1ZE3H

Crystal structure of the ternary complex of fimd (n-terminal domain) with fimc and the pilin domain of fimh
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
122
structure length
122
Chain Sequence
TGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/structural/membrane protein
molecule keywords Chaperone protein fimC
publication title Structural basis of chaperone-subunit complex recognition by the type 1 pilus assembly platform FimD.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2005-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1ze3H00
5IQMA 2UY7B 3JWNH 4XO8A 4BUQA 5ABZA 3JWNG 5CGBA 4X50A 4XO9A 4AVKA 5AB1A 5JQIB 5F3FA 1PDKB 5F2FA 2VCOA 4CSTA 1KIUB 5IQNA 1UWFA 3ZL2A 4J3OF 2UY6B 5FLUA 1TR7A 2XG4B 3SQBB 3RFZA 4CA4A 4LOVA 2WMPB 4AVJA 3BFWA 4AVHA 4XOAA 3BFQG 5FX3A 4XODA 4XOEA 5FWRA 3MCYA 4AV4A 4AUYA 2J2ZB 5AALA 4ATTA 2JMRA 1N0LB 1N12A 4XOCA 4J3OH 5AAPA 5LNEA 5IQOA 3ZPDA 4XOBA 1KLFB 4AV0A 1ZE3H 3BWUF 3JWNE 2W07B 2XG5B 4AV5A 4AUUA 4CSSA 3ZL1A 5FS5A 4X5RA 4X5QA 4J3OG 4AVIA 4X5PA 1QUNB 2JTYA 4AUJA 3ME0B 5LNGA
chains in the Genus database with same CATH superfamily
2F0CA 2WKGA 3VD3A 4CKQA 3BJLA 3MPCA 4IKJA 1MCBA 4RETB 1MPAL 4EMZA 1RPUA 1SF3A 3QG6A 1OAXL 2Y6TE 1JRHH 3VNZA 1Z5HA 1OZUA 4FFTA 4KAQL 2GBTA 2NR6C 3H3KA 4N2HA 4NRYB 2CQVA 1FNGB 3HPLB 2WLKA 3RAJL 5D7LD 5LB1A 1GC1H 2ERJC 4N0CD 1KIUB 1KYOK 3VXUB 4ICWA 4OW6A 3TO4A 3NH7L 4B3VA 1ZVHA 4PLNC 5I8OL 2QELA 3WFHA 4AZ8A 4C8XA 2QPFA 2ADGB 1BMWA 4Z7IA 3BHBA 5F7BA 4KUZH 1MWAH 4LL1A 3AFLA 4O02L 1KB9J 5AENA 5JQHC 3BEWA 1ZLUH 4NLAA 1DLHA 1XF5A 2AK1H 2HVJB 2AQSA 4L3CB 5LXVA 3KPLB 4S0HA 5JQ6L 2BNUB 1KLGA 4X6DB 2OL3A 3EJUA 4NZ8A 1U8IB 3NCEB 3OPZH 3X14B 3CZFA 4DKFL 1JZ4A 5D8JL 2AGJH 1PFCA 3DVGB 3IGFA 4KVCL 5TFSH 2HTKC 3QUZD 5EV7A 3LS4L 3VFOA 1KTLA 1D5MA 1WBYB 2K6YA 1WP6A 1NEPA 2OLDA 3MXWH 1L7TH 3GHEH 3DPBB 3KWWA 3ZHDA 1MNUL 1ZSDB 2BXYA 3KPSD 3PV6B 3TNMA 1TJHL 1N8ZA 3OKMB 5KYWA 2CKBH 2Z91A 4GXUM 3VFWB 4AYFB 1DBJL 1AS6A 4P46D 5F89A 3WO4B 5HYQA 4LASH 1JXJA 1GGTA 3UTPE 1WWBX 4EUPH 5A2KH 2GJJA 3MNDA 1DBAH 3MRGB 5D4JA 1UURA 1JGVL 1RY7B 5C07D 2JK5A 4JFPB 2YOCA 4GQPH 3BO8A 4NKMA 5F9OH 1FNSH 1U58B 4K8RH 2BFGA 3ASOB 3NABH 2PO6C 3IE4A 1Z9MA 4N1EA 4LKCB 4G7RB 3R7RA 2BWDA 1P7HL 3S36H 5L8LB 4NYLA 4Q9QH 1RZGA 2JKJA 4OTXL 4I9XA 4KJYA 2QQQA 3ECUA 1JYNA 5IG7B 2E75C 2LVEA 4FQJH 3HE6D 4YHOL 2HG5B 3QXTA 1KCKA 5K5YA 4A38A 3TCLB 3D2UD 2J6EL 1OTSD 2PTTA 4NJ9L 1CFSB 3EF7A 4OQTL 4YHNA 1E5ZA 5D7IF 4YHML 5TGBA 1J8SA 4AEIL 4JZJB 4XNAA 4B9GA 2D3NA 2VDKH 4N25A 3CQFA 4NQXB 1JV5B 1NCJA 3HMXA 3E3QC 5KW9L 2Q76B 3HZVB 4KTDH 5D9SA 3DO7A 4MCZB 5B39B 3D09A 3NJXA 5EBLB 4R5XA 2UY7B 4HLZG 5FGBA 2WWOA 1HC1A 2R1YA 4WDIB 1MFAL 4XX1G 5E56A 3HLAA 1M71A 4LRIC 4UQ2A 3BSZH 1T89C 4M43H 4LAJH 3FB8A 4JE4B 4I0PC 1SUJA 2B14A 2H2PC 2WKOF 1FV1A 2CALA 1HKLH 3VXUE 3ULVE 1SFHA 3DSNB 5JW5B 3ECBA 3PP3H 3HNVL 1IEAA 4MAYA 1X44A 4I13B 5ADOH 3K4ZA 3UTQB 3MX0A 4X4YB 1NKGA 3NDZE 2I5YL 2PCPA 4G2AA 3C6LB 3MV8B 1A4JB 1P4LB 1NPUA 3F62A 3PY9A 2MOGA 1NC2A 3H2WA 3OAZH 4QYOB 4X6DE 1TPXB 3WMSA 4XTRD 3SN6N 1SZNA 2JKSA 2YARA 2FD6L 3JTSB 1I82A 15C8H 3QDGB 4GT0A 4ODTL 4RFEB 3IS0X 4PFEA 3L08A 1QFWL 4R4BB 1UB6A 2KQNA 1VPOL 3O2WH 4GS7B 3RVWC 3PU7A 1AFVL 2WXRA 1KJ2B 2BCKB 2HKHL 4CNIA 4YEFA 2VXQL 2JVUA 3QIUA 1UT9A 5E24E 3KBFA 1IVLA 3MJ6A 4NHCL 3RWHA 1OAUH 1C1EL 1JZ2A 5DLML 3QDHA 3WS3A 3IJEB 3RB7A 3DNKA 4PTTB 4XAWH 4F15B 5HYIA 3OVUB 4N8VG 1OGSA 3CVBA 1OKEA 5CINH 5HYFA 5CWSA 4H1LH 2XJLA 3Q2NA 1WE5A 2MIZA 1UUSA 4FFWC 4F24A 3MC0A 1CR9L 2YD9A 4GSDH 1QBLH 2YK1L 3A4AA 4WHYG 4IHOB 5ITBL 2WLLA 5T5FH 3OF6D 4U1MB 5DHYA 1U8NA 5CEZD 5DVPA 1B0GB 1ZV2A 3GJFK 2KDGA 2C9PA 3KYOB 5F8QC 3O41B 4FXKB 1MWOA 5IJVA 3GS4A 4TV3A 4CKVX 2A4ZA 1RP9A 5JTWA 1YMHB 4OF0A 1FZMA 1KCVL 1DQJB 3ARGC 3RPIA 4PP1D 5SX4I 1VFAA 7PCYA 1K8IB 3OJMB 4PJXB 3WMPA 3ZE0F 1EHLH 3MCKB 4X7TA 1GCFA 1HHJB 3JWNH 2VSCA 4RGMB 4NZJA 2Z4QB 4G9DA 5T8IA 1FFPB 3ROOB 1EJOL 3T4YB 1JGDA 5AYUL 5C0BB 4P3DB 4UDUA 1ZHLA 4LKXB 2WB7A 2Z8SA 5EU3B 4I8DA 3U6RB 3LIZL 4LL9A 3MLVL 1O9ZA 4HAFA 4F8TA 5EZLA 1MCEA 1F56A 4NO5B 4L4VD 1CLOH 3UAFA 3V6FA 2B0SL 1MCJA 1PG7X 4KRPC 2OX5A 1HHGB 3MKKA 1U8QB 5ICXB 5ANMB 4JK0D 4ZW5A 1I8LA 3Q06A 3P30H 2VC2B 2LLNA 5KVFE 2HRPL 4J3SA 4J3OF 3B9KC 2IOOA 1BQSA 2WUCL 2H5UA 3MV8E 3S34H 3UJIH 5D1ZA 1WUZA 1ZWIA 5KJ4A 4PJGB 3IJ7A 4G72B 2NZ9D 1GZQA 3CG8A 1MN4A 4HXAL 1DVXA 3VMPA 2YPLA 4IEFA 4PRPD 9CGTA 1XF4B 1E5YA 3QDGE 4PJDB 4F7PA 3WS6A 5E00B 5L6YH 3MLSL 4M02A 4XWOC 4WW2B 3ZKQD 4HH9B 2C1PA 1HNYA 1L6XA 3IMSA 4ZOBA 2AXHA 2IO5A 2X1WL 5EN2A 1G0XA 3T04D 1QO3A 1MCOH 5E4IA 3QUXB 4W9FC 3RWJA 2CDGA 3HB3D 3UJJL 4MA7L 2FLBT 3IAPA 2VN4A 4XOCA 5J13C 4UOJA 2ZP0T 2A4EA 1DE4A 1HCYA 2VDNH 3DI2B 3WYRA 4XMXA 3G5ZB 2EVHA 1MVUB 4KOBA 4LPWA 1CU4H 2QSCH 1OIOA 2ZXQA 1MFBH 3II2A 4LLYA 3ZDYB 4DAGL 5BRZA 4YHZL 2VLJB 3QQ9D 4AL8C 1QTYT 4L23A 1YNKH 1MFDL 4FGMA 3OKNB 4MD0A 1UH4A 3ZZ1A 1VKXA 5B4MC 5BVPH 4YPGB 2DQDH 5J06A 3UP6A 2OR9H 2PR9A 3ABZA 4ZO6A 5DEZA 3GXIA 4KTGA 4BEIA 2EDBA 3K6DA 5DCCA 5AOZA 3AAZB 5GISH 4NRXA 3B3BA 4U0RB 5IMLA 4Y1AD 2EABA 5E8NA 3A67L 4PJ9C 2E74C 3U0PA 3P2TA 2CNYA 3FDWA 4ZMWA 1BFTA 2YUWA 3E38A 2V3DA 4F7MB 1YPZB 4MA3A 4QTHB 5KVDL 1YECL 4ZS6D 1C08B 1G4RA 2OP4H 1Q4NX 3ZKXB 2BW5A 4MBRA 4IOIA 3GZOA 4PJXE 4KROC 5EIIB 4K3GA 1QPXA 4AUJA 2P5WD 4IIZA 4KY1H 4HHWA 2Z65C 5LGKA 1JGIA 2PXYD 1J12A 1CXIA 3KPMA 4TTDD 3SQRA 4IGBA 5C0BE 1OM9A 4JW3A 3WE6A 1OGAB 5AW3B 3IBOA 3UROR 4GRLB 2H32H 3TXAA 2P48B 1U93A 5DZ9A 3WKYA 4JCLA 5FKPA 1C5BH 3RVTC 4N90E 3VI4A 4WVRA 4QAMB 3CSFA 2VN7A 3EZJB 5F9DC 4MZ3A 5JORA 3ZKND 5ANME 2QGBA 3RWFA 2IAMD 3MRIB 4JCWA 3ZTEA 5I17A 1GIGL 2PYFA 5IQLA 2JKIS 4B96A 5FA4A 4ADIA 4JR9H 1J1XH 3HS0A 3RTLA 2YUZA 3CBJB 4JUSA 5E2VH 5LWYH 5EU6B 5FUZL 4B5ZA 3KBHE 3AGVA 4PJGE 1OGTA 2P42B 3VTTA 4RZCA 3F7RA 5IB1B 5AD0B 1N0LA 1M05B 1UH2A 5SWZB 2QTEA 5DJCB 1UWGL 4PJDE 4DOHB 1T03L 4N4YB 1UM4L 1HS6A 1GTFA 5DI8A 4AE0A 1AG0A 4PLKC 3W39A 1BOYA 1G0DA 2YSSB 1QBBA 4F92B 4JFTA 1FBIH 4RA0C 4BZ2H 1YEHH 3QWOA 2CBPA 5IKCB 2FUTA 3ARDD 4WFEE 3DJRA 2A9NL 4K9JA 1WFMA 1AOHA 4AL8H 5L2JB 2QGDA 3FRUA 1A7NH 4R97B 4ELDA 3ZDYE 3QI9B 3QORB 1U8CA 4HCRL 5EWIH 5HPMB 2VLJE 2LQRA 3CXHK 2JH2A 4Z7UF 2AEPL 2YGPA 3BPCA 2R69L 2UX7A 3EBGA 4P5TB 3D48R 4Y5XC 4YXKL 1OF0A 2V2XA 2Q7YB 5CD3A 2HT4D 3BWZA 5DJYA 4NXSA 1CFTB 2XCMC 3K8KA 5I23A 1IBBA 1KELL 1N6QL 3GDBA 2XDHA 2XI9A 2BVOB 1RSFA 2I26N 3NZ8A 4LAQH 1INEL 1GYWA 4ZMOA 1IAIM 4LCYB 5D6CB 4DKEL 4JO2L 3QUHA 5E2UL 4GG6F 2MOQA 1BZQK 2O6EA 2OMYA 2VDOL 1YPZE 1L9PA 1NGQL 3EYUH 4PVNA 1CTOA 3SPCA 1G9NC 3ROLA 2RCSH 4WY7H 3I6LD 4GW1A 5FFOA 5B3SB 5LBSA 2AJSH 5DVOA 4G11A 2CDFA 4P59L 1J9TA 3IB4A 4XXWA 5EF2A 1H6UA 1AIFA 3DHPA 1TTGA 5LCVA 3IFOB 4X7SH 2OSXA 1OGAE 4BWUA 1CWVA 3ME0A 1FUNA 2XTJD 2XWZA 3HI1B 4E5XG 1KOAA 5CBAB 2YXFA 3S6CA 3L1EA 4K7PH 4HKXA 5F7AA 3GGWB 3IVKA 2Y1AA 4PJBB 1EWHA 3MGTA 4QF1A 3R8BB 2F19L 4Y16D 3KPNB 4N2BA 4ZAKA 4L2YA 1NBZB 1YCSA 1HINL 2VDMH 2P7TB 5DMIH 5AL0A 2NXZD 3N5AA 4M4PA 2WLMA 4RMUA 1UWFA 1TITA 3D1MC 5EU6E 4PJAF 3QZWG 3DX6A 4L1LA 2AXWA 2RFXB 3B9EA 3GS7A 2N7SA 1JFHA 2X4NA 5LG1A 5SWZE 3UEZA 1KIRA 1MELA 1NIFA 2JI3A 3TH4T 4DOHE 4LBEA 4ZFFA 2CIIB 1SNRA 1TQCC 1BXVA 4X6FB 1UWYA 1YEWA 1TETH 3VGAC 1SOXA 5I1JL 3PGDB 5D7JB 4Z7VF 3D9AL 1SM3H 4UZSA 3B5GA 3V0FA 3L48A 3QWQB 4BINA 3AB0C 4KJQC 3IRPX 2O26U 4RAUA 1CLZL 3UC2A 3N0PB 1OO2A 4G8IB 1EEYB 3ZHNA 1DJXA 5CJQL 3SD2A 2FHCA 3RFZB 1G7MA 1I3GL 2Q20A 5I19H 1DUYA 2DKUA 3VXRA 2E7LC 2OI9C 4HIIB 4PJ5A 3VXSD 1RUKL 2CO3A 1XGYL 2OCFD 4LCWD 4BSVA 1F90H 1EX0A 1TZIB 1JZ5A 3KEDA 2FEEL 1EMTH 4MB1A 3NSJA 3BGMB 1N18A 1XR9B 2YUVA 4I18B 1JYWA 2DJMA 5F3HA 3ZE2F 3WMQA 3NTCL 1PZUB 1OHZA 3OMNB 1WG3A 8FABA 2IC2A 1JDDA 2N59A 4ZPVB 3K1KC 5DHEA 5I0YA 5K1NA 5E2WH 2O30A 1G9NH 3STZA 2NQ3A 3C8KB 4DNLA 4EBQL 1QLEH 3DVFA 2WBJB 2OJEB 1K8DB 2BSRB 4N2NA 5F6IB 2DS4A 1BIIB 1FORH 4MKTA 3TA4D 1CLVA 1UENA 1I8MA 2NOYA 4WI5A 1AGDB 1O6SA 4LOFA 2YQGA 5KSAC 3REWA 2LHAA 2A5UA 3GBDA 3FTYA 2VSKB 1PZAA 4FQPA 1TU2B 2IPTH 2GUYA 4HDIB 1D5RA 2I85A 1L7IH 3QB7C 4OD1H 4ZS7H 1N19A 3IDGB 1A3RL 4P23C 3P77B 5TDPA 4HYTB 3UX9B 4Z1PA 5FECA 1JZDC 4PJBE 2IWEA 3P1VA 1T83C 4H88H 2DL9A 2E0PA 2N1KA 4K15A 4KMTL 4R5VA 3VB9A 4AI7A 4CC1A 2QQLH 3T8MA 1EEUA 3O3EB 4MNQB 1ID2A 4TVPE 3NFPB 3MZGB 5CP3A 3MBEA 4WENB 4U1LA 3C8HA 5KTEL 3ZL2A 3ARWA 4Y9EA 4YSCA 2CK0H 1HT6A 3UYOD 2MPVA 5EMYA 5HY9B 4YBLC 2Q2LA 1OE2A 8CGTA 4PGCB 1UYWH 5DWUH 1NCDL 1W8NA 3UTTB 4S2SB 5B1KA 1PF3A 1NUFA 2YQBA 4AVJA 3VQLA 2GSIB 2Q7AA 4QT5A 3V4PH 4AVHA 4LIQE 4FABL 1IKFL 5FHAL 4UDTB 5DUPL 1EZVY 4LPVA 5DVNA 3DURB 1MIML 4V1DB 2ATKA 1GYVA 5ADPL 1LHZA 2VAAB 3MJ8B 4LSPH 5I0ZA 4NB7A 4LLDB 4N2LA 3RIKA 1NMCB 2JE8A 1PQZB 2NY2D 4JDZB 3VMNA 3M1OA 2OTUB 3LXBA 4I2XA 2NX5A 5EO1B 1BDYA 3GPEA 1CFQA 1S9YB 3QPKA 4JM0A 5EC2B 2QQKL 3ZMNA 1YDPB 1HHKB 1AXTH 3SGEH 4NUQA 2HKAA 3AXLA 1HH6A 5B8CA 4IW4C 4DQAA 2QHLA 1OARL 1HCZA 4M8VA 4JDEA 3WTYA 2X05A 5JW4Q 5HI5D 4U3SA 1EBPA 4U05A 1NBQA 1HXYB 4S1QL 3WXVH 3WDHA 1KCWA 4NKOB 1KYUA 1AO7A 2FO8A 3MNZA 1QI5A 5A7BA 4BKLB 1YYML 1U8HB 1S9VA 1HILA 2BSCA 2FWLB 3BDYH 3C6SA 3OB0K 3JZ7A 4Y0GA 5AL8A 4F8QA 5A43C 5D2NB 3QNFA 5DS8A 4IRSC 5FS5A 5A2AA 3RWIA 1BSIA 2ICCA 2DWDA 3UPAA 2DQIH 2AV7A 3ARPA 5EO0B 2B4CC 3BH8B 4APQD 3VD9A 1N10A 4MZ2A 4O00A 4BE6A 1ORSB 1PKOA 4JG1H 2BM3A 3G5WA 3QJZA 4QRPA 2F5BL 3S5ZA 5C70A 3TONA 3ZVVA 1MFCH 2G0LA 2O6CA 3QAZC 4MMXA 1WD9A 5GS2H 4LU5H 4XT1C 3GUTB 3A6OA 3CK0L 2J25A 1MI5D 3WY2A 4Z78B 5I1DA 3SSGA 2WXMA 4HUCA 1G7PB 1FSKB 4X8CA 4OI7A 3SOTA 1LP9F 1PCXA 1Q1JH 2CO6A 2VDQL 4HZ1A 4WRLA 1TZAA 4MNQE 4FKEA 3H42H 1T2QL 1SXAA 3V4UL 3ARFB 3G08A 3KM2A 2GW5A 2XV3A 4HIHB 4X8JB 4UQ3B 3TFKD 1U8PA 1LK2A 3D4GA 4WW1B 3F5WB 3N44B 4NN7C 4WTWA 4I5BB 4RISH 4ELMF 3ZDXB 3NPZB 5DD0L 3U7WL 1IE5A 5CU5A 2J8UB 3RTQB 1XIWC 4DJMA 1AZNA 1JYVA 1WT5C 5GHWH 3GNMH 3S96A 2AK4D 1TCMA 3UTTE 5DO8A 3BZ4A 4RWYL 32C2A 3V6OC 4IRZH 4UM8A 1HL5A 3EO0A 3ZYIA 4U1JB 3VFTA 1QSEA 4M8QA 1B6DA 4NM4H 4Z3HA 4MCNA 4QOKB 4V1DE 5AQ0A 3EZ8A 4ZUUA 1IFGA 3UACA 4O2EB 1TEGA 2GIYA 4FX5A 4XMWA 3O2VH 3U0TB 2EO9A 3A23A 4MXWH 1I9RH 1OCWL 4KX8A 4KUCF 5JDSA 1HYSD 3TX4A 1QRKA 2H45A 3BZFB 3O0LA 1FC1A 4FQXB 2ZXCA 1W0YT 2DMGA 2I7OA 3SDDC 2J8HA 2R23B 3KLSA 3LH9A 5BO1L 3R1GL 3DWTA 5CZKA 5GGVY 2I9TB 3D51A 3IKKA 5IBTH 2B16A 1F1AA 2YWZA 4BZ1A 3MJWA 3FAWA 2XC8A 5EN3A 3RVXC 1KXHA 2I25N 5B22A 5I24A 1A14L 1P4BL 1TVBB 4J4PD 4FE9A 2BOBA 4MMYA 3S4SG 4L1SA 3L3IB 1Z5LA 4AQ8C 5D2NE 4KK6C 2YS4A 3D6GA 5C97A 1YUHA 3APCA 3GSRA 2VR5A 2P8MB 1YEEH 3OMAB 3NGBB 3TZVC 3ZJAA 3Q5OA 4IBSA 4KDTC 2F53B 1DSYA 3P02A 4QHLB 4YFLI 1DYZA 2UXVA 2BWIA 2HMIC 1ET5A 4TNWF 3BP6B 2AJXH 3LN4A 1KYFA 1I1FA 1UT1A 2VLKA 4NO0B 4R4FH 3LEVL 5EZPA 2IAND 2NY6B 5E4EB 4CBPA 4HQQL 3DGCR 1DBMH 3FO2A 4ZNCD 1AR1B 1CK0H 1E50A 4DWHA 1FN4B 1PD6A 4FN0A 4GW4B 3BUTA 3GJFH 1DQKA 1YLBB 2CLZB 4FFYA 3WELA 35C8H 3U1SL 3FONA 5DRZB 1VEOA 2A74B 2DDQH 4PB0L 5DK0B 4CU8A 2DQJH 3GS0A 3VFRB 4F2FA 4MQ7A 1SGKA 1Y18B 3OZ9L 4IKKA 2QVKA 4N68A 3U9UB 1OPGH 4F3FB 4F8LA 3ZDXE 4W9HC 2J8UE 4XBEH 1A7OH 4CRPA 3GD1C 4JPKH 4AYID 1G7JA 1M53A 1LK3H 3HFMH 1F3DH 5H2BA 3S9DB 2HPTA 1ED3A 3FCTA 2X3BA 4JKLA 4QXTB 2IADB 2AKRA 3IJ9A 3I6KA 2FX9H 2WM0A 1UD4A 2WXHA 1EV2E 3F6LA 4KRNA 5T1DH 1OTTC 3KYNB 4RH4A 5AW8B 4C57C 4JG0L 1CG9A 4PRIB 1ACZA 4EN3B 3EDKA 3DROA 3O4OB 5GJSH 4GFXA 4U1NB 1N8OE 5K59E 4F5CE 4QOKE 2PYEB 3EJTA 3D3VA 4CAGA 3FTGB 3UTPD 4CUCA 2CO2A 5C0ND 2VJ8A 3SDXB 2B08A 2BH0A 3WFEH 5DYOA 3D52A 4ODBD 4X9GA 1OXYA 3EOBB 5IB5A 3WENA 4X99A 4TSBL 4BYHA 4A2HA 4Z0BH 3KPRD 5TE6L 4AKPA 2J43A 3OKEA 3T65B 3JV4A 5EZIL 5I71B 5I18H 1U33A 4O4YL 1T5WB 2GK0B 4KH2A 2XZAH 4IBWA 1TUPA 3QARA 2VDRB 1I7ZB 4JPWH 2IPKB 4Y2DB 1QA9A 2XZQH 4YHPB 5AAWC 4EDWH 2AVGA 1S7UB 5EOTB 1YSOA 1CZ8H 4NWTL 4P2QD 5H37H 3RL2A 2WXFA 4IDJH 3VD7A 1V3KA 2G0KA 3OHXB 1OAYL 1Q9WA 1A6TB 1HH9A 1R75A 3EDEA 3RU8L 1ZE3C 3G6JA 5CR8A 2Y72A 5JOFA 4C59B 3M8OL 1Q9LA 2F53E 4IKLA 4JVUA 4LSTH 3X3GH 4QY8B 5SV3A 2YEZA 3B6SA 4YC2B 4ZPTB 3UZQA 4OLEA 3V0IA 2E27L 2DMHA 3O6FB 1PZ5A 3T2NH 5LGJA 4JM2A 4HUVB 4JQVC 1X5HA 1VB9A 4J3OG 5F1OB 3MRDA 2NNCA 4NEHB 3PFUA 4PD4J 4YS4A 4KQ0A 5M7QA 3RFRA 3H55A 2XQYA 2FBJH 2MEJB 4H5SA 3ULVD 3KPPA 1LLAA 4DETA 1CI5A 2JSFA 3D18B 3QG6B 4KKLC 1H5BC 3ARRA 2EIZA 1TTBA 3DV4A 4CGTA 1ILSA 1TOXA 2VO8A 3D30A 2AQ3A 1N7ML 4RDQF 4XE0A 1S7QA 4DCQA 5T33L 4PBDA 3BKMH 1RURH 1NUGA 2ZQKA 1EXUB 3MVSA 5DMKB 1HSBA 2FQDA 4W81A 4KO6A 3TO4B 5FPIA 3CFCL 5HYJD 3PWJB 3PABB 1X9UA 2QZQA 1DEEB 5EU5B 5CLWA 1MF2L 2XQBL 2APSA 1TJGH 2P80D 2EIKB 2PWDA 3TBYB 4NCDA 3PWPA 1WAAA 2KS0A 3BEWB 4J3OD 1DLHB 4PRIE 2NYKA 1RUMH 3O2DA 1RLBA 1WUNT 4TOYL 4U1SB 1JVLA 3VD1A 5CIPA 2OL3B 2JCCB 2PYEE 5B39G 3VA6A 4DZBB 2FWSA 3WIFB 3SDXE 2Y7LA 3P54A 2FX7L 3OJ2C 5MEOB 4FQ1L 4Y7MA 1OCZB 2H6PB 4BZYA 3I6GA 1V7ML 4H8QA 1A6WL 3TNMB 1G9HA 1HJBC 2HN7A 1T3FB 2XRAH 4Y2LA 4NQCA 1BREA 4KU1A 5B1JC 2CKBB 1LWRA 2EIEA 1HEJC 1HKFA 1UVQA 4N2KA 3MLYL 3QT2A 2VZ3A 3AU1B 3T2QA 2JF1A 4EUPB 2R56L 3Q1SL 4XBGB 2JK5B 1I75A 4WNQB 3AGWA 2AZUA 4XMKL 3BO8B 4NKMB 4L5FH 4OUOA 4TSAH 5TE4H 1JSYA 1ZE3H 2DQCH 3TT3L 5J12B 1R17A 2CDEA 4R7VA 2F1BA 4B9ZA 4F9LC 4N2AA 1RZGB 2BFVL 4A7QA 5KSVA 2AEQL 3GMQA 3IFNL 3CX5K 5J9PA 3ZE1F 2X1PA 4E41A 1JFQH 4G3YH 1AKJB 4GNKB 2PTTB 1R5IB 3KJ6H 3I84A 3QJFB 4JGMA 3VUAA 3CH8A 4WGWB 4YHNB 2YD0A 2RIKA 5FYJE 3BKCL 1T5KA 3RWEA 4GG8A 1A25A 1WRFA 2LT9A 1Z0MA 1AZVA 2X0UA 4WGKA 5E9AA 4HGMA 1UB5B 2C5DC 3WL9A 3ZO9A 4OLUL 5AVWB 1KBBA 4JFDB 2C1OB 1M1XA 5JLZB 3PIQB 4G8AC 1UGNA 5DMYA 5DK3A 4POYA 2NT1A 1UD6A 1ASPA 4G8GB 4Z7WA 3FOMB 1QWNA 4FYRA 1YG9A 5C7XL 3HLAB 2DYPA 3KWVA 3HMWL 5ICUA 1M71B 2NW2B 1VAHA 3GBNH 3COOA 3DOHA 1KN2L 2ERJB 2OW7A 4L37A 3SE9H 3U36A 4GAGH 3C6LD 3MV8D 1FO0A 1T22B 3NCJH 3PJNA 4HEPG 4PJIA 5CXPA 4YDLC 3VWJA 4PD4K 5E5MB 3BFOA 5ILTL 4AVKA 4LSQH 1BG9A 2J4WL 5KVMC 1JXKA 2PLTA 2X3CA 1ZS8A 1J5OH 1IEAB 1KCUH 3QDGD 1ICTA 1BBDL 5E1IA 1M6OB 3A6BH 4HULB 2PR4H 1Q90A 1MQKH 2A6JA 2VR4A 3EOTH 4F93B 5I1CH 1JPFB 1CDIA 3M46A 4P0DA 1G7QB 2RD0A 1WFNA 2E7BA 2NNRA 3CLFL 2DWEA 4XN5A 4HMEA 3PAZA 2JCCE 2GIXA 1YQVL 3KMDA 3LKRB 4H26B 3KW8A 3HBQA 1IM9A 1MFMA 3MDJA 4P2OA 3TTSA 4XMLH 5DEJA 2VIRB 1CXKA 3IMRA 1I7TB 4YSQA 2ATPA 2BVEA 4L8SA 2IFFL 2CGZA 1IFHL 1UB6B 3AT8A 4P9MH 4J3TA 4DK3A 1SEQH 1TF4A 2MNJB 3K6IA 2P46B 4S1DC 4FS0A 2YKLH 4CNIB 1PJWA 3QE5A 1DVZA 2CRZA 3W82A 2UX6A 2G75B 2EYRB 3RWHB 1PGRB 5F7EL 1ZHBB 3QWRA 1U95B 1AYRA 3WS3B 4L48A 1UD2A 2PO6B 1HQ4A 1NCWL 4CMMA 5A6MA 4LEXL 1A7BA 2Q8BH 2R0KL 5KG9A 1BQUA 2ZXWB 4OLZH 2VM4A 4P06A 4ZUWB 3DGDA 1SN5A 3HHMA 5C9KA 2YQ3A 3SODB 4GSRA 4XZUB 4JGUA 1KGIA 2HLAA 2X9XA 1VFOA 3AMLA 3HJEA 1IT9H 4JQIA 5A3IC 2BJMH 4U4IA 4PR5A 5B38A 3OXRA 4M48L 3L5WA 1N59B 2C34A 1A1NA 4LPUA 1RU9H 4HKJB 3SKUD 4PHXA 5HGGS 3SJVB 3BP7A 4BA0A 1OAZL 3UCRA 4RQQA 3FN3A 3DVIA 5B21A 3BSHA 3C6EA 4P48A 5C0BD 5EF0A 4JFDE 1VADA 3UTSB 3FTSA 4N90D 2Q3XA 5ID0A 1BFVL 4G8GE 3BLPX 2QSTA 3TO2B 3UAJA 4OV5B 4KO7A 4WU7A 5D1QD 4I0PB 5BRQA 1GJIA 2GI7A 1OLZA 1JGDB 1RZJL 5HJGA 3VW3L 1S7SA 4UDUB 1MPAH 1ZHLB 1KIQA 4OZFA 4MZIA 1AXSB 4UIMB 3S5LG 2NUPB 4F7EA 2JWYA 2XT1B 5ABZA 2B5IB 3WEXB 3T71A 1YO4A 1H3UA 2FAUA 4YOKA 4WHTA 5DC0A 5DD5H 3OKDB 4ZFOA 5B7EA 2CUHA 4YHLL 3SDAD 4BFJA 1J86A 4JAMA 1E40A 3NH7H 3CIAA 5CSGA 1PLAA 4WJ5B 2MOVA 4Y8AA 3QUXD 3CFKA 3Q3GB 4WFED 5DMJB 2W92A 1XCWA 1T2XA 1ZV9A 2Y4SA 4O02H 4HWEL 2EC8A 3CCHA 5FW8A 2XTSA 1NCUA 5E23A 3DJTA 3V55A 2HLFC 3OLIA 3QJHA 2OK0L 1NEUA 1U0QA 2VLJD 1L9NA 3CPUA 5CKGA 5AKTA 3OKLA 1AGCA 1TQBB 4ZSOA 5LGHL 5D8JH 4X6EA 3REVA 5EF1A 1UXLA 4KVCH 2GEQA 2XVBA 3KHOA 5CJXA 1F4XL 4J8QA 3ZTCC 5GGSY 1IBHA 1EFXA 3POHA 2BSSB 5DQJA 4HWUA 1MNUH 5AZUA 1FNLA 1TJHH 4UQ9A 5BRZB 4TUOB 1DBJH 3DIFB 2D7NA 2R39A 4X9FA 2K3TA 3MO1A 3T5WA 2VGLM 3F7PC 2ZAGA 4OF8A 1UKQA 3KLQA 4ISVB 1BD2B 3RE0A 1JGUL 1H0DA 3PWUA 2LAGB 1JGVH 4HC1A 2RJMA 3MRMA 3WNIA 4AT6A 1HIMH 3OBAA 3HUJB 4EF3A 2ZUVA 5KBNC 2V8MA 4GXFA 4KXZI 3O9WA 3SJVE 1ZGLP 2V7NB 3QR0A 5IMLB 5E8NB 4DGIH 4OTXH 3E3QE 4OZGA 3IDUA 4X6BA 4FNPA 3NSCA 3ARGB 3VCLA 2NY4D 2XWJB 3CU1A 4NJ9H 2NY0C 3BMWA 2VERA 3GI9H 4GRLD 4OQTH 5C08B 3UTSE 2V17H 4YHMH 2ZKHL 4DW2H 4DIXA 4AEIH 4I48A 1QTSA 3CMGA 1SN0A 1P7QB 5KW9H 3RYMA 4KXCA 2IDCA 4Y1TA 5TDOA 2XIDA 1ZVSB 1MRFL 2KDYA 1CFVL 1YN6A 3BPOB 2Y36L 3MRBA 2EYSA 4IGBB 4JS7A 5F7MC 2MCPH 1W80A 5DJ0B 1DBKL 2H8PB 3OB0H 3G6DH 3QNYA 5EU6D 5CLYA 3P9WB 1MOEA 4X0KB 1U93B 1XFPA 4KRPB 5FKPB 3VI4B 3CH1B 5AUMB 3QDMB 5SWZD 3V5DA 4JJ5A 3W9EB 3B9VA 4JO5A 1SHWA 3RWFB 2BZ7A 3B9KB 5HDWA 3IWUA 2PYFB 4GMTL 1QQDA 1T21A 1MY5A 2A7BA 2AEOA 2CZNA 2FJGB 4HJ0D 5DC9B 5E8OA 5D7LA 4N2GA 4PQXA 5LAXB 3DARA 1OCCB 1ZGLM 4GUPA 2OYKA 2VL5B 1TCRB 1XR8B 5EUKB 2KPWA 2YPVA 1JRHI 4OAWA 3PAYA 1TIUA 2H9GB 1LQSR 5K69A 1UM5L 1G1CA 2CLVA 5IZ7A 2WVUA 3NOIA 3L5JA 4OFQA 3N91A 2GBVA 4BFRA 1CGXA 3SYPA 4UV7H 1BECA 3S0PA 2R8SH 2DWYA 3PWVA 1VA9A 1V5JA 4AEHL 1JIBA 2FD6H 5J13B 1T1YA 2F9BT 4ODTH 3LHPL 4HFWA 4P5TD 3MCYA 5KS9A 3QYMA 1QFWH 3WV0A 1NIAA 2R0LL 2YR3A 4Q89A 4S1SL 4PS3A 1DSWA 3LDBB 3QUZA 2VO5A 2PPCA 2WVVB 4O51B 1AFVH 1UOKA 2HKHH 5BRZE 1A6AB 4HIEB 2LU4A 1HDMA 2GC7C 3KPSA 5J11B 2VUKA 3BPCB 5JOEA 3NSFA 5GIRA 5KZCB 1NCOA 1BD2E 1PZDA 4P46A 1ZHKA 1M7UA 1FPTH 3MRLB 2NNFA 3WFDH 4W9GC 2B9AA 4FNUA 2VERN 4G6JH 3FQ1A 1WQVT 3HUJE 5C07A 1CR9H 3L45A 1J5CA 1IEHA 4K2UL 3AT9A 1KGXA 1RLWA 4JFVA 1B2WL 4TUJB 2A83B 2IFGA 3TJEH 2CO1A 4K5PA 4KROB 4K9EL 5C08E 5GS0L 3DBXA 3HE6A 1KBPA 3NDYE 1XZ0A 4N2EA 3D2UA 3PP4L 4W93A 2YPKA 5EEVA 2C3XA 3H9SB 1AQ8A 4ZMLA 2NLJB 5CUSL 4Y4KC 1VDGA 1MIEL 1URZA 1UJ3C 4DEPC 2QQNL 4IBYA 2V5YA 4TVPD 5I1KL 1MHHB 3ME0B 4ZQTA 3MJGX 4OM1L 2B77A 3FH7A 3NFSH 3VI4E 2W9DH 4AIEA 3OPUA 5A2IH 1DBBL 3EO9L 3QDME 5K1JA 4EKJA 1EJOH 3RQ3A 5IB3B 3WIIH 3Q0HA 5CCGE 3IVKB 3C60D 1K9TA 3WEBA 4G6ML 1MHPL 1ZY9A 4NFBA 4NZUL 4GKLA 4ZAKB 1FFQA 2X70B 3QXAA 3OQ3B 4NM8H 3RX9A 4K5NA 4PWHA 3SPJA 3PAUA 2WHVA 4RSYA 5D7HA 1MXGA 3QHFL 5L8KB 4GO8A 3RJOA 1U92B 2WUCH 1S7RB 1SBSH 3EJJX 4LBEB 3CWGA 5E2TL 1SYVB 4LGPB 1P9MC 3ZKMC 4X9IA 4NPYA 4JGNA 2NNXA 3E8UH 4TYUA 3C5ZD 1U4FA 2I7SA 2FATL 1KGCE 1OCOB 1KWGA 4OLWH 3HKZA 3DUSB 3VGBA 1WZ1L 4XNUL 4DHLA 3AY2A 5DT1H 5D7SL 3C09C 3T0AA 4EIGB 5E94A 1P6AB 5K9KB 3ENEA 5D72L 3RHWF 2X9WA 2XN2A 1E43A 1MUJA 2X1XR 3EBIA 4YDIL 1G7MB 2OCCB 4G1EA 3CFIC 4XVJH 3S2CA 3UJJH 4B95C 2W07A 4WI7A 1PLCA 4N8UA 4Y5XB 3BVNA 1S9KC 2PETA 2X0VA 4X80L 4I7ZC 4KUCD 5AAPA 3WLWD 2WBJD 2QPSA 4Z23A 5CILL 3RBSA 2FWOB 3L1OL 4PRAA 1WHOA 3SKJL 4U1HB 3H7BB 4U6YA 5F1NA 5JHLA 3B3IB 5KVEE 2YRLA 3OHMB 3QNXA 4KJPD 3Q2LA 4KK9C 1MRCL 1E8WA 2ZUYA 3TF7C 3DUUB 2EKSA 1A3LL 2P3YA 5I0XA 3OF6A 4R4ND 4QWWD 5HI3C 2G5BA 2ADIA 2UWEF 5I2IB 3A67H 5ANHA 3CJJA 2NYYD 3GFUA 3JVGA 1A22B 4HPYH 4HV8A 4AH2A 4RESB 1O6SB 5CR1A 3H9SE 3T2LA 2AVFA 3O3DA 2KQMA 1FVEA 3REWB 3VXQB 5LQBH 3LNEA 5GRYA 2YAFA 5F1IA 4UNTA 4MNQD 3U82B 1U8LB 1JNHA 4AENB 4WJKB 3APNA 4WK4B 4KHXH 5EULV 4JFSA 2DIJA 4FLQA 1H15A 4YHIA 1AD0B 1JL8A 2AMUA 3MV01 2MMXA 3EYQC 1V55B 3CPLB 1JHLL 3UBHA 5FECB 5FO8A 4WI0A 4LOUD 2J57A 5LHDA 1TQUA 2HJFB 4N8VA 5EU7C 1DL7H 4TQPA 3H9YA 1MW2A 4GXUN 4NKIL 3KAAA 4QI3A 3UTTD 4AQEB 3GSWB 4UT6L 3GBML 4PREA 3K6OA 3MBEB 5IBLD 1SJXA 3KGRA 5EC1B 1ZK5A 3K8LA 4L4VA 1KT2A 1Z9LA 1ODUA 2HT2C 1TQCB 3CVHL 3N85H 3PXJA 3VGAB 1WAPA 3P9MB 4V1DD 4IMKA 5E6UB 4K3DH 2EQDA 3LPWA 3HPJA 4LCIH 2A9CA 3ZL4L 2WXKA 3AB0B 3LMJH 2WIIA 3MRQB 4LFHG 1PG7H 4AM0Q 1T03H 3WKMH 1OGPA 5JA8B 4PRPA 2Y7OA 1JWSB 4DVBA 3O45A 4IBQA 4MCYB 3RGVD 1DUZB 2ZOKB 4TTGA 1O0VA 2J71A 2OI9B 2EDWA 2XZCL 1X5IA 4ZG1A 4TNVF 5FDWA 4GKZA 1ZT7B 3A24A 2Q8AH 3NRFA 1UQSA 2A9NH 4I2XB 4MS8D 4Z7OF 2GB2A 4ONGH 2ZSVA 1T1ZB 1CFQB 5L88H 3ARBC 1WYJA 4XZ4A 4ZYKB 3FMGL 1R0AH 3LEXB 1L9QA 4JFUA 1DFXA 3DI3B 4HCRA 4JFQB 4EQ2A 5F7FA 4OD2A 2R69H 4XO4A 3DK0A 4RGOL 5IHWA 4NO3A 4YXKH 3DXAB 4ODSH 3MNZB 1XH3B 3NZSA 3PJSA 1FGVL 5C2BL 5ALBL 3TC9A 1J88A 2CJTA 4LFHD 3G6AB 4ECNA 1IGCL 4UT7H 2Z0BA 2CCVA 4GAJH 5DS8B 4CJ0A 3GYRA 1INEH 1T1XA 2QKIA 3DV6B 4Y5YC 3HE7C 4DKEH 4JO2H 5KSAB 5E2UH 3PWLA 3U83A 1NFDA 1HE8A 3QIWC 4Y1AA 3FTXA 5FKAB 4U3CA 2R2HA 2GHZA 3ECWA 4YR6B 4CC4C 2XWBA 3A4DA 1ND0B 1NQBA 1A21A 1COBA 3BP4A 3ARFD 5C92A 3TVMC 4GLRH 3RKDD 4NIYE 3RWCB 2A9MH 4P59H 1FVDB 1Z6JT 3T77A 5C71A 1T5XB 5IMKA 3M1BA 1S7WB 2AABL 1UXWA 3Q7JA 3R06B 1GZHA 2P5WA 5T1LD 3ETSA 1JI1A 1HSAA 3PDDA 3RTQD 3EOAA 2PXYA 4IHBA 2F2HA 3O11B 5FB8A 3O6KL 4LLUA 4UQAA 1JF6A 5GZOD 3DX9A 3PRZA 1YVLA 2XY1A 2ICWA 1JN6A 3ARXA 4YBLB 5HGHA 2KT6A 4CVXA 4DVRL 2VSDA 2F19H 3JWDL 1JZFA 5FM4A 3WGVB 4F58L 5C0FB 2IAMA 3BJ91 3C12A 3MRNB 4EE2A 4L2LA 4G6FB 1R5VB 1MAML 1S7TA 3BKYL 4W9CC 5EOQH 4U2YA 1CDUA 1S2EA 4YDKL 3BN9C 1GJWA 2PW2A 2JQZA 1K5WA 1OP9A 3N06B 2YD4A 5FUOH 3CDGA 5J0BA 2XG4B 4IYKA 4FQXD 5GGSB 4P2YA 1WICA 4M8QB 3WLBB 5B7MA 1OSZA 3MODL 3TEZA 1N26A 5FYKL 3D9AH 3LRLA 1I1AD 2PPFA 3EH1A 5CGYC 3D85B 2C9SA 1BEYL 1DCEA 5LBSH 3WNNA 4LCCC 2PP7A 2VXTL 3GPSA 3RI5K 1OAKH 1CLZH 2M1KA 4I2XE 5JDSB 5E9DB 3D2TA 3ARDA 3PUCA 3BCDA 5LCVH 1LNUA 3P2BA 1BVNT 3TS8A 1OD7A 4YSDA 2CM5A 4NPKA 4POZC 1RUKH 3CZKA 1RXLA 1TNMA 4U1KA 2F53D 3DXAE 2H3KA 2BIIA 3LKNA 3ETBF 4PRNB 4D94A 1MHCB 2CO4A 2J55A 2WLZA 2WXIA 3P4NA 2BOBB 3QQNA 4NO0D 1KLUA 2HFEA 2XKNA 3MACL 2WLIA 3CVCA 2ZCKL 3VRLE 5CZVL 1XGRB 3GSRB 2OMTA 5ALCH 2R1XA 2ICEA 3D8MA 5HI4C 2W8CA 4ZX5A 3MOBL 2C9XA 2NMSA 3H53A 5IROC 2BLFA 4JZNA 1AR1D 3MRCA 3QRBA 4FJ6A 3TWYA 2JKWA 5F3BB 1TMCB 3KG5A 4OLXL 4HUKB 1N2RB 4WWKC 3FFCB 3UGEA 5IIEA 3QS2A 5BZWA 3ZMRA 5KYYA 5IVXF 2GPZA 1IILE 1NCCL 4P4KC 4K07A 5DEGB 5A1AA 4FQIL 4AJ0A 4UAOC 1P4UA 2OBGA 3DVNB 3QO0A 3WJJA 3II3A 3BH9A 3QDJB 4EPSA 4U7MA 4OCLC 4P4RB 5J1SC 4ONOA 3GJFB 2Y7QB 1A3RH 1LD9B 2HRGA 4EZMA 4HGWA 1A2YA 1P69B 1AHWC 3FONB 4PH8A 2V5TA 3H9ZA 1AC6A 4TNGA 3C5JB 3Q6FA 4PRID 1QR1B 2K7PA 3SY6A 4EN3D 1A0QL 3VXPA 1TFPA 4L8BB 4PBXA 4ZNEA 4A7VA 4Y16A 2PYED 4U3HA 5HHVL 5C0DA 4YHKH 4ZTOL 3DSFL 1CB4A 1DVSA 1BG1A 2BK8A 4HISA 1KMGA 2XLLA 5IMOA 1RHHB 3G5VA 5JW4M 3DX3A 5JNYA 2P24A 4LRNL 4W6XB 5CJOH 2DMCA 4B41A 4HUMB 1ZXQA 2LV4A 1G7HB 2ZYRA 5DMGC 4FABH 3P9LB 5FHAH 3UO1L 5EBMA 3FTWA 3QPQC 1KXVC 2WN3A 3EF4A 4PJCB 3AM8C 2I27N 1C8QA 4LVHC 4KBPA 4Y2DD 2FZ3A 4M56A 4NJAL 4P99A 2ARJQ 5AVQB 4D3CL 5E9DE 3SDDB 4X99B 4E5XA 3IDYB 1L9OA 3BAXA 4PV8A 5ADPH 3GTTA 3VD4A 2EXYC 3JV4B 1ACCA 4BJLA 5LUMA 4P57A 1OP3K 6FABH 3CSPA 4OFPA 4OUUB 1C16B 1KXTA 2Z4TA 3OLGA 3UZVB 3RGBA 3VXSA 2QQKH 3CFBA 3ZPDA 1JK8B 5C0AB 1S78D 4G71B 4KGLA 3NG5A 4LCWA 4UOW1 2AXFB 3QZWA 4MNHB 3ULSB 5ITFB 5FYJD 2I9LA 1K72A 5J6SA 1OARH 1TSRA 4B9KC 5DJ2B 3MRJB 4ICXA 4FXGC 3HRZC 4A6YA 3VG0L 1CICD 4S1QH 4M5YL 4LNRA 4XNMB 4Z76A 4Q8BA 3OGCB 4XP6L 1YYMH 3UPRB 1AQKH 2ZXAA 3AMKA 2NSXA 3VTAA 1ROWA 3QQXA 1B9ZA 3DETD 4HUXA 2XKUA 4BFGA 2PTUA 1BVOA 1X9QA 2VABA 4AM0B 4JM2B 3FFCE 1UA3A 3OMZA 1VGKA 1C5DB 4PJEF 1J0YA 2DH3A 2F18A 1SEBB 2JJTC 1EK3A 3L16A 3MRDB 5CMAB 2N0KA 2IOIA 3IMUA 1C9SA 5EO9A 3QQDA 1BZ9A 2WCGA 4KITB 1S3RA 2IDTA 3FQTB 4Q4EA 2VE6B 2UYLB 1LEIB 1JERA 1T04A 1YNTF 2J1XA 3QDJE 4EUPG 1DQDL 4ILDA 2EIZB 2FSEA 2GYSA 1WO2A 2R15A 1FL3B 1L4IA 3JV0A 3N42B 3CK0H 3QPXH 4TSCL 4GY4A 1T0PB 3VI3F 4ZMXA 2DLGA 4JG5A 1RZ7L 4DCQB 1JPTH 4AE1A 1Q38A 2EIBA 3C9NA 4UYPA 3HC4H 3WNMA 1T2QH 1BM3H 3AS3A 3VAEA 3T6XA 1AQDB 4ZK8A 4FQCL 1CD9B 4R7DA 2BMKB 3BIKA 5HDQL 1BLNA 5F2FA 2AXJA 1AD9A 2GFBA 1UOWA 3T3MF 3UZEA 3PWPB 3AREC 1UZ6E 5DD0H 2H1XA 1FCGA 3FU8A 3GRWL 3QUKB 3LD8C 1RUQL 4M1DL 2JKRM 2A6KA 1OZTG 3FTUA 4XC3L 2ZZUT 4FLSA 2EZ0C 5AZ2H 3GMLB 3GWJA 4PJCE 3QXDB 2ZX6A 1GY2A 4K71C 4D9LH 1J48A 3ABGA 3EAKA 1NMBL 1DQIA 3GSQB 2HN7B 3RZCC 1A3QA 1WFTA 2R9HD 4FFVC 1D6VL 1FZKA 5D2LF 2W60B 1UVQB 1NSNL 3BWAB 1OCWH 3TN0D 2HJLA 1G7IB 1E27A 1PY0A 4Y89A 1AKJD 4NGHL 3X12B 4FNSA 2DF3A 5C0AE 3KEHA 4D8PA 4MSWA 3MRPA 4FI8A 2DQEL 4TQHA 4RCAA 3EJZD 1YEJH 25C8L 2WBXA 3N55A 3P4OA 5HGDA 1BX2A 5E0QA 4AXWA 3H9HA 4YE0A 4IIQA 3IEAA 4W1TA 4JFDD 1W72H 3B7UX 5J9PB 4KK5C 2VR3A 3CD4A 2B2XL 3JTTB 2EECA 4G8GD 3BQUC 5T1MA 1U8MB 3BISA 1OT2A 2NR6D 3CFMA 4U6HA 3SGEI 4AYEC 3V6ZA 3AQDA 2BSTA 4A67A 4GG8B 3T8XB 3QNZB 3QEUB 4MXVE 2D73A 3IF1B 1JRHL 4ZW8A 1OEZW 9PCYA 4NERA 3D08A 5EFIB 4APQA 2V37A 1SUHA 2O93L 5ESAA 5JOPD 4JHVA 1H5BB 4AGMA 4OZ4B 2JTYA 1GC1L 3TWCL 2ED9A 3VNYA 1EO5A 4HJJH 5I74B 5GZNC 3V9CA 4HQQH 1B6UA 1DZBA 4H1LG 1GCYA 4RAHA 5GGRB 3U36B 2KBGA 3FK3A 2Z0UA 2NW3A 2VDLB 1MI5A 3TYFA 1JD7A 3P4MA 2IMMA 1MWAL 4HXBH 5E6YA 5FA3A 4C55A 5I16A 4L8CA 5CFHA 4KXDA 1IL1B 1VENA 2HTKD 2AK1L 3F7YB 4O2CB 1ZS8B 2W95A 1BVLB 2W5PA 5CEXB 2FYVA 2VAJA 3DC0A 4NQSA 1H8OA 3OPZL 3OZ9H 5TFSL 3PWPE 3U7YH 4IMLB 3POCA 4M1GL 5I8KH 2X42A 5IOPA 5LXGL 3KYMB 2DN7A 1PY9A 1HEHC 4HWBL 1EZLA 5TD4A 5I0DA 1L7TL 4PYGA 1RZIA 3TH3T 5G55A 3WTXA 5ID1A 1X5KA 4B9IA 2AK4A 4JG0H 1XEDA 5ENWB 4XNQA 3STLB 2ED6A 1P5VB 1A9EB 1MW0A 2PO6D 3D25A 3MGOB 4JANB 4GRWB 1BJ1J 1H9DA 4BUGA 4OF7A 1AACA 2ZF9A 3IDNB 2FT6A 4W68A 2GJ6B 4LB8A 5F9OL 1FNHA 1LWJA 1FNSL 1MCFA 3ZT6A 4S0SD 4K8RL 1UCBL 4YGAB 5BOZG 43CAA 3UH8A 2APWA 3WO3B 4AGNA 1AYOA 2VUYA 3S36L 4QHNA 2YZ1A 4Q9QL 1N12A 5DWPA 5EZIH 1F6AA 4EJ1C 3SJVD 4FQJL 5IB4B 2QHRL 4L5FE 2FJSA 3EYOA 4V33A 4QHMB 2RHEA 2KZ1B 4PVBA 1I1RA 4FFYH 4OGQC 1RZ8A 4TL5A 4ODXA 4LF3A 1TKWA 5AW4B 1W8OA 3T3PF 3EYFB 1ASOA 4YL9A 4LOEA 1ZT1A 2I69A 2VDKL 3UTSD 3CDCA 3RURA 4NWTH 4BH8A 1BW8A 2Y2YA 3CN2A 3OXRB 4WZ9A 3GSNA 3VGGA 3L5WB 4EIZC 1OAYH 4KTDL 4QHKI 1IBZA 3RU8H 4J4PA 3D0LA 3SE6A 2MJWA 4I0PD 4C47A 5FGSA 3M8OH 5SWSB 2H2PD 1RVFH 4L8DB 4MLIA 4PW3A 43C9A 4ZFQA 3RX5A 3EG9A 3GZPA 5KN5B 4HOZA 1L3NA 3BSZL 1UCTA 3VACA 4WNJA 1M3IA 1EAPA 3NK4A 1NUDA 2D0GA 2O5YL 3LNGA 2BDNL 2Y5TA 4NRZB 3T1WA 2ARJB 1PCSA 1M7XA 2P5PA 2P8PB 3N43B 2WNGA 1K3IA 4HG4J 1AGFB 4HH8A 2IANA 3JVFC 5ADOL 3LZQA 4AYBA 2X9YA 2GT9B 3MR9A 2V9TA 4FCHA 4Y19B 4FL4C 1IQWH 1G1YA 5GRWA 2A6DB 4DUWA 4KI5F 2Z31C 4Z7QF 5KYXA 3RVWD 5LLIC 4QRSB 15C8L 2AJ3B 2PWGA 2WCSA 3B7YA 3BUYA 4Y9GA 3S4SA 4XR8C 3CFCH 3V0AC 3SE4A 3MNWB 3FAXA 2ZYHA 2D2OA 3WEAA 2WKOA 1LO4H 5CF3A 3CFKB 6TAAA 4FEIA 4R8WL 5FM5O 5KSBF 5I8CA 3O6ML 5HYSA 2VITA 1KJMA 4X98B 4DP9X 4UTAA 1O7DC 3FRPB 4O02B 2X9ZA 3SGJC 1CN4A 3TF4A 3X11B 4OZIF 1OAUL 2EH8L 3T1FB 4FFWD 2NY3B 4X6CF 2FL5B 3UXFA 4GRWE 4AX3A 4CA4A 3OJVC 2WKLA 1HNFA 4HK0A 3KH3A 4JO4L 4XPTH 2GJ6E 1W16A 4AQAA 5CINL 3Q48A 2DLTA 4HWNA 1BD2D 4HEME 4FQ1H 3V4VA 2HKFH 1OVZA 5DZVA 2CR6A 3VFUA 3GM8A 2JXMB 1GW0A 2K6WA 3TV3L 1A7RH 5T5FL 1TLMA 2XG5A 1MAKA 3MO1B 3KLAB 5EIVA 3EUDA 1G5GA 3KPRA 1LEKA 1B3JA 4OH2A 5EUOF 2CCWA 5DSCA 1H0DB 1K5NB 4N9GA 2R56H 3PWUB 3ARGD 3Q1SH 4KO9A 1PNCA 2IXQA 4PS8A 3X3FH 1A4KB 2C26A 3MRMB 4XMKH 3VE0A 1WCQA 3VTMA 2K9UA 5C08D 3NZHL 4MJ4A 4X5XB 4HT1L 3TT3H 4M4RA 2J1YA 4U4BA 1PKQB 3SDCC 5JO5A 4G1MA 3O9WB 2QDWA 3LZNA 4FQQA 4D0CA 5IT2H 4P2QA 4TNWK 1OSYA 1WS7A 1ET8A 1P7QD 2BFVH 2K8MA 4JG9A 4R7NA 4XCCH 3IFNH 4PJFF 1BZ8A 1PD1A 2WB1A 2VT0A 4PWFA 1KYAA 5SWSE 3VQ2C 1OWRM 3VXTB 3VCLB 2K1MA 4CVZB 1DQQB 4CN1A 1OPOA 4KRPD 1ZS2A 3O2DH 2IV9A 4KKCC 2WLJA 3S5YA 1RH8A 3BKCH 3RZWA 4G43B 4JPSA 3QDMD 1ADWA 4XBPB 5DZJA 1OV8A 1X5FA 3B9KD 1EAOA 2RACA 5TDOB 3FB6B 1YN6B 4NRYA 4JKNA 2EYSB 1XGQB 1RMFH 1FNGA 3HG4A 3HPLA 3MYJB 3UADA 1Z5YD 1VACB 3P30L 3QNYB 1BLIA 1U3ZA 4OQ1A 3N1MC 2HT3C 1KIUA 4YDVB 5C7XH 3HMWH 4TN9A 3S34L 3UJIL 4Y19E 5CN3A 1KN2H 2AXGB 4JMXA 4KXBA 5F7WC 4XWOD 2ADGA 2OXHA 4JDVB 3WTUA 3HN5A 4JE0A 4JFED 5I6LA 5E51A 2HYMA 3JSSA 1QQDB 4BWWA 1I8IB 1FP5A 2CG9X 2DQTL 5FWQA 4M29A 3ZKSD 5ILTH 2YGVA 5D7LB 3S3CB 3KCPA 4AC4A 5L6YL 4BQ6A 5EEXA 4HG4K 2XPYA 4L3CA 3KPLA 4GUPB 1BBDH 5K93A 2BNUA 4X6DA 4ZD3L 4OJEH 1F02I 3X14A 5HYJA 1XBDA 5I6OA 2EDFA 4PGDB 3FQWB 2X4QB 3DVGA 5I6MA 3E0GA 3J27A 4OCNC 5C0JB 2P80A 3GSXB 3KXFE 4AQ1C 3SY0B 2VDNL 5FLUA 1C7SA 3DPBA 1OM3L 4U7KA 4X0NA 1ZSDA 3PV6A 2FJHB 1MFBL 5B4MD 4QYAA 3UPCA 4HX1B 5E1QA 4AYFA 3VFWA 5KZCD 4F2EA 5KS9B 1EDYA 2OFQA 1YNKL 4EI5C 5AVZB 3W1ZA 3LH2L 1PJ9A 4TRPL 3SKMA 1TVHB 3O3UN 4CMHC 4WO4C 2G3MA 1QR4A 5PCYA 5BVPL 1TTCA 1VFUA 3LZRA 2DQDL 4HS6B 4JFPA 3FZUC 1OB1B 2OR9L 4PJ9D 4X5LA 1U58A 3WJMB 2WOBA 4LKCA 1MCPH 3GM0A 5GISL 1XDTT 4P46B 3T09A 3ATEA 1A5FL 1FO0H 2EYTB 3KPOA 3NN8B 2ZYSA 4KROD 1EVUA 4LEXH 5DFWH 3NVQA 4G59C 5IG7A 2CBMA 4K4KA 5C07B 3G5XB 3WAJA 3NCBB 4AV0A 3TCLA 1PKQE 3HZKA 2CRYA 3ORJA 4KQ3H 3FHQA 3H9SD 4E2OA 2OP4L 4K7PX 2YD1A 4AQOA 3FB5B 4KJWC 4JZJA 3U25A 2IALB 2QVTA 3ILPB 2X89D 2NY0B 1JV5A 2VMJA 4KY1L 4J1UB 4N2MA 4ES8A 2Q76A 4M48H 3HZVA 3RVTD 4MCZA 1P5UC 3J8F7 4BK5A 5B39A 3DBXB 3F7QA 3HE6B 3LS5H 2UY7A 3PGFH 5IJDC 3B4NA 1PTZA 3KWUA 4KHTH 5IK3B 3SYCA 1NBYA 4MJ5B 1GGBH 4X5WA 3LAFA 1A9BA 4G9FB 2QADB 5T3ZL 1E67A 2XN1A 2QVIA 2HZHA 4MQTB 2IGFH 2AQTA 3ZBMA 4L1HA 4JR9L 3CFDB 3VSUA 1B4JL 1J1XL 1QFOA 5JW5A 1T66C 2A99A 4PVMA 1MSPA 2Q6WA 4UT9A 2H26B 1NUNB 2E86A 2J72A 3GKWH 2VR6A 5CJXC 4X4YA 3FOLB 2CM6A 3C6LA 3MV8A 5D7LE 3NIFF 2R4SL 1P4LA 2W91A 3CXDL 1AY1H 1W6LA 2WWNA 1HK6A 1HOEA 2L7EA 4QYOA 1AI1H 3BUIA 4YHLH 4ZTPL 1JXDA 1QP1A 1X9LA 4RFEA 1BXUA 1GKOA 1YEHL 3QDGA 1W91A 2OR8A 4BZ2L 4CSTA 1P7BA 4HKZA 1N6VA 2Z8RA 3FU7B 4R4BA 2J20A 2UZIH 4EO5A 1X4YA 4AL8L 2X6CA 3X1FA 3BN3B 1FZOB 1CC3A 5TK2A 4YE4H 5DD6B 3FT4A 1KJ2A 2BCKA 2MKWA 4GB9A 5EWIL 1THAA 5KS9E 1BA9A 3J2PA 2JB6B 2CD0A 5E94B 1EGJA 3VSQA 3DJSA 1IRAY 5IJKC 5LGHH 5AW9B 3NP4A 4G1EB 1I3RA 1F4XH 1CVSC 4H7VA 1W9XA 4RGNC 5EOCL 1UXMA 2CXGA 4HEPA 4QNPE 3NA4A 3LQZA 4KDWA 2AEWA 4LAQL 3EH2A 4KZ0A 4NI3A 4IHOA 1F0LA 2OTWB 3OM3B 2DYRB 4U1MA 3WKQA 5KBLA 3QRFM 4BH7B 1HHHB 5C07E 4JHWH 3GXDA 1OK8A 4BSWB 1YRKA 2P5EB 2GAZB 4IOSA 4UF7C 3B5HA 1B0GA 4GI9A 3ZHFA 1X5MA 4WY7L 3GDCA 3QNXB 4PWJA 3KYOA 4N0FB 4NDMB 1WWCA 3O41A 4TQ8A 4FXKA 5DJZB 1FAIH 4Z7UA 3VYOA 4RMTA 4E0RB 1UWXK 2AJSL 2EKSB 4Y8DC 1MG3C 1YMHA 2BZCA 3HG0A 1T4KA 1DQJA 5EZJB 5F7YC 3VD0A 2G5BB 2ADIB 4J39A 4YXLH 1OP3H 1K8IA 4Y4KB 4PJXA 4DEPB 1UJ3B 2OSLB 2X40A 2OYMA 4XN4A 4AH2B 2BS8A 3LEYH 2JJUA 4JFHD 5DRXB 1LO3H 1FVEB 1AGEA 1HHJA 3L17A 3L1FA 4FKHA 2Z4QA 4K7PL 2CRIA 5F1IB 3FF8A 3ROOA 2B9BA 4ZUVB 1U42A 4G9FE 5C0BA 1O5PA 2ZKHH 2G5RA 4P3DA 1IM3B 4AVIA 4WI8A 5GS0C 1EEZA 2VDML 4YHIB 5DMIL 4RX4D 2F8IA 4XWGL 4BHUA 4NO5A 4IJTA 3F04A 2BVQB 2XWXA 1MRFH 2GSMB 3KDPB 4CSZA 1HHGA 2Y36H 3F12B 1IKNA 1U8QA 5ICXA 3OGOE 5ANMA 4N8VB 4YSPA 5D1QA 2WZ0A 3VGEA 5IREA 3HOGA 4MLSA 1II4E 2C9UA 3TASA 5C09B 5C9JB 4B0MM 1KZQA 5DC4B 1RIUL 1KCLA 1GH7A 4MZRA 4KJQD 3GRGA 4NKDB 1GR7A 5KVGL 3HNSH 4GMTH 1CVRA 4D9QE 1XF4A 1HN1A 4HC1H 2A9DA 3LXAA 4PJDA 1FZJB 5E00A 3PAVA 3VM7A 3CFQA 4KX7A 4BXVA 4I9WE 1J0HA 4WW2A 2L7UA 4HH9A 1UADC 1RZPA 2LU7A 2X53A 4LSUH 3NPSC 3VX0A 2E56A 2YKKA 4LPTA 4H8VA 3QUXA 4PJAA 1SXSA 1IGIL 1R9FA 2EC9U 4ZMYA 2HUEA 2JKNA 3VDAA 1E8YA 2ZNWA 1E9QB 4YSSA 3G5ZA 3CFNA 1JP5A 1VRSA 3MBWA 4XX1E 3ZDZF 1WGVA 1E90A 3LHPH 1QRNB 4BDVA 1CE1L 2VLJA 5E9NA 3ISRA 3DXAD 2P8LB 5DVLA 4AUYA 3OKNA 4IK6A 4HKBB 3HB3B 3KS0J 4YPGA 4FHKA 1KENL 4DF9A 5E2WL 2ZJSH 5L0QC 4FYSA 5L9DH 1G9NL 1AQMA 1JZ3A 3UBXB 1QLEL 2AQ1A 4NSKB 4OD2B 4OZHF 3AAZA 4HSCX 5KSAD 4Z7NB 2P5EE 1FORL 2JELH 3S48A 1L9MA 2NSQA 3D4ZA 3CBRA 3F83A 5DGRA 3VFMB 3BWSA 5LJYH 5K33A 4OJCA 4AG4L 1D5IL 1JCVA 3AQXA 4F7MA 1YPZA 3HN8A 4QTHA 3UABA 4P23D 4HAKA 1C08A 4LVOC 1T1XB 2QKIB 2IPTL 2Z1PA 5GS2D 3KW7A 4L9DA 5EIIA 4LMQI 1B2WH 4OD1L 5FDYA 2VDOB 4NZFA 4M1CC 4BQ8A 5DQDH 1IBGH 4HVBA 5GS0H 5KVDE 3HI5L 4H88L 2YBRA 4GMSL 3BP4B 4R0LC 5F72S 2QQLL 3FFDB 1NCTA 3IXAB 4GRLA 4FAAB 4LO9A 2EDHA 2VRKA 5CUSH 2R2BB 3FSAA 1MIEH 3TBVB 1Q0EA 2BWQA 3IJSA 1JUFB 3M1BB 4Z3IA 5JIMA 4MBOA 1DJSA 4UQBA 5LG6A 1RZKH 2NDGA 4G7VL 2W38A 4JKKA 3MRIA 1JDAA 2PXYB 5AKVA 4G6FD 4GO9A 4NUGL 3IM1A 5C09E 3SGDH 2DPKA 5EU6A 3EO9H 3H2PA 3EO1B 5DWUL 2E46A 3L4XA 3TBTB 1JN6B 2G9HB 1MJ8H 4QXWA 5IB1A 1MHPH 3V4PL 1M05A 3AJ7A 4HCFA 5SWZA 2XWCA 5FO9B 5L7XH 3RG1C 4NQEB 3DHJA 3PXHA 5DJCA 4YWGL 2ITCB 4WCYH 4C58B 2QLYA 3WN5C 2CIKB 4RFNB 5MI0C 4PJ7B 2VLLA 3AG3B 3D85D 1WDAA 3VXMB 2OJZH 5DFVC 3ARZA 1RJYB 4HUNB 3QHFH 4LSPL 1J11A 5E9DD 4KKRA 1EO8L 3CDGB 5IKCA 5E2TH 2VXUH 2FGZA 3HAEH 2HFFB 2OMWB 1CTMA 1FNFA 4LGRB 2FATH 5L2JA 2L4OA 1AQHA 3N1GC 4HHGA 1TQSA 2CK2A 5FV2A 1UOVA 4CU7A 5HDBB 1FLRL 1QRNE 3E9UA 3CZEA 5GSRB 2F54B 2Q10A 1JVOA 5D7SH 3HR5B 1FFNA 3CIQA 4P5TA 4LL4A 2P45B 3JVGC 3CZLA 4YDNA 3AACA 1BAWA 4EBQH 1J5IA 2X4PA 3ARDB 4D7PA 3CQPA 5D72H 1LNUB 4M9PA 2X3AA 1E6JH 4IRSD 3WSQL 3WXVL 1CFTA 4TNFA 4B27A 4NQDD 1KJVB 2GITB 4PCTA 5TK4A 3WAKA 4HJIA 4BM7A 2UXGA 2W59A 1P84K 5BW7A 4Z7NE 3MFFB 2BVOA 4U1KB 3MTRA 1A9VA 1QFWI 2NT0A 4LCYA 5D6CA 1E5UI 1TQVA 2YD7A 3L1OH 2HVKB 2EUXA 3FFCD 3ZU8A 1KLUB 4Y5YB 2XKNB 2Z34A 3T6ZA 3T0DA 4WV1C 4ZW7A 4JG1L 3VVVA 2FYYB 2JKLA 3QIWB 1HWWA 2OMTB 1MRCH 1MFCL 1D5ZB 3EDDA 4MMZC 3FTVA 1IX2A 3QCVL 1XXFC 1DDTA 3MRCB 1OOWA 3RX8A 4UYQA 3ZL1A 3G5YB 1H6FA 3QDJD 2I60L 3ARUA 3IFOA 3TVMB 2BINA 4NKQB 3AT0A 3FS9A 3T8VA 3RDTC 3HI1A 4IMKC 4GBXC 2B15A 5CBAA 2FGWH 1JYXA 1XIWD 4PJBA 5EU7E 5AOJA 3TYGH 5C0EB 5E70A 1QEWB 1F5WA 2UXTA 3KPNA 1NAKL 2C3GA 4I87A 1ZGLA 1NBZA 4RISL 3CSBA 2P7TA 1RK0B 4HW6A 3N41B 1JHLH 2OZ4A 2XTJB 2YO3A 3GNML 2RFXA 5H37G 1ETB1 1AKPA 1R1CA 4FZ8H 3L1GA 1BGXL 4NKIH 1T1WA 4NQEE 4IRZL 3C60A 4YSEA 5IFAL 2CIIA 4K23H 4X6FA 4R90H 4Y7OC 4UT6A 4ADGA 3ZGIA 1LP9A 2MKLC 4PJ7E 3PGDA 2WJ5A 3OKOB 2VISA 3VXME 5JHLH 2F7QA 3FQYA 4HCGA 1PZCA 5CFAA 1PVHA 4FQHB 2YBGA 1WV7T 4NT6B 4PJHE 1KB5L 2DM7A 3CVHA 3SDDD 3JWDC 3O2VL 1MCDA 1ZCRA 2LLLA 3MJ7B 4MXWL 3LTVA 5C3LD 3N9GH 1I9RL 4XCNB 4W9ZA 2O6FA 4G8IA 4PCKA 1EEYA 4WSGA 4Q4IA 1R19A 2HP4A 1UG9A 5KOMC 4ELMA 1NCBH 4JJOA 2Y07H 4L1DA 3RFZA 4F2MB 5HDBE 3RVXD 3VFVB 4ZFGH 3C5ZA 2CNZA 2RR3A 2F54E 3I3DA 2BVYA 2WQWA 3JUYA 4D0DB 1HU8A 2XUWA 4EZLA 5GRVL 5C0AD 2DM4A 2X2JA 3L7EB 3BH4A 5FGCB 1E4WH 1TZIA 2HVBA 4RNRB 1QSFB 3PF2A 3TZVD 4DEUA 3BGMA 1X6LA 2F7OA 4I18A 2Z7YA 1J8RA 1SOKA 5FCUH 2NYZA 1GS7A 3ES6B 4L3FA 1UZ8A 1DJZA 1KXTB 2HMID 4WFFD 3TNNB 4ZPVA 2P26A 3VQMA 1JWUB 3FMGH 1S7VB 4LCVA 3U4EB 4CDGC 4E36A 1F6LL 3C8KA 2I9LB 1T0NA 1IUZA 1TTFA 2WBJA 2OJEA 2BSRA 4RGOH 1BIIA 2AJXL 5LBVA 1G6RH 4FG6C 1XZWA 3PE9A 5D70L 4IBZA 4Z76B 4R4FL 4NENB 5CN2A 1BV8A 4KNSA 1I8AA 2YQ2A 1AGDA 3VDCA 4DGYL 5C2BH 3N2JA 2FCBA 3F65A 3DX4A 4WWKB 4HUXB 1IGCH 1U2HA 3MLRL 3JYCA 1ZXKA 1DBML 1DVTA 5I1IH 1TU2A 2DIAA 3DIVA 2OMZB 4X7EC 1BJ1H 4HDIA 4P4KB 4YK4C 4DKTA 2NY1C 3MOAH 4UAOB 5EO9B 5EA0H 35C8L 3P77A 2PCFA 5ACZB 1KEGL 4B6ZA 1HL4A 2K45A 2DDQL 1KC5L 3E80A 4JHAH 1Z32X 2DQJL 4B53A 1T04B 4M8RA 3LKSB 3O3EA 4MNQA 2C4FU 5A6IA 1OPGL 4PSPA 2FSEB 4R84A 4PCSA 1OTTD 4UCFA 4BXSV 3GQFA 3BAJA 4XBEL 2XTJE 2H6UA 2DQHL 4JPKL 1PAMA 1X5XA 2FE0A 3C9NB 1WTLA 4WKXA 1UFUA 2F7PA 2ZKYA 1SFDA 5HY9A 5BQDA 2VDQB 5EOCJ 2IPUK 2Z9TA 4PGCA 12E8H 3K2UL 4KXAA 3ZW3A 1NIDA 3QFGA 3K71B 1T0MA 2EC9T 4FYQA 1GW6A 3UTTA 4DVRH 4S2SA 1BLNB 4RAVB 2ZUSA 3JWDH 3CC1A 4JN1L 2O4EA 2X4SB 1JHTB 2F68X 3JV6B 2CJ3A 2E7HA 3QEHB 3FCBA 4M7ZC 3RVUC 4B3EA 1MAMH 3BKYH 5HJ3B 3WXWH 3DURA 3AUVA 2VXVL 4JGJA 4V1DA 4GQ9L 3L4YA 4Z0BL 5E7BA 3RHWK 3U48A 2P4AB 2VM3A 4LVHB 4G70B 4F2ME 4LLDA 3V9FA 4XRCA 5EG6C 5I18L 1PQZA 4JDZA 2Y3NA 4L29B 1U3NA 3BT0A 2OTUA 2XZAL 3MODH 4Y2OA 5EO1A 3TCTA 3V95A 2XIIA 1WBZB 1T4WA 3B8YA 3IDIB 5FGCE 5GRJH 1VHPA 1S9YA 3N1FC 5EC2A 1QSFE 5GSVB 1YDPA 3RGVA 4HIQA 2EVIA 1FZKB 1KY7A 4XXCC 4AJVA 3B2PA 2FLMA 4HS8H 4IDJL 2E7DA 3ARYA 1FVCB 3FCUB 2J5WA 1JMZA 3DGGB 3SKNA 1HXYA 4RMWA 4URKA 1MQ8A 4NKOA 3PCYA 2Y1VA 1WIPA 2XN9B 1JOIA 2N01B 2HJKA 3MRPB 1E3ZA 4FXGB 3HRZB 4MSWB 4AJWA 2DKSA 3X3GL 3RB5A 5HHNB 3C5XA 4XHJC 3VO0A 5D2NA 3CTTA 3T2NL 4AXWB 3IAGC 4IIQB 4WI2A 1CI3M 1M6UA 1QNIA 5EO0A 5T5NF 2BSED 5E4AA 3R0MA 3M86A 4KKLD 1OOAA 4K5OA 3C08H 1NAMA 2FBJL 5T1MB 4DN4L 2MRYA 1V3JA 1ORSA 4XAKE 3BI9X 3QDAA 3UBXI 3ZZSA 4FQLH 3V6ZB 2ZCKH 5CZVH 4E9YA 4YVUA 4OIIH 4CSSA 4HUWA 3F7LA 4U33A 3MOBH 4FI6A 4XE5B 4QRTA 4APQB 4XHQA 4Z78A 5ESAB 3VJ6B 4KTEL 1G7PA 3MXVL 1EEQA 3BKML 2JJSA 3EIFA 5D7KE 5IHHA 1MFUA 4WF7A 1HQRB 1OW0A 1BXXA 2WQAA 3ET9F 2A77H 3ARFA 1WBXB 4FQIH 4KFMA 5JXEC 4HIHA 1TJGL 4X8JA 5SWQB 2YAPA 4WW1A 3F5WA 1TO4A 4L8CB 3V52H 2OCJA 4I5BA 4R7XA 1E4JA 2BNRB 5T1LA 3RTQA 2J8UA 5FIEA 4IU2B 4NCC1 2H0FA 3AREB 5GZOA 1HL9A 4O2FA 3IWVA 3OKYA 1A0QH 4MS6A 4XO9A 4YO0B 1RK1B 4YL4A 1YY9C 4ZOAA 3ZX1A 4QXGH 2D2CC 1BCIA 4U1JA 4J2XA 2GJ6D 5AOIA 4F5CA 1ZDSA 2J1WA 4BE5A 4C4KT 4AGQA 2OYPA 4K71B 4XB7A 1S8DB 3BIAX 5DHVH 3EJCA 3ETBJ 5CD5C 1RUAH 4TNVK 4G6AC 3SE3A 2KC0A 3VXNA 3RZCB 4BELD 3ATDA 2CAKA 4WIQA 3VFNB 2DQGL 4TPRL 3BZFA 4PCYA 4FQXA 1KFAL 1MHEB 3UO1H 3GIZH 3U2JA 2R23A 1BZOA 5TE4L 43CAB 3ZTNH 4WU5B 5HXMA 2DQCL 1I1AA 1TQWA 4NJAH 1QEXA 2I9TA 4D3CH 1GGUA 4J3UA 4OFVA 3S3PA 3HZ3A 4KKZA 5DJXB 2EDRA 4P5MA 1AE6L 3M7OA 3NIDF 5DJ6A 1F3RB 6PCYA 2XN9E 1RJZB 1UA7A 2WXJA 1JFQL 1TVBA 5FAAA 3FQNB 3EJSA 3KJ6L 1PLBA 2ZXDA 1GMEA 1GPOH 3L3IA 5SWSD 3K2IA 3DJZA 5IB2B 2P8MA 3U30C 3BQUB 2WSKA 3MYZA 2F53A 2ZP8A 4N20A 4QHLA 3A5VA 1DN2A 3ZRFC 4N0YL 3BP6A 1CUOA 1OT1A 2ZXEB 5D5MF 5CZXD 1MLCA 3MJ9L 4NO0A 4M62H 4XBMA 2BS71 4JRYB 4K3EH 1NMAL 1XB6A 4XP6H 2X28A 2VLME 4FKKA 1KBVA 1CGYA 1PX4A 2FEEI 3GBNL 1EAPB 1BM7A 3SE9L 4GAGL 5F0LB 1FN4A 1EPFA 4Y19D 5L4FA 1U30A 4EEEA 2UZXB 4WK2B 2V7HB 3D06A 2CLZA 2HG0A 5D7IB 1UWXH 3P0GB 4K55A 4XP9H 3SDYL 3T4AC 4OGYL 1L5GA 1YA5A 1KCUL 2IANB 2WTOA 5DK0A 2OAAA 2EXWC 2V9QA 1QKZL 5HGAB 2YAHA 1MQKL 3GXTA 1KTJA 4JRXB 4LSDA 1DQDH 1Y18A 4N1CA 5AW0B 3FO0L 3NJMA 3U9UA 4F3FA 5C6WH 2BNRE 2BRQA 4PG9B 5IQMA 4TSCH 3DDGA 1GXEA 2ZCHL 3QCTL 3EFOA 4KH9A 5IJCC 1GC1C 3VRLF 1RZ7H 1Y6KR 4P07A 4HJSA 1OSPL 4YPJA 3KJ4C 4QXTA 2IADA 3KXFD 4IU3B 4HOXA 3BUYB 2HCZX 4S1DD 1RZFL 4PRIA 4FQCH 4EN3A 3GSVB 2DLEA 4LHJB 5HDQH 4U1NA 2GBAA 4JFZL 1CXHA 1SEQL 2PYEA 5FO2A 4A6YH 3FTGA 1XO8A 1JXGA 2Q0ZX 3SDXA 4LP4A 2BY0A 4JQXC 5DZAA 3L3OC 3GRWH 2BZDA 4WQOA 3EOBA 2VH5H 4FJYA 1OALA 4XC3H 3T0EC 5FLVA 2OSYA 4HK0B 3C8DA 4P05A 3T65A 2NY7H 4LHQB 4ELKA 3MV7D 2Q8BL 1OP5K 4OLZL 3QUMA 3WY1A 2GK0A 1IEBB 3VFUB 3X13B 1I7ZA 4GEIA 2IPKA 4IJ3C 4Y2DA 5E8EB 4YHPA 1IT9L 1X7TA 5AVRB 1S7UA 4GPVA 5EOTA 2F1AA 4WUUB 1QFWM 4UQCA 2Q86B 1AS7A 3C2SA 1G9ML 1NSNH 3KPRB 1DVFC 3OHXA 3U7AA 3EOYG 3QBTB 3ZR6A 4OJFH 4K8RC 4W4OC 4NGHH 3H4HA 3BRGC 3V0JA 5F70A 1J1OL 1JS4A 1NL0H 3FYEB 4V11A 2DQEH 1SY6A 4QY8A 3IKCA 5JO5B 4ZPTA 4FQQB 4FHJA 4P2QB 3KNBB 1YAIA 3CZGA 3N1QC 5DVMA 1HCFX 3MCLL 4JRYE 2DRUA 1RD6A 2FT7A 3QJSB 4ZOEA 3VQ1C 1AANA 1CICA 3FL7A 2C4FT 1GJUA 2XYCA 3SGKC 2M83A 4F57L 3D7PA 5CCKL 4D0BA 2DOCA 4GQQA 1CFMA 3LV3B 3L9EA 3MUUA 3ZHKA 4B9YA 3D18A 4GAYB 1PX3A 3EYSL 3OC5A 4X5RA 4Q2ZB 5D7IE 5DRNB 5EPMB 2BVPB 2I32A 4MJID 2X4OB 1JK9B 2IANE 1GYCA 2NUTB 4QHKJ 4GW5B 5HDOA 5DD5L 4A2GA 4ORGA 1EXUA 5DMKA 4TULH 4JRXE 3TWCH 3OLEA 3B2VH 4FL4B 1LEGB 4A7GA 1PW3A 3ZE0B 3DJ9A 3C5SB 2AERT 2Z31B 3PABA 1DEEA 1GOGA 1MW3A 3GK8L 3PWJA 3GMPB 5EU5A 2OXHB 5HHMD 1GYAA 4MD5B 3T9WA 4K7FB 1FA4A 2MQ0A 1KXQE 3DHMA 2VZUA 2B59A 3TBYA 3K6SA 2FHFA 3KCPB 2WBKA 4FG0A 1WK0A 3FKUS 4H25B 3B9DA 5IFJB 2G4EA 3NK3A 4U1SA 2EUVA 2ODHA 2JCCA 5HYJB 1ZPLA 3OTTA 2KZWA 4DZBA 4N26A 3WIFA 2YD2A 2VRQA 2CE6A 2H1PH 4M1GH 4YZFF 4E9RA 4UM9B 5LXGH 5GGTL 3X1GA 2APBA 2XBDA 5MEOA 4YSOA 4MRCA 4HWBH 2H6PA 2F15A 1NDGB 3CQQA 4ODHH 4YDMA 3H4FA 4Q9RH 2EJ1A 1T3FA 2XOTA 1F45A 5E0FA 2BP8B 2CKBA 4N6RB 3BAYA 1Z9PA 2YD6A 3AU1A 4HJ1A 4B97A 3SKMB 4U0QB 4EUPA 3S8WA 4XBGA 4WNQA 2LU3A 1EZVX 3L3KA 4WUUE 1UCBH 1HIML 4OGAC 4TXVB 4XH2B 2FJFB 2K6ZA 3KPRE 1J87A 4YXHH 1P6FA 3F00A 1KCRL 2NY0D 4ACPA 3SPIA 5HYEA 5E95B 2OTPA 3NJNA 4DGIL 3KPOB 3NIGF 3TN0A 3SDCB 1BVNP 1QLFB 2QHRH 4XVTL 1AKJA 1ZLEA 2WC7A 5AAMA 3HZKB 5JR1H 1F3DJ 1R5IA 3QJFA 5LNEA 3GI9L 3CSYB 3FPYA 2V17L 4P2QE 1BFOA 4L0PB 4QRQB 4DW2L 5JIHA 1J7VR 1Y1DA 2OR7A 4PY7B 5I1GL 2ZAHA 4XPAL 4QRRB 1UB5A 1MCIA 4G9FD 2QADD 3H1ZA 4YBQC 3FU5A 4JFDA 4F1ZA 1ZA3B 2C1OA 2YN3A 5JLZA 3PIQA 2DQUL 4JRLA 5J7CC 1XT5A 2MCPL 3TJPA 5MHSE 5BZXA 3WTWA 2X2IA 3KR3L 4G8GA 3G6DL 1CLYH 3FOMA 5JW4N 2NR6A 3TPUB 3LPFA 1ETA1 1NBYB 5I1LB 1KPRA 5IM7A 2NW2A 2P9RA 4G80B 4X5WB 1UACH 1A9BB 2J5LC 2OZNA 3D07A 3JWNC 4NC1C 4OCSL 1T22A 1E9PB 2O5YH 3CLEL 4LSSH 1KY6A 2IEPA 3KS0H 2BDNH 4G8FB 1YZZA 2E76C 5E5MA 1OD9A 2XVLA 1BVKB 3EKCA 3DTDA 3VH8B 3ZE0E 1USQA 3G6JF 4D9QD 2Q6WB 4LLMB 2MTPA 3IMVA 5H94B 1M6OA 2GTZA 2MHAB 5DO2C 2XXFA 1UD5A 2AQQA 1YN7B 3F01A 2PCXA 3MV11 2R51A 3H0TA 4GSQA 4I9WD 1JPFA 3SZKC 5JIPA 4U1IB 5HHOB 4GRMB 1G7QA 4MB5A 4RBPH 1IQDB 3DOSA 4UV7L 2CHXA 1BXAA 3B8SA 1O7DE 3NA9L 2R8SL 1SMOA 1KNOB 5HYJE 5INDB 1CURA 1G0YR 1LJMA 2LU5A 3LKRA 4H26A 5GRVK 3VFPB 4HKZB 1SOQA 2VIRA 1MEXH 1I7TA 1QFHA 4X42A 1DJIA 5I76A 4YUEL 3KLDA 4R8WH 1R5WB 4E9TA 2I07A 3O6MH 5C7ZA 1ORQA 3ZIMA 5IMMA 2AAVA 3D33A 4IQHA 4AKQA 2TSBA 2YC1A 1F8TH 3FT4B 5ECGA 4HP5A 4IKNA 4YGVB 4CMHB 4WO4B 5L2KB 2BPBA 2RBLA 2EINB 3BD4A 1B0RB 2EYRA 2G75A 2EH8H 3O8XC 3KYAA 1J0JA 1ZHBA 1U95A 1W6WA 2P1YA 4R7LA 3NEEA 2PO6A 1FPTL 4JO4H 3WFDL 4AIXA 1MZYA 2P5ED 1I3RB 1YJDC 2YD5A 3QH3B 4G6JL 2R1WB 5DYFA 3SBPA 1AMXA 5ABDE 4ZUWA 1NM9A 2WD0A 2EDDA 2G60L 2EDYA 1I4FB 1BQHB 3LQZB 4XZUA 1M7IB 3DRTB 4CADA 1WAAF 2CA3A 3LXUX 3TV3H 1P2CB 2VDPH 3AS0A 5T5FA 3K91A 1E8XA 3TJEL 4Y4KD 1ZANL 4F7TB 1N59A 4F8NA 4HKJA 1I1YA 2YEVB 3SJVA 4XGZB 1CF1A 1CJYA 1R33A 4Z7UB 3FUHA 3ULVC 1QACA 4MGXA 4PY8I 3NZHH 5HHPB 1P5UB 4LEEA 3SOBH 4HT1H 4QRRE 1CFBA 1IGMH 3IU3B 3W3BA 1IM3D 5AVSB 1T4KB 3UTSA 4TVSa 1JF5A 3ZO0A 4AMKL 3F58H 4HOWA 3HVDA 4YQXL 4G83A 4KFZC 4H40A 3LKOB 4CVUA 4LRIA 3TO2A 2E8ZA