3ILEA

Crystal structure of orf157-e86a of acidianus filamentous virus 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
VVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEARTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ileA00
3VB8A 3II3A 3ILEA 3II2A 3ILDA
chains in the Genus database with same CATH superfamily
5C0CB 4BKLA 2ZWNA 3KWTA 3GEFA 2LFEA 4IU2B 1GGCL 3PWJB 3KXFA 4UQ3B 1RK0B 1S3KL 4OUOA 5GRUL 2FE0A 3STLA 3IETA 4X6DA 4OFYA 1RURL 3U9PL 5DURB 4R97C 1OB1B 2W07A 1QRNE 1D7BA 1QHQA 1U8NB 1WCBA 2BIIA 4P3WA 1PZ2A 4Z3FA 1R5WB 1A3QA 2DWYA 3RIFF 2F53A 1D9KD 1WGVA 4OLEA 2BP3A 3JVGA 5A2BA 5ID0A 4GEIA 5A7EA 5K9KB 1IO4C 3GRWH 2R2CA 4NQDA 4S0TD 3EYSH 3WNKA 3G04B 5ECJE 2VWEC 4FKEA 1WTLA 4AMKH 2P7TA 5FEBA 2BVOA 5EEZA 2ZAIA 3CBKB 3D39E 4JQIA 4NNXA 1P4IH 3IT8D 4N1EA 4FYSA 3S8GB 2XC8A 3DIFA 3HS9A 1RULL 3V8CA 2I5YL 2AEPL 5BO1H 3BQUA 3C09B 3ZT7A 4GAAA 1C5DB 1AS6A 3NFNB 4R8WL 2W8CA 5G5DB 3ARPA 1QRNA 3ASNB 4GKSA 5D6CA 1FUNA 3WFHA 2OMXA 1IAIH 4FMVA 4IBTA 1ZLDA 3LEVL 2C1OB 2QHRL 3PGDB 4U6VH 4JGNA 4JK0D 2VJ8A 2ED8A 1JXKA 2IH3A 2VSKB 1RZPA 3HUJE 2CZNA 5B1JA 3AY2A 5GIRB 2IDSA 3D9AH 4GRWE 5DJ8B 3TV3L 1MCOL 5KANG 3FQWB 4R83A 1MRDL 1JFHA 3KBEA 4G1EB 1KYFA 5EBLA 1TIUA 2Z31B 1I7RA 2DLEA 2V2XA 2Z8RA 3K0WA 4KXZI 2UVFA 4RWYH 3RPKA 4LCVA 4ZTOH 2VDNB 5T5FL 3S3SA 5BRPA 4ORZC 1CL7H 5BNXD 5KSAA 3CZUB 4DAGH 1CZ8H 1X7QB 4I5BA 5ICXB 2ZXWB 3U2IA 4DP8X 4Y5XB 2J2ZA 4KX8A 5ERWA 3HNTL 4ZTEA 5LGHL 1FL3A 3H56A 2VW7A 2Y06L 4HD9A 4MB5A 1G4RA 1QTYT 2VL5B 3AZUA 3O2VH 1NGZA 4X4XA 4IOIB 4HKJB 4G8AC 4XVTL 3GEWB 1LMKA 3JTBA 3PQYD 4LCWD 4PJEA 1FFTB 5HJGA 1UA7A 5F3HB 3OSVA 5DJ0B 3MACL 3QW9A 4RFEA 4X5XA 2OA9A 2DJSA 3LQAC 3O3AB 1S7QA 4JJ5B 3ZKND 3ULAB 1HVXA 4DTGL 2EC9U 3RUGF 3Q48A 4OVVA 2NRDA 1CBJA 1HZKA 3LYRA 2V5MA 4NDMA 2PABA 4GW4A 2JKJA 1WT5A 1M6UA 5I1KL 2LLLA 4ZS6D 4U6TA 3ASWA 5F44A 5CWSA 3OKLA 2UZPA 3IJSB 2EDFA 4DOHB 1TXKA 1CD0A 1UM4L 5K93A 5INCB 1NIDA 3V0FA 3QQ3A 1CGWA 1EFQA 4NP9A 1LK3H 2H6UA 3CIAA 3I75A 4G42A 3FO0L 2DYPD 4I13B 1JPSL 4OW6A 5E8PA 3K5RA 4QOKA 5AW3B 2BFGA 4N2EA 4JY5H 4FNUA 2QQKL 4UBDD 5TD4A 2TAAA 1I9RH 4JY4A 2ZYHA 1ZGLP 4TL4A 2BERA 2XTLA 5C9JB 1QACA 3OC5A 3VXUB 5BMFH 1RVFL 3T3PE 3BJLA 3U2JA 5I1CH 3R19A 3CFJA 3TX4A 3T65B 2F1AA 1WEJH 1MLCB 4Y4HB 1JPSH 2O72A 3LIZH 4M8UA 5E5MA 4D0BB 3WEMA 1IAIL 4XCYA 5D1XE 1FO0L 3GO1L 4CDHA 3ZTDC 4BFFA 1SNRA 4FQXB 3IBEA 1ZTXH 4RRPA 4XCNA 4B60A 1I7UB 2UYLB 5IW6A 4N6QA 5FA4A 5DHVH 2ID5A 1LLAA 2VN6A 3FTGB 1JNHB 2R0WL 2Y5EA 4PJXE 4TV3A 4XMZA 3S3DB 3U9WA 5BRZB 1YNLH 1CB4A 1RIUL 3O4LB 4YDIL 4Y1SA 4Q0XH 1AR2A 3RPIB 3MBXH 4GKZA 2IXQA 4O2FA 4KRPC 4AM0A 2Y2TA 2JI2A 2PCYA 3S3JA 1R3KA 3ML9A 4QRTA 5ICZA 5IESH 2FJFA 4OR1A 3IJEA 1G43A 3BZ4A 4CKVX 4WK4B 3DNKA 5EO1A 2APFA 2IBZX 3A4DA 3D85A 3SQBA 3ZTJG 3MRBA 4FA8A 2G2RA 5DRZA 5FO9B 1U30A 4MJ5A 4MX7B 5LGHH 3RTQA 4HA1A 4HPYL 2VXTH 3UTPD 4ETQA 3RY5A 2FGWH 2WLLB 4NUGH 3RWEB 1A4JA 2C3VA 4NN5B 1GPOH 1XB3A 2WVTA 1T0OA 3EBIA 3NOIA 3OR7B 5I1CL 3BZEA 5AZEH 5BMFL 5ICYB 1ZVSA 2GBTA 5TTRA 1ZS2A 2AK4A 4JKLA 5K39B 5I5RA 4LDLB 5J6SA 1DVFA 2EKSB 1NIEA 1WVZA 4LOVA 4M29A 5D1XD 4G83A 4MJ5B 4MX7A 3UAAA 5A2FA 1NGQH 4DEPB 4P2RD 3IEAA 1G9NC 3K72B 4HJGB 3MPCA 5FF6B 2YGOA 4R96A 4Z3HA 1E6JH 4KRNA 2HX8A 1OO2A 2DY2A 3D3VD 3OKDB 2WMPA 3BAEH 5CSGA 5L7XL 4DQOH 3FN0H 4ZSOA 2I60H 5D2LE 2X2JA 2M8XA 5AKTA 3H6JA 2UXVA 4JVWA 2OK0H 1C5DA 1K4CA 1N67A 3MJ7A 3G6JA 1W6LA 2GABA 2ZTBA 5C07A 5C2BL 1ZHBA 1CICB 5EBGA 1FDLH 2VLJB 5ICUA 1ZT1A 3ROLA 4K3DL 4J3BA 4RMBA 1A3RH 3RI5F 1AGFB 1TNMA 1J0IA 5JDSA 1R19A 3GSRB 4XO9A 2IOIA 1CGSH 5KN5A 1KXTB 3QG6B 1P1ZA 3IBOA 2B9AA 3P77A 3CFJB 3HHRB 3CVHA 3ZUNC 2KPNA 2AXHA 4ZSOE 4OD3L 3FPYA 1ZVHA 5IHBA 4MASA 1F4XH 1I7RB 3J27A 5E2WL 3E38A 1EAOA 5HYQA 3QULA 1EZUA 4LCCB 5C0AD 1DUYA 2WBWB 3VXMD 4GG6E 5F2FA 4ZW6A 3MA7B 2VLLB 4YOKA 3CHPA 3TZVB 3VWJA 3A6CL 3QCUH 1C7TA 3HMWL 4OCXL 4XMVA 4H26B 2QFRA 4Y16A 5IK3B 4NQSA 4RMQA 4DKEH 3SIKA 3UAJD 3HA0A 4ZXBA 4XE5B 1BZDA 1AXTL 4TQIA 4RGOH 1M7DA 3QDGE 3UPRB 5DQDL 3SJVD 1URZA 1LO4L 2FT8A 2ADIA 2QMKA 3O2DL 4KK6C 3CZGA 2B5IB 3D6GA 3LNHA 2GTQA 4O58H 4XO4A 4G6MH 4OT1H 1KIQA 4Y16D 3A67H 4PWGA 4K94C 5L0QB 4M8QB 4L9LA 4LCUB 2COQA 3L5XL 2ZUTA 2VM3A 3HVDA 4BIKA 5FXCH 1OTSC 4YX2L 3NPSC 4HJUA 4NUJA 4C47A 4J3OG 5D7IE 5T1KB 2I9TA 2JXMA 3S35X 1OSPL 1IGYB 4FFTA 5E94B 3RWHA 4XBGA 1ZLSL 3VGHA 1E9OA 4LIQL 3PDOB 5JW4N 2BSED 3C6LB 2AJZA 4XPGL 4DN3H 1JV5A 5AKVA 3L1EA 4YHOH 4HG4K 2QLYA 5IHWA 5BZDB 5E2TH 4YPJA 5J6HB 5KOMC 2A1WH 1FNEA 4PWJA 1YAZA 3ZTJH 4BA8A 5AOZA 3VD9A 3CSFA 4LCWE 4KFZC 2GJ6D 3RL1B 2V9RA 2H6OA 2YIHA 4YDVA 4MS8C 4M00A 3P3RA 3JBG7 5C0IB 5C09E 1KIPA 1MRFL 2XWRA 3FHAA 4WWKD 1F8TL 5FW8A 2MOQA 1LO5B 1A3ZA 1EO5A 4OJFL 2YD2A 1NQBA 5CINH 2WXFA 2OMNA 3WTTA 5F89B 2E59A 1EHNA 3CVIH 4JFVA 4B5ZA 2BVQB 3QIUB 5CBAA 1NUDA 4G6AD 3BQUC 5BJTA 3PHQB 5EU7E 3ALWA 2PR9A 4X5WB 1MDAA 2VDPL 2Z31D 1S7XA 4FNLH 2V8LA 3X12B 3NMEA 5BS0A 2ESVD 2IO5A 3L54A 4DUXA 1UWEL 3V6OC 1ZHNA 4JFUA 1MZYA 4YDJA 3PWVA 2AW2A 2X4NA 2D4FA 3CFDA 1ORQA 1OP4A 4IJ3C 3K6SA 2ATKB 4OZIB 2J88H 3ESPA 1YEJH 3BZ5A 5JIMA 1JCVA 3WHXA 3W5MA 2AJUL 3L3DB 5HDLA 5E08H 3NN8A 3O3BB 2B9BA 5IVXE 4UOQA 1NC2D 1JXFA 4OY9A 1ZCRA 4PCYA 4J12A 1KT2B 4G7RB 4ODUB 3LNIA 3IFLL 5AKSA 5TE6L 2KUTA 1XFPA 5KYXB 4PRPD 4GB9A 4E9LA 3AS2A 4PRAB 1UUNA 3V6ZA 4V2BA 4WI8A 3RX9A 3VRLE 1J1OL 3N91A 3C5JB 4MA7H 3SPVA 3KPMA 3Q9QA 1G0XA 4MWFB 1ZEAL 4MJ6A 1U8QB 1AJ7L 4JFEA 1A4BA 1PG7W 2AABL 4HF5L 4TNVF 5IY5B 4ICWA 2W92A 4JDTL 4L4TB 3WE6A 3D39D 2QDWA 3KNBB 5L8KB 2VR8A 4G7VH 5T1MB 4E5XG 2JB5L 4S2SB 1JHTB 4OGXL 2VDLL 1V7ML 4DK3A 5FCUH 3G5VA 5AVRB 1I1AB 2C3XA 2V9TA 4GSXA 3ZHNA 1P4LA 4YS4A 4JZOB 4YBLC 2YAPA 1KC5L 2YD5A 2WQXA 5EFIB 3GJFA 2RR3A 3QDJD 4XMXA 3WMQA 2Z4TA 4LNVA 4OFVA 5G4MA 3V6FA 4PJ5B 1S9WA 3SGDI 4LASL 3SYCA 1DL7H 3CVCA 1YMMB 3BPNC 3CZFA 4TLTA 1ZPUA 4HJJL 2ENSA 5DJZA 3UTSD 1MI5E 1AHWB 1FCCA 2JKIS 3WIHA 5EC1A 4MAYA 2HJFA 3LB6C 1Z2KA 3TASA 1NGYB 4M1GL 1T0MA 1FN4A 3SKJH 1MCKA 3PWLA 2E47A 1BVLB 3WL9A 2CCVA 1RD6A 3CLFH 1QFWL 4BSVB 1D7DA 1LGVA 1A7NL 3X1BA 4N8VA 1N6QH 1E28B 5IJKC 5KYWA 4DT2A 4OCRL 5D4HA 4ZFQA 5CWSB 1OGAA 4HUMB 4EBQL 4UT6A 4LSTL 3THML 4KDTC 4NWTH 4ZRGA 2I9LA 3QXVA 5DFVD 4NUJB 1KXQA 4RGNE 4EUPG 5KSBB 1UZ6F 4P2OD 5A2KH 4JFXA 4FNTA 1SHWA 3P30H 3MUGA 3QG7H 4HIIB 3FQUB 4XBGB 1L0YA 2WSDA 1CFSA 1SVBA 2W81C 2ZKXA 1Y1UA 4MNGB 5I0WA 3DUSB 4JW3A 4AK2A 4M48H 4HBCL 1AQMA 5FCSH 4BQ8A 5CILH 5IUSA 2A6KA 3BT2L 2X6VA 2AXGB 2NY1C 1MOEA 2X2YA 1WZ1H 1H8OA 1JOIA 2O61B 3NK4A 4P2OA 4UTAH 4HJTA 5IFHH 4XPHH 3CFQA 5B4MC 2Q7NA 1A64A 2DJ4A 2J6EH 4Z0BL 4WEBL 4E5XB 3ULUF 3KL0A 5HYSB 3TC9A 2BVOB 3UBXG 3EO1B 1FHNA 5ID0B 4WW1B 2FLBT 2W65A 4LSQH 2DIAA 3AQZA 5AYQA 5C08D 1XBRA 3MNVB 1NCUA 2PP9A 4YSQA 5B39A 1QBLL 2FR4A 5DJDA 1UWGL 2QJDA 3IMBA 5D2LA 1KB9J 2WSPA 4P3CH 1AGDA 3SYAA 4HPYH 3ZO0A 4UQEA 4Q6KA 1B0GA 3MSPA 2XZQL 4ELMA 2Y1YA 1CDIA 2X0UA 4ZUTB 5HP5A 1WUNT 4MAUH 4BH7B 4MKMA 4PJXA 4FFWC 1FE8L 3CFCH 3L5WA 3KYOA 3RURA 1BJMA 3T4YA 5I15H 1H3UA 1JXJA 4XP4H 4C4KO 4CC1A 5BOPA 1NAMB 2H1LM 1RZIB 1UB6A 1RSFA 4ZW7A 3CPLB 5SV4A 4GG8A 1QSFB 3QIWC 4JO8A 1LK2A 4QT5A 2MMXA 2X6UA 3TPUA 3SDAB 2ILLA 2Y5TA 4Z7UB 5E6UB 4YDIH 2UZYB 2CKBA 1KIPB 1ADQH 4UV7L 4NENA 2X0WA 3L6FA 4L5FE 4OGAC 3CSTA 1T1YA 1ONQA 1RXLA 3JUZA 5C2UB 5SWQB 4K5OA 1QR1B 4OLYL 1D5IL 2B4CL 2Z7WA 1FC2D 1W0VB 1JDDA 1GZHC 4PWIA 2QQLL 4JFTA 2GKIA 3Q0HA 4MAYB 1W15A 4ANUA 1IKNA 1TMCB 2YD6A 4R96B 4HCRA 1DTUA 1X4ZA 2KKQA 4QOKE 7PCYA 1THAA 5F9OL 4HJGA 3UPAA 4TRPH 1E3FA 3LQMA 3B56A 5C0RL 4PJIB 3WMSA 3WIIL 3NIFF 5HI3C 2R4RL 1BAFH 1RPKA 2NY2B 5AVSB 3ZO9A 1BJ1H 3QORC 4ZTOL 3F83A 2XA8L 2YUZA 2VQ1A 2XWXA 5JXED 5MP6H 3CWGA 4NO5B 3HZ3A 2YR3A 2ALWA 2OV0A 1KWKA 4LVNB 2ESVB 4H8HA 2VXQL 3WEBA 2D7MA 5INDA 3L3IA 3PHSA 1ZV9A 4AVJA 4LMQE 3CC1A 5A3IC 2QQNH 5FM5O 3MJGX 4K5PA 1QI3A 2YQ2A 4PGCA 5IBUG 2PCPA 2D8KA 1JSYA 4HKXB 3S34H 4J7RA 4OQTH 1YQVH 4XP5L 4EVNA 3S9DB 3IDIB 4JFFA 4N2DA 3PHAA 4ZT1A 4JREB 1QFWI 2ICWI 5J89A 1A7QH 3L3KB 2CK0L 2KC0A 4YJZL 1ORSA 1P84K 4CL7A 1MW1A 4YDLC 1RY7B 4PJBF 2C4FU 3T4AB 5TH2A 4P05A 1NM4A 5T3XL 1S5HA 1HHGA 2CCWA 4RISL 1TETL 4UNIA 3L4YA 5BV7H 1I1YB 2BIOA 1ZLUK 1WE5A 1MHHA 5IQNA 4G9FE 4TTDC 2J4WH 3VNYA 1FZOA 2NCEA 3GSXB 3RA7L 5A7BA 1ZVYA 3OLGA 1ZXKA 3MKGA 3NZ8B 3OJVC 5EPMB 4APQC 3TH4T 1KLGB 1AKJD 2P8MA 2YPLD 5AB0A 2R2BA 3FUNA 2GJ6B 2Q6WA 1AANA 3RPBA 3R4RA 2PO6A 1EH9A 4YHLH 4X9HA 1MCOH 2A74C 3FZUD 5ISZE 1U8LA 1BMWA 1MFCL 1TZIA 5TF1L 4JUSA 1V3KA 4AYSA 3M7FB 3VU2A 2RHEA 4ATWA 5B39B 1BGXL 4HWBA 4UI2A 2CHZA 2R2BB 3SE8L 1DQJB 5DD6B 3RVXC 2E7MA 3TT1L 3VD1A 5D96C 4HULB 1D5BB 5C0AB 3VVVA 2EEDA 1WD8A 4Y4KC 4H44C 1TLMA 3EJYD 3V2AR 3WSQL 2JJWA 4NZFA 3S37X 4UQBA 4IBYA 1EHXA 2P48B 1G7JB 1A7RL 2F19H 5HJ3B 3WKYA 1OY3B 4GT7A 4P99A 1YEHH 2QPFA 4G5AA 5IFJB 3GBDA 3MRRA 2HVBA 4XX1E 1YUKB 4QXGL 1LO5A 3HFFA 4N22A 3GSNH 4DVBA 4JZJC 5BJTB 4WTZG 4IRZH 2WXMA 4QXVA 5DZLA 1X7SA 3VXTA 5E1HB 1K2DA 2ZCZA 1NSNL 3T8MA 2ZQKA 1TQUA 1T5XB 1H5BA 1EO8H 3KGRA 1PJ9A 1U41A 2BHZA 4NQEE 4PJXF 5IMKB 3QEUB 5TDOA 4ZAKD 3OZLA 1FF5A 2NUPB 1CICD 3SDXF 3V0AC 4EI5B 5E9NA 5IQ9B 2OJZH 2BMKA 5GGUB 5TQ2L 4FQIL 3MA9H 5TE4L 4N5EC 5JQ6H 4KK9D 2F0CA 1KPRA 5IHZB 4BQ9A 2WB1A 3VFOA 5CEYA 1E0OB 3QORA 1NFDF 4NFCA 1CLYH 3MREB 2OP4L 1QKZL 1KTCA 4P5TA 4L0PB 3GSVA 4FQXA 1FQ9C 3TBBA 1WA2X 1CLZH 3AITA 4ZFOA 3ARTA 4R90H 5MEOA 3G5XA 1OXYA 2I26N 4L29B 4OLXH 5T3ZD 1SMOA 3C9NB 3B3BA 2AJVL 3O2WH 1A14L 2F8OA 3IMVA 4XC3L 2L3BA 4BWUA 1FH5H 5D71H 4QJ4B 5J7CC 3GYRA 1S78D 2Y7QA 4H0GA 4FCHA 1XEDA 1OGSA 3PUCA 4HHAB 4XP6L 2BC4A 2GJZA 4XVSH 3WNIA 3MLWL 3OF6A 1GGIL 3TEZA 3VYOA 3MMEB 3POCA 5LNGA 4JQXC 3QZBA 1UQSA 4N3TA 2D0GA 4X2UA 1WA1X 2GIMA 4L8DA 1N3NA 2F53D 3IF1B 1KJ3H 5J1SC 2P5EA 1VADA 4EZLA 1RZFH 5BOJA 1KFGA 1J9TA 2CGYA 1IJ9A 4JHAL 3MGOA 2FSEA 1CTMA 3DGDA 2VLKE 4RFNB 4MSWA 2VRAA 1R3HA 4Q2ZA 4NN7C 2GAZB 3AT8A 4P07A 4DW2L 2WXQA 3MJ8A 1OCOB 1S7WA 4WAFA 5E8NB 3QFJE 2AANA 1P0SE 4PJBA 3NH7L 3SBWC 5DI8A 3MOBH 3LPWA 2PYFB 2Q8BL 4KDVA 4YN3A 5BS0E 3K6NA 1ID2A 4Z7WB 3NPZB 4E0RA 3TYGH 4IOIA 5J6GA 1JV2A 1NC4B 2ZKWA 4PBXA 4EQ2A 3WL9B 1JG9A 1MI5A 4GFXA 5AD0B 1F3RB 5EU6A 1S7VA 3ABLB 5DMJB 2F5BL 2GBVA 4HUKB 1S7SB 4JFSA 1U8KB 4GAYA 1BOYA 1N59A 5DA4A 1H6UA 4I4WB 1F2XK 4HJSA 1NGPL 1KF9B 3CFBA 2P5WE 2H26B 4HFWB 2VR3A 2DQHH 2E7HA 2JMRA 2EIBA 5E6IB 2DIBA 2DYPB 5AW2B 2Q10A 1JGLL 5DMYA 4EN3A 2XWTA 4JREC 3A6OA 1PQZB 1O0VA 2GJ6E 4R7NB 2X7LB 2DQ6A 1OWRM 4MDJA 4FKHA 4JPIA 3BUQA 1KYDA 3EYFA 4PJGF 3MRIB 2WWMC 2XQYK 2H3NA 5SWZE 1Q72L 2QVMA 1SOKA 3CDZB 1RUPL 3N1GC 4JN2A 4M3HA 5IJKA 1DVSA 3CSYB 5DQ9B 1G6RH 1T66D 3MRNA 3TEWA 2B4CH 2XN9B 4DVBB 2R56L 1UYWH 2E27H 1QLFA 1ZA6B 5F1NB 3UZEA 5B1BB 3I6LE 3GC3A 1K5NA 2B3RA 3T0DA 1X9QA 1S9YB 4B97A 2Y7NA 4LCYB 3TO4D 3SGJC 3PQYB 4QKTA 1T1XA 1HT6A 5CD5C 4JN2B 4XN9A 3FSOA 2AEOA 4NZ8A 5HDBF 3BP6B 2H0EA 2RBLA 4GMSH 2FBJL 4HC1L 4N26A 5CKGA 1DQML 2Q76B 3RUGB 2GEQA 2HCZX 2QPSA 1P7QB 1UT2A 3QUZD 3SY0B 5I15L 1NZRA 3FTXA 2P7TB 3T6QC 2E5EA 5FYKH 1MREH 1AKJB 1S9XA 4IBSA 4PREA 2BVUA 1T03L 2OMVA 2F7RA 2OMYB 1SMAA 3GRWA 1UB6B 4YBLB 1HILA 3REWA 5CN3A 2NCMA 3T4YB 4ZUUB 1DJIA 1ULVA 5HHQB 1KTLA 1I8MA 2AQ1A 3Q6GH 3T2PA 3F85A 3HRZC 5F6IC 3RWFA 4NWUL 1S7RA 4XXDB 1BLNB 1R0AL 3Q7JA 4CBZA 2D31B 4EN2A 3EUUA 3GRGA 5BRQA 4MD4B 4I9XA 3HRZA 3LKRA 3VXPA 4LLMB 1NFDA 1WJ3A 3U2SB 4XAKE 4LDEB 2CM5A 4FL4C 3AS0A 3TLRA 2NLJA 5GZNC 5F6IB 1KGCD 4OB5H 3WUWB 2IG2H 1OTUD 1AQ8A 3QQ9D 2A6DA 4UT9A 4TKWA 3NCXA 3ZE2E 3QWNA 4EJ1C 3CH1A 4BBWA 3N9GL 1GC1L 2GYSA 3OZKA 4HXAH 3ZDZF 1EMTL 1P7KB 3NH7H 3UZQA 5ISZD 3BP7A 1ACZA 1MHCB 1QPXA 3W81A 5L9DH 3FN3A 2GJPA 5TFSH 4QHPA 3DOSA 4XBEL 5ICXA 3QUYA 5GSRA 5C09A 4WRLA 3SOBH 2NXZD 3TN0D 1HIML 4FD0A 4Y2OA 2IMMA 2G0LA 3EOTL 2PTUA 2RQEA 5IHHA 2K3TA 2JIXA 1FL5A 4YZFF 1EZSA 4E36A 1U8OA 1S78C 3PFUA 5IBLD 5I26A 3UZQB 1ZT4A 2PTTA 1MWOA 1E9QA 2I7OA 4V1DE 2L7EA 2AQPA 3V5DB 4CDGC 4CU6A 3R0NA 1WBYA 3B34A 2D9QB 1D9KB 4OCWH 1OP5K 4ZQTA 2BO0A 3L3DA 4DGIL 3IMTA 1UA6H 2LLNA 3ME0B 3QGVA 2YD9A 4PJ7F 3WELA 1J87A 4GI6A 2YS4A 3WTVA 1AD9B 2NY1B 1JRHH 4JRXE 3KMDA 2HT3D 2FEEI 3QJHB 1C1EH 4GXVL 4HUUB 4ZS7H 3LQAH 2MEJB 5T5FA 5LDSA 1PD0A 4GQQA 3B6SA 1FRGH 1E4WL 5I6NA 5DQJA 5SWZB 2I9LB 4YPGA 5SX4H 1HYRC 2NMSA 1MCIA 4X0NA 5GGVY 3TO2A 4D7BA 1VEPA 3BPCB 1PZSA 3ZTNH 5LWYH 4AJWA 4TQEL 9PCYA 4M5YH 3NCFB 1EEYA 3WFBL 1PKQE 4M6MH 5CD3A 3NCYP 2DEYX 1S7UA 4JDZB 3EHBB 4ZYKB 4MQ7B 4AG4L 4PBWD 4ZFOL 1U8JB 15C8L 2XETA 2HKHH 1T1ZB 3QNZA 3T3ME 2DQJL 1KJ2H 5CSBA 4H25A 4X83A 4QRRE 5LG1A 2Y36H 3RUGA 5E00A 1AZVA 3CH8A 1Q0EA 3V55A 4JPVH 2Y3NA 3DV6B 3GDCA 5I30L 2RFXB 3G5ZA 3OPZH 1QSEB 5EFIA 2IH3B 3S4SA 2ZOLA 1MRFH 1IFGA 1KJMB 1M42A 4GRLC 1MWAA 4EE2A 4M5ZH 3KPSA 5D93C 4YC2C 2X0VA 1HKFA 2CHWA 2EIJB 4Z7UE 1F3DH 2CU9A 5IVXA 1LO0H 2V2WB 5FGBC 4ENED 4K07A 4ODVL 3FT4A 3DTDA 1N64H 1EZVY 5LCVA 4F27A 5C86A 2Y23A 2DQUL 3DETD 1C5CH 5HDQH 2WZPA 5SWZD 3VGEA 5I1IH 2WUCL 2OKMA 2V33A 1UD5A 3U9UB 1A22B 2H3XC 1VPOH 3CSBA 3BH9B 4APQD 4KY1H 4OLVH 4QT5B 2NY1D 2A6IA 3PPEA 4GLRI 1HC1A 4G59C 1PL3A 4ZFZB 3MRGB 1DQLL 1OGAB 4CC4C 3NTCL 2GUOB 4B9PA 5H4ZA 5EOTB 2VZOA 3DV4B 1O9WA 1NFKA 5KYWB 1COBA 3D09A 1BVZA 4OF0A 1MW3A 2M2DA 2RCSL 4WKZA 4PV8B 2BCKA 3GSWA 3MGAA 5FYJL 1AS7A 3D2UD 2C3VB 1GXEA 3BHBA 2F1EA 4B9KC 2JCCB 1Q94A 3PL6B 4PJDB 3UADA 5FYLL 4Y19B 5BCAA 1FCGA 1MXGA 1CLYL 2CJ3A 5LGKA 3KGTA 3BWAA 2GSGB 4I0PA 4AKPA 4CMMB 2PYEA 2Y7LA 4MNGA 3GGWA 4Y5VC 5KUMA 3WFCH 1G7QA 4HS3A 3P9LA 3PU7A 3QEHB 1FGVL 3E2HC 3UYOD 3R7RA 4E5XA 1SUHA 3CG8A 4TMPA 1CTNA 5E2UH 3F58H 2IGFL 1EO8L 2WIIB 4WHCA 3NAAL 4TVUA 3GKWL 1QQDA 3LXAA 3EOYG 4KZ0A 3KJ6L 5MEND 4U4IA 4XI5D 1HL9A 4GJTB 3SCMD 3L3OA 1JYVA 3C6LD 5GS2H 2ZUVA 1X5AA 2CLRA 3ISRA 3FT1A 1EO7A 2YJLA 4HK0B 5EO9A 2YD0A 4JFEE 5EBWA 2X42A 4AL8H 5EH1A 2NNXA 1D5MB 2Y7QB 3HHMA 4ETYA 3WU1A 3L3KA 4U1MA 4KI5C 3VFMA 4F8NA 5JORA 4LEOB 5HHOA 2ZOUA 1D5XA 4P4RB 4WU5A 4GAGH 3WEOA 5L7XH 2ZX9A 4KOCA 3RY4A 5GSVB 3CIQA 5HI3D 2IMNA 3C6LC 1U4EA 5TF1H 2H0FA 4K94H 4AYID 3ARGB 1L9TA 3HMWH 3QIWD 4XH2B 2PPDA 1WFJA 3DI2B 3HRPA 6TAAA 4YSSA 1QBBA 4XB3A 4EUPA 5C0JA 5FLVA 1KPUA 2XA8H 2X4QA 5CIPB 1OK0A 3P73B 4JO5A 4XOEA 2FHBA 4KVNH 5LNEA 4U0RB 1CT8B 1HI6B 2L04A 5D70H 4QAWA 3B2DC 4NUGL 3HE6B 1I9JH 4Y16B 2BSSB 5IK3A 5C8JA 4J8QA 4ONGH 2GBAA 5I19H 3QAZC 4R7VA 4JKPL 1F13A 4PJHB 5DLMH 2R8SL 4B9FA 3GLAA 1AIFB 2EDXA 2XX0A 5F7DA 1TETH 3SJVB 4ONFL 5BV7L 2P47B 3SO3C 2F74A 5CR8A 2Z1PA 1D3CA 2DQDH 1WSST 3ESVF 3HG4A 4X4ME 4XCFL 5HHME 1XIWB 3RWDA 3TZVC 4OCNC 3NA9L 2QQQA 3U4BH 5IGXH 2PLTA 1ROCA 4UV7H 4FAAB 3FYIB 2VSDA 3DHMA 3M46A 2VXUL 3D3VA 1E2VA 3MLVH 1QBMH 5EU6D 1RIUH 1DEEA 4QD2E 3JYCA 3GHBH 2EJ1A 3MYJA 3FTZA 3KLHC 3OC8A 1OCWL 4WWKB 5AB9A 3QUMB 2NY6B 2BP5M 3RWHB 4Y9CA 2WKOA 2F1BA 2PMZA 5T1JA 1EIBA 1XGUA 4HEPA 1N12A 2A9MH 5IVXF 2N0KA 2FZ3A 3ULUC 1FBIL 1ADWA 1YA5A 4GKLA 4M6OH 5EN2A 5D55A 4W9JC 4PRPE 3UROR 3PWUA 3EYFB 1O7DC 4OKVA 1IFRA 1N9PA 3ZHDA 5F89A 5F88A 1MF2H 2B1AL 4YO0B 5I2IA 4OLZH 5LXGL 1JPTH 4A7UA 2AVGA 4WNQB 5FDWB 3LV3B 3CGTA 1PY4A 3ILQD 1I3RB 3S36H 3BP6A 3HBZA 4MCYA 1IZJA 3Q6FA 3WTSA 2NY4D 2X4OA 3OBAA 5FDYA 2NY5L 3FB8A 3KYNA 4LOUD 3EO1A 2FEEL 3EJTA 2MCMA 4KJYB 1QLEH 2Z65C 2CA4A 4JEGB 4NZUL 2A9ML 2PKDA 43CAA 4HC1A 2VDMB 4ZFGL 5HDOA 2EH8L 4DESA 2BNRD 1SEQL 4YK4C 2DWTA 3HAEH 4CJ1A 4Z77B 1RIVL 2DYSB 2KH2B 4QWWC 1USZA 3L4WA 2MHAA 4JPWH 3ATAA 2R51A 4MAYC 5DUMH 1QBML 3HMXA 4F7TB 1MIEL 1ZLWH 4UMGA 2C1PA 3WUZA 4QNPE 3QO0A 4PLOB 2HVJA 1YEEH 2YAEA 3K46A 5DUML 4KJYA 1E4XL 4KMTH 4DEUA 3EJCA 2R29H 2C3HA 2HTLD 4U6HB 2Z31C 2ZXQA 3L16A 4PJ6A 3OLDA 2EH8H 5ADPH 2HKFL 2J55A 1QX1A 2DQDL 4ZFGH 3QO1B 5I6LA 1GYVA 1S9KC 2K6ZA 1IQDA 4JN1L 3FOMA 4KK5D 5G55A 1KDIA 2WK2A 5F9AC 4AM0B 4B27A 1XTLA 2NNFA 5C0FA 4L8DB 4RGNC 2H0PA 2IAMB 1AG6A 3SDDB 4E9YA 5LUMA 2B59A 2OYMA 1KENL 1V10A 1CZ8L 1G1OA 4Y9EA 4UAOC 3D87B 2JSFA 1KIUA 4W9KC 4LCCA 1IGJA 1KCLA 1B0RB 5D1QC 5I8EA 1M7IA 3MODH 3HG2A 2G2NA 2FECL 3CZSA 2Y0SA 3LSOA 4H8UA 5DD3H 4LSQL 3HR6A 3VJ6A 4WEUD 4FF9A 1J8SA 1Q9OA 1SHXA 2X38A 5KVDH 4UANA 2X1OA 4PRHA 3CZFB 1TVBB 2VZUA 4FQXC 3V4PH 1T7YA 1L7TL 2VLRD 1CU4L 5I8EB 4MQXD 1D6EA 1U8MA 1NBZB 1KTRL 1MZZA 3LN9A 4FQXD 4J3XA 2LU7A 3S8WA 3WE1A 3DIFB 4RA0C 4Q9CA 1IAKB 1HZLA 4DK5A 2P4AB 4J4PD 4DZBA 4YDMA 1KLFB 4WUUB 4TNGA 2PXYD 4OLWH 3PWPE 4ZOCA 3SKOA 1P6AB 4R8WH 4M3JA 4N1HB 5F7LB 3BZFB 4C58B 3FTVA 5ADPL 2RH0A 3UAJC 3MRKA 3ARDD 1XF4B 3V4VH 3CX5K 3U6XA 1ACCA 2HX9A 2FYYA 3SD2A 4DKFH 2WQAA 1BIIA 2YUXA 3GINA 5F1IA 3A0OA 1U9KA 4U2YA 5C0DB 3CN1A 3UBFA 1ZT1B 2DWSA 4R2GD 3SKOB 1QR4A 1FAKT 5T3ZL 4XCCH 5B22A 2HH0L 1JTOA 3WG7B 4ZAKC 2AI0H 2WUBH 2CO7B 4N85A 3X11A 3MYZA 4QGYA 3DXAA 1SVCP 1FVEB 4TTGA 1JZ3A 5J1AB 5ALCL 1I82A 4S1QH 1SXCA 3LZFL 2NY5H 2YAQA 5CZVL 4UMSA 2Y1AA 3EFOB 2WVSA 3FOLB 3MRQB 5LAPA 4HX1B 3UC2A 1PSKL 3RFZA 4HJ0D 1NPNA 5F8QC 4WWKC 3SE3A 1S2EA 2GK2A 2EXYC 4MVBC 5EF2A 3WIFA 4Y4FC 1ETJA 2J8HA 4UNVA 1R24A 1CYWA 4UOW0 4GUPA 2GITA 3BP5B 2H32H 1JPTL 2XY2A 1RZQA 4JE4B 2DH3A 4UQ2B 4CILA 4K55A 3MBED 3N42B 4Z5RB 2IXQB 4JVPA 3X1NA 1V7MH 2XU9A 2OQJA 2P9RA 3ESMA 1PZDA 3RFZB 1P4LB 4XPTH 2FWOA 4P4KC 5D7IB 4Z7WA 4E0RB 3PP3H 4LPTA 5IHLB 5I6MA 5DD1L 2Z0UA 2XFGB 3IRCA 4XMKL 4U1GC 3TBWB 3T09A 1I7UA 1FJ1B 2HFEB 1INDL 2XNAA 5HBBA 1IL1B 4GRLD 4YDVB 5D1QE 4B7IA 3RP1A 3BLKA 3QEQD 2DWEA 3BPOC 4YC2B 1TJGL 2RJMA 4YLCA 5D93B 1JERA 3DX6B 4UIMA 1RZ8B 2YK1H 3ULVE 3U0TA 1GTNA 3INOA 1HDMA 4JFOA 4YHZL 1WO2A 5AOKA 3RZCB 1SDAB 1CDHA 3H2QA 2VKWA 1QVOB 2EZ0C 3N85H 3QDGD 4GIPD 1ZXQA 4E41D 2JQMA 1BFSA 5DJXA 1FGVH 4X8JB 1KYUA 1ETB1 3UGXA 2G3NA 3GK8L 4G9DA 5B8CA 1R3JB 5DVOA 1J9RA 4NOBA 2P8LA 2DI9A 5E7BA 4YL4A 1LVEA 5GS3A 3ELAT 3SQOL 4A2EA 2Y7MA 1P2CB 1IQWH 3HZMA 3OLIA 3SEPA 1PZ5B 2XUWA 1LO4H 3PF2A 4PJFB 5C0AE 4ZSOB 1R5WA 2HN7B 1C5BH 2W9DH 3IJ8A 4IU3A 4KV5E 3UJIH 4F9LA 2DM3A 1C5BL 1B3IA 1YEFL 2ZXAA 3IPFA 4W9ZA 4WUKL 2EEAA 4K7FB 4OGYH 4QXTB 1Q9LA 1DO6A 1JWUA 3GIZL 2Q0ZX 5D1ZA 3SDAD 1PD1A 4BDVB 5IG7A 1DQDL 1AD9A 3QIUA 3BGFB 2ESVA 4EZMA 1Q1JL 3GBNH 1YNTF 5F9JB 1JNLH 2VLMD 2DIJA 4JANB 4APXA 5A3ID 2AXFB 4HEMA 3WGVB 4MMXC 1VPOL 5TGBA 1SBBA 2A1WL 4WTQA 2AZAA 5ACLA 5IHUL 5FUOH 2LU4A 1NUNB 4GKOA 4Q9QL 1BZ9A 1EA9C 4YAQA 4GQZA 3H4HA 4GQ9L 2G9HA 3TVMB 3FS9A 1W80A 3MRBB 3V0GA 3FDWA 1A3RL 4Q8BA 2VLJA 3ROLB 1S5IH 4RMUA 4UTAA 2ZWSA 5LO7A 2VABB 4XTRD 5HY9B 4M5ZL 1AGFA 4ZQKA 5C92A 2GQHA 4E9SA 5KYXA 3TESA 3Q8FA 4XO3A 1WS8A 5TQ0H 2D3JA 1KN2H 3BAIA 2YGVA 4QRPA 5DD5H 1QLEB 2J57A 1KGCE 2A6DB 3JWDC 5ACZA 2V2XB 3W82A 3ZDYB 1DBBL 4PG2A 2NX5B 4NAQA 4LL4A 1QLRB 2CLZB 3IDYB 2BSSA 5C8JB 2VC2L 1EMTH 5HSFA 5KSUB 3E6FB 1NOLA 1TCRA 3ARVA 4GBXC 3WNPA 3II1A 4GT0A 5F0JB 4NLAA 3RU8H 4WFGD 4X7DC 4C83B 4U1IA 3JTSB 4G8FB 3O6LH 4FYQA 5ANMA 4JJHA 4HSAC 1LD9A 4KK8D 3CQPA 5FKAB 3K7UA 3DSNA 1M4KA 2QKIA 2C26A 2ZX8A 3WJMA 1F1AA 3MRPA 1TCRB 2F58H 1GS7A 3LVTA 1X5XA 2BSDA 4H1LA 3QIBD 4KQ3H 5CZXD 2QADD 3KH3A 2OQJB 4Z76B 1R75A 4HIJA 4GRLB 4NPKA 4JFFE 1GKOA 4K7PH 1UXLA 4TSAL 3V4LA 2FZ3B 2EDDA 2ZXDA 2HRGA 2HLFD 1TZ8A 3GWJA 4PMFA 2P8PB 3EJZD 4OI9A 3QCTL 5DVNA 3P3YA 1ZT7A 5C71A 3UP6A 4M7LL 4N2GA 4JM0A 2XVGA 3H3PL 5TDPB 1RUAL 3MBXL 1KSRA 5EULV 4M61A 3ZE0B 2DWXA 1A47A 2D4DA 2HG0A 4WI9A 1N26A 1MQ8A 4A04A 5IB2A 1OB1A 2W07B 3ULUD 3VD2A 5E1IA 4A2GA 3OMNB 1UWXK 4HUWB 4ELKB 5DJ2B 4XNAA 4HCRH 4UOW1 4HIIA 3GSUA 3E6HB 3HC4L 3KLHD 2CUMA 3ILPA 2NW2A 3S48A 4WI4A 3BVDB 2W0LA 3NUKA 4HW6A 5DZOA 2OMTA 5E6IC 3BN3B 4UWQB 4D9LL 2VUYA 2NPLX 4DKAA 1EFXD 3PDDA 4HJIA 1QSEA 1TVHB 1ADQA 1GZQA 1U3ZA 1JGVL 1MQKL 2EIZB 3STZB 3QQ4A 3U0PA 1FZMA 2DLGA 3VGAC 2BFVL 4ZMZA 4I8DA 1E7VA 3VNZA 2DQHL 4HUXA 2V5TA 5ALBH 3K71B 1DZ0A 1E5YA 4HK0A 4JY5L 4B3VA 3RJDA 4CVZA 1CD8A 5D7LD 1QD0A 3FSWA 1NCWH 3L3IB 5DCCA 5AVVB 4O02A 1GJWA 1UVQB 2C9VA 5IVZB 4ANKA 5JNYB 2P5EE 3M8OL 5F97E 1FZKA 5B1JC 3QFJD 4B9IA 2EXTA 3K2UL 5F7UA 4PWFA 1RUKL 1D5MA 3RTQC 1U8HA 5DRZB 1JL8A 4ZO9A 1ZMYA 2G5BB 1P84J 2A3TA 1VCBC 1PEWA 2NUTB 3BAKA 5C3TA 3VFVA 2VH5H 1N18A 5LQBL 4FQ2L 4LK4A 3PABA 2ENJA 4BFKA 3U46A 2EEXA 4N8UA 2YO3A 3CDGA 4JPWL 2R0WH 1FYTD 4UM8B 4X7EC 5I5IA 5DYFA 5G5DA 1P9MC 1CBVH 3JWOL 3QJVB 3DPDA 2YSSA 1BQ5A 3HVNA 3JVFC 4L8SC 4KKCD 4WFED 4C57C 4Q56A 5FS5A 1WFUA 5E7FA 1ZKAA 4ZQKB 4W6XB 1BW8A 1VENA 1IC5H 3GO1H 3BHBB 3QUXD 5KSVA 5DRWB 1T1YB 5FO8B 2AXJA 2DLIA 2FNBA 3W9DB 1I7ZA 3RGHA 1CFVL 1IBBA 4WLCA 3HB3D 4NYLB 2FGZA 1F6LL 5DRNB 5HXMA 4G43A 1L7IH 1AOHA 4JO1H 3OKYA 5K9KA 5LXGH 4XN7A 1SDYA 2Y9RT 3WI9A 3SCMC 3PFQA 1PX8A 2OSWA 3O0RH 3VFPB 3EXLA 2XXMB 3D0LB 4ZW8A 1OAUH 5CEZD 1MI5B 3P02A 4LEXL 2B2XH 3UCRA 4K73A 2FT7A 4I18A 5HYJD 2R69A 1S7TA 4P23D 2UXFA 1T0PB 3KS0H 3EYOA 3NVQA 4EI5D 2WXRA 1KCKA 3WJMB 3K6DA 4NO5A 5B38G 2QELA 4V33A 3VFOB 3JV6B 2TRYA 4LRIC 5HVFB 3QIBA 5HHVH 4H88H 1PFCA 5E23A 2O5ZL 5D6CB 1CYGA 1QKZH 3RTQD 2DQGL 1JGDB 2UZXA 4E41E 2XFXB 1I8LA 4EI5C 3TIDB 6CGTA 5D9SB 1NIBA 4O5LL 2A6JB 3LD8B 5E4EB 1AKPA 1TZOA 3DGGB 4QRPB 1V3JA 5FK9B 1EJOL 4G7QB 4XBPA 4HVBA 2EYRB 3MA9L 4HIHB 4XP1H 3CVHH 1FORH 2J1ZA 4UDTB 3T04D 5DJCA 4Z7NB 3QZOA 1U8JA 4DZ8A 5E56A 2P5WA 5I71B 1SLWA 5C0CE 4RLDA 1YECH 1H0DA 1MWAL 2OTWA 5A16A 4YBQD 2R2HA 4PGDA 2KQNA 3IJ7A 2WQVA 1R5IB 43CAB 4DQAA 3ZYJA 4BA0A 4GLRH 4MHHI 1AS8A 4PS7A 4QHUB 1CXKA 1KJMA 5B3JF 3S4SB 1LWRA 4K3EL 4R4NC 1N8ZA 5D7EA 1BBDH 4TNWK 3VXSE 5CJ5A 1KV7A 4N5UA 1EHLH 4Q7DA 2MNUA 1PLCA 3PWLB 4LSUH 4PIRF 3UBXB 3O9WA 3BISA 4M8QA 3QXWA 4U49A 1VFMA 2QPUA 4R4FL 4C83A 2MPAH 1JGLH 4OZHF 1T2XA 1NANH 2B39A 5JZ7C 1AIFA 1X4YA 3SBPA 3L2LA 3JV4B 4PRID 4DO4A 1NJ9A 4W4NA 3F64A 5BZWB 1MPAH 1CE6B 1PG7X 5I6KA 5C0FB 3BVTA 4DGYH 3QZWA 2XWDA 1AR1B 5EU5B 3EH2A 3WJLC 3DURA 1YEDB 4WI3A 1O7SA 4M03A 4X5RA 5D2NB 3VG0H 4ZDHA 1HOCA 4NO0D 2P8LB 2J5LB 2AJXL 1AVAA 1R3LA 3T0XA 1DVXA 4UAHA 2NSMA 1QNZH 4GRMA 3L13A 4YNYB 3AXLB 4B9JA 1WF5A 4M56A 3DI3B 3OXRA 5FECB 4FQHB 1UUSA 4FQPA 3DPBB 2QVTA 2AS5M 2CR0A 4M1DL 5DO2D 2ALAA 4L1SA 4H0LC 4NO0A 5SX5H 2ITFA 1PYWB 3IRPX 4KFMA 2WXNA 2Z35B 1ZANH 5A2IH 5GSRB 2N59A 3H9SD 5F21B 1CS6A 4EUPH 5AALA 1RZFL 4K7FA 2XHNA 4Z9KB 5JZ7D 1F0LA 1CVSC 5EUOE 3QUYB 3C6SB 2DDQH 1PG7H 2VO5A 1FVCA 2FECI 4WNQA 1FFNB 2QR0A 5D6DA 3RIAF 3QUYC 1GOHA 1UXMA 4CRPA 3E1F1 2MCPL 3NIDB 3IPBA 3RKPA 4IRZA 5EIIG 3ZU8A 1INQA 5F70A 2YFOA 1AP2B 3ATDA 1NDGB 2Z4QB 1KOAA 2ZWLT 4HWBL 2NNRA 4UTBA 5JNYA 3QJQB 4JFPB 1UXWA 3CFMA 3F5WB 3PDGA 1JFQL 1RCYA 3B5TA 2DBLL 4HIXH 3NZSA 1SBSH 3EKCA 5FIEA 1FYTA 1GZHA 4XMPH 1CFMA 3QXAA 1FZJB 4MD0A 4Z7VB 1LJMA 3BWUF 4YHKL 3MHZA 5CHNB 4KVCH 4DF9A 3JUYA 1KZYA 1DQTA 2O6FA 3KLSA 1QFHA 4H5SB 2WBJA 4PSPA 4HWBH 4IKIA 3ATEA 2NXZC 3DK2A 3WNLA 1A1NB 1HILB 4HPHA 1M2VB 3Q1SL 4JRYA 3GSQA 1B3JA 1W0VA 2DI7A 3LQZB 5D5MB 3BCFA 1JK9A 2WLLA 3N1FC 1JWMB 2MQGA 3CMOL 4EDXB 2P80D 3MLUL 2A77H 3DVGB 2ZCHL 1OGTA 3MV7E 2EYRA 4P9HC 1JF5A 4Y4KB 3GUTB 1IEBB 1ZA6A 4WTZA 1T2JA 5DHYA 4OLYH 3RHWK 3UJTH 2ZONA 4GUQA 4JPVL 1K85A 1HI6A 3RE0A 3OXSB 4MMZB 4I3GA 3HE6A 1FSKB 3CXDL 4GW1A 3RPIA 3UZEC 4KXAA 2MTPA 1OCZB 4XVOA 1N59B 1NWPA 5E70A 3ZE1E 4PWEA 3INUL 2XCMC 4AG4H 5T1KA 3V0DA 2I9TB 4J6RH 1CDGA 1PLGL 4G1MA 3LEXB 5ILTH 1F90L 3QJOA 4PJCF 2FCBA 4PJEB 2YD7A 2DEWX 3W2DL 3T3MF 2K3HA 3LKPA 5IJVB 4MCNA 4ELME 1JN6B 1XSKA 3KPLA 1F6FB 1M7DB 4YHKH 2I07A 2CD0A 3O9WD 5HGBA 1SHMA 5CO1A 4GSUA 2CXGA 4XGZB 3ZJAA 3HN5A 1JF1A 5F7HA 2MJWA 2DTSA 3LRLA 5IB1A 3H1ZA 4AKOA 2XBDA 1CCZA 1O75A 4HZAA 1BECA 4UZSA 3VI3E 5CEZE 3O0RL 2NXYB 2DQCH 5IVNA 1XH1A 1BIIB 2CO2A 2VDRL 1J9CT 2H1PH 3TIEB 2EIMB 3TO4C 1FAIL 5F7WC 4LBEA 1E5ZA 2N01B 4P2OB 2AGJL 3IDUA 3Q2NA 1YO4A 4UCFA 4BSWA 2CAKA 3FJTA 2A6KB 3V5KA 3I75B 3CFTA 3LN4B 3V4UH 4A67A 1DDHA 1U2CA 1PZAA 3GMNB 4UBDC 1X5JA 5A2LH 3U4EA 4S1QL 1DEDA 2Q86B 5I17B 5KBMA 2QPDB 1TCMA 1ZHLB 4LSRL 1H9VA 3N0PB 5GISH 1JZ2A 2X9ZA 4NBXB 4FXKA 3PAUA 4PM1A 1ACYL 1URIA 2WINB 4M7JH 4BE6A 3MCYA 5DLLA 3AREB 1U21A 1AZRA 3F01A 1BZ7B 2E0PA 1FP5A 2F54A 4XRCB 2JJVA 3OWRA 5E5MB 4LEEA 3CVHL 2IADB 4X5QA 1CLCA 1G7LB 3DSFL 2EDQA 5KVFH 1RFDH 4YHPB 4QHMB 2ROXA 3SN6N 1J88A 4MA3B 3B2MA 3COOA 4FQLH 1WBYB 4IGBC 1BX2B 2EZ0D 2CKBH 4U3SA 1NBCA 1OP9A 4Z77A 4Z7UF 4ODSL 2K4WA 5B7FA 3PJSA 1X9LA 1RIHH 1HH6A 3V4VB 4IGBD 4G80A 1MCPL 4LSSL 1QFWH 2AV7B 2CK2A 4XP5H 4FP8H 4NC0B 4KMQA 4QO1A 3E8UH 4HK3J 5D2NC 1GVIA 1RZGB 2PWEA 4F9LC 1KEGL 5I8CB 2FDBP 1SMDA 3SKMA 5CGYD 1TZGH 5EU4B 3GXIA 1G4MA 1OAXH 5EUOB 1JGVH 1MQKH 4GKNB 3U9UA 5J1TC 5I1DA 4N8CH 1JCKA 2OX5B 1K72A 1L0PA 2A6IB 2GY7B 4PRIE 4I85A 3I84A 2FWUA 3BVXA 5E4OA 2C3GA 2EINB 4AVHA 2Z7YA 4K5MA 4NQEB 4JO1L 2H41A 2OULB 5DJYA 3LNDA 5C7XH 1WZ1L 2VQ4A 1P5UC 5K9OB 2HLFC 4AGOA 4KU1A 1MJJA 1A6ZA 5IV2B 1JVKA 3SKNB 1M2OA 3AMKA 3VGAB 4IU3B 3VXME 1U8IA 4L2LA 4IKLA 1G6RL 4Y5XA 1PZUB 3QNYB 3VSQA 3ISWA 1O9ZA 1NEZB 3MLXL 3MLPA 2HKFH 4WV1A 5KBLA 1XGPA 2KZWA 3VRJA 5C09B 4ADJA 4DP9X 3BFOA 1I8UA 2YMXH 4H8WC 2IQ9L 3OPUA 4OJAA 5ETUA 5D5MF 1L5GB 4BSJA 2JTYA 1UT9A 3F6LA 2NY6D 3NSCA 2JKRM 1A4KA 1ZHKA 4MVBD 5DT1H 35C8H 3QNYA 4ODXA 4P59L 4DP5X 1TJXA 4NZTL 1LM8V 1Q9KA 2HXAA 2OXGA 2VXQA 4W9FC 1U3HA 3UTSA 2B08A 4BSWB 1OAZH 3MJ9H 2ESVE 4GP5B 4M1GH 2UZIH 1FFRA 3NCMA 2R39A 2IF7A 4Q9RL 1DJWA 2ARJA 1XGUB 4IDJH 4RNRB 2GSIB 3FPXA 3TEUA 3O11A 1JP5A 2Q2LA 4LHQB 4WWKA 3SE3C 4GRWB 4HGMA 4MA1B 5DQ9A 4BINA 1X5GA 3OB0K 2MQCA 4LARL 5E6ZA 3OX8B 4HIEA 2LFGA 4PRDB 3ULUH 4MS8D 2BFVH 3D3VE 1E2ZA 2F5AH 3MLTA 4NPJA 5JYMA 3VYNA 2Q8BH 3N43B 4J23A 4HIPA 3R8QA 3T0EB 4W1TA 2K1MA 2LHAA 4O9HH 3OHXA 2X1QA 4N8PA 5TF0A 4M43L 1AO7B 2A74A 1DJYA 1BD2B 2P3YA 3LH9A 1BPLB 5GSVA 1JHLH 3EJRA 2Q6WB 3SY0A 5KTEH 3D4CA 3QQ4B 4M6NH 3U0PB 3SPHA 1V54B 3BUTA 4GG6A 1Q0XL 2EIZA 3GXFA 3HC4H 3GNML 4J4PA 5GS0L 1MFNA 3FQXA 4I77H 5DVMA 3RFRA 5IROD 4QYOA 5E6YA 5H94B 2VZ3A 2JVUA 2NZIA 3EJYC 1Y1DA 4MBRA 1T7ZA 4L5FH 3TL5A 3JT2A 4FXTA 2CMRL 2F7OA 4L3EB 2HVKB 3TYFB 1KCWA 3QUXC 3OG4B 5HHXH 5I74B 4K5LA 3WS6C 2NLJB 4FXGB 4JKNA 2QV2A 3CZNA 3HCVB 5CAYB 3F8UB 1J1XH 1PCXA 3ATBA 1CUOA 4YX2H 4HS8H 4Q97A 4P8QA 4WW2B 1OIOA 5JA8B 5B38B 3WY3A 1YC7A 4LEOA 4PJHF 1U58A 4Y19E 3REWB 3H53A 5GGSA 3S98A 3VXSD 1KNOB 3QQNA 3WD5H 1U95B 1XF3A 3U36A 1KTLB 2ZF8A 5DFVC 4LCCC 3CFEA 4PJEF 2YBGA 4FFZH 4KVPA 2LTQC 4YXKL 2WTRA 4AE1A 1KIUB 2YUVA 2PW1A 4XH2A 3WLWC 4ILDA 5K59F 4AYDC 2Z93B 3VSVA 1L9MA 3A6CH 4ACTA 1VFBA 5FW7A 5BZZA 1JZHA 3C6SA 5D1XB 3TP4A 1KPRB 2J72A 2VQ1B 3F62A 2NTSP 4Q58C 3U7WL 4PJ8D 1CE1L 3P0VL 3GXNA 2BK8A 1T1XB 1CL7I 1G9MH 4I0CC 2ZG3A 1FFNA 2QR0B 2OI9B 2H8PA 4ZO7A 5BW7C 4L1LA 3QJHA 1HESA 3T2NL 3B2XA 4FLQA 4ONHB 3KPRE 4EKJA 1DVTA 4LOUC 4IRZL 3L1GA 1AE6H 1IRAY 4AEFA 4PG9A 5DWUL 1WFMA 4P3DB 4RIRA 4Y8AA 3VW3L 5HI5D 4X5XB 1OSEA 4ZD3L 1YEHL 4YDZA 2AABH 3V4PA 3CCHA 4K3DH 3LJ3A 1KGIA 4AGQA 2RALA 2AC0A 1B9KA 4XNBA 2IIJA 3U79A 2RAMA 3BFWA 1UD4A 2BC4B 2FX9H 1PDKA 2D7PA 1OANA 3T9WA 4OJYA 3L5WB 4OT1L 3WTYA 3GKWH 1ECZA 5D1XC 5DC0A 4OI8A 3CFKA 4HS6B 2AJYH 3JQOB 5EC2A 1AY1L 3MAWA 1BGXH 1AO7A 1LEIB 3ZX1A 4HQQH 1AGBB 1CE1H 3KHOA 2BHFA 4UT7L 3KR3L 5D5MA 3H8NA 3O6KH 4FZ8H 3X3FL 4ABVA 1PLAA 2B0SL 4IMLA 1GH7A 1M7UA 2H1XA 1PPIA 2QADC 3OAUH 2IWGA 2EIDA 3D25B 4NRZB 2LR4A 5FYLH 3VD3A 4PRNB 2G2RB 5E8NA 2ZG2A 4Z3JA 1F4XL 2GJ6A 5GHWH 3ARDC 4HQQL 1BF8A 1VGEL 2IAMA 4XC1L 3Q6FB 3ZQXA 2BS9A 2V5YA 3IFPB 4MNGE 1LQBC 2ZJSH 5KJRL 2K4AA 1UHVA 4MMZA 4J5VA 1FFOB 3QZMA 1J9QA 3DO3A 3DTXA 5FO8A 4OJFH 1DLHB 1XR8A 3AQYA 3APMA 1HFUA 3O6FA 3HAEA 3BKJH 4J3WA 4DGUA 4PBDA 5IKCB 3NCJL 2H3KA 1IAIM 4N0FA 2WWKO 4XNQA 2WY3B 4GBXD 2VMJA 3UBHA 5IMMA 4MQXC 3IDNA 1YJDL 3L2NA 2EEBA 1PX3A 3MRJB 5EBMB 2YARA 3L1OL 2DD8L 3ARBB 3OM3B 3U1SH 5FX3A 2AFNA 1TF4A 4Y1AE 1WISA 4EO5A 1RHHA 3QUHA 2NY4C 2QV4A 2D2OA 4GW5B 2AJZB 4GAJH 2A9NL 2BVEA 2Y2YA 4UT6L 2JKSA 4PJBE 5MERA 5AEAA 3BPCA 3K2MC 4B0MM 2DQMA 5BOZG 3HJEA 4AYFA 3ZDWA 2YRLA 5B1CA 2ZSVA 4NQCD 2J1YA 3U0TB 2OR8A 3D1MC 1JTTA 5D1XA 4HZLB 5IIEA 3S35H 3Q2LA 5AVTB 3LRSA 1AGCA 4CNIA 1PBYA 1WV7T 3D5OF 4U05A 4PR5B 3OPZL 1JHLL 3CLEH 1A5FH 2P5WD 1G94A 3QNZB 3BAJA 4Z7VE 3SJVE 4QJ3B 5KW9H 3VSUA 5B4MD 3VW3H 1N4XH 2WLNA 3PJNA 2WP3T 4MA1C 5EG6C 2ATPB 4RGOL 2FO4A 4F8PA 2R0ZL 4NKQB 4YXKH 3MNMA 4TL5A 1GPOL 4M6ML 5DYOB 1AGCB 4CNIB 3PHQA 1GOFA 4AIOA 4Y1TA 4KZDH 3L2MA 2DQEL 4Z6AT 3BD5A 2QSVA 2J6WA 2ZAHA 4OZGA 3RDJA 2XG5A 1DUYB 1H8NA 2OMVB 3P4MB 3WLWD 4NJ9L 3C60D 1KTJA 3V4VA 1OAZL 3OKNB 1HEZB 1TITA 1UH2A 3P54A 2HH0H 3TNNA 1GW6A 3UBXA 2C9XA 3JWDH 3PQYE 4X6CE 4WU7A 2IAND 1E4XH 4KMTL 2KT6A 4DKTA 3NN8B 2DTML 3O3BA 4JFFD 4R3SA 2DOCA 5FGSA 1BYNA 2J8UA 4QHNA 3UIYA 3MRDA 2EDWA 4I7ZC 1BVOA 5LLIC 1NMAH 2FQFA 4Y5XC 1TMQA 1C16A 3GSRA 3QJZA 4NQED 3V0WL 1FNGA 1U91A 4NC2B 3S37H 4JFEB 4PRAA 3VA2C 1UJ3B 1FE8H 1A9BB 1JZ8A 3PJLA 3AFLA 1KJVA 2NR6C 3BE1H 1I85A 3EDKA 3QUZB 4G8EB 2WYTA 3SB3A 2OK0L 1FIGL 3C08L 4M62H 3QDGB 4NN5C 4AGNA 5A40E 3VFUA 5KTEL 5AOIA 4DGVH 4TF4A 4F7EA 1CDCA 3PYCA 1ZLVH 3WJLA 1J0KA 2P24B 4JRYE 2HLAB 1EV2E 3Q5YA 4KAQL 5JW5A 1LDPH 2VLME 4ENEC 4HCIA 1ONQB 4UYPA 3QYNA 4A2LA 4Q4EA 5LCVL 2K7QA 1BEXA 1ZRUA 2H4EA 5HGAB 5C08A 2CWRA 4MNQE 3RL2A 2XTJE 2R4SH 5CJBA 3I3BA 2AKRB 3VU1A 1HH9A 1IGMH 4HHAA 4WF7A 3MV8E 2MKWA 4X98B 4XN1A 2V17L 3P4LA 1WZKA 3OMIB 4NQSB 2XJLA 4HAGA 3HE7B 4HK3N 4JKMA 5GS1A 2GCYB 3EYVB 4LLVB 1KV3A 3MGTB 1C08A 4MCMA 2WPGA 1RJYA 1VGKA 4FABL 1DVFB 1NEPA 1Y18B 2EKSA 3VGBA 4AENB 4ZMTA 4Q9RH 4YFDB 2EXWD 5DD0H 4X7CC 1DEEB 1DP0A 3KPLB 1EXGA 4XCCL 4XMLL 4PJ8C 3DX9B 2YD1A 4DGVL 3GHBL 2R29A 2D9CA 4B0MB 4BHUA 2H9GA 3GM8A 4D7PA 3VUAA 4F15C 2P44B 1RK1B 3G7TA 4JN1H 4MNQA 2VL5A 1T03H 4X6DE 4PPTA 1O5DT 2H5UA 3AREC 4DPAX 4FQLL 4NWTL 3BIKB 1TO5A 4EN3B 1XF5A 4Z7IA 3MLXH 3NEXA 2F61A 2HFFA 2X3BA 5GGSY 4BH8B 1MJ7H 3TCLB 2JKXA 1U36A 3IAQA 4NQDE 4R2GC 2VRQA 1WPCA 2C4FT 3FUKA 2J43A 2NY6C 3ZT5A 1CJYA 3PAYA 2NUPA 4EI5A 1YYLH 3T0EA 1XGZA 2UWEB 3E3QE 1TQTA 5F0MB 4XNXL 1U6AH 3V5KB 5C97A 4MXVE 1CL7L 2X70A 3ZDZE 4A1RA 3CN0A 2DQEH 4O2CA 2PYEE 3MQIA 3O41B 4MDIB 2A83B 5IQ7H 4L4VE 1OTTD 5GRUH 1KXQE 1OZTG 4RMVA 2CBMA 3WS3A 1KEMH 1MFMA 1MELA 4TQPA 5LAXB 2ZUXA 2DF3A 4IRSA 3MODL 4WI0B 4WK0B 1KXVA 1SXAA 4LHUB 4OU3A 1IEAB 5HYSA 2VCOA 2LGNA 3MA7A 1A6WL 4J3OF 3VX0A 1KEGH 3AT9A 4J2QA 4BWWA 1KENH 1NKGA 4KO7A 3MJWA 4Y16C 5HI4D 4FFYA 3W37A 3D51A 1HNGA 3NCCB 1HH6B 4IMKA 2HJLB 4OZHE 4XP9H 2WWMD 3DLQR 3KGSA 1MH5B 5D1QB 4BUQA 4NNXB 2EECA 2EC8A 2IOOA 4RRPG 3T77B 2W80C 5CGTA 4Y89A 4ALAC 2K8QA 3V0WH 5AVXB 3VFUB 3HPJA 1S8DB 2WLJA 1J12A 5E2VH 2VR5A 2YXFA 1DJXA 3BPLB 1KNOA 1FNHA 4OM1L 4TUJA 1BVNT 1NAMA 1U58B 3Q06A 2WXJA 4KK6D 1J8KA 1OV8A 3KYOB 3HFMH 4FFVC 3FT3A 4AMKL 3B3IB 1IM3A 4X6FA 4X7TA 4X6EB 1RZIA 1XR9B 1MG2C 2WKGA 4AV5A 5AL8A 1FJ1A 2HFEA 1RUQH 5MEPA 4N8VB 1B4TA 1FNGB 1P7KA 1U91B 2G75A 4KKLD 3B9DA 1NGXA 3BKYH 4HG4J 3QUZC 1AZNA 3D33A 2ZCHH 4HLZH 2NW3A 1HHKA 3S7GA 4EOWL 1LNUA 2PYEB 1TQCB 4UM9A 1JZGA 1UJ3C 1T83A 1Q9LB 1IM9A 4F93B 5CFHA 2X4UB 2E7DA 3JWOC 3GSOB 3TM6A 3W9EA 1JS4A 3MXVL 5T5FH 3FB8B 1NBVL 4TVSa 1T66C 1MFDL 3OLEA 3UBGA 4FTVA 5I8KL 4WJKB 1X5ZA 2HLEB 1B4JH 5KW9L 1RPUA 3BJ91 4Z7OE 2YLHA 1DSYA 1MCWW 1SYVB 2JJUA 2K8MA 1NUGA 3ZL4L 2HN7A 1FBIH 1Z9SA 3V4PB 2XPGA 3HI1B 3GZPA 3ZR6A 3KL3A 4RX4A 2CIIB 5IM7A 3VMPA 3K6SB 4OZIA 3MO1B 3RWGA 3HZYB 1J86A 2IBZY 2WUCH 4XOCA 1ASQA 5JLZB 4ODWB 5JHLL 4KTEH 4R5VA 5LBSL 1SPDA 4NI3A 4HGWA 2EH7H 1T7WA 4HWZA 2DLFH 4OCYL 5AW1B 3EJQA 3O11B 4FQ1H 5HHOB 3QUZA 1OLZA 1LO0L 1A1OB 3VXRB 3G08A 1EEUA 1YVLA 2D7TL 1XMWA 3RQ3A 1QW8A 3FBQA 3MRKB 4I89A 5FHBH 1RERA 3PP4L 4XVJL 3SDCA 2YAMA 5IOPA 3AC0A 3L5XH 1XF5B 4FQCH 3WAKA 1R6VA 2V9UA 4BZ1H 5CZXC 1HHGB 3TWYA 2R8SH 2JJSC 4O58L 4ADGA 3K6OA 3LQZA 1ZSHA 2DKUA 4LLUA 1S5HB 5HY9A 1BZEA 3R18A 3HJ0A 5FYLE 4A7SA 1EQWA 1I1CA 2CIKB 4PTTA 1Z9MA 2MKLC 5GGVL 3LXBA 4LBAA 1ML0A 1SJVA 3NIDF 1GMIA 1R1CA 3MRFB 3Q8AA 4JO2H 5CEZH 3HC0A 4AENA 5DMIL 3QHFL 1T04A 5E8EB 3VG0L 1TQWA 3UZVB 4OZIE 3BWSA 4K94L 3Q5OA 4AEHH 2VDMH 2AF2A 4PWHA 1UENA 5J9PA 3ZN6A 4CVUA 3VDAA 1U42A 3VXSB 1DSFH 4R4BA 3X13B 5HHQA 4OFYD 1TZHB 3VI4E 1UH3A 4LF3A 3T1WA 4CBPA 3M17A 1A9VA 3II2A 4DNLA 5I1GH 3LQAL 4RZCA 2XYBA 1JV2B 5DC4B 5IF0A 5EU6B 2MPAL 4X6CB 4R4FH 3BSHA 3E8VA 3ZDYE 3HZVB 4W9CC 1U8CA 1TJMA 4ZNCD 2QADB 1JI2A 2FBRA 4JRYD 3PDOA 3B5HA 5I71C 3KCPB 4ZFFB 3KEDA 1C8PA 4F57H 4OD1L 1MFVA 4PUBL 2RA1A 1L6PA 5E9DB 1Z5HA 1TYRA 3AB0C 1MHEB 2J20A 5HHMD 3QJSB 1VFAB 2J4WL 1QSFE 4TNVK 3FZUC 3QUMH 4MS6A 3MLTB 2DLTA 1N2RB 3LN4A 2E76C 4FNSA 3VFNA 5JHLA 4KNTA 4YSRA 3EDEA 2WOBA 3QEGH 4CADB 3ULVF 3DUSA 3DIDA 1CIDA 3N9GH 3FF8A 2Q9OA 2WKLA 3Q3GB 3REVB 5F7KC 5EZLB 4UM9D 4JQIH 1CYXA 3L4UA 4K71B 2DQJH 4ZUTA 5KBNC 4J8RA 5D1ZC 3E2HB 4QLWA 2B1OA 4N2LA 5IZ7A 4JFDA 2BRRH 1OT4A 4K2UL 3CVBA 4JFHD 2EP6A 1BVKA 2Z92B 3UXFA 1PLBA 1Z66A 3E0GA 3D08A 5PCYA 3GSVB 1L3WA 3FQYA 4LLWA 3J07A 3GDBA 3LRKA 4KKLC 4LEBA 4RDQG 4IHBA 3PWPA 3VD4A 4Z95L 3PL6C 4BHUI 4LSPL 5EWIL 3WDIA 1N5YL 1KCSL 5F1KC 1OHQA 1WWWX 5D6DC 5DVPA 4JO4L 1OQXA 3FOMB 4FQQA 5HHNA 5SWSD 5EC2B 3STZA 3FRUA 2ZNXA 4RFOL 5CCGE 5I1HL 3G04A 4KC3B 1EHLL 4LKXA 1NAMH 2QGEA 3G9VA 4HCFA 5CUSH 1A65A 3ZE1F 2GJRA 1DQMH 4JM2C 3IU4L 4L37A 5L2JB 1A25A 4FKKA 2Q8AL 3C87A 3MV9A 2BS71 4MNHB 4KKAC 4Y9FA 4E9RA 3MRCB 3O2DA 1L7IL 5TK2A 1NEUA 4S0HA 3IMRA 4L3CB 1D6VH 4XO5A 1ZVSB 3UMNA 4I1PA 2VJXA 3ZTEA 4NRXA 2B7DT 5CU9A 1XT5A 2ZSWB 4FTVD 4PB0H 1WBXA 4P2RB 5LJYH 1JHTA 3BSZL 1JGUH 4MAZA 3D4ZA 1NDMB 4FNQA 2WB7A 3US1A 4FHKA 4NENB 3RGBA 5D2NA 4AJYV 1JNNL 2G3ZA 1J05B 4J6IA 4ZG1A 1KGXA 4O5LH 4HALA 3OKEB 2X9WA 3MV7B 4LLAA 3HNSL 3HAEB 1DJSA 4HFUH 3V8OA 2V5RA 1HSBB 1RJYB 4MCZB 4LDCA 2WQWA 4LCIH 2E8YA 4HBQA 4H0IA 3MLYL 3SY6A 4IBWA 1T5XA 4PGJA 3QS2A 1GL4B 3ZIYA 1RUKH 4LLYA 4JFZH 3VQ2C 3I50L 3MBWA 4M4PA 3GHEH 3A22A 2HJFB 1FNSL 4WCYL 1RZKC 3KWXA 4HHWA 3ZDXB 3QDAA 1BQHB 4PJ5E 2PO6C 3LEXA 5AD0A 1YYML 2UZIL 2ZOKA 4LESA 1DFBL 3JSSA 5J56B 3VFSB 1OHZA 5CJ8A 4BK4A 3E80A 3Q6GL 5KN5B 1B0IA 2E3VA 4LF3B 1I1RA 1H9DA 2R1YA 3QZPA 3CE1A 2E9JA 3FO2A 4U33A 4HOMA 3H0TA 1XL4A 5EN2B 1AZCA 3VI4F 3FFCB 4LSSH 4PJEE 5BRZD 4H8VA 4BXSV 1YQ2A 1E4JA 4TUKL 2CBOA 5J12B 1QFUH 2NW2B 4ANVA 1OP3K 4N0RA 3NIGE 1SN5A 1QABA 1T21A 4M7KH 3B9KD 3HPLA 4WGWB 2J8OA 4L1BA 4NQXA 2FBJH 4HC1H 4YR6B 3IVKA 3UO1H 3BSZH 4MB3A 4N9GA 2VXSL 3SKUD 4A7GA 4JDEB 1E8WA 4HETA 4XXWC 5A1AA 1ROWA 5ABDE 1GY2A 1LE5B 1UZ6E 2VIRB 4K15A 3JWOH 3T4AA 4Z1PA 3GMNA 4MGXA 1XX9C 3IJSA 5HJDA 2F53E 1NCNA 1GCYA 4IKNA 2D0HA 3I74A 1U3HC 4P23C 5E1GA 1A1NA 5IWLA 4K4KA 4LPXA 5IUCA 4HZ1A 5C7XL 3RVUD 4XPFH 4RDBA 2NYKA 1MFBL 5KJ7E 5IW3A 5AZUA 3L5JA 1D2PA 5I6XC 2NNCA 3IGAB 4R4ND 5D72L 1ZIBA 1W8NA 3UP1A 1MAML 1MRDH 1KG0A 2AK4D 4UTBH 2Y6SC 1FNFA 1JUFB 2X28A 4Y5YA 4AMXA 4I2XE 4XC3H 1XCTB 4N8VG 4LSPH 1KCRH 1OAQH 2NXYD 3QUYD 5EWIH 4EXPX 5JYLA 1N5YH 3L9BA 4JFPA 4ZFOB 4M9OA 5HPMB 4ZDHB 3F7YB 5L2KA 1FLRL 1QTPA 2DQTH 2R2EB 5FO9A 3KYNB 5CJQL 1E8XA 1AHKA 3QRLA 3O9WB 4XXCC 3TBCA 5I75C 4AQ1B 4ETQB 1UWYA 1HXKA 3S97C 1KBGH 4UOZA 1CVRA 3LDBB 4LVOC 1JJUA 1CXIA 2X3CA 5E8DL 2D31A 2ADGA 2WCSA 4ERSH 2KS0A 4ZFZA 3IDYC 1T7XA 4X5PA 4F8OA 3KG5A 4PCTA 4K9EL 5B38A 4HKZB 4AYMC 4HCGA 2W91A 4QRRA 4PG2C 1NJ9B 1P2CA 5GGVH 1G5GA 3LPPA 4O2FB 4ELKA 4PJCB 3GSOA 4IS6B 2NXZB 2IPUK 2X4UA 5CFAA 5SWQA 5IQOA 1IM9B 3C60C 5FB8A 1V3LA 2VDLH 2JTDA 4I9WE 3KLKA 2IAAC 1MRCH 4Y4KD 4X4XB 3K4DA 3GMMA 3BVVA 4YSOA 4OQTA 4MD5B 2BVYA 3CX2A 4NBZB 3X14B 4GO8A 4F57L 4YLQT 2P52A 3MLUH 4PV1C 3FO1A 3H7BA 3IDJB 3WKML 2ZOKB 4D0BA 4NM4H 1U8IB 4W70A 1FFPB 1F45A 1U92A 3BEVB 3I6LD 4JHWL 4MMXB 3VQ1C 1E4KC 1MNUH 3HBQA 4Z7AA 1EK3A 2DL9A 4MA7L 3EO0A 2JE8A 1ZDQA 4XVUC 3I02B 3LMJL 5CBAB 2JB6A 2BM3A 3FQ4A 2R1WA 3IJHA 1E4KA 2AXFA 4X9BA 3MO1A 3BDXA 5IM7B 2FJUB 3EGSA 5EEVA 4P04A 2BIMA 5INCA 3EH4B 3GXTA 1CC3A 2F58L 2XN9D 2XN1A 3LH2L 4KVCL 4LVEA 4TQ8A 1WTGT 1XF2A 1DVUA 4JZJB 4K8RC 1CWVA 2C7UB 3JTTA 5E8OA 3OKDA 2WXGA 5KS9B 4F2MA 4AIEA 3DA0A 1QUNA 2B14A 1SF5A 1XGTB 2VSCA 3HUJB 2B1HH 1T6VN 4AGLA 5MEQB 3T8VA 1NCOA 3EH1A 4JO2L 3MR9A 4WEEA 2CJUL 4P2OC 2JI1A 4O2CB 2R2HB 5LGJB 4U6XB 1UJ3A 2HUEA 2ZE0A 3TO4B 4PB9L 4BEIA 4C55A 2WC7A 2XY1A 1QNIA 3ZDXF 2EDTA 4H0HB 4P5RA 5F1OB 4PS4L 3CVDA 1IMHC 4E42B 2XV6B 4WFGE 5AAWA 3ISYA 2EADA 3EIFA 4NO3A 1YY8A 2ZG1A 3O6ML 1AR1C 4EIUA 5C6TH 1XO8A 3RIFK 1E42A 4U6XA 3IXAA 3PP4H 2ZOLB 4A2HA 3PIQA 1SEBA 3DRTA 1IAOA 3CXHJ 3IB4A 4N90E 4QY8A 4FG6C 3G5ZB 2J2ZB 3GFUA 3KM1A 4GSRA 5ITBL 4W4OC 1ZK5A 4E9WA 4RFNC 3HFML 1MWAB 5FM4A 4PY7B 3VM7A 1A7QL 1XEUA 2Z9TA 2X9XA 5F3FA 5FR3A 3E1ZA 3TBWA 3VRLF 4BM7A 5BUGA 3QZWB 3VWJB 4OZFA 5T1LB 3GUTA 2GI0A 5E6ID 3T2LA 2OJEA 3S34L 3VFGH 3U30B 4GQPH 4WUUA 4UV4L 5DJAA 2NT1A 2GW5A 1E6OL 2XWCA 1D7CA 1YY9D 4KUCD 5ACMA 4AITA 4I1RA 5E8DH 1A14H 1F4HA 5I66B 5CXPA 2ICWJ 1YEIH 5ANME 1NINA 12E8L 1BQRA 3CU7A 4G6ML 4QDGA 2ENQA 3IGUA 1PNDA 1AC0A 4GBXA 2CRIA 3U4AA 1QWUA 2CDGA 4WDIB 2UX6A 3EYQC 2DEXX 1GYAA 1T1WA 3CZEA 3RWCA 2R9HC 4QRPD 2KZKA 1UKQA 2YN3A 1JIBA 1QZ1A 3EJZC 4LGPB 5I66A 3ILPB 4YHLL 1IQWL 2FD6H 2Z93A 1IV8A 1PSKH 1Z7JA 3B7TA 2CJTA 2JQZA 1BBJB 1CK0H 3UOAB 1H19A 4LE8A 2L7QA 4HIQA 4IRSD 4B9CA 1ZOXA 3ZZ1A 4KH9A 4M8VA 3D69A 2BWQA 4DPBX 4LVNC 3RZCA 2WXHA 2AI0L 1VFOA 3EDJA 4DIXA 2BSTA 5ITBH 3RA7H 5CJXA 1E3XA 4QI3A 2WIIA 4WW2F 2QZ5A 3ARFC 5DS8B 4CN4A 5IQMA 3ARGD 3LKQA 2BCMA 1BQHG 5EF1A 1DBJH 2UY7A 3CX5J 4KK9C 4H1LH 4LGRB 3UO1L 3QJFA 5T3XH 3BD4A 3FSVA 4FXKB 3BWZA 3FTSA 5JLZA 3SQRA 1F4WL 5AW9B 2JCWA 1G9NL 3SSGA 3EBGA 2EUXA 2MOGA 1VZHA 3OKNA 5D7IA 4X42A 5IP4A 1PIGA 1EFXB 3WSQH 4WTWA 3SE9L 2OSXA 2BSCA 2OZNA 1MCEA 2J56A 4FX5A 5GGRB 3IMWA 1YUHA 1IC4H 3JWNE 1SXNA 3TT1H 5M95B 3FN0L 3IXTA 2FJSA 3DURB 5CD5D 3DMMD 1ZLVK 2J12B 4OUUB 4RMSA 2ZKHH 4QRSA 1EPFA 5I73C 1L7TH 1W72L 5SV3A 4AQEB 1XF1A 3UEQA 3EFDH 2XQ0A 2QVKA 4UAOB 1G7MB 2VLKB 5F3BB 4ZO6A 3POHA 5C08E 2H2SD 4XMUA 1FHGA 2UVEA 2DM2A 1IGML 2RGSA 5EBLB 2HT4C 2I69A 1UWFA 5EB9A 1OT2A 2NW3B 4LCIL 1NEZA 2OZ4L 1UM6H 4KOBA 3WAJA 3OQRA 3QHZH 4PGZA 2V3DA 1RP8A 4OJEH 1NGXB 1H3PH 1NH6A 1L9RA 1MNUL 2NR6A 4JPKH 5JHBA 1YYLL 2JCCF 4PJDF 3UACA 2ZOTA 4UIKL 5EDSA 4CMHC 3JV5A 1Z9OA 3VXQA 1HXYB 4FHBD 3QYMA 4YQXH 1AQKH 1TU2B 2VW6A 3LKSA 3P4NB 1I1FA 4HOXA 5FGBA 5EPMA 4NZRL 5EEWA 3DROB 4PB0L 1ZTXE 3MBEC 5EIQA 2AEQL 1U3HB 4IRJC 4TSCL 5IV2A 1BSIA 1MJJB 1OZUA 4GRLA 4UILH 2IH9A 4LQ1A 3ZXAC 4JJ5A 4JFYB 4AUYA 4KGJA 1ZGLB 1O6TA 2XPGB 3HI1A 2J71A 2XDHA 2E7LC 2VH5L 3RB7A 4WY7L 3N40P 3D2UA 3R1GL 4RMWA 3OAZH 5EA0H 4FFZA 4YDLB 4W9GC 4NCC2 5DU7A 2HA1A 1H8LA 3OJDA 5EOTA 1RJLB 2ICEA 2ORBL 4U1LA 4CW1A 2HRHA 5D9SA 5AVUB 7FABH 2XZQH 4IEFB 3AABA 3N1QC 4WCYH 2HT3C 3V9CA 2ITDB 3B43A 1BYPA 1H3WM 2JJTC 3FH7A 4DP6X 4J3VA 4X5WA 4KHXL 1NBYA 3QDMB 4YDKL 4XTRC 4XT1C 1YEGH 4H40A 1KC5H 3HEIB 4OLZL 3E3QC 4G11A 1KN4H 1BPVA 2AK4E 2X70B 4GXFA 5JOFA 3HS0C 2VDOB 2G60L 5JW3L 3HUJF 3QQDB 2Z7UA 3NGBC 1I8KA 1UEMA 1R46A 3TNMB 1KCBA 4ZXBB 4QHUA 1A0QL 1MFBH 3IGAA 3MRFA 4FI8A 5D2NE 5AB2A 3IJ9A 1MJ8L 2WKOF 4PYGA 5KAQF 1ILUA 1CFQA 3IFNL 1OTSD 1TNNA 1CBVL 3LEYL 1OOAA 3FU6A 3V0IA 1MCSA 4UT6H 5B3JE 3P11H 2A9NH 3ARDA 1D6VL 4FQQB 4BGLA 2HJLA 3VDCA 3QQ9C 1OSZA 5MENE 2ZUWA 3IFLH 5TE6H 4G2AA 3JWDL 3SBQA 3RI5K 4YHPA 3AS1A 2WO3B 1A8JH 2CKBB 4LPUA 1QFUL 4OCSH 4JO4H 3BQUD 2GB2A 4L37B 3DXAE 1SOXA 4BK8A 4QGTA 3QIWB 1YEJL 4WI6A 1HK6A 4YZWA 5MI0B 5IEHA 4F2EA 1ITBB 2EDEA 4L8SA 5D7JD 2O5XL 4WNSA 4D9RD 4MB4A 1I8MB 2YPLE 4NHCL 2MFNA 1WP6A 3CN4A 1JZ7A 4PJIE 2NY3C 1I75A 3TA3D 3FQ2A 3ARGA 2DRUA 4PJ9B 5HGAA 3FQWA 3LPGA 4ZMNA 3DX3A 3AG4B 3ARED 2WBKA 3CVIL 5LBVA 3O3EB 5DJ6B 1U95A 4XNYL 3ESUF 4H20H 3U36B 5ESAB 2K9UA 3O6KL 4FZ8L 1MHEA 4YBHA 5ADOL 4MAYD 1F8TH 2IGLA 3S35L 5T1DH 1WWAX 2UY6B 4MJHA 4ODHL 4POZC 4IJ3B 4P9HL 2EXWC 1A6VH 2OMUB 1UCBH 1DBBH 4P2YA 1I8IB 3GF8A 5EN3A 4MA8H 3WXVH 3K2IA 4JKWA 4ZMOA 4PJHE 5CSZA 1M3JA 2HT4D 4TPRH 3PWPD 1JZ5A 2O6DA 2FX9L 3GMRB 4A7VA 2FLMA 1VFUA 5H37G 3D0AA 3L3OC 2ZYIA 1XIWA 1ZLSH 1EANA 4EDWL 4U1SB 2DD8H 3F6JA 2KLTA 1ZPLA 3OKMB 1ZHBB 2J73A 3ECUA 1S5IL 5AZ2L 1XD1A 4M02A 4YWGH 1GJIA 3JWNG 3DX0A 3WLBB 4UINL 2WO2B 2EILB 4ZOAA 1KUMA 2FAUA 1J1OH 4XWOD 3C60A 3P4MA 4IOSA 5FYJD 3BKJL 3WO4C 5AW5B 4ES9A 1QATA 2BW4A 3KLAA 4W6WB 5IHUH 5MEQA 4ZI8A 1N8OE 4HWZB 1BA9A 1DLFL 1WS7A 4KQ3L 1J8HD 2CHNA 4YXLH 3J8F7 4TUOB 4UB0L 3VFVB 4N2CA 3OKOB 5B3NA 3RB5A 4LKXB 2NY0D 1CT8A 5IT2L 4KVNL 4JFWA 4E9TA 5CJOH 4AZUA 4OKVB 3MCKA 4YH6A 4TTDD 1GGBH 3MJ9A 4H2CA 4LHUD 4TN9A 3UEZA 1YNTB 3RWIA 5JTWA 3KBPA 4ZYKA 1MEXH 2XWJA 1UWEH 4LLUB 4K2UH 3RU8L 1U33A 1FZMB 5F7MC 3Q5TA 3U83A 5EZJA 2CHDA 4HUXB 4DGWC 3K71A 2EO7A 1FVDA 5J11C 4KKBD 2RCSH 4JO3H 3STBA 1M1XA 4Z78B 4ZZKA 5K9JH 5FHAH 3CJJA 2WNGA 3D0VB 5FKAA 4YE0A 1HSBA 3MOAL 2KLSA 4EIBA 2IC2A 2XIDA 5DD5L 3TTSA 5TK4A 1XHHA 1JDAA 4JRXD 3OKEA 5DGRA 3RAJL 3L3GA 3S4SG 5EDXA 3BKYL 1CGUA 2CG9X 2BDNL 4HS8L 1I1AC 2FWLB 4JDTH 5FHBL 4OLVL 3CZKA 4GKZB 2BNRE 1LO2H 4IYKA 4ODXB 4DOHE 5HDBE 2XNAB 2CO1A 3AG2B 4PJGA 5L2KE 2F68X 1UOKA 2DLFL 2DWDB 2W0PA 3EYQD 1NGZB 2Y5TB 3IWUA 3KYKH 3L3HA 3UG3A 2ETWA 4N0FB 2LV4A 4GO9A 4Q9QH 4PJAA 2C9PA 4OFPA 3PREA 3O6FB 4HKZA 4QRRB 4UM8A 4XXWA 4YUEH 3NAAH 4AK1A 5EF3A 3DO7B 4NNPH 2P8PA 2RD0A