3ILEA

Crystal structure of orf157-e86a of acidianus filamentous virus 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
VVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEARTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ileA00
3ILEA 3VB8A 3ILDA 3II3A 3II2A
chains in the Genus database with same CATH superfamily
1FYTE 3O9WC 5JYLA 2W8CA 3FULA 3PGDA 5F88A 4TTGA 3MFFA 4YSAA 1DP0A 4QI3A 2AZUA 5EEXA 1HXKA 4ZW5A 4P2AA 1E6JH 4GW5A 2FDBP 1SJVA 3WSQL 4BZ1A 4BGDA 4PJ8B 2HMID 1JVKA 2CRMA 1Z9SB 3B56A 2XRAH 3D0VB 4X5XA 2EVJA 3NQIA 1TFPA 3NJJA 5TE7L 1OTTD 3FT1A 3U9UB 4KMQA 2YN3A 3PL6D 5DWUH 5F7YC 4E41D 4JPIB 3RY5A 4YDVA 5D7LB 4K8RL 1F13A 3QNZB 2D2CC 4GIAA 3H3BC 2DLFL 4YGAB 4HX1A 4GRMA 1C5CH 1OTSC 4IS6A 3ML8A 2ICWB 3D6GA 2IANA 4N86A 2E4TA 3BISA 1WBZA 1T6VN 5AYQA 1DVFD 5AW2B 1M1XA 1OE3A 3FU7B 4TL5A 5K59E 4IEFB 1ORQB 2NT1A 1LO4L 1GGBH 4H25A 4MA7L 3FSWA 2DD8H 2R29H 5KOMC 5KWYC 1I9JL 4PB0H 2EABA 2AERT 4GFXA 4Q6YA 3Q5YA 1IBGL 1NFAA 1U92A 3QJHB 2IDCA 3GD1C 3EYUL 4MCZA 1DBAL 3KJ6H 3FO9A 1BBJA 1T20B 1KXTB 1DQKA 3EG9A 4OV6F 5MEQA 4V11A 4NQDE 1JGDA 2DQCL 1KIPB 5FA4A 3LV3A 1BMZA 5MP6L 4YBQD 4BFFA 3TJEL 4HK3J 3EOBA 5JA8B 5E6YA 5HHOE 4ZG1A 2VZSA 3QIWD 3SDCC 5IJCC 1HHJB 3F12B 3JZ7A 1DQMH 2DQUH 3KPTA 4MZ3A 2UXTA 4CC4A 4KKZA 3T8MA 1QSED 5CEZH 1QBML 2CLRA 3S8FB 2HFEA 2X2IA 1RFDL 4P2QE 4TKWA 5IVXF 1JZ3A 3MNDA 3FFDA 1L9RA 4I0PD 1QHQA 4KRPD 1RZQA 4OJAA 3S98A 5LDSA 3ABMB 1E27B 1FH5L 2WVUA 4JDZB 4ONGH 5DK3A 1AGCA 1AGEA 4JDVA 2A6IB 2MJWA 1CD9B 5DMIH 2PW1B 2X87A 4QRSB 2VQUA 3P54A 1SY6L 4P46C 2OMBA 1M3JA 4YDNA 4UOW0 1KUMA 4Y4KD 3S3CB 3ZXAC 3A4AA 5J06A 5IBTL 2OMUB 4U31A 2HAZA 3ULUF 3VRLE 5HDBF 4ELMB 2OMWA 4X80L 1T7WA 4BELD 2JTYA 5F8RC 1A9BA 1GYUA 2X2JA 4ZW6A 5DJDB 3DX6B 4HLZG 4D8OA 3CSPA 5JQ6H 4NKMB 5FYKU 1CDIA 2VO5A 2VLLA 5T5FH 1S5IL 4AUYA 2QPSA 4E2OA 4ZD3L 3QXDA 3WJJA 1BVOA 1S7UA 3IMRA 4GPVA 5ANMB 2A6KA 3FTSA 1MW1A 3SJVD 2V5RA 5AYTA 2HG5B 2B4CL 5ABZA 1FVEA 1MY5A 3DUUB 4U0QB 3HKFA 4XOCA 2OTWA 1HVXA 4M8VA 2NZ9C 5HDBE 5I1IL 3T77B 2VDNB 4RGNB 1WAAA 4OBRA 1I82A 3MUJA 3FTWA 1D9KD 1MJUL 4H0LC 2G4EA 3WJLC 1VADB 1ZPUA 2ICWJ 2PKDA 1K2DB 4OLWL 3FRPA 1U8MB 4IRSA 2TRHA 2AQPA 4QYOA 4WY7H 5JW5A 4XN9A 3CN0A 4PI0A 4XE5B 3UTPE 4AT6A 4EOWH 4EN3C 5ADPL 3IU3A 2Q20A 4RFNC 3ZT5A 4WTZA 4PLKD 2A99A 2VDNL 4C59B 4AJ0A 5DGQA 3VXRD 3B7RL 2G5BA 1JERA 2IV8A 1AZZC 3QUYB 2APXA 2Z4TA 1RSFA 3P3SA 2R0KH 2NTSP 3C9NA 1Z5YD 2LVEA 3FSZA 1PIGA 1A6WH 3MRNA 5BW7A 2HKFL 5IHZA 2OAAA 1P9MA 3EFDL 3SDAB 1B0GB 2XTSA 2ZWSA 5DRWB 3CQQA 3I85A 5I19H 2PO6D 4Q9CA 3O8XD 4HQQL 5BRZA 2QELA 4DGUA 3AS2A 2AXFB 1OT2A 1M9SA 2HX7A 4FQ2L 2ESVE 1OF2B 1QA9B 4J4PA 5JQHC 2BNQD 1WS7A 2Z92B 3D39A 3P30L 4PV1C 3ATDA 2FHFA 3ETSA 4Y2NA 4J3SA 5FO7B 3Q43A 3EADA 4WO0A 2Q6WA 4KAQH 1AS7A 3FCSA 3CH1A 2XY1A 3VMNA 3KDPB 5FUOH 3J7HA 1F1GA 1FBIL 2VUYA 3JTSA 5F7UA 1DQQB 1UENA 3VI3A 2J1WA 2DMGA 3VWKD 1EXUB 4P3DB 2WXKA 5LGKA 3L9RA 3DO7B 1NPJA 3X3FL 2P5EE 3QNXA 3BAEH 1FIGH 5MENB 3GKWL 2E74C 2H6PB 5BS0D 3RFZA 5CR1A 1H19A 3K80A 5KZCB 4NO5A 4N5EC 1A2YB 1MRFH 2ZG3A 4PJEF 5C0CE 1NCWL 4CAGA 1QEXA 4OCNC 3WO4B 2IWFA 2CO6A 3HI1A 3ZZSA 2V2WB 4JN1H 5IGXL 4JFDA 5AAMA 3HE7C 2DY2A 2DBLL 5KBDA 2XQ0A 3Q9PA 3AQYA 4LIQH 5IESL 2DH3A 3IJHA 4Q4IA 3GRWL 2WJ5A 4W9JC 1CE6A 5D5MA 1CVRA 4LHUB 3AGVA 4N26A 4HUVB 1RIUL 3SCMB 2WXIA 1NIEA 4PJ5A 1N6QH 2V5TA 3F5WA 3MOBH 3BP4A 1MREL 2WWOA 4XNUH 5KVGL 5KYXB 2N1TE 3QHFH 4KH9A 5E1AB 4EZKA 2GIMA 2VMDA 4PJEE 5B22A 1YQ2A 1GGIL 1UD5A 4PMEA 3WIAA 1HTYA 4JRXB 4PEEA 5HVWA 3S96B 3CFQA 4WU5A 4C55A 1QASA 1UA7A 3L4ZA 2APFA 43C9B 1S9XA 4PJHE 2HYMA 1J9CT 2MQ3A 3ML9A 4WI6A 5BUAA 2R56L 3O9WD 1L7TL 5JHLL 3BZFB 5KJRH 1EGJA 2X4OA 1KCRL 4JO2H 3MVSA 1M56B 2YXMA 4NS0A 2LE9A 1YEDA 1S9VA 5LBSA 2BIQA 2F18A 5HI5C 5EEYA 2ADGA 4MA8L 3EJJX 1FNEA 3GSNB 3R7QA 3VDBA 3CFKA 3VE0A 3QHTC 1F2XK 1MCPL 4MDJA 4MNHB 4W9ZA 5EBLB 5FUZH 1KCWA 3RGVA 5F9OL 4JRWA 3P9MB 1IVLA 1ZLUK 1U8QB 2P47B 2EDTA 3BP5A 2P80D 5FM5O 4RAUA 3O6FC 4TM9A 5B1JA 4XTRD 4MNQD 5AOKA 1JNHB 4L37B 1I7RA 3GSNL 3ULUC 2VLRB 1FE8H 1HXYB 2OI9C 3L3KA 5CWSA 5D2LF 2GKIA 2F8VA 3ZVVA 4KV5F 2HUEA 2J8UB 4D0DA 1MRCL 3SDDA 4MJHA 3BFWA 1WIOA 4QHUA 3PNWB 3MNZA 4OAWB 3B83A 5EU6D 4GQZA 3FTGA 3DMMB 2XNAB 2VQTA 3G6DH 3VXQB 4LAQH 1AJ7L 5FGRA 3DX0A 4KJYA 3NCJH 1JZ7A 2JB6B 1TCRB 3PY9A 3DX9A 4MQXC 5IFJB 3KEDA 4JHWH 4P5KB 4YLBA 2KDGA 2OJEA 2R23B 5D1QB 4ZQTA 5D2LE 5FEBA 3W5NA 2ZCLH 4IU2B 1SM3L 2DEXX 2MSPA 2NRDA 4KV5E 4FZ8L 4ZMOA 4YJZL 5K1NA 3TURA 4C4KO 4JJ5A 3E0GA 3WCYA 3V5KB 4NO0A 1BOYA 4AIZB 5DS1A 3I50L 4G6AC 1A4AA 3DVGA 4JG9A 4P5TB 4XCNA 4X9YA 3J2PA 4DGYH 4F2MB 3KCPB 3OWEA 3VWJB 3HBPA 4RMBA 5C07D 2R1XB 4FYTA 3UJTL 2IJ0C 2VDRH 4AZ8B 4H8UA 1C1EH 1JNNH 4BK4A 4HIHB 1DBKH 3JQOB 5D1XC 4FABH 1IL1A 3ZRSA 3O11A 4BXSV 1CICC 4AW7A 1TF4A 3FH5A 4YSDA 5A2LH 5AW6B 2NZ1A 4PVBA 3VJ6B 1BJ1J 2MTPA 2ZPKH 3QCVL 4LBEB 1BFVL 4KUZH 3APMA 3P69A 4N4YB 1SEBA 3WY1A 5ILTL 1HOCB 1XGYH 3GMOB 5CO1A 3IJ9A 3AREA 2NLJB 3KHQA 3QEUB 4L5FL 4I2XE 4EKJA 4IDJL 4ZUTA 2PTTB 4TNVK 2WLMA 3NTCH 3K4ZA 3MTRA 1NMAL 4KMTL 5B1BB 2Y1ZA 4X9FA 1QFWI 4WI8A 5A2AA 1WZMA 5TQ2L 1OB1A 3T0WA 1QFOA 3AT9A 5DUMH 2P44B 3VSTA 1UASA 3KLSA 5IWLA 4LPYA 5AQ0A 2GK2A 1U30A 2R4RH 3L54A 2QVTA 1KBKA 3HE6A 4GOSA 4IOSA 4LVOB 4QKTA 2BERA 4JPWL 1RAMA 1MF2L 3ARGD 4WI7A 5E2VL 2YGPA 1CL7H 1LEGA 4LPVA 3ZTEA 1G0DA 3DNKA 4PWJA 3ILPB 3V10A 2CA4A 1S3KH 3BI9X 1IC5L 4P07A 3FSVA 3CMOH 1Y6KR 2X4SB 3BO8A 5DDHB 5H94A 2VO8A 4I3RH 1UWXH 4MLIA 4HCIA 4Y4HC 3DV4A 5F8QC 2DQDL 1BAFH 3CFDA 4RWHA 3S88H 3AJ7A 4NQXB 4AEFA 4CGUB 2J8HA 1W2KT 2ZX9A 2XQYG 3L3GA 3I02A 2K9UA 2P5WB 3MV7E 2ADJA 4GXVL 3LQZB 2IH3A 3U1QA 5F97E 3FQUA 3GK8H 3DOSB 3PP4L 4Y1TA 3DOIA 1HJCA 3LRGA 2Y7OA 2CMRH 2SEBA 3DX8B 3OV6A 3WGUB 2YLKA 5JXAL 5J6GA 2X4RB 3BPOC 5IMMB 2PWGA 3NIFE 1A3LL 2BSEA 2C9RA 4QHNA 1OP3K 3HPLA 4W9EC 3U2IA 1V3KA 5LGJB 4JANB 4B9FA 2WW8A 4MA3A 1MCFA 1HH6B 1E8ZA 2COQA 3CN2A 1A6TB 1R24A 4QPEA 5DZNA 3L48A 4YSSA 2ICWI 3ZLQC 2CM5A 2Y6TE 2AQSA 5LUMA 3OKOA 2OK0L 1U8PB 1MNNA 2A3TA 4AENA 1AGBB 2X4UA 4M7JL 3H2PA 3NJGA 3QQ9C 4UIKH 3U2JA 4W4OC 3P0VL 2RALA 4MHHG 2WN2A 4G8GB 1Y18A 2DMCA 2P5EA 3IKKA 5ESVB 1MG2C 3EXLA 3QS2A 3TPUB 4ABVA 3TLRA 2OV0A 2YARA 4L1SA 2JI3A 1MW3A 2R15A 5ESQA 5I74C 3K72B 4U1JA 1DQTA 1I8LC 1JRHL 1LK2A 3KPNA 4IIQB 3S5ZA 1RHHB 4R0LA 2CM6A 2QQNH 1F3RB 1PMYA 3PPEA 2BMKB 1TENA 5C0CA 5DURB 4KPHH 1XWVA 3O3DB 1FG9C 3LAFA 1TZGH 4I87A 1IGCL 3LIZA 4AEHH 5ID1A 3ZT7A 2OZ4A 1LE5B 1CYGA 2HKHL 5I76A 1CR9H 5L6YH 2DQMA 4LQ1A 2GT9B 4X5RA 3ESPA 3PJSA 5EG6C 3ZHNA 5GRVK 1PDKA 1UOWA 1KELH 1OAZH 2W60B 4FTDA 4PJ7A 1G9MH 2VUKA 1XIWA 1MHEB 4QXUL 2AS5M 3N2JA 3QJFB 4NN5B 3VVWA 1QEWA 1U92B 1JNLH 2YEZA 4AE0A 5J9PA 3GMRA 1X7TA 1HKLH 2CJTA 2O61A 1KYOK 4NZUL 3ULVC 3FFCB 4A1RA 2VLJA 4PS4H 2VXQH 2V37A 1YJDH 5K9QI 4QKXB 1YEKL 2FLRT 3WXWH 2Z31B 4WFFD 3SEPA 1LP9F 2AJVH 1A1OB 5C0EA 4I3SL 1WFOA 1CT8A 2M2DA 3BCDA 4CSPA 5JHDA 2IOMA 1QBBA 4GT7A 1I3UA 2D9QB 4DK6A 1BOGA 4JFOB 2VZVA 2WKOF 4APQD 1BZ9A 3ULUL 1AXSA 3VQ1C 4J1UA 1SLXA 1U91A 2CGRL 2CLRB 5HI4D 2F68X 1AO7B 1CFMA 4GW4A 4Z3IA 2OMNA 2WBJD 3IFLL 1UH4A 5HY9B 5F1IB 4HF5L 3VU2A 5KAQG 1T03L 4NQUA 1AGEB 3IPBA 4ZI8A 1DQLL 2YQ3A 1RULL 5IHWA 1J5CA 3EZJB 4LRIC 3N40F 3DJZA 4XC3L 5GRJH 1RPUA 4JFVA 1URLA 3L4CA 4U0RC 5ECJE 2OFQA 3GTNA 3B2UC 3M17B 2HTKC 3SKJL 2Q86A 3VAEA 1CD8A 2MCG1 4XXCA 1RJYA 4Y9BA 3ZE0B 1CI3M 2ZCKL 3AACA 4XC1L 4ZUUA 3AG4B 5CN3A 2G2PA 2JH2A 8FABA 1C08A 1K4DB 3O2WH 3NP3A 3W9DA 4NC1C 4ZMXA 4L05A 1UFGA 3BJ91 2QFRA 3E6HA 2E4FA 1HHGA 3AWGA 1QSFE 1RUKH 1KXVA 1AC6A 1GC1C 2VR6A 1IIIA 4PW3A 4AYFA 5J57B 2X1QA 2E0PA 1V3LA 2V2XB 1AOZA 4KO5A 4NC2B 3BGAA 1AE6L 3OHXB 1JPSL 5EIVA 5GZND 1JGVH 2CALA 2DKSA 4QRUB 3DX2A 5IQOA 4PLOB 3C60B 2WXGA 4J12A 5EZIH 1DQIA 1CICD 4AT6B 3B9VA 3G04A 3CWGA 2BVEA 3MRCA 2ARWA 1X6NA 4HC1L 3WN6A 2E7MA 3FO0H 4TVPH 4HULB 2WZPD 1NCCL 1YEGL 1GYAA 2H3NA 4A04A 1U95A 1XH1A 1BF8A 3K1DA 3LD8C 1DZ0A 4FLSA 4R2GD 1RSYA 1UQSB 2YJLA 1IGIL 3NSCA 1MCOL 3K3QA 4QAWA 1FGVH 2VLKA 2EO7A 2RTTA 4JKKA 2YPVH 1MI5E 1UJ3B 4JRLA 3SOTA 3HZYB 2CUAA 4WHTA 5FAAA 2WBXA 4P99A 3T0DA 4FFWD 4OD2A 5EPMB 4YK4B 4OZ4A 4KK8D 1VPOH 2GB2A 4KKCC 2DWEA 5E51A 2FBJH 2WCSA 5IUSA 2DLGA 5L88H 4R8WL 3P77B 1N19A 3P9WB 3A4FA 3N1MC 2CU9A 3TBCA 3UJJH 4I0CC 3RJDA 1N7MH 4ZFGH 4I2XA 1L0QA 2UX7A 4QR7A 3RDTC 1FA4A 4WI0B 4Z0BL 3ATAA 2XZQH 4BZ2H 1OT1A 1R34A 3BAXA 1E28B 3C5ZB 1Z9LA 4N1EA 5EWIH 4A7GF 4H1LG 2R2BA 3BKCL 4XHJC 5INCA 1OAKL 5D2NE 1J10A 4Y4HD 1U3HA 4TNWF 1ICTA 2VE6A 4NIKB 4M43L 3EHBB 2NSXA 3LRKA 1UD4A 4J3BA 2LLNA 2XN9D 4LCWD 2D31A 3QG7L 2MOVA 1IFHH 4K3GA 2L7EA 4KZDL 4B41A 3DSFH 2NXZB 4KK9D 4YDMA 1P7KA 1XQ4A 4MJIB 2Z0UA 1SPDA 4GXUM 1MLBA 1ZT1B 2OKMA 2FT8A 3DHPA 4XGZB 4B9PA 3D51A 3B5GA 4OBSA 3BT2L 5DHXB 1Y1UA 2F5AH 5DJ6B 4DKEH 2Z3FA 2IG2H 4BD4A 5C0GB 3VI4F 1A64A 2RAMA 1E67A 4KQ4H 1N9PA 5CF3A 1ZXKA 3FUJA 5DVPA 4X6DA 3NCMA 3MV7A 2EAEA 3CE1A 3QDME 5LBGA 3EJYD 1QTPA 1KIUA 2XQYK 3HB3D 3CZUB 3WBDA 2CUMA 4PY8I 4X4KA 4CMMA 4PYGA 4XNZC 3GHBH 5I30L 4NWTH 1KJ2H 2OR9H 1YN7B 4GRWB 4WV1A 2IPKB 1WH0A 4DZBA 5CXPA 1U2HA 2ZOLA 2BWDA 1N12A 4NN7B 4OKVA 4UT6H 3VI4E 5I1DB 1BVLA 5KANI 5L7XH 3MV11 5HDOA 4ZMAT 5KAQF 1XR8B 2JB5L 2BIPA 4YHPA 2W9EH 1F1DA 3PWVB 4YR6B 3W3BA 5A43C 1L0XA 5FUCC 2XV3A 2H2SC 1J1PL 4IU3B 1I4FB 3FF8A 5D8JL 3QUZB 1I1FA 3GBML 3G5XA 1QUNA 3HAEA 4AQ1C 2B2XH 5KOVC 3IMWA 1OAXL 5GIRB 5C3IA 1R46A 2X12A 5C0AD 2A74C 4ODVH 1WISA 4RAUB 4ELKA 1RZKC 1QNZL 4OU3A 4R6UA 1A3ZA 4PV9A 3WIHH 1KCSH 1RP8A 1HQRB 4F7TA 2CBQA 5DC9B 3RZCB 4DPAX 9PCYA 5ICZB 3ZZ1A 3MCKB 4IRZA 4R7DA 4D0DB 2OP4H 2P8LB 3UBGA 2LOEA 3RTQB 1BYNA 4JRYE 2YAHA 3T09A 4ZJ9A 3RILA 3GSOB 1JWMA 2XBTA 3HC3H 1BEYH 3AXHA 5DFVD 4V1DA 1TZ8A 4XI5D 3P3TA 3OKLA 5AENA 4UINL 5DJXA 5FKAB 2PCFA 4ZNCD 1N5AA 2FL5B 4FYRA 3IDUA 3KPSA 5TE4L 2JCCF 5F0JB 3O2DH 2AEPH 1YQVL 4MQTB 2WIIB 3NZ8A 1KTJA 3ARRA 1QI4A 4FXGA 4UQ3B 3QO1A 5EU5A 1W9XA 2C3XA 5DJYB 5JIDA 3V6FB 1FQ9C 1VGEL 3IPFA 1JHLH 12E8H 5AZ2H 1SEQH 4YXHH 1LJMA 5B4MC 4A66A 3W37A 2QZQA 4XN8A 3MUUA 2X4NA 4F2EA 5CJXC 5IBLC 4LF3A 4E9SA 4K7PX 1AKPA 3H53A 1LQBC 3U0TB 3ISRA 4WI9A 2JCCE 1I3GH 2NX5D 4JQIA 3PGFH 1L3WA 4OLVH 3ULUH 1NBYB 1KN4H 2YGQA 3WHE1 2MH4A 3O11B 1SHWA 4OLYH 2X28A 4Y2DB 1P69B 4IGBB 2AK4B 3AMLA 2XTJC 1TETL 2HTKD 1FCCA 1RK1A 2QGBA 4W70A 1WGVA 2LAGB 4JFED 1GH7A 2HVKB 1S7XA 1N70A 1UXSB 2DTML 4OUOA 1L9QA 4FQXA 1A7RL 4QIRA 3OJVC 2Y7MA 4DP2X 3NH7L 2R29A 4FG6D 1RV6X 4NQCD 3T0EB 3EF7A 1BWMA 1OB1B 3DGCR 4MAYD 5I6LA 1L7IL 3KPRD 3IRZA 4BFIA 5BOJA 3MRBA 1Q38A 2CZNA 4J3XA 2E8YA 2BY0A 2EYTA 5FV2A 1QSEE 3MJ9H 4OSUH 2Z9TA 1MAJA 3ARDC 3G5YB 1CVSC 2J55A 3DURA 5CBAB 4ONFL 4O02H 4Z18A 4RMWA 2B7DT 4KX8A 3SGKC 4AQAA 5K9KA 3NAAH 4GW1A 3VD0A 5AAWC 4GFTB 1ZDSA 4O51B 1N0XL 3G9AB 4S1RH 4NUJA 2R2CA 3R7RA 2HT3C 4LKCB 3AZUA 5K9JH 2V2TB 5I17B 3T0VA 2M8XA 1JP5A 5DWPA 1JZGA 2CJUH 5T1KB 4PJAA 1ZTXH 3BUYA 4X9BA 3AB0C 4AVHA 2R1WA 4KDWA 4XMLL 1M7XA 4O9HH 5D70L 3L7FA 1GIGL 1UWEL 5F9WC 4M8QA 3H1ZA 1EVUA 1LO0H 4UUJB 4NPKA 4PRPB 5K69A 4OGYH 2KBGA 3R8QA 1JRHI 4BSWA 4IBTA 4JDEA 3I02B 4LCIH 2EXYD 4GAJL 2ADJB 3KXFB 3THMH 5D93B 5HGBB 1S9KC 3UTSD 2IH3B 3SJVE 4LMQI 1DLFH 5BV7C 1DHKA 3TV3L 2K4AA 1QACA 4NJAL 4OR1A 5H37G 3Q2LA 1H8NA 3S35X 1AY1H 3ZQ9A 3P4OA 1DQVA 1SBSL 3AT0A 4Z7UA 3FUDA 4JS7A 4JPVH 3QDJA 4Z95H 5T5FA 4ZTPL 1QRNA 4CU6A 1ZSDB 5BQDA 1TTFA 3GBNH 3MRLB 1RZFL 2E5EA 3LEXB 4OF0A 5DVKA 5H4YA 2O5YH 1EHLL 4WJ5A 2IH1A 4DKAA 5J12C 4KXDA 1R5VA 1MAMH 3WN5A 1JXFA 1R24B 1NSNL 4PIBA 4Y4FD 4ZOAA 3CLEL 4QRPA 2IWGA 2QPDB 4WGWB 1K4CA 3B7SA 3VXRE 1EAOA 4TUKL 4ALAL 1EBAA 4ZOEA 3BKML 4PJFF 2GK0A 4UB0L 2XVKA 3KBHE 3P9LA 3TIDB 2X4UB 5HYSA 1H6TA 5DO2C 3W11D 3APDA 2ZZUT 2ICEA 3LS4H 4XH2B 5FR3A 2BP3A 2JIXD 1K9TA 1E7UA 3L16A 5D7JB 3TWCH 4RQQB 3CX5J 5E23A 4GQ9L 4MKTA 4WQOA 4A7SA 4YFLI 1Y18B 3H55A 4EIUA 4FNPA 3RWEA 1RUMH 2EDNA 3ZW3A 1BXVA 2J5LC 3ARTA 4AQ8A 4CW1B 5CLZA 4UQ2A 1NAMB 2BNQE 4PJDF 5D2NA 4ZTOL 1XH3A 2JKJA 4WUUB 4H8WC 2Z35A 4PJFE 1NCBL 4NKOB 2R83A 2H7WA 3PHQB 3C6SB 4GO8A 5AD0A 1FFTB 4KTDL 5B39B 3SY0A 4AVKA 3AXLA 4EDXB 4HAFA 2ADYA 32C2B 5CN2A 3C2AH 1PGRB 2CQVA 5JO5B 4TNGA 3X1FA 4DO5A 5K39A 3WDHA 2X3BA 3WFDH 1PAZA 3I9AA 2WMPA 1MFDL 1NAML 3JT2A 1OF0A 2FH6A 4KX9A 1R3JB 5DEGA 4FQJH 3QK0A 3PP3H 1MUJA 1PDKB 3LVTA 5K33A 5BS0E 2I9TB 2EEFA 3MRMA 3NSYA 4RA0C 3L08A 4AM0A 4PJDE 4JHUA 1AXIB 1XIWB 1BGXH 3ZX1A 1CTNA 1E5YA 5M95B 4UQDA 3LIZL 3EZ8A 1RPQA 1IGFL 2X0VA 2NYYD 2DL9A 2MHAB 5K9QG 3LZFL 3IJYA 1F90L 3ZE1B 25C8H 3IFPB 5FYLL 1UCTA 5GSVB 4LESA 2J88H 5ID0A 4R9HA 3S3JA 2H2SD 4NZDA 4BK8A 4YHNB 1S7QB 5TGBB 2VDPH 2YMXH 3BSZA 2ZOOA 2Y2YA 2Z4QB 4AJWA 5ITFA 4HLZH 1BBDH 4P8QA 4JPKL 4HPHA 3DRTA 3A67H 2DOCA 4J2XA 4J1UB 4R4NC 2DKUA 1U91B 1D2PA 1PSKH 3B5HA 1MCKA 5JMOC 2EDRA 4QHLB 3VFTB 3SIKA 5A2KH 4O5LL 3B9KB 5ISZB 1WWWX 2JF1A 1NUGA 1IM3B 2WCGA 5D6CB 4PJ9D 1RU9L 3VO0A 2JLLA 1E9QB 2UY6B 1FLTX 3OJMB 1INEH 1CU4L 3HR5A 3IDGA 5TK2A 3PU7A 5AW3B 1F86A 1I7ZB 2BNRB 4XMWA 4KY2A 3VTAA 3B37A 1TZHA 1IM9A 1WITA 1BP3B 5IEHA 2NY0C 5DFWH 3PXJA 2XYBA 3DVNA 3KNBB 3NESA 3ULVH 2X1PA 4MMZA 3BFQG 5IFHL 1RJYB 1YEEH 2DQ6A 2QADC 3QPXH 7FABL 3QI9C 4ZUUB 4NC0B 4XNAA 4UTCA 4KTGA 3T3MB 2JE8A 5B3JF 3IDYB 1C08B 4L2LA 4JRYA 3MROA 3OB0K 3W9DB 3VNZA 2F54B 2QLYA 2Z8WC 3K8KA 5A6MA 5AW0B 5IW1A 2X88A 3KPMA 4LOEA 4MNQE 5FO9B 2K4WA 4AGQA 3AG1B 2JVUA 3N1FC 3TA3B 5IKCA 3JT0A 4E36A 3AM8A 2UZYB 2E7LC 4DN3L 4GEJA 2LHAA 1M7DB 1TJMA 4Z7QE 4G5AA 1KB9J 3CC5B 4ZXBB 4YSEA 3CDZA 1CGWA 1NC2B 3KPPB 3PL6A 3SB3A 4N8VB 1A21A 4OCWL 5EU6E 4S1DC 2GIYA 4E41A 2YSSA 3I2CL 3M1OA 4JQXC 3AT8A 1A9EA 1CLOH 3ZTDC 3VXUA 2CBPA 1Q1JL 4KJPD 1N59A 1Q94B 4K9EC 1XF4B 1YPZB 4N6RB 5TDNA 3MA7A 1T7XA 1PLGH 1DVFA 2WC7A 5EN2B 3A3YB 1ANUA 4A2FA 5JXEC 1PX4A 2HG0A 5F9AC 5IB3B 3RRQA 3QARA 4PW9A 3F2LA 1I9RL 3D2UA 4L9DA 4N9GA 1YECL 1E5AA 2VR9A 4MMXA 3RURA 3E8UL 1CDHA 2GTZA 1VKXB 4IOIB 4R4FH 4X0KA 1DJYA 4NQTA 3BVTA 3GJEB 2N56A 2K0RA 1K3IA 4XPGL 3HG0A 1E6OH 4FFZL 3VSUA 2XKNA 4ZMZA 1GC1H 2BOBA 1VHPA 5BRQA 5K5YA 5C07E 1WFIA 2V5YA 2QPFA 3LH2L 1NDMA 4Z7AA 4NBYB 2X4PB 5DMKB 3QZOA 5HDLA 1U8JB 1F4XL 3S7GA 1N64H 3VGEA 2IAMD 3VYNA 5TDOB 4BXVA 3O3AA 1I1AC 1G7PA 3VFWB 1QSEA 3TO4A 2AJSL 3EYSH 4KTEL 1QFHA 4IRJD 4H5SA 4GRLA 4I0PA 5HGDB 2QT6A 1XGRB 4F7MA 2YKLH 2Y2TA 5TDPB 5IM7B 4HWNA 5E1QA 1BV8A 3KJ4C 1CDUA 4R90H 3GMLA 3X13A 3VYOA 5JQIB 4A7TA 3DTXA 1RURH 4TLSA 4Y4KA 1UXWA 3MJ7A 9CGTA 4LHJB 4LP4A 4U6VH 1ACXA 5FHBL 5GJTH 4BKSC 4MXVE 5J11C 3VFVA 1RCYA 3KPOA 1F4WH 5T3XH 3BIKA 5JORA 3BT0A 3F7QA 3HG2A 4G1EB 3N9GL 2VC2H 2GCYA 2VM3A 1DJXA 1NUFA 1QI5A 4S11A 1AHWA 3M1BA 4M8UA 4TPRL 1JGLH 5CU9A 1X4YA 1DCEA 2WO3B 3LRLA 4GAAA 3MYJA 4JO3H 5A40E 4JG0H 3VX1A 1NBVH 5EA0L 3VFUB 1CDBA 1I1YA 4AG4L 1DBBL 4L48A 1FL5A 2DM7A 4XVJL 3SJVA 1GGUA 2QKIC 4G42A 4FFVD 3ZZLA 4LPXA 1A3RH 1MCHA 3VYPA 1ZMYA 1E4XL 2WNKA 3CFBA 4MS8C 1S7VA 2DV6A 1BQSA 5IMOB 4CN4A 1IZKA 1D7FA 1JXDA 1YEHH 5KANG 3V6OC 1UWGL 1F4YL 2Y5TB 2ZX5A 3IU4H 4HZLA 3WE6B 4U3CA 4BWWA 2NZIA 5KVEL 5CZXC 1U8NA 2HCZX 2VR7A 3GSUB 4PBDA 3QISA 3GEWB 1X5AA 1JYNA 1W15A 2BDNL 2JWYA 2QSCH 1N2RA 4I4WA 3N0PB 3BE1H 1PKQB 1A14L 5E7FA 3VXRA 3LMJL 1TEYA 1MCJA 3U82B 1T04B 3G5XB 2YXFA 1FHGA 4HUUA 1F42A 2J73A 4GSDH 2YQGA 4W6YB 2C4FU 1BD2B 2UYLB 3MRGB 4I18A 3ABGA 1QR1A 4Q6IA 1QZ1A 2Y6SC 5F21B 2WXHA 1ZT4A 4O4YH 1HHKA 1D5XA 1IFGA 3IMSA 1XGTA 4Y8DC 3QUXD 1X5MA 5MI0B 4DVRH 2H9GB 2DLEA 2VDLH 4KKLD 2BCKA 4B27A 1HYRC 5AVZB 5KYUA 2PO6A 4PV9B 2JI1A 5TTRA 5I8EA 4F7TB 3ATEA 5E6IC 2NY6D 4WI4A 2NXYD 3CD4A 4TSBL 1RZGA 1MHPH 3K2UL 3PFUA 1W6WA 4XZ4A 5SX4I 3N5AA 1J0HA 4PJGA 1F0LA 1E7VA 5EEWA 2YUVA 5DEZA 2A1WL 1CK0H 3KGSA 1G87A 2VDMB 1CZ8L 2Z93A 3O3BA 4Z3EA 2BP8B 5JW3H 3X3GH 5I2IB 4JM2D 5AVYB 5HYJA 3D7PA 4OM0H 3SODB 2LTQC 2FQGA 4LO9A 4YQXL 5DFAA 5CEXA 1B0RA 1QLRB 1Y1DA 4Y2OA 1D7CA 4WFED 4Y5XB 2YGNA 2F53A 3WG7B 3BWAA 2CDEA 5I8KH 1TIUA 2WLZA 4Z5RA 5ICXB 3WTSA 4K8RC 3TEZA 2OMXB 3AG3B 5I16A 3BZDA 4G3YH 5T8IA 4L4VD 4PJ8C 3Q1SH 4E5XB 1NOAA 4WO4B 1T0NA 2BWIA 4TRPH 1IKNC 1BJ8A 2PLTA 2X9WA 3PWPA 1RZKH 5FECB 3MLVL 1AR1B 4PJCB 1BX2A 1MCCA 3HZMB 4F15C 3C87A 1U93A 2CPUA 1ZLWK 1RUQH 2MQCA 1E6JL 1L9TA 5DD0L 3PHAA 1JSYA 1QLEH 2DWDB 4BK5C 1L9OA 3NCYP 2QJDA 1J11A 2XRAL 3PDDA 4RFEB 1HHIA 1RD6A 3IXTA 1KEGH 4MA1B 5AUMA 2DLIA 4B9KC 3T1FA 1MN4A 1AHKA 4H2CA 5DWUL 4HOZA 4UOJA 3U4EA 1PW3A 2XV0A 3O4OB 3X17A 4WFFE 4KZEH 1LEIA 1BZ7B 2XU9A 1VRSA 5AWNH 1C5CL 4Z3FA 1NKOA 4KJWD 1OAQH 3O9WA 4PG9B 3KW8A 1B9KA 4BFJA 5J1AB 4AGOA 3FRUB 4L4TD 4U3SA 2ITCA 1UEYA 3OMAB 2FQEA 1GGBL 1CBVL 2R29L 3MA9L 4PB0L 5A2JH 5J5EA 4ZPVA 5B38G 1QSVA 2V3FA 2D03H 4JFZL 3GZQA 3UC2A 1RJZA 1TVDA 1MJ7L 1X5ZA 3KJ6L 1XGQA 5I0DA 3DBSA 2GFBA 2YGOA 2H32H 4POZD 3U4AA 1J0KA 1SXCA 4OFPA 2APBA 1IUZA 2UY7B 2AK1H 3B8SA 3H9SA 1XVSA 1T22A 1BCIA 1YNLH 1Z3GH 2FIKA 2DQFA 1LWRA 3TCLA 2MIZA 1SFHA 1U58A 5E95B 2DQUL 1AQMA 2W80C 3GC3A 4DVBA 2QTVA 2VDKH 1PZCA 1VFAA 1XZ0B 2DQEL 3Q7JA 3RWCB 5EF0A 3T71A 5JIQA 3D3VB 2WZ0A 4CILA 5C92A 2EILB 4ZOCA 2B4CC 2BLFA 3B3IA 3UBXG 4ONGL 4Z78A 1JDAA 4UV7H 5EO0B 4TS6A 4HWZA 3QE5A 3QZMA 5DMIL 2VMCA 2FEEL 2EDEA 5L8LB 3ZL2A 1D5BB 3IXAB 4ORGB 2HP4A 3GSRA 4MAZA 4OFYA 1JHTB 4NERA 3WNKA 4S0SD 3RUGB 3DPDA 2WSDA 3PABA 1ZANH 5LN4A 4ZUWB 4WFHD 3MRJA 1IRAY 3V6BR 4HIIA 3S3BB 3QJUB 4YH6A 3QS3A 4RGNC 1F3JB 4LKXB 5JQ6L 1U21A 1E65A 2D9CA 4JFFB 4QOKD 4KDTC 2CLZB 4ICWA 5EUKB 3K0WA 1JDCA 4GO9A 4L0YA 1E8XA 1T2XA 1OPOA 4JHAL 2BVUA 2HVBA 4EXKA 1VFMA 3SSGA 3T2QA 1Z5LA 2ICEB 3ISYA 1SOKA 1VERA 5FHAH 1H5BC 4NLAA 3W82A 3INUH 4P46A 4HALA 5K93A 3RBSA 5HVHC 4RH4A 3GM0A 1JI1A 5I26A 3A21A 4G9FA 1OCWL 4BSVB 1FFNA 3W2DL 3RE0A 3FW6A 3JWNE 5BV7H 5I15H 1RZIA 1ZCRA 3FT4B 3GSXB 4L23A 2C1PB 4EOWL 5C0FB 3OMZA 1IAII 3MBEB 1J87A 3SKMB 3TO2B 1TTAA 1OALA 4ATTA 2YPVA 3QIUB 2H2PD 1XD1A 3GTVA 5FPIA 1RPKA 3BW9B 1MIEL 2R0KL 4L1LA 3HG1D 4AL8C 1EMTH 5A7EA 2KYIA 1A6WL 1AD9A 4ENZA 1AGFB 2AW2A 5IR1A 5I18L 5ACLA 1WBXA 4XMTA 5I19L 1YNTF 3RWFA 2KKQA 4DP4X 3QZBA 3NIDE 3DUSB 4NO2A 3WJLA 1JWSA 2XN9E 4LCWE 4PJBA 3QC5X 4MAUH 5CZXD 4L1HA 3FUKA 4JPSA 4DUXA 5KUMA 3LN5A 3OXSA 3CDCA 4KAQL 4ADJA 4EN3A 3FNKA 1N3NB 3PJNA 3D34A 1Q0XH 1YEFH 1QPPA 4URTB 5FUOL 3U9WA 4U6YB 4PY7B 1QQDA 5EIIB 5I9QB 5F1NA 4N2MA 3H85A 4IBQA 3C5SA 1X9LA 4Z7VB 2UWEF 3A4DA 4MNGE 2KUTA 4N0CC 5GS0C 3QXVA 4H8WH 3BAEL 1FIGL 3PXLA 2DQHH 2NNCA 1GJWA 3H7BA 3OMIB 4FP8H 4BQBA 1YZZA 1PG7L 2Q2LA 4HS3B 4GT0A 2W07B 1MRFL 5E9AA 2ZXWB 4F7CB 4XBPB 2CDFA 4JN1L 1HZLA 2CK0L 4R5TA 2QVIA 4RISH 4WW2B 5IQNA 4E42B 4HJTA 3G5ZB 4N25A 1KDJA 4XPAH 3A0OA 3CHSA 2YKKA 1DUZA 1E5BA 3QDHA 4LIQL 4NENB 4YZWA 4B6ZA 2UWEE 5KSBA 1J8HD 1IM9B 4L8DB 4X6CF 2EDFA 3CLWA 2C4FT 3LNFA 1G9NC 3ZUCA 2COVD 4WWPA 3RWDA 1G7LB 2IPTL 3Q8EA 2MNJB 5IMKA 3VMOA 1HOEA 4FF9A 4YBHA 3S36L 1DBMH 2VCOA 3BXNA 4LSQL 1KJ2A 3ARPA 3V8CA 4ANVA 2X6VA 2ITFA 1MHCB 3PXHA 2R2EA 3CFUA 4JN2B 4PRBA 3PDOB 4ZDHB 2RB8A 4PJ8D 2NCEA 5C0AE 2WP3O 2DEYX 4L0PB 3MJGX 1INDH 3WFHB 1KLGA 3ZUNC 1X4ZA 3B43A 1OSZB 2QMKA 1PFCA 3LPFA 3TXAA 5SWZD 2EEAA 2GJPA 3G9VA 2LV4A 3PQYB 4JO2L 5D7LD 4N6QA 3ZPDA 2YPKA 1YEIH 1U8OB 4F1ZA 4V2CB 3FB8A 1ONQB 4G6FB 4HOMA 4AH2B 1KTLA 1FGNL 5T3ZH 1L9NA 3L3HA 5KW9H 5DHYA 1KJMB 4XCFH 3VXUB 4HW6A 3S2CA 2IQAB 3VFRA 2ED8A 5E8OA 4LCUB 1XB6A 5FUZL 3BEWA 4H1LH 3UTQA 3VRJA 3G08B 4NT6A 4R84A 3ZHDA 3DMMC 4FHBD 2XWZA 3L6FB 4XX1G 3FN0L 3HCVB 4M6NH 2VL4A 3X12B 5CEYB 4QRQB 1NC4B 4N1CA 2FEJA 2BW5A 1FE8L 1WJ3A 4LOUD 3REWB 1KACB 4BFBD 3RHWF 2ZG1A 4AV0A 1V54B 4RMUA 4A7UA 3HPJA 5D1QC 2AI0H 3GPSA 2ED7A 3L7EA 4YLCA 2XKNB 1QFWM 1OLZA 2BOBB 5B7MA 3OL2A 1K8IA 1X7QA 3ZTNH 3QEQB 1BIIB 2NX5E 3KCWA 4PP1D 3G6DL 1E4XI 3QQNA 4WDIB 2JKTM 2LFGA 4LAQL 4P5TC 5I6OA 1NDMB 3NCJL 4NHUA 2OXGA 3VWJC 3X14A 2D3VA 4R3SA 3ESUF 4P06A 5JLZB 1Z9MA 1CG9B 4G2AA 4NKIL 1JYXA 3O6FA 2ZCLL 4MJ6A 4JFEE 3EGDA 2AV1A 2X70B 3IDJB 3EH4B 1BXUA 3QR1A 3DPBA 2BC4B 4NYLA 3TGXA 3CZKA 3Q6GH 4K9EH 2FT6A 1T2JA 2MKLC 3FQTB 4DGYL 4NQCE 3EJQA 1KV3A 4WK2B 3OQRA 3ZKXB 3NIGB 2D7OA 4GNKB 1RXLA 4E0RB 3KPRE 2WUBH 3RVWD 3U9PH 1RHFA 5GRXG 3CUPB 1JNNL 4QRRD 3KPOB 4NGHH 4BRJA 4IMLA 4P9HL 1DBKL 1HXMB 4HT1H 4X4ZA 4FABL 3F8UB 1ZDQA 1FO0H 2ZOWA 2E76C 5CSZB 43CAA 4AUUA 2G9HB 1PEWA 2XACC 3W1ZA 1KXQA 2F1BA 3I6LD 1KTRL 4AMWA 1WICA 2ZPKL 1SF3A 1YY9D 3KDMA 3PPSA 5EOCH 4AXWA 3V5DA 3MRPB 2N1KA 4R7NA 4Z0XA 5E0QA 2OSYA 1NAKH 1UD2A 1P5VB 2J57A 4O02A 5HP5A 4M1CC 5FF6B 1TQUA 1EH9A 4DOHE 1S7VB 3FQYA 1U8KB 3BRDA 4KY1H 2PYEA 3DJTA 5DUML 4ENED 1E9PB 2AVFA 1TMCB 3QC6X 2R4RL 4CVXB 3TT1H 3FOLB 3MV9A 5D1XA 4YX2L 3QUYD 5GGUB 3PYCA 4FDWA 4NWUH 1GZQB 1CICA 1IZJA 2MQ0A 3BN9C 3H0TA 3KYNB 3UTSE 4D0BA 1CL7L 4I4WB 4RMRA 2R0WL 4PTUA 5LGHH 4EVNA 2CDGB 4YHLL 5MEOB 1P7HL 3SDAD 4ZAKB 4WWKB 2R39A 2WVSA 2WZPA 5G5DA 1S3KL 5F7DA 3L3DB 5EULV 4CJ0A 3CMOL 3JBG7 5DRZB 2YRZA 3R1GH 5E9DA 3TN0B 1X44A 4LSUH 1P1ZB 4N0UA 2ATPA 2EZ0D 2ODIA 2C26A 4XPHH 1QKZH 1P5UB 2CLVB 4JX0A 3IMUA 3AAZB 3UDWC 3ROLA 5GISH 4UWQB 2DLHA 3LPWA 4Z76B 3VGFA 2R59A 5HPMB 1WWCA 2NUPB 3ARBC 3M46A 3QR0A 1K85A 4Y1AB 2CKBH 3N04A 1OK0A 2N7AA 1IARB 1TEFA 5E8DH 1GOHA 3GK8L 3ZO9A 1I8MA 3FYIB 2CMRL 4HMDA 5JOFB 5MEND 5BRPA 1NH6A 3ILQC 1ZV2A 3OGOE 5E08L 2Y7NA 4FNQA 4KKAD 1G1CA 2YPLD 4OF5A 2EE9A 4LQFH 3GO1H 2XPZA 5KZCD 3BUIA 3KLKA 4HXBL 4TYUA 4QHPA 5LNEA 2WVVA 4RAHA 3HN3A 2CDEB 4Y4HA 2OCFD 3ES6B 4Z5RB 2NY4D 1FFRA 1QFWH 3IDIA 4L3EB 3RJQB 5EUOB 4GQQA 3TNNB 1PD6A 4LCWA 3CU7A 3KBFA 3C6LD 1F18A 4G8IA 2F7IA 4DF9A 5FA3B 4YXKH 3VGDA 4LHUD 5BZDB 4IIQC 4L29A 3MMEB 3SCMD 3VFPB 4UIKL 4HSAC 1GOFA 5CS7A 2QR0A 3IMBA 4GIPD 1BIHA 2Y25A 3BMVA 4C4UA 5IROD 3VDAA 3K6NA 3L2NA 5T1MA 4JO4L 4JEGB 5BVPL 1MCSA 5L2KD 1ECZA 4S2SB 2ZUSA 4JRXD 4MNGA 3GBEA 5J1TC 4CNIA 1LVEA 3N6YA 2FHBA 5I0XA 4M03A 1CIUA 2DJUA 2QQNL 3LYRA 4LLDA 2YZ1A 3U4EB 4JNXA 5KVDE 2Q1EA 4ANUA 2FEEI 1GAFH 4KPHL 3E9UA 2ZIDA 3RNQA 5I1AB 1BQ5A 4N8UA 4UAOC 2KH2B 3T2NH 1VACB 3QORD 1CUOA 1A22B 1NCAH 1RI8A 3D33A 4AGLA 4AEHL 2X89D 2G60H 1CR9L 5L6YL 4D7BA 2ZWZA 3LN4A 4U3SB 1MZZA 4K8RH 2Z31C 3WLWD 4HEME 1M05B 1OAYH 2NR6C 4K3EL 1OAZL 2DLFH 4BFGA 2F2HA 3T4YA 1G9ML 3QDAA 3SPJA 3BWZA 1O6TA 3QO0B 2E47A 4W9KC 3F01A 1LK3H 4PP2A 4V33A 3ZDZB 1JNLL 5H37H 3V9EA 1RKRA 1HKLL 3OQ3B 2HSIA 2WXFA 3S34H 5JHBA 5ESAB 1I8LA 5A3ID 4OI7A 1S78D 4WHYG 4PS4L 1MHHA 1UOLA 2VXQL 4HEPG 4FULA 4TVSa 1I9JH 1YJDL 2GJZB 3RVUD 1GZPB 1ZOXA 1IBGH 3WXWL 4P2RA 2C7UB 5FGCB 1JUFB 2XOTA 1MQ8A 3EYUH 5CLXA 5JPMA 4UBDC 1T5WA 5IV2A 4U1MB 4LSRL 5CCHE 2DKMA 1KPRA 3GXUB 5C2BH 2J5WA 2HTLD 2JKRM 2WKGA 4PRNB 1F8TH 3HZKA 4K3JH 3QDGB 3DRQA 3UTZB 1VFAB 5MP6H 3NK3A 3VM5A 4QXWA 3TJEH 3EYFB 4MDRA 5FYJH 4XP5H 2NSMA 3KBPA 4D94A 3C12A 3FQXB 1KEMH 4NPYA 3DECA 2VR5A 1IAOA 4Q7DA 5TF0A 2FSEB 4R96B 2ORBH 1E4HA 4CC0A 1EANA 2GBVA 5EF3A 2I07B 4UT7H 2E6PA 1ASPA 1XGUB 1KWKA 5AB9A 2Y69B 3A6BH 3KH3A 5GRJL 4KK6D 5B39G 5I71B 3WEBA 1FFPB 3W39A 4ZMWA 1WDAA 3BLBA 1U6AH 1WAEA 4JMXA 4JB9H 3A22A 4UTBH 1OE1A 3ESNA 3MNWB 4OJFL 5LAPA 1LO2H 4A6YB 3SDCB 5CGTA 1SY6H 3N50A 5HGAA 4DETA 1OANA 3DX1A 3D05A 1YMMA 1LO5A 1TVHA 4JKNA 3EJZC 4L9LB 4NQQA 5D1ZD 2XWJA 5GGQL 3T4AC 1AQDB 1YY8A 3AABA 5FYKL 2O93L 3C60C 3H9ZA 3RWGB 2KMWA 5JDSA 3L9EA 4GI8A 3CFIC 2GEQA 4A6YL 3WL9A 2JJTA 3ZSTA 2NX5A 3OKMB 3DBXB 1S7TB 4ZQKA 4LRIA 5JIPA 4FG0A 4DK3A 3MBWB 4EI6A 3E1ZA 4HV8A 1S5IH 1R3HB 1TZOA 3CSYB 1DSYA 1JD7A 1ITBB 4NQVA 4RMSA 2WNXA 1YN6B 4QY8B 4CVZA 4Z77A 5JMRA 1WO2A 1JGVL 5AOJA 4G7QB 1CFQB 4YVNA 3MRRA 4HYTB 3S8GB 1HL4A 1O7DC 4EAEA 4X7TB 1JFHA 5DF0A 4DP9X 4XAWL 3LKNB 4UZUA 5EZIL 3DVFA 1UJ3C 2WSKA 1OP5K 1AQ8A 2BVQA 2R1YB 1RQ5A 1KTDB 2DF3A 4TVPL 4YK4C 4JAMA 1CQKA 3WE1A 3V0VB 1UC6A 1U2YA 3KPRA 4WHCA 3UG3A 3MLRH 4XRCA 2KZWA 2VDNH 1J18A 1FGVL 5TF1H 2WLLA 1C16B 1W8OA 2YPVL 5KG9A 3FTVA 2X6MA 3AMKA 1AD0B 2HVJA 2NYZA 1JWSB 3C5ZC 3MV8D 4FNRA 2LU3A 4PJBB 4U1NB 2ADIA 3P11H 4X99B 2ZXEB 3T0XA 4LOFA 2VMFA 4X5PA 2FBJL 4MQ7A 3IDMA 4LLVA 3DYPA 4RFNB 3EHBC 4LEOB 4UDTA 1N7ML 2ODHA 2XIIA 3QJZA 1JD9A 1KBVA 4OCYH 2HFGH 5HI3C 4OZIF 3P30H 1CDCA 1WCBA 4BZ2L 2P5WD 4MWFB 4AMKH 3DK2A 5EWIL 2YIHA 3QZWB 2XXGA 3HS0B 2B59B 1FBIH 1S3RA 1WIUA 4JZJB 2C1OA 1CE1H 4HMCA 2W81C 4MSWA 4OCRH 2GJ6A 5GHWH 3RIFK 1JZDC 1TKWA 3HMXA 3SPIA 3UTSA 1CI5A 2ZXAA 1EO7A 1UUSA 4JFXB 4AL8H 4X9HA 5HJ3A 4BCZA 3GKWH 1IFHL 1JN6B 2HB0A 4PHZA 4N8VG 2W0LA 4PBXA 4L8CB 4UANA 3TJHD 1KZYA 4XNBA 4LEEA 4WEEA 2B14A 1X4XA 4WIQA 2EUZA 1PZ3A 4X83A 4NUMA 4OJDH 5IF0B 4HGWA 2E59A 3ILQD 3EFFB 3CAFA 2X4TA 4FTVA 1JG9A 4FJZA 4Y16D 2AJYH 4WENB 2GBUA 3I9GH 3MJ8A 3L5IA 1JYWA 4DKEL 1U8HA 2IG2L 1LWJA 4HH9B 2H47C 2OTUA 4L8SB 2B5IB 4Y4FA 5HTSA 2X05A 3WHXA 2DBLH 1O9VA 4KQ4L 2KLTA 3F62A 1XXDC 3BUQA 4PFEA 4WU7A 3NFPB 1P4LA 4NN7C 4AYID 5DS8A 3P4NA 4G8GD 1AS8A 1RIUH 5DYOA 3RL2B 3ULSA 4RETB 5GS0H 4U1GB 4JM2F 4XXDB 5EU7E 3QUZC 1CFTB 1A47A 4NWTL 1GGIH 3D4YA 3U4BH 3UBFA 1HSBB 1BJMA 2ENPA 3HE7B 3DHJA 1MCLA 4LSDA 2VWEE 3MGTB 4NQDB 3CX5K 4BCXA 4UT6L 5CILH 2C3WA 3ETTA 3L95B 4LB8A 1S9WB 4AQEA 2IBZX 4N68A 1UGKA 2R56H 4HUCA 3ME0A 2MOQA 1UM5H 1XAKA 5HHOB 1MFEH 2W9EL 1KTLB 2IAND 4ISVA 5BXFB 4HLEA 3OJ2C 4IJTA 2GABA 3MNVB 3MPCA 1A7PH 1EBPA 1KPUB 3DJ9A 3RZCC 1XTMA 1JGEB 5IW6A 1Q0YH 3F7YA 3RTQC 2EUWA 5DK2B 4CVUA 2EH7L 1UVQB 4M5YH 1XSJA 1G9NH 4K7PY 1G84A 3FO2B 2VJ0A 4JGJA 4ODVL 4WFEE 3S9DB 2K3TA 1YYLL 2HXAA 4JKWA 4LLMA 4GG6A 3QHZH 3FFCD 1SJHA 1GMEA 1EAPB 3QQXA 3V0EA 4XCYA 4HKBB 5LGYA 3PWNB 3NEXA 1KCSL 3D0LB 3OPUA 4KKNA 4U1SA 5CIPA 3BDXA 3SE8H 2IQ9L 3V6ZB 4L4VE 3TYGL 2OP4L 3HPJB 5C7XH 3CZSA 1M2VA 1WT5C 3S97C 5CJ5A 4NZTH 4Z7OF 4KKQA 2IXQB 3N55A 1SYVB 3HC3L 1BEYL 4PGCA 5IVXB 3LKSB 4U1IB 4WUKH 1M6OA 1RZ8B 5IK3A 4YOKA 1NGPH 3CFJB 3GJFH 4AQ1A 1EO8H 1TTCA 1UYWH 3NSXA 1XZWA 4TQ8A 3O2DL 1NOFA 3VXTA 2AEPL 2A74A 3ROOB 5EZJA 2Z1KA 4JZOB 4XXWC 3WY2A 1AJ7H 3SGJC 1LILA 1LYQA 1OZTG 1VESA 2NW2A 4DW2H 4BRVA 1KWGA 5HDBB 3UTTA 4Y2DC 1CL7I 1KCLA 5LDUA 2OI9B 4Z7OE 4JM0A 3DX7A 2F19H 3VFNB 1RL1A 12E8L 1MKFA 1RK0B 1SEQL 2VJ8A 2XETA 4YXHL 4RIRB 3W9EB 3QUKB 1E5UI 1DFBH 4FZ8H 3P2BA 2H8PA 2EIDA 1WZ1L 5EOTB 5JPNB 1I3GL 1F1AA 2BH0A 3LEYH 4L4TE 1TNNA 3I50H 3PGFL 4OLVL 4PLJC 4UM9A 3QWOB 5CCJA 7CGTA 4P2YA 3ZGIA 1J86A 3BZ4B 3X1GA 1UXLA 1KV7A 2LT9A 1FVDA 3QEHA 1NGYA 1VIWA 3T0EC 4F20A 1U8LB 3L5HA 3A24A 3G6JF 43CAB 2ARJQ 1AS6A 1THAA 3EO1A 3DYMA 4DPRA 5JW4M 3GGWA 2YUWA 3F7VB 3JTTA 4AXWB 2QDVA 2JELH 4F7EA 2A6JA 4ATWA 4R7NB 2FCBA 3FF7A 2FWOB 2XQYA 1W0WB 3TEWA 1E0OB 2NNRA 1JF1B 4PR5A 3RWIB 5C8JB 2WANA 3VXPA 1T0MB 2JJWA 5T1LA 4YZFF 2OXHA 3T65B 1NBZB 2ESVB 2EO1A 4IRSD 2BRQA 3WS3B 3N41B 3B34A 1E3ZA 3UEQA 5ILTH 4F7PB 3G6JE 1K6QL 3D2TA 2H32A 4GBXB 2EIZA 4GJTB 3MJ9L 4KMTH 3MUGA 5TQ2H 1SHXA 4O02L 5GGVY 1PU0A 1QSZA 3TTYA 3TNMA 2X6BA 1HCZA 3O45A 5CMAA 1AZVA 1T1ZB 4PTUB 5I1KH 3QFDA 3U6RA 1WP6A 5DD1H 1OSPH 4S1RL 1KCVH 1KB9K 3I84A 3GIVA 4YZFE 5F3BB 3FB5B 2DWSA 4F3FA 5K9JL 4JPWH 4BQ6A 4U33A 5BRZD 4OM1H 5JR1H 5E2VH 4E5XG 2CJUL 3AY4A 5E9DB 5KS9F 5FW6A 2O6CA 5EDSA 4J4PD 3I75A 4WFHE 5KYWA 3STZA 4O9HL 4XMUA 3BHBB 1LO0L 2YA0A 2BVOA 4U4BA 3TFKD 3PWJB 1COBA 3P3UA 3K1KC 4ALAC 2VZ3A 4OGYL 2O6EA 4QOKE 1F56A 3U83A 4D9LH 1GKEA 1MH5A 3ARDA 5DD6B 4LCIL 1A7QL 5BQ7B 3SBRA 3THML 4Z6AT 4QTHB 2WZ5A 4OUUA 1MLCA 4PJIA 1D5MA 3SGKA 1DLFL 2HLFD 3GRBA 3WKNA 3HUJE 5AAWA 3FN3A 4N2AA 4Y19A 1AY1L 2MEJB 1KULA 1WFJA 4PJEB 2EJ1A 3QFGA 5I73C 5GSRA 4JPVL 4CADA 2ZUTA 1EEZB 4TUUA 1MW2A 3UPAA 2XXMB 1PD0A 3VXSB 2IAMA 4KVPA 3GBNL 1U8IB 5GGRY 1BQRA 4L3FA 2O5YL 4LLUB 5D7JC 4G83A 1IGJA 2YMOA 1VJSA 4L3CB 4PGDA 1MAML 2NXZD 4JFDD 3IDIB 4WF7A 3E8VA 3US0A 5HD8D 2H4EA 1XF2A 4Z7WA 3EFOB 4M9OA 5EO9A 5BO1H 2WTRA 3NZUA 5IJVA 1RJLA 4TSCH 3HG1E 4PJ5D 4I77L 3UFIA 4LCYA 4ONHB 2YXWA 3LS4L 3WEOA 2KC0A 4XX5A 3HHSA 3TWCL 3PWUB 3SE6A 2D0FA 2VABA 3U0PA 3WNIA 4XB3A 2F74A 2FJGA 4OGXH 1RUML 3GMNB 2YOAA 5CD5D 2BHFA 5HJBA 4G72B 3BX7C 4QCIA 1TVBA 3WENA 2XTLA 1K72A 3N40P 4M5ZL 3HVDA 2IIJA 3CFEB 3EH5B 3JVFC 3X11A 2I25N 3O6MH 3O0RH 2MFNA 2F0CA 1NLDH 3LZNA 3BVVA 5CGYD 1AHMA 1SVCP 2Q76B 3UIZA 1M4KA 2O5NA 3DOHA 2VERN 1IAMA 1SFDA 3C2AL 1JRHH 3RWHA 4QJ4B 3OZLA 3LZRA 8CGTA 2D7TL 3L5XL 2R69H 2FYYA 4FQJL 4X4YB 2P52A 3SKOA 5E5RB 3V7AE 1UD6A 2FD6H 2Z65C 4Y7MA 1BGXL 3D18B 4PIRF 5LXGH 2VDPB 2BHYA 5GGSA 3ZDYF 4OIAA 3WTWA 1V10A 1LNUB 2FGWH 2WGNB 4OZHF 3KWTA 5KSAB 3FMGH 4XMXA 4F92B 3FT3A 1GW0A 1PZ5A 3QQ3B 3TTSA 5IHHA 3EJTA 5D2LB 4DESA 4LT7A 5I8OH 4QXUH 4Q2ZA 1BG1A 1L5GA 2J88L 3B9KC 1HH9A 2B1HH 2KERA 5E8EB 1WFMA 1J8HE 1S5HA 1EEQA 3KLHC 2VDPL 5F0PB 2YMXL 3Q2WA 4NZUH 3SDDD 4C57C 1SDDB 3QFJB 3GXFA 1FJ1A 4IMKC 3A67L 4GSQA 1F97A 1M7IA 1JZFA 4OZHE 1UFUA 1WGOA 4NQEA 3DYOA 1KC5H 1LGVA 3DIFA 3SDXA 5ES4B 3IE9A 4WW1B 3GXNA 2F7QA 4NFDA 4EN2A 2ZX6A 5DJAA 4TQIA 2VERA 4R5XA 1DSWA 4PPTA 2HJFB 2CGRH 2OX5B 1HQ4A 2EH8H 4UNVA 1INEL 1DYZA 2HRGA 2P7TA 3KD4A 5GRWA 3IDYC 4FFYA 1HSAA 1GL4B 3NJHA 4WKZA 3GI8H 2A0LC 4NO0D 5KSUB 3W39B 2W94A 5SWZE 1BQLL 1YHPA 1DLHA 1T03H 5D7LE 5F7EL 1T89C 3U6XS 1NCTA 4J5VA 1RULH 2WXLA 1UD8A 1FVCA 4CN1A 3OG4B 4D7PA 1PZSA 4RRPA 3ULVL 4WJKB 4PREB 4XAKD 5T5NG 1G7MB 1YEEL 3QPXL 4RAVA 4JVUA 4JFPA 2FJUB 5JHAA 3SBPA 3SKJH 4DZ8B 3GTTA 4YFDB 4G80A 4ZRGA 5M94B 5AZEL 1ZA3B 4YNYB 1MNUH 3NEEA 4Y2DD 5CSBA 4PW4A 3BN3B 4YIQB 3NDYE 4ZXBC 2OW7A 4IGBD 2FUQA 2VDOB 4RMVA 4XWOD 4OV5A 2KL6A 1K8DB 2DYSB 3O4LA 4XC1H 3CN3A 5EBWB 4YAQB 3ZHKA 1IE5A 2G75B 1LL1A 5C9KA 1P4IH 4CVZB 4PLJD 5DQJB 4PAZA 3ARED 4CJ1A 1INQB 2B9BA 1KLFB 5B7FA 3EBAA 2CIIB 1ZJBA 4M3HA 4NO3A 3Q48A 5TH2A 2DJMA 2E7HA 1N0LB 2ZYSA 3CCHB 4H1LA 1ZLDA 4GAFB 5CP3H 1AE6H 3PV7A 5I6MA 3GS7A 4DCQB 3BAYA 3QI9A 1QBAA 1VF5C 4PBVC 5DEJA 3FCBA 1LWHA 3LS5H 1SN2A 4DGWC 1JXGA 3R18A 4IOSD 4I9WD 3K5RA 3MRIB 3U7WH 3WEXB 5IIEA 4GQRA 1B3JA 1PLGL 3MLZH 5CINH 1Q8MA 4HC1H 4J3OD 4WNJA 3U1SH 2CHXA 3PHSA 5DK0A 4AJVA 4CUCA 4F9LC 3VD3A 2FWUA 2CIKB 4W9CC 1MSPA 2BM3A 1A4JA 4ZUSB 3POCA 5C9JA 5KBKA 5F7MC 2EDJA 2W1NA 1ADQH 4B53A 5FCUL 2Y06H 4XBGA 2FEDD 2E7LA 5ANHA 4R4FL 2FO4A 2JNZA 3FTZA 4ELME 5T1KD 1E6OL 1GC1L 4TMPA 1OVZA 3E38A 1KYAA 4OCSH 5F1KC 4JQXA 3T6XA 4PRPD 4QRRE 3K6SA 2ZWKA 4M6MH 3X1NA 4NNYB 4JCMA 3KLQA 3VH8A 3U2SB 3KYKH 3ENEA 5ANME 4BHUI 3IEAA 3I6LE 2JXMB 2XG4A 1WG3A 4RNRB 4F58L 4P2OB 1IV8A 3EYSL 4CDGC 1KSRA 2UZPA 3ALPA 2J1XA 3CDGB 1HYSD 3ARFB 2GJ6B 3OAZH 4OI8A 1TJIL 2YKLL 1EFXB 1G5AA 1PLAA 2BSED 1JZJA 2VC2B 1NGWB 2AXGB 3OLGA 3IETA 4R90L 4A7QA 1FO0A 3E6FB 3L4WA 5ERWB 1OAKH 1AIFA 4HSQA 3WD5H 1FZJA 3MKKA 4TL4A 1T6WA 3KM2A 1RURL 1JGIA 5I6XC 3QAQA 2FATH 3V5HA 1JZ6A 2DLTA 4U6VL 3FL7A 1I7TA 5GJTL 3RDTB 1VCBC 2H41A 1F4WL 5T3XL 1M1SA 4FTVB 3QG7H 4IOFD 2VC2L 4MD4A 3LJ3A 4TQEH 1RMFH 3ZDWA 1JGLL 1SVZA 4MJ5A 4LDLB 3ZDXF 2ZUXA 3W56A 1P2CB 2F8XC 2E86A 4ZMPA 1I1AA 4HKZA 5J6SA 3F6LA 3IN0A 3OX8A 3BVNA 4HKXB 4WU7B 3W0WA 2NT0A 3BT2H 5HDQH 4UDUB 3ETBF 5EBMB 1BQKA 5BZWA 3ZT6A 5HVGB 2ZP9A 1VSCA 4KXAA 2NY3B 1GPOL 3HUJA 4QJ5B 1A3RL 1YRKA 2ZSWA 5GRZA 4JVWA 1Y0LA 4WNQB 3MR9A 5DHVB 4U49A 3AADB 3MLXH 2WO2B 1YEHL 1E8YA 3K0YA 1UA3A 3IU4L 4QNPE 1QYGL 4QHKJ 4YSPA 1QD0A 3EBHA 1PLCA 2GITB 4YO0A 5GJSH 2M26A 4HK3N 2GC7C 1BVKB 1E9OA 4H7VA 5MI0C 1ZE3C 4AQEB 2PP9A 3FU6A 3MXVH 4L1TA 2QSCL 3PAZA 1QO3A 4I48A 4YE4H 1QZNA 3GSQA 4QRTA 3BE1L 4DP5X 3APFA 5MENE 1JK9A 2WPGA 2OL3H 3UCQA 4GSDL 1EJ8A 3HJEA 3MN8A 1T3FA 1XIWD 2YPLE 3B4NA 3LKOB 3RTLA 3CPLB 4OZGF 5KYNA 4GMSH 4O4YL 2QKIA 2DM3A 2FGZA 5L8KB 2ITDB 1UM6H 2X9YA 2P3YA 5JIHA 4BKLA 4LLMB 3TIEB 5D8JH 1ND0A 2VLJD 4XNZB 2EDLA 4M29A 2QL1A 5KVGE 2Y1AA 1LP9B 3B7TA 3V6OA 1OAXH 1FZOA 1NEZA 2OSXA 1MHPL 4Y5XC 5JHDD 1QNZH 2PCPA 2YEQA 4G6KH 1JV2A 4NNXB 4NLHA 4WAFA 1ZWIB 3RU8H 4A2HA 5HHQB 4LLAA 5LKNA 4GI6A 4I85A 1U8CB 2EDBA 5JW3L 4QRFA 1WZAA 1I31A 3X3GL 1KBWA 8PAZA 2J71A 4LXFA 4LLQB 1T1YB 4OM0L 5L2KE 5I66A 4WO4C 5ALBH 5ISZD 2K1MA 2YD5A 4JRXE 1D5IH 4NAQA 4IBYA 2A74B 4X7EC 3CZFA 3IVKB 1QSFB 3F58H 5I8KL 5HHPA 2OM5A 1KLUB 4FXLA 5E5MA 5TE4H 1GGCH 3V0AC 4OLXH 3LSOA 3PAYA 2GBAA 3KLAB 2C3VA 2DS4A 1YUHB 3QJOA 3Q1SL 3F64A 3MRDB 3LZPA 1F6AB 1QLEB 1XH2A 2I32A 2E7CA 1QVOB 3PGCB 4MA1C 4OVVA 4ZS6D 4GSUA 1F5WA 4AYGA 1RZKL 2R0LH 4FQQA 2YRPA 3KGTA 4U7KA 5FK9A 2AJZB 1J8HA 3O4OC 3QNYA 1SMDA 4RSYA 4OGZA 4XN5A 2QSQA 1RUQL 4DUWA 1OT4A 1A4KB 2YFNA 3TC9A 1DBJH 4CDHA 1XFPA 1CD0A 1LDPH 3ARQA 2E75C 1QLEL 5G4MA 4JFWA 2CJ3A 2BOCB 1JPTH 2Z7WA 1MRDH 1NCHA 4AYSA 1KEGL 5ACMA 3HNTH 4ZMYA 1MCIA 3CXHJ 1MI5B 4O2EB 1FDLH 1ACYH 5E4IA 5GS1C 2TAAA 3TA3D 3VXPB 3UC0H 1LD9B 4PJ8A 5T1LB 5L2JB 1Z9SA 2J8UE 3D0VA 5BJTB 5AWNL 5GGTH 1J05B 1H6FA 1IKNA 3U9UA 3BOVA 1NC2D 2YOCA 1A7RH 3O3EB 4JPIA 4J3WA 2XKSA 5D7LA 1ZGLB 2H32B 4CKVX 2BSCA 1IC0A 2FT7A 4JGUA 4EJ1C 1WHPA 2QSVA 3R4RA 2UX6A 2IPUK 1WTLA 2ICWA 2XTJB 4BK5A 5FWRA 5C0JB 4U2ZA 2D03L 2CWRA 2OSLB 1R3KB 3FU7A 2LGNA 4F9PC 4IEFA 1ORQA 2JFCA 3GZKA 4F3FB 3ATFA 4ONFH 2VDKB 5DMYA 2AK1L 2BHUA 3QJHA 1NIDA 2AEQH 2FO8A 1XCQB 2K70A 3WY3A 1YNLL 1Z3GL 1T20A 1KXTA 4NAMA 3NCEB 1T66C 1ILSA 1IAIM 5FC9A 2WHVA 1NFDF 1KIPA 4PJXF 3A4EA 1G1KA 3QQ4B 1OGAB 4Y88A 2CO1A 2VDKL 1OM9A 4LVNB 4AK1A 4L5FE 2VM9A 4XBMA 4JKPL 1MLCB 1VENA 4PJIB 2ED6A 1HZHH 4UTBA 4FQPA 1NL0H 1XBDA 4ZOBA 1SY6A 3LZOA 2AQNA 2HT4D 4H8QA 4HGMA 3DJRA 1XGPB 3WEAA 3WIFB 4GAJH 3OKEB 3NA9H 2N7BA 4ADIA 4MBOA 1E27A 1JV5B 1VCAA 4IKLA 4JDZA 3RVTC 3QDMB 3UEZA 3D85B 5KN5B 1C8QA 1NGQH 1ZANL 2F8OA 4NJAH 1JXKA 2A6IA 1UACH 4PJXE 1HCYA 2PW1A 1OGTB 4PCSA 4QRSA 5F9WB 1Z9NA 3M7FB 2V9UA 2GSIB 1JZ2A 1PZUB 4PV8B 4K3DL 2I7OA 5A2IH 5CBEB 1KB3A 2OMUA 2NY1B 5CU5A 2IDUA 4ELMA 1RZFH 2ENQA 1H8SA 2YD3A 1EHLH 3O6LH 3QQDB 4G11A 3RPKA 5DEFB 5EEVA 1FN4B 2EC9T 4QGYA 4P5SA 4OFDA 1H9DA 1NCJA 3MBEC 5DJDA 3DX6A 3OXRB 1DVSA 1NSNH 3QIUC 5FHAL 4NKMA 2CO2A 2YAEA 3V4UH 4C8XA 2NOYA 3OKDB 1DANU 1IFRA 3BKMH 1ZS8B 4UB0H 1THCA 5ANMA 4HGKC 1CF1A 2Y23A 3ESOA 2HG5A 3MV8E 5D7IF 3S6CA 1QTSA 4KROD 3DUUA 1TVBB 4WHYH 4EQ2A 5EF2A 5I15L 3FFOA 5AKTA 5J12B 3T77A 4WGVB 5CM1A 3X11B 1CO1A 5DRNB 2V3DA 4YS4A 2GI0A 1VADA 4KDTA 4PCTA 2E9WA 2P45B 1I7UB 3GIZL 1K2DA 4ZTOH 1L0YA 1U8MA 2P5WE 1EMTL 3BMWA 2W38A 5B3JE 5L0QC 4QEGA 4NB7A 2FYYB 1NCBH 2W0KA 2A5UA 4A39A 1UT2A 2H5UA 2EIMB 3K6IA 4BDVB 5I9QC 1TJHL 2DI7A 3QUYA 2F61A 1IC4H 2CR0A 3QXWA 2YEVB 2YC1B 2WTOA 5GGSB 1CGVA 4PI2A 2J5LB 3I6GB 1ILUA 2DBJA 4FQLH 2YAQA 3OR7B 3SDAA 2DEWX 1R17A 1B0GA 1ZVNA 2A9BA 3P02A 4AZUA 1I8UA 3EDDA 5DRWA 3UYPB 4OD3L 3LB6C 1CLYH 1IGTB 3TZVB 1NIBA 1Q0XL 2AXFA 1RUAH 4W1TA 1TQBC 2F58H 5IREA 3GLAA 1QA9A 1L9SA 2Z92A 4ZT1A 2X5PA 4C4KT 5FO7A 4ZTEA 4N20A 4WW2C 1TITA 1V3MA 3H9HB 4M1DH 4H8WL 4V1DD 3H6AA 1WBYB 4KXBA 2JCCB 2DQHL 4WKXA 4FP8L 1VFOA 1DQQA 3AY2A 3QZPA 4DNLA 4G8GE 4LMQE 1XSIA 1EXUA 3BPNB 3KPSD 4P3DA 3DO7A 4JPKH 1G43A 1C5DB 5DJAB 3HLAB 5AL0A 4MCMA 3C6EA 5E7BA 2H6PA 5JW4Q 1NJ9B 4JM4H 1OD7A 2YR3A 4RISL 3BVXA 1PYWB 4XPAL 1IAIH 3A5VA 1X5LA 1A2YA 1AAJA 1CTMA 3IB4A 4FA8A 1RU9H 3BGFB 5AB0A 1JBJA 2H1XA 5GZOC 3GNML 3HC4L 3GINA 2V2WA 4A67A 2IOOA 3IGLA 4WO4D 4AKOA 1SJEB 4QHKI 3FOMB 4LK4A 1K3ZA 2IANE 3QIWB 2BFVH 3AC0A 4FZEL 1AR1D 3SD5A 2CHNA 2IMMA 2K6ZA 2BSTB 5AVVB 1OOAA 3AWEA 1ET5A 4HUVA 1DSFH 4A2EA 1AVAA 5A2CA 1UADC 3QIBC 5IFHH 1PZBA 5IZ7A 3FQWB 5KYXA 1QHOA 4FLRA 4U1HB 5E1AA 3FCGA 1QFUH 4FYSA 1QTYT 3FFCE 5F71A 2QTEA 2BZ7A 2FX8H 1TU2B 4FQXD 4EEEA 1D6VL 2VZTA 3S96A 5F7KC 5K1VA 2NY0B 4JHVA 43C9A 2ZXBA 3CHRA 1YEIL 5DC4B 1MOEA 1FL6B 2WB7A 2Q7NA 5E24E 2QVKA 3QZWG 3BZFA 3N42F 2WQUA 5T3ZL 4Y89A 3KVDD 3WYRA 3U36B 1AZCA 4DN3H 1TFHA 3QYCA 3H6JA 2WO4A 2ZAGA 4M5SA 1X6LA 1L0PA 4F27A 1EZLA 1TQSA 5DTFB 4WRLA 2EYSB 4OCWH 4ZNEA 2UUDH 4EI5C 5LHDA 3I2CH 5A16B 2ARJB 2J8OA 2EDHA 1UWXK 3GSNA 1GYCA 1F4HA 2C5DC 4M6NL 3B9AA 3OLIA 3QP3A 3OPZH 4MNHA 1CGTA 5EBLA 1ZHKB 2B3RA 1AOHA 5CEZD 1U8QA 5KVFE 5ITBH 1WAAF 2AI0L 1AQKH 5LCVH 1HNYA 4LNRB 1JNHA 1E30A 4L37A 3VRIB 5IMLB 4K3HA 2VLRA 1WD8A 2J56A 4P9HC 2E9BA 4KKBC 1HXYA 2ZYRA 3BP6A 1Q9OB 4N28A 3ZE0E 1GYVA 1FRGH 5CHNB 3P0YH 2FX7H 2J8UA 1TJGH 3T9WA 3ZKXC 4L8BB 3ARZA 4Y5YB 3PNWA 5E2JA 4OAWA 4FL4C 3DMMA 2XNAA 4G8EB 3UABA 2JSFA 1OKEA 3VXQA 3AS0A 3L4XA 3FHEA 1WAAE 2JB6A 3ARYA 4HFWB 1J1XH 1TCRA 3LY6A 3QDJD 4WK4B 1QRND 3Q6GL 1MEXH 2ZCHH 3O8XB 4K9EL 5IFJA 3IETB 4P5KA 2PCXA 3ARUA 5D1QA 1OP9A 4IU2A 1SMOA 2ZKHH 1DEEB 3QUHA 2BNQB 2K7PA 2ZAIA 4GSXA 3V5KA 4DFHA 4XNXH 4AIZA 4QRPD 4JKMA 4MS6A 4JFFD 1A1NB 4K71C 4P5TA 4APXB 4HT1L 4F2MA 5D7SH 3VWJA 1FO0L 1WCQA 1UURA 3MLUL 3TBSB 2IDSA 5FO8B 3VWKB 1W0VB 4TTDC 1LEKB 2R1XA 1SOQA 2XWXA 3KPLB 3V4LA 3ZKNC 4AZ8A 3S48A 3VI3F 4HIHA 5EOCL 3NPSB 3HC0B 1NFKA 4NZ8A 3EGSB 4N2BA 1U3JA 4U05A 5BS0B 1H3PL 1UJTA 5BRZE 4TPRH 4PJDB 3IE4A 2ZOTA 1UA6H 2EXWD 3UO1L 1I3RB 2VXTH 4HJ0C 3RKDD 5C0RH 4ZX6A 1BFOB 4LBEA 1JGUH 4WWKC 4ZAKC 3RX7A 3PF2A 4EF3A 1U4FA 1HOCA 4MCYB 3GMOA 1Z7JA 4B9ZA 3PWLB 1DBBH 3BUTA 2Q8AH 2DI9A 2NLJA 3QEUA 4K94L 4PH8A 4GAYB 3TN0C 2PTTA 1E9OB 3GI9H 1E4XH 3BJLA 4ETQA 3VI3E 3HI6H 1EERB 2HPOA 1ZS2A 1P5UC 5DJZB 2VKXA 5F93C 5LGHL 5B8CB 4QRTB 1UWGH 1F4YH 1ZLEA 5D5MF 5CR8A 4AJYV 1EK3A 2VIRB 1YA5A 5DJ0B 4YL4A 4GLRI 1CIDA 3R1GL 4H88L 4Q52A 4XVTH 4HUKB 4F2FA 1KCUH 1IEAB 2CKBB 2ZUYA 3ILPA 4N0YH 5DZVA 4XPHL 4EUPH 2AMUA 1QKZL 5K9OB 3ECBB 1CLVA 3CC1A 1A66A 5LLIC 3BH4A 4JFDE 3SQRA 4JPQA 1JL8A 5CUSH 4KRNA 2X4SA 5I28A 2XG5B 5DDHA 3NJLA 4K5NA 1DANT 5EO1B 2WK2A 3UBHA 5D5ME 4NKDB 4J8QA 5DMGD 3FPYA 2Z6FA 5CFAA 5HGHB 2CKBL 4PJ5E 2ZUQB 4N0RA 5E8DL 4PRAB 2V6HA 1GCYA 1VFUA 5E8NB 4BCYA 4HOXA 4NQXA 3V9CA 1WV7T 1XV8A 3V0FA 4DSYA 2PMZA 3IFNH 4CC4C 1H15B 2WWMD 2F15A 2K8MA 4LQFL 2CA3A 3GO1L 3LQZA 1ZE3H 4N3UA 1GSKA 1E4WL 3DOSA 4FN0A 1CZ8H 3DX8A 5EOCJ 5ALCH 4NCC1 3II3A 2X4RA 3IM1A 4XCCH 1C5BH 2W9DH 1F58H 4PRDB 5IMMA 2Y7QB 4MNQB 2XX0A 1QW9A 4HJGB 4GRWE 4M7ZB 5E6IB 3UDWA 15C8H 1KFGA 1IM9D 1PCSA 2IDFA 5LGJA 3V4PH 2CO7B 4JANA 4YXKL 3GRGA 2ATAA 2B39A 1HH6A 2VDMH 1NICA 3Q2NA 2W91A 2AABL 3I3BA 1A6TA 4FQQB 1D3CA 5IHLB 5EU6B 3KS0H 4YSTA 1FWXA 2P8MA 4JFYB 1IGYB 1U8PA 5DFTA 1R3LB 3WFBL 1SLVA 1AGBA 2ATKB 4ZZKA 1RIHL 5AG8A 4O00A 3RB5A 1UB5B 1OQOA 2BJMH 3LQMA 3MLVH 3RIFF 3WJJC 3QAZC 1BSIA 4Q74A 4LNVA 2XLLA 3BUBA 3GEFA 3KLDA 1C9SA 1AZNA 1YJDC 3N3EA 3OAYH 4G8GA 1JCKA 2YK1H 3ASOB 4X5WA 5DD0H 1KF9B 2O4EA 4GKSB 4MDIB 2G5UA 4MHHI 5ESVA 3PQYD 1GAFL 1OGPA 4LASH 3TPUA 1UGNA 5K59F 4RWYL 1ZT7B 1EAJA 3T2NL 3K72A 2FECL 1NCAL 4IIQA 2EKSB 1RHHA 2G60L 3FT2B 3U1PA 3F05A 2BMKA 1MAKA 2WYZA 3LN9A 4F15B 5C07B 2X2YA 4H0IA 6PCYA 1IIKA 1OAYL 2VUOA 3O3DA 3VXUD 4K9JA 1V7NH 4FAAB 2WOYA 1MIMH 1XH0A 1LE5A 2DICA 5EC2B 1QX1A 1LK3L 1RERA 1W8EA 2FUTA 4KO6A 2GT9A 2JJUA 2AZAA 3BIBX 3LEVH 1ORSB 2HT2D 3S34L 1S7RA 4PGEB 4CBZA 1P9MC 1CBVH 2W60A 1N8OE 3D2UD 3MA9H 2NYKA 4NUPA 1NC4D 1MHEA 5B21A 1OTUD 5KBMA 4AGMA 2X4QB 1A7NL 3QJFA 2XX1A 4P57B 4JFZH 1QBLL 1TSRA 4B9JA 1MJ7H 4YDZA 4N2NA 3AS3A 3FFCA 4NRXB 1MFBH 2J21A 1JFQH 4XAKE 5C2BL 5I71C 1CYXA 1F8TL 4K3JL 2Q8BH 2CO4A 2Z31A 5HBBA 1A1OA 2NR6A 1OHZA 3Q05A 1ZVSB 5FFGA 5FYJL 4XP5L 4YUEL 1KEML 3LNIA 4JFOA 3BC9A 3VRLF 4MXQD 1PTZA 2ORBL 3TBBA 4DIXA 4MLSA 2PTUA 3ARGB 3KVPA 5AKSA 4UT7L 4L9LC 3TO4D 2DQEH 3ZBMA 4F8QA 1AO7A 3A6BL 4GRLD 5HY9A 1FG2B 5F1IA 2ZWLT 1U6AL 2ZCZA 4Q0XH 4JB9L 4X8XA 4UTBL 4QT5B 1LO2L 4OIBA 3NFNB 1EO5A 4FLQA 2Z8VC 2IOIA 5ICUA 5E70A 1R3IL 3IMTA 3M17A 3BQVA 4OJEH 4N2IA 4MVBD 4I9WE 2RR3A 4Z8FH 1Z3RA 4G1MB 3FU8A 4JFHD 1B4JH 1T1WB 5CGMA 1MG3C 3VD9A 4U1KB 5CP3A 2YAMA 2Z1PA 2R51A 4KVCH 3QG6B 4NZJA 4AE1A 4DTGH 4LHQB 1AR2A 2WXMA 4JHAH 4F33B 1K4DA 1ET8A 2EDYA 5H35A 3SYOA 4WWID 5BZZA 1G6RH 2EEDA 3QPQD 3UAJC 4Q6KA 4HC1A 2V2XA 3O81A 3OHXA 5E4OA 1AG6A 2BS8A 4B0MB 1Q9LB 1OCWH 3KYOA 3LNHA 4Z9KB 3CHXA 4QRUA 3W2DH 4MJ4A 1Q9KA 4ZPTB 3C60A 4LRNH 5E4EC 3S2AA 1G7QB 1R5WB 3WAKA 3QH3B 4P23B 3MLRL 4YHMH 1H5BB 1CDYA 5TF1L 4HJ0D 1YCSA 1HILB 4ES9A 4KO7A 4JUSA 3ET9F 3IDNA 4X6EB 5HVHB 1MIEH 5KBLA 4ODWB 5L4JA 2PPAA 4DWHA 5CP7B 1UQSA 4PRHA 4OZFH 4MTMA 3P11L 3HS0C 1CWVA 3RGVC 3QULB 5I18H 4JZJC 4HBCL 2NW3B 4QXVA 1UJ3A 1MW0A 1ZV9A 3HZYA 1Q90A 3OBAA 3UJIL 2KPWA 5EPMA 4OF3A 4OCYL 5ABAA 2HFGL 4AGNA 1VZIA 1FC2D 4XN2A 4RGMB 4AMKL 1SYSB 5DQ9B 1XF1A 1SNRA 3P77A 4R7LA 1RZ7H 5KVMC 1G7HB 3SPVB 4KI5D 3US1A 3DV6B 3MUZ1 2G3MA 4BUQA 3TL5A 3S4SB 1CE1L 3KPQA 4WI0A 1CMOA 3LOWA 3ELAT 5HYJD 1OOWA 4QF1B 2IBZY 4OCRL 5GHWL 1XSOA 1BLNB 1E28A 2FZ3B 3IJEB 3C5ZA 4AL8L 4L8SC 2FIRT 2B5IC 5KJ7E 4PJ7F 2F53D 2W59A 1Z66A 3JYBA 1PG7H 3B2VL 4L3ED 3DHUA 2WYHA 4FXTA 2NDFA 2NY7H 4JY5H 4U1GC 2AJYL 1KGYE 2WUCH 2CK0H 2IFFH 3I9GL 3QUMB 4JRFA 1XCTB 4LVHC 3C5XA 1KOAA 3PWPD 1NCIA 4MJIA 4BYHA 1A4BA 4APQB 2VGLM 4P05A 4PJHF 1ZT1A 3G6AB 4GAGL 4K5OA 4XGZA 2NTFB 3EJSA 4PJ7E 1PF3A 5E1HB 3TVMB 2IPTH 1NANI 3LNEA 4Z1PA 5DJ6A 4DQOH 2WBJB 2YRLA 3DGGB 3L1OH 3QUML 5C0GA 3AS1A 1T4WA 3S36H 5GS0L 4XNYH 4LSQH 1FL3B 2VLJE 3EYVB 3U4BL 4KGJA 3O2VH 4XZUB 3WNPA 1OSEA 4JY4B 4UM8B 3K71B 5CILL 2GAZB 5JHDE 4PHXA 1OSYA 4QYAA 5F9JB 4M93C 5DRXB 1UM5L 2ZOKA 1MFEL 4G7YL 3QRLA 1TXKA 1YN7A 2EIBA 2IPKA 2Z8RA 3BEVA 1GSMA 3AROA 3OJDB 1A7PL 3STLB 1QAWA 2P49B 4N22A 5I1DA 1FZMB 4P3CL 1BYOA 1Q0YL 3T0AA 2NNAB 2OMVA 4M5YL 2Y2WA 1XR8A 1G9NL 3BZEB 3D69A 5ISZE 1E2ZA 4YR6A