1ZE3H

Crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
122
structure length
122
Chain Sequence
b'TGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
molecule tags Chaperone/structural/membrane protein
source organism Escherichia coli
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
total genus 15
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2005-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1ze3H00
5F2FA 3JWNG 3RFZA 4X5RA 5AB1A 5IQNA 5FWRA 4XOCA 3JWNE 4X5PA 5FLUA 4XO9A 4J3OF 4XOEA 4XOBA 1QUNB 5ABZA 5F3FA 3ZL1A 3JWNH 1KIUB 1TR7A 2JMRA 3MCYA 1KLFB 2XG5B 4LOVA 5CGBA 4AVKA 2UY6B 4AVJA 4AV4A 4AUYA 5IQOA 2XG4B 3BWUF 3ME0B 2WMPB 4AVHA 4AV0A 1UWFA 3ZL2A 4BUQA 4J3OG 4CA4A 2W07B 5JQIB 4CSTA 2VCOA 2J2ZB 5IQMA 5LNEA 5AALA 1N12A 3ZPDA 1PDKB 3BFQG 3BFWA 4J3OH 4XO8A 4XODA 3SQBB 4X5QA 4AUUA 4CSSA 5AAPA 5LNGA 1N0LB 4XOAA 4ATTA 4X50A 2UY7B 1ZE3H 4AUJA 5FX3A 5FS5A 4AV5A 2JTYA 4AVIA
chains in the Genus database with same CATH superfamily
1F6AA 1Y18B 1OE2A 4Y1AA 3EYUH 1J8HD 2ZKWA 3MBWB 1BIIA 4WNJA 1GW6A 5KAQF 3AREB 3PAUA 1FN4A 2ZSVB 2OQJA 3ZDWA 3H9ZA 1MF2L 4PB9L 3BWSA 3V6OC 4OZFA 4XNQA 1SEBA 2W07B 3GMLA 3WEMA 3PGFH 1L9RA 3MBEA 5EBWB 2XIDA 3F8UB 3LOWA 5IR1A 4PJHF 1FZJB 5FO2A 1QO3B 2A83A 1M2VB 4CBZA 4PN6A 1A9BA 1M7XA 4HIXL 4YO0B 3M17B 1O6SB 1BZDA 3C60A 2E74C 3O45A 4G7VH 1A3RH 3RVXC 4YZFF 3U1SH 5FEBA 1S5HA 5HVHB 2X2IA 1NIFA 1HHJB 5A7BA 1BZOA 2K6WA 5D5ME 5DK0A 2IH3A 1G9EA 1S7TB 1V3MA 2WXOA 3D3VB 5JLZB 1R24B 4LLQA 4Y1AD 2Z7ZA 2J4WH 5AYUH 4CVWA 4WFFD 5HP5A 2XTLA 4LCWB 1RIHH 5IM7A 2DH2A 3Q3GB 1RZIA 4HJJH 5KVEL 1WS7A 4P4RA 3IMUA 1JVKA 1MCLA 2IVFC 4LFHD 2DEWX 3G6AA 5SX4H 5F7KC 2PKDA 5GGSA 4URTB 2J4WL 2JB5L 1ECYA 4HPYH 1SY6A 1ES0B 2R23B 2YN5A 1IZKA 3MYZA 4HGWB 2VERA 3L9EA 3DI3B 4F2ME 2UWEF 3ZRSA 1G7MA 4HLZG 2F54B 4N0UA 3CLEH 3FFCA 1RK1B 1R4XA 2P52A 1BFVH 4XNZC 3HN8A 1JXFA 4K94L 1DVFC 1Q0YL 4OGYL 3BUYA 4Y4KB 3RY5A 3O41B 3FCSA 3JWDL 1F18A 3MLTB 1OGAA 5EU6D 4WUUB 1WD8A 2MEJB 3BYTA 4QY8A 1KTRL 1LJMA 2VM9A 4ZX4A 2HPOA 4P4KA 2NY7H 1G7LB 1Z3RA 3FHAA 3HB3C 1NGWB 5F1IA 1RIUL 2NZ9C 5FYJL 3WBDA 1LO2L 3DO3A 3L17A 3N91A 3P30H 3QJXA 1KIRB 2DYPA 2ZSWA 4J6IA 4UTAL 3KPLB 4UAOB 3MYJA 4OGAC 4CAGA 4R2GB 3ZTDC 5C07D 3U4BL 3H7LA 2W95A 2WUCH 3LS4H 5F6IC 4YJZL 3QXDB 5SWZD 1WBZA 1AXIB 3CHOA 4P2RA 3F62A 1B0RB 1JXGA 3RVTC 2HB0A 2IPKB 5E51A 3ZE0B 3JVFC 5A2AA 4QIRA 2ARJQ 1YUHA 4KUCD 5KSAA 3FMGH 3STLA 2V9UA 2N7SA 4F3FA 4KRPB 3BSZA 4OCLC 2JLLA 4YE4L 4NZJA 4PTUB 5F9JB 5DQ9A 1MRCH 4PCYA 4LLDA 4JKPH 3EJZC 3IGAA 4BWWA 2VQUA 4ALAH 4KXCA 2G5UA 5B4MD 1RHFA 3T0DA 1W72B 1UADC 4UOW0 1H3PL 3IVKB 2V2WB 1T5XB 1OTSD 2ZXWB 1F3JA 4ACPA 4C54A 5FXCH 3ARBD 4FQJH 4JQVC 4R4FL 3GQFA 3KGSA 4CN1A 5I18H 1EHLL 5EEUA 4TF4A 1YJDL 1KYOJ 3MCKB 3MKKA 4X50A 3VYNA 4P2QB 1R5WA 2GFBA 2OA9A 3QJTB 5IMMA 4ZAKC 3EJTA 2EE9A 3DUSA 2E9IA 4MNGA 4FQXD 2CLRB 2HFGH 2YGNA 4KBPA 4AIXA 1AMXA 1TENA 2BVQA 2YWYA 4QRBA 1FO0L 2XWJA 3FFOA 2R7EB 1DDTA 4YFEA 3WO4C 4MJHA 4JY5L 5HGHA 4EZJA 1DDHA 3IJHA 5GGVY 3WAKA 1X5IA 2ZXDA 1UXLA 2HMIC 4XC3L 1PY9A 3K72A 4GSRA 5TFSH 1XAKA 3TBSB 2DH3A 3CH1A 2NRDA 3OR6A 1F45A 2EDFA 3Q1EA 2BM3A 3MRDB 3MROB 3TO4B 4XMPL 1E7VA 2VMEA 1ILUA 2X4OA 2A9NL 3GXIA 3IPFA 5DO2D 3TPUA 5HHQA 2NY4D 4XN9A 1T1ZB 4GI8A 4WY7H 3U2SA 2EDWA 2BIHA 3OF6D 4O9HH 3ZUCA 4PBXA 3VXOB 4H0IA 3CC1A 4JGUA 1M9SA 1U2HA 3LZPA 2C1PA 3QQ3B 2AXHA 4L1BA 1Z0NA 1JGEA 1MIMH 2HVJA 1YEFH 4OFVA 4B6ZA 4AGMA 4YHKL 3UGUA 4XVSH 1DJIA 1MWAL 1T1WB 4KZ0A 3VMOA 1R5IA 3EHBD 3FH7A 5IROC 2E7LC 4WWKC 2AZUA 4HP5A 4JE4B 2OYPA 3GHPA 3US9A 4AG4H 1NEPA 1NAMH 1JNHB 2MMXA 5B3JF 1AOHA 3DWTA 3KW8A 4O4YL 1NMCC 3IFNL 4X6FA 4UM8A 2QVTA 4UI2A 3DLQR 2DQHL 4PJEB 3ROLB 4DGVL 5IVNA 1QRNB 2D0FA 1O5PA 3KPSE 4R90H 5BUGA 3ZE2F 3B1TA 2YGVA 2B1AH 3DBXA 1NIEA 1W91A 4PJAE 4FFTA 4ZTPL 3CLFL 2CHWA 2ZKXA 3BZDA 1EDQA 5IB4B 5J6SA 3L8QA 1QLRB 3EBIA 1DBAL 1YDPA 2CLVB 3JWNG 2A5UA 4PWHA 4CADA 4UINH 3LEXA 4JKWA 5E23A 2NR6A 2EINB 3F7LA 3EOTL 1RUAL 1JF6A 3CFCH 1K4DA 1JWUA 4KJPC 4HWZB 5IFJB 5C6WH 2FAUA 1FFRA 2ENPA 4U4IA 1N2RB 4XNXL 5CUSL 1CDUA 1FVCB 3ZPDA 2QADD 4KQ4H 1WGOA 1E27B 1Q4NX 1JNNH 3OXRA 1QACA 1BD2B 1A7NL 3IM1A 4GXVL 1USQA 3KEHA 3CBJB 1AGEA 1UOWA 4OIAA 3S4SB 3DRTA 3KPSA 3AS3A 3RKDC 1A6ZA 1S8DB 3K7UA 3V95A 5I1GH 2XVLA 3AT9A 5TF1H 3G9AB 1U92A 1LP9A 3MLWH 3VRJB 4P5MA 3IRZA 1IT9H 1KF9B 1HSAA 3T8XB 3ZXAC 5I0ZA 2YBGA 2XPYA 2C9AA 1SJXA 3HN3A 2YRPA 4E9WA 2EXWC 3ZLQC 1FRGH 3QWRA 3RZCC 1CICA 3RDTB 1FFOA 1EO8H 5C09A 4O02B 1B0WA 1TITA 4K7PH 4GQRA 2OFQA 3HS9A 4GIPD 2ISDA 1F1AA 2WLZA 3PNRB 1CFQB 1IILE 1ZT1B 3GYRA 2VDMH 3G5XB 4J3BA 1LEKA 4DUWA 3TEUA 2BHZA 1TR7A 4NNXB 4QJ3B 1BOYA 1E4KC 2WZPA 5I71C 1I7ZB 5D7EA 1LWRA 5E2TL 1A4JA 1GOGA 1UD2A 3PWPD 2VR6A 4WW2C 1WWAX 1XGUB 2CJUL 5ERWB 4ONHA 5GS0H 3O2DH 2X70A 1F11B 2VJXA 4GRWH 3FB7A 4K3DL 3X13A 1E8WA 3L3KB 5I9QB 3T3PB 3MRFB 2YA0A 4FHKA 4B9KC 4M48H 2QLYA 1KB5A 5D1QC 1NZRA 1OARL 1VZIA 4FA6A 4XPAH 4JJ5A 4YEEA 4JM0A 4KZEL 3RA7H 4I2XA 5FCSH 2AJ3A 3KZ8A 2CUAA 4TUOA 1NCWL 1HXMA 5D1ZA 1UJ3C 1OAUL 1SXCA 1MUJB 2G3XA 3B7YA 4GKSB 3DX7B 4NRXB 1LO5B 4YSOA 5EBWA 4JPIA 4L4TD 3L3JA 2EDYA 1NOAA 3I3DA 1A9BB 2YARA 4ZAKA 3N1GC 5ABAA 1JPFB 1N5AB 5FDWA 3VXMB 5HYEA 2QZQA 1D6EB 2UX6A 1XGQB 4I2XE 4ZSOA 5F9WC 5LAXA 3FU9A 4X80L 5IEHB 1DQVA 5DD5L 5DC9B 2VXUL 2DICA 2P5WA 3INOA 1SF5A 3PWVA 1BQHA 2PABA 5IM7B 2ARJA 2IAMD 3E6FA 2OSXA 4P3DB 1OZUA 3IRPX 3WJJC 4KX9A 2MPAH 1FH5L 4B9PA 1FL3B 3E3QE 1J1XL 3KDPB 2VQ4A 5DRWA 4BFKA 1U8LB 2GHZA 5E99L 4MA8H 1YEJL 3WIIH 4HUMB 3C6LD 4JS7A 2HJLA 5EWIL 5IVXE 4G43B 4GRWF 4NIKB 3VU1A 4JRWA 2PWHA 5JUEH 4P2RE 2EP6A 2FYVA 1T0PB 1JZ2A 1G0XA 4XCYB 5BUPA 1KBGH 3W82A 4POUB 4ONFL 4HGKC 3FK3A 4MZ3A 4PS7A 3AMKA 3BEVA 2ERJB 5E4EC 4Z9KB 5J13B 4QNPF 1EV2E 1U36A 2VLLB 1OAXL 3OC5A 2Y2TA 3VE0A 4YBLB 2W1NA 3GBML 1MFNA 3W9EA 3V0HA 5TE7H 2B2XH 3WS3B 2DM3A 1INDL 2K0RA 1D5RA 4Y16C 1ZHKB 1JZ3A 8CGTA 2YD2A 1YG9A 5IQLA 5JHLL 4IJ3C 4W93A 1CT8B 5ESAA 3HNTH 1UWGH 3DX4A 4J3OH 4X42A 3JV4A 1U8KA 2OTPA 3TM6A 2JH2A 5CMAA 3QIBC 3MA9H 3CVDA 2NW2A 5J4MA 1N5YH 3RWHB 1BG1A 3OWEA 2VQ1B 2ZX5A 2IBBA 2BP0B 2P26A 5EU4A 3AQXA 5FA4A 3C5SA 5F3FA 3ZKND 1G7JA 3N40F 2ICWJ 3V5DB 1HHJA 1IC5H 3TOPA 4DESA 1YAIA 4UQDA 2VISA 5FYLE 1NCCH 2UYLB 3H2PA 1H15A 1XGRA 1G5GA 2E6QA 3PHOA 1KCVL 3HIZA 3BZFA 2WLIB 2Z6FA 4Q74A 1T20B 1HIMH 1CI3M 4EZKA 2QKSA 4E5XA 2R2BB 3CVBA 5B7EA 2SEBA 4Q9CA 5AAWC 1GGCH 1NANI 1YPZB 4YXLL 5D72H 3VSVA 5E2WL 5D70H 1TJGH 4G6FD 4XHJD 4FQQA 4XNUH 1X9LA 4FKEA 3ZTNH 3OXSB 1HE8A 1UFUA 2HPTA 3ULVH 2EEAA 2W9EL 1VB9A 5JUEL 1P4BL 5BOJA 3RHWK 1VLXA 5HSFA 2J6EH 5EBMB 2CDEB 5AAWA 4S1QH 1CF1A 4XMKL 4OCXH 3VI3B 3RNKA 1UKSA 4H25A 3JV6B 5GGQL 1YN6B 4ZQKA 5SWSB 1GGBH 1P2CA 5LBSA 2AMGA 2VZ1A 2CWRA 3DSFH 4FXKA 4HIHB 2ZT9C 1U8CB 2CLZB 3QARA 2VZ3A 4XXCC 2XV6B 1KB9J 4M56A 1HQ4B 2MCPH 4LEEA 4A37A 2XTJB 5L2JB 4QY8B 1NTDA 3AFLA 4GMSH 2OZ4H 3UX9B 3SGEI 2K6YA 3VU2A 2XZQH 2DJSA 1QBML 3P4NA 4JZOB 2GCYB 5EO0A 1BZ8A 5C70A 3EYOA 5FWQA 3K72B 3BVDB 4U1LA 4ZQTA 2F19H 2WVUA 3BDYH 3MRJA 4LAQH 4J2XA 3A67L 4TNGA 1EFXD 4I5BB 2FLRT 3QS2A 3H6AA 1Y6NR 1RHHA 4WTZG 3SE9H 1NCNA 5FFOA 2K4WA 2ADGB 3HR5A 3NGBB 4PWKA 3DVGA 3MUGB 5BQDA 5I1KH 3LKSB 3QIWC 1JK9B 2BNRA 4Y8AA 2X4QB 1SOQA 1YNTB 4Y19D 2ICEC 3BUTA 1MRFL 4PI2A 5H4YA 1IRAY 1QAWA 2A6DB 3HPJA 4PV1C 3WNOA 4CDHA 3HNVH 5I0WA 3L2MA 3BH8A 3WFHA 1ZOXA 1BAFH 3SPVA 4GS7B 3F04A 1KNOB 5C3TA 1CZ8L 1SJHB 1C5CH 2P80D 2KDGA 4DNLA 5IG7B 1I1AC 2X1OA 4S0SD 1X5AA 3WKYA 4EI6A 2VDML 3P4OA 3BP7A 1QUNA 1HC1A 3VI4F 2HX8A 1QRNA 1MY7A 3AABA 4ZYKB 4JANB 2OCFD 4CVZA 4LL1A 1TZOA 3DMMC 1I3VA 3N40P 4MXQD 2IGFL 5ABZA 1YEEH 2F7OA 3GJEB 1SN5A 4P2QA 3QQ4A 4R0LC 5KS9A 4KDTA 4LDLB 3R1GL 4HXAH 4Y1SA 1IBBA 3PL6A 1W9XA 3CHRA 3IJ8A 2VW4A 4K2UH 3MCLH 1AI1H 4F57L 2XZCH 4HYTB 5KVGL 4WWKB 2Z8WC 1I1RA 4EN2A 3F3HA 4IM8A 1IAIH 4IRSD 2GT9B 1KJ2B 1YDPB 2WIIB 5IUCA 3QC5X 2D73A 4G71B 5DJ2A 2LU3A 4WCYH 2Y72A 4KHXH 5GSVB 1YECL 4QHNB 1EAJA 2VR7A 3QQXA 4JFZL 3IFOA 4YLQT 4FG6C 1IC0A 1SXSA 1HYRC 3QQ9D 4KQ4L 1DQML 2BJMH 4AYGA 4LSRH 3LPWA 2X41A 4WKZB 2ZKYA 4B27A 5ANME 1ORQB 1IE4A 4QTIH 4X7DC 3N44B 3NJKA 3H9SA 2ZWZA 3PAZA 3IAPA 1OM9A 3P73B 4TUUA 4XZ4A 3VVWA 3C2AL 4FLRA 5BRQA 5ADPL 4GLRI 4PJ5A 5BVPH 4NO3B 3QUML 1J7VR 2FK9A 2WZAA 3VW3H 1CK0H 1OCCB 2DMKA 3SEPA 4U6VH 4DN3L 5F3HB 4HIIB 3IDYC 2E86A 5C97A 2XWXA 3AWEA 4LCIL 5CSGA 5F2FA 4Z3HA 3T3ME 4ENED 3IETA 3GMOB 1A8JH 3LMJH 5JPMA 5FW7A 5BRZA 1C1EL 4JFOB 2VR5A 4MD5B 3Q8FA 3V6FB 3QUYA 1IKNA 2BPBA 1ND0B 2J21A 1IM3B 2CIIA 3CLFH 4RLDA 3H7BA 5F0PB 2OL3B 2V9QA 1EIBA 3V0VA 3ARGA 5JPMC 1KN2L 4D0DA 3UPRA 5C0DA 4GSQA 4R90L 4X6BA 1A1MB 3AQZA 4F8QA 3ATBA 3HOGA 1LNUA 1AQKL 1Q9KA 4KHXL 1TZGH 2L7UA 1IGJB 4TUJB 3BAJA 2IFFH 1ZV2A 3N1MC 1JK8A 4BHUI 1Q9LA 5DF0A 1GZQB 1GJUA 1P5VA 4F8LA 2FWOB 4HFUH 1OGTA 2K78A 2XY1A 1HJBC 3SDXE 4ONHB 4TSAL 1SHXA 4HC1A 4CGTA 3M88A 2NDGA 4LNRB 4ODXB 1GY1A 4IIQC 1JWMA 5HYIA 1TZIA 4MQ7B 3X12B 1F97A 3QAZC 2XWBB 3UCQA 1B0IA 4DGYL 5DYFA 4OF3A 1VAHA 1WBXA 1H0DB 4XH2B 3B4NA 3ABMB 3Q6GL 3FFCD 2AJUH 3TVMC 3BWAA 4HEME 1ONQB 3BH9B 3E1F1 3BMWA 3GMNA 1CZ8H 4G42B 4I3RL 4A2HA 2JKJA 4XXCA 3GB7B 3OJDB 5C7XH 1GCFA 1BQSA 3OMAB 1N3NB 1L6PA 2DQFB 5GISL 3QDJA 5J9PA 3PF2A 4DPCX 5IJVB 5IROA 1NSNL 2BY3A 3HLAB 3VUAA 1S9VA 3EJJX 2JV6A 4WI3A 5GSRB 1ZANL 1U8IA 5DDHB 1ACCA 4XC1L 2O5XH 2V6HA 1DQTA 3MJ7A 4MXQC 4JREB 4RFNC 3T0EC 2IJ0C 3HI5H 4U0QB 3SJVB 5GS0D 3BE1L 2CUIA 2ADIB 3PJSB 3FQ2A 3GSUB 2DMBA 3ETBF 3ZDYB 2C9RA 3BCDA 1MHHB 1WSST 3FTGA 4FG2A 4DKTA 4DOHB 1KN4H 1UFGA 5C2UB 2X38A 1XSIA 5E2UH 3VD2A 4NQEA 4KO5A 3U83A 2V9TA 3JTSB 2F19L 1J0YA 3GXDA 4LOUD 1PD6A 2IQAB 2XWTB 1DQIA 1A4JB 5AKRA 1AO7A 2E3VA 4RMWA 3L7EB 1H3UA 4K73A 5FGSA 4D8PA 1SOKA 4IIZA 3VSQA 1Z9OA 3MRBB 2ETWA 3AW5A 3W9EB 1BZQK 3GINA 3GDCA 4O51A 5E6IB 2IALB 1CYXA 1LE9B 2WZ0A 2P43B 4GEJA 2WM0A 1ZVYA 3KGRA 4H4NA 4FNTA 3PJLA 1X7QA 4LMQE 4G9DA 1J1OL 1U93A 5IQ7H 3VD1A 4JFVA 4FP8H 3SYPA 1NBQA 3L4VA 3G5YB 3NJIA 4UDUB 4Z7NB 5E24E 2O30A 4PRHA 2X9YA 5HPMA 1MKFA 2QLVB 3NG5A 4Y5YB 3FCUB 4HF5L 3ZZ1A 4KNSA 3FT0A 3OC8A 3WE6B 5IMOB 2PXYD 4WFGE 1QSVA 1HNGA 1ZK5A 1HOEA 2N1KA 3WTYA 4G80A 4OGYH 3KPOA 1OSEA 2FL5B 2SODB 3VXUB 3W5NA 2BNUA 3VACA 1YPZA 1U8NB 3MLXL 2Z31B 3GGWA 1GYCA 1XD0A 1NWPA 4TTGA 3BAKA 3H56A 3VXRD 5IJKA 4LLWB 1X6LA 1GYVA 3HI1B 4UMSA 1G9ML 4QO1A 3GKWH 2CKBH 3EOBA 3Q5TA 4G43A 4YUEH 4JL2A 2Z34A 4RGMC 3MLSH 5LLIC 2NY5C 1JV5A 3C60D 4JFZH 1BVLB 1VFAA 2HWZL 2E27L 2OV0A 4Y19E 1BG9A 3LEYL 3QEGL 4G8IB 2P24B 3M45A 1ROWA 3EW3B 3MJWA 4JG0H 4MRBA 1A3ZA 4P57A 4EEEA 1S7XA 1P53A 3BXNB 1PLBA 1V3KA 4DEWA 4TQ8A 1XR8B 3RWDA 3UJIH 2WB7A 1S9YA 2OR7A 4I4WA 5JIKA 3ZL2A 4KKCC 3MUHL 3WIHA 3IDYB 3VXPB 4E9YA 3MRMB 4MA1B 4PS3A 3FU3A 4X6CE 4FQ1H 2IC2A 3VGHA 4B41A 3EBAA 4PGJA 3MBWA 5DC0A 2Y5EA 2G75B 4U6YB 1I8MA 4PJDF 4XP4L 4ZFGL 3MX0B 1SLXA 1I1FA 1FJ1B 1LEGB 4OFIA 5C1MB 1V10A 3VFGH 4HIXH 3OV6A 1KYDA 3MRIA 4LHUG 4N2LA 4MJIB 5E95B 4N28A 4LCUA 3TNMB 2CCVA 4ISVB 3C9NA 4NNYA 1FFQA 1CYWA 1FZJA 4TVPL 5E99H 2KQMA 5HDBE 4J12A 5D4QA 5HVFB 2UZIL 3DXAD 5ECJE 5KAQG 3KL0A 2EE2A 3CDYA 3N43F 3ZGHA 5MERB 4U1GB 2J5LC 1BAFL 4UTCA 5DJYA 3UAAA 4NUQA 1HX0A 2A6DA 4QEGA 4HW6A 1IQDB 1OGAD 1SJEB 1KJVB 3J07A 4JDZA 4GG6F 5CLXA 5FWRA 3V52H 3QZBA 3NA9L 3TA3B 1U4EA 2VUYA 4KTEH 1K5NA 1NFIA 5C08A 1ZMYA 5B1KA 5AB2A 1G1CA 2MWCA 2Y3AA 3NCJH 4OI8A 2DYPD 4Z7WE 3TH3T 3CQPA 2A0LC 3ZKMD 3SDDC 1P4IL 3O9WB 3QCTL 2Q8AH 3ES6A 3QIBB 4MJID 5DJ6A 3JV6A 4XNDA 4JFYA 3CN4A 3V4PL 3GSWA 3T0WA 2WD0A 2XZQL 1EDHA 1G43A 1F4HA 4I7ZC 4ODWB 4X5WB 5TDNA 1SBBA 3V52L 3L3OC 5I8KH 4N0FB 4JFPB 1ZXQA 2BVPA 5KOMC 2VXVH 3WJLA 1FG9C 1YAZA 5DEGA 5E8PB 3KM2A 4GRLD 4OZFG 1ROCA 4XO4A 2BNQB 2OM5A 4L1HA 1A3QA 2YLKA 1ZA6B 1NCBL 4BDVA 2I07B 4LNVA 2ZG2A 4XAWL 3LKOA 2JSFA 4JX0A 4CBPA 1MCQA 5DJXB 2DEXX 1BPVA 2BSED 2JE8A 1HZHH 3LNFA 3K0WA 4XPFH 3APDA 5TQ2L 5K9JL 5CGTA 1P4BH 3VGEA 5GGUB 1M3JA 1UJ3A 4EVNA 4HK0A 4APQB 1EO8L 2IBZX 5AOIA 3PHQA 5I1IH 3BPOB 4J3SA 3KWWB 4WTWA 3G5VB 4LSVH 5D1QA 2QMJA 5B38B 1BJ1H 4LU5H 1HIML 2HLEB 3FUIA 3T77B 4FEMA 1YC8A 3WG7B 5IVOA 1CVSC 1FGVL 3UJIL 3E1ZA 4Q8BA 3PIQB 5F88B 5GGSY 3ZDYE 1GC1L 5LBGA 2UUDH 3K5SA 4EJ1C 1GYAA 3SJVE 4QT5A 2WLYA 2KL6A 1U42A 5BOZG 2HWZH 2LAGB 3KPNA 2E9JA 5JW5B 2CR0A 2JXMB 2XQ0A 4YUEL 3IN2A 2DMHA 4R7NB 5F6HJ 5IBTH 2VZUA 1NBCA 3BIAX 3DROB 4GAYB 5EN2A 5AVYB 4NT6A 4YEFA 4LPUA 3P3TA 2DQIH 4X6BB 1HHHB 1OXYA 1VRSA 3DO7B 4AXWB 1EXUB 3TTSA 4I18A 3KCPB 3ULAB 5HVHC 2J8UB 3QWNA 1Z0MA 1EFQA 4NPJA 2CALA 3TCTA 2B0SH 3TP4A 4QMEA 4G7SB 4PRPA 2NZIA 1KZYA 4ETYA 5EF3A 3ATDA 2FQGA 5DJ2B 5BZWB 3FCBA 2JI2A 2PWFA 2Z8RA 1MOEA 2AV1A 5E9DA 4J4PC 4M5SA 3EH5B 3C6LB 4EI5C 1J18A 3V0AC 2Z64C 1WA1X 3IBOA 4NRZA 5EWIH 4YGVA 2A3TA 5D71L 5KANI 4G1MA 5IMLA 4JVPA 2H8PB 3PQYA 3TPUB 1LK3H 3QJOA 1UOLA 5CLZA 5AD0B 1IAII 2MNJB 3SDXB 4CW1A 3VMNA 3MRHA 2DQHH 5DMJB 1GW0A 3HC0A 4GG6E 5DFWH 1BPLB 2AKRB 3B9VA 3CFBA 2JIXD 2FQFA 2ZOWA 3KR3H 2M1KA 3EH4B 2HUEA 4P9MH 3DPDA 2BS9A 5AW2B 4CC4C 5EIIA 3EAKA 4PJBB 2WOYA 4OCRL 1V7MH 2P7TB 3CN0A 1SOSA 4WJ5B 2DD8L 4X6CA 5KVDL 5I1HL 1MCRA 3FQTB 3BSZL 3TZVA 1AXSB 1I75A 3VB8A 4ILDA 1E5ZA 1PX3A 1G7IA 1DVFD 3GSUA 1YMMD 5DR5H 5I1JH 1E4XI 1H3GA 2CQVA 4PJGA 2P9RA 5J6GA 1NLDH 2V33A 3FQWA 2GB2A 3PP4H 4IOSD 4U05A 4AGQA 3LCYA 2XVKA 3HS8A 3Q0HA 5BS0D 5FKAA 3MGTB 4RIRB 4N2GA 4Y9EA 5A2BA 2EVFA 2R4RL 3LH2L 4N0CD 3KPTA 3MLZL 2DQJH 1YN7A 4F91B 3OKNB 1NJ9A 5GJSH 1EUUA 4C4KT 4YFDB 2WXLA 5TGBA 2AJUL 2IOMA 3VQ1C 1XGZA 4EIZC 2EUWA 2FT8A 4AGNA 4L4VA 1M6OB 2ITEA 3QZLA 2EDDA 4WLCA 2FIKB 1NEUA 2IGLA 5HD8D 5IHWA 4WGWB 1R3JA 1AIFB 1GKEA 5F0LB 1OT1A 1QWHA 2EDTA 1ZWIA 3PV7A 1VACA 3SN6N 1KC5L 4AV0A 3ARBB 5JZ7D 3CZFB 3QSKB 1XB6A 4Z7UB 1GHFL 1QRND 3H85A 2O6FA 3VWJA 4AL8C 2BSRB 3UJTH 1L9SA 4OKDA 4I88A 5IFAL 2FSEB 2VWEE 3ATAA 4HEPG 3VI4A 1MRCL 2DQFA 5AW6B 4F5CE 5CCHE 1JV2A 3MV7E 4HZLA 1HI6A 3IFPA 1E67A 1YSOA 2HLFC 1NGXB 4NPYA 3FU0A 2VLMD 1U8IB 5TK2A 1BP3B 1XZ0B 1A66A 1BLNB 3FFDB 5TDOA 1IIIA 1TTBA 2XT1B 4UIMA 1DCLA 3FN3A 4KVNH 1IVTA 1Z7JA 1CTOA 2V5RA 3B9AA 4QRQA 4L48A 3KGTA 2OMTB 5HHPA 1RLBA 1QVOB 2WO4A 1FORH 3DX8B 4BJLA 2XJLA 1FVDB 1Z2KA 1YEHH 3BGFB 4WI5A 2HKAA 5F7HA 1ZK9A 1T80A 2NY4B 4DOHE 2OL3H 3F6IA 3DXAE 3WTTA 3T0AA 3HVDA 3OKLA 4RNRB 2P24A 2X40A 5IB2A 3DMMA 3V9EA 4NENA 3QUXB 3WXWL 3WD5H 1IEBA 1PS3A 4XOEA 2LVEA 1NGPH 2Z91A 2P5WD 2J6EA 5DEFB 1COBA 2APFA 1KTDB 3WYRA 1WLHA 1JTPA 2X70B 3DGCR 3EJYC 5K9OB 2GJPA 2DQTH 3CX2A 1Q0YH 3EGDA 4KDVA 4KY1H 5DD0H 3GSNH 4M7KH 4ZUWA 3ZTJG 3VW3L 1IC7L 4Y9FA 1TQTA 3UROR 5EUOE 2GJ6D 2B59B 4KKBD 4P3WA 4DZBB 3WFEH 3O3BA 3KLAB 2EYRB 1QO3A 2A83B 4ERSL 3EYQD 5I9QC 1GA2A 1GR7A 5E03A 5DO2C 3MKGA 4DAGL 1CFNA 2R4SH 1S5IL 4BH7A 1I9RL 4WCYL 5F97E 1NAML 2YO3A 1D5BA 4U6HA 3TVMD 1H3XA 2CKBA 4FKKA 4LCWA 3HVNA 3SQBA 4WQOA 4ZSOB 4L0ZA 3V4UL 3NCBB 1OE1A 1OAQH 3VXRE 4JAMB 3ROOA 4EZLA 4XVSL 4OLUL 3HKFA 5FW6A 1BXAA 1MFUA 4HUXB 3L3HA 4XOAA 3BWZA 4LRNH 1ODAA 2ARJB 2PW2B 5F9JA 1JOIA 2GSGA 2KERA 4OCSL 1A4KB 5CIPB 4KO6A 3LZLA 5C0AE 2P42B 3QIWD 4KAQH 5FGBA 3ZL1A 1P5UA 2VLKE 1CLZL 5HVGB 3LRSB 3LAFA 1D6VL 5E6ZA 4AIZA 2DQCL 4L5FH 1KTKE 2W94A 3TCXA 1G7MB 4OGQC 3SQRA 3SKJL 1QHOA 2VZOA 2IWFA 1R0AL 4MZ2A 2UXGA 3VWKD 5I8OH 3V4LA 5EMYA 4L4JA 2XZAL 3RURA 3O41A 2UY7B 1VDGA 3BP5A 3RX8A 2DQUL 2ZOTA 4MMZB 4PRDA 2E7DA 3HNVL 4GUOA 2WLHA 2R7EA 2Y1VA 4XOCA 4P5KB 1UJTA 4XBGA 3RUGB 5F7NC 3FULA 3I9IA 2DJUA 3CC5A 3JTBA 4HWNA 4POZD 3WEXB 4Z5RA 4ZUTB 1S7QA 1LDSA 4G9FD 4N2CA 3H0TB 2HFFA 2F54D 5SX4I 1QRKA 3TO4A 1MCCA 1KJ3H 1Y6MR 3WFDH 1EEYB 1AE6L 4X7EC 4XO5A 1A21A 5IB5B 2KZBA 4AKOA 5JO5A 4X8JA 3U6RB 1XAUA 3CVHA 4W6XB 5KSBE 4L8CB 4IJ3B 1G4RA 4KROD 4TNWF 3MXWL 4OD2A 2O6DA 5I30L 3TBYA 4D7BA 4TSCH 1ZIBA 2CGRL 1AR2A 4ZO9A 4GMSL 3BAEL 5I15L 4O2EA 5A2KH 1FHGA 2F15A 2WXMA 3GI8L 3HZKA 1XH0A 2VRAA 2R59A 3W2DH 1A6TB 2G9KA 3NCFB 3QH3B 4M62H 4MWFB 3PPSA 2Q10A 3DSFL 1RZ7H 3MJ9L 4JHAL 4IMLA 1N6QH 1JZHA 3EH3B 3V0IA 1HU8A 4J3VA 4QRUB 1A6WH 3DOHA 4K07A 4PJGF 5EFIA 2CR6A 2V8MA 3O9WA 3IVKA 5JHLA 5J3HD 4RBPH 1RV6X 4PY7B 3PDDA 4PJ7E 2HRPH 1U3ZA 3DGGA 1WCQA 4RMBA 1PZUB 2NQDA 5D1XE 2YQ3A 4LXFA 1T66C 1QFPA 3SDXF 2UVEA 1PGRB 5D1ZD 4JPWH 4YXLH 5CBAA 2BSTB 5ES4B 2XVBA 2FLMA 2Y5TA 2CLZA 4LLVB 2K3HA 3Q3GA 3W39A 4KHTL 2CK0H 5DMIL 4KNUA 4MB1A 1WWCA 2DQMA 1RZKL 4BKLB 1FNHA 2UVFA 1T83A 1Q1JH 1TCMA 3LEXB 5IEKA 1DVTA 2FTAA 3RB5A 3E9TA 4WUKL 4KAQL 1NLBL 1JDAA 1UD5A 4F92B 3C08L 4DERA 3SE6A 3G6DH 3LKPB 4QXGL 3VI3F 3CBRA 4NLHA 3QRLA 3HE7A 4HGWA 4Q0XL 4BA0A 4RA3A 1CF8H 4TQHA 4X99A 4WO4D 3TV3L 2Q76A 2VM4A 3CHXA 2X87A 4XP5L 3RL2A 3A0OA 3SZKC 4B7IA 3Q44A 1YEGH 2AKRA 5F89A 2YGOA 1CL7H 4JUSA 5AUMB 3JYBA 1Z9SA 2H0JA 4AEEA 4UTBA 1NC4A 4EMZA 4QXTB 5DRZA 5HVWA 2NY0D 1RUQL 1SDAB 1A1OB 1AGDA 2FEJA 3I6KA 1OPGH 2P8LA 2FBJH 2QSTA 3TA4D 1SJHA 5I16A 4HJUA 4P4KC 5JW5A 5MEOA 4F7PA 4BFJA 2GUYA 4FFZA 5SWSE 4F58L 3DUHA 4MNQE 2XETA 2DQTL 1RZFH 4UT6L 3VGGA 1OHQA 3D0LB 3FL7A 4PB9H 1NL0L 3SDCB 1R3KA 5T1LD 1U6AL 2K70A 1V27A 1X9UA 1E0OB 3W56A 3MZGB 3BAWA 3UAFA 3X3FH 4JRLA 5F8QC 4YS4A 4FZEH 2PCYA 1CLYH 3WNNA 3AM8C 3M6DA 3DX6A 4JO4H 2XXMB 5BZXA 3NVQA 3W9DB 4ZS7L 4E41A 1HHIA 5KTEL 3DSNB 4O2FB 4G6KL 5D2LF 2VLJB 3C6LA 3IFLH 5IMKA 1WQVT 3VWJD 2ZOKA 5TGBB 4TLUA 5KBMA 3QXAA 2BZCA 3HZMA 4YDKL 4ZD3L 1W72A 5LWYH 3MOQA 3PGDB 3N04A 2ED8A 2R15A 1HXMB 5A3ID 2FIKA 1B4RA 2F7PA 4LPWA 3GHEL 4WF7A 4UZUA 4NP9A 3X14A 5GRVL 2D7NA 2JJTC 2WBXA 4MSWA 1SQMA 3GSQB 4P4KD 1FNLA 1U8HA 2NR6D 5D7LB 3HG1B 2IWEA 5HJGA 3VFRA 4HMCA 3TXAA 4GFXA 1QBLL 3VI4B 1XGQA 4DGWC 5JW4N 1FI8C 1LP9B 3UC0L 4S0HA 1JXKA 3IJHB 1JHTA 3D48R 1WG3A 5I6MA 5IHUH 5INCA 4N20A 3ZL4L 4GRMB 1U3JA 1ZE3H 4LK4A 3QEQE 4C4BA 5F3BA 3H4HA 5JHDA 1X5ZA 5KUKA 4PJCB 1PTZA 3NZSA 1P7BA 3U9PH 3RU8L 5I71B 5HHXL 4WNSA 3VNYA 35C8L 1T1ZA 2EKSA 4WW1A 5FOBA 4HOMA 3ARTA 5CILL 4NFDA 3FC8A 5FKPB 1BMGA 4HHWA 5F7FA 1JXDA 3B7RL 7PCYA 1DLHA 1SBSH 1FRGL 2Z31D 4XCEA 3QIWB 2AC0A 4JFUA 1N26A 5KYWB 4P0DA 4RIRA 3QFDA 4TUJA 4YHZH 3EKCA 3BEVB 1ZDSA 1KXVA 1PCSA 4NENB 4GH7B 4AMWA 4HAKA 4HUKB 3CGTA 5GRWA 3V4VH 5JMRA 1U3HD 5DJCA 1U8MB 4JO2L 15C8H 3VE0B 3TEWA 1HXYA 2BP8B 3VD7A 5I1DA 1X5GA 2IH1B 2DM7A 3BAIA 4NQDD 1K3ZA 3O9WD 4WNQA 2GTWA 4I2XB 4P46B 5E8DH 1E4XL 1JWMB 3FF8A 4PGZA 3VXME 1JNNL 1WWBX 2KI6A 1DE4B 3PWNB 5C09D 1DUYB 1QEWB 3K1DA 4YIQA 3G6JF 6CGTA 1I7RA 5K9QG 1MCNA 3VI4E 2CDFB 5FA3B 4OZGE 1UEMA 1RMFH 4L3CB 3RWHA 2E76C 4GMTH 1I8IA 1W8NA 1ET7A 2Z0BA 2WCSA 3MQIA 3CFCL 1NDMB 2PWEA 4CUCA 2WHVA 2ODIA 1URIA 4N90D 1T0MB 4FZ8L 3ZDXB 3KPMB 1JV2B 2WLJA 4ZX6A 1KIPB 1RUML 1PG7L 4JRXB 2BSCA 1MFBH 1N3NA 2XWZA 2XQYK 3L9RB 4NOBA 5D2LB 3OD3A 3MRCB 3NFSL 4YHPA 3QDJD 4IOIB 2NMSA 1OAYL 4ESKA 4RGOL 4C8XA 1Z9NA 2ZXCA 3CLWA 1ITCA 3ZE1E 1DUZB 5HI4D 2DWYA 1JZJA 5CAYB 3I02A 3V0DA 1QLEL 1EGJH 1XQ4A 4X9GA 4FHBD 4BFIB 1OVZA 2EDLA 3U7WL 5JQ6L 1EERB 3L6FA 1GGYA 2WLLA 4R0LA 2VM3A 2ADJB 3QI9D 1ASPA 3VH8A 4MNQB 2AXWA 2Z92B 2ZXEB 3GZOA 3TV3H 1RJLA 3KH3A 3MGOB 4A39A 4BCZA 3GM0A 1X4XA 4HG4J 2OX5B 2DDQH 4YR6A 1YEFL 1OTUC 1BIIB 5FGCB 3UO8B 5KANG 3RWEA 3GBNL 4FABL 5GXBB 2F7QA 3P4NB 4Q7DA 2BW4A 3S5LA 5KG9A 3O3EA 3DPBB 3QHZL 5AB0A 1OAKL 2EYRA 5F6IB 5AVUB 4C58B 4EI5A 5C0RH 1JZ5A 4OBRA 1YA5A 2YPKA 4XMPH 4BINA 3D69B 3LIZL 4FQXA 1M2VA 2BFVH 2Y7MA 3QORB 3NJVA 3M1BA 2DWEB 4N9GB 4MNHB 1DVFA 5MEPA 1QMUA 2VO8A 1CQYA 3D18B 2HTKD 2PMZA 2QSCL 4XC3H 4XVUC 4MCMA 1H15B 4XRCA 2FB4L 4ZUVA 4AEFA 2CKBB 4LSTL 3SQBB 3JWOH 3STZB 3HBZA 4H13C 2W88A 1F2QA 2P5WE 1IM9D 3IXTA 4LP4A 4HSCX 4XX1G 2AQSA 4H20H 5DC2A 3K5RA 4K5PA 2HFGL 3NCCB 3ZJAA 5K9JH 4PCSA 5AAMC 2G0LA 1UHVA 4U1MB 1SMDA 2OSYA 2VN6A 2WVVA 4NQCE 1QFWM 1ADQH 2VDOB 2XTSA 4PJ5D 4JGMA 4EXKA 1H6FA 4GKSA 5KZCB 4HV8B 3DX7A 4CSTA 3MJ9A 4RZCB 2JELH 3W2DL 1NICA 1KV3A 2BS71 3E6HA 1BZ7B 2DIJA 3A6BL 3BRDA 1KGWA 2VQTA 4DH2A 3OZLA 5C8JA 4RGND 2GTZA 3EXJA 3UYPA 3LZFH 2J55A 4NKMB 4H26B 5CD5C 3H53A 5HI4C 5A40E 5L2JA 5E2VL 2ZP0T 4AZ8B 2XWRA 3U7YL 4G6AD 3TJHD 3NP3A 3WSQH 3V9CA 2ODHA 2HSIA 2YAFA 3WEXA 4H8VA 1C7SA 5EU3B 1GTFA 3BLBA 1FJ1A 1KJMB 3DX2A 4K5OA 3SJVD 3WEAA 1XV8A 4JKKA 1KIRA 3D4GA 5B3JE 3IDJB 1LO2H 3P30L 5FLUA 1KZQA 1AGFA 3MV8A 3W11C 4RGNE 4W9IC 3ZDZB 4BSJA 4NM8H 3SE4C 5CXPA 1H9DA 4GXUM 3BQVA 3GIVB 4YDNA 2WB1A 1A6PA 1G0YR 2NXYB 2KKQA 3QUXD 3WGUB 3ZUNC 3WENA 4X6DA 1TVDA 4W9FC 4DK5A 1YUHB 1N18A 4R5VA 1D5IL 3O2WH 4HIIA 4Y4HC 5G4OA 4Z0XA 1AKJB 1MQKH 1L9QA 3BH8B 3WFHB 2B1HL 1OHZA 3V79C 1R5VB 1S7WA 2RR3A 3BISA 1FYTE 1NUNB 1SGKA 1QFWL 3EYSL 4B9ZA 2YKLH 4XAKD 2PTUA 4YHLH 5E2JA 5F6HI 3KWVA 5FHBL 2Z93B 12E8L 3CLEL 2X0WA 4LOUC 2ZP9A 2P8LB 4KKPA 4C56D 1Z5YD 3H7BB 3ARFD 4OCSH 5HDRA 4ABQA 4YBHA 3BHBB 3MU3A 2VDNB 4HA1A 1NCHA 4Q2ZA 2C8NA 2XXGA 4X7SL 3AGWA 1SDDA 4JQXC 4S2SA 3T4YA 4QRRA 5BVJB 3B2DC 5L8LB 3PUUA 3W37A 3VFUA 5L6YL 4NUJA 3BEWB 3SGJC 3BZ5A 4JHWH 3KPQB 4GKLA 1B4LA 1JFQL 1T2XA 4QWWD 4WWKA 2O5YH 1JS4A 3L5XH 2ESVA 4Y4KC 3OSVA 2VXTL 4I48A 4U1JA 4X7CC 5C0AB 3MRRA 1Q8MA 3EFDH 5AYUL 4Z78A 1MAKA 1VFOA 4X4XA 2PWGA 4NQED 3ESVF 2CIKB 4R8WH 4G7VL 2OULB 3NQIA 2QGEA 4AQ1B 2BY0A 4X6EB 1XF1A 2CDEA 5I1CH 4XNMB 3FU8A 3CFKB 4UAOC 4PGEA 3DDGA 4N2OA 2NR6C 4H44C 3I6GB 5KSVB 4PJXB 3MXVL 3EOAA 1I9JL 2VYRE 3GZQA 4ZMTA 4N2FA 3T0BA 3D2UB 1RJZA 1NGPL 1IQWH 1N19A 2FSDA 3GXMA 3IS0X 5HHMD 1JDDA 1BGXH 2FYYB 4HH9B 4ZOBA 1TLKA 2E6PA 4AWJC 2V5TA 4FI6A 1T7XA 3M07A 3IETB 3CDGA 3DRQB 5C07A 3LZOA 1JGUH 1EMTH 1ZVSA 4JY4B 3B5HA 3QCUL 4OGAD 5I6PA 2EH8L 4KGJA 2JKSA 4N9OB 1AP2A 2D4FA 4FXGB 1HS6A 4JFTA 4UV4L 1J5DA 1K72A 4KVNL 2D03H 1DANT 5C0DB 2F54E 5EF1A 4HBCL 4PTTA 4YK4C 1CE6B 1UXMA 3V10A 1M4KA 1RVFH 2IMMA 2UXVA 3BT2L 4WW2A 4EZMA 4Z76B 5BQ7B 1QSEE 1TVHA 1X5YA 4DVRH 3SDCA 1U8PA 1JHLH 4F2MA 1QUPA 3DXAB 1IM9A 3TJEL 3QP3A 4F33B 1F56A 5T5NG 2JJSC 1AGBA 1GZQA 1P5VB 3D6GA 4EN3A 2C3HA 1MNUH 3RFRA 4F2FA 5FO8B 1G6VK 1QPXA 1YMHB 3HS0B 3SY0B 4E42A 1CDCA 4F15B 2W9DL 2J3SA 3UTTA 4HS3A 1KB5H 4Y8DC 3ZHKA 4BD4A 4PGDA 5D7IA 4AQOA 1F86A 3PWLA 3UZVA 3QUKB 2R2EA 3IWVA 3QDMB 2FCBA 1FIGH 2CG9X 2VUKA 3O8XB 1J8SA 5ADOH 1M57B 2MKWA 4HWZA 1JPSL 4FQ2H 4J39A 1ID2A 1I4FA 3MV7B 4JANA 4X0NA 4J3OC 4TQIA 4JW3A 2W60A 4XMVA 3WV0A 2BOBB 3MJGX 5GJSL 1YY9D 2B4CH 3EZ8A 3RZWA 2BXYA 3GSQA 5JOFB 5GRUL 1WISA 3U9WA 4K4KA 3GPEA 1T0MA 5LGJB 3O0LA 4FXLA 1A25A 1CXFA 2UZYA 3CSBA 3GSRA 4LSSL 4PJAA 5F1OB 1XT5A 3F84A 4MRCA 4LHUA 5D5MF 3SKOB 4KGLA 5C0CA 1KV7A 5INCB 4X5RA 4YHOH 1U92B 3NJMA 4M1CC 3MRPA 4OFYA 1LILA 2FL5A 5DK2A 3VXUA 4XWOC 2IG2H 4Z7QB 1RQ5A 2FNWA 2G2RB 5EO1A 4KFZC 1DSWA 5CEZD 2Y6TE 1MNUL 3WNMA 2VGLM 2APBA 1DVYA 2YJLA 4MXWL 1UA6H 4X8XA 3IRCA 4RMTA 4U3CA 1MHCA 3AITA 4PJFE 3UTPD 3TJEH 1AZRA 2WKOA 1DEEA 1W0WA 1LK2A 2BO0A 3APFA 3P9MB 1JNJA 3FQWB 2ZOUA 1L3NA 3IF1A 3WNIA 1BFOA 1UTDA 4MKMA 1OGAE 2VMFA 5I17B 3G6JA 5H35B 4Q6YA 4FERA 3VG0H 4OZ4A 3BPNB 4KV5E 1BYPA 5KJRH 3ULVE 3B37A 1OCRB 4P2QD 3ULUD 1SLVA 1JCVA 1SHMA 1KN2H 3Q2LA 4GBXD 4PJBE 4RDBA 3WNKA 5DHDA 1CN4A 1EMTL 1AHWC 1DE4A 3PWNA 3PY9A 2BDNH 1IGML 2QJDA 3V0VB 1U8JB 2HVKB 3CFJB 1M6OA 4LOFA 1TTAA 2YN3A 5CP7A 1WUZA 2IAND 3LY6A 3OKDA 1MUJA 1DJWA 5BV7H 3A6CH 3VX1A 4QRTA 1NH6A 4BRJA 2JJTA 2WGXA 2VLKA 3F65A 5BXFB 1TSRA 4GG6B 1XIWA 3P0GB 4BSVA 3MLRL 3LIZA 4NO5A 1GSKA 2NY1D 3HBPA 3NABL 4JDVA 1KSRA 4KJQC 3HRPA 4FNLL 1S46A 1T4KA 5MERA 4POZC 5IEHA 2CRYA 3ULUE 2NNAA 1UWYA 2ZYIA 1KTCA 4OSUL 5KVFL 1PFOA 2PPEA 1ZEAL 2WC7A 4N2IA 1XZ0A 1LDPH 1U41A 2X4PA 1DQMH 3ELAT 5GS2D 1LXMA 4UIMB 2V2TB 3DUUA 4IKKA 2XWBA 4AW7A 3R19A 1CB4A 1AKJD 3HI1A 4QRQB 1KCSL 3G04B 5CSZA 2ADYA 4MDIB 1AXTH 3B3BA 1FYTB 4JHWL 4P3CL 4XN7A 4G11A 4AL8L 2MRYA 2PO6A 4W68A 3QPXH 4AYEC 6PCYA 1WHPA 4N6RB 3KBFA 5AOZA 4TNVF 4P5TD 2EUZA 4OJDH 4A2MA 5BO1H 1YUKB 2Y7NA 2WYTA 3DMMB 4YBQD 5TDNB 2IQ9H 5FCUH 3D25B 3ZT5A 2QR0A 2WP3O 2HAZA 3S96A 3L48A 3WIFA 1E4WL 2OXHA 2F2HA 4AIOA 4OLVH 1D5XA 1MVYA 3HRZB 2X4SB 4KKCD 4KU1A 2JIXA 3P9LB 3WLWC 1QHPA 4CMHB 1B3IA 5FOJA 2RHEA 2EVIA 3O3EB 3QG7H 2VDQL 3HTLX 3MSPA 1D5ZA 1NGZA 1KCUH 1NCBH 5JYLA 2X44D 3CSTA 2WP3T 4MAYB 3UIYA 3ARUA 4ZPVB 2QV4A 3ECBA 4YK4B 1RPUA 1M1XA 4ANVA 1LMKA 3FB8A 4FL4B 4FJZA 3WNLA 1IGFH 4R7XA 5CCKL 3RVWC 1F6LL 3HR6A 5JHDE 2YAPA 4HK0B 4APQA 3NFNB 3W38A 3JWDC 1S2EA 1BA9A 3W0WA 2PCFA 3QUMA 3CBKB 3VDAA 3U4EB 1NCDH 3AB0B 2JB6A 4ZPTB 1S9WA 3P77A 5EHFA 3BZFB 1A6VH 2YD4A 2YPLB 5D8JL 2NSXA 2VABB 3ME0B 3VJ6A 2Y06H 4Z7VF 2AERT 3GSXB 4U1MA 4CA4A 1FHNA 2EE6A 2WWMD 1H8NA 4GT7A 1EEQA 2ZONA 3L16A 1SM3L 4NQCB 2NTSP 4YAQB 4LLYA 1OB1A 4TULH 2F68X 3MBEB 5IR1B 1QBMH 4WHYG 5DD6B 2QVKA 1M71A 1E5AA 1PG7W 5HI3D 5IIEA 5JXEA 1HHKA 4JG1H 4FTVB 1XEUA 4G8GB 4TV3A 1HN1A 3BSGA 3FBQA 4M7LL 4TL5A 4Y5VC 2NY0C 2BCMA 3RDTD 3RWGB 1ZHNB 2ZF9A 3CFTA 5C8JB 2EIZA 2J72A 2K7PA 5I66B 2YS4A 1UWXK 4XB3A 5J13C 1KFAH 2Y07L 1AVAA 1U8CA 3GSOB 4ABUA 2IDQA 1C12B 1BXUA 4JFQA 2CSPA 4U1JB 2X4UB 3D5OF 2YEZB 4FQHB 3DX9B 2Q6WB 3S2AA 3WDHA 2A9CA 1CFSA 2CBPA 2X0VA 1O5DT 3TASA 3UPCA 1R75A 5FGCE 2Y4SA 4OZHB 3MBXH 4KOCA 5AVXB 2VW6A 4R83A 3GEFA 4PG9A 1OCZB 2XX1A 1J8KA 4OJCA 1FWXA 2V0AA 3PHQB 2NY3C 1S7XB 3H42H 5DA4A 1KGIA 3G5VA 3GXNA 1E6OH 2BNRB 3N3EA 4I9WE 4JCWA 3VXTB 4YFLF 4NUGL 3AG1B 3DO4A 5DTFA 5I74C 3RFZA 4I1PA 5GGVL 3OG4B 5ID0B 8FABB 1LEIA 5F88A 4IRSB 1I8MB 4LLMB 1KNOA 3O3AB 4P9HH 1AR1B 3Q2VA 4X6CB 4U7SA 4N0YH 2K8MA 4J8RB 4TSBH 2X1XR 3QDGE 2JXMA 5A6LA 3N50A 2O61B 5IB1A 3KPLA 2JI1A 2A1WL 3PP3H 4MD4B 5SWZA 4AYFB 1WJ3A 5C0GA 5AVWB 1SDDB 5BVJA 5DMKA 4X5XB 5ICZA 4JFEA 1AD9A 1JVLA 2KHAA 4JPKH 3RZCB 1JYNA 1G6RH 4LIQE 3VRLE 5JORA 4HF5H 4LL9A 3R4DA 2V5YA 5BV7L 1QLEH 2AK4D 5DJYB 1V8HA 1DBBL 4ZTOH 1KGCD 1KBGL 1JRHH 4TKWA 3U46B 1XH1A 2CNYA 2P80A 2NSMA 3BFOA 5HYQB 5L2KA 1MI5B 5F7EL 3TWCH 4HU2A 5K9QI 3IMRA 3OKNA 1QASA 3SBQA 3N1QC 4RGOH 4A67A 2FT6A 2YPVH 5C0JB 5ISZE 5TTRA 1DBKH 3Q43A 5HGDB 1HDMB 4V2CB 5T3ZL 4FADA 4KK8D 4M5TA 2R1WA 3MV01 1BMZA 3KLDA 4H8PA 2H9GA 5ELIA 3HFMH 2EYTB 1MH5B 3MV9E 5LXGL 3D12B 3RL1B 2R83A 2W80C 4I3GA 3SDDA 1D3CA 1AMYA 4WHYH 3S98A 3RWJB 3H9YA 4JZNB 2VAAA 5E4EB 5E9DD 4ODWA 4X5WA 4F37F 5DD5H 2X3AA 2Q76B 2XPGA 1F5WA 4HH9A 2BNQD 1ADQA 2G5RA 5DZVA 4P2OC 5DQJB 4G83A 4M7ZC 1NKRA 3F7RA 3WTWA 4IEFA 2GK2A 4RFOH 1T04A 3BP6A 3PYCA 4ENZA 3A4EA 5CJBA 1FAIH 1ZJAA 4JLRA 4PJBA 2Y1AA 4UILL 3U0PA 3Q6FB 5DI8A 5F96H 3V2AR 1QHQA 2F5BH 4JHVA 3WTSA 3DETC 1AP2B 1ZLUH 1CFVL 4PJ9C 1IU1A 2Y69B 2GSMB 2RFXB 3U9UB 5KSBA 1UXWA 2CIIB 2EIMB 4EUPB 3IDIB 3MROA 3WKPA 2CHZA 2HFTA 5M7QA 1CS6A 3QEQB 5J1SC 2ZX7A 2O5XL 3M1CA 3NFPA 2BOCB 2D7OA 3Q8CA 2W0LA 4JDTH 4N8CH 2Y2WA 3U2SB 4L9LA 1IC4L 3RBGA 3W0WD 1QR1B 2FECI 1LP9E 7CGTA 4UQ2A 1IM9B 3SPIA 5JIDA 2C1PB 3QQ3A 4ETQA 3FOLB 5GISH 3NEXA 1L0YA 3V8CA 3PV6A 1IGJA 2VDPH 3ALWA 1QTYT 4JM2F 4AVIA 4BFBD 5H35A 2H2SC 3AAZA 3P1VA 5JPNC 3QXUA 5EO9B 2VWEC 1PKQB 5C0BA 2D7TL 1XCWA 4UM8B 3EYQC 3QDJE 4YVUA 1I7UA 2ZOKB 1V3JA 4PP1C 2M83A 2MHAA 1OEZW 3D50A 3FO9A 2VLJE 1OY3B 4P23A 1HEZA 2ZCHL 5F70A 5BPPA 2H3NA 1FLRH 2QQNH 4NWUL 5JOFA 4KVPA 5ISZA 1Q0XH 4D9LH 1M7DA 1NCGA 2J20A 3RILA 1Q9WB 1EAPA 1NBVH 5EZPA 2ED6A 4I0PD 4JFFD 3V6BR 2IPTH 4Y4HB 1X5KA 4MSWB 4BFGA 4E41E 3BT2H 3TT3H 2IFFL 5IB4A 4ZG1A 2IV9A 5JPNA 3OLIA 1QLRA 2A4CA 2JCCE 4KJWD 3FQRA 1EZVX 3IN0A 3VH8G 4ANWA 1JZIA 1T0NA 4QXUH 1RZGB 1XX9C 3D52A 3KJ6L 3CZNA 2WVTA 4PGBA 5JQIB 5CEYA 3GNML 4DQOH 2WQVA 4HXBH 1BXVA 1SJMA 5J1TC 2NW3B 1TNNA 2OMTA 1WC7B 4FYTA 5K33A 2UXTA 3OZKA 4JO4L 4YPJA 4YGVB 2J6WA 3BYYA 1CLYL 4JPSA 5ANHA 5F0MB 5JDSB 1I3RA 4BRVA 3TIDA 1MLCB 2FQEA 3GSNA 4PJHE 2PR4L 4XOBA 1JMZA 5EN3A 5EUOA 3CD4A 3NRQA 5I26A 2PO6B 4ZX3A 3ULUL 2FJSA 2OP4H 4PLNC 4UT6H 5DHYB 1ZLSH 3S4SA 2EO7A 2XN2A 3EJZD 1L7TH 1K6QL 3PGCB 5F7YC 4Z95L 4ZTPH 2A2QT 2WKLA 4CSZA 2Y0SA 2B1AL 1U8MA 4X98A 4XMLH 3Q06A 3JTTB 2DKSA 3C2SA 2Q7NA 4IRZH 3REWA 4A68A 4BFOA 1BVOA 2W65B 2WBWB 4XBGB 2HJFB 5JNYA 1CICB 3TZVB 3PHAA 3L81A 3QNZA 4L9DA 5A16B 4B97A 2VXTH 3RIKA 3ZK0A 3IFNH 1MW2A 1JFQH 2BSSA 1RZJH 4RQQB 1XDTT 1S3RA 2H2PD 4GG6A 2Q3AA 3FQYA 1R3IL 2QQQA 2NNRA 1OAZL 3FB8B 4ZOEA 5DHMC 1TQCB 5IB5A 1INEL 3EDJA 5TDPA 1MWAA 1C8PA 1U91B 2XFXA 2X4TB 3QIUC 5CJXC 2OK0H 4FS0A 4M9OA 1HH6A 5HPMB 1Q72L 4OV6F 4RMVA 1KEMH 4QRSB 3IMTA 1MIEH 1AS8A 4HUXA 1WICA 2VLKD 4FQIH 2PW2A 5IT2L 3LNDA 4CC0A 1SHWA 3QG6B 3F83A 2PP8A 3C09B 3HE6B 1QFWH 2ZICA 1U8NA 2AI0H 5DMIH 1ZGLA 2X5PA 4S10A 2FD6L 4G59C 1FNGB 5TFSL 3U7AA 1C5CL 1CBJA 4K7FA 1H3VA 4DW2H 3W3BA 4NQXA 4NRXA 5GGTL 5JDJA 2BERA 4FDWA 3FRPB 3D39A 4QRPA 3MOAL 4M5YL 1IJNA 3FQUA 4ZAKB 4U6TA 1UA3A 4ODUB 1BVLA 1VFAB 5IHHA 1HL9A 4UDTB 3ESNA 4AI7A 3O4LE 1RK1A 1UD8A 2H1XA 3WIHL 4DP7X 3MRKA 4RA0C 4ZT1A 1JE6A 2ROYA 3S96B 2FX9H 2P5PA 3UJJL 5I1EH 3N41B 4NXSA 2ICEB 2NNCA 3INUL 4E36A 1D5XB 3HRZA 3DVNA 3FCSB 3FAXA 4YC2C 5HDWA 3RPKA 4YDIL 1BLNA 3FFDA 1AY1L 1KIUA 1OQOA 1FFNB 1KLGB 3EJYD 4LDOB 4OH2A 4Z5RB 1D5ZB 3RIFK 4FYRA 2QFPA 3NT0A 2WSPA 1QVOA 5D2NC 3KW7A 5T1KA 1NGWA 2YGPA 5DD3L 5E56A 1XBDA 1X5MA 4H1LG 2YAMA 3CUPB 3KXFA 4X5LA 3T2LA 4JKPL 2XZZA 2DYPB 2F5AH 3MUJA 5F72S 3NTCL 3TLRA 3VFWA 3QJSB 4GFTB 4QTFA 5J12C 2DS4A 4OD2B 2BZ7A 2A6IA 3SDAA 4OM0L 1L5GB 5AENA 3MNVA 3IE4A 4R7DA 5FO7B 1CGYA 1VFBB 1AD0B 3ML9A 3GRWH 4NO2B 1NDGB 4HD5A 4QHMB 2JFCA 2D31B 1HT6A 3Q8BA 4J1UB 1N12A 3FBKA 4RAVA 3P3YA 3LRHA 4NZDA 5SX5H 4OCYL 4BFNA 4S1QL 4FCAA 5F7LB 3TJPA 1Z1WA 2OQJB 2XTJE 4HZ1A 4LCYB 2WMPA 1HKFA 3CSYB 4XNUL 4AMKH 4E9TA 3HI6H 3RWFA 4Q4EA 4TVPD 3CDZB 3K2UH 2BIMA 3MLVL 3WL9B 3FQNA 4RZCA 3TF7C 5DJAB 4AT6A 2H5UA 3A6OA 5CJOH 1EH9A 2UYLA 1P6WA 4WRLA 3LIZH 5D1QD 2VRKA 3VXRA 1ADWA 1NINA 4NKOA 5AWNH 5PAZA 1BFVL 1KACB 5JW4R 2EJ1A 4L0PB 5C0RL 1HINH 5IW6B 2A6JA 4B96A 1RSYA 2CGYA 3C12A 4A7GF 2P5EE 4H26A 1KGJA 4GXFA 3DX6B 3LRMA 4PY8I 3IDXH 2HKFH 3O6KL 5TH2A 3B5TA 3I6LE 5C71A 1Q72H 4P4RB 3CFUA 1X5JA 4L18A 5KYYB 4A2DA 2DDQL 5JW4M 1EAOA 3HFFA 4KK5C 4K9JA 2A38A 1PNCA 2G9HB 4JJHA 1JF1B 2YHGA 3F12B 4FFWC 5GGSB 3B9KB 4LARH 2D4DA 4M29A 4F7EA 5ETUA 4WFGD 3ZHNA 1XR9A 1INDH 2NNFA 2X9WA 4MJ5A 5AW9B 4MHHI 4ZQKB 5SWSA 5TE7L 4HZAA 4W70A 3WXVH 3GBMH 1RIHL 2VDLH 3QDMD 3IGKA 1MLBA 1B90A 5BV7C 3Q5YA 1P84K 4ZUUA 4MMYB 4CMMA 2AJYL 1ZPLA 1IBYA 3U1SL 3VFNB 4XBMA 2D3JA 3OKOB 3QR2A 5EO0B 2IBZY 4AYID 3GSNL 4M7KL 1OAYH 1C5BL 3NH7H 2ZXBA 5JXAH 1ZLSL 3ULUH 3RGVD 2FATL 5KSAD 1NFDB 1BF2A 5D7JC 1EEZA 3MAWA 4LSQL 4JR9H 4J7RA 1MXDA 3QEQA 3CN3A 4PJ8D 2CXGA 5E1GA 3BN9C 3O4LB 4QRFA 1P1ZB 3DVGB 4Y5VA 5GRZA 4ZI8A 4FEIA 5AKVA 1PBYA 1HHHA 4QRRB 3VFVB 4P2RB 1CCZA 2VXSL 5EOQL 1LHZA 4RVBA 2WK2A 1T1YB 1MCOL 2ADFL 4NPKA 4Q9RL 3VYOA 3OJ2C 4XBPA 5BZDB 4KTDH 5C0AA 1SZNA 1JMXA 4QHKJ 3OAUL 1SEQL 6TAAA 4E2OA 4YZWA 15C8L 3DTXB 3QI9A 3FQ4A 1A8ZA 3OHXB 2RTTA 1L0QA 3C6SA 1BSIA 4YDVA 3EF4A 4F7MB 3CFEB 2X88A 1PQZB 3O6FD 4D0BB 5ISZB 5D7LA 2C3WA 1FVEA 4WSJA 4PFEA 1ET5A 3O2DL 3FAWA 2R69L 5GS0L 5B1JA 5GHWH 1GCYA 3HC0B 1EEUA 1YHPA 3QGVA 4PB0L 5JW4Q 1S4IA 3FTZA 4UUJA 5E8NA 4IEFB 4IDJL 2CK2A 1SJVA 3NIFB 3EJCA 2BVTA 4ORGA 2CLRA 1YEIL 2QL1A 2HT2C 3U2IA 4FAAB 1OAJA 4JLRB 4KRPD 4OGXH 3U0PB 1J9RA 1GAFH 3ZDZF 1U9KA 2WW8A 3WTUA 4GRMA 1RZGA 2NCEA 4F37K 4H88L 4AQEA 1D9KD 1U4FA 1O9WA 4N86A 5GHWL 3T3PE 3QRFM 5T5FH 3WDJA 3DURB 5BRZD 3GMMB 2RH0A 3HC3H 4NWTL 3TBSA 3HLKA 4MS8D 4LF3A 3T8VA 5JDSA 1IC4H 2YKKA 3GS4A 4G3YH 5DGRA 1BZ9A 2QPFA 3NAAL 1QR1A 4WU7B 3IKKA 3H9HB 3NCWA 1J8HE 2A73B 3KPRB 2KS0A 2X1PA 2GAZA 3M8OL 4OQ1A 2I5YH 4DF9A 5I75B 1OSYA 5IWLC 3L6FB 4XCCH 4ZFZB 4LDEB 1B2YA 3RTQB 1EX0A 1GGIH 2I60L 4Q9QH 3BQUB 1MCDA 4Y7MA 4DKFL 1IE5A 4XPTH 4LVHB 5MENA 4M7LT 4GRLC 4XXWC 2HLAA 2WZ5A 3W81A 1AGDB 1HCYA 2R8SL 5DK3A 2W0KA 4AM0B 4B9CA 4MA3B 4NZUH 4YNYA 4NC0B 3DJ9A 1OW0A 3IDNA 4FKHA 4JREC 3OAYK 3WU1A 3ARGB 3FCTB 4P9ML 1HEZB 3V7MA 1BHGA 1YYLH 4PJDA 4OY9A 2ZCKL 4MA1C 1G9NC 2D2OA 1XZWA 5AQ0A 5L88L 2V7NA 2PTTA 3QDAA 3SGDI 2XICA 3D0LA 1A6UL 1U6AH 1NDMA 3ZO9A 4NJAL 3B9KC 3MO1B 3QK0A 3KPMA 5E00B 5IK3B 1MZYA 2AK4B 2IMNA 3CVHL 4OJAA 1HESA 4GJTB 3L3OB 2J8UE 2AF2A 4GRLA 3ESOA 4HJ1A 1A2YB 1IAOB 1BD2D 1YCSA 3ARED 4G6JH 1HFUA 3JBG7 3W9DA 1E4HA 2HJKA 5FGBC 4U1IB 5C0CB 5EG6C 4YHYB 1JD7A 2VLJA 5IMKB 1DUZA 2R0ZH 4LE8A 4WFHD 5TE4L 5KSBB 3CZUB 3HZMB 4MQ7A 4EDWH 1G7PB 1P7QB 2DF3A 3OVUB 4G6ML 1DSFL 3VD0A 1KCWA 3N44F 5L88H 3F5WA 3FN0H 4LSPL 4XPBH 2ATAA 3BGAA 5D7JD 3TA3C 4CNIA 2YZ1A 4LARL 4L29B 2W81C 5GGTA 2QDVA 3UAEA 3V8OA 5IWLA 4TSBL 1CF8L 2IADB 3QZOA 1AGCB 4G5ZL 4KY2A 4JFDE 4BWTA 4TQEL 3EUDA 2GIYA 3PABA 1XH3A 4K5LA 2R9HC 2WO2B 2ILLA 3DRTB 3KPSB 4WFFE 1H8OA 2X4NB 3C08H 3SBWA 3IU4H 1UD3A 2VJ0A 3NIGF 2R2CA 3ZHFA 4YR6B 2XPZA 1SYVA 5D1ZI 3HN5A 3U4AA 5ICYA 2ARWA 4FQLH 1GS6X 2DAVA 5DMYA 3TBCA 4FMFA 2HRLA 2J1ZA 4WW1B 4PJFA 2FO8A 3GF8A 1IVLA 2WQ8A 3MBXL 4N87A 3QORA 3FRPG 1CFBA 4JZJB 4XMZA 1A1NB 1XIWB 3T2NL 2A4ZA 5HGBA 1N68A 3JQOB 3MV9B 1QA9A 1BVKB 2WNKA 3SPHA 5MEQB 1HKLH 1I7ZA 3KBPA 3C6EA 4IBSA 2VIRB 4F8NA 3HRZC 1KYUA 1IBGL 3T04D 1YEIH 2FX7L 3T3PF 2M26A 4LLUB 2IO5A 4WTZA 1W6LA 3KL5A 4JO3H 2ATPA 5IHZA 3VFPB 4Z7WB 4F7TB 4GIOA 1J9SA 1NCAH 1UB5A 4OM0H 4NKIL 5LNEA 4QLWA 1CO1A 5F7MC 1ZT4A 2OMZA 43C9A 2P8MA 4RWHA 2RALA 4OV5B 3LIUA 4FA7B 2IXQB 5FYLL 4OU3A 4XR8C 2XY2A 2YMXH 1A6AB 4YE4H 4P2QE 4TULL 5B21A 3V4PH 3MA7A 4H25B 3TBWB 3RGVB 1AE6H 3PL6D 1K2DB 3QCTH 2Q8AL 1KJ3L 3LN5B 3OAUH 3T2OA 1J88A 1TVBA 2HT4C 4WI0A 2OYLA 3WDIA 3IMVA 3T1FA 2AJSL 3L9RA 5HDBB 1TZ8A 3QAQA 1X5LA 1BF5A 3TBVB 1KYAA 4KKLD 2X4SA 3VRIB 4YH6A 3RDTC 3MFFA 5J7CC 3T6QC 4QF1B 4QTHB 3O2DA 4LLWA 4W9CC 4FNSA 4AITA 1GPOH 4HG4K 4U1LB 2BSDA 2V37A 3SY6A 1JF1A 2NY7L 3ABLB 3K6SB 2JMRA 2KDYA 2UY6B 4N1EA 3QHTC 4XNBA 5A1AA 3AG2B 4GI9A 3NJLA 5J56B 3MV8B 4DW2L 3X3GH 4KKRA 1ZE3C 3RX9A 4XPHL 5JO5B 4FFWD 4WUUD 2ZUTA 1VCAA 3NH7L 4K94H 1A7PH 1FFPB 1QPPA 3VXMD 4WIQA 2Z65C 3TBYB 1T2JA 2YMTA 3GS7A 5CEZE 3BUPA 4XCNA 5CHNA 4AC4A 4OZHE 3LS5H 3HG4A 2EIBA 2P1YA 2XKUA 4ZUUB 1M05B 4NC2B 3LXUX 1MFEL 1OD7A 2X09A 3DRQA 2IFGA 4R2GD 4XE0A 2PP9A 5F0JB 5C07B 3U0TB 4Z6AT 4XVTL 2EDOA 2L8AA 3U30C 1M53A 4GKZB 5DSCB 4ECNA 1L9PA 3WJJA 4NS0A 1SXBA 3FT4B 1FGNH 3EBHA 3JV4B 2PO6C 2F53B 4N0UE 3NP4A 3FTSA 2E8YA 4S2SB 1I82A 4RGMB 3C8KA 4UV7H 3EIFA 3UBXI 5B3NA 3X1GA 3THMH 1DVFB 1SFDA 2YD0A 4UBDD 1U8PB 4F2MB 5KS9B 4NKOB 1JXJA 4FTVE 1NOFA 3D9AH 1R33A 4Y5XC 2FO4A 1MNNA 1J8RA 1IBHA 1T1YA 3HHMA 3MRRB 2X28A 4Z78B 4GP4B 3NJNA 1HINL 2ESVE 4AOFA 3D0AA 1T22B 1E5YA 1PPIA 3OL2A 5HJ3A 3HEIB 1A7PL 3OSKA 5DD0L 2XX0A 5IBLD 2MPVA 2WZPD 4PJBF 2N3JA 5IEKB 3MOBL 1CG9A 2YC1B 2OP4L 2MIZA 4FQQB 2LT9A 2YPLE 2VDKH 2WXRA 3X3GL 2K1MA 4BK5C 4H8QA 3JSSA 5ETUB 1XR9B 1EPFA 3A6CL 3ES6B 3QIBA 4Q6IA 4S1SL 3D3VE 4UT9H 5I2IA 1J1PL 1Y6KR 3MCKA 1DBJL 3QDME 3P73A 2AANA 1IGMH 3QWOB 4GY4A 2PLTA 1QP1A 2CO6B 1NBYA 1YEDA 2QSVA 4M7JL 1AQDA 5KW9L 1J5CA 1RZJC 4OCYH 5C0AD 3I50L 4M3HA 4MMYA 2NUPA 1WWWX 4QXVA 4CMMB 2O72A 4AGOA 2ZQKA 4L4TE 1IARB 4HKJB 2V7HA 2ESVD 3AZUA 1KPVB 4KK9D 5DEGB 4AZ8A 1G6RB 2L04A 3ZW3A 1FSKC 2CCLA 4OT1H 2FGZA 4GSXA 5ID0A 4AK1A 3DA0A 4X4ZA 4OCNC 4MD5A 3DJRA 3TN0B 2VSDA 1OOWA 2OZNA 1QSEB 3WY1A 2ZP8A 3CH1B 3NBNA 4JZOA 4JDEB 1P69B 2EZ0D 5K39A 4XB7A 2OJZL 5H37G 4PTTB 2F7IA 1R46A 3ZMRA 1FAKT 2DQGL 5AB9A 3A24A 3GTTA 1XTMA 2Z8VC 4YXHL 4W9ZA 1IX2A 4M1GL 4PMFA 3NACL 3IMBA 1YEWA 5B1JC 3AQYA 1JPTH 1JGEB 2CHXA 5HDQL 2IG2L 7TAAA 1HZKA 2ZCLL 5I19H 4JFHD 4KPHH 5DRNA 2DTSA 4HHAB 1FCGA 32C2A 4Z0XB 5IJCC 3PP3K 1ORSA 5GJTL 3IMWA 1OLZA 3QWQB 2G2PA 2JKRM 1MRDH 4PGDB 3VA6A 3RNQA 5LKNA 2PO6D 4WENB 1MZZA 1BM3L 3BCFA 4YPGA 4ZFQA 3T2NH 1CGVA 2APTA 1TZIB 1TTCA 3RLSA 3TFKD 4O00A 2X05A 2C3GA 4AE1A 1JIBA 1U8JA 3F05A 3MBED 3KLSA 2N0KA 3H9SD 3DBXB 1UGKA 2DJ4A 1NBZA 4KKBC 5ITFB 3Q6GH 2NY3B 2MJWA 3KCPA 4PRHE 2NY4C 2J8UA 4BSWA 1HWWA 4OFPA 1U8HB 3WE1A 1GOHA 4NDMA 4UOW1 2ZUWA 1QSFB 1G9MC 3ENEA 1SMOA 2UZPA 1TO5A 4QCIA 1I3UA 4GRLB 1FAIL 2H32H 4UILH 4BQCA 4NKDB 1MIEL 1BDYA 1N6VA 5EORH 2VNCA 4C55A 1PYWB 1T7YA 4YXKL 4UZGA 1H8LA 5EC2B 5GSRA 3V6OA 1NAKH 2KLTA 5DDHA 3T4AC 2J2ZB 1UZ8B 4P23D 5I75C 3R06B 4UZSA 3D85B 4JPQA 1R3IH 3S6CA 1N2RA 5J1AB 4EUPA 1CL7I 5CP3H 2IOIA 3EXLA 1IIKA 2W91A 3AC0A 4UQ3B 3I6GA 5KSVA 4H8WC 5CZKA 3VFSB 2VXQL 4PBDA 5CLYA 3O6FA 1SF3A 1DSFH 2Y7SA 3NEEA 5LDSA 3ARBC 1UACH 1PZBA 2HT4D 3EGSA 3JTSA 3SO3B 5DZLA 1DLHB 1LK3L 5TE4H 5GZNC 4XP1L 5HGAA 4UWQB 1FNFA 3PL6C 3UBXG 5F9OH 3PABB 5MENB 3V7AE 3HMWL 1ZVSB 1JGVL 4B60A 1JNLH 2X6AA 1HXYB 5ANMB 4HWEH 2KMWA 2IH1A 4G6AC 4OUOA 3V6FA 3UO1H 3QUYB 5E7FA 2ZSVA 2XKNB 6PAZA 4S0TD 3MGAA 2PR4H 1XCQB 4PGCA 5HHNB 1OSZB 1A6UH 4JKMA 4BCXA 3LYRA 1WPCA 2Y1YA 3PDOA 3ZE2B 2B0SL 5I1AB 4U6VL 2ID5A 4PJHA 1NMAL 1YYLL 5AW8B 4EIGB 1A02N 1M7DB 4P2RD 4F7CA 4DK6A 1LNUB 3QEQD 3QZNA 2DQIL 2AQTA 2BK8A 4Z7WF 1ZTXH 1FZKB 2VMJA 3FO1A 1T4KB 3QJUB 3KYKL 3BDXA 5F9AC 3ARDA 3BD5A 3ASWA 1NIDA 1OP4A 3ESPA 3LD8C 4MNQD 3CXHK 1PJ9A 1YN7B 3P11H 4HJIA 1B0GB 1V7NH 4ZFOB 3C5ZC 5IMOA 3U6XA 3WE6A 3IGUA 1GGIL 4NUGH 2OMNA 4GW5B 1VGKA 2O5ZH 4WFED 3T4AB 4TOYL 4PVBA 3QXWA 3VXSB 2H32A 2DYSB 4DVBA 3FB5A 4JHBA 1WEJH 1WZAA 2FJHA 4D9LL 2XZCL 1AIFA 1IFHL 4L8SB 1FLRL 1GIGL 2QQNL 1Q38A 1I3RB 3ARGC 4ZK8A 4G8AC 3KBEA 4P04A 5IIEB 5M95B 3ARBA 3P0VL 3R1GH 4HXAL 2YQGA 4HISA 5KSBF 3FU5A 4A2FA 1K5WA 1K8DA 1S78D 3QUZB 3VFMA 3AXLA 3NJJA 3TBWA 3UFIA 1TSHA 5FHBH 4XPFL 1D2OA 4LVHC 4CILA 2CXKA 1A7OL 3NN8A 5AZ2L 5EU6A 3TO2A 4MMXB 4QPEA 3ARQA 3WIFB 4G6FB 3T1FB 2H2PC 2EDBA 5D7JA 3ZYOA 1XFPA 1D5IH 3E6FB 2ZUYA 1NQBA 4OKVB 3ARFA 1E8XA 2IPUK 4D0CA 3QDGD 3MACL 1IGTB 1ASOA 5C6TH 4PRPD 1OD9A 2EDXA 2GEEA 1E8ZA 4U6YA 1E9QB 3ZKXC 4KUZL 1E9PB 2WXGA 3WTVA 4J2QA 1DJGA 3BKYH 5INDB 4IBZA 5EF0A 3QI9C 3X11A 2OXGB 2B08A 5CGMA 5EIVA 2OMYB 1KUMA 4H8UA 1WBZB 3L4ZA 3M1BB 3PQYD 2AQ3A 5HJBA 1RL1A 4PJXE 5J12B 4YHMH 2F5BL 3OJVC 4KTDL 4ZPTA 3STZA 3P77B 3BPCB 1A6VL 2KZ1B 4LCCA 3BDYL 4LAQL 5D8JH 3HJ0A 3Q13A 3LJ3A 4OUUB 3S34H 5D7LD 1NCDL 2C9QA 3QUXC 3T0EE 2A9ML 1PZCA 1X44A 5DYOA 4GKZA 2IH9A 2J8HA 2ICCA 3RWCB 5CCKH 1E6JL 1TTGA 3L4YA 2CO7A 1XF4B 3OKDB 3FO0H 1LE5A 5EZIH 2YD5A 1NUGA 4R3SA 1S7VA 4OM1L 4LSQH 5CKAA 1FPTL 4AQ8A 4PVLA 2CO4A 1FQ9C 4X5XA 1ED3A 3CZKA 4HAGA 3ZE1B 3BQUC 1F58L 1MFAH 2YPVL 3I9PA 1C5BH 1TNMA 4OCXL 4WI0B 4DKEH 4TUKH 2B77A 4IU3A 5C08D 3CWGA 2KC0A 3H2QA 4U7MA 3UZQA 3EO1B 3UP6A 3VFGL 3T2QA 1TCRB 1JAEA 2X4UA 5C0CD 4XNZB 6FABL 4L8DA 4EAEA 3S88L 3DECA 5J8OA 4PREB 5E2WH 5JMOC 4LSTH 4LBEA 4N22A 4K15A 3I9GL 3O6ML 4RSVA 4JPKL 3IXAA 1IAKA 1BBDH 3KPRD 3U36B 5IFHL 1T03L 2YD8A 3A4FA 4HMDA 4Y9BA 4OLWL 2PCPB 1KJMA 3QQDA 3FONB 3K6DA 3CUPA 3KXFB 3QR1A 2H9GB 4AJYV 3GS0A 4WO4B 3KLHD 3LH8A 1XTLA 1KBWA 2QELA 4PJGE 3PU7A 3ZDZE 1KPRB 1XGPA 3WUWA 1BQ5A 4P9HL 2BS8A 4LKCA 4UNIA 3O6KH 1JD9A 1MFCL 1OT2A 2EKJA 3BXNA 5IUSA 3IDXL 3VX0A 3S3PA 2WLKA 4P8QA 3EDKA 1T6VN 3HNTL 4AX3A 4DTGL 4OQTL 1LEIB 2XFGB 3MRMA 4P5TC 3N5AA 5AWNL 1QW9A 1ZAGA 3ESUF 4NHUA 3IGFA 2VRQA 3PIQA 1ZHBB 3EDFA 3CV5A 4I1NB 5IVXA 4N2HA 3I84A 4KMLB 1DN2A 5BOPA 3U7WH 1U8QA 4UANA 5JQ6H 4JQIA 3WGVB 3E2HB 3ZYJA 1EJ8A 5C0GB 1AOZA 3CSYA 3H8NA 3LH9A 4XZUA 5DEJA 2J1YA 1A4CA 5E08H 2QFRA 1DBMH 4KUCF 2G3MA 3MUGA 1RUKL 4L8CA 1N4XH 4Y2DD 1PLGL 3DO7A 3FUDA 4MJJA 1UQSB 1MCWW 3S36L 5DJDB 1R24A 4LLQB 4R4NC 1THAA 1J1OH 2JQMA 1KTJA 3PRZA 3L95A 4F5CA 1CDIA 4RZKA 1UT2A 1KELL 4ODHL 1VZGA 3BN9D 5EULV 1SNRA 2NY1C 4I77H 3WFBL 1ZSDB 3IB4A 2YK1H 3JXAA 4KH9A 5I76A 4OD3H 5EO9A 5ILTH 4JL1A 1MEXH 2DLGA 4CVXB 2EC9T 2KZKA 5IG7A 3DV6A 3IGAB 5AYTA 4H8HA 3HCVA 4NQDB 1J87A 2NQCA 1M71B 3GIZH 4JG1L 4NN5C 4HETA 5ESVA 3CMOH 4B0MM 4ZYKA 4Y2DA 4PRIB 2OZ4A 5EZLB 3ZE1F 1R3HB 3HZ3A 3CPUA 4JM4H 2APWA 4YSAA 3HG1D 4ZS6D 4A38A 4DSYA 4JFYB 2DEYX 5E8DL 2WBKA 3HC2A 3HG0A 5C0FB 2EYSB 2WUBL 3MLPA 4LVNC 1PZSA 4AUUA 1MI5D 1MLBB 3MTXA 4HKJA 4QRPD 3CQFA 4CN4A 5EEYA 1C12A 5LB1A 4LBAA 4MVBC 2MNUA 5HYJB 1QI4A 4BELD 2FX9L 4IRJC 5EIIB 3ULUF 3VQLA 4FA8A 4Z7OB 5HGHB 3BKYL 1DL7L 3Q2CA 3WIHH 1FL5B 3EHBC 2IEPA 1ZLVH 4UQIM 3V55A 1HWHB 1UZ6F 3L3IA 5I5JA 3B2XA 1OT4A 1VSCA 1HSBB 2E7MA 3R06A 3LKPA 4J3OG 5IVZB 4X2UA 1EEZB 3REVB 3MACH 4KH2A 5C7XL 3PPEA 4YSPA 2E7HA 3PDGA 3TIDB 2GTQA 1B0RA 4ATTA 2VDQH 5CBEB 1T21B 2QHRL 1BFSA 3MNMA 2MQ3A 3MREB 4MCZB 4PI0A 1MCHA 4Z0BL 3FU7B 1AR1D 3ILQD 1OTTC 2XOTA 4GOSA 3GXPA 3JWNE 4HHAA 4PRAB 1KJ2L 3BVWA 4K3HA 4JFDA 1J5HA 2BLFA 1UD4A 4HU8A 4M6OH 1QSZA 1OP5K 3HA0A 2GK0A 4R4BB 5KVDE 1JYWA 5I0XA 3SOBH 4OD1L 2XG4B 4OF8A 3A47A 5DQ9B 3SDAD 2Z35A 3DX1A 1JGLH 1CGUA 4EI0A 3I6KB 3MRFA 1EZUA 4AMXA 1KIQB 1R3LA 3F00A 43CAA 1I53A 4NIYE 1UB6A 3QO0A 5D2LE 5D6CA 4HFUL 1II4E 3ROLA 5J11B 2VLRD 1TKWB 4JRXE 3PDOB 4Y16A 1RKRA 2CUMA 1D2PA 4JFEB 5FYJU 1A7NH 3CFDA 3B2MA 5C0BD 3W11D 3DIFA 2APXA 3GLAA 1JK8B 3LQAL 5C2BH 3NA4A 3FJTA 2MCMA 3RDJA 4AH2B 1ZTXL 1UZGA 2FH8A 1ZT7B 3ILPA 3KM1A 4XXDA 1A3LL 1JGUL 2UZYB 3EF7A 3GSRB 3DHJA 4PJAB 5IJBC 3OG6B 3CFIC 4GAGH 3NZ8A 1XO8A 4DN4L 4P05A 5BUAA 5HI3C 2ITDA 3H3KA 4KKAC 3ZDXF 1QRNE 3N9GH 5D1XB 4UINL 3MLRH 1U0QA 5CEXB 2WKOF 4IIQA 3G5WA 1WD9A 5JA9A 3UDWC 1VZHA 2WWMC 2X4RA 4MKTA 2G2RA 2XV2A 5EO1B 1TJIH 3OKKB 1N8ZB 2QV2A 3QYNA 1CC3A 3M7FB 4HJGA 2PPFA 1M56B 4F58H 2HJLB 2BDNL 1Q94B 3KHQA 1MHCB 3HMWH 5ADPH 3BWAB 3O3DB 4HXBL 4Z3FA 1K8DB 3EGXA 3QUZA 5F9OL 4JM2A 3AXLB 3E8VA 5KJ4A 3QYMA 3IF1B 4LPXA 2QGCA 2OLDA 1OLLA 1UACL 1WFJA 2F8OA 3RI5F 5EOTA 1JHTB 5GZOC 2V3DA 4OZ4B 1KTDA 4LMQI 1BQLL 1CL7L 4YDJB 4DP1X 4U1NB 1A7BA 1TQCC 1EHKB 3QNZB