1ZE3H

Crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
122
structure length
122
Chain Sequence
TGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone/structural/membrane protein
molecule keywords Chaperone protein fimC
total genus 15
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2005-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1ze3H00
4X5PA 1N0LB 4J3OH 4XOAA 4XOCA 1QUNB 5FS5A 3MCYA 5AALA 5AB1A 4CSSA 4J3OG 4AUUA 3SQBB 4AUYA 2J2ZB 4CSTA 5F2FA 4AVIA 4AVJA 2XG5B 4XO9A 4AUJA 3RFZA 3BFWA 1KLFB 4J3OF 4XOBA 3ZL1A 4CA4A 4X50A 4XODA 4AVHA 5LNEA 4AV5A 3BFQG 2W07B 1ZE3H 5IQNA 2WMPB 4AVKA 5IQOA 2JTYA 3JWNH 5LNGA 4AV0A 2UY7B 2VCOA 4AV4A 3ME0B 5AAPA 3ZL2A 1N12A 3JWNG 1UWFA 2JMRA 3ZPDA 5JQIB 5FLUA 3JWNE 4LOVA 5F3FA 5CGBA 5IQMA 5FX3A 4BUQA 2UY6B 4XO8A 5ABZA 1PDKB 4X5RA 4XOEA 4X5QA 3BWUF 5FWRA 1KIUB 4ATTA 1TR7A 2XG4B
chains in the Genus database with same CATH superfamily
2X40A 1HI6A 2L4OA 3Q6GL 5EULV 5C0FB 1KDJA 3UYRH 4FQ1L 3GI9L 3RU8L 1QWNA 4WWKD 4YHML 3NYKA 2G4EA 2Z6FA 3VRJA 5CJQL 3T77B 4M7JH 2WAQA 4UZSA 3CLEL 5F8QC 3UGXA 5J6GB 2VDKL 1BXUA 1OP9A 3K6IA 1ZA6B 3EYUH 3WD5H 1VA9A 4D0BB 2H1XA 5I16B 1RFDL 4XN2A 1Q4NX 1JOIA 5JW3H 1CFVH 1DQLL 4RWYL 4B97A 1UWFA 1L9QA 1ES0B 3VMOA 2K4WA 2ZUXA 4I48A 1FLRL 2IAAC 3UAAA 1G7MA 5MEOA 1H6UA 2GB2A 1FSKC 3LKSB 4LZKA 3D50A 3GBNH 5GPRA 5ISZB 4K94C 3QIBB 4KI1A 1HXMA 4LLQB 4JVUA 3ZOAA 4DEPB 5KWYC 1ZJAA 1SJVA 4MB3A 2F68X 4QOKA 2GJRA 4L5FL 3W9EB 4EIGB 5FB8A 3DI3B 1ID5I 3LXUX 1MCWW 1ZE3H 1BBDH 1I53A 4EI5A 3V10A 1JGIA 2VM3A 4XPGH 1GGBL 1N12A 3GI8H 5AD0B 3ULUD 1M7IA 3OG6B 2WINB 3COOA 1IBFA 3GK8H 3KPLB 1FWXA 4LQFH 4TNFA 3E3QC 4K3HA 4R8WH 2F7QA 5FWRA 1KIUB 4F5CE 2FWUA 4N20A 3ZU8A 1A8JH 2B2XL 4LE8A 4N2NA 4RRPG 4XRCA 2H3NA 2YD2A 1WTLA 4YQXL 1A6ZA 1IBDA 3EFFB 4AUUA 1NKGA 3K91A 1L0YA 4I18B 1GGTA 1K3IA 4ZFOA 5KANI 5DJCB 3IJ7A 1JZ6A 3MV9A 1S9XA 4YVUA 2DOCA 1PNCA 2AERT 1QRND 4LLUB 2R1XA 2Z0UA 2H3XC 1GZHC 3OZKA 1OEZW 1KLGB 2FR4B 1A6PA 3FHEA 4UOQA 2JMRA 5ENWB 5HI5D 4EO5A 4GRWE 1IFGA 4NQEB 4QEGA 3EF7A 5CINL 4KRPC 1CO1A 3QWRD 4GSUA 5LBGA 4UUJA 1NH6A 2X6VA 2F8XC 1RURL 2MFNA 5KSBA 3EF4A 3F7VA 3U6XA 2LABA 4LLUA 1THAA 2M83A 35C8H 4N0FA 2BVYA 1ZSDA 2QSCL 3WTUA 1S5IL 2JQMA 1HHKB 4D3CH 2GAZB 1GH7A 3ROOA 3NCBB 4FFZH 3VD9A 1F6AA 3O2WH 3OM3B 3MNWB 3M46A 2HKHH 3RPKA 2I85A 2ZUYA 2I9LA 5DYOA 4YWGL 1MXGA 3TVMB 4Z3FA 4MVBC 2Z7ZA 3EO1A 4LHUA 4AL8C 2NCMA 3FOMB 3OXSA 5L7XL 2ROXA 3K6OA 2YQGA 4P4RA 4PJ8D 3KXFA 1XB6A 5EN2B 2BFVH 1HHJA 3ARQA 1PX4A 3BWAA 4WWNA 3V0EA 3PNRB 2DQJL 3V8OA 1IKOP 4FTVD 3KLKA 3P40A 1HT6A 2BRRL 2D7QA 4MJIA 5IHBA 1LEIB 5I6PA 2X4RB 1RIUL 2EKJA 2QZQA 4YL4A 5KZCD 4BSVA 5C2UB 4GG8A 4R3SA 3KNBA 4PV8B 4EN3A 2FIKA 3KYMA 3OZ9H 4HZLA 5HTSA 5F72S 3AXLA 4S1RL 1XZWA 2AW2A 3V0HA 2BC4B 4XPGL 2PXYB 3RY4A 1XH2A 2R0WL 1MCBA 1SPDA 2FQGA 3AMKA 1BAFH 4G43B 3FN0L 4R97C 1I4FA 1DVUA 4PRBB 1KBPA 1TTFA 3H9YA 3O3BA 4HPOL 3KXFD 4FQHA 3RHWK 4WHYG 1T3FA 2MNUA 4HLZH 2YN5A 4IDLA 1I3GH 3H56A 3QJTB 5KVGE 3RILA 3U6RA 2GJJA 1FPTL 4QJ5B 3BDXA 3B6SA 4ZSOA 2ZCKH 4HWBH 4PTUA 4HWUA 4PJGB 4UTBL 2YD1A 1SF5A 5D5MF 5I28A 2YMXL 5AB0A 1SBSL 1G9HA 3P77A 3PIQB 5HHPA 2XKSA 3JTSB 3WD5L 3U36B 2BVUA 4M8VA 3QI9A 4Y0GA 3BVWA 4HZLB 3CFJB 5I6OA 2E9BA 5TK2A 4JRYA 1AIFA 2PPFA 1CFNA 5I71C 2CO3A 5J6HB 2OULB 4OSUL 2DWEB 4PMEA 3GZKA 1AXIB 3CE1A 3VI3E 4AM0B 5IJVA 3QDMB 2P52A 4HU8A 4MJIB 4R5VA 2IQ9L 4G5ZL 4PS7A 3VX0A 4WFED 1Z3RA 2YSSA 4H8WC 4IBUA 2V0AA 4DO5A 4MQSB 4Z3IA 1CGTA 4OCSL 3OR6B 2VLJB 4OCLC 1DDHA 3S2AA 3LX9A 2ATPA 4X2UA 1RZGA 2JVUA 1NGZA 4JR9L 5BXFA 3T8XA 4AGOA 2VAAB 4OCNC 3SGEI 1JD9A 3IN0A 1EMTH 3P4MA 1PFOA 3AACA 4KKCD 2PYFB 3QEQD 2JJTA 4P5TA 1JZ4A 3VFSA 4C4KO 3ULUF 4RZCB 3RGVD 3LNEA 4AYFA 4J5VA 2GSIB 1CFNB 1E5YA 1QFPA 3VWJA 3V6FA 5GZOC 4MBOA 4NN6C 3FZUD 1RXLA 4HUUA 4ODUA 3RJOA 5CWSB 2ZJSH 2CUAA 3NTCH 3UPRB 3OPUA 3V7AG 1OF0A 4LDLB 3WUWB 5IHUL 3OPZL 4XB3A 5AALA 3JBG7 5HJ3A 1INQA 3MPCA 4HZ1A 4KTDH 4PG2C 5EEWA 2RR3A 2Y23A 1U6AH 3DIFB 3G5YB 4GUOA 1M05A 4MD4A 1GJIA 2H26B 3GXMA 4Y5YA 1J8KA 4GUPA 4LMQI 1BZ7A 5IVXF 3ZE2F 1T3FB 1JDDA 3OHXA 2EC8A 1KYAA 4B0MM 4M1CD 3WDHA 3EFFA 1XF3A 2Q7NA 2KI6A 2JIXA 2CKNA 1ZY9A 3HFML 3FB8A 3IXTA 3AY4C 5DJ8A 2V2TA 4NKDA 3BKJL 3U2SA 3VJ6B 4A6YA 3WFDL 4PJEE 3KPRE 3QFDB 1KCLA 5B8CB 3ZL4L 4LCCB 2PLTA 4AYMC 4PVMA 4HIJB 2WXGA 4G2AA 3JYCA 4NHCH 3Q2VA 5GZNA 4EN3B 1HNYA 3GRWH 5LBSL 1H3PH 4FQXD 5DFAA 4D8OA 3FCSA 2Z7WA 3MLVH 1RJYA 2AQRA 3FNKA 3WTSA 4BFNA 1E3ZA 5JPNC 1ULVA 3QBTB 4LDCA 3ZYOA 5KN5A 2VLKD 3K4ZA 4JFFE 5K9OA 2VSKB 1PG7H 3K71A 2P24B 4P57A 5HHXL 5GRJH 1KEMH 4AIXA 2EXYD 3FOLB 3NJHA 2WQ8A 5CJ8A 4XMPH 1T7WA 3LPWA 5CJXA 4OBSA 2VW4A 3DRQA 3H3BC 3ZT5A 3QWQB 1ES0A 3IFPB 4ZO8A 4P9HH 5EUKA 2OJ1A 2OYLA 4FZEH 8PAZA 3WTYA 4OUOA 1YPZB 3EYQD 4TTDD 3D9AL 5DUMH 1WAEA 4UQ3A 4BZ2L 2OMTA 4HFWB 5H35B 3EYFB 3WO4C 3ZTJH 3VI3B 3II2A 5B21A 2XG5A 4WRLA 3G08B 2NY0B 4KOCA 3K2KA 3T2QA 3UOAB 5HYSB 5CCGE 2LR4A 3CZLA 1TG8A 2BHFA 3RHWF 2VLRB 1R3JA 2AJZB 2Z92A 1AZUA 5C7ZA 1F4YH 3K6FA 4W9HC 2J6EA 2QVIA 5GRYA 1CE1L 4G8FB 3MRBB 5KS9F 4KDWA 1LK2A 4X6DA 4ABVA 1MCQA 4IMKA 3RUGF 3AU1B 5HHNB 2DYPB 2Y3NA 1C7TA 4M93C 4PH8A 3ZDYE 3CXDL 1HHGA 2AXHA 5K9JH 3RIKA 1H0DA 4O2CA 4Z78B 5T3XD 3RWEB 1T80A 3GM0A 3HMXH 3U30C 3HI6H 3QE5A 4M00A 3RNKB 4M7ZC 5C0ND 3I50L 3HHRB 4PWKA 4AYDC 1VACA 3IU3A 4NGHL 1JPFA 3MO1B 2YUVA 3KHQA 5GRZA 3TC9A 2B5IC 4GBXC 2AK1L 3KPRD 5KANG 3NRPA 2AAVA 2B1HH 2CBQA 4QT5A 4HETA 1NANH 4XBGB 3GDBA 2JLLA 2Y7OA 3L48A 2J71A 1IGTB 1LO0L 2ICWI 3EBGA 2WZAA 4WW2B 1TETH 5EOTA 1NM9A 4XMPL 4WNJA 3TA3A 4JE4B 2BWIA 4ZMOA 3FO1A 4LSRH 1AJ7H 4L4JA 4HEPG 2R1WA 3RZCC 5DVLA 4YHPA 4HJJL 2XV3A 3PUCA 3TZVA 2GYSA 4L9LC 3GSOB 3W11C 1BMWA 4H4NA 1U58B 4ZFZB 4OR1A 3SE3C 4J39A 4Q9RL 3ILQD 3SYAA 3VM7A 2K6YA 1T2JA 5EORL 4NX0A 4GXVL 4MJ6B 1G9NH 1H5BA 2EE6A 2JKWA 3GO1H 3AWEA 5EEZA 4JFSA 4KKZA 2FLRT 3QQNA 3UFIA 2NW2B 3FU7A 5F7YC 1NGYA 1CVSC 4TSCL 2QFRA 5BV7C 4K5MA 2FGZA 4BXVA 2R2BB 2XKNA 2VERN 4UQAA 3VMNA 4LL9A 3ZT6A 4B96A 1EFXB 1JWUA 1DDTA 4UWQB 1KTDA 1JWSA 1FVCB 1TLKA 4QOKD 1ZXKA 3D69A 1DFBL 2Q86B 4ZO7A 2J5LC 1LP9A 4D0DA 1A7PH 3CMOH 5FO9A 3LRSB 1COBA 3KYMB 3MACH 1E4XH 3MGOA 4GKNA 5CLTA 1E4WL 4FKEA 4O5LH 1U8LB 1NMCC 2FHFA 3ECQA 2QDWA 4K3DL 2IJ0C 4P4KD 1DUZB 2GJZB 2WXKA 3N41B 1XCQA 3KPSB 3QDAA 4R2GD 5IB1B 4UI2A 2KZ1B 3BKYH 3IDXH 1E30A 2ADFL 2N1KA 4OCWH 4ABUA 4ERSL 3L6FA 4OCMC 5H37G 1TJIH 3OAZK 5AAPA 5E8DL 4DESA 1HCFX 3K72B 3ARDD 1A66A 4XVOA 4EZMA 5EIIA 2UZXA 1G7HB 5H4ZA 5F1IA 2DMCA 2IGLA 3W2DL 3NCWA 5PCYA 2J1WA 3HNTL 3L3JB 3VYOA 2GTZA 3QB7C 3ZIMA 3PDOA 3RDTA 1OT1A 5D8JH 4WI7A 4HS8L 1V7NL 2JKTM 4LNRB 3ALXA 5C0CB 3QIWB 3IU4H 2AXWA 1KYOJ 2WBWB 1YEIH 3VGHA 2NYYC 1OSZB 2ESVE 2MNJB 1OSYA 5JYMA 3A4EA 3OD3A 2J7LA 3NIFE 2VSMB 3RWDB 2I27N 3QISA 1Q94A 4HJGA 2X53A 1XGYL 1UFUA 1Q1JH 3MA9H 5LG6A 4GQ9H 3V4VA 1IBGH 3BN9D 3LXBA 2GFBA 2J6EL 1PDKA 1YEJL 5IJKA 5C8JA 3HN3A 2MOQA 1X9QA 4K2UL 2KL6A 1DP0A 1FVEA 1XD0A 1E9OA 1OK8A 1MH5B 1RP8A 2GBAA 2R2HA 3WNPA 4PB9H 4ZS7L 4GUQA 5EG6C 1B6DA 3CFUA 1AQDA 2V7HB 3O6LH 4PYHA 4UM8A 2B77A 4MA3B 4MQ7A 5CZVL 5I18L 1E8YA 4IRSB 1A2YB 2XETA 1A6ZB 4N90E 1U93B 1Z5YD 4RESB 4AENA 2C7FA 3EOTH 5CIPB 1ZHNA 2XVLA 4MA8L 4JNXA 5E9DD 4M5YL 1UA7A 2D0HA 2FK9A 3WNMA 3QHFL 1RI8A 1NCAL 1XGPB 3D39D 3QA3A 2NZIA 3EGXA 5AD0A 1NCBL 1ZLVK 3RU8H 1YNLH 2ICCA 5DVKA 5C0BE 4B3EA 4F7CA 3IRPX 5HJGA 1QASA 3K1DA 4UDUA 5IW3A 3S36H 3TBCA 5EF0A 4YEEA 1BFVH 2HVKA 2BY3A 4K94L 5AYQA 2BIOA 4K8RC 3DI2B 4N0CC 4JFOA 3ECUA 1NPJA 2HT4C 3KLAB 4F7CB 5JPMA 3V52L 1FFNA 4NFDA 3TT1H 3QFJD 5IV2A 3JWDH 1FVDB 4J6RH 2FHBA 3J7HA 2WQAA 3LNHA 4MSWB 4N9OB 4JRYE 4IDJL 1JZ3A 2B0SL 1IBYA 1JMXA 4NWTH 1F3JA 2IH3A 1J0JA 5TE4H 4I85A 4K7PL 4A6YL 4OI8A 3L3HB 3VU1A 1ZCRA 2ZCZA 4NM8H 3SDAB 4IRSA 1LO3H 2DMBA 3CFEB 1YPZF 3GMNB 5B1BB 2ZUQB 5JUEL 4RWHA 3T77A 5E5UB 4CN6A 4HJ1A 1J9SA 2DLFL 3F12A 3CZUB 4PWJA 1CG9B 1W0VA 3FBQA 1OM3L 5H2BA 2EDXA 2Z4TA 1A7OL 2XX0A 3P4OA 2CLRA 4PRPB 1ZRUA 4HVBA 1T20A 3EBIA 1EDQA 1GPOH 2AZUA 2X4QB 1YMHB 3LRHA 3TO2A 1QD0A 3WHXA 5F9OH 4XXDB 1ZGLP 2PO6C 3TJPA 2ENPA 2W9LA 5EUOB 1XZ0A 2OX5B 3L3KB 3GINA 1MHEA 4ELMA 3KPNA 1UTDA 4H88H 4F3FA 5IW6B 1MLBA 4EE2A 4PY8I 3QZOA 2NY6C 4NKMB 3M17A 4LNRA 1GKOA 1BOGA 2OAAA 4AQAB 1L6PA 3WN6A 4Y2DC 1AACA 2V7NB 1RUPH 4HC1A 1SLWA 4TSAL 4W6WB 2X4SB 3SJVA 3W0WE 4DUWA 2JF1A 5F1IB 4KNSA 4XOCA 5KYUA 2HT2C 5F93C 4GPVA 4MA7L 4R8WL 3EJPA 5I1CH 1ZAGA 5AZ2L 5D1XB 3FXIC 4H20L 1FNEA 3GXIA 2GJ6B 3V9CA 1U8LA 4FNUA 1HAUA 1QFUL 2PMZA 3U83A 3CU7A 1JZHA 3QG6B 4GKNB 2BOCB 3HZYB 1TEFA 3O45A 2R15A 3CQFA 5D2NC 3SGJA 2KUTA 3DX6A 1BD2D 3HVDA 3NSDA 1HH9B 4OLUL 4UBDC 2UXVA 2B59B 1AZBA 2BZCA 3S36L 3ZHFA 4PTTB 4HPHA 1OWRM 3GIZH 4NI3A 1BGXL 1PKQA 2H41A 3B2XA 5I0DA 4NT6A 1PLGH 2QV4A 1NC4A 2CDGA 3ELAT 3RPBA 3BP4A 4HF5H 3SBWA 4G9FB 1BQHB 1CDYA 3BH4A 1QABA 5IQNA 3Q5TA 2J3SA 3EFDL 2HRHA 1A4JA 1PKQB 1MFEL 3TYFA 5JA9A 4JGUA 2XQYK 2B59A 2Y5TA 1S7UB 3F7RA 3HC3L 1A6TB 5LGJA 3TYGH 3ATDA 2GY7B 5MEQB 1S7VA 2OQJA 2O61B 3V4PA 3AGVA 3GSOA 4R7NA 3X1EA 3HS8A 2UXGA 3GD1C 2W0LA 1MXDA 2OL3L 5FDYA 1MRDH 4NNYB 4EXKA 3J07A 3OC8A 1MY5A 5JHDD 4HOZA 1U9KA 5C7XL 1A14L 5F7DA 4K8RH 5F96L 2P1YA 4M8QB 3ARXA 3I9AA 3CMGA 3LIZA 4UU9B 1UWXK 4JREB 1YUKB 4HKJB 3SDXA 3MYJB 5HHOA 1TJIL 5C07E 2BRQA 1JUFB 3HG0A 3B7SA 4JPKH 3MV8E 3OZLA 2VERA 3CHPA 3V0WL 2LE9A 1JYWA 4Y4HD 5I6MA 1G1CA 1BZ8A 3TCXA 3V4VL 3ZHLA 4ANVA 2VYRE 4AVIA 3FFDB 2WLMA 1J5OH 1NFIB 5A2FA 2EIEA 4QI3A 1MHEB 2JXMA 3C2AL 1BM3H 3SPCA 5E8OB 3FU0A 1WICA 1C16A 3S2CA 1BBJA 2OMWB 5T1KD 2VXTH 5IIEA 4Q2ZA 4Z3JA 1FRGH 1IGCL 2OMBA 5DHYA 5HYQA 4MNQE 3LMJL 4HJSA 5CGBA 5IROD 1AQMA 3SKUD 2F61A 3L4ZA 3IJSB 1DO5A 3IDIA 3TBWA 3TT3H 4JN2A 4WO4B 2Q3XA 2R7EA 3FT3A 5BOPA 1U2YA 2JKJA 4XTRD 4HS3B 5FC9A 5KS9B 1QSEE 3G5VB 1JNNL 5GS3A 3P4OB 4PGBA 3NZHH 4MA7H 1CI3M 5I8EA 4MNGA 3QJSB 1PZ2A 1EEZA 5INCB 2K70A 3GXDA 4BQ6A 3CNKA 4M43L 4NQEE 4GRWF 1YPZA 2YQ3A 2EDQA 4YSOA 1YEGL 3SQBA 3SKJL 2F0CA 3WAKA 1F3JB 2IH3B 2XG4A 4L8DB 1CD9B 4PJ9C 4PJAE 1KJVB 5EBMB 4D8PA 4KMTH 2WNXA 5JHMA 4GAJH 4RX4A 2FO8A 2J4WL 3BT2L 4JDTL 5HD8D 2NY5H 3N0PB 4GRMA 5HDWA 5MEND 3F84A 1EAPB 3MV8B 4QXGL 3WFEH 4D9LH 3BAEH 4YPGB 1HKLL 4HC1H 2J8UF 2BCKB 3VFOA 4A2GA 4EI5D 2VAJA 1L3WA 4MA1C 1WEJL 2D31A 2PTTB 4NO5A 4N2HA 4U0RB 1AG6A 1B4JH 4RFOL 2FECL 3C8KB 4LPXA 5B8CA 1YY8B 3UTOA 1R3IH 2GJ6D 5FECB 1C1EH 1GA2A 1KB3A 2P80A 4G8GE 3PL6C 3CZFA 1NKRA 1ZHNB 1OAQH 3TYFB 1G43A 2XRAH 4Y16D 2QEJA 4ZTOH 3UCRA 1A2YA 3L7EA 4CJ0A 5G5DB 5TFSL 4APXB 1OD7A 3BUYB 4N0YL 1BZ7B 4K7PH 5SWSE 3DETD 3ZY7A 4Z7VE 4WEMB 3BPNB 3KVDD 4HBCH 3DO3A 3OC5A 4APQD 2DKMA 2F54D 4AQ1B 1MH5A 2IDUA 2H2PC 4Y9FA 4K3JL 3CXHK 1T0NB 1C5CH 3OGCA 1M42A 2X6CA 1WPCA 3CH8A 1D5IL 1ETJA 4AEHL 5HYQB 4PJEB 2X4TA 3CH1A 3ARBD 2NSXA 1T0PB 1FNEB 1REIA 4L4TA 3ZR6A 2H32A 2WQWA 4J3XA 4UOW1 1UG9A 5BQDA 5JOFA 1Q94B 2FYVA 2Y72A 2P46B 2YD8A 1F4YL 5F7HA 1IAKB 5EOQH 4DQOH 1KFAH 2OYKA 4MKTA 4G8EB 4HA1A 1WEJH 3WJLA 1SFDA 1UWYA 5AG9A 3K6SA 3ARWA 4MDIB 4WDIB 5C0BD 1NGPH 3MZGB 3X3FL 4Z0XB 4Z7NB 4F37F 1U21A 3HPJA 4JZJA 3WFEL 4QGTA 4FLQA 4ATTA 3LY6A 1KV3A 1P5UC 5DRZB 3MBWA 1CLZL 3NCFB 1F2QA 3FCUB 4N86A 2OJEA 4X7SH 4KPHH 2WBJA 3RFZA 3HMXA 1INDH 4PJBE 1X44A 2QQLL 1KGXA 4M7LH 1MW1A 1GYAA 1KENH 3F7YB 1K4DB 1R4XA 1I8LA 2B20A 5F44A 1T89A 2X4QA 2B16A 3ZKSD 4RAHA 1DL7H 2O6DA 3NVQA 1QFWL 2BJML 4GW5B 5D7HA 5FKAB 1L7IH 3KYKH 3ESMA 1PG7W 3D69B 1EMTL 4A6YB 3S4SB 1S7RA 3WUWG 2BXZA 3FB8B 3IXTB 3KM2A 3OWRA 1MF2L 1FHGA 5DEGA 1XF3B 1YECH 3R0MA 2WWKT 3PXJA 3WIIH 5BW7A 1NDMB 3VXSA 4GSDH 5GGSA 1Q9OA 3SSGA 3K2IA 3KWWB 1W72L 2XDHA 1DCEA 5H8DA 1NIFA 3FMGH 2E5EA 1AR1D 4UCFA 2NW2A 3FU7B 2IWGA 3MI6A 3M1BB 4GT7A 1NBZA 1J8HA 3EGDA 4UT6H 3FO9A 1A8ZA 3ESNA 4QGYA 4J3VA 3CFDA 3T6ZA 4S10A 2EH7L 2OMUB 4UDTA 3ZKNC 3MV8D 5HI3D 1AANA 3L3IA 5JLZB 5GRWA 4AT6A 3MV9E 3SCMB 1JPGB 4EBQH 4QHMB 5H37A 3TA3B 5DD0L 1KYUA 3IK2A 1L0XA 3EYQC 4TTDC 4Q89A 1JD7A 1U2CA 1F4HA 1NINA 4KROC 3QNXB 5KYUB 1JAEA 1F4AA 1BQKA 3TGXA 3DO4A 2DQ6A 4KH9A 3IE9A 4KPHL 1XGZA 4CVZA 5I74B 1FYTB 1I3RB 1QHQA 3QYMA 2QHRH 4KAQL 4OH2A 3T0WA 3BQUD 1HQ4A 1HZHL 1MLBB 4GT0A 1ASQA 1M6OB 5ESVA 2ZF9A 3Q6FB 5JIPA 4G6AC 2OMNA 1UWGH 1AQDB 3MLTA 4B5ZA 1B2WL 2G5UA 2HH0H 3D1MC 4MJHA 5IIEB 1P7BA 3GUFA 4J2XA 2ARWA 1FO0H 2XWJB 5IOKA 3OSKA 3L3OA 5JOPD 1GSKA 3K2UL 3EIFA 2DQMA 1DVFD 4XP5L 2XZCL 2NDFA 4F7PB 3Q43A 1RZIA 1GR7A 2YD7A 3GMPB 4QKXB 2JH2A 2RJMA 4HBCL 2VR3A 2EDKA 2FO4B 2VWEC 4HJGB 4ZTPL 2IV9A 5TE6H 1IC5L 1EEYA 1WBZA 2CHWA 3G5XB 5TDPB 2AJ3B 1X5MA 4DP6X 1PX3A 5DLMH 5EWIL 4LOFA 3SN6N 3MV9B 1KCSL 2IAND 2F7RA 2JKXA 1T0OA 5KBPA 4K07A 3NCCB 3RY6A 5EUKB 4LSQL 3FF8A 2EH8H 1OT4A 4GRWB 1ED3B 3ZDWA 1WFNA 4GXUM 3PY9A 1G87A 3B9KD 3QO1A 3PDOB 3RDTB 5K59E 1NCOA 1TZIA 2TSAA 4RDBA 5FOJA 3SD5A 2WWMD 3BD5A 4WSGA 1JZIA 2NY7L 1I9IH 4DVRL 3FQYA 3NFNA 2BOBA 2BHUA 3LZFH 3FDWA 2WLJA 4OZGB 3QCTH 2OSXA 1VZIA 1F8TL 1TITA 1UCBH 4G6ML 4AUJA 4G42B 3BWUC 1UB6B 1ZT1B 2QHRL 4JG1L 5DDHA 5DMJB 2GJZA 3CHSA 1J1PH 1UKSA 4G7VH 4J3WA 3CZEA 3CZGA 2VUOA 4MQXC 4YE4H 5GGQH 3RB7A 5DQJA 3LKSA 2NXZB 4X80L 3NGBC 1HHJB 1A5FL 5B1JC 4A2DA 1CCZA 1N3NA 4W68A 1AY1L 1LEGB 4OD3L 1EJ8A 2R69H 4QMEA 4P4RB 2YAQA 2JIXB 3VJ6A 1XEUA 3WMSA 3WO3B 3TWYA 5F3BA 3U2SB 1EFXA 1JWUB 1WFTA 3S6CA 3DK2A 4L8SB 1JFQL 3FS9A 2PN5A 3UH8A 1PU0A 5E8PB 3VAEA 5IVXA 2LTQB 5D4IA 2WXNA 3F85A 1ZVSB 3WEAA 3D2UB 3ZT7A 2H7WA 3ZKXB 3GS0A 5TK4A 2EUZA 3DURB 3RIFF 4C83B 2OSLB 2ZSWA 1ZHKB 2HVJA 5MP6L 4MMYA 1ET7A 1KXTB 3CUPA 1LVEA 2YJLA 3KGUA 1UQSB 4IOIB 3O8XC 1CD1B 3GUTA 4E2OA 3DKHA 3O6FB 4Y5VB 1V10A 3SYPA 1BZOA 4XC3H 1U4FA 1IBZA 1KLGA 2FR4A 3VWJB 4NHCL 1KPUB 4PRHA 3TT3L 4I9WE 4G7YH 1RURH 3LDBC 3VFSB 2Z8RA 3N91A 4TLTA 5GISL 1HIMH 1CGXA 2PUQT 3O4LA 4FI8A 3SGKC 5JXAL 1EGJA 2YFNA 1AC0A 2P5WE 4HXBH 2O6FA 2D8KA 1NJ9A 1UURA 1OSPL 1I1AC 5AUMA 2UZYB 2IEPA 4Y89A 5FLUA 2WQUA 2YAPA 3NIDE 5GSVB 4AZ8A 1KIUA 3LNDA 3QUXB 1J5OL 1MHPH 1XR8A 4R4ND 43CAA 1ZPUA 3HLAA 3G6JA 3HRZA 2L8AA 1VEMA 1OAZH 2W88A 3QIWC 2C3VB 1ETZB 1K9TA 3QW9A 5I19L 1IGYB 3T0EC 1MRDL 1C8QA 1MFCH 2ATAA 3IVKA 3BD4A 3DTUB 3A24A 3A6BL 4AM0A 2DWEA 5GGTA 1ZDQA 3DJ9A 3GSNL 1W6WA 5I1KL 3TTYA 3V4PL 1I31A 4HSQA 3C75A 3UAFA 4HJ0D 3T6WA 4ZFOL 2YPLE 3LRSA 4AT6B 1ZOXA 2ZP8A 4AIZB 1FL3B 4KKBC 1AGCB 2VLJE 5C0CE 4Z7UE 1G0XA 2IO5A 3CLEH 5SX4I 2OSLA 3L9EA 3U1SH 4P2QA 3PAYA 5EEUA 5DU7A 5CP7A 3D0VA 3WEOA 5IEHA 4U31A 4FP8L 5GJTL 3WTWA 5DK3A 2EUXA 2R2BA 2AABH 2XKNB 3DK0A 3P2TA 3VRIB 4OZIB 4PRHE 4Z77A 4OLUH 3RUGE 4DP0X 4GIOA 2NRDA 3HE7C 4POUB 4X8CA 3BX7C 2YC1A 43C9B 5JPNA 5L2JA 4W9DC 4MXQD 1I4FB 4HK0A 2NY1D 3O3BB 3F5WB 3IDMB 3ULVC 2CMRL 4DEUA 3PHQA 5BMFL 1WD8A 4Y4FA 1R3LA 3QDJD 4AJYV 3W82A 2E9IA 2Q2EB 4RGNC 4XNUH 3MHZA 5C9KA 1K4DA 4FQ1H 2WQXA 1QR4A 3H2QA 4P2OC 3H2WA 3UADA 1JZDC 1RHFA 3OAUL 4Z7QF 2MCG1 5JA8B 1EO5A 1C1EL 3V55A 2EVJA 1OLLA 3T4AA 2Y2YA 2B1AL 5KJRH 5J3HD 3RGVC 4ZMQA 2WLLB 4HXBL 1UA3A 3TO4B 1GXEA 2YGQA 4XVUC 2RQ8A 4WWKB 1QOKA 5AQ0A 3INOA 8FABA 1PZUB 1LD9B 3FOMA 3OXSB 5EN3A 1CFMA 1OQOA 5D7IF 1KN2L 5CLXA 4KGJA 3RWEA 2BS9A 3FTUA 1A3RL 2Z31B 5AVXB 4Z78A 2GCYA 3AQDA 4FQLL 2D2OA 1S8DB 3GKWL 2CGRL 1EZSA 4J8QA 4PLNC 5FHAH 2GAZA 4XN1A 3VGDA 4BQ9A 1JNJA 1T66C 1OP5H 1GJWA 1IEAA 5IOPB 5CKGA 3TFKC 3GEWB 1JHLL 3L4YA 1CXHA 4NC1E 1I1CA 3B3BA 4MTMA 4WK0B 2J88L 4QY8B 4XN4A 3H2PA 3KGRA 5CHNB 4BM7A 4NCC1 3L45A 1N18A 5TE7L 1EDHA 2K9FB 3L9RA 3ARGA 4PRPD 4Z7OE 3MBXH 3FPXA 3NJIA 2G0KA 3BHBB 4Y1AB 5FFOA 3B7TA 3FCBA 4YHYB 3KR3L 1CN4A 3QUMA 4GKSA 3X14B 4ODBD 2ZAIA 4HFWA 3JTTB 1S9XB 1S7XB 3R4DA 5C1MB 2V37A 1D6EA 3OKOA 3UTSD 1OM3H 4K7FA 3OF6D 4N6QA 2H3NB 3H9SB 3O4OB 5F3BB 3WN5A 3CDYA 4JO1H 1R5WA 5CBEA 2A9MH 3BZEA 2ZX9A 4TULL 1OAYL 4FG6D 4R4BA 4UQBA 2WWKO 5FPIA 5I1HH 2XWCA 3SGDI 3TO4A 4XCCH 4H0LC 1M1XA 3GO1L 4Y4FD 3S8FB 5FO2A 3L4CA 4NZDA 5DD5H 3LQAH 3TH4T 2XHNA 3DVFA 4KK9C 4PJCB 5FUCE 3D3VB 3GLAA 1A9VA 4HEMA 2Z0BA 4HJ0C 5J6HA 4UT6A 1H6TA 1Z9LA 2OCFD 4DUVA 1CLVA 3FB6B 2BNRD 3L1OH 3VQ2C 4CVXB 2PXYD 2YAMA 4LCCA 1V7MH 3SPIA 3D39B 5DD6A 5J1AB 3F58H 4Y4HB 1ZHLB 2DQCL 3IT8D 3CFDB 3H0TA 4UV7H 4JFFA 3QIUC 3F5WA 3IDMA 4I48B 3UGUA 4HCRL 2H0PA 5I30H 1KGYE 2GHWB 5ACMA 2FQFA 1U8KA 3MV11 5DJ2A 5DHMC 5LNDA 3SOBL 1R17A 5LDUA 3C08L 2GK2A 1UENA 1A0QL 2OMVA 2E6QA 1AS8A 2HG0A 5DTFB 3RYMA 2XWZA 2GW5A 3MKGA 2J8OA 4ESKA 3WKQA 2OK0L 5KYYA 2N59A 5C0FA 1MW2A 1R47A 4HPYH 3IS0X 1MCJA 1O75A 4PJ6A 3TVMD 2HKAA 3VFMB 4GW5A 1DQVA 1MOEA 5FKAA 3TBWB 4KZDH 5CO1A 3L3OB 4ZMYA 2JB5H 5DHYB 4ZQKB 2NY5C 1KBGH 4PV8A 5DUPL 1JV2B 2C3GA 2XQBH 3T09A 2JKNA 3V5KB 5E9DE 4FYSA 4W6XB 5D7LD 2NY1C 3RFZB 1I85C 1XGYH 3PWPA 4IJ3C 1NFIA 3IXAB 1ZT4B 2OJEB 1DJWA 1NCJA 4ZMWA 3V4PH 5EZJB 2D73A 1F18A 4Z7UA 3LN4A 1KWGA 4RWYH 2VZSA 4NQDD 2PWGA 1LP9E 5FO7A 3QUXA 4PCYA 3SGKA 3R8QA 2G75A 4NAJA 4NO2B 4GW1A 4LL4A 4PJ7A 1T5XB 2A73B 2VXVL 3ZO0A 1IGIH 1KEGH 1AGDB 1XAUA 1A9BA 2E7HA 1EXUA 4NPYB 3LKRA 1VGEH 5EPMA 3STLA 4AVJA 3LAFA 4KRLB 2JI3A 3GHBL 4FL4C 5CILH 1OAKH 4P46C 3L2MA 2VKXA 4K23H 1HAWA 4RQQA 2VMEA 4P2OB 5I6XC 3CVDA 5J1TC 1KOAA 4Q8BA 1OP3K 4O58H 4E36A 4UAHA 2WBJD 4Y9EA 3MLVL 4P5TC 5IMKB 2LLGA 4XO3A 3OGCB 4RAUB 5E7FA 3K0WA 4XWGH 1NUGA 1OTTD 4UM9B 4B9CA 1QKZH 1SY6H 1X5FA 1L6ZA 3EGDB 3MACL 3QYCA 4RDQG 4M4RA 5I1IL 3V0FA 2B9BA 1U3NA 2R1XB 1ONQA 2ZUSA 4X7CC 2XBTA 1RY7B 4N4YB 4LSTL 4ZMAT 1N4XH 1FL6B 5F1SA 2DMGA 4A68A 2YAOA 4OFPA 3P02A 1GPOL 3RVXD 4DP2X 3BUYA 5MENA 5J9PB 3D0AA 1KC5H 1TTCA 1NUNB 4YAQA 5C97A 4MD0A 3QORC 5DEGB 1JVLA 5E03A 3V0JA 3JUYA 5KYXB 2WCGA 3OL2A 1E5UI 2CBOA 2NSQA 3IJ8A 4HOWA 1A7RH 1LP9F 4PJ5E 3LZRA 5I73C 4F15B 3QI9C 3MCYA 4LPVA 3VRLE 1AH1A 3KLQA 4P2AA 2RCSH 3A21A 3PUUA 5C0AE 1HJBC 3NABH 4E9RA 1G9ML 3SE4C 4CGTA 1KJ3H 3ARBB 4L0PB 1YUHA 3GFUA 3NFSL 4M9PA 4Y5XB 3GXTA 5CZXD 4BUHA 1ZGLM 3CK0H 4GOSA 5C0DA 4K5PA 1HQRA 4PREA 5D72L 3CZSA 4B5EA 5L8LB 5CILL 3CHXA 3ZDZB 4LSPH 1I9EA 4U1LA 4XMVA 1MIEL 5T1LA 1VGEL 4Z0XA 4J4PC 1YNTB 3CN1A 1AD9A 1CR9H 4I87A 2W9EL 3CFTA 3MRPB 3VG0L 4M3JA 3K6SB 1RZ7H 4DSYA 5D6DA 5HVFB 4NKMA 1T1YA 4ETYA 4YH6A 4OI7A 2A74B 3FUEA 4U6HB 1HHKA 3NP4A 1U8IB 2UZIH 4RFOH 2Q0ZX 3KPNB 3O2VH 2H32B 2OX5A 1JZ5A 5IR1A 4M3HA 2X4TB 3LDBB 3QRLA 4U4BA 5D7LA 3TVMC 3WHE1 3VWJC 2A9CA 2DQEL 3QWNA 1AGBA 3RNQB 3TF4A 4P07A 4Z5RA 3D85D 3ZN6A 4DKAA 4F8PA 2VL5A 5HSFA 2WHVA 2A9AA 4P2QD 5C9JB 5C09A 3Q01A 2FSEA 4XNXL 1LILA 4KHTL 2AQ1A 2B4CL 3BZDA 3S5LA 3U7WL 5F2FA 3PXHA 1RAMA 1SBSH 2AF2A 3PU7A 3OLDA 2JB6B 5DJCA 3VNZA 4OLYL 4JQXA 1YEJH 2XPGA 2BSDA 4Q0XH 1NPUA 4R83A 5E2VH 5C6TH 3VDAA 3WOVA 3RL1A 3RWGB 3V6OE 2MSPA 2OSWA 2YARA 2ITFA 4XRCB 1IBHA 2BVPB 2WBJC 1GZQB 1VENA 5IG7B 2Y6SD 2CO7A 4DERA 5KSVA 1BA9A 4G5AA 2XV6B 3NFSH 4WWOA 2QLYA 4KI5F 1X4XA 4OF5A 1IM3D 2Z8SA 5HGDA 4TSBH 1OPOA 4HGMA 5FM5M 4QRBA 2C9RA 4LCWE 2R0ZL 3SHSA 4PGJA 1HJCA 1JNLH 1G6RL 1QUPA 4L29B 2BCKA 3UP1A 5LBSA 1MFBH 1EHXA 4G6FD 1FAKT 1CDJA 4QYAA 4S0HA 4IKJA 4YPGA 4S11A 1QSFB 1NCWL 4PY7A 5ERWA 1HX0A 5DMGC 4NRYA 1JPGA 2VXTL 2R4SL 3QDGA 4IIQB 1ZGLB 3Q1SH 3P3YA 4OZFH 1LMKA 2AJYL 1BM3L 3V4PB 4UDTB 3QA3B 3CK0L 1QLRB 2IOIA 2CH8A 1ROCA 2PCFA 1OGTB 1A1MB 2BRRH 1LWJA 4D8PB 1HXYA 1W2KT 2X89D 2DN7A 3KAAA 4G8IB 4JFQA 4LGRB 4RISH 4DN4H 2PNDA 1VFBB 4YXLH 5EA0L 5LB1A 2RAMA 1VCAA 1U6AL 4JQVA 4OZFA 2BFVL 3DVGA 3DX2A 4OCXH 3FCTA 1ZTXH 4J23A 2LGNA 3DX8B 5LWYL 3LS4H 3HS0B 4PJIA 2V7HA 4KY1L 4LT7A 1NOAA 5K39B 2WTRB 5D2NE 1ID2A 2XPZA 2NXYD 4WKZA 3CC5B 4PG9B 1IVTA 1RL1A 4M43H 1PKOA 4GBXA 3ZDZE 2WKOA 3SJVE 4N0UA 2EDRA 2V5YA 4FS0A 1URLA 2CZNA 3DXAD 3UBXA 5ID1A 1HYRC 4ZXBC 4LP4A 1ERNA 4B60A 3RVXC 3QH3A 4L3CB 4RGMC 5MI0B 3KPQB 4A1RA 1OAUH 2OMWA 4GNKB 2MTAA 4IOFC 4NN7C 2OTWA 3QRBA 5E6UB 1S7SA 1U8OB 3RWDA 4MQXD 4LFHD 1JGLL 2ZXWB 5AW1B 2DMKA 2YXMA 1OSZA 1BIIA 1T22A 1D6VL 3SY0A 4O58L 1MFMA 2YA0A 1OB1A 1IU1A 4FQLH 3M1CA 2C1OB 4OIBA 3VTMA 3GMQA 3G9VA 2ZKHH 4JHAH 3UBGA 1PQZA 2GQHA 5FK9B 2E59A 1U92A 2MH4A 5EDXA 3ZO9A 5KSAD 4ZOBA 3OGOE 3LRMA 4RISL 5HYJE 5JOFB 4F92B 2F54A 3MA7A 1DQLH 4Q6KA 1VB9A 4FE9A 2UV3A 5D55A 3CH1B 2VISB 5FYJU 4O02A 4LIQE 5J13B 4LAJH 3UG5A 5B3JF 1R1CA 3UTSB 3GBMH 1WLHA 4ETQB 4QHNB 5T5NG 3FULA 1KBWA 1OTUD 5DMYA 4LCUA 1P1VA 2BK8A 1BWWA 2Y5TB 3CC5A 3FQXA 4LP5A 3GRWA 4KVPA 4Y4KA 3P0VL 3O8XB 4ALAH 5KVFL 1DLFH 5DS8A 4W1TA 3S3SA 2VDRH 5D7JA 3WAJA 4FJZA 1B4TA 3WXWH 2CE6A 3PGDA 4XVJH 5ECGA 1D9KC 1AMYA 4BQBA 2WIIB 4KROD 5BUAA 4QRRA 2DBLH 2WLIA 4AW4A 1CS6A 4M61B 5KVEH 5KBMA 1NFDF 1TFHA 1HH9A 3AJ7A 3ESOA 4ZTEA 4F27A 3EYUL 5AB2A 1M4KA 4DQOL 2YSTA 1P7QD 4I7ZC 4UILH 1H19A 4HF5L 4ZFZA 4FX5A 3CSFA 5EFIA 4H26A 3K74B 3PGFH 1YAIA 5BS0A 5AVUB 3HI1B 4WJ5A 5D71L 4NRYB 4MKMA 5C71A 2VDQH 2RBLA 1RJLA 3LQZB 2EXTA 2W07A 1BX2B 1YN6A 3E2HC 1R5VA 4NKOB 2Z3FA 5KSUA 5I2IA 5I8OH 3AADB 1M2VA 3BFQG 3F7KA 3GSXA 3IMBA 5IQOA 5DD1L 4K3JH 1NANI 2HFTA 5EOCL 4XBGA 3WMPA 3LJ3A 1L3NA 1J1OL 2FYYB 5BV7H 4AMKL 4S0SD 3HG5A 5E99H 1U8MB 2EACA 4E5XA 4YDKH 4AYBA 2XG4B 2NR6C 4L8DA 5EBMA 4A6YH 4DQAA 5GS0C 3PF2A 4HKZA 3HAEH 4LBAA 1V54B 3FUMA 4IEFB 3RNKA 3RVTD 4XMLH 2GTWB 1ZLDA 5ITFA 2EUWA 3C5ZD 3EZJB 1S46A 2DYPA 3WFBL 3MRLA 2VDPH 3F01A 3L5WB 1ZV9A 1CFSB 4JBSA 1AZRA 3LN9A 1WRFA 3IKCA 1MJUL 4PVNA 3CFBA 5JHLA 4L1BA 4Y8DC 5I76A 2QADC 4Q6IA 1SXNA 1QR1A 3C5JB 4UT7H 3D52A 3OTTA 3S36X 1OPGH 2A77L 1L6XA 2X2HA 5TE4L 3RGBA 2ADYA 1KG0A 1BBJB 1RUML 5E8OA 1GS8A 4LVNB 4C4BA 4AQ1C 2ZKYA 2EYTA 3ARFD 1F4XH 3BLPX 1EJOL 1JHKH 1QBLL 5FEBA 1S78D 4DGVL 1ZANL 4PGZA 5FKPB 1FZKA 3MRFA 1E2ZA 3PJSB 2EIMB 2HTLD 2QSQA 4EN2A 4LKXA 4MFHA 4IS6B 2BINA 3GMLA 1P4BH 4I9WD 1BQSA 2ZUQC 3Q5OA 3BISA 5K33A 2FATH 1G7JA 5CEYA 5C0DB 2Y7QB 1N0LB 2JK5A 4M5SA 2YN3A 1A22B 1S3KL 1T66D 4FFZA 3MRIA 3CVHH 3HNSL 3HUJF 3DPBA 4XNZC 5GS1B 1O7SA 4KK8D 3AU0A 3ULVE 5AW5B 5JW4Q 1MREL 5A2AA 1AP2A 4J2QA 1WIOA 3THML 4KNUA 4HIJA 3CFKB 3MLXL 1P2CA 3VW3H 2YGVA 1EA9C 5FGCE 2EEXA 2DD8L 3DPDA 3UEZA 4FFWD 3AAZB 5DEFB 4JG0H 3EDFA 2QR0B 5I1AA 1BXAA 3SY0B 2VSDA 3VFWA 5EEXA 3D87B 4O51A 2VZ1A 5A2JH 4JO4L 4KQ0A 5ABDE 3ULVL 1NCAH 1HEZA 2J6EH 3NFPB 3RX5A 1CXLA 5EEYA 1EX0A 3GB7A 1YEDB 2C3WA 2TRYA 4WHCA 1EBPA 1UA6L 4S2SB 4HX1A 4HPYL 3IBOA 3W0WD 1BQRA 1AI1L 4XCEA 1ITCA 4DK6A 3ILPB 2HFGH 3QZWG 2JFCA 1FZJA 3HS9A 5KG9B 2ZCKL 4HWBL 5CZVH 3RVUD 4FZ8H 4N0UB 4WHTA 2A0LD 2L7QA 1LE9A 4NENA 4EUPG 2QPUA 4HUUB 3KZ8A 2GJ6A 3MFGB 1OCCB 1G7PA 2X2JA 3FO1B 1BVKB 4IRJA 3SODB 2P5EB 3BYTA 4AYGA 2GBTA 5GGVL 1NEPA 5FDWA 1PY4A 5H4YA 4LDOB 2O5ZH 2X6BA 3JWNC 4Z9KB 4BRVA 4E9QA 1AD0B 3HUJA 4WU7A 4JFED 3FQ1A 1QFWM 1HKFA 3R0NA 3ZQWA 1NGZB 2ZWNA 4HIEA 5FYLD 4U6YA 2GI7A 3UYPA 3WIHL 5I1LA 2XWTB 4HLEA 3OB8A 2Z4QA 3MRMB 3GSNH 1RJCA 3AM8C 4ODXB 1RH8A 5KVDL 3FU6A 3HN5A 1CDIA 4WFGD 3TEXA 4ZFFB 5A7BA 1IC7H 3TH3T 1AKPA 1KBVA 3CMOL 3PHAA 3MJ9L 1RQ5A 1HHGB 3QEGH 5FCSH 5K93A 3L3KA 3KPSA 4Y5XC 4FTVE 1DN2A 3CPLB 1MWOA 3CDFA 4EN3C 1SJMA 1OCWL 2ZCLH 4L29A 5TGBA 4N0CD 1FIGH 3O4OC 4WO4D 3MGOB 1WK0A 1L9OA 4JFEB 4KJWC 4V1DE 5D1ZI 5F3FA 3VGGA 2VXQL 1MFDH 2MPAL 5E00A 5HGDB 3ARED 2Y6TE 1XTMA 2ZSVB 1PZAA 1NM4A 2IAMC 1AZCA 4KMLB 1FNHA 1OGAB 1C08B 3BGAA 1RUAH 3B2PA 1HTYA 2NNFA 3N50A 3BAJA 4R84A 5DQ9A 1OF2B 3DSNB 5A7EA 3Q13A 1AGFA 4PEEA 2OTPA 2JCCA 3EYFA 3IGAB 3APNA 1QFHA 4DF9A 4PTUB 5AFAA 5L4JA 2BVOB 4XPHH 2PP7A 4UQ3B 4ORGA 5HVGB 2AQPA 1Z9NA 2DQGL 3C8DA 4XMKH 4LCWD 1J12A 5CMAB 6FABH 3SZ6A 3D39E 3C5ZC 3HS0C 1U33A 2VDOH 2IGTA 1QO3B 2UWEE 5AOIA 5T5FH 1LQSR 2EEBA 4GSDL 5LWYH 5DC0A 4WI6A 2B3IA 2HT2D 4Y4HA 4BIKA 3U0WL 5DC2A 2XC8A 1AXTL 2FX9H 4QRPE 2XIDA 4UT9H 5ESAA 4IMLA 1N5YH 4KK5D 4LPCA 5J56B 1UJ3C 2YQBA 1LYQA 3QORD 5IF0B 4N2OA 4P46B 2I7SA 3QT2A 4RIRB 4EIUA 3RWIB 5C6TL 1UXLA 4KX9A 2X10A 1YDPB 3RZCB 2DDQL 2EAEA 1BIHA 5DJ0A 5JHDA 2W60B 1XFPA 4Q4IA 3MV7B 1KV7A 3G5ZA 2IC2A 3GSWA 1QZ1A 5D7IB 3UMTA 4EI0A 4ZMTA 2X3CA 3TTSA 4QDGA 4ELDA 4JFXA 1XF5B 3MNZB 4U2YA 1MELA 4QJ4B 1RIVH 2J2ZB 1QNIA 3BQUC 4QLWA 1FNAA 1X6LA 2R2CA 5C0BA 4F2FA 1AO7E 4LARL 3IDYC 3JTTA 3QUHA 4JHWL 3U25A 2AHIA 1KJ2A 2NW3B 3FH8A 5J1SC 4IDJH 5BZWA 4Z7VA 4D0CA 1E2VA 1RK1B 5DZNA 3WJJA 1FV1A 1NLBL 2CG9X 2OM5A 2IXQA 3LKQB 1KGCE 5JO5B 4OF0A 1TQVA 5SWZA 1DJZA 4BBWA 3FN9A 15C8H 1TVHA 4G11A 2P28B 4LSVH 2UWEF 4YSQA 3MUY1 1Q0XL 4WY7H 1SRDA 1ZVNA 1RMFL 3HZKB 1BV8A 2OZ4A 5JIKA 1S8DA 3KHOA 2GCYB 5FYKD 3JZ7A 1KTCA 4ZFOB 3PQYD 2ZXDA 5HY9B 1EHLH 1M3IA 4E9TA 5IT2H 4DPCX 3UBHA 3DHPA 3GYRA 1WFJA 2GG1A 4YC2B 4JDZB 1TQBB 3LRKA 4RFNC 2J25A 2G3ZA 1P7KB 2ALAA 2UX6A 4JO2H 5F7UA 3QQ4B 4YHZL 3CQPA 3ARTA 1C9SA 3HC0B 2Z91B 3JV0A 4L3FA 3ERXA 1QI3A 3PWVB 5I9QB 5DT1L 3VWKB 1E90A 2Y7LA 4YNYA 4QRSB 1F1AA 4FXGA 2AXFA 4PM1A 5AKSA 4JREC 3UBFA 1H5BC 3CFJA 2XWRA 3G04B 4AIEA 4LLQA 1KCUH 4OCRH 3U36A 3BKCL 1EZUA 4PWFA 1KXHA 3JTSA 5ISZA 1I7TB 3O3EA 4H8WH 2WKOF 4B9FA 1ZTXE 1SHWA 2YPLD 2O1AA 4PJ5B 4JJOA 1NBYB 2WLYA 3BCFA 2NTFB 5E4AA 2FWLB 1F58H 1IGJA 3LYRA 4N2LA 1DEDA 3CZNA 4XC3L 1N59B 4WCYL 5LXGL 4XNDA 2Z9TA 4FLRA 2K78A 1UD8A 4QHKJ 4ZW6A 4FTVA 3WFCL 1VLXA 1S5HB 3NACL 4P5KB 3IDGB 1BQUA 3GLZA 2G9HB 3QORB 2YPLB 5B1KA 3VXNB 4YXHH 2ENQA 3UJTL 3KE0A 1OAKL 1MHCB 2R9HD 4J1UA 1UUSA 5CGYD 1DBKL 3GZQA 4WI3A 4AY0A 5HYSG 4HGWB 4M8UA 3AXLB 2DRUA 1KEGL 5IUSA 2DYPD 4YHPB 5K69A 2CJTA 4JFUA 1MHCA 1CTMA 3WNKA 1J86A 4J8RB 3KNBB 4L3EE 4N2IA 1A7NL 4RMUA 4JKWA 5DGRA 3SKOB 4RZCA 2HTKD 2J8UA 1FFOB 2DH2A 1JL8A 2PYFA 1RUKL 2ZCHH 4P5TB 2AJVH 2VE6A 3PWUB 2AKRB 2AITA 5GJSH 3MOBL 2IWFA 1J1OH 2BH0A 4GG6E 2Z31C 2FHCA 4TNEA 5GZNC 4AC4A 3AG2B 4G6JH 1P4IH 3SDXE 4JZNB 4PRIB 3T3MF 2OCCB 5AOZA 4HCIA 4AYEC 3PYCA 4UAOB 1XIWD 5DT1H 5AUMB 3QYNA 1R3KB 1I7TA 4FDWA 4IJTA 4XNZB 3VVWA 2IPKA 2W81C 5AVYB 1N6UA 1OANA 2JKSA 2NQCA 5CXPA 6PAZA 3NK3A 4FKHA 3HIZA 2LLLA 2CQVA 2L7JA 1BCIA 4S1RH 4ADJA 2QKIB 4MZ3A 1RJZA 2NXYC 4JJ5B 1TF4A 1Q72H 4BCZA 1A6AA 3UDWC 1EO8L 4DEPC 1AIFB 3C9NB 5C08A 3OHMB 4LCIH 2OI9C 3TNNA 4F8OA 2XN2A 2VLKB 4RMVA 1I8UA 1UQSA 5CJXC 1P7KA 3VA6A 4R4BB 2HVJB 2E7CA 1BWMA 2HXAA 4FQXB 4LGSB 5SWSD 4PJGA 3ZTNL 3K1KC 4B7LA 2JJWA 3GBEA 1G1OA 3SE9L 4CADB 1YYCA 3TBVB 3TYGL 1AQKL 1CFQA 5MERA 4X8JB 2B4CC 2IPUG 5E70A 4L8SA 4NGHH 2HKHL 4NQVA 2WQVA 2XFXB 4FKKA 3WELA 5IB2A 2F7PA 3DRQB 3RPIA 1RZJH 4H1LH 4WGVB 2WP3T 2H2PD 2WVUA 5D9SA 4A7TA 5M94B 4H2AA 3ARGB 3Q06A 3QXAA 3ESVF 1OVZA 2ZYIA 1UUNA 5CHNA 1GHFH 5F71A 3VFTA 1XSJA 4KXAA 3U0WH 2A6DA 1T21B 2SODB 3H7BB 1RJZB 4JJ5A 3T0EB 4X4MA 5CP3A 2XV0A 4L2LA 5LGHH 4PJAF 4CNIB 3WKNA 5FYJE 4HZAA 4GAYB 4LCIL 3SKNB 3TBTA 2OXGA 5IMOB 1JPTL 3BN3B 4HSAC 5LBVA 4YPJA 5DJ8B 1HVXA 1I1AB 4PS3A 3VCLA 1IAOB 2V2TB 3EO1B 3ISWA 1J5CA 2DQIL 1SN5A 2L04A 1A7RL 1JXGA 3ZL4H 4QXGH 2GIXA 3PJLA 3AT8A 4L9LA 1X6NA 3BH9A 2HKFL 4KQ4H 2NY5L 4H5SA 5I1GH 2W92A 1I8IA 4HALA 5SWSA 3FUHA 4FA7B 1Q1PA 2BY2A 3MTXA 4JFZL 2G3XA 3BPCB 2A6DB 3B34A 1U3YA 1TQWA 5ESAB 1KPRA 3MRQB 2XZQL 1FGVL 3ET9F 2YLKA 4ZYKA 1SXBA 2C4XA 4EVNA 5K9KB 1CGUA 1JTOA 3Q05A 3FFCD 1K6QH 5IBLD 4LVEA 4ODUB 1G0YR 5HGAA 5BNXD 2E7LA 4ZUTA 4OJAA 1U0QA 4LGPB 1JI1A 4ZMLA 3WEXB 3SPHA 3WY2A 4Y2DA 5CD5D 5F3HB 3Q6FA 2R27A 4NQDE 4DCQA 2WB7A 4ZOCA 3MLWL 2YPKB 2JTYA 3MRRA 3HHMA 2A74C 3K8MA 2VDOB 4WKXA 4ZS6C 4FJYA 4NNPL 1KC5L 4L4VB 4B9KC 1KUMA 3MR9A 3DLQR 1D7FA 1YEKL 3BVVA 4PJ5A 2QT6A 2Y7NA 5I8CA 1FL3A 3MJWA 5DUBB 3EHBB 4ADGA 4MZ2A 3MU3A 2DL9A 2A6KB 4PB0L 1CICA 2G3NA 2VLLB 3KCPB 1F00I 4QRSA 3HMWL 3HA0A 1GGIL 2PR9A 3QJZA 4JRYB 1NMAL 2VZ3A 4OGYH 3F7LA 1HXMB 1CVRA 4MNQD 2A3TA 4Z23A 2DWYA 3UJTH 5IJDC 3GSRA 3C6LA 3HR5B 5T8IA 5EU7E 3QUZD 3O2DH 3VD5A 4EPSA 3GLDA 3DUSA 4UB0H 5IWLC 2NY0D 4XZUB 1KB9K 4GRLC 4U6YB 4RGNB 3PP3H 2HX8A 4ILDA 4H8HA 4YDJA 5E9DA 4V1DD 4JR9H 2YPKA 4G80B 2HRGA 2MCMA 4FFVD 3PWUA 3KW8A 1WIPA 1ZV5A 1WG3A 5BS0D 5KW9H 2WNGA 3OJ2C 2Q20A 5C09D 3WEXA 4YDMA 3H3PH 4NZRH 1BVKA 4IRJB 4KXZH 1IM9B 3HE7B 1Z1WA 4JHWH 4FNQA 3SOBH 1JDAA 5DRWA 1WAPA 3ZKMC 1JRHI 2ARJQ 3AS3A 4EJ1C 5DC4B 1I7UB 4JRFA 3GJEB 3NDYE 5CJQH 1FZJB 3SDAD 5T1MA 4Z76A 5I1DB 5JO5A 5T33L 2XXCB 1ZVHA 4W70A 4G1MB 4ONHB 2AEPL 1DUYB 4J3TA 3BUBA 4NIYE 1WZMA 3FTWA 2VDQB 2HMID 4H5SB 4QYOB 4ALAC 2ED8A 4PLJD 1QAWA 2E8ZA 2WGNB 2HZHA 1NAMB 3N9GH 3I3BA 1NMAH 4OGYL 3TBYB 4QHPA 4W9CC 4X4ZA 3B9VA 5I74C 1IGJB 4KUZH 4UINH 5IQ9A 5F70A 5EN2A 4F9PA 2H0FA 4Y19D 4WW2C 4DZ8B 2IPTH 3EJZD 1DQML 1CGSL 5HJBA 4GAYA 2WWMC 4UMGA 5GHWH 2I9LB 3GZOA 4RMQA 2AJSL 1B3JA 4GI6A 3AREA 4KKPA 4KO6A 4LOUC 5GGSY 5C08E 4MDJB 1GGCL 2AK4E 3EJRA 3IWUA 5HHMD 3WBDA 1E2WA 2V17H 4JUTA 2CBMA 2R0WH 1S4IA 2NY1B 5IF0A 2J20A 3DTXB 3BXNA 4CU6A 4NQDB 4MX7B 4LF3A 3A3YB 3RTQB 4GMTH 1NGWB 4YWGH 2MEJB 3D6GA 3HC0A 4LEBA 1AVAA 4LLYB 4A7UA 1G7JB 4Y9CA 2AJUL 4Q56A 1SHMA 1JXJA 3X13B 5FLVA 4P3CL 2BSCA 4HIQA 5HYJD 2P42B 4I2XB 1TZIB 2I32A 3LRGA 4OZGE 1KIRB 3WI9A 3MRFB 3LKNB 4LCWB 5I8KL 4IRSC 3QDGE 5DD3L 5FV1L 3Q5YA 5ISZD 1BG1A 1C12A 4RMWA 3US1A 4HT1L 3Q44A 1YZZA 1P5UA 2BIHA 3L7EB 3RGVA 3D4CA 3PQYE 1LDPL 1JHLH 2NY2D 3GKZA 1B2YA 4GJTB 1FDLH 4QTIL 4WTZA 3S3PA 3STZA 3R06B 4QTFA 5INDA 2PCPA 5H94A 3GMPA 4F7PA 3QCTL 5LAPA 4PI2A 3W5NA 3FTGA 1OGPA 1FF5A 3GBDA 1N5YL 3IKCB 1SOKA 4N85A 2X70A 3HHSA 2F5AL 3WGVB 5CBAB 2FX7L 3MRLB 1W16A 3ZYJA 2NX5D 3BO8A 4F7TA 1GY2A 2WGXA 4M5YH 3IF1B 1QNZH 3LN5A 5AVTB 5BPPA 1AJ7L 1NZRA 4MB5A 1Q9KA 5DJZA 2IWEA 5IFJA 1MNUL 4L4VE 5IVNA 1T7XA 1IGCH 2UXFA 2HPOA 2X9ZA 1BYNA 3OAUH 3L16A 3H55A 1I7RA 1BQLL 1FO0A 1TJGL 3FTSA 3P54A 4G9DA 4DW2L 4Y1AD 2NCEA 5ETUA 5B3JE 2EEFA 3IYLW 1UCBL 4G6MH 2FL5A 5F96H 3PWNA 2W60A 4BFFA 1WV7T 3LZFL 3DTDA 3GNML 1AAJA 3DROA 1XSIA 2ARJA 3PGFL 1HCZA 3QNXA 2AKRA 2RIKA 2BNUB 2YGOA 4NJ9L 1M2VB 3GBLA 3GBML 4WTXA 1XCTA 4J3SA 2X87A 5FDWB 4ANXA 2A6JB 2BWDA 1ILUA 1QA9A 2OYMA 1B0GB 1RIHL 1E6JH 4GAGL 2J56A 2GT9A 4JM4H 5CZKA 5DWUH 3V5DA 1VKXA 4N9GA 2G2PA 4AL8H 1DBAL 1YQVH 2OMYA 3LV3B 4O9HL 3TCLB 2ZE0A 4Z7NE 1RZ8B 1OM9A 5J5EA 3QJOA 3DOSA 1E27B 1YLBB 4CILA 2ITCA 4CMMA 1J0KA 1UOWA 3CDZA 3TPUB 5ESQA 5E6RB 5DZLA 1QFWI 4MMZB 1TT6A 4YHLL 3VD7A 1ADQL 4FTVB 5FYKH 3K8KA 4IHBA 3AS1A 3V7AE 2ZWZA 3ARFA 4HAGA 1AGFB 4NC2B 3L7FB 4NI6A 2WUBH 1CK0H 2VN3A 3PG2A 1ND0A 5ALCH 5I1JL 1UA6H 4X7TB 1Z6JT 3NP3A 4I3RH 4LRIA 3NJGA 1SEQH 2FAUA 3FC8A 4HKJA 1JGVL 3N04A 4FXKA 4TQIA 4C56B 2X4PB 3W5MA 1S9VA 3ZE1F 3F7YA 2GK0A 5CZRA 1KGJA 2AGJH 2C9UA 1WCBA 2ZWSA 4XCCL 3EJYC 2APWA 3TO4D 2VWEE 2CRIA 5GIRB 2QZ5A 3MODL 3UJIL 2HFGL 1JHKL 2OCJA 4JO8A 2VMJA 1P7HL 3MBWB 4OLXH 4XBEL 3RTQD 3G6JF 1S7VB 4LHUG 1PBYA 4ZAKA 1D5XA 4XHJD 5DWPA 2FZ3B 3L9YA 3O8XD 3U79A 3OXRA 3PL6D 4X9BA 4EBQL 4IBTA 2OP4H 5F89B 1KIQB 1BW8A 2R29H 2XU9A 3PJSA 2WZ5A 1F41A 1E43A 1LO5B 2F53D 2WMPA 3PRZA 3ARFB 1LO4H 1SYSA 4UT7L 2ERJC 3P30H 1I1FA 2VC2L 4FCAA 5D96B 4QRUA 3A47A 3D34A 3Q9QA 3QIUA 3EYOA 4IU2A 1MN4A 4JFYA 4KKNA 1O7VA 4P06A 1I1YA 4JPQA 4MCYB 1RZKH 4EI6A 4LLMB 4AMXA 4Y2LA 3FPYA 2BNQD 3V0VB 3ARVA 4FQ2H 5LVEA 1HIML 4ZPTA 3OAZH 5LN4A 4A2EA 4DOHE 4QRTB 4U4IA 2BOCA 1FCGA 3HZYA 4NUQA 3HB3D 4FABL 1MAJA 3JV6B 4H88L 3HG1B 4AM0Q 1ZT7A 4EEEA 4B7IA 1U91B 2B14A 5DRNB 2FLMA 1CFSA 2AXGA 3QUYD 1W0WB 4JFYB 4NUJA 4U6XA 4NWTL 4O2FB 2Q7YB 2NYYD 1WC7B 1NFKA 2FH8A 5ITFB 1W0YT 5CJBA 4M9OA 2X38A 3MNZA 2H45A 5GGTH 3TN0B 3FYEB 2P47B 4TQEL 3W11D 5I15H 1EJFA 5FOBB 1B0WA 2ZAGA 2APFA 2ZP0T 4JM2F 4TUOA 5IK3A 5SX5H 2XN9B 4ZT1A 2OYPA 1XH3B 1QLRA 4X6BB 1MAMH 5CSZA 5JXEA 1XF2B 2CDEA 3S3DB 4I4WB 2PPDA 3N42F 1F0LA 2Y69B 3ARZA 2D31B 1LO2L 4R7LA 5E4IA 3U9UA 2EXSA 2W0FA 2PYEB 3PQYA 1U30A 4HOXA 1MI5E 2O5YL 4MNHA 3MV7D 5CBAA 5LGHL 4JGJA 1MW0A 1N0LA 2F1BA 2WXPA 1BDYA 3QEQE 3N1FC 4BFGA 5I75C 4YBQD 1E9QB 2O72A 4C55A 2QL1A 5F6HJ 3GMLB 2MHAB 4G8GD 4YLBA 1AZZC 3GMRA 5C0RL 1M9WA 4ORZC 3SB3A 2OR9H 5KVGL 3HB3B 5L8KB 5TDOA 4ZMVA 3E6FB 1BEXA 2BVOA 4EZJA 1TZAA 1MY7A 3IFOA 3NZ8B 3RIAF 3HZVB 5AVRB 4L2YA 1NIEA 2DV6A 5I0WA 1SMAA 2VABA 5GRUL 1QSFD 5IGXL 4HIIB 4Z7OF 1I3GL 3CFIC 5K1JA 4N2DA 2XZZA 3A67H 2AFNA 3I6LD 4LPUA 5E4EB 4CC4A 4L1HA 1GW0A 4XP4H 2BSTA 3AABA 1K3ZA 3PL6B 4Q2ZB 3T2OA 2OMXB 2F54B 3MA7B 1KWKA 4KRNA 4M1DH 4I1PA 4HQQL 2VCOA 1MJJA 4H25A 2VDNB 1HN1A 3AREB 3PNWB 1IAII 4MJID 2OJZL 4Z8FL 2ED9A 4U1NB 5DD0H 1TZ8A 4Y16B 1MDTA 2IADB 4P9ML 5ETUB 2HFFA 4NIKB 5CNHA 5IQ7L 3TN0A 1OB1B 2O5XH 1GYUA 3D30A 5E5MA 3RDTC 3QEQB 1RD6A 4BK4A 1M7UA 2VIRB 1FJ1A 3CC1A 1ETB1 1NAMA 2EIKB 2XICA 1WC7A 4LLDA 4QYOA 2P5EA 3UTTE 4XPTL 1SFHA 2VQ4A 5KSAB 1U91A 5JDSA 5JIHA 6FABL 4NERA 3I9IA 1MLCB 2DF3A 5E6ZA 5KAQG 3PHSA 4WTWA 2BS8A 4IQHA 2QGBA 3PHOB 5JW4N 3PGCA 2V5RA 3R7RA 3TJHD 1YHPA 2VC2H 4MCMA 3D33A 3PABA 3V4VB 2NOYA 3OF6A 3BZFB 4JDEB 3WFCH 4LLMA 4LQ1A 1SEQL 1SLUA 1NUFA 1NFDA 1RP9A 1J11A 4CSTA 1YN7A 4Z7QB 3GTVA 1F58L 3P4LA 1X5AA 3NSYA 4XVTH 5FYLL 1S7QA 2CDGB 1FIGL 1XH0A 3O3AA 3P3TA 4NT6B 5F0MB 3VI3F 3MODH 3UJIH 3KPRB 3OXRB 4YE4L 5GGQL 5F89A 4V33A 3X3GL 3ULUC 1D5XB 4Y4HC 1CXFA 1RSFA 4UM9A 1TOXA 4N3UA 4PP2B 1A64A 4RVBA 3CU1A 2VZUA 3GTTA 3FB7B 3V4VH 2R0KH 3RURA 3K72A 2XTJB 4J27A 5FS5A 1NSNL 2BVQA 4KXBA 3DGDA 3A67L 3S3JA 1BVLA 3WS6A 2LVCA 3IGLA 4A7VA 1AO7A 1CU4H 4H8WL 4QO1B 1U3HB 3AITA 1CT8B 3GK8L 1WCBB 4EZKA 3CD4A 1CUOA 3I9GL 1K8DB 4NBYB 1TSRA 3MLZL 1KCVH 2E8YA 3DWTA 3FO2A 2CPCA 3MRIB 1IKNA 5E1GA 4GBXD 2SEBB 2DI8A 3K8LA 4PRAA 5I17A 4PJ7F 5FO9B 1ANUA 2DIAA 5I8CB 1EZLA 2Q76A 1EHLL 2B9AA 2IMNA 3GMQB 4NS0A 4GW1B 4MD5A 4I0PB 1GAFL 2HYMA 4UBDD 2XCMC 3TV3L 3QZPA 1XL6A 1KGUA 1E5ZA 5FYJD 5FXCH 5B7MA 3L7FA 1O9WA 2KS0A 1CLZH 1EGJH 3O3AB 3T0XA 2HG5B 3MRNA 1TJGH 3FQWB 4PIRF 5CLZA 5FR3A 3S96A 2R39A 1PJWA 3LPPA 3X3FH 2D7NA 4RSYA 4WEEA 2GIMA 4HD5A 3M8OH 5DZAA 1U4EA 4JFEE 5SX4H 2EYSB 3FSZA 4GINA 3EYVB 4LEEA 5FUCC 5B1CA 1IJ9A 3GJFB 1E67A 3ULVH 3IWVA 5IVZB 3V79C 1OE2A 2JQZA 4OF8A 5DJDA 4NLHA 3LVTA 2PPAA 3CFBB 5EU6E 3T4AC 3VFRB 4EVNB 5IFAL 5K9KA 4N5EC 1FP5A 5I0YA 4J3OH 4BQ8A 1KPRB 2GT9B 4PU2A 3WEBA 4MNHB 2H6PB 4KKCC 4IBQA 3T71A 4B9ZA 1WD9A 4BRJA 1WA1X 2K7PA 4P3DA 3AS2A 3CFEA 3GMNA 1KJ2L 1IV8A 1UM4H 4UANA 4WW1A 2NTSP 1NQBA 4YK4B 2WSPA 3HBGA 1PG7L 3BCDA 1NGXA 1K2DB 2N0MA 1WTGT 4P59H 4PP1C 2BY1A 1F90H 4Q4EA 1G1YA 3BGFB 1VACB 3DUSB 3FO0H 1RUQL 3IU3B 3LNGA 4ZUVA 5LLIC 3RE0A 4CC1A 1FC2D 5I5MA 2AV7A 3HC2A 3QC5X 2XIIA 4LRNH 3J27A 4PPTA 5JHLH 4CJ1A 1H0DB 4O2CB 3BH8B 3N1QC 4V11A 1NCUA 5I0XA 3OX8A 3S0PA 3LZNA 1SLVA 2GABA 1OARL 3BO8B 5LNEA 1CF8L 3HZ3A 5HYIA 1G0DA 1PAMA 5BS0B 4YXHL 3OMZA 3ETTA 5EZOL 2V17L 3B7RL 4Q14A 1XGPA 1RUMH 5HP5A 3SPVA 1J8HD 3RJDA 2PO6B 5INDB 3GSUB 5I8KH 3BEWA 4KHXH 4OTXH 4OZIE 5MENE 3VXRD 4HWZA 2Z7YA 3HE6D 3QUXD 5HI4C 3RUGB 4DKEH 3FTYA 5C70A 1DQMH 4FQXC 1I3UA 3B1UA 3PWLA 5IM7B 3B2VH 4C54A 4ENED 5I6KA 3MBXL 2OMTB 3BWSA 5KVFE 5KS9E 3SO3C 3JV5A 5JW5A 4XVSH 1TTAA 2DAVA 2FWOA 1ZD6A 4OJCA 4QXVA 3WFBH 2DQFA 2B1AH 3JZYA 2ZPKH 2BFGA 1DANU 4H0IA 4I2XA 1V27A 1QSEB 1MPAH 2XX1A 4LPWA 5C09B 5HPOA 1K5WA 1KENL 1U8CB 4WAFA 1P6FA 4ETQA 3IMVA 1SOSA 4KJQD 5AW3B 2WQRA 2Y2TA 3UTSA 2PABA 2IDCA 3SDXF 1G7LA 1A6UL 2MKWA 3JV4A 4WI8A 3TNNB 2VXQA 3ZUNC 3MZTA 3CTTA 3ESPA 3BXNB 1NC2D 1SQMA 4PW3A 5AVZB 1X4ZA 1ZA3A 2CMRH 1Q0YH 4OCSH 1JWMA 1J05A 4LBEA 3UG4A 1MVYA 5C0AA 1SEBB 4OGXH 4EUPA 2DTML 4X6FA 4XO8A 2JV6A 1BECA 1DJXA 2CHXA 1O5DT 2P48B 2NZ9D 4DZ8A 4PLKC 3F04A 1IO4C 4WTZG 1HESA 1ZXQA 3QEHA 1QSFE 1JK9B 4D9RD 4M7ZB 3U30B 4WK4B 3ARBA 1U8OA 1AHWA 1T7YA 2E27L 4MMZA 3W57A 4GFXA 4FZ8L 2WSKA 4L4VD 3O6FC 4Y5VC 5ANMB 4XP6H 5J11C 4OCYL 3VO0A 4U6VH 4OKVA 5EBWA 1KFGA 3LKOA 3TURA 2G5RA 3A5VA 1A0QH 4XB8A 2VDRL 3BIAX 4JZJC 3WUWA 2VB5A 2E3VA 2J1KA 2AV1A 2OTUA 3VB9A 3ILQC 1UVQB 4RMBA 2W9DH 1OTUC 4DVBA 1B0GA 1PLAA 3V5DB 3IJ9A 5B3NA 4HPOH 3ARUA 3N41F 4PJIB 3WE6B 3WG7B 3QIUB 1IGIL 4R97B 3SDCC 4ANKA 4D7BA 3FCTB 2YXVA 3QG7L 1F11A 3MRCA 1XGUA 5I1JH 1E6JL 3RDJA 1YJDC 4H20H 2EQDA 5IEHB 2H32H 3BKYL 3IDXL 2FL5B 4NXSA 3LEXB 1QQDB 1I7RB 5TQ0H 4RNRB 4KRMB 4WEBH 4JO5A 4PJCE 2RQEA 3GIZL 3TS8A 4YIQA 2RTTA 1N6QL 2WXMA 5I19H 2WYIA 1EH9A 4NFCA 1A7PL 3QDJB 1J0HA 4P2OA 5DR5H 1XF1A 4R90H 1AO7D 4XMUA 1CJYA 4YO0A 2R23A 3GIVB 4YSCA 1OAYH 2XQ0A 4PD4K 4RFNB 5AAWC 5TDNB 1MHPL 1GC1H 5DMGD 2VITB 2GK0B 4PYGA 1NIAA 5E8NB 2YXFA 1AZNA 2H8PA 5CJOL 3LKRB 1K4CB 5HDQH 1QLFB 1FQ9C 2HVBA 1R24B 3QI9B 4BDVA 3WCYA 2Y7MA 5F9WC 4TLUA 3KXFE 3ZXAC 5AZ2H 4OGQC 4FFZL 1K72A 4HGKC 5HHPB 3S3BB 4P23C 5C0CD 1RHHB 4FQJH 1NMCB 2E75C 3KCWA 4JZNA 4G7YL 1D7CA 2Q1EA 2ZX5A 3RIFK 2ZNWA 5CLWA 1T89C 1BD2B 3TNMB 2C34A 1NPNA 3F6JA 1ZT4A 4O4YL 1B9ZA 1F11B 3MRCB 4OD3H 4ZI8A 3ULUE 2F6AA 4HWEH 4AGQA 4EDXB 1MVUA 1R34A 4N1EA 4QXTB 2WNWA 1CXEA 4XCNB 1FFOA 2X4NB 3DGGA 2HLAB 5H37H 3EJJX 1B0RA 4JG5A 2FD6H 4JMNA 4CMHC 1Z3GH 2ZOUA 4WSJA 3M6DA 1Y1DA 4PY8J 2X7LB 2WZPD 2PXYA 4G7QB 5HPMA 1U3ZA 2AJSH 1KXTA 4J1UB 2P5ED 4X9IA 4C83A 2EINB 2CCWA 5F9JA 2CR3A 5JHLL 2A9NH 1YYMH 2D0GA 4NQDA 3B3IB 1NAML 4B41A 1I8IB 4WWKC 2QJDA 4L9LB 4HV8B 2ARJB 3BH9B 3TN0D 5FO8A 4AMKH 2IMMA 2FJHB 4RMSA 1JK9A 1FDLL 2APVA 3WU1A 4OB5H 4YGVA 5A16B 3UAJC 3D2TA 3VD1A 2JTDA 2IV8A 2EDMA 5IHHA 2VSCA 1D9KA 1HQRB 4KBPA 2R8SH 3DUUA 3MNWA 3LSOB 3QHFH 1FA4A 3F00A 3L4VA 4CVXA 3T4AB 1HHIA 5B38A 4P46A 5GGVY 3CSGA 1PIFA 4P3CH 1EFXD 3BW9B 2KDYA 3IEAA 4F1ZA 3HBPA 3WKMH 2Y1VA 4E41B 1T5WB 4Q0XL 4FEMA 1Q72L 3BVNA 4AH2A 2ED7A 5I8OL 5JW3L 3L3OC 4RRPA 4M93B 3VXME 3QFDA 1JPST 4HUWA 4PSPA 4U6TA 2CJUH 3RPIB 4NKDB 4JDZA 2VLKE 4JFFD 3BD3A 1RK0B 4OFIA 4HS6A 3V2AR 2D7TH 1PZ3A 2YA1A 4LRIC 4AIOA 4I18A 4TPRL 4MD4B 1F97A 2IDTA 4OFVA 5TDPA 1FLRH 2G9KA 3HG2A 4FA6A 3UEQA 4ZZKA 5CP7B 1I9JL 4IU3B 1P69B 1RHHA 3ETBJ 1OGAA 2ZUUA 3O6LL 2KLTA 2C4FU 1SOXA 1YEIL 1YEEL 5IMKA 3HR5A 4DAGH 3ZMNA 3QG7H 3ASWA 5CWSA 3BVNB 4Z7IA 1QLFA 4PJIE 3CCHA 5C86A 5D7EA 3KDPB 3C60D 3GS4A 4KZ0A 4NM4L 1AKJD 3W2DH 2ZG1A 1XGQB 1QWUA 1TYEB 1T1WB 2V33A 3AG4B 3MA9L 4MAUH 3WJJC 3SJVD 1D7BA 3QPXH 3TBBA 4ZO6A 5DQDL 2P26A 4YMPA 2WBXA 4KXDA 4PWHA 2HUEA 3N44B 1E7UA 2P5PA 2ZXQA 4ABQA 4NQCE 3VI4A 1LMIA 1G5AA 5F7FA 1WS7A 1Q0EA 4L4VA 4XMWA 5KVDE 1L9SA 1W80A 2LAAA 3GQFA 4ANWA 3OKKA 1U8JB 1K2DA 1GRWA 3ZZQA 3CVHL 3HNSH 1XGUB 1TO4A 2YZ8A 3HOGA 2ZG3A 1AD0A 2G30A 3EO9H 3HUJB 4TNWK 1XBRA 1IL1B 1QFWH 1OP3H 4LDEB 2NY6D 5D70H 3SKOA 4RMTA 2J8UB 5D93C 3ZKQD 3ZKXC 1JCVA 4UM9D 5T5NF 2ATKA 1IKFH 1KYFA 4KRPB 1WZ1L 2YPVA 3QEUB 4OGAD 3BOVA 4KY1H 3QR2A 2X41A 4WTQA 4MHHI 4FNPA 1EXGA 3FQRB 4GP4B 3IM1A 3MRQA 4TVPH 4WJKB 2YAFA 1MCNA 2ADJB 2ADIB 3BPCA 5ABZA 3DURA 2AQ2A 3VXNA 4AITA 4OFDA 4LFHG 4YSPA 5SWSB 4HX1B 2Z64C 2YLHA 5IQ7H 2V5TA 4PJIF 5F97E 1AC6A 1U36A 1YEDA 5DSCA 4QIRA 2C3XA 1HZKA 3C5XA 5D2NB 1UXSB 2BDNH 2MMXA 5AOKA 5I1AB 5DQ9B 3QSKB 1GYWA 2LAGB 4OQTL 1PG7X 4RBPK 1RZKC 2V5MA 2OPCA 3B1TA 4JG1H 4KDTA 4XXCA 3VI4B 4M1DL 1P5VB 4XVSL 4CVUA 2OSYA 3TFBA 4K94H 1F8TH 1KXVC 5C6PB 2Q6WB 1KN4L 3NQKA 1NCDL 1TSHA 1EUTA 2BNQB 3W1ZA 2F19L 3DMMA 4MCZB 4DAGL 1DVFA 3HPLA 3V6ZB 5AYUL 2I9TB 2O30A 1DQJA 1PL3A 4BFIA 1W15A 2R23B 2IGFL 3GIVA 4YDNA 2P5WA 3BE1L 3EDDA 2EDEA 2DYSB 3NN8B 4R5XA 1UB6A 3APMA 2UYLB 1U3HA 3O4LE 4G6FB 4DPAX 5E99L 3PCYA 4W6YB 5EEVA 5IUCA 3KLSA 2EH8L 4M5ZH 3TJHC 1NAKL 3NCJL 2VZTA 5EZOH 1NCWH 4JQIL 1CD0A 1I1RA 1M1XB 2LQRA 1L5GB 2WZPA 2Y6SC 3VD3A 1T7ZA 4L3ED 4NBXB 4Z95H 1MFBL 4ODXA 3BPLB 5DFWH 3HPJB 5GGRY 3T6XA 4MAYB 5HY9A 5DA0B 4PUBH 4N8CL 4B3VA 1PYWA 4OIIL 2E9WA 3W39B 4GB9A 4R7DB 4BZ1L 2NY2C 1HZLA 3QJHB 3IBEA 1DLHB 1QRKA 5DS1A 3ULAB 3L95A 4TQ8A 4V2CB 2YBRA 2WSDA 1HHHA 3I75B 4JFDB 3RZWA 2PO6A 3MV7E 1QHPA 3L9RB 1CYWA 3GUTB 4I1RA 4I2XE 3G3LA 4Q6IB 2DBJA 4D9LL 1VEPA 4XN5A 1WWBX 3RRQA 4PJFE 1JJUA 1T5WA 5JHDE 3WIHA 5ACLA 3DX1A 4NBZB 2IXQB 5IQLA 4OT1L 4RGOL 2XWJA 4UV7L 1KSRA 4FGMA 1RK1A 3CFCH 3K5RA 3B8YA 4H2CA 3SD2A 2NW3A 2PXYC 2AQSA 5ICXA 2CRYA 5GSRB 3ATBA 5E8PA 5C0BB 2DDQH 1FJ1B 4XP9L 25C8L 1WFIA 4JHBA 4U1SB 1QUNA 3FONA 5D1ZA 4UYQA 1KIPA 1FO0L 1YA5A 4NXKA 2ZCHL 4RAVB 4LMQE 3HE6A 5FA3A 4B27A 4FFYA 3VXRA 4N1CA 5IB5B 4TNGA 3KPSE 4NN5C 2F54E 5JOEA 2WINA 2PPCA 5J06A 4PW4A 2DEWX 4GLRH 3OQ3B 4RIRA 2ICEA 3LPGA 1GOGA 3CN0A 4GO9A 4B53A 3VFOB 1MEXL 3MKKA 2BDNL 3LNFA 3S88H 4DHLA 3QAZB 4WO0A 4Z18A 3WLWC 1RJLB 5F9JB 4LIQH 5DYFA 4OZGA 1RZKL 1WH0A 3TJEL 3NFNB 4Z6AT 4H26B 3UJJH 5HHVL 4HWNA 5L2KB 1G7MB 5MEOB 3LB6D 4F58H 3PWJB 4TRPH 1WWAX 2YC1B 43C9A 3UTTB 2WY3B 2YPVH 1HH6B 4U1IB 4OW6A 1AR1B 3N2JA 3O11A 3FCGA 1BPLB 4IHOB 4PBWD 4A55A 4G59C 4XH2A 3AM8A 1QKZL 1SY6L 2Z31D 3VH8B 5J6GA 1QVOA 3X2QB 1KCRL 1UD6A 1Q9OB 1L9TA 4KTEL 3TNMA 4HWZB 1R0AH 4K4KA 5DVMA 3SYOA 3STBA 1IQDA 5KS9A 1OF2A 3DSNA 4PGBB 2FNWA 2ZWYA 1UH4A 3VGAB 1T5KA 1C08A 4HLJA 3UROR 5C7XH 1FZOA 2B39A 1AGCA 2Q76B 1QR1B 4LSSL 1E9QA 5I17B 1JRHH 1SF3A 4X42A 1FN4B 4OF7A 4NQED 3WNLA 1JNLL 4F2MB 2G2RA 4KI5D 4K5OA 1MF2H 3B7UX 3L5WA 5FV2A 1LGVA 4KVCH 3FHAA 1E4JA 4XCYA 3H9SE 1IE4A 1U3JA 5EC1A 5FW6A 3IVKB 1GMIA 3BKCH 3WY3A 1SMOA 4GRWH 1OW0C 2WB1A 3LH8A 1RVFL 2EEAA 3O9WA 4MAUL 1ZJBA 3EH4B 5BUPA 4WZ9A 2BY0A 25C8H 4DNLA 1BFTA 5I1LB 4E5XB 3LEXA 4YHMH 4M7KH 1MVFA 2X9WA 4CMHB 3ULUH 2WO2B 3ZGHA 3S7GA 3CFCL 3DDFA 5TTRA 3T65B 1YECL 2CO4A 4GXFA 5FW8A 2VE6B 1X5HA 2WO4A 3VTTA 2CO2A 2E7BA 2KPWA 4L8CB 1FFPB 1A7BA 1MJ7H 1KF9B 4M02A 2O5NA 4OBRA 1KCUL 4NC0B 2X0WA 2VDMH 4JKKA 4NENB 2LOEA 2O5YH 2XA8L 1FPTH 5EBLA 3UZQB 4LOVA 4R96A 2QLVB 3QO0B 2EDDA 3PHOA 5C07A 2X4OA 2H0JA 3V0GA 2VZOA 4BZ1H 1KNOB 2HLFC 3LKQA 3RG1C 1SXSA 1NCGA 2KERA 4JL2A 1B4LA 4F9LC 3VE0A 4E9WA 1QTYT 3VG0H 1S5HA 5ADOL 4HCRH 4N22A