJA 1A0QL 1I82A 1IFHL 3O6FD 4NERA 3BLKA 3SEPA 1F56A 2OL3H 4N0CD 3SGDI 3T6XA 3LN5B 2AXFA 4BGDA 4BFNA 5DT1L 4J8RA 3BH9A 4WHTB 4YDVA 1C08B 2Q7YB 1N0LA 1LO0L 3BPOB 1IBYA 4F58H 3U4EA 2F7OA 3O2WL 3NTCH 1OTTD 4GEIA 4XZUB 1C5CH 3WIIH 4OLZH 5E4AA 3RLSA 2DQCH 5LUMA