3ILEA

Crystal structure of orf157-e86a of acidianus filamentous virus 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
149
structure length
149
Chain Sequence
VVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEARTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
total genus 41
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ileA00
3II2A 3VB8A 3ILDA 3II3A 3ILEA
chains in the Genus database with same CATH superfamily
2O6FA 4PR5A 5T5FL 1UZ8A 3OD3A 4KMQA 3VG9B 2GT9B 2PYEE 1JPEA 2H7WA 1QRNB 5A2KH 5IVNA 4PTUB 4A55A 4NYLB 3D3VD 4LPTA 1FH2A 4TUOB 2E4TA 2ENQA 2YQ3A 5HHPB 4NXKA 3BP7A 4DSYA 1AQMA 3UBXI 3FOLA 2ZQKA 1CICD 3MAWA 3S3SA 2GSIB 2AEIT 3ZO0A 4G5AA 2BFGA 3TTSA 2OJ1A 1I3VA 3U7YH 2HKFH 4PJ8D 5JHAA 1AIFA 4PLJD 5CIPH 1WTLA 3DPBB 3W57A 3BKCL 3ZO9A 2CJUL 1HHGB 5BO0D 3EH4B 3PAZA 5HHQB 3S8WA 4R90H 3PHOA 5F97E 3S4SB 2Q86A 3BPOB 5DK2B 1MFAH 3DX6B 3IU3B 1CCZA 2VDQH 4KMTL 3V52H 1F8TL 2QTVA 4Y5YB 4YHZL 3BUIA 3FTUA 4G42B 1DN2A 4NLHA 2C9PA 3JV4B 4F7KA 1DVFC 3O81A 1W16A 3ZTEA 1DQJB 3CFNA 2VCOA 1LD9A 3QUXB 2CHWA 3OKEB 2G9HB 2ICEA 3QJTB 4G8FB 3CGTA 4X9FA 1WIPA 5HDQH 3QB7C 4V1DB 1MJ7L 1ESOA 3GI8H 5JOFA 4NQVA 4BFIA 1S7RA 4OZFH 1H3PL 5IF0A 4OJCA 2WINA 4NQDD 2GJ6B 4HQQL 5E2TH 4BSJA 1CFSB 4A38A 1UWYA 2YA0A 3BIAX 5DHXB 1GSMA 4U1KA 2OL3B 1XSOA 1P9MA 4WV1C 4R2GC 2RACA 1T0NB 4OZGF 2EIMB 2J1ZA 4HH8A 2DOCA 3ZKXB 3A24A 5LGKA 1Y18B 3FUEA 1DUYB 3HRPA 4Z77A 5JHBA 3LVTA 4O4YH 5GZNA 2F7RA 3LS5H 4FTVE 3B9KB 4H25B 2BY0A 1KIPB 1N0LB 4MXQC 1R5IB 4JDZA 3PL6A 5MEND 3QZLA 4U4BA 1D5IH 3VFWB 4PU2A 2QPUA 4R7NB 1Q90A 5D2LE 3A4DA 1ICTA 3LD8B 5EIQA 5A2IH 2C1OA 1BVLA 1ES0A 4R90L 5BW7A 4HKZB 2EYTB 4YHIB 2X9YA 4MZRA 1GJIA 2VDQB 4IS6B 4POZC 1KBKA 2ALWA 5CEYA 5C0BB 4JE4B 4XXCC 4JFDB 2JJSC 4TS6A 3CH8A 4QOKD 1U58A 2G60L 3ATBA 1A3QA 4L8SB 1SLUA 4Y9GA 3BW9A 4AUYA 2Z4QA 1YC7A 3RJOA 1YEEH 2WXKA 3FU7B 1EXHA 4PV9A 4DP0X 4MHHI 1I75A 4HHGA 1PSKH 2XTJC 3B9KA 5CU9A 2CUAA 4K7PH 1TDQA 3MNVA 3CH1A 4BDVA 1D6EA 1UKQA 2IAAC 2D3NA 4GKLA 1NOFA 4BUHA 3BI9X 1B0RB 1QA9B 3BP4B 4FNTA 2JH2A 1GMEA 1CT8A 4AQ1C 4DEWA 4EZMA 3FQNB 4IRSC 2VMDA 3H9SA 1F6FB 2E56A 4NHCL 5KBLA 4I77H 3K0YA 2YAHA 4MA8L 4LRNH 2NY2D 1G7QA 3MJGX 4XN5A 3SPIA 3FB5A 1QSFE 3P4NA 3B83A 4N1CA 4LPYA 5AUMB 5AVSB 4ETQA 1TO4A 2XTLA 2ZG2A 1OKEA 1ETZB 3WIHH 1BF5A 3T0BA 5HYJB 2HJLB 2KLTA 3D87B 2C3GA 4DZ8A 4LHUD 4NO2B 3U9PL 1CI5A 3Q8EA 4HSQA 1TOXA 1JDCA 3BFOA 4Z0BL 3O3AB 1DYZA 5I9QB 2KZ1B 1ZT1B 1TU2A 3DOHA 4MNQA 3EFOA 5F0JB 2YRPA 4JFFE 3LKPA 4ZMQA 3APMA 1T6VN 5C2BL 4DQOL 3OHXB 1G94A 4UOQA 1FZJB 4HZAA 2YD9A 5ESQB 4JQIL 4HWEH 3WXVH 5D8JH 2XBTA 2NZ9D 4PVNA 3WTXA 3N3EA 2DKUA 4B97A 4RDQF 1HHHB 4F24A 3F7KA 2X4OA 1JRHI 1RZGA 1AD9A 2VLRA 4MXVF 1UXSA 4S1SL 1F2QA 2W9EH 4APQB 4KGLA 3RX8A 1L0PA 1QVOB 1AP2A 4ZBJA 4NQCE 1IGML 2AVFA 2MRYA 3TNMA 3ZYIA 3LKSB 4MJIE 2EXYC 3MJ6A 4LARL 1QMUA 2JLLA 4I77L 5DRZA 5HDBF 5FGCE 2GIYA 3UC0H 2VLRE 3EJUA 3GT6A 1M9SA 4NRZA 2AK4B 2AXGB 3AREC 4H20L 5DHDA 5CN1A 4Z5RA 3Q8AA 2QQNH 4JCWA 2X4UB 3STLB 1IGYB 4RGOL 3HC0B 3PS6A 1L0XA 5AVUB 5KSBA 5HVGB 3MV8E 1CDYA 2CDFA 4WGVB 4M7LT 4B0MM 5HVFB 2WXRA 4MRCA 5D9SA 5DC0A 4Z8FH 2Q7NA 3IGLA 1G7PB 2CUMA 5C0CA 4MHHG 3ZKMD 1UH3A 4K94H 3TEYA 1FLTX 4EI6A 4HJ1A 2X2IA 1UXSB 4AH2B 2BOCA 1F1GA 1TEYA 4DW2L 2VJ8A 2BDNH 1EJOL 4FTVB 4YVNA 4OLYL 1F58H 5LCVL 2COQA 1P84J 4L3EA 3N2JA 3OM3B 4N2KA 1CVSC 4XRCA 5C0GB 2NY3B 3I9AA 4OBRA 1Z9MA 3OHMB 1E5BA 4GG6A 1M1SA 4YDIH 5F7KC 3B6SB 1FRGH 4KY1H 3N41F 4QXUL 3NCYS 3J07A 4GFTB 5MP6H 12E8L 1GPOL 1F42A 1A1MB 2VDOL 4B95C 1TTGA 3MNWA 3NCXA 4HZLA 4U0QB 3HJ0A 2OTUB 3TCLB 1JVKA 1SHXA 2YBGA 2VR8A 3P11H 3DO7B 2VLLB 2CLRA 4B9PA 32C2B 4HT1L 43CAB 2BP0B 3E7JA 3IJ9A 1DQDH 3QIBD 2YD3A 2RBLA 4A2EA 5T3ZE 5L4MA 3MA7A 4K5OA 3E1F1 1AC6A 2X3CA 1IE4A 4G7RB 2H32B 4L1SA 4RWHA 4F92B 2YUZA 4JM2A 3FULA 1S7VB 3GJEB 3OLEA 4E0RA 1EGJA 1R33A 1HKFA 3QA3A 1RZ8A 2M8XA 1OP5K 5DYOB 3M6DA 2GG1A 4FHJA 1SVCP 3WKNA 2E8YA 3SE6A 5KBPA 5F7UA 5AALA 4XX1E 3IJYA 3MVSA 4OCRH 4JFQB 4W9DC 4ZK8A 3U79A 5GS0C 4X4XA 1S9VA 1XZ0B 2DWEB 4UDUA 2XZCH 3WFDH 1OF2B 4Y19E 1EVUA 4ZZFA 3KCPB 4GQ9L 4P9MH 3BN9D 4HJIA 4FMFA 4TVUA 2UZIL 4JB9H 3WTUA 4RMUA 3WDIA 4Q7DA 4ZXBD 4LNRA 3GS4A 3CBKB 1T4WA 2V5MA 1E9OB 2VN5A 3ESUF 5E2VH 2VTFA 5D4HA 2D3VA 4FQJL 3RRQA 5D7JB 2YRLA 2IBGA 4OGAC 4XNZC 5D1QB 1MJUH 4X5WA 5CLZA 2KKQA 4UILL 1IEAB 1F11B 4NLAA 3TH2T 5EBLB 3WD5L 4HKZA 5HI4D 3LV3B 3LZRA 2JFCA 1B3IA 5DRNA 3T0DA 2JKRM 3ZTCC 2GSGA 4WTZA 5BNXD 1IO4C 1BD2B 2H8PB 2VE6A 3DI2B 2WHVA 1HTYA 1QI5A 1VPOH 2ATKB 4GRWF 4JL1A 4OQTH 5FLUA 4UTCA 4F3FB 1KEGH 4N25A 1JGVH 4I3GA 4LEXH 1M57B 1OTUD 3HZ3A 5E95B 3MJ7A 5J12C 1NINA 2A77H 4M7JH 1RZKC 2X1QA 1R0AH 3UTSD 1H15B 1R3HB 1W80A 3HLKA 3MLYL 2I9TB 4GG8A 5TF1L 3V6ZB 2RJMA 1BXAA 2UY7A 4IRSB 1NCWL 3FPYA 4R4BA 3RL1B 4DWHA 5I18H 3R4DA 4AEHH 3PHAA 1F6AB 1H6EA 2BSBA 4NQSA 4P9HH 5D1ZA 5IM7B 3OX8B 4WK4B 2IBBA 5EBWB 2AXHA 1DSFL 5DJCB 3PQYD 4FJYA 2EEFA 3UJJH 5F9JB 2OMZA 3NSDA 1B0IA 1HL4A 2XRAH 4YHKH 2Q2EB 4Y19A 3GKWH 5K39A 4ABWA 2PO6D 4KQ4H 4GINA 4YXKL 1KYOK 4HUKB 4R7DA 2B2XH 1X3DA 1JI1A 2UVFA 4OFYD 4N2AA 2FX9L 1LO3L 2X44D 3LNIA 3QSKB 4YDVB 4FYQA 3WXVL 2WLLA 4BQ6A 5FLVA 2CGRL 3BGFB 4I9WE 4F1SA 4FQIH 1BSIA 5AAMA 3KWTA 5CWSB 4HS6A 4PG9B 5MEPA 3U1SH 4YO0A 1U42A 3C60A 3RWGA 2DQFB 3IFOB 1G1KA 3OC8A 2VQ1A 1N59A 2G2PA 2KT6A 2YN5A 3GRWH 3JTTB 5DQ9A 3ROLA 5E6IA 3L48A 5D1ZB 1TTFA 4UIMA 4AM0B 3DURB 1EO8L 3O9WC 2FUQA 2O1AA 3VXPA 4QHUB 4JO2L 5DD6A 1JZHA 2WTPA 1YYLL 2DRUA 4N2OA 3QQ3A 4ODSH 1JSYA 5CGYC 4QHMB 5DGQA 5EO1B 2GYSA 5D7IE 1UGNA 5BZDB 4NX0A 1N3NB 1CGTA 4G80B 2B1AH 2NY4D 3CFEA 1C16B 5BVPH 1NFKA 1DJZA 1IX2A 3G5XB 4DNLA 5ABDE 2EYRA 3OWRA 3TOPA 1DDTA 2WAQA 2H6OA 1CXFA 1MLCA 2WB1A 1JTTA 2BX5A 4AL8L 1N6QL 4AEHL 1JDAA 3MACH 1OARL 3AT9A 1BW8A 4TVSa 3OKNB 4W9JC 2ZAHA 3MLYH 5LG1A 4GAJH 2FECI 2C4FT 1BFTA 3GHEL 1QSFB 2BXZA 5HYEA 2PLTA 3WDHA 4Z6AT 4HK0B 2QZ5A 1ZPLA 4CAGA 2EO1A 3JZYA 2WWOA 2PCFA 5D5MB 4FXTA 5G4MA 1PMYA 1T89A 3T2QA 3SOTA 2YD5A 5IVXB 4RSYA 5AB1A 2GEQA 1O6VA 2CKBH 1KCSL 1FC1A 5K9KA 2J8UF 3O4LD 5IMOB 3LIUA 2VDNL 3D2UA 4F58L 5G4OA 3QG7H 1TMCB 2Z1PA 3MO1A 3TBSB 4ODTH 4YGVA 2BSDA 1OIOA 1NCCL 2GT9A 3AU1A 1MFBL 1IM9A 3KD4A 4OAWA 4YQXL 3V7MA 4V11A 4D0DA 2R2CA 3RNQA 5L4JA 1KGCE 3P9MB 5BZWB 1AGBA 1IVLA 5DXWA 2COVD 2WKOA 3TBTB 4XXDB 4U6XA 1M3JA 4IW4C 4IDLA 5ETUA 4M1GH 4DP2X 3MYZA 2QHRL 1KJ2B 2ZP9A 3MX0B 4DH2A 3WNOA 4Y4FD 4AXWA 4A2LA 2IG2H 1T5WA 1ACCA 3ZKNC 4Y4KD 5D7LB 3M17A 5EB9A 2IXQA 3AJ7A 4PJ5E 4XN2A 2JB6B 5J89A 1QNZH 1J0IA 4HU2A 4WIQA 4J23A 4Z18A 2V4LA 4GEJA 5DS1A 5FYLH 4NP4L 5MERA 4IOIA 2ZWZA 3RBSA 5TK2A 3K71B 2FHBA 2CA4A 2DWYA 5IW6A 3ULVF 3MO1B 3MSPA 3DYPA 3I3DA 1NKOA 4OLVH 3JBG7 2X2YA 3EO1A 4I1NB 4XMWA 5TDPA 1PLGH 3MUJA 4HZ1A 5H8DA 1RIHL 5IBTL 3VX0A 1FFTB 1UA3A 4KY2A 4O51B 2IH1A 4P2RB 4GAGL 4JX0A 5FYJD 1ET8A 1OAUH 2BM3A 3DX8B 4FXGC 5ISZD 3EO9L 1KELH 5FM8A 3WGVB 1XHHA 5I6NA 2Q0ZX 2VLKB 3JZ7A 1YG9A 4D8OA 3O6ML 3NRFA 1XR9A 4PBWD 1OCWH 3O9WA 3DGCR 1MFCH 4LCUA 4PJ8B 3TASA 3G6JF 1WE5A 3JXAA 5CJ8A 3V0VA 4N87A 1EBPA 4PIBA 4WRLA 1IAKA 2HZHA 1G5GA 1WZLA 2N1TE 1UUSA 4KKCD 1TO5A 4ZAKD 1RFDL 3KYOB 3C60C 1UZ6E 4X83A 2FBJH 4WUUD 4KXBA 4D94A 2N01B 4N2BA 4ABUA 3HAEB 4K94L 1JGLH 1A65A 2P47B 3LIZA 5DJ0B 2HH0L 3NFNB 1BQSA 2G5BA 4P04A 3UTTD 4OZFB 1NMCC 3A0OA 1S46A 2QELA 1XGRA 4JDZB 1N2RA 2C7UA 3EYUL 2Y2YA 3T1WA 1C1EL 1A4CA 5D2LA 5TQ0H 1SHMA 4YR6A 1BXVA 1JCKA 3F83A 3SDCD 3UTPE 1G9EA 1DVFD 2YXWA 2ZUQB 3JWOH 2OXHB 4H20H 3SJVD 5CFHA 4M8QA 1JFQH 4GW5B 4U1NA 2OMWA 3ZKSD 5FO8B 1GIGL 4AYGA 5IKCA 2PR9A 5AYTA 3MLUL 1ZDSA 4YDKL 4GW1A 1SLXA 5DUPH 2IDCA 1NAKL 3P0YH 4K5MA 1BYOA 1TVDA 1E28B 2IADA 2JJVA 4WY7H 4QRAA 1KJVA 3QRLA 3UP1A 3FTXA 1U36A 1F13A 1A6ZB 3QDGE 2B3RA 3X1NA 3MV01 1JK9A 1G7HB 1RZIA 1C5BH 2LLGA 1AGDA 3UAJD 2IDUA 1XGYH 2DBLH 2ZCKH 1JGDB 1AHWB 3Q3GB 2PWEA 3R8QA 3WLBA 1GR7A 2WLLB 3QE5A 4G8EA 4GKNB 4FCAA 4Y5YC 5D6DA 4LHQB 5DMGD 1EJ8A 3AAZB 3BYTA 1AQ8A 4YFEA 2BVPB 3GLDA 1BLNB 5E9NA 3ZTNH 4L37B 5INDA 1FGNH 3HC3H 2D03L 4JG1H 5BRZA 5FB8B 3D9AH 3TXAA 3O2DA 3D6GA 1N59B 4P3WA 3QJSB 4WSKA 5CJOL 5A6LA 3GTNA 5ADPH 3NG5A 4HPHA 3CPLB 1UB5A 3HUJB 1YJDC 2I32A 1FNAA 4H2CA 4IKKA 5T1MA 2X4PA 1MCQA 4P23C 1EO7A 5C71A 5T3ZD 3WAKA 4JUSA 3PQYE 1D7CA 2CPUA 5DHYB 3UJIH 4BIKA 1JPTL 1IGIH 3W39B 5K9OB 1JZ3A 1MCKA 2MEJB 5IFAH 3OLDA 4WJG3 1HILB 2DQGH 2PWDA 3FB6B 5E8DH 3UYPA 2A73A 2CLZA 1DN0B 1UWEL 1IC5H 5DLLA 3NJNA 4FG6D 3DMMD 4UQ3B 1GY2A 3RURA 3NSYA 3NJJA 1YECH 2IAMB 4M43H 1QRNA 1W91A 5C0DA 4ELMA 3I6LD 1YNKH 4Z9KB 4QJ5B 5BUAA 1FF5A 2BMKB 1YEEL 2EDMA 3EJYD 1PLAA 1YO4A 2Z1KA 2H0EA 1I3UA 3BSHA 4RQQB 3WMSA 5JTWA 3RKDD 1THCA 4HUUB 3CN1A 3IGUA 5F0MB 2KZWA 3KHQA 2EUZA 4HH9B 4JPQA 4F9PA 5CKAA 5KVFL 3VXRA 3D69B 3NEXA 3H56A 3WEAA 5KSVB 5LNEA 1EEZB 3KJ6H 3UP6A 4AMXA 2HJKA 3TIDA 3T0ED 1ZVSB 4AQEA 4Z7UF 4JM4L 4U6HA 5DZOA 2ADIB 2GFBA 2WKOF 5IGXL 1RK1A 3NJMA 1TU2B 2DDQH 2CR6A 2YMTA 4GPVA 4W81A 3SCMC 4PW4A 2H6PA 1WEJL 4G6FB 3CE1A 5HI3D 1DQLH 2X4TA 1OOWA 4Q9BA 2HTKD 1ASOA 3OKDB 1HQRB 3O6KH 4WO4C 4YBQC 4OLZL 4AH2A 4DPBX 5E9DE 1Y7VA 3QNXB 3V0GA 4AT6A 2R59A 3D50A 2AJ3B 2IPKA 1TF4A 1NBYA 2HSIA 4G7SB 2Z8WC 3WJLA 1KCWA 1X5LA 4RGNB 5FUOL 5I1LA 4ZMOA 1LP9A 2XBDA 3MLRH 1K5NB 4JO3H 1SLVA 4NJAL 3QFJD 3VXMA 4KFZC 1U3NA 5TPWH 5JPMA 3TJHC 4RMWA 2DQEH 3EUUA 2BVYA 4IKIA 2ZXBA 3ROOA 2J72A 5IROA 4MJ6B 3U2SA 3PG2A 2QSTA 1NGQL 2PO6B 1TJGL 3N1QC 1YMME 2OFQA 5C0JA 2MQGA 4L3CB 3KHOA 1GRWA 1INQB 2ITCA 4OLUL 4OJFL 3BGAA 3OLGA 2YPKB 3CZUB 3DUSA 4PRDA 4X80H 3WNJA 1QFOA 4DAGH 2P26A 3FUJA 5HYSB 4BZ2A 3H4HA 4KQ3L 1ADQA 4V33A 3PP3K 2LLNA 4GAYB 4V1DA 1BVLB 4W4OA 5AZEL 3ZMEA 5JOFB 5LG6A 3D39E 1AXTH 4L3EB 5SWSE 1U8QB 5DEFB 4NC0B 3TM6A 3LKQA 2J88L 4J3OH 3I9PA 2ITDB 5E70A 2FH6A 1AAJA 3MNWB 3PY9A 5ITBH 1VDGA 3GMLA 3TEUA 3VB8A 1FC2D 5FA3B 2Q20A 1PYWB 2XY2A 3FAWA 5KOVC 2X41A 1KELL 4EN3B 4J8RA 4HA1A 4BFFA 2CBQA 1GOFA 3B3IA 4PJAA 1QBMH 3VMNA 3SGDH 1NGQH 2Y7MA 3LHAA 4HWBL 3LPWA 1BPVA 1PZUB 1B0RA 4AOFA 1DJGA 4HUVB 4YZFE 1JV2B 2JI3A 5AW6B 3V4PH 3VXUA 4NJAH 5ADOL 5JHDB 1I8KB 4ZW6A 4IGBB 4WI3A 4XAKE 1GH7A 2KC0A 4YLBA 2KH2B 2YWZA 1FL5A 3IJYB 4R9HA 2X1WL 3IMUA 2ZYRA 4LLDA 4G6JL 5B38B 3APCA 3EW3B 5MENB 1X7QB 4J27A 4U05A 1XCWA 2V7HA 1Z6JT 3L1OL 3FO1B 2EDEA 5CJQH 4AE0A 1O7SA 3B9KC 2YAOA 3IWVA 1HCYA 1ZGLM 4PGJA 4ISVB 2BVTA 3ZYZA 3GMMB 1T7WA 3QZOA 2QMJA 2NY2C 4F9PC 3SBQA 3P30H 4KXCA 2QTEA 3RZCA 2FIKB 1HHJB 2N7BA 5C0AB 4EI0A 4PJDA 1BM3H 3SQBB 5ICXB 4XXCA 1TTBA 3VYPA 1XTLA 2E7CA 4H8PA 4JM0A 4F58H 1OD9A 3OX8A 2EADA 1HYSD 4M29A 3EJZD 2EC8A 5C08E 5I73B 4HEME 2H0PA 2HYMA 1I7TA 5L9DL 1JV5A 4Q9RL 3W5MA 1KB9K 5E03A 1SFDA 4HJEA 1AQKH 4K4KA 4PS3A 1F6LL 4GKOA 4J4PC 4FQXD 2APBA 3DIFA 3E3QC 3HE6C 5ANHA 4RGMC 2JELL 2Y1YA 1PGRB 3LRSA 5F3BA 5IT2H 4MWFA 5HJ3B 4B9GA 1RD6A 4U1JB 5E4IA 5TGBB 1FZKB 4X7CC 1CI3M 2DM3A 5DS2A 4NZDA 1URIA 5F7EH 5EEZA 3BVTA 2WANA 3NFPA 4CNIA 4P23A 2NCMA 5CP3A 1Z9NA 4UQ3A 4LLVA 3HTLX 3NIDB 5D9SB 3RJDA 3P3RA 5I5MA 2NW3A 1OPGH 3PGCA 2V3DA 3L7FB 2W60B 4CVXB 1X7SA 2XNAA 2DMGA 5JW4M 4KWUA 3CC5B 5I23A 1CYXA 3CDFA 5EBWA 3ABGA 5KJ4A 4XTRC 1QBLH 2Y22A 1DVXA 2IDQA 4XMPH 3UC0L 2UYLB 1NIFA 1YUHB 3QEQE 1MG3C 5DRWA 3IDJA 3F7VA 2JK5B 3KBFA 2QV2A 5L9DH 1XF1A 1IVTA 1G0XA 2KQMA 2EC9T 4H7VA 4P5SA 2O5NA 5A6IA 1U58B 2X89A 3LS4L 4KHXH 4K07A 4CW1A 4OTXH 2Z4QB 4U1LA 3LN9A 5C0EA 1M6OB 4KO5A 3WD5H 4Z7UB 3ZGIA 2WNXA 4X6CF 4GMTL 4U3SB 1OCWL 2ZUVA 3L95B 1MRCH 4A6YL 4DOHE 4EI5D 2XV0A 4MQXC 3U2IA 3VUAA 4JY4A 2EXSA 5KTEH 3WNLA 4KZEH 3BC9A 2FX8H 3PDGA 4HWBA 4GO8A 2D7QA 5JQ6H 1FYTD 4ZQKB 3IJ7A 1JYWA 2ICWI 1IAOB 3FRUB 3UC2A 4KZDH 2MHAB 4ENED 3U6XA 8CGTA 1G7QB 2Z31B 3ECWA 4DZBA 1EEUA 2I7SA 3SY0A 1LTXA 3IF1A 3CXHK 4DP6X 4EN3D 3QS3A 5GZOD 1ZMYA 5IR1B 1J9TA 4O02H 4G6JH 1COBA 3SJVE 2EYRB 2I7OA 1FVEA 4G7VH 4K7PY 1GA2A 5EU4A 5C0BE 4HZLB 1MWAL 5GZNC 1HOCA 2OTUA 1V7NH 3TCLA 4Z7QB 3QK0A 2YPVA 5EO0B 4MQTB 4M3HA 1FQ9C 4IBTA 3QRFM 1MNUL 2LVEA 1L9QA 2CK0H 5CD5C 1YEHH 4H8VA 4XNYH 3FW6A 3RPIA 3TNNA 5IQ9B 3WNNA 4JQIA 2J8OA 1E4JA 1NCBH 1X4XA 3T1FB 2VC2L 4OV5B 1KUMA 5DT1L 4S1RH 2FQDA 5ITFB 4KNSA 2L4OA 3UZVB 1K3ZA 5JQIB 4MNGB 2Q8BL 5AD0B 1SVZA 2CRYA 4LPXA 3SY0B 2R69L 3IF1B 2ZAGA 3P9LB 3V5HA 2FJSA 1TYJA 3S37L 3S4SA 1UKSA 4H2AA 4H40A 2VE6B 3N44B 1HHGA 5HHQA 4M62H 2YUWA 3L3IB 4MA7L 3K6IA 3HMWH 4P4KC 2Q86B 3TFKC 4FFZL 5I76A 1BYPA 1DVFA 2YKLL 1MEXL 3QEGL 1IGTB 1A7QL 4OLUH 3TJHD 2IH1B 1C5DA 3CLFL 4P2RA 3SY6A 5BCAA 4JPVH 4PTTA 4BFJA 4U6XB 3Q5OA 3GLZA 3V6FA 2NXZC 3HFML 4FQQB 1QR1B 1VSCA 3QXUA 3L3KB 4LCWB 5GGRY 4GT0A 4TYUA 2OW7A 4J6RH 5K5YA 2BIQA 2AQSA 1V8HA 5CCJA 4IGBC 4XNBA 1MCDA 2RH0A 3DI3B 3HI1A 3JWNC 1N8ZB 5EC1B 5JQHC 2HFGH 2OL3A 3NDYE 4M7LH 2P43B 2VXSH 5I74B 1HXYA 4PJGB 1KXHA 1RZQA 5TPWL 3IFNL 3NA9L 3I6GA 4B96A 3DX9B 4FXGB 2H8PA 1SY6A 4F7MA 2ZXDA 4IYKA 1YMMB 4JPWH 5F9WC 3X14A 3L4XA 4JVPA 1AS8A 4XBPB 2XWTB 4K73A 3RGVC 1C5DB 3BESR 4UTAL 3H55A 4M5ZL 2YAQA 4S1SH 5E6YA 3SPHA 4XO4A 3ARGB 4QIRA 1I9RL 1OP9A 4B9YA 4UM9D 3UDWC 1X9LA 2BCKB 2MQ3A 3CVHB 4L2YA 4PM1A 2MQCA 5KTEL 5SX4I 1Z3RA 2FBRA 4RAVA 1V54B 4ZOCA 4N90D 1K8DB 1WCBA 1Z9SB 3AG2B 3KPQB 5IHUH 12E8H 3HZYB 5C0CE 3SDDA 2NY0C 2R0WH 3UH8A 25C8H 5DD1H 4Z0BH 4LPCA 5B21A 4XP9H 2V33A 4GYBA 5HBBA 5KSBE 3K46A 1NFDE 3ECQA 1TJHL 4PRHA 5SWSB 4QRBA 1WT5A 2ADJB 2WMPB 4X4XB 1S9VB 2DWEA 3Q8FA 4JFDD 2ZYSA 2V9QA 3GBDA 3EHBC 1TLMA 3L9BA 3PHQB 2XWEA 3TBYA 2WYTA 1RZJH 4FZ8L 1GXEA 1OHQA 1BV8A 2J2ZB 2RCSL 2HKHH 3VFNA 3O3EA 5C07D 4D0CB 5I6KA 1E6OL 1SXCA 3MA9H 4RGOH 1WDAA 5C3TA 3RWCA 3W38A 1FLRL 4WI8A 1Q94B 2R4SH 3S36H 1FZMA 2ICCA 3T0EA 5E9AA 2X53A 4AKQA 4Z7AA 4MA3B 1SN2A 3V4VH 5KBNC 3V10A 4UMGA 2NYYD 1CXEA 5AAMC 1QI3A 2CO4A 5K69A 4P0DA 3FQ1A 2OP4L 5DD6B 3LY6A 4MNQE 4PGDB 4UB0H 4HALA 3CV5A 5K9JH 5IFAL 1KY7A 2L3BA 1X5FA 3PHQA 4XODA 5C0AE 4FNSA 4DF9A 5GZOA 3BX7C 4JR9H 1H3UA 1CK0L 2YSTA 3IETB 3L4TA 1DLFH 1I8LA 1MJUL 4HIXL 4KI5C 4LO9A 3S48A 4XAWH 4Y2DB 4WSJA 5AVVB 2K4WA 3EOAA 4FZEL 3HS8A 1A7RH 3JV6B 3WEXA 3MGAA 2FJHA 2OJZL 3WMQA 4ZNCD 4W9HC 2VXUL 5DJXB 1S9WB 2BIOA 4N2NA 2QGEA 1OALA 3TZVB 2BIPA 1ZIAA 4W4OC 4CMHB 1S4IA 1XXFC 4HWZA 4LKXA 4UT6H 5L6YL 5IROD 1R3LB 3EH3B 1ITCA 1W72B 1UFUA 2CJTA 4XGZB 4HAKA 3KLLA 4P57A 1X5YA 2B9AA 2V5RA 3LNHA 5HI4C 4U6YB 1BZ8A 1CFVL 1XH2A 2AV7B 4YSUA 2P7TA 3EYFA 3MLUH 4UDTA 3PAUA 1IBHA 4WWPA 2BERA 3D4CA 4NZTL 3AB0C 4WFFD 4JFEE 4LEBA 3WUWA 5DRXB 2JKSA 1D9KB 3MRKA 5GJTH 4YO0B 2CR3A 3EGXA 5JHMA 3ARFC 1YEDA 2NW2A 3ZZSA 4FE9A 1S7WA 3D3VB 5DLML 3IXAA 4HETA 2X0UA 3QDJE 2BP3A 4MMZA 1PG7H 3VRLF 2B14A 3UYRL 4L0ZA 5HHOB 2NUPB 5GS3A 5IVZA 5D7IF 3SCMD 3UACA 2QT6A 1CWVA 3LZLA 1LP9B 2PCYA 1KF9B 5LWYL 3VXMB 2PPAA 1QKZL 2SEBA 3FT4A 4C56E 1UYWH 4ZXBA 5D7JC 4RMBA 2OMBA 2OCJA 1ZWIA 3JTSA 3D08A 1FJ1B 2SODB 3VXNB 3K71A 5T1JA 5IMLA 4GUCA 1K4DB 1RERA 2WXMA 4PR5B 2IAMD 3MGOB 4ZOAA 4OZIE 1ECYA 2R2EB 2ATPB 1U92B 4F33B 3FBKA 4IRZH 4KI5F 4X8JA 4YSPA 5DT1H 43CAA 2F53D 1PFOA 3I02A 4NQXB 5BJTB 1ZLWK 1JWUA 4XMZA 2J44A 2JKIS 1S7SA 4HJUA 3WO3B 1S8DA 3QIUD 5GJTL 4HXAH 3UFIA 2KZBA 35C8H 2XIBA 1BZ9B 3G5WA 2X4NA 3NA4A 4LCWA 5CGBA 4OCWL 2DWXA 5D7IB 3A23A 3VRIA 5DVPA 1L7IL 4M6MH 1TYRA 3NA9H 4HK3J 1FNSH 4PVLA 4LBAA 3S36X 1RZPA 3SDDD 1SEBB 5E8EB 3RP1A 2YA1A 4MNGE 5C0CD 1FHNA 2HLAB 3U46B 3GSNH 1T1WB 3GXNA 1UC6A 1E8YA 1S5IH 2Z64C 5IMOA 4WU7A 4ZTEA 1O0VA 5CCKL 5EEWA 1U2CA 3BW9B 5IQMA 4XHJC 3PWVB 2R2EA 4Z7WF 4MDIB 2I69A 1XIWD 3NZHH 3OKKA 5HHXH 1LK2B 4RMRA 2D31A 5DI8A 1AKJA 1YN6A 5JUEL 1SF5A 2WVUA 5T8IA 4QXGL 5C9JB 1Q1JL 4G8EB 4GKNA 4OT1L 3VD2A 2WWKT 4MYWB 3FFCD 5C6TL 2HFTA 5B1AB 2VW6A 1P5UC 5GISH 3RDTD 3OF6D 1D5XA 3FB7B 3ZIYA 4BELD 4BUQA 4DERA 1EFQA 3VTAA 2FATL 4I1PA 2CUHA 4R7VA 1DVUA 2A9NH 5EULV 2H41A 2ZIDA 5FCUH 2QVTA 3T3PE 3G04B 4MDJA 4UQ2A 15C8H 4FQPA 3C08H 1EAJA 5TJWK 3CZNA 3WIHA 5I6XC 5CBAB 2F74A 3VW3H 3N85H 1V10A 5EA0H 3V6OE 4XNDA 1T0NA 3G5VB 2WXPA 2DJ4A 2R8SL 3E9UA 2P5EA 3ULUF 1ZT4B 1Z5YD 1PYWA 4G59C 1H8OA 4IIZA 4JDVA 1IGCH 4MJJA 4WKZB 3H4FA 2D8KA 5I17B 4QCIA 1NUFA 3EOBB 3SBWC 3FQRB 3J8F7 4K94C 5DVOA 2EDJA 3SPVB 1H3VA 3D4ZA 1SYSA 2VR9A 1BX2B 2CCLA 2EKSB 5FW8A 4ODXA 4G8FA 4Y2OA 2JLPA 3S2AA 3GNML 5ERWB 5EUOE 1OZTG 2D2CC 2E75C 4XPHH 3UPAA 3L3GA 4NKMA 1VGKB 4LQFL 4QRUB 4YDJB 1E40A 4RFEB 1XL6A 3T2NL 5IM7A 1GKEA 5AOLA 2XN9A 5GRJH 4KROB 3JWDC 2BLFA 1KTKE 4H5SB 3N04A 4HLZG 4X99B 1EO8H 3K6FA 1ZVNA 1P1ZA 4R7DB 1JTPA 2V8LA 4QUOA 4AIEA 4HG4K 4U1JA 5TGBA 1FFRA 2FR4B 4KNQA 2ZX8A 1RUQH 1P4IH 4G8GE 4HJJL 4JDVB 5C7XL 3DTXB 3HVDA 4G82A 2B16A 4FZEH 5I5IA 1WAAF 2JJTA 3EJCA 2X40A 3CLEL 3MRHA 4GRLD 2JSFA 3BKML 2J71A 4F2MA 1VAHA 3O0RL 4B7IA 4YR6B 4I18C 4PJGF 2VO8A 5E6IB 1S9YB 3GSOA 3ULVH 3Q43A 4HIQA 5KW9H 4FQIL 2FE0A 4ZDHB 1MZZA 1U9KA 4ZTPH 1NUDA 2IPKB 1NCIA 4N2MA 4X4ZA 5HHMB 4G9FB 4L8BA 3DKHA 5E99H 5C86A 4I18B 3KPRE 3FB5B 1XGYL 4IS6A 2VDNB 2FSEB 5F7DA 5FKAB 5I8CA 4JFDA 2ICWJ 3B3BA 3ILPB 5IY5B 2GHWB 1RURH 3B2UC 3TF7C 3ABMB 3GB7A 3P2DA 4C47A 3G08A 5AW4B 2ZZUT 2R27A 4Y88A 5DEZA 1CGVA 5EOTA 3CVIL 1D6VH 4LU5H 3ROOB 4Q2ZA 3BAEH 3MYJB 5ICZB 4QRSB 4BBWA 4EAEA 4AQZA 1QA9A 3ZT7A 4H26A 4G8GA 4OFYA 4JRXB 2W65B 1DBJL 1F56A 2HLFD 5D4IA 2VN3A 4B53A 1RIVL 5E9DB 1KFGA 5GS0D 1CLVA 3O8XA 4Z7NE 1JRHL 3G6JB 3ZYOA 5GSRA 2XT1B 3BE1L 1UACH 4W9FC 4E9XA 3S4SG 3QJFB 1FAIH 2VMJA 2FEJA 2KS0A 1XGUA 3P4NB 5GRVK 3TO4D 3U1PA 4YDLB 4MXWL 5CIPA 4AGPA 2HFFA 3WNPA 2AJVL 1M71A 4XO5A 4FP8H 3HR5B 4P4KD 3U7AA 5I71C 1UKTA 2YS4A 3VO0A 1IAII 2YOAA 1VFOA 3RTQC 3U7YL 4AV0A 3KCWA 4BKLB 5IHZA 1CIDA 4TNVF 5IHHA 5E5MB 4UILH 4M5TA 5EC2A 1WHPA 3TPKA 3JV4A 2WQSA 1T1YB 3K80A 3BVVA 3RNQB 5T1LA 3MLPA 4MJ5A 3FPXA 1MJJB 3HR6A 3TJPA 3FFCA 1MWAA 1S78D 2H2SD 3E6FA 3C6LD 4XPTH 2EUVA 2WQXA 3FO2A 1KLFB 3TNMB 4MX7B 2K0RA 1OWRM 2CK2A 4HH9A 1XIWB 2YGOA 5EU7C 1F4WL 2WUBH 2GJ6A 2AK1L 1SYVA 4U1KB 4YC2C 1KYAA 4OCRL 1IKNA 2PO6C 4PWHA 1AMYA 1JPGA 4CL7A 5AL0A 4EKXA 1HH6A 4K23H 4HIJB 3U0PA 3GMMA 5DD5L 2G2RB 3SKMB 4PFEA 3BPCA 3TLRA 5GGQH 1Q0YL 3HMXL 4MQXD 5F93C 1FBIL 1GS7A 1TJIH 5HSFA 2X1PA 1F90H 5C3IA 1R4XA 4APXB 1IM9D 1IBDA 4UQIM 3CX2A 3RG1C 3KPOB 4MNGA 1ZTMA 2FLRT 3BGMA 3DLQR 3WKML 4CSZA 4DP1X 4OFPA 4PWIA 4MAUH 3O9WB 3KWUA 2QGBA 5E6IC 4PEEA 5F9JA 1MRFH 1VRSA 3QUZD 5AW0B 3B6SA 4E5XG 4XBGA 3OKLB 4XMLH 2YK1L 4HPYH 2BDNL 4HOXA 1LEIA 1A1MA 3FH7A 5AW9B 5KVFH 5KSAD 4OIBA 2F1EA 4KKZA 1XGRB 2CK0L 2AGJL 1OB1A 2EINB 1SHWA 4WEUD 4L9LC 3A67H 4UYQA 1AGCA 2RFXB 5JR1H 4BK4A 4ZUTA 4JN2B 3ZDYB 4R3SB 2WLJA 4U1IA 3VH8B 1DBAL 3N5AA 3V8OA 4MD5A 2CGYA 1T66D 2HWZL 3MJ9L 1Z9SA 2XN0A 1OEZW 1MW0A 4XO3A 1A6TA 5B3NA 3KPOA 2EDXA 5ERWA 3CVBA 4XCYA 2NY4B 5ANMB 2YIHA 3FU6A 1FA4A 2ILLA 3MCYA 4U1NB 4PB9H 2CRMA 1JZ2A 2Y4SA 1RMFL 1SY6H 2DEWX 4G8IB 5IT2L 3MR9A 4ZSOB 1F4WH 1KG0A 1F0LA 2JE8A 2V5SA 3UADA 2YD7A 4AC2A 5FF6A 1JHKL 4HVBA 1RU9H 2PCXA 4W9EC 2C9QA 2XFXB 5IUSA 1F18A 4I5BB 2YD8A 1FZKA 1Y1UA 2VLJE 3DA0A 4TXVB 1FH5L 2K8MA 4MNQB 4WJ5B 4XNUL 1FO0L 5FXCH 1KB5L 3AQDA 3V6ZA 1BQHG 3NSXA 4E5XA 3TJEH 2YEQA 4HKXB 3RY5A 2H3NB 1U93A 3VFSB 1YYCA 3OMNB 1MREH 1B9KA 5F96H 4PRIA 1KCBA 1JWMB 2F2HA 1T7YA 2EICA 3BMWA 2E59A 3H7LA 1KLUB 3Q2CA 2JI2A 4HK3N 3QDHA 1J5IA 3ISWA 2XWBA 1PCSA 4J3UA 4FA8A 3MN8A 3L3OA 5BS0A 4WO0A 1Q9WB 3GIZL 1MAJA 4I0KA 4FXKC 4H0IA 3DRTB 2IPTH 4AKPA 1T2QL 3UO1H 1LE5B 2G9KA 1HH9B 1IFRA 2HT4C 5BQ7A 5FO9A 4D0DB 2XOTA 2CU9A 3ZE0F 2BC4A 3NJLA 4IOSA 5AW7B 2H4EA 2JIXA 4JHAH 1PSKL 4DP4X 4WHTB 1DBKL 4AUUA 3BP5A 2DW5A 5D5MF 1XF4B 3FB8A 1WIUA 3RILA 1T1XB 1X9QA 4KXZH 1B2YA 3QDGB 1JZGA 4J3SA 4JRXA 3HRZA 5ALCL 3HIZA 5IESL 2WXFA 4BE5A 2HXAA 4XH2B 3CMGA 4TQEL 1KCLA 3QEHB 1EO5A 3QORA 5ACZA 3LQAL 5DEGB 1TEGA 2ESVE 1JGEB 1PKQB 2AJXL 1VA9A 3L3OB 2Q3ZA 3D69A 5TE6L 5BS0B 3B2DC 2R8SH 3L2NA 4KTYA 2F53A 1NGZA 1JK8B 2FEDD 5PCYA 4DVBA 4XP1L 2XQYA 4FG0A 3IB4A 4GXVH 5GHWL 3JV0A 1KTDB 1YJDH 3FRPB 1T03H 1DO6A 2FEEI 4B3EA 4PJ9D 3OXRA 5FYJH 5T3ZH 1EZVY 2A74B 4ZO7A 2X3AA 1RVFL 1JHLL 3GRWA 3FF8A 1L0QA 4LFHG 4Y16A 3M88A 4KXAA 4OZGA 2VJ0A 1GY1A 1LQSR 4Y2DA 2D7TL 4UQDA 4PJ8C 2VXVH 4X6FA 2L7EA 2VM4A 3CU7A 1Z5HA 4Z7OB 1NAMA 1T0PB 2I07A 2CG9X 4XNMA 2WLNA 4QDGA 3DURA 3FMGL 1QI4A 2PCFB 4KVNH 4ZOBA 1OT4A 2IWFA 4JG0H 4XWOD 2JTYA 4DGVH 1W8OA 1RP9A 4QRPA 2I85A 5HGHA 3B1UA 2ZX6A 2G4GA 1QLEL 3WY3A 1R47A 3GBML 3JWNH 4XRCB 1U3ZA 2ERJC 4JKKA 4EF3A 3DHUA 1WSST 3MNZB 2JI1A 5C8JA 2VDLB 4GG6B 4J4PD 3QI9B 3HS0A 3MU3A 4NDMB 5LKNA 5KBDA 3RDTA 3OJDB 1VKXA 1TCMA 1V3JA 5I15H 1JPSL 4JFHE 3VXRD 2AJZB 3N1GC 3AT8A 1FV1A 3ARQA 3E2HB 4P5KA 5L8KB 1Z0NA 2J1XA 4XPTL 3QI9C 5HDQL 2G2RA 3AREA 4WWOA 43C9A 1HZKA 5FIEA 3KL3A 3O3BA 3QQNA 3N41B 2XA8H 3WOVA 1CFNB 1CN4A 4BQ9A 1R3JB 2DIJA 1LMIA 4HUWA 2CO3A 4D2NA 2EIBA 3Q05A 4N28A 2ENJA 2QADC 2DKSA 2IH9A 4TNEA 4ACTA 1S9KC 4ZFOA 1OW0A 2CJUH 2YK1H 3ZYJA 2WCPA 4UQ9A 4GKSA 4Y2NA 3HC4L 5T5NG 4YUEH 4Z3JA 3U46A 1KFAH 2H1PH 4MAYB 2LV4A 2VDMH 5DWPA 3K6NA 3MV7E 5AZEH 4U1HA 1R19A 3MLWL 4XBGB 3GZQA 2AJXH 5IWLA 4UTBH 4UNVA 1T0MB 4KQ3H 3KW8A 4YK4B 3NP4A 4HJ0D 3FQYA 4XWOC 5EU4B 4BA8A 3ULUD 1M2VB 2FATH 4N5ED 2H9GB 1LO4H 4NBXB 2ITFA 1HX0A 3SE8L 4LBEA 3JVFC 2WUCL 3AXIA 4FFTA 2N4IA 4MMXC 1Q1JH 3DOIA 4N1HB 4N5EC 2EE2A 5IZ7A 1ETA1 2F9BT 3QNZA 4UUJA 1QOKA 1CG9B 2R1XA 4P46B 3ULUL 1JZIA 4D0CA 1BVNT 2WVSA 2X9XA 1EVTC 2CO6A 3BPNC 1C7SA 5I1CL 3CQPA 2AQNA 4N8VA 5DSCA 3QDME 3O41A 1W6WA 4D8PB 5ENWA 3RVVC 4FEIA 2A83A 3V0VB 3DX4A 4TSCL 1CGYA 2AK1H 5J7CC 5D72H 2QQNL 8FABB 4FG6C 1ZS8B 2ZOLB 3DSNA 5D1XB 4OD2A 5AW5B 3FUNA 3RPKA 3TP4A 3C5SA 4D0BA 5I82A 1F1AA 2ZCLL 3L9EA 1LDPH 3IWUA 4LCCC 2XACC 3B7RL 1A6UH 1X7QA 3PWVA 3F58H 4XCCH 3ZRCC 4F7EB 1D5ZB 5JQ6L 1QHPA 4OFKA 5T3XL 1MHPL 2CMRL 1CE6B 1G7LA 2UUDH 1L3NA 1KJ2H 5FDYA 1X9RA 4LVHB 1XSIA 2OSXA 5J13B 1JHLH 4JZOB 5H94A 3MRBA 1VLXA 2W0PA 5CZVH 3DHJA 2FIKA 3VXSB 1SOXA 3T5WA 1RHFA 4KHXL 2P5WE 2YQBA 3OAZK 3SGKA 5DZNA 2CHZA 3IE9A 2CPCA 4HUUA 2AV1B 1QKZH 3QUZA 4B50A 5IB2A 1YEJL 1KLUA 4LSSL 5D1XA 1A4KA 3U9PH 5A16B 1P1ZB 4G6AD 2J6WA 3PABB 1YRKA 1D7FA 4MWFB 5HJ3A 2W38A 1IL1A 4JDEA 4A6YB 4G6FD 1N64L 2WYHA 2WJ7A 4JFVA 3IVKA 5CFAA 4HXBH 3BSZH 4MQSB 4XB3A 3VDAA 4XC1L 3T4YB 3A6BH 4RZCB 4OCYL 1L3WA 1SUHA 3CUPA 4MJHA 1YEIH 5BO1L 4BSVA 3SPVA 4RX4A 2D9CA 1XIWC 1EV2E 4JUTA 3ZKMC 3VXQB 4FLSA 1FPTH 4ODXB 4K3HA 3KWWB 4NT6A 5FHAH 1MY5A 1P9MC 3QJOA 3REWA 3LH2H 3F7PC 2Z34A 4PN6A 4B3VA 3AY2A 4DCQA 3JV6A 3T09A 2DQGL 1ZHNB 2VQ1B 3JTTA 3QCUH 5KANI 3HUJA 1RZJL 1RJYA 2IV8A 4LSRH 4OLEA 1WAAE 3KPLB 5ECGA 2QKSA 3EOTH 5D5MA 3BJ91 5DMIH 4N68A 2Z8SA 4PS7A 1MCFA 3QQDB 4HDIA 2NZ9C 4KTEL 4L05A 4BFNA 3KLHC 1K5NA 4JFPA 3IJHA 3PWJB 1J8HB 4WW2C 2G3MA 4H13C 4PRPE 2B7DT 2FWOB 1MAML 4NKDA 2HTKC 1A1OA 4IIQC 2ITEA 2WOBA 1IQDB 5IJKA 5EZPA 3BUYB 3T3MF 1BOGB 1FO0H 3RY6A 5KYYA 1YAIA 3LRMA 4AJWA 4WNJA 4NOBA 5C0FA 2I27N 4OZGB 4ZOEA 3PWLB 5F70A 3AZUA 4QHNA 5KOMC 3W9DB 3P3UA 4HS8L 2YWYA 4XPGH 3S98A 3NN8B 3QAZB 1A4AA 4N2HA 2Q6WA 2KBGA 5HYSA 4NM4L 5JUEH 4TTDC 1UB5B 1XX9C 4OZIF 2DQDH 1BLIA 4HC1A 4YIQB 4OQ1A 2O5ZH 4X6BB 2AEPL 4HEMA 1R17A 3MV9E 2HX7A 5DF0A 1PKOA 5EN2B 5E8EA 4P2RD 3WTWA 3FO9B 2Y24A 1IUZA 3CHSA 4Z7OE 1I9EA 3QPXH 4BZ1A 4S2SB 5IW3A 3HNSL 4TQPA 2HRHA 2B39A 4Z1PA 3OJ2C 5J56B 1QSVA 3TS8A 2Z93B 1H3PH 3UBXA 4F7PB 5IOPA 5HHNA 3ORJA 2CIKB 1WBXB 2PTTB 1NDGA 2EJ1A 3LVEA 3V0IA 35C8L 5EDXA 3ABZA 3CHXA 4UT7L 5B8CA 5HD8C 3BHBB 2NY3D 3QR2A 4S10A 4OD1H 3I02B 2RQ8A 2HH0H 2EXWD 4U1GB 4ZMZA 1IGCL 2GCYB 4OCSL 5ITBL 1UT1A 1LQBC 4FTDA 4FTVD 3MRPA 5DVMA 1PKQE 5FS5A 2QKIB 4P2AA 4XZUA 1HXMB 4IK6A 3UPCA 3WFBH 3GMNA 4LVNC 4JPKL 1E65A 3MXWL 1E9QB 1RK7A 1X5HA 3QZPA 3O4LE 1SEBA 1ZHKA 5LN4A 3AS1A 1TFHA 4KK9C 4X7SL 1T1WA 2P5WB 5DHVH 2YEVB 1J1OH 4TTDD 5C0NC 3QUYC 1RK1B 4JY6A 4PJ9B 3UYOD 3GMRA 4NQEE 2Q8BH 1Q1PA 1QFWH 4PJAE 2ED6A 2K6YA 4NENB 3EO1B 4XN9A 1I9JL 1T7ZA 1PG7L 3Q2NA 3RTQB 4GAGH 1YPZE 2NNFA 3VYNA 1PNCA 1XL4A 5AW8B 3VWKD 2JMRA 3FQ4A 5HYSG 3QNXA 1OARH 1JZ6A 3QA3B 5AAWA 1MHCB 4F5CE 2P8MA 4UOW1 1A5FH 5F1NB 5KYWB 2R1WA 5EOCL 2Y7QA 4LRIA 1N4XH 1KBBA 1VGKA 2IJ0C 5CILH 3EGDB 2LR4A 4WI9A 3ATDA 3V8CA 3GTVA 4LLUB 3ZLQC 5K9QI 2E9GA 4ZXBB 2ROXA 4QPEA 2Y7OA 4YFLF 1B2WL 3Q1SH 4XBPA 1BFSA 3G7TA 1MFEH 4YHPB 2BVQA 1YMMA 3DHMA 3P4OA 5TFSH 3DDFA 3VFUA 4EPSA 3STBA 2NUTB 2X88A 4FHKA 2X9ZA 4JN2A 5PAZA 1NL0L 1D7BA 1QO3B 5I8OH 4IMLB 1CD0A 1KIUB 2VM3A 2DWTA 5C6PB 1L9MA 4P05A 3BT2H 4DUXA 2I9LB 3QQXA 5D2LB 3VXME 4BINA 2BW5A 3OQRA 3E9TA 1M1XA 3RIKA 1KN2H 4NUPA 1LP9E 1WEJH 5EIIB 4G43A 2AFNA 3V2AR 5T3ZL 5AFAA 2DLTA 3CPUA 3L3GB 4L29A 4NKMB 4NZRH 1KG0B 4Y7OC 1B4RA 2QHLA 3VD5A 2IPUK 4WWNA 2DH3A 3MXWH 2F1AA 1NPJA 3CN3A 1HZHL 1JRHH 1VACB 3QDGD 4FNLL 1ZK5A 4Z3FA 4XVJH 3COOA 1AZNA 3UBHA 3RY6C 3EZ8A 4TOYH 1AKJB 1YN6B 2A9DA 2VLRD 4DUWA 2HLFC 3US9A 4A2HA 2DQUL 1OP4A 4LEOB 1XCQB 1NM9A 2CIIB 4JG5A 4R3SA 4U1IB 4JQVA 4ONHA 3C6EA 4FNUA 1EX0A 4P5TA 2Z7UA 4OZIB 2ERJB 1LXMA 3VFVA 2PNDA 4YE4H 5CD3A 4L4VD 2DYRB 3VXUB 1NGYB 4WK0B 4MDJB 4UQ2B 4JFHD 3VXRE 3ZHKA 3EYVB 4YPGB 3JWDL 4I2XB 5CBAA 5KVEH 3S96A 1BBDL 3HCVB 3NT0A 4PGDA 1UATA 1N7ML 4NGHH 4PRNA 2XV2A 3PFQA 4G7YH 2DQTH 5D4JA 3MODL 4D9QD 5JA8B 4KKRA 1OAKL 1SVBA 3KXFB 4NWTH 1RPUA 1J9CT 2VXQH 3QIWA 4P2QE 5FCUL 4F1ZA 4PRHD 4N2EA 1PD6A 3JV5A 4JRYD 5F1SA 1AXSB 1URZA 2NY5H 3CFKA 4E41B 5GIRA 2Z3FA 4Y2OB 5E5RB 3RWDA 4QXVA 4LCVA 1BAFH 5FAAA 3Q6FA 4FFYL 5I8OL 1NQBA 2OMXB 3KEDA 4NQDB 4L9DA 4W9KC 2JCCA 1CGWA 2LTQB 3CSPA 3H3BC 3PQYA 3T77A 4KX9A 3ZDXB 3IM1A 3VFRA 3QUZC 5DEGA 5EU3A 3VSTA 4OB5L 4GUQA 1AGFA 5BQDA 5LAXA 1JHKH 2DZEA 1KJ3H 1RJZB 3BQVA 4P4RA 3QIBA 4LHJB 1SUJA 4IOFC 3LRSB 5AVXB 2G75A 5CZKA 4F15B 4ZPVB 5ID1B 1SXZA 4FFZA 4LLYA 4LSPL 1WFUA 3L4WA 2XYBA 3K0WA 3UGUA 4NNYB 4H1LG 4RX4D 3QC5X 3MV7B 2A6IB 2BC4B 5HDOA 1NGXA 3B4NA 5I1HL 1P7KA 1BFOA 1SNRA 4GW4A 5ESQA 6PAZA 3O0LA 5K1NA 2IALA 1G0DA 4QJ4B 3U6RA 2Y06H 1EUTA 4LOVA 3RWFB 2H32A 2YQGA 1J87A 4JFOB 2FBOJ 5FGCB 2AMUA 2VR4A 5AVYB 4RBPH 3WIFA 2NR6A 5IB4A 1RFDH 1A7QH 4FERA 3FCUB 5JDSA 4B5EA 1VEMA 3QORB 1OGAB 1M7IB 3O9WD 4OZFG 1A2YB 5HXMA 4ZS6D 2ED8A 4ZX3A 4QYOA 1Q72L 3CK0H 1FRGL 1NSNL 15C8L 3H9YA 4KY1L 5C09D 5CLYA 1CICC 4C56B 4XVUC 1IAIL 1J8KA 2AQ2A 4MS6A 1INDH 3OHXC 1TLKA 4JMXA 3ZIMA 2NX5B 3KCPA 5EO9A 2GJ6E 2VO5A 3BDXA 1HSAB 3GMRB 4X8JB 4DW2H 4PG2C 1SJVA 5B7FA 1U8LA 3UTQB 3FFOA 3FN3A 1ULVA 4N0UA 1KB5A 3MUY1 3RPIB 4AYMC 1AYRA 1U3YA 2EYSA 3RLSA 3WU1A 4APQC 2BCKA 5BJTA 1MLBB 1QEWB 3FFCE 3VFGL 4G2AA 5JW5A 3Q8CA 4PBVC 1RL1A 4OJDH 2UWEA 4RCAA 4LXFA 4O2CB 3JWNG 5E4AA 1GC1L 2CKBB 4ANXA 4RGNC 1MF2L 4HGWB 1I1AC 2Y7QB 3NABL 3H2QA 3P9LA 3V5HB 5K59F 3GZOA 5CN2A 2Q76A 1ZGLA 3EYSH 1TJMA 4CMMA 3RFZA 5IV2B 2HFFB 1U8QA 2VDRH 3P40A 3PWPE 1E4WH 2X3BA 4M6ML 1LVEA 5DEJA 4Z7VB 1WWAX 3T6WA 3KVQA 3AGWA 4NQED 4AYBA 5HI5D 2YPLE 3IAPA 3OJDA 1CLZL 1NC2A 1RSYA 4PW3A 3MCLL 4KRPB 4MJ2A 5M7QA 2VLLA 4XN1A 3OMZA 4KKLC 1GYAA 4I89A 5BZZA 2X2HA 2BJMH 5D7SL 3ZU8A 3LKOB 3N42B 2UZPA 3DX8A 3VSQA 1AANA 4ANVA 3UERA 1DJYA 1JZDC 1QR1A 3TN0C 3TNNB 1J1PL 3QZBA 5T5FA 5D70H 3KLSA 3ARVA 3R1GH 3IPBA 3FSZA 3CG8A 3QWNA 5ICXA 4GLRI 1EGJL 1ZV2A 2EEBA 5KUKA 3LXCA 4MX7A 4MSWA 3VH8G 3NCCB 4XOAA 4XCYB 1V7ML 2ZKMX 3BKCH 5MHSE 5ECJE 3H85A 5IV2A 1FE8H 4Z78A 3MRRB 2NY1B 1LNUA 4A2GA 3R7RA 1TTRA 2UVEA 2B77A 2VOTA 1R6VA 3SDAB 4CGUB 3GEWB 2V2WB 1QSEA 3FZUC 2FO4B 5FV1L 1E9PB 4TL5A 1ZJAA 3K1KC 2JJWA 4RGND 1S7UA 1JVLA 2OQJA 1HH6B 1IBGH 1IEHA 1RK0A 1GGBH 5H4YA 2HN7B 1VEOA 5C08B 4OLXL 3B5GA 1SBSL 5I75C 5KZCB 5DJ6B 5ISZA 5D6CB 1KGIA 1SYSB 1U8OB 2CH8A 4RFNC 4P23B 3TZVC 3TTYA 4L4TA 4N9GB 4LU5L 3A21A 1NCJA 1XF4A 5I15L 3WBDA 4AIZB 1B3JA 4OKVB 3RIAF 3D25A 1SMDA 3ARSA 2ISDA 3ASNB 1CD1A 1NGYA 2GIXA 2H3KA 4OV6F 3KPPA 5T1DL 4UBDD 2ARJQ 2Z6FA 3KBHE 4HHAB 1D6VL 1UM4L 2WLIB 4PJIB 4FNLH 4UT6L 2BP5M 4N26A 3SGEH 1BMGA 5L6YH 4PREB 2APWA 4HWUA 2M1KA 2OI9C 4E42B 4PJXE 3T8MA 2PWGA 1LMKA 3D0VB 4LSVL 1GGYA 4XWGH 5DWUL 3OZ9H 1CE6A 1G7LB 3HOGA 5D93B 1RLBA 3O6KL 4Y2LA 1RPQA 2J2ZA 3O8XD 4AVKA 1FFNA 4Z0XA 2K70A 2DM7A 1AR1B 1I1FA 1MVUB 1XR8B 3II1A 3IK2A 2OXGA 2IPUG 1EHAA 5JORB 2AK4E 1V3KA 3AQXA 5C2UB 3GXDA 1EUUA 3QRGL 1A6WH 2WBJC 3BP6A 1NLDH 3BZEB 2E6QA 1GSKA 2R0KH 3LQAC 1OAXH 3HRZB 5DJ8A 4AYSA 4ZDHA 5F7DB 1F4YH 1I1AD 3KZ8A 1LO3H 1N7MH 4XWGL 3G5ZA 3NQKA 4MASA 1UASA 1G9MC 3DGGA 4PREA 5A2LH 4P2OB 5ANME 4IEFB 3K8MA 4PJ7B 4N6RB 5DJZB 1OSYA 2OZ4A 4AQ8C 3H2WA 3TL5A 4O9HL 1WQVT 4FMKA 4P07A 3NTCL 3V6OA 3F3HA 3EADA 4R96B 3QXDB 3CUPB 3SPGA 2XN9D 3S35X 4BSVB 4KU1A 5DUML 4E41E 1X5KA 4P2QB 4OLXH 4FQHA 5D1ZI 5HJBA 1AS6A 5F7BA 2XI9A 4N2LA 2BFVH 2GJ6D 3G3LA 4NN7C 1P4LB 2J1YA 2XVKA 4NOFA 1ZLVH 4M7ZC 3MLZH 4C59B 5CJXC 3TWCH 4GQPH 5K93A 1A7OL 4ZFOB 2ARJA 1FSKC 3POHA 3QJQB 4I3SL 3QYNA 3NFSL 4XO8A 4C57C 4K71C 3LN5A 4BSWA 1V7MH 3S34H 3VVWA 4DK6A 2R29L 3HI5H 2XG4A 4XE0A 5CCGE 2XN2A 4OZHA 1FG2B 4KDTA 4KJPD 5DJAA 2Y07H 3V4PA 3VI4E 4M4PA 1NCOA 1PAMA 1IC7L 4IOSD 4JAMB 3AADB 1T4KB 5EO9B 1TZGH 1HOCB 4EUPB 2HUEA 1T0OA 4PY8J 4BZ1L 4K3DH 3ARDA 1L5GB 2DTML 4NNXB 3V6FB 4MB5A 4RISH 3KPNA 1RAMA 4HK0A 3OF6A 4DKDC 2ICEC 4B9JA 4N85A 2Q1EA 4PJXF 2WY3B 3DRQB 4BV1A 1HYSC 3G04A 2Y72A 1I7ZB 2E9IA 4L23A 3DV6B 1HK6A 5F3HB 3M45A 3BRDA 2ODHA 4S1QL 4GI6A 2VC2B 5KVEE 3IBOA 1ROWA 2GUOB 1NAKH 4EN2A 3WAJA 1H8LA 4LEEA 4CC1A 5B39G 1ZGLB 3TA3D 2ENYA 3D07A 4F8OA 2Z92A 5IW1A 2R15A 3BEWA 3L5HA 3D1MC 1AGEA 3GBMH 4YNYA 5IJVA 1NIAA 5DURD 5J1TC 3P1VA 3MJ9H 4Y4FC 1BVZA 4WKZA 2OMYA 5E8NB 3V5KB 1OT2A 3GXTA 4KVNL 1KXVA 2V9TA 1WJ3A 5DUBB 2CR0A 3RA7H 3JT0A 1AI1L 2BNRE 5I66B 4LNRB 4LESA 4DT2A 4PUBL 4K3DL 3ZL4L 5SX5H 1E4HA 2VGLM 1RI8A 3BAWA 5FR3A 4IBUA 1MFNA 4CDHA 5CR1A 3GUTA 3HZYA 4A7GA 4UZUA 1F4XH 5D2NE 2YAMA 3TH3T 5LGJA 4BXVA 1FNEA 3ES6A 3SYOA 1DJIA 2VDNH 2BY3A 4WFFE 2FDBP 2YGVA 3ESMA 4H88H 3EBAA 2ITDA 3JQOB 1P69B 1GJWA 3WKMH 2GTWB 2PPEA 2I5YH 4L8DA 4QLRA 2R29H 3HI5L 4M6NL 4TQIA 3VGEA 2YR3A 4M6OL 4HV8B 3SDCB 5F9OL 3OKKB 5LBGA 2PCPA 3ZHDA 4XX5A 3B34A 3X14B 3RWHA 3X1EA 3KEHA 1IC0A 2JJUA 5DFTA 3VFNB 4ZMNA 3S0PA 3BN3B 4NQCB 3LQZA 1YNKL 4ZUSA 1Q9LB 2VLKA 3ECBA 3HLAB 1L4IA 3HE6B 4Q9QH 3DVIA 4HIIA 4DCQB 3KPMB 3WNKA 4MVBC 2V2TA 1QUNA 3EZJB 2DMKA 2BNQE 1WUNT 4TSBH 4Y4HC 2IQAA 6FABH 4M1DL 3HZKA 3VXTB 4FS0A 2LGNA 3HG2A 1TQTA 2CKNA 4LCIH 3O8XC 5HP5A 1EAQA 1UD6A 5KS9E 1XCXA 4OGXH 2C34A 2R4RL 3QWOB 1T0MA 1QRND 2BVUA 2JKLA 3GFUA 4I7ZC 4NM4H 3CDGA 2X6MA 3UAAA 5I71B 3FU7A 4A6YA 2CHDA 3EF4A 3G08B 4URTB 1NGPH 4E9WA 2VL5A 1OTSD 4LEOA 2FX8L 5D96B 1JZEA 4MKMA 2HVKA 5AVRB 5C9JA 2V5YA 1YY9C 3U9UB 4EXKA 2YD6A 3WFHA 2EXWC 5EFIB 1SHSA 4HX1B 5CUSL 4FI8A 4ZD3H 2LW3A 2R2BA 3H9SB 4YHLH 2EUXA 3MODH 3O41B 5FOBA 4LKCB 4XP4L 4G1EA 4XP1H 4X7TA 3REVB 3HCVA 1EEYB 1DZ0A 5HJDA 4EMZA 3GLAA 2I60L 5ABZA 3ETBF 1IGFH 3QQ3B 5I28A 1I85C 1XMWA 3HVNA 3T3MB 5J5EA 4Z95H 4AX3A 1G43A 2WWKO 3N0PB 1TEFA 4M7KL 4N6RA 3T6ZA 3D5OF 3C12A 5I1GL 2IQ9L 3CFEB 1BAGA 4NO3B 4H0GA 4HEPG 1D5ZA 3LEVH 2FTAA 3WSQL 1L0YA 4JN1L 4AEIH 5BQ7B 4GAFB 1XGQA 3AWFA 3NACL 4JFFA 4WDIA 3K8KA 3LPFA 2F5BH 5J12B 1N67A 1YMHA 1XXDC 3KDMA 2WV3A 2MCPH 2NNCA 5F7NC 4FZ8H 1MY7A 2NYZA 1TPXB 4L37A 4XMUA 4TUOA 3GTTA 4MNHB 4HUXA 4W9IC 1QPPA 2NRDA 2EEDA 1FDLH 5GGUB 2XU9A 3QFJA 3SGEI 3QHZL 3GSWB 4WTWA 4LCYA 1QSFA 5DCCA 5EZLB 1IBGL 3EFFA 3E1ZA 3GJFK 3MJWA 2IVFC 2ARJB 1JERA 1FZOB 2KDGA 4FFYA 4R84A 5IVZB 4DHLA 5FC9A 2A1WL 1ZHLA 3WIAA 1PTZA 2E5EA 3FHEA 4OM1H 1EXUB 4H88L 4H1LA 4K8RC 1S3KH 5ABAA 2GB2A 3ALPA 3MRGB 2D03H 1HQ4B 4PJHB 1XGQB 2A4ZA 3UJTL 1G84A 4PWKA 2FIRT 2F54E 4UDTB 3CHOA 3MRHB 3RIFF 3U1SL 4XCEA 1T4KA 2N1KA 5AOIA 4QF1A 5C0CB 1T22A 1XF3B 3DSFH 4LHUA 2BH0A 2ICWA 4A2MA 1CQKA 5J6GB 4OJEH 1BQKA 2JCCB 5IBLC 4A7QA 4QY8A 3MLSH 3B2VL 1A14H 1MCRA 2FB4H 1W2KT 3KWXA 3F04A 4Y1SA 1KV3A 4QRQA 3CZJA 3IFNH 4K23L 1CDHA 5KANG 1PAZA 3SDXB 3MBEB 3BGMB 4XZUB 4P2RE 3MNMA 4PJBB 4IDJL 3MKGA 1SDYA 1SY6L 4GLRH 4HCGA 5JIIA 1BYNA 1IM3B 1KNOB 2Y1VA 1NTDA 1IT9H 2IH8A 4GI8A 1OY3B 2LOEA 1G87A 1ML0A 4PCKA 3OKMB 3T3ME 5CU5A 4J3OC 3U6XS 1JUFA 1ZCRA 2V37A 2ZXQA 1C1EH 4CN1A 4F8NA 5KSAA 3O3DB 4NENA 4PP1C 3MLSL 4QTIL 2KPNA 1GZPB 3VGDA 3L81A 5D1XC 3OGCB 1F4AA 4LHUB 1KIPA 1WD9A 2DWSA 4GG6F 2D7PA 5KZCD 2HJFB 3IDIB 3M46A 1JWUB 1U6AH 3PFUA 3WG7B 2VKXA 1ETB1 3MBXL 3UABA 1BZ9A 2DF3A 3KGTA 1E50A 1CTNA 2BINA 3P77A 4Q89A 3CFCH 2YUXA 3CQFA 2LTQC 2PYEB 3GPSA 4ENEC 1M7XA 1J8HE 4KH2A 5KSAC 3ARGC 5C0BA 4H0LC 4DVRL 2ZJSL 4DO5A 4MBOA 2A1WH 1XO8A 1TQBB 3PJSB 3V4UL 1W0YT 4M9OA 3O6MH 3E6HB 1WYJA 4PJFF 3TC9A 4RH4A 3PYCA 3WO4C 4NZFA 5KSAB 2DWDB 2F19H 2PW1A 3ELQA 2XXFA 3HN8A 3P0GB 3QUHA 5D1ZD 5DK3A 1XEDA 2LABA 5DI8B 3DXAB 5GJSL 1BJ8A 4K3EL 5T5FH 2D7MA 5GSVB 3GSRA 4W70A 2Y36L 1R5IA 4UUJB 4WFGE 1DBKH 5D7JA 5JW3L 2Q2LA 4WFEE 4JZJA 3W1ZA 4OZHE 4OLVL 3SSGA 3VD3A 2GTZA 4J3OD 1CL7L 3Q0HA 4GP5B 1OB0A 4N0RA 4KFMA 4XNXH 3V7AG 5HGAB 3K7UA 3KPMA 4G6AC 4IHBA 1UWEH 4PGEB 1VESA 4ZT1A 3V0WH 3UZEC 1HSBA 4J5VA 2YZ1A 3MLRL 3WN5C 4PBXA 3S97C 3GRBA 3N91A 5FO8A 3TA3A 2QL1A 3NIFF 5FA4A 1PZCA 3SE9L 3C5SB 4D0BB 1XBRA 4UOZA 3LRGA 3PGFL 3QZWA 3GDCA 1XZ0A 4UDUB 1F3RB 4F3FA 4TV3A 1KULA 1SJEA 4MLSA 4NAJA 3KH4A 2FSDA 5J6HB 2YMXH 5F7YC 5CINL 5BRQA 3GO1H 3P2TA 1RZIB 5JXED 2N0MA 4X0KB 2X9WA 3ARGA 4UCFA 1TR7A 1LP9F 4TNGA 1Q4NX 2EIEA 5JYLA 1DQJA 1KXQE 4LSQH 1BF8A 3HBQA 1MFBH 1KB5H 2CLVA 7PAZA 1O5DT 3MNDA 2NXZD 3ZE2F 4PGBA 3OC5A 1N5AB 3ZTDC 5ANMA 3D0AA 1EAPA 1HS6A 1CR9L 4EOWL 2PKDA 4JLRB 3HB3B 2NXYC 1IBFA 2XXCB 3OZ9L 3CK0L 4KPHH 2F8XC 3C9NB 4KHTL 4H4NA 4LLDB 4WU5A 5GGRA 5B38A 1RH8A 5D1QE 3I50H 3ILQC 2X4RA 4LSRL 3QORD 3W39A 5K9OA 4J12A 5KS9B 2AK4A 1IRAY 5ALCH 2ADFH 1Y18A 5DMIL 2WIIA 2K1MA 3HS0C 3QO0A 4HKBA 1XH1A 4UU9B 5DQDL 3ZHLA 2VXTL 3HI6H 4Z7UA 4NHCH 3DTXA 1KTJA 1QFUL 4G9FE 3AWGA 5SX5K 4WDIB 4BKSC 1AE6L 3TA4D 3WLWC 1J11A 3TT3H 3WEOA 3VG0L 3W5NA 4PJXA 1TETL 2PXYC 3ZQWA 4GSDL 1MKFA 3RWDB 1AG6A 4AMKL 2XETA 5CMAB 2JELH 4BM7A 3UAJC 1S5HB 4R0LB 3F6JA 2XPGB 4LCYB 4KJQD 5T5NF 1MCWW 4BXSV 1FL3B 4MJIB 4MFHA 2YJQA 1NFIB 5DR5H 3MROB 4A1RA 1UM6L 5B7MA 1RLWA 3ARFB 3LN4A 4OU3A 1KEMH 3ZKXC 5E1IA 2XQYK 2AXGA 3NCFB 3NSFA 4YK4C 2HP4A 1BM3L 3HC3L 3B9AA 2EKJA 2IDSA 4G6MH 2C1PB 4XOCA 4YLCA 1VZHA 2VLMD 2XPZA 1U3HB 2R0WL 4OVUA 5EWIH 2NNAA 2XQBL 2R23B 4HS6B 1A1NA 3QUYA 5MEPB 4XCEB 3ZY7A 3BH4A 4E5XB 3NRQA 1T1XA 3IFOA 4WHDA 1H9DA 1QSEE 3UZQA 3SO3B 4ZFGH 2Z35B 5FM5M 4MAYC 3NUKA 5I1JH 5KAQF 1NL0H 4OQTA 5DD5H 2P44B 4QHNB 1BBJB 3FO2B 1O5PA 2XIDA 2J56A 1BOYA 5DRWB 4R2GD 3SBPA 4QRRE 1CO1A 1JK8A 2YAEA 1GW6A 1PF3A 4X6DE 4P9HL 1ERNA 4DZ8B 3VWKA 5C0BD 3GS0A 2FQFA 1M71B 3M7FB 5I1CH 5I18L 3MRFB 2WUBL 3AU1B 4OAWB 5I5RA 1OCOB 2CWRA 4HWBH 5BZWA 3ZUNC 4O5LL 3UL4A 3W0WD 2A2QT 3B2XA 1MCPL 1A8ZA 2WUCH 5IREA 3KR3H 1BVOA 3FB8B 2DTMH 3KPNB 1UFGA 3BHBA 3FKUS 1C12B 1X5MA 4G7QB 4AQ1B 2WXJA 4POUB 3HBPA 2DIEA 4XMXA 4U0RB 3SO5A 4WUUA 4C4KO 2FBJL 2NUPA 2BWQA 2X2JA 3IT8D 3P11L 4N8UA 4ZG1A 4CN4A 2V2XB 1T5XA 3FU8A 1AGFB 1MRFL 2VERA 1H3TA 2DTSA 3N40F 4WUKH 4JO4H 5GRWA 1K85A 2PN5A 2X4SA 3FQXB 4LSUL 1E3FA 5KYUB 4JCLA 1BD2A 4MXWH 1OGTA 1P6WA 3ZVVA 1AZVA 4QKTA 4Y1AE 5JLZA 2EH8L 1QX1A 2QVFB 3WYRA 1B4LA 2XKNB 2P5ED 2ATPA 1MCEA 2LLLA 1UOKA 3DARA 4A39A 1FV1B 5LXGH 1RK0B 4UI2A 2EH7L 2FL5A 3IRCA 1U6AL 1KPVA 5CP3H 2Y2WA 4F37K 5TFSL 4ODHH 2OK0L 3OKEA 2F61A 1MIEH 4OKVA 4K55A 3L3HA 3OXSB 5F3HA 3CSYA 2OMUA 3BKJH 4RFOL 5HGHB 4I4WB 5A3IC 5EN3A 3SD2A 4LVEA 4AW4A 4WHYG 2JQZA 3WTYA 3SYAA 1XVSA 4N0YL 2QJDA 2PXYA 3JYCA 1MFDH 1N4XL 4DGIL 3RWIA 1AGEB 2ZOTA 2IGFL 4S0HA 1JZ7A 1M56B 3QO1A 4P8QA 4Y4KA 3KLHD 4TPRL 4B6ZA 1PZAA 3QEQB 1MCLA 1X5AA 1UJ3C 3QWRD 3PXLA 1T83C 3SGDI 2OYPA 5KW9L 3VI3A 1KPVB 4LL1A 3RVXD 1TQWA 3H7BB 1QZNA 2EH7H 3O3EB 4GRLA 2H5UA 4JRWA 5CJXA 2RQEA 2J4WH 4I87A 4PJ5D 5FYKD 1DQLL 3KPSA 3L3HB 1K8IA 3QQ4A 3W2DL 2FH8A 4MQ7B 4ATWA 3LKNB 5FUZL 4J8QA 2AABH 5FYKU 2AF2A 1E28A 3AY4C 4OTXL 3IDUA 4NO5B 2Q8AH 3QFDB 4QOKB 4WEBH 3CFJA 1N3NA 4G80A 1PY9A 1PU0A 3BWSA 3QO1B 4N8VG 4R4NC 5D7KD 5GRJL 5LGYA 1D5MA 2VL5B 2KYIA 5I75B 2NSQA 4M3KB 4XVTL 4AENA 1MJ8L 3IU4H 2VQUA 3QXDA 2X12A 3BD4A 1HOEA 5IJKC 2CIIA 1LE5A 1D6EB 4K8RH 3MBEC 1EZUA 3GNMH 4A66A 3APNA 3MRQB 1BLNA 3NRPA 3O4OB 4M93C 1KC5H 5KS9F 2QSCL 2ZTBA 1WAEA 2NX5E 1F97A 1EXGA 1USZA 3HBGA 3NH7L 1DFBH 3IJSB 1EHKB 1G6RL 4JANA 4R2GB 2WBJA 5GGVH 3KPSB 4Q6IA 3ZJAA 4G1EB 3VD9A 1E67A 5E0FA 3UTTA 3I3EA 4X5WB 1E27A 4X9YA 3FCTB 3U36A 2P8LB 3AWEA 4LLQA 2J25A 4OZ4A 4X0NA 3UZEA 2GQHA 4AEIL 1I31A 2ADFL 4UINH 3RVWC 2AEPH 5D71L 4ELDA 2ADGB 4JO2H 4GSUA 4JZJC 3SKUD 5E99L 4Y4HD 3GQFA 1A3RH 4NKIL 1D5BB 2WPGA 3AS0A 3BXNB 1VADB 1JNLL 5F9AC 4X4YB 4P49A 4BZ2H 2R9HD 4GSRA 4KXDA 4YL9A 5DTFA 3ZTNL 1U3HC 3D2UD 1A4BA 1BVKB 2CDEB 3MZGB 5LVEA 3MRMA 2FD6L 4AZ8B 5IHUL 5BVJA 2BSSB 3UBXB 3WE6B 2XXMB 3X3GL 4N22A 3KWWA 2WXQA 2ZSWB 2R23A 5SWZD 3US0A 2W95A 3I6KB 3D3VA 4NWTL 1FN4A 5D7SH 3HAEH 4AVJA 1A6VH 1KJ2L 3RYMA 4A2FA 1CYWA 4GH7B 4L3AA 1KTCA 1MAKA 1H3WM 1UM6H 1WGOA 3MCLH 3VXRB 4PJIA 5I8CB 3SGKC 3U48A 2ADGA 3GSNA 2NZIA 4MJ4A 3BIBX 2AMGA 3W81A 1IL1B 2CNYA 4JDEB 4X9GA 5IVOA 4PMFA 4RGMB 2YRBA 2MKWA 1CD9B 4ORGA 1QWUA 5DUPL 2E6JA 3RY4A 4AYFA 2E7HA 4KX7A 1DBAH 4QI3A 2EDLA 3WN5B 5IB3A 5GGSY 1AE6H 1MVUA 5E56A 3TU6A 5FCSH 5IFJA 4DN4L 2UUDK 1HNGA 3G6DL 2ICWB 3NGBC 4ICXA 4WUUE 2O72A 4NPJA 5J6GA 1U30A 3ZGHA 1YQ2A 3ZKND 1KENH 1T21A 4Q0XH 2ZWYA 3CBJB 2YGQA 2BOCB 3BSZA 4XMLL 2BY1A 4ADGA 4NFCA 4X6BA 3ZOAA 4K3GA 4Y5VA 5TQ2L 1F02I 3DGGB 2FGWH 5I8EA 4HG4J 2YD1A 1QQDA 2M2DA 3MLWH 4PMEA 3QULB 3QFJE 5DC9B 4XP5H 4U1HB 1SOSA 2O26U 1XDTT 3QDMD 1HEZA 1QLEB 1KN2L 3W0WE 1H0DA 1XF5A 1ZIBA 4JKWA 4OGAD 1G1YA 1MFCL 3IDGB 2F7OA 5I76B 1BOGA 3NZUA 1IGTA 4OZFA 1RCYA 5FGSA 1YMMD 4RDBA 2A9AA 2ZCHH 1RIUH 4JGMA 4DFHA 1KJMA 1JZJA 3AFLA 4NPKA 3ESPA 5CSZB 4IU2B 4LFHD 5C0RL 1HL8A 1P7QA 3LKRA 5F0LB 2AJ3A 4KH9A 5IJDC 3EUDA 3Q1SL 4HGWA 3H3PL 3SDXF 3CXHJ 5DD3L 4LDEB 1NCTA 3BRFA 5DO8A 1GOHA 1KIQB 4ODUA 4FA6A 2F74B 3LB6D 2YGNA 1SGKA 3O6FB 3KGSA 4O02L 4PW9A 1ACYH 1UT9A 5AZ2H 5JPMB 1KJ3L 4OCXH 5E2WH 1QPKA 5CEXB 2PXYB 7CGTA 2NR6D 2BK8A 4Z7VA 1LLAA 1GYWA 5CJ5A 4TUUA 3AXLB 2O5ZL 1JCVA 4PB0L 4RISL 3ATFA 3P69A 1D9KC 1K6QH 4KI5E 2ZXEB 1JGDA 1B4JH 4KKAD 4XC3L 1IC4H 4PV9B 4AYID 4N9OB 2P3YA 2BZDA 1MSPA 2KERA 4XE5B 4Y7MA 3WLBB 3CFQA 1B6DA 3H9HA 4YH6A 3P4MB 1BX2A 1P4BL 5IHWA 1WK0A 1I85A 1H9VA 1T80A 5KN5A 1UENA 5FWQA 1QG3A 3MV9A 5IIEA 2MOGA 4GAAA 1L7TL 4UOJA 2OMWB 1XGZA 2IXQB 3WJLC 1IC7H 2AV1A 3QUZB 1IFHH 2HLAA 2W0KA 4Y9CA 4JG9A 4UTBA 4GXVL 1DFXA 4OFVA 1A7OH 1XGTB 2AJVH 4NGHL 4FF9A 3WTVA 1H3XA 1R1CA 3M7OA 4FXKB 4YN3A 2CCVA 4KKBC 2VLKE 3QPQC 3BVNB 4MZ2A 1EH9A 4A04A 1HJCA 3BE1H 2IV9A 1A22B 4JFFB 3PXHA 1L6ZA 5GSVA 4GG8B 3RZCB 4F2FA 1I1AA 1S78C 1X5GA 4NFDA 3ZE1B 2J20A 1NC2D 5HYQB 2BHFA 3GYRA 4PRBA 1EAPB 2OX5B 3FTVA 3T0XA 3QAQA 5CD5D 2YBRA 3TONA 5IBUG 2KQNA 1KXQA 3FO0L 3GM8A 4NO0D 4RQQA 1HSBB 3LEYH 1G9HA 4M48H 4W6XB 2NSXA 3AQZA 4NQUA 1U41A 3CQQA 3FT2B 4TRPH 4B0MB 4BK8A 4ZI8A 4Z7IA 2P8LA 4LLQB 3HUJE 9PCYA 4N8CL 1ZLDA 2XJKA 5D2NA 1FZOA 5IB2B 5HHOE 2VDLH 5TD4A 1QW9A 3SE3A 1RURL 5KSBF 3MFFA 1DCEA 3LSOB 1DEEB 1AQKL 2V7NB 1LO5A 4MD4A 5JHLA 3PWJA 1HILA 4RETB 1AH1A 1HEJC 1WH0A 3MPCA 2ZG1A 4EDWL 2BNRA 4N3UA 4UV4H 5IBLD 2APTA 3HE6D 1MREL 2XWDA 1P7KB 5HGBB 4Q97A 4TVPL 5I9QC 3BT2L 4WI6A 1H19A 2CALA 1Q9LA 5MEQB 4GMTH 3L3OC 1WBZB 4GKZB 2ZKHH 4Y2DD 4NAMA 1PLCA 2EZ0D 4XNQB 3Q8BA 1GZQB 1TVHA 1WO2A 1BFVH 3NN8A 3O3UN 4Q4EA 3DC0A 1JV5B 4B9KC 4TPRH 1HESA 5E5UB 4WO4B 3CDCA 3VXPB 1NFIA 1UD8A 1BP3B 4TRPL 2YJLA 4PLNC 1Q9WA 5FK9A 1M6UA 4DN3H 1ZLUH 4P57B 4WY7L 1KWGA 2QR0A 4KK5D 1JK9B 1MIMH 3MI6A 1ZE3C 4QWWD 3KS0J 1I7RB 3VXMD 1GTFA 1KXVC 2EE9A 1J8HA 3N1MC 3QIWB 5D6DC 4MLIA 1AG0A 1KGWA 1NFDF 4X8CA 3SN6N 4AYFB 1VFMA 1I7UA 1G9NL 2CM5A 1A1OB 3AY4A 4F7TA 4YMPA 3CFKB 1MQKL 2F5AL 5I1AA 4KKLD 2VZUA 3MA7B 1D7DA 3NACH 5B8CB 3AGVA 1J05A 4FQHB 4WWKB 4EJ1C 2GEEA 3CLWA 4PRAA 3ZT5A 1FAKT 3DGDA 3LEVL 3WSQH 2F6AA 1GGCH 4JBSA 2R69A 4PI0A 3IKCB 1IJ9A 4GAYA 1F8TH 2TAAA 1HC1A 2P28B 4TNWF 5D7EA 4WEMB 5DRZB 1J9SA 1UJ3A 3NESA 5DJAB 2WVTA 3VFMA 2QPEB 3R06A 2XXGA 3LN4B 4HPYL 1SYVB 2BOLA 3IMSA 4NO3A 2VDPB 2R69H 4E9QA 3JYBA 1ZT1A 1I7UB 4CVZB 1FL6B 4NI3A 3HZVB 1TQSA 4S1RL 1AXSA 1TQVA 3IDXH 4H8WL 4AK1A 4E41A 1FZJA 4DEPB 1KB3A 2X6BA 1QFWM 3QEQD 2AKRA 1IC4L 2X6CA 5AKTA 2N56A 4X4ME 4OF0A 3HUJF 1J9QA 1WA2X 3WFCH 1L9NA 3D85B 4UTAH 2DI7A 3QUXA 1L5GA 3ARDB 3TBVA 3GO1L 3QAZC 2NY1C 1W0VB 5HPOA 3M1BA 4K2UH 1LEKB 4HFWB 3RZWA 4TQ8A 1IEBA 1ZHBA 4LPVA 3Q6GH 4CMHC 3UTSE 3DV6A 2KL6A 5TE4L 5GS2H 2PR4L 1RJCA 1EEZA 5FA4B 1R3KA 1XB3A 2C9RA 4U2YA 2XC8A 4HUNB 1JXKA 3QZWB 2VW4A 2HT3C 2QLYA 3MRGA 4WW1A 5TDPB 3NCWA 3VQ2C 2WVVA 3GSXA 3L13A 3M1CA 2CM6A 5GS1A 4W68A 2DJSA 5F6IC 4X5XA 2BVQB 4LLAA 5BRPA 2FB4L 4EN3A 2QMKA 3F65A 1LK2A 1JP5A 4KNUA 2NUTA 3FN0L 2F08A 2DYPA 2I24N 3TIEB 3PP3H 5KYXB 4FG4A 4KZEL 5GS0H 1WZ1H 3BVDB 4PJDB 5FYLD 4HFWA 2DAVA 1ED3B 1CFTA 2EIDA 4L3ED 4DJMA 2C1OB 5C0ND 5CZXD 5FYJL 3VVVA 1J0JA 1MI5D 2K3HA 4XNZB 5D1QC 4PLKC 3EGDA 3THML 2J3SA 4IKLA 3QUKB 1TZIB 1YEKH 3G6AB 4JRYB 2EEAA 5DVLA 4CC0A 3VWKC 5B3SB 2QV4A 5EEXA 2V7HB 3DO7A 2WBJD 4OZGE 1WZ1L 4OGQC 2XFXA 3LX9A 4Z8FL 2BHZA 5ISZE 1IZKA 3B9EA 3GZKA 2EVJA 4NQCA 4WJ5A 4XP6L 1XMEB 1RIVH 1Y1DA