1KMGA

The solution structure of monomeric copper-free superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide Dismutase
publication title Structure and dynamics of copper-free SOD: The protein before binding copper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1kmgA00
2WZ5A 3QQDA 1SXZA 4MCMA 5CU9A 5KBLA 3S0PA 1L3NA 5KBMA 1E9QB 2AQPA 1S4IA 1YAIA 2APSA 1JK9A 1E9PA 3GQFA 3PU7A 1EJ8A 1XTLA 1F18A 2C9VA 2Z7WA 1XSOA 2VR7A 1MFMA 3RE0A 3H2QA 2Z7UA 3KM2A 3GZPA 4A7VA 2GBUA 1U3NA 3L9YA 1SDAB 1F1DA 2SODB 1SXAA 3HOGA 2GBVA 1OZTG 1P1VA 2AQQA 4A7GA 4A7SA 1E9QA 1YSOA 1HL5A 1PZSA 1UXMA 1JCVA 2E47A 2ZKWA 2WKOA 1PTZA 3CE1A 1BA9A 2ZKXA 2WKOF 2NNXA 2V0AA 1IBFA 1OZUA 1SXNA 1BZOA 2AQNA 3KM1A 1SPDA 1ESOA 1B4LA 1OEZW 4MCNA 2WWNA 5KBKA 4OJAA 1DO5A 2AEOA 1E9OA 1N18A 3ECVA 3ECWA 3GZOA 3T5WA 2VR8A 3KH3A 3GZQA 1EQWA 4OH2A 3F7KA 2JCWA 4N3TA 4L05A 1E9PB 1SXCA 3ECUA 4BD4A 2Q2LA 3CQPA 2AQRA 1IB5A 4A7GF 2LU5A 3SODB 1IBDA 1Z9NA 1QUPA 1OALA 1F1AA 2ZKYA 2Z7ZA 4B3EA 1UXLA 2AF2A 4FF9A 2VR6A 3GTTA 1SDYA 3MKGA 4U4IA 2K4WA 3KBFA 1Z9PA 2WYZA 1XTMA 3HFFA 3KBEA 1B4TA 1F1GA 3QQDB 2XJKA 2Z7YA 2C9SA 4BCZA 1TO5A 3LTVA 1HL4A 1SOSA 2AQSA 4A7TA 1JK9B 2ZOWA 2GBTA 1OAJA 1TO4A 3MNDA 1CB4A 1FUNA 1IBHA 3CQQA 4BCYA 2C9UA 4A7UA 1PU0A 2AQTA 3GTVA 4N3UA 1DSWA 1SXSA 2XJLA 3L9EA 2WYTA 1SRDA 1SXBA 3HW7A 1YAZA 3H2PA 2WWOA 4A7QA 1Q0EA 2JLPA 2WZ6A 1N19A 2R27A 2E46A 1E9OB 2WZ0A 1AZVA 1IBBA 3F7LA 1CBJA 3KH4A 1RK7A 3K91A 1KMGA 1COBA
chains in the Genus database with same CATH superfamily
3CN1A 4ONFL 1TTBA 3PGCB 2WWMC 3U0PB 3TF7C 1DVQA 2IQAA 5LO7A 3TBYB 3MRQB 3ARRA 5EV7A 5IB1B 4WWOA 3C6SA 1CFQB 4EZLA 1MJ8L 2ZUQC 4L8BB 4R9HA 3VMPA 4PRIB 3Q48A 1EAPB 2MOQA 4PGCB 1RY7B 4I89A 4ZW6A 4H40A 4Y2NA 2WBWB 3L13A 4M3HA 4FI8A 3VWKD 1PCSA 2DEWX 1MHHB 4YAQB 3WAJA 3H9SD 2C1PB 15C8L 4RMRA 1S7RA 4YNYB 5AOJA 1XXDC 4GRMA 5IMKA 5HYSB 2ZCLH 3U6RB 1ADQH 5ISZE 1F6LL 3QZOA 5DJZB 4A68A 2R0WH 3O8XC 3RNKB 3BVTA 1D7BA 1HXMB 4KH9A 3RGVD 1I8MA 4F15C 4FTVE 1RUPL 2NT1A 5IQ7H 3SEPA 1M42A 2ZKWA 1PTZA 3JWNH 1WDAA 3TN0D 1XF4A 4NRZA 1A6UH 2XV6B 3I50H 3NACL 2HXAA 1B6UA 3PWLA 1A6ZA 3UX9B 3OAUL 1R5VB 2VDPL 2OR9H 4HFUL 3RWFB 1OEZW 4IU2B 4MRCA 4MJIB 2R9HD 5EUKA 1XHHA 2WBJC 3JWNG 3Q0HA 4JG9A 3RWGA 1QPXA 3VUAA 3EGXA 1LK3H 2F7PA 3NIGF 2AK4A 4AQAA 4AQEA 2VJ0A 4WFED 4PI2A 2VTFA 4BZ2L 4FYSA 1NGYA 3MV9A 3VFRA 2GFBA 1ODUA 1RUKH 3ABLB 3UPAA 1GIGL 1RZJL 3DBSA 4EN3D 3FTZA 1G94A 6PAZA 2DM7A 4LKCA 1FG2A 1IC5L 4RAUB 5GIRA 4IGBD 1SVCP 4GSDL 5IG7A 3IKKA 3N1QC 2DMHA 3BZFB 4NN5C 1JVLA 1JHKH 2N3JA 4FQLL 5F0LB 3LZQA 3ZU8A 3WELA 4LASH 4OCWH 4Y4FC 1I1YA 4TTDC 2BNUB 1BAFH 4HJIA 1L4IA 1NPNA 4O4YL 5B7MA 1FHGA 3APDA 5C0GB 3DVFA 2DQTL 4QDGA 1N64L 4UNTA 3PJSA 4FQQB 4KRPC 1E5UI 3KLQA 3U9WA 3ZGIA 1EFXD 1KTLA 5I6PA 4LARH 3RHWF 1KLGA 3WSQL 2D0GA 5K9QG 1FJ1B 2ZYRA 1MCPH 4BH8A 2GCYB 5LAXB 4H8WC 3HE7B 5F1SA 4HKXA 5C6PB 2WWMD 5C0AA 1WAAE 3NK3A 1QSEA 5GGUB 2MKLC 2YPKA 5D2LE 1BWWA 3V4PL 2QV4A 5ALCL 1JWSA 3L1OH 5KW9L 1S5IL 3VE0A 2GIYA 4DKAA 1AO7B 4NCC1 1KELH 2IGFL 4P5TA 3Q6FB 4QIRA 2NQ3A 3HG4A 4NAJA 4UZUA 3L3GA 4XP5L 4YS4A 5JO5B 4X6DE 3AREB 1BVOA 4QOKE 3V9CA 1LP9F 2BVPB 1JPFB 1OAKL 2O5XL 3OGCA 1IAKB 1S6NA 4Y5XA 4KX7A 4FFVD 2EUXA 4X8XA 1JPGA 1IM3B 4N5EC 2GT9A 3EJTA 4YXLL 5C9KA 3ILEA 4DGIH 1ZHKB 4NXKA 4Y4KB 1L3WA 4FKKA 3ZQ9A 4F9LA 3O8XD 1BVZA 2BZ7A 2Z65C 2JLLA 3C6LB 5GS1C 3KCPA 2EE3A 4RX4D 2MFNA 4FQXA 4WHTB 2C9PA 3WNKA 1G7QB 1JL8A 3SYQA 3VDCA 1IC4H 3TZVC 3BYYA 3VXPB 2VKXA 5D6CB 4EI5A 4XO8A 4LSQH 4EXPX 2DJ4A 2H7WA 4AEIL 4APXA 4KNTA 1X6NA 1T4KB 3MV7A 4MZ3A 4OF6A 3MOAH 3SSGA 3JWDL 3QO1B 1MWOA 4HT1L 5KVGH 4JO2H 5HJ3B 1H8NA 4MCYA 2WBJD 4AZ8A 4NT6A 3IGAB 3BUBA 2QGDA 1MWAB 1NBYA 1K5WA 3ZVVA 1NBZA 3C8DA 3H6AA 3HVNA 4HKZA 1G5AA 1ORQA 4NQED 1OGAE 4GSXA 1F6FB 2NXYD 5IVZB 1YMMA 3BDXA 3VCLB 5EU3A 2VR4A 5E4AA 4YLCA 1A7BA 3T3PE 4GT0A 2W81C 1MCOH 2F5BH 5EORH 4JDZA 4MFHA 1IAIM 1K9TA 1NSNL 5DUBA 4QLRA 4AJ0A 1TQTA 2CHDA 1D5BA 2K45A 4Y4FD 1NCCL 1KTRL 2KLSA 4TTDD 1NOLA 4DZ8B 1NMAH 5T3XH 4U6VL 5DRWA 3MMEA 5I15L 1FG9C 5J6HB 2ODIA 1MUJA 35C8L 4MD4B 2WVSA 5BS0A 3MCLL 2EUZA 5SV3A 4M7KH 3WN6A 1AGDA 4DEPB 2PF6A 3B56A 1KIQA 3FN0H 3LV3A 3ZTJH 3P9LA 3RWHA 3DBXA 1QBAA 1R34A 2FHBA 1AMYA 4JFED 5E94A 1D5RA 4PJEF 1A1MA 2AJ3B 1TCMA 4E41A 2ZWYA 4UM8B 5KOMC 2XWRA 3L95B 4U1JB 4PBDA 2XBDA 5E2WH 4NUJA 3BZEB 1MCBA 1VPOL 4AQ1C 2BCKA 3K6FA 3MLXL 2R23B 1BQSA 2FX8H 3DJ9A 4M8QA 3ZTJG 2EIZA 3C8KA 5L8KB 1XF2B 4ABVA 1I7TB 2JKTM 3S3SA 2QHRL 4N5ED 3L4XA 3G04A 1GCFA 5E56A 5LAPA 3L9EA 1JGEB 4FRWA 3Q13A 3SN6N 3UCQA 5K33A 3TM6A 4MMXA 1N19A 4GAFB 3D4CA 4NGHL 2IWKA 4X6BA 4BGLA 3N5AA 1UUSA 5EEVA 5DQJB 5BQDA 2HX7A 3MGTB 4Y1TA 5IB3A 5DYOB 3TZVD 4DVBB 4JZJA 4FFYL 4ELKB 2W07B 1A6TA 1G7HB 1LQSR 2CGRH 3UADA 5EOCH 2KLTA 2F5AH 3QEUB 3RX5A 5KSUB 3U7AA 2I9TB 3LNHA 2YS4A 1GR7A 4HYTB 3HMXH 5CILH 3VI3E 4Z7WA 1RU9L 5BZZA 3BWUF 2NR6A 1NAMH 5GGVL 5E9DB 3GIVB 3KPPB 3EGSB 3QUYC 3N43F 5GGSY 3UZQB 4GW4B 4QY8A 1T21A 4ZTPL 3P73B 5E0FA 4DQOH 4DNLA 3L4YA 1GL4B 2VLLB 1ML0A 3HVDA 5LBVA 1U8QA 5TPWL 5D7IF 4A7SA 2W0LA 3GMQB 4HIIA 2CBMA 4HUUB 4A6YH 4EF3A 5IW1A 3B4NA 1JCKA 4YSOA 4LAQH 4H8UA 1EEQA 3PP4L 1JRHL 3N3EA 2QGEA 4GQ9H 3A47A 2FECL 2FWOB 3AAZB 1IGCH 1KTCA 1ESOA 4FFTA 7PAZA 1ZGLB 1H15B 2ED7A 2GJ6A 4NQVA 4OIFA 2UX6A 2XZQL 4PP1C 4H20L 4R4FL 1H9VA 2O61A 4N9GB 1T04A 3RILA 4ZFGH 3MRRA 3QZPA 3HC3L 3WTWA 1A7OL 3BWZA 2V37A 1YCSA 1AE6H 3S96A 3GEWB 5FW7A 2G5BA 5DK3A 2ATPA 4CMMA 4AENB 4NP4L 3FFDB 4JMXA 1EVTC 1QI3A 2HLAA 3BWAA 2DBJA 4OUOA 4R7NB 2VRKA 5HDOA 4TUJA 1KPUB 2VDPB 2ZOUA 2IO5A 1U8LB 4HDIB 3P9WB 1C1EH 3CHRA 4CA4A 3DDGA 1UUNA 3KBPA 5F1IA 3QJZA 3MLUL 1ETZA 1OARL 2B1AH 1CE1L 3O41A 5GRZA 3NYKA 2YEZA 3MV01 4AYFB 1ACCA 2W65A 4CJ1A 5HHPB 4A04A 3LYRA 1ULVA 4OD3L 2ZCHH 5HGDA 4NC2B 5L9DH 2X2UA 4MTMA 3FB6B 3K8KA 1VENA 3BISA 1UKSA 1YEDB 3FUKA 1YY9D 4O5LL 4CMHB 4HS6B 2DJMA 3RFZC 5B39G 2KKQA 3RKDC 2NNFA 1I8IB 3T65A 4UT9A 2YXFA 1JV2B 4IS6A 5DYFA 2YHGA 4X5WB 4V1DD 3QUYD 2H47C 1T1YB 1CQYA 4KNUA 3OKOA 4NN7C 1FE8L 3ZL2A 3RPBA 1ZLUH 4ICXA 2YRBA 4ZFOB 3SY6A 3TYFA 1DQJB 4JJ5B 3GBMH 4JFDE 1XTLA 2EKSA 5I1LB 4Z7VE 2JIXA 3SGKA 4OZIB 3NCJL 5EU7E 3FTVA 4G6ML 1VADB 4UDUA 3GXDA 4DHLA 3BRFA 1FGNL 2ZF9A 4DGYL 3MJWA 4LPUA 4EZJA 2B3IA 1CN4A 3L7EA 4F7MB 3F7VB 4IMKA 4OZFA 2B1HL 1E90A 3K8LA 2HFEB 1GJWA 4PJCE 1FZMB 5EU4A 5GRWA 3O9WA 2P52A 4BE5A 1E9QA 1AJ7H 1MI5D 5BZDA 5IBTH 2QADC 1JZ7A 3WFZA 2X6AA 4OFVA 2EDWA 5I1DA 1RUML 3WEAA 4U3SB 4C47A 2C8NA 1UA6L 3PREA 3MFFB 1M9WA 3HC4L 5D1XC 1AZNA 5T3XD 3X13A 5ACZA 1FIGL 3CVIL 1NFDE 2R4SH 2LAGB 4YDLB 1UQSB 3T0XA 3QWRA 5BJTB 2GJJA 4RLDA 2AQ2A 1XD0A 4XP9L 3ZDZF 3KLDA 1PZBA 5IMOA 3RVUC 1CFBA 4B7IA 4P2OB 1I9RL 2IBGA 1V54B 1RHHB 5ETUA 4Z7UF 3GMMA 1E6JL 4L1HA 1AXSB 1T89A 5E70A 3KHOA 4JS7A 3G6JA 3TIDA 2GUOA 3DPBA 1GRWA 1B0IA 3P9MA 1HWGB 2EE9A 4MA8H 5DWPA 4YHYB 1OGTB 4IBVA 3QVAA 1N3NB 1TENA 4KMLB 5I1GH 2NY2C 1T1WB 1A65A 5IJCC 2HX8A 2OMZB 1JZ3A 3RKDD 3MX0B 3OG4B 3CXDH 2PXYC 3I9GL 1ZVHA 3NCYS 3A0OA 4OAWA 3GM0A 4QHPA 1TETH 4LCYB 2HYMA 3QORB 4NUMA 4DGVH 2Y06H 4HMDA 4X6EB 3F83A 2F7IA 3O3DA 1QO3B 3AG4B 4GQPH 4L8DB 4RZKA 3ZTEA 3NOIA 2HJKA 2C9UA 3HMWH 4CADB 5FCUL 1HNFA 3AXIA 3C60A 1NOFA 3TVMB 5AWNH 4AM0B 1DVYA 4HU8A 1ZA3B 5CR1A 5J3HC 3NRFA 1GYAA 4M02A 2DQIH 4G6KH 4QXUL 1OWRM 3WEXA 1TJIL 3V0VA 2CH8A 4LLWA 3WLBB 4YHOL 1EGJH 1O5DT 3EUDA 2ARJA 5ILTL 5DUPH 4JUTA 5DMKB 3DX9A 5CJQH 3V0GA 3W2DH 1KF9B 3N06B 4CN4A 2PUQT 3OKDA 1YY8B 5C70A 3EYOB 1RK1A 2G3MA 5FM8A 4N2MA 3S4SB 4JPQA 4Q4EA 1WEJH 5T1KA 2WLKA 4Z5RB 3K2IA 1VEPA 1GGCL 5GZOC 4YN3A 1XZ0B 4JL1A 3BXNA 3PNWA 2QADD 4G43B 3BVNA 3MBEC 3H6JA 1DBBL 4M6ML 2D4DA 5BRZB 1MPAH 4PVNA 2JKXA 4P2QE 4E0RA 3BLPX 4TUUA 2XX0A 1KYUA 2XN9E 5D1XD 1S9WB 1SDAB 4KI5E 3O2DH 4LK4A 4XXDB 4D3CL 2BIPA 1R33A 2WQAA 4P23C 4CKVX 3FU3A 1T83A 2UY6A 1J05B 3GSXB 3GXPA 1BM7A 3CN0A 4I4WB 4WEBH 3TA3D 5I1IH 3RUGE 4KK5C 2BP0A 3RVUD 2AAVA 4HAFA 2MNJB 3GI9L 4FP8L 4OF3A 1JWUB 4L4VE 5GJSH 2CK2A 3KW7A 2W5PA 3PDGA 4CVXA 3AS3A 2BNRE 2JELL 4DZBA 3CVBA 2FT6A 4G8AC 2OTUA 3QJXA 2ZKHH 1P5UC 4H2AA 3RZCB 2H3KA 3EYVA 5HHQB 1Z5HA 3EJCA 3MAWA 5FUOL 5J0BA 1I7RB 1QSFA 4Y2DB 4WI0B 5HYEA 5DJ2B 4F7PA 1OP9A 2NY2D 3U2SA 5IQMA 2UXTA 2QV2A 4TSAL 1A9EB 3ZE0F 1X7SA 1OM3L 4QRUB 2PXYD 4XMVA 3SPIA 4YC2C 3SPGA 3IJ8A 1KB5A 3LZRA 4QHKI 2MRYA 3MUJA 4TQ8A 1JNNL 3PHQB 4LOFA 1GZQA 2PYEA 5CS7A 1P7QB 1QP1A 3LQAL 5F7UA 2B9AA 2A6JB 4Y1AE 4Z7NE 3RGBA 1ET7A 2QSTA 3BH9A 5I1HL 4MJ6A 3IDNA 4G8FB 4PIBA 1RL1A 5G55A 4JEGB 2CIIA 4UU9A 1VF5C 4GXUM 5J3HD 1SJVA 4LXFA 3K2KA 1KEMH 5A40E 4NRXA 2F19H 1MNUH 1BQKA 3UACA 1FC1A 2VDQB 4TOYL 4KVPA 4NQSB 5AW2B 3QR1A 2OMUB 4CUCA 2X9XA 1NDMB 3GHBL 3MV8B 1QBLL 4WUUD 3BRDA 2F54D 1BBJB 2IVFC 5JORA 4UZGA 1WZKA 1BLNA 1XGYL 4XNQB 3L08A 3AT8A 4OFYA 3MBED 4W1TA 3R06B 5GGTH 1CCZA 3QA3A 5FO7B 4MMZB 3HLAB 1GY2A 1ASPA 3HTLX 1MELA 3V52L 5GRXG 5K9JH 2OPCA 4ERSL 4YDVB 4GRWF 4JN1L 4KK5D 3IJ7A 5E8PB 3NABH 3MA9L 3K1KC 3HNSL 1JWMB 1TYRA 3PQYD 3FB8A 1AMXA 3PHOA 2XDHA 2EIBA 3B9KB 4HCGA 4X6CF 3EHBC 1XSKA 5DMYA 4Y4HB 1BFVH 3OMZA 1OAYL 4NIKB 1P69B 2BPBA 2FH6A 3EYUH 3HUJA 1OAUH 1IEAA 2CDGB 3MRHA 3KLSA 4G5ZL 4KO5A 4RRPA 1C16B 4R4ND 1KCRH 4UT6L 3QDJB 2AEQL 1KIPB 1SMDA 3Q9QA 3QEQB 1T5WB 1H5BC 4RESB 3ZKNC 1NWOA 5DD5H 3D85D 5I19H 3DV6A 3LD8C 2A9BA 1Y07A 1VEMA 5IM7B 4OLUH 2P24A 3CDGB 3QP3A 5EZOL 2B4CL 2EINB 3JZYA 1U8JB 3BT2H 3KPLA 4R5TA 2OP4L 5HYJD 1AQKL 1AOZA 3FBQA 1Y0LA 4NNYA 4ODWB 2LR4A 3KH3A 5E2VL 2G2RB 1HQRB 4PG2A 2B0SL 1TZAA 4TSCH 3L45A 5J11C 3BDYL 2PPFA 4G8GD 4DAGH 1ZLVK 3W11C 3EADA 3EAKA 1R9FA 3D0VB 3ZPDA 9CGTA 3U82B 4GXFA 4Y5YA 4PWGA 2WXOA 4FD0A 1UWGL 2TRYA 1S7QA 2H6PA 1GYWA 2HTKD 4K23L 4XPTL 1A3ZA 3U25A 1MG2C 2KYIA 2QKIB 5E0QA 1LO5B 1CO1A 3ASNB 4AK1A 3RPIA 2WCPA 1E5AA 1UWFA 4WEEA 3CFDB 4BSVB 3IDJB 5A16A 4M62H 3L5HA 4BEIA 1N9PA 4XWOC 1TVBA 1RCYA 2B08A 5KSVB 4Y19B 3MQIA 3TT1L 2D73A 2RGSA 3F6LA 1YPZE 5CD5C 2XQBH 4JRYB 5E8DH 2EDYA 1IKNA 3AY2A 3LKRA 3UZVB 5F7YC 2FR4B 4O2FB 4QRRA 4YPGA 3AB0B 1V3JA 2EAEA 5I76B 4ZTOL 3MZTA 3QQ9C 2GY5A 3OTTA 4Y88A 5JPMB 4PHXA 1EWHA 2BVYA 2XFXA 4QRSB 5HTSA 3TO4B 5DRXB 3IDGB 5KANI 2PPCA 3W39A 4HWBL 2K4AA 2R1WA 3RDJA 2NY1B 3UEQA 1VFBB 3NCBB 2VXTH 2YUWA 4YVNA 4RFEA 4U1SA 4CSTA 2L7QA 1HZKA 2X38A 3O6KL 3LNGA 4OIAA 3RHWK 4G3YH 1ZPUA 2IOIA 2XZCH 2QZQA 2XTJE 3QDMD 3EHBD 5CZVL 2O6CA 2Y72A 2BSSB 3GMOB 1ZS8B 1HEZA 1KBGH 1QYGL 2WSPA 4QF1A 4XWGL 1G4RA 5H37H 1OK8A 3JV6A 4L0PB 4TYUA 4Z0BL 4XCEB 3TJEH 4RBPH 2VSCA 4C56A 1A2YA 1PY0A 1KBWA 3ZKND 1LJMA 1KLUA 1KGUA 2NOYA 4L3FA 3MCKB 5DEJA 3MV9E 5AOMA 4TV3A 5J6GB 2F1BA 3ZLQC 1HH9B 4R8WL 1IC7L 5H37G 1LD9B 1RK0A 3AS1A 4RGNB 2K3TA 4MA7L 4X7TA 1ONQB 4W9EC 1QRNB 2WTPA 3U2IA 2Y5TB 2AXHA 2AQQA 3WS3B 2X4QB 3CGTA 3BSGA 3PAUA 4WK4B 5DA4A 4ZPTA 4N1EA 5LNEA 2JMRA 2DM4A 4MWFB 3W11D 1NKGA 1WWCA 4GSQA 4UTBL 4M7ZC 3LS4L 2BOCA 4G7YL 5ICXA 1EDQA 1Z5LA 3PPEA 1OIOA 1A4KB 1YNLL 3HI1A 1PG7X 5C0AE 4JFPB 1TQUA 1J1XL 5AVQB 4RDQG 3VYNA 2OZ4A 5TE4H 3F7KA 5C1MB 4ZS7H 4XWOD 5M95B 3TBYA 3F5WB 4JFHE 1IM9A 5ISZD 2GEEA 4XO4A 4BH7A 2LU5A 1L7TL 1E67A 3ARGC 4HGKC 4XHJC 1F1AA 5F9DC 3SBWC 4RDBA 4Z6AT 4U1NB 4IMLB 5E4OA 3U79A 4ABQA 4GUCA 3U6XS 1MJJB 3IMRA 3NIDE 4WY7L 4FTVD 4LSSL 4XN8A 5IJKA 4OSUH 4ZUSB 3EOAA 3ZR5A 3OJDA 1FV1B 4TVPL 3QUKA 4JN2B 1UWEH 5EG6C 1MXGA 4YAQA 2A7BA 2C1PA 3BP5B 5BXFB 4WTQA 3RAJH 3RY5A 2XNAB 4L1DA 4HS8L 5ADOH 3IBEA 5FM4A 5DO8A 3BEVB 3C09B 3FQTB 1HXMA 1SJEB 4BK5C 3DIVA 4Z3EA 1IC1A 2OL3L 4WHDA 5M7QA 5EO9B 1VDGA 4QRAA 3FB7B 1INDL 4NKOB 3MV7E 4OV6F 1WA2X 5I6OA 4F7EB 3BW9B 1UM5L 1DJWA 4DESA 5JIDA 3GO1L 1IBBA 2EEBA 3B2UC 1R5VA 5E1AB 1JYVA 4XI5C 2LLLA 2FO4B 2C3XA 3P4LA 4IU2A 5B38G 1H6FA 3GMLB 1XT5A 1FAIL 2BP8B 3LQMA 2ESVB 3FUFA 1U58B 3TWCH 1FRGH 3IPBA 4CC4A 4LVEA 2MKWA 1HHJA 2H2SC 1X3DA 1Q0XL 2WLLB 3KPRB 5F2FA 4EVNB 1U33A 2OSWA 3I9AA 3K4DA 2HJLA 3HEIB 1RI8A 3HKZA 2VO5A 3BZFA 5F3HA 1K2DB 2JV6A 2TSAA 4ODHL 1BAGA 1RJYB 2KDGA 3PDDA 4Q9CA 5EU6B 2ADGB 3QPXL 1E43A 2BNUA 4PV8B 5GXBB 5IMMA 4AMKL 3MRMB 1UD2A 5DFAA 4NAMA 1FGVL 5BS0E 5KSBA 3WFDL 4FQQA 1WAEA 2BNQB 3US0A 2Y7MA 1MFBL 1B4JL 3N50A 4QOKD 2V5YA 2QVTA 2X9YA 4NJAH 1CFSB 4GXVH 4NENA 3BSZH 5TQ0L 3NN8B 2EH7L 5CINH 3TCLB 2UWEB 1G7IB 2NDGA 4XHJD 3EZJB 4LCIL 1UHVA 4HC1H 1NZRA 4TQIA 3NIFE 4JFFA 5FGBC 2BY3A 2N4IA 3S35H 4NI3A 4W6WB 3S5LG 5D2NA 3V8CA 2BVPA 1JPFA 3NPSB 2LW3A 1EO7A 1ACXA 1B0GA 1IAKA 3QJVB 1OB0A 4HK0B 4OLXL 5C3LD 4XXCA 2H9GB 5DHVA 2MQCA 1ZHKA 3LRHA 1CLYL 1ZOXA 1A6VH 1IGIL 2YD3A 3C6LA 1KY6A 4V2CB 4PGDA 3TNNA 4HCRA 3ZE1B 2WBXA 5DT1L 4D9RE 2RFXB 1T0NB 1OGAD 3T8XA 2WUBL 3ZYOA 1AOHA 3KYMB 3P69A 4H1LH 4WHTA 1BVLA 3AU1A 4YXHH 2C4FU 4FQPA 2HWZH 4JNXA 3B2UD 1P0SE 4M7JH 3V0WH 4L37B 1JPSH 1JF1B 1SGKA 2CNZA 4ZO8A 1E3XA 4XI5D 5SWZA 2VL4A 3NH7H 3QO1A 3V5HB 5HJ3A 4H1LG 3QJHA 1JD7A 1MWAA 2Q86A 5F3BB 3WFCH 4J3BA 3JUYA 4PV9A 5HDBE 2RQ8A 4A7QA 2H2SD 2R29L 4HGWB 4MASA 5IVZA 2YK1H 3WUWB 1A1OA 1M1SA 3VRLF 3OKLB 1AZVA 4PJIB 1ES0B 3VFGH 1T6VN 3FTWA 4HEMA 3ETTA 3GNMH 4MXVE 2XA8H 4GMSH 5KBDA 1H8OA 1A21A 2ZCLL 4Z8FH 2Z4QA 1Z7JA 3WNOA 5CSBA 5FGCE 5MENA 1S4IA 4PJGB 1UURA 2R0WL 1RD6A 2E7BA 1NCHA 4X6FB 3RJDA 3SIKA 4CSZA 4XPBL 1FFQA 2VISA 3CSGA 3D18A 3GRWL 2CLVB 5IQ7L 4MD4A 3TNMB 4XNAA 4RCAA 1D6EB 1ZANH 3SPVB 1CURA 1A6UL 3PWPE 3I50L 5IB2A 1FF5A 4P2RE 2BZCA 1TMQA 2QQNH 4JM2B 4W81A 1GA2A 4M43H 4DO4A 2LT9A 5L2KA 4U1JA 3L95A 1BP3B 4G42A 5HGAA 3ZW3A 3BZEA 4RWYL 1LK3L 3QXWA 1PLAA 5GISL 3WXVH 2R23A 1F2XK 1XF2A 1I7TA 5IEHA 1KJ2H 2M2DA 3LHPL 3T4AC 2CHZA 3TJPA 1RUKL 2P5PA 5HHMB 1JGEA 3GJFH 1PNCA 3KM1A 1MY7A 4LCCA 3CFBB 3TX4A 1XH0A 2J7LA 1ZT7B 4N2LA 1BMGA 1R3LB 3JSSA 3W57A 5I5IA 4DQAA 4JX0A 4ANWA 3HA0A 4W4OA 1JHKL 4LASL 4AEEA 4PRHD 2YPLB 2WCSA 4E36A 5D7LB 2A9NH 4DVBA 2H6UA 1XCWA 4MSWB 1Q9OB 1KGCE 3U9UB 1G7HA 4QPEA 4ELKA 1JJUA 4WU7A 5JZ7D 4LARL 3WEOA 5JOFB 4GP4B 2EXTA 1UXSB 2Z1PA 3II1A 1TEYA 1HAWA 4XR8C 4PJDF 2NTSP 1Y18B 1EAQA 2VDML 3HE6B 5T5FA 4APQD 5C07E 1NCWH 5EU7C 4P2YA 5HHNA 5IGXL 4QKTA 3TS8A 1A4JA 1SDDB 3IFPB 5E9DA 3ZKXB 3KPPA 1FL5A 1P6WA 4LCUB 1MJ7H 4PRDA 1FH5L 4GW4A 5GZNC 1KELL 3SKJH 1YUHA 5F7HA 3ESOA 4CILA 4ES8A 2D3NA 1PZ5A 5E6IA 2VLLA 1U41A 1PY9A 4PCKA 2D9CA 4I77H 3ARQA 4RZCB 2JKRM 2WAHA 3NSYA 2VUKA 3CQQA 3NJNA 4DKEL 3U30B 4QJ3B 3C12A 2QR0B 2VW6A 3GMQA 4HUUA 3S36X 1T80A 4UDTB 1YHPA 4JG0H 2JLPA 3FKUS 4A66A 4U1GC 5L7XH 3AAZA 2HKFH 1KN4H 1XF1A 2YQ2A 4LGSB 3NFPB 4LMQE 1KMGA 1TJGH 5DVKA 4S1RL 1IC4L 4QKXB 5B1CA 3TV3H 1I7ZB 1QAWA 3WMQA 4ZQKB 4D9LL 1V55B 4AJWA 4UYQA 2GC4C 43C9B 4BQCA 3L7FB 4OCXL 1CR9H 2X9ZA 3NA9L 3DMMB 3QQ4B 5DZVA 3IVKB 2YRPA 3RJQB 3U6XA 2EYRB 3II2A 4JY6B 4K9EL 2XN0A 4AENA 3H2QA 2G2NA 2V2WA 1V3LA 3VXQB 4R4BA 2LTQC 5AB0A 3G08A 3CFKA 1KPUA 1DQLH 1U8LA 4QUOA 4YUEH 3LVEA 5D1QB 4WI8A 3G6JE 3JT0A 1MCOL 1EHKB 1CFTB 2DLIA 4JFQB 4JVPA 4JRXB 4AYFA 3NTCL 5HHPA 1J0KA 4BZ2A 1UXMA 3VRIB 3R1GH 2AK1H 2D7TH 4XZUB 5AKVA 5IVNA 2AW2A 5T3XL 3X14B 1IBFA 1YEDA 2DF3A 3BIBX 4Q14A 2JI1A 2VMEA 3SDDA 5EZJA 4ECNA 4JFDD 3LHAA 2BVQA 4B95C 3FN0L 2XX1A 2W9DL 4FG0A 4JHAH 1NINA 2OMXB 4S1QH 1T1YA 5J1SC 5GZND 5DCCA 4HIEA 4G82A 1CIUA 3KAAA 4JGMA 1T0PB 1AXIB 4G7RB 5E2WL 1IBDA 1WYJA 1OT1A 1WS7A 3A21A 3RWJB 2FX8L 3NUKA 3LS5L 3C5ZC 5EO1B 3THMH 2YQBA 1ZK5A 3DGDA 4HUWB 4MZRA 5I1LA 3Q6GH 3K6SA 4FHKA 3V4PA 3CMOH 4LRIA 2CR3A 1EA9C 1SYSB 2AV7A 5DJAB 3NG5A 2PO6A 2VM9A 4I0PA 2Q76A 4JAMB 3MLTB 1JGIA 2ICWI 4IRZH 2ICWB 2V33A 2VXUL 4KI5C 2AEWA 4KTEH 4PRNB 4AWJC 4Y0GA 4UILH 4RNRB 2ALAA 4F7MA 3IDMB 4X9BA 5INDB 1DVFB 3W0WA 1HL8A 1FUNA 3QFDA 4R90L 1FZMA 2YAOA 3UG4A 3WNJA 4HPYH 1BZEA 2CGRL 3DROA 1UGNA 4HP5A 2F5AL 2FJHB 5EOCL 4KJQC 2NZ9C 3UJJH 1P53A 1Q0EA 3HPLB 4KH2A 4U3SA 1TNNA 3SYCA 1KULA 1NAML 4OLEA 1N6QL 3DV4B 5JLZA 2Y1AA 2X44D 3OXSB 3FT3A 1XF3A 4G11A 1IRAY 2QVMA 3KWWB 3BKML 1CDGA 1SXZA 2W60B 3PRZA 5I74B 2VWEE 4BELD 3QXUA 4WTWA 2OMTA 3QYMA 4P2OA 3FU5A 2AAAA 4JJHA 1RHHA 2F74B 4JZNB 1CXIA 1WISA 4A6YL 4OGQC 3FMGH 4GG6A 1RKRA 1T1ZB 4S1SH 4BCXA 1W8NA 5I73B 1IFHH 1Z6JT 2IMNA 3FCBA 5KN5A 1N3NA 3VXRB 3LNEA 3QHFH 1T1WA 2V4LA 3EH5B 1IGCL 2HT4C 4F58H 1QHOA 2GBVA 3CU7A 2UZIH 2PYEE 2XXFA 1J87A 3C5XA 1JHLH 1NMBL 4LCYA 1XH2A 3QORA 2X09A 1ZLSH 4ZFGL 4MMYA 4TULL 5LGHL 5E5UB 1AE6L 1P7KA 4M4RB 4HBCH 4AV4A 4NBYB 4LEOB 3TVMA 1HEJC 3BH8B 4HJ0C 3G5YA 4KHTL 5A6LA 3O6ML 5EZLA 2FJUB 1DO6A 3LXBA 1UZ8B 1WAAF 1L6XA 4UQBA 1M71A 3WLBA 5D2LF 3RIAF 1EDHA 1UCTA 5IESH 3O6FB 1C1EL 2CO7B 3NDZE 4KZCA 4F57H 4P2QD 5AW8B 4ETQA 2XN9D 5DMKA 2Z31A 4FZ8H 4RMTA 4KI5D 4A2FA 3CVHB 3T6XA 4ZD3H 1IB5A 2B1AL 3DXAE 1YY8A 3QNYB 1HJBC 3ZSTA 1Z3RA 5HY9A 5L9DL 3QJRB 4LVOB 4Z5RA 2V3EA 4C58B 4WDIB 3DVIA 1RJLB 1XZ0A 4P2CG 3WIAA 4R97B 4BKSC 4YL9A 4L4VD 2VW7A 3GINA 2NZ9D 1KPVB 2QLVB 4U0RC 3OKKA 4YBLB 3VXNA 2BNRD 5T1LD 1LWJA 3VQLA 2DI7A 2GJZB 2XKNA 5JOPE 4X80H 1HXYB 1H6TA 1J05A 2EEDA 3GSXA 3MNDA 4FFYA 5JA9A 2YC1A 5L0QC 1L9NA 4ZO9A 1BFOB 1CF1A 3S88H 5DMIH 2QEJA 3T0EA 3ARFC 3HUJE 3OPZH 2IDFA 3MR9A 3DVNA 3CD4A 1CF8H 1KACB 4U6YB 3IXAB 4LGPB 3REWA 1RIVL 4CU6A 4PJFB 3AQZA 3AY4C 2HRGA 4YDKH 1FZKB 2IWEA 1AD9B 4Y1AD 1T2QH 4PRPB 5F7DA 3X1FA 2YEVB 3K72A 4N1CA 3NZUA 4XO5A 2HT4D 4UTCA 2XLLA 4NC0B 3I6KA 4L4TA 5ICUA 3RA7H 3K1DA 4NHUB 3SQBB 3DWTA 3LNIA 4XH2B 1SEQH 4Y9EA 3O2WL 1DANT 1DQVA 2WMPA 3EW3B 1DBJL 2YXMA 3OLEA 4NNPL 5FYJE 1P7QA 1RVFH 5A7BA 2A6JA 1NEPA 3U7WH 1RPUA 2CLRA 3DC0A 4HJ0D 4OU3A 1EDYA 1IFGA 1F3JB 1P4UA 2GSMB 2NYKA 2R4SL 4G8FA 2I24N 1F4YL 4NKIH 2Q6WB 2P5ED 4X5XB 2BFVH 1S5HB 3W1ZA 25C8L 1JAEA 1P4IL 2DQFB 3Q5YA 1J9RA 3Q5TA 3SOBH 5J4MA 5F89B 2O5YH 3R4RA 4U3CA 1BJ8A 4BKTC 5IBLC 4NQSA 5AVSB 3RDTA 3LX9A 2KL6A 1I82A 2WTRB 2GJRA 4IBQA 1FDLH 3J7HA 1JN6A 1ZIAA 2PW2A 3VA2C 5AZEH 2BM3A 1KC5H 1BBJA 2YIHA 4J2XA 4K7FA 4H25A 4QRRE 5I1GL 4XNQA 2OMWA 4LSTL 1A6PA 3AROA 3R06A 2XTJC 3LN4B 3GI8H 4RDQF 3HRZA 4EJ1C 3DRTA 5CBEB 2CBTA 1TETL 2CG9X 1DVZA 3HLAA 1JXDA 1XX9C 2XBTA 2WXKA 2Y3NA 1HCZA 3X2QB 5EBMB 3ZO9A 1E42A 3CK0H 4YDVA 1FWXA 4LSPH 1NWPA 4N28A 2P4AB 3HZMA 5AWNL 1JWMA 4TNWK 3GLZA 3ARFD 4AGPA 2E9BA 3PV6B 4TLSA 1T0MB 3QZNA 3SPHA 1OVZA 2DQIL 3GT6A 4G6KL 5J12C 3ULSA 3W9EB 1SBBA 5AAWA 2WXFA 1L9RA 4QHNA 4C56E 3HZ3A 2J72A 5MEPA 1C16A 4X7CC 5JNYA 2PMZA 1WK0A 3ARDA 1JF5A 3BQUA 4WEUD 3SE3A 5EN3A 4Y5VA 3W2DL 1SXSA 4HULB 4X0KB 3TH3T 2BMKA 2Z93A 5I24A 3D50A 1YC8A 2QSCL 1WEJL 5IM7A 3DIFB 4HHGA 3IBOA 2X6BA 2YD0A 5DHXB 5I1AB 1IARB 2EO7A 2VMFA 1EXUB 1IAII 4JPIA 5CBAB 3BN9C 2BINA 2XG4B 32C2A 3JUZA 1CDHA 4PJ8B 2G2RA 5CU9A 3VFVB 3DSFL 3RWDB 5FYKE 3O2DL 1BGXL 4WW2B 4P5TC 4ZAKB 4IK6A 1TTAA 4GSUA 5KG9A 3G5VA 1FH2A 5I1IL 2X2YA 2JTYA 2X87A 4U4BA 3CLEL 4EAEA 3FF7A 1X5ZA 4OGXH 5IBLD 4OKDA 2VLKB 2QKIA 2VERA 3MREA 4DW2L 1CICB 1QWUA 1F1DA 4F9LC 2FL5B 2PCYA 4ONGH 4AKOA 4QYOA 4XX1E 1ID5I 3CBRA 4PRIE 2XPGB 4YDJA 3D3VB 2R4RL 3KZ8A 3BKYH 5KSVA 4Y19A 5D5MA 3BVVA 4JRYA 4UNIA 3CN3A 3QWNA 1ZMYA 1CL7H 1BA9A 2XTJD 1U6AH 2ZSVB 4UV4L 4C55A 4O2FA 1MFEH 3NCWA 3QZLA 4EI5C 3VXUB 5I76A 2G9HB 3KLLA 4W4NA 1PG7L 1L9PA 2BCMA 5JPMA 3WFHB 3TO4A 2WN2A 2LQRA 1R3JB 3IDGA 1OQOA 1YQVH 2Q5BA 5EULV 3E1F1 3IU3A 1Y1DA 4TN9A 3LKNB 2VR9A 4BDVB 3MV9D 1OAZH 1SXCA 3FDWA 4LPWA 2FEEL 2HT3C 4WGKA 4FX5A 4N0UA 1KEML 5IV2B 2F19L 4KQ3L 1RJCA 5JW3H 1S7TB 5I2IA 3U7YH 1MNUL 4YXKL 1H3PL 2OI9B 1MVUB 5E2TH 2FIKB 3EDEA 3FF8A 2WSKA 4UINL 1H0DB 4AUYA 6FABH 5T33L 5LDSA 4MJIE 3K6IA 4KO9A 4XCEA 1N2RA 5IBUB 3P0VH 2VR5A 4KI1A 5BV7C 3QUML 3T09A 3KBEA 3MCKA 2YLHA 4HWUA 2X4UB 5J6GA 2NW3B 4OV5B 1B0RA 1V27A 3OR7B 1ZKAA 1G6RL 4FNPA 2Y5TA 3BN9D 4NQXB 4YX2H 3IJEA 1EERB 3WS3A 3K71A 4DUXA 3OB0H 4K73A 1CTNA 2AJUH 2Y23A 3E8UL 4LDOB 4P5TD 5AUMB 4JFHD 3CDZB 4NPJA 2CDEB 2VC2H 4MWFA 5IW3A 1D2PA 5H35B 5K9JL 1MREH 3AZUA 5KSBE 2Z92B 3NABL 4KVCL 3VM7A 3QULB 1GKOA 2WLIB 4AC4A 1UFGA 4JFPA 1NCAL 1XDTT 3UABA 3APNA 2X3BA 3CZLA 2APSA 3TBSB 1TZGH 3PFUA 1NFDF 4MMXC 3RL1A 1IGYB 4F1ZA 3F5WA 3IAPA 4GFXA 1KCRL 1NH6A 2ZONA 3KL5A 1EUUA 5D70L 4JFFE 1Z9LA 2E8YA 5D71H 2APFA 3VGGA 4IBZA 4JY4B 4IMLA 4WNQB 2EYSA 3LPPA 1MJJA 4JZJC 2MQ0A 5LCVH 1JFQH 4EI5D 2ZX6A 5EIIA 4OLUL 4Q2ZB 1D9KC 3MV7D 1FV1A 2DEXX 1EO5A 4OJCA 5DD6B 1EUTA 2EDNA 2HP4A 1IV8A 3K74B 2XNAA 3UAJD 3KS0H 4PGEB 1RERA 4L3EB 2BFGA 4OFIA 3SKOB 1C5BL 1NUFA 4LF3A 4G83A 2WNXA 3CDFA 1MXDA 4GBXA 3BEVA 3NRQA 3FUJA 4TSCL 5JQ6H 3V4VB 4ZUUB 2HT3D 1XO8A 3HC0A 4OZFH 2R2EB 3L9RA 1MCCA 5EO9A 2EKJA 2YQGA 2CK0L 4H5SA 3FB7A 5FGSA 3QRGH 1WS8A 2VO8A 2HKHL 2VITB 2YGOA 5BQ7B 4NWTH 1ZLUK 3T6VA 2LVCA 4F7EA 3ABKB 1XH3B 2EH8H 2FEDC 4XOCA 1XIWB 1YEFH 2DWEB 4XBMA 2AJYH 1TVHB 3QUHA 2UZXB 5E1AA 2IGLA 2X2HA 3BWSA 3JV4B 3WHXB 3HNVH 4OZFG 4PLKC 1EV2E 5FCSH 1NBQA 5EBWB 4Q4IA 4M62L 2HVJB 3SGJA 1W72L 2AV1B 3LH8A 3QXDB 2ESVA 2JNZA 3MO1A 1WBXA 3SGDI 1NMCB 5KSAB 3VG0H 5E8DL 1MZYA 5BS0D 1YEKH 4KKBC 3HZYA 2CWRA 2A9CA 2W0FA 3N85H 2ICEA 3ATDA 5F44A 2K6ZA 5KUMA 3EO9H 1RIHL 3KPRA 3UBHA 1ECYA 4Y16A 4P49A 1XBRA 2YOCA 2V2TA 1UOWA 3FOLB 2X4RB 3FT4B 4PB0H 2Y1ZA 4YE4L 5DS2A 3H1ZA 5IEKB 1AHWB 2GIMA 4JCWA 1KT2B 3SGEH 3IXTA 1RJYA 2NY6B 2VXTL 5IB4A 4CDGC 5CCJA 2J5WA 1BG9A 5KS9B 2FNWA 3ES6A 1E6OL 3UTPE 3KPMB 3L3KB 5A7EA 1F45A 1SY6H 3GXFA 4LHUD 3CAFA 2XZCL 4KQ0A 3OSVA 3V0DA 2BZDA 1DSWA 5HJDA 1V7NH 1GZPB 1CFSA 1DJSA 4KI5F 1KBGL 2FSEB 1MOEA 3NN8A 5AL8A 1P1ZB 2UWEA 3KH4A 3WKNA 3L16A 1TMCB 1VFMA 4K94H 4A2DA 5TFSL 1YO4A 3QIUC 1BOYA 2W9LA 1XCQB 2Q1EA 3MRKB 3TBCA 2O5ZH 4D9RD 3KWVA 1J5IA 1G7PB 4PU2A 1D9KD 3S0PA 4L3CB 3DI2B 4AJVA 2Z35A 4NKDB 4FKHA 3SDCC 4HH9B 4HK0A 2I7SA 5LGYA 4WCYL 2ZCKH 2GTWB 4P5KA 4PWIA 4UT6A 3KWUA 4F2MB 3EFOA 1DYZA 1L5GA 5DR5L 2ERJB 1LNUB 2RMNA 3O4LA 5ACLA 4MAYB 2NNCA 4G6AD 3ISYA 4MA1C 4UUJB 2X1XR 1UJ3A 2A2QT 3KGTA 1LO3H 1R47A 5CWSB 2RFXA 4BFNA 4KZDH 1MF2H 4X98A 5TDPB 4U1LB 4XGZB 4ZPVA 3KYMA 4G80B 4K3EL 5FA4B 4WVRA 4YHML 2HRLA 4YHZH 5IIEB 3ARTA 1Q9LB 1K72A 1X5FA 5C8JA 4QXWA 3G6AB 3SGKC 2XKSA 4ANKA 4A37A 4L37A 3DO7B 3SCMA 5CSZA 1U2YA 3ARBB 1QEXA 5E9DE 5TE4L 1N6VA 1JZGA 3OKNB 4BGDA 2GTZB 3SBPA 4GKNB 3E1ZA 3V5HA 4I2XA 1UWXK 3I6LE 3HB3B 5F3BA 1K3IA 4X99B 1UATA 3IE9A 3OL2A 1L0QA 1GSKA 1P84K 4IMKC 4NFBA 4HGWA 3WY1A 5JDJA 4GKSB 3WUWA 5E8NA 1HSBB 4NM8H 5CEYA 3O9WC 1ES0A 2BW5A 4OSUL 1HE8A 2P44B 4NZUL 4P3DA 2ZZUT 1UT1A 3L8QA 3U1SH 2JK5A 1AKJA 3E38A 3PWPD 3KJ6H 1UWEL 4TMPA 4P2RD 2AABL 2WTOA 4JREC 1K6QH 4JFWA 3RAJL 2WNGA 4RISL 1DE4A 1YEHH 2R2BB 4OI7A 4DERA 5ADOL 1KJ3H 1LM8V 2Y1YA 1JNJA 2ARWA 2YUZA 4PUBH 5FXCH 1X5YA 4FF9A 4X6FA 5F88B 2WO2B 2K1MA 4HJJL 1HINH 4P5SA 4BK4A 4MRBA 2CLVA 4XE5B 5E2UH 3RI5F 5LWYH 1Q1JL 4GLRH 5I6NA 5KYNA 3BKCH 4KKPA 3AG3B 4PJXF 1D6EA 5BZWB 4HWBA 3UPCA 2YBGA 3QUZB 3ZHFA 1E8ZA 4JQIL 1LEKA 1T89C 2AJXH 4FXGB 3ETBJ 4JM2A 3OVUB 4RFNC 5KYWB 3LH2L 3QIUD 3ARSA 3LKPB 2M1KA 3UTQB 5TE6H 4BXSV 5JXEA 1VGEH 3GSNH 1MCIA 2FGWL 3P4NA 4WWKA 2FSDA 2AQTA 3LSOB 1VCBC 3UROR 4WQOA 1AKPA 1F42A 4X5LA 4M8VA 2PABA 3H2PA 3L3OA 3M88A 4I48A 4G9DA 1KGCD 4XP6L 5EU5B 3SDCD 3TONA 3VWKA 4L9LA 4V33A 5AVYB 4EZKA 3ROOB 2JQMA 3EFDH 3MRNA 1YNKH 4GJTB 2BVOB 4TTGA 5C07D 3VB8A 1J10A 3ILQC 3GM8A 4HLZH 4K94C 1EEYA 3V4LA 2RAMA 3QJTB 1IAOB 3U4EB 1U21A 2YPLA 2PWGA 4B9CA 4MSWA 1Q9OA 5JYLA 3U9UA 1WBYB 7TAAA 1TEGA 3TN0A 5HHVL 1ZHLB 2K6WA 2WLYA 5JOFA 4ODTH 3FU0A 2O6PA 4DKDC 1UXSA 4LBEB 3GZPA 4NJAL 1G4MA 4ZFZB 4N2AA 1Y18A 4XVJH 1QATA 4R7VA 3BSZL 4KHXH 3IYLW 4MJ5B 1WFMA 3GBDA 1W0VA 4MAUH 5CINL 5GHWH 4UTBA 4NYLA 4U0QB 4QWWC 2BOBA 4LCUA 2OXHB 4XB3A 4HC1L 4G8IB 4IRSC 3MTXA 5EBLA 2H3NB 1FNEB 2PP7A 4OZIE 4RFOH 1OHZA 1WFIA 2DY2A 2WKOA 3MRGA 3QFJB 2JFCA 5TDOB 1N26A 2IPTH 4L8SC 4IGBA 2PR4L 2FGZA 2Y3AA 5A2IH 1A6VL 1I1AC 1T83C 3QWRD 1NC4B 2QBWA 5EUOB 1PVHA 1P5VB 3ECBA 4A2EA 5BOJA 1TXKA 3UP1A 2K6YA 3UIYA 4MLSA 1XB8A 3QEHB 4JFZH 2YJLA 4DPCX 1BJMA 4IBYA 3LQZA 4YXHL 3DK0A 1WC7A 1BZQK 5BMFH 4M7JL 3VXSD 1XB3A 3V0WL 1JPSL 4ZQKA 5JQHC 5CGTA 43C9A 4GQQA 1CLZL 2ZUYA 5FYJH 3QQ4A 2OL3A 4BQ8A 1KPRA 3DSNA 3ZL4H 2W59A 2P8LB 1EJOH 3RIAK 2HRPL 1FC2D 4LEXH 2AJZA 4NHCL 3N0PB 4HIHB 2YK1L 5JIMA 4PHZA 3ZKMC 4NWUL 4NUPA 2CJTA 3TPUB 3VFGL 3VX1A 3L5JA 1A7RH 4WUKH 5HDQH 5C0BD 2D7MA 4IU3B 1W72B 4N6QA 1M7IA 1M1XA 3O8XA 5DVLA 1DQTA 4JRXA 3AQYA 1Q72H 3ILDA 3MC0A 1WO2A 5IHWA 2V7NB 5LG1A 4LLUB 3FL7A 1QZNA 1NIEA 1YZZA 4GW1B 2J1KA 1OKEA 1XEDA 5AB1A 2EDBA 4YHNB 3QQXA 2DD8L 1EH9A 2H8PB 4R2GB 5CUSH 1TUPA 4RMSA 1SEBB 2QQNL 3OM3B 4OT1L 5DGRA 5DZOA 2HPOA 3MRIB 4QWWD 5DTFB 4GEJA 3WKPA 3Q9PA 5G4OA 5IB5B 4NQEA 4IRSD 2O93L 3AXLB 8FABA 2X0UA 4JKMA 1PFOA 3NCXA 3Q8FA 4QTFA 3WXVL 1DEEB 3K0WA 3MZGB 3RWJA 2RCSH 5E4EB 4AUJA 5ABDE 4Z78A 1KJ2L 2NX5B 1VKXA 1SYSA 3QI9B 5DJAA 1CD9B 1I1AD 3CXFA 4HLEA 4KX9A 4JAMA 3MLTA 4BHUI 5EZIL 4CBPA 3QUGA 5DMGC 3F85A 4RNRA 2WAQA 1OAXH 3D05A 1J8SA 5AVXB 3LZFH 2A9NL 5INDA 1ILUA 2YD6A 4I9XA 4RQQB 5BRZE 2ZUSA 3UO1H 5DURD 5E1GA 2OK0H 2HLEB 2FJHA 3DVGB 4MBRA 1H3VA 3U36B 1PZUB 1U8PB 2ADIB 3HS0B 3MLWL 4CN1A 1KCWA 3HPLA 2FT7A 4P4RA 4F8PA 5I66B 2ZWNA 1I7UA 1URLA 2EC8A 2D0HA 1NCWL 2P3YA 1CTMA 3DV4A 5FYKH 3KWXA 3U1QA 3OXSA 4LLYB 1E4XH 2JJTA 4RBPK 2F2HA 1BVKB 3SKJL 2L7JA 3T3ME 2W60A 4XAWH 3ZKMD 4LO9A 3Q7JA 3D06A 3ZHKA 2EDDA 3SO5A 1DVTA 4LNRA 3CZFB 4YH6A 1KJVA 4Y2OB 1S3KH 4ZJ9A 1A22B 2F74A 3EKCA 4BJLA 1NGZA 4PG2C 3WBDA 1J48A 5GS1A 2P5WB 2Z91B 2X41A 1HT6A 4N8CH 2VLRD 1IX2A 1ZHNB 4UB0H 2AITA 1T1ZA 3QO0B 2R29A 2MMXA 2E0PA 2EIMB 1GHFL 4JG0L 2HJFB 3LN5B 4GRLB 4L4TE 5L7XL 3L48A 3V7AE 3V5KB 3VXRA 4ZUWB 1QNZH 1LTXA 1E3FA 4EEEA 4Y5YC 1AY1H 1C7TA 5ENWA 3VDAA 1TJGL 2TSBA 2RHEA 5HI5D 3TV3L 5DHYB 4WJ5B 4XX1G 5AVVB 2JI2A 2Z8WC 4Q56A 4S0SD 3V0FA 4CBZA 3GMRB 3LN9A 3HI6H 4M4RA 3DXAD 4CGTA 1U3HC 1OB1B 1T5XA 3GRWA 1A7QH 2FLBT 7CGTA 3BH8A 4OFYD 1IKNC 4PVLA 2GSGA 5CIPB 5HYSG 1BV8A 5EC1B 4ZNCD 5I0WA 4DKTA 2WZ5A 4ZNEA 4FTDA 4G8EB 1ACZA 5KBMA 2LGNA 3LY6A 4XP1H 1BMZA 2A6IB 1ZY9A 1TEFA 1FSKC 4M48H 1W0WA 1YVLA 1UD6A 3ZKQD 4HUVA 4KROC 1BEYH 5JOPD 3NIFF 2DQDH 2KQMA 3MRFA 3D2TA 1R17A 4MS8C 5AYUL 4AEFA 3R1GL 1C08B 2D7TL 1HAUA 1W16A 3DYPA 3P4MA 4X0NA 1IT9H 1RQ5A 1JVOA 2MQGA 2Q9OA 1RJLA 3GMPB 1GYUA 2CCWA 4JG5A 1ZT4B 5AOLA 4KDWA 4X9FA 3P77B 1CYWA 3AS0A 4OGZA 2VDNB 1JZ2A 5I1JL 2JKLA 3MXVH 4CC0A 4RGMB 3BAWA 4JHAL 4S1QL 1S78C 4TL4A 3ZJAA 5IVXA 1Q0YH 2BOLA 1HXYA 2P7TB 2CKNA 2IAMB 1CUOA 3GSVB 4Z7WF 1DVUA 1E4JA 1FVEB 4ISVB 4JPWH 4OBRA 5J06A 2D7NA 1MCDA 3L1EA 1VRSA 1BFOA 4HIXH 2HUHA 1HILB 3SPJA 4O2CB 5FLVA 5ITFB 2VXSH 4R3SB 1YEEL 3Q6GL 3MGOA 1E65A 1KV7A 1RLBA 4AYEC 1H19A 3DI3B 5FYJD 4LVNB 5D7JB 1KCVH 3QEQE 4U7SA 1FZKA 1J9CT 2HN7B 1AD9A 4S2SB 2LFEA 1N8OE 1JGLL 4BK8A 3VFMA 3V10A 2C3GA 3QNXB 1QUPA 4EIBA 2XA3A 3N43B 4MXVF 3MFGB 2E7LA 1KENH 3LKQA 4E9TA 4F8NA 2BIQA 5DQ9B 2QPFA 5HGBB 4K3HA 2BWIA 1FVCB 2YGQA 4HPYL 3M1BA 4MX7B 4IJTA 2YBRB 5LNDA 3L5WA 5DHVH 4U1HA 5E9AA 2XY1A 4WLCA 1NC2D 5D72H 3UJJL 1B88A 3ZN6A 4ZMZA 5IR1A 5D7IB 2XSKA 3SDAB 3ASWA 1U3HD 3EOTH 2IV8A 2XQYG 1J0HA 2CLZB 2W94A 4HCRH 3S37H 4N8VB 4YLQT 1YJDH 1F3JA 4QTIH 3PIQB 1SN2A 2GBTA 1B2WL 4GXUN 4QRRD 4Y8AA 5IJKC 4FQ2H 3PL6B 4TUOA 4XN9A 4X5XA 2N7AA 4GP8B 2NY0B 4KJPD 4MDRA 2DLEA 3CSTA 2YFOA 1XCTA 1BM3L 2D3LA 3FO1B 1A9BB 2D7QA 5I9QB 4KXZI 5FKPA 4KROD 1LHZA 2WTRA 4Y19E 3ARUA 4MS8D 1MWAH 2BSBA 4JRYE 3WFBH 1GAFH 4LRNH 4S1SL 2NW2B 1SJMA 4QGTA 1JERA 3HHRB 3TEYA 3N55A 3JTTB 3QG6B 3FS9A 2W0KA 2A99A 3QHFL 5H94B 4QRQB 3TCTA 3ZDXB 4WI5A 1NCNA 3BIKB 4HQQL 5K5YA 3LN4A 1LDSA 2H2PC 1MI5A 4LCWB 3D4GA 5JIKA 5B3NA 1JTPA 4OGYH 3REVA 3UTSB 1TJHH 5GRJL 2EIKB 1S9VB 2GY7B 4C56D 1S78D 4M5ZL 5EBMA 1KG0A 2E74C 1V3MA 1T5KA 5C0DB 4CC4C 4S1DC 3F6JA 1TTUA 3RY4A 2BSCA 1ORSB 5C0EA 2VB5A 1IAMA 3PV6A 4QRTA 2EJ1A 4YGVA 3IAGC 5ESQB 3UGEA 3BKJH 2CJUH 1H3XA 3FRPB 3W9EA 4N1HB 3WOVA 2IFFL 3FZUC 2ZJSH 3FQXB 3AQDA 1P7BA 2I60H 4TXVB 1INEH 3BI9X 4FZ8L 5FYKD 1D5IH 5MERA 2ISDA 1X7QB 4HOZA 1KB3A 3G7TA 4G7QB 4FADA 4KK9C 4XNUL 3EO1B 3H55A 4RGNE 3RFZA 1DO5A 4NEHB 4G5AA 1NBCA 4XC3H 1QRNE 3MRBA 5DXWA 3H9HA 1A25A 1CGUA 3LZLA 2QGCA 3VGBA 3VYPA 3STZA 3HE7C 4E9XA 1EXUA 3CTTA 2VH5H 1CPUA 3SYOA 3OC5A 1A1NB 4PJ8A 2PCPA 3WN5B 1SYVB 4PRID 4FXKB 4WW2A 4ES9A 5FGRA 5TE7L 2I5YH 1FNSL 3J2PA 2P26A 1QFWH 4TVSa 5C3TA 3AREC 5DD1H 3KGSA 2CIKB 4HOXA 4X5QA 3TO2B 3CFCH 3IDXH 1JGUH 3IDIA 1JMZA 1RUAH 4XXCC 4NQDB 3M6DA 4ODSH 3UYRH 2CGYA 1NAMA 3UYOD 5MEQB 2W9EH 2J1XA 1MCSA 4JANA 4U1KB 3N42B 5CCKH 4O02B 4Q9BA 3DX6A 3C6LC 3GJFK 2VAJA 1T2QL 2P1YA 2XTSA 5FW6A 4KKAC 1MAJA 2PCXA 2VT0A 3HBZA 3O3AA 1I4FA 2KPNA 3TH4T 4X42A 1P4BL 4NO5A 2H2PD 3G6JF 5DJ6B 1HEHC 2WCGA 4B5EA 3WEMA 1IJ9A 2W91A 2E46A 3W82A 3H9SB 2QPSA 5F9JB 1FNGB 1SEQL 4LPXA 2GITB 2HVBA 3FTXA 4MS6A 3RY6A 4F2FA 1MJ8H 1ETB1 5D1XA 2WB1A 1OF2B 2ZTBA 4MJID 2IOOA 1RVFL 2YAQA 2RD0A 3WS6A 4HUCA 4S1DD 3TA3A 4BDVA 3ERXA 3HIZA 2V2XB 4LSVH 4YSPA 4OD1L 1E4KA 1BJ1H 5IV2A 3F7YA 1S7TA 3FZUD 2CR6A 3BZ4B 5E4IA 4ENZA 2V9TA 3EF7A 2O5YL 5J6HA 2FIKA 2PP9A 2Y7SA 1OO2A 2A9DA 3SBQA 3DHMA 3UBGA 1E30A 1IBGL 2ESVE 1P4LB 1RUPH 1FDLL 1NDTA 3BEWB 2HKAA 3JWOL 4KK9D 4Q6IB 5AZEL 1KC5L 3IETA 1OZTG 4JFOA 5E1HB 2FATH 2X4UA 5DDHB 3UPRB 3NACH 3KPRE 3L5XL 2NW3A 4A7GA 1A8JH 4M61B 3OAUH 2VDPH 4N0CC 3HE7D 5EOCJ 1KXQE 1JK8B 4HFUH 4DEPC 3GI8L 4JKNA 1O7DE 1ADWA 2JCCA 4X4MA 4IJ3B 1R24A 5B39A 5IOPB 4FCHA 1AQDB 2XXMB 2RACA 3NSJA 1BEXA 1DVXA 5EU6E 5AUMA 1KYFA 4ANXA 1GZHA 1G7MA 5H35A 4JFFD 3GHEH 2OX5B 3ARED 2ZICA 1QVOA 3KVDD 4LSPL 3RIFK 2XV0A 4Q74A 5C0RH 1EFXB 1GIGH 5FECA 1RZJH 3QULA 3DJTA 4GO6B 2WLIA 4BQBA 1IM3D 1SLXA 2ENPA 4GSDH 3BUPA 4OLWH 3D6GA 1ZJBA 5JIPA 2UWEE 1HXKA 3FT2A 4LCCC 3MLRL 4ZSOA 1KDJA 1S7VB 1TTRA 3C6LD 1IGYA 2J20A 1LO0L 4O4YH 1THAA 4OI9A 4KKAD 4KKZA 1K8DB 5I75B 2BXYA 1ASQA 1N64H 3Q44A 4JVWA 3TF4A 1BYOA 1GS6X 1GMEA 4JY4A 4WNQA 3DURA 1M6UA 1H6EA 2F1EA 4DP2X 1A3LL 3UYPB 3L4WA 2WJ7A 3O3EA 5ALCH 3NJKA 2HLFC 3L6FA 2FH8A 1IBHA 3QXAB 1BQHB 4KPHH 4CNIA 3ZE1E 4XP5H 4XNZB 5C2UB 3WLWC 4AV0A 1XB6A 4HIJB 4DWHA 3BAXA 2Z0UA 1R4XA 4OIIL 2IXQB 3UBXI 4AE0A 3UBXB 4NSKB 3NT0A 4YXLH 2EZ0D 2CO2A 5GS0H 3ZE0B 4JDVA 1LGVA 4OGXL 2UX7A 5ESVA 4YSDA 4JZOA 3QQDA 1JGDB 1TVHA 4I2XE 3E3QE 4RMUA 1CYXA 2V9RA 3JV4A 3LXCA 1KLFB 1N59B 1WVZA 4PBWD 5EBWA 4M93B 1QASA 3T0WA 3NJJA 2E86A 1N12A 3QXDA 3H42L 4FNQA 3BKYL 4LEBA 1AANA 2Q87A 2B77A 4PJIE 3U4AA 2CO1A 3UTPD 5KSAA 3QWOB 4N0CD 4AEIH 5MEOB 2VZOA 1CL7L 3EDDA 3K80A 4ALAL 1U6AL 2V5SA 3JWDH 4Y2LA 3QZWB 1D5ZB 4HT1H 5HYJA 3I6GB 3PUUA 1ZJAA 5G4NA 4PR5A 1WCBA 4AG4H 1FAKT 3HOGA 3FYEB 3VFWA 4GMTH 1OTUC 5IEKA 1AHWA 4FNUA 3S8WA 4JKLA 4KRPB 2ZX5A 4Z7OB 1WZAA 4NBZB 3HN3A 1AGCB 3MUZ1 5FDYA 3SYAA 2R39A 1OAZL 2WXLA 4V11A 1HC1A 1NEZB 2A4ZA 1NSNH 1RZPA 5JW3L 4A2MA 2EO9A 4F37K 1O9WA 3L2LA 1AGBB 2X7LB 4NZRH 2FSEA 1DN2A 5DI8B 2WQVA 1HWWA 4ONHB 3FO2B 4FI6A 3FFCA 35C8H 1XCQA 3U9PL 3DARA 2ATKA 3HUJF 3MCLH 3VFPA 4GRWB 1RZJC 1BYPA 2A6DB 4K8RH 3EJUA 1JYNA 3SDDC 5HHME 1OALA 4PW9A 3QIBA 4LL9A 2HLFD 3LKSA 2OTPA 4HH9A 4WV1B 4X6CB 2GTWA 3D2UB 2CD0A 2AKRA 3B3IB 5KWYC 5E9DD 1A9VA 4MQSB 1IKOP 3MRDA 2AJUL 5H2BA 2NSXA 1FL6B 4MAYA 2YPLE 3MLXH 2KZKA 5D7LE 3I6LD 4FYQA 4G1MB 1R46A 6PCYA 1MREL 4F27A 4LCVA 2FBOJ 2QHRH 2R1XA 2ZP8A 5TDPA 2F8IA 3QDMA 4U1LA 1UD3A 3EBAA 4G80A 4XGZA 5HI4C 3ULUL 2CPCA 2L7UA 5IIEA 2BY2A 4N0RA 3HPJB 1RP9A 4GAAA 2OSYA 3EG9B 4NGHH 4LRIC 3EBHA 3QNFA 1NJ9A 5J1TC 2EXYC 3ARBA 3O2DA 3QS2A 5I6MA 4ZX4A 1JZ8A 3OKNA 3S4SG 4I0PC 1ND0B 1DQIA 1P6AB 5GGSA 2WINB 4K2UL 1H5BA 4NPYB 4URKA 4X7DC 2DI8A 4X99A 3D34A 4CDHA 3MJGX 4I5BB 4U6XB 3RL2A 2J8UA 4EOWL 4X8JB 4L1BA 1FFOB 5LCVL 1ED3A 5GS0C 1XWVA 2XACC 1DSFH 4WHYH 5GGVH 2N59A 1JK9A 3JTSB 2O72A 1LE9B 1OTUD 4ZTPH 2WXMA 1F18A 3O3BA 3B37A 1FFNA 1QLRB 1JZ5A 3EUUA 4YDLC 1OSZB 4XNYH 4HJUA 4TVPE 4TVUA 4CVZA 2VIRA 4B96A 2AXGB 5TPWH 5FO9B 1RHFA 5F88A 1NM9A 3BZ5A 1RZIB 4Z3TA 4AVHA 5IREA 2IBZX 4XPAH 3JWDC 4P2OC 3ZE2B 1I53A 1C8PA 3ILPB 3C5SA 4NWTL 5BZWA 3RVTC 1AZCA 2EH8L 2XUWA 3VTTA 1J5OL 2BW4A 3MA7A 1TPXC 1G9HA 2Y36H 4FXGA 2X4OB 3IAQA 3GMNB 5ISZA 1P84J 2D0FA 2G0LA 1HL5A 3HNVL 3V7AG 1FYTB 2L7EA 4AQ1B 3PNRB 4YHYC 2R7EA 4Y89A 3LSOA 1A64A 2F53B 4B41A 1TU2B 3V6FA 3B6SA 3VG0L 4RIRB 1E0OB 5EU5A 3AADB 5D1QE 2JJSA 3D0LB 3ARYA 3N85L 2N1TE 4ZS6C 1A7OH 2VDQH 3B43A 4F3FB 1D5MA 3QORC 5T1DH 2BVOA 4JRXE 2DQEH 3OR6A 3VXMB 2JCWA 1UKQA 3QUMA 3WMSA 4NP4H 4RAVB 4PB0L 1PBYA 2DJUA 1F3DH 1U92A 3WTUA 4PD4K 3TVMC 3ML9A 5HI4D 3H0TB 1F86A 4LU5H 1DBKH 1G6RA 1PD1A 2J88H 4HV8B 2QQLL 1SY6L 2Z6FA 3EBGA 2X3CA 4FFWC 2FBRA 4XO9A 3MLUH 2EXYD 1OARH 3LRGA 2EVJA 1CE1H 4LBEA 3KD4A 3B9DA 1J0JA 5A2KH 4ZFZA 1EXGA 3BLKA 3QUYB 2Z31C 1YECL 3CZUB 3KYAA 2K0RA 4LQ1A 2HT2D 3J8F7 4G6FB 4O5LH 1C8QA 3G9VA 5E8EB 1MCQA 1YA5A 1XGUB 1OAQH 3FU7B 5GS0D 2H3NA 1MFAH 5FKAA 3TA4D 1XR9B 3FFOA 3L3DA 4IHBA 1X5GA 1CBVH 3K2UH 2ZCKL 1G7JB 1FE8H 3FSZA 3GSWA 4B97A 3MLSH 5EO0B 4PY7B 3ULAB 3QE5A 3BD3A 2J5LB 2WXHA 4LLVA 5EUOA 1T3FA 1P5VA 5ABZA 1N7ML 5SWSB 1DJXA 1IZJA 1ANUA 1VGKB 3HAEB 4KZDL 3WU1A 4ORGA 4X6DA 3T0EC 4P2OD 3NCJH 4D0DB 1JHTA 1I8LA 3RVTD 4G6MH 4AT6A 4B53A 5A6IA 5JHDB 3CZEA 5JQIB 1U42A 4GI9A 3RZCC 3NJXA 1MFMA 3QARA 1WIOA 4DGYH 4I0CC 4WKZB 1N4XH 1ZLEA 4QXTA 4M7LL 4QT5B 2ZNWA 4Y2DC 3PP3H 2B1HH 1JUFA 5AAPA 1XSIA 3BN3B 2EE6A 1FA4A 1LK2B 3FUEA 1ZHBB 1AR1B 1ZTMA 1XCXA 3HR5B 1WCQA 4FQJH 4ZS6D 2JI3A 4CSSA 4MD5A 2O1AA 2D2OA 1RUMH 3QORD 3P2BA 4L8CB 3U1SL 3HC4H 4ZMXA 4N2DA 2WIMA 1W72A 2VXQH 3CVIH 2DKUA 3AWEA 4WWNA 1NANI 4I18B 1YEHL 4YHLH 3TVMD 3VXRE 4TLKA 1E27A 1SPDA 2F7OA 3EBIA 4FDWA 4ZMLA 2CUHA 4PUBL 3CZJA 4K8RD 4WI7A 4X5PA 1I9RH 4PVMA 5KTEH 1JZJA 4C83A 2F61A 3L9BA 4FFWD 5ID1B 5DK2B 2ZG3A 4GIAA 5GS3A 3BFOA 1C12A 3TFKC 1E6JH 5LWYL 1KFAH 3QAZB 3SKMA 4HKBA 1E5YA 3BKCL 2Z31D 3EOYG 5KSBF 2AJXL 4YR6A 4Y9GA 4U7MA 4YLBA 1PKQA 1MH5B 4FQHB 1HN1A 4OVUA 2BY0A 3N41F 1MRCH 3A22A 4D0BB 1UXLA 1VGEL 3FSOA 3GSNL 3MNZA 4XPGL 3AXLA 5GJTL 1HCFX 4G1EB 2C3WA 4KKNA 4ZNEE 4X4XB 1XL6A 2ZPKH 2WD0A 4HUMB 3ZZSA 1DEEA 4C57C 5E5MB 5KYXB 1QG3A 2K8MA 1SLUA 5BRZD 3BOVA 2WKLA 4M56A 5H37A 3UL4A 4FXLA 5IWLA 3FCSA 5FUZL 1GGIL 3EFDL 1SOXA 3OKYA 1EEZB 1T7YA 3DX8B 3GXNA 3FB5B 4IOIB 4XBEL 1D5XB 5FCUH 4Z0XB 1R0AH 3D8MA 2DB8A 4AIZA 2IBBA 3FU9A 4KKQA 4LHJB 4F7CB 1TO4A 2G4GA 4ZMTA 5KEZA 5LXVA 3RB7A 4HH8A 1TJIH 3OQ3B 3SO3B 4YHOH 4KX8A 1U8IB 3N1FC 2F9BT 4ILDA 2Q7YB 1NCIA 1SF3A 4E5XB 2M26A 2I07A 4Y4HC 5GRUH 3WDHA 4FL4C 3DVGA 3U36A 3RZCD 1C5CH 5I66A 4Y2DD 2W88A 3ARDC 3NZ8B 4KHXL 3H7BA 1MVFA 5GHWL 4QRBA 4BZ1L 3CQFA 4JFTA 2R0KH 4L4TD 4MA3B 4HWZA 1DP0A 2ZOLB 2GQHA 4L0ZA 2X89A 4RFOL 1AIFB 1U8NB 3CZFA 3EO0B 1P7QD 4D3CH 5HGHB 4Y2OA 3OJ2C 3VI3A 3GUTB 3JBG7 4XT1C 3F00A 1BCIA 5JDSB 2VR3A 2Z91A 4IHOA 2BJMH 3STLA 1XGPA 4N22A 1VZGA 4PRHA 2HJFA 1I1FB 1FZOA 3WJJA 1KWGA 4FGMA 2ID5A 1U8MA 1HHGB 1KJMB 3HBQA 4ZUWA 3FTSA 3TFKD 5F6HJ 1UASA 4JFZL 1WWWX 3VD5A 1FN4A 3S3BB 5H4ZA 1YNTA 2VZ1A 2QKIC 2UYLA 5DHYA 1BIIA 5FUOH 5G2NA 3FHQA 2ORBL 4APQA 3MV8D 1I3UA 5C92A 1DLHA 3GGWB 2MPAL 5ANMB 5EIIG 3I84A 4XMWA 2IAAC 3ZDWA 1WT5A 3OZ9L 4MB3A 2BC4B 2P43B 3PAZA 3F6IA 1EJOL 3FSAA 5CIPA 1LE5A 4NO3A 4JQIA 2GEQA 4BD4A 4P4KA 3EYFB 4QGYA 4OZ4A 4NZJA 5JPMC 1AYOA 3NJGA 2A6IA 3TO4C 2X4SB 2KZ1B 3NCYP 4WUKL 5DJXB 3QG7H 5LLIC 5L4JA 5F72S 5FR3A 1R3IH 2GIXA 1TQBB 1U4EA 5AD0B 3GSOA 4DH2A 1G0XA 3KBFA 4LOEA 4GW5B 3B9KD 1XTMA 2NY5L 3MBEB 4TOYH 4Y4HD 2XWBA 2M8XA 4DKFL 3GMPA 4KFMA 5DUJA 1VHPA 3GRGA 3VFUB 3WNLA 2VSDA 5C0IB 3WTVA 3P77A 3ARPA 4RETB 3GHBH 5BUPA 1I3RA 4P23B 3ARDD 3PUCA 1W91A 4M1GH 4B9YA 1G7LA 4M3JA 5CUSL 4BBWA 2OQJA 4IOFC 3B7TA 3QEQD 1XGYH 1VCAA 1SXBA 1TKWA 1HSAB 2YMOA 2Q0ZX 4U3XA 2WWOA 1MW1A 3PQYB 1Q9KB 3GSVA 3LPGA 1VB9A 5DJYB 2WO3B 4ISVA 1FVEA 2I27N 1XGRB 3OX8B 2H32B 4RGNC 3UIZA 3VD4A 2W0PA 1HILA 1HZLA 5AOZA 2RCSL 3PXJA 4N2NA 3BSZA 3BLBA 3ME0A 3SE4A 4R3SA 3IJYB 2CO6B 3O45A 4MVBC 1TLMA 4ERSH 2DIAA 4LOUD 2XQ0A 5TF1L 5JXAH 4PJDB 4R7DB 3BVUA 4PTTA 5PAZA 4HC1A 3VRJB 1EJ8A 3VTMA 4MXWH 4BUQA 4AIOA 2C9VA 3RQ3A 2BIMA 1KGJA 3H4HA 4HFWA 2J25A 4POYA 3QNXA 5KVMC 3IRPX 1HHKB 2YR3A 1SN0A 4KBPA 4WI9A 1OAXL 2B14A 3CSYB 3LZFL 1OOAA 4MB5A 4G5ZH 2R2HA 2X6CA 4JFDA 3UO1L 4Z76B 1M6OA 4MX7A 1R5WA 4PG9B 1CTOA 4UT6H 5EOTB 4Z7VA 2OK0L 4Z3GA 1REIA 3GLDA 3TBWB 1YEWA 3BHBA 1SMOA 4JG1L 3VWJB 4Y19D 3QC5X 3SDAA 1CS6A 1SBSL 2PW1A 4EDXB 3GK8H 4JRYD 4H8VA 3PIQA 1MVYA 4DVRL 1IIIA 4ZMOA 1FO0L 3O11B 4KAQH 2PTVA 3PL6A 4XAWL 5JUEH 5I5MA 4Z77B 1LEGA 3NJMA 1USQA 2OMBA 4RSVA 3TO4D 5HYIA 1NDGB 3A67H 3ZT6A 1A9BA 2NY1D 3BDYH 3ZKSD 5SWQB 3RIKA 4IBSA 3G6DL 3T5WA 5CJXA 3ZZ1A 5F1NA 4GBXC 4N8CL 3C09C 1Y1UA 2PTTB 2NDFA 3HR6A 1E9PB 5CAYB 1UWGH 2J21A 4K23H 3VXUE 2K7PA 4QRQA 2E27H 1AY1L 2APXA 1QX1A 3BIKA 3NCMA 5IK3A 3ZDYE 5IW6B 3FQUB 1FNFA 2QTVA 5KJRL 2YLKA 4ZMQA 4O51A 3TT1H 1ET8A 4M5YH 1A4BA 1EVUA 3WUWG 3SGJC 3QRFM 1AHKA 3QCTL 4PREB 5C0DA 4L29A 1A7QL 3EHBB 4RGND 3LTVA 4ZTOH 2CHWA 4NNXA 1I8KA 2CCVA 1QRND 2CGZA 3QZBA 2FLMA 1L6PA 4Y16C 1IE4A 2Z0BA 5PCYA 3T8MA 4DP0X 1M05A 3FQXA 4XP1L 1O7DC 2WQ8A 4NRYB 4M48L 3ZZQA 2WZ0A 2XWJA 3LD8B 1K5NA 1X7QA 4AC2A 2NYZA 1MW2A 4PCYA 5DS1A 1PX3A 3EO1A 1KN2H 5D9SB 1QYGH 1VACA 3NJVA 2OSLA 1I1RA 1KJ2A 1O6VA 2Q8BL 4WO4B 5D1ZB 2CJSA 4X4ME 4AKQA 7PCYA 3GJFA 4Z0BH 3TBTA 2WVVB 2AQPA 2VLME 5AVUB 4FEMA 1NOAA 1BQLH 3JTBA 1A1NA 1A02N 2B9BA 4PAZA 1CXEA 4XC1L 4LPTA 4H0HB 4J4PA 1LILA 1SYVA 4R8WH 1IC7H 3R8QA 1ZDQA 1PLGL 2DBLL 4MA7H 3UJIL 3S7GA 5DK0A 1SJHA 3DO4A 4JPWL 4KTYA 1Q94A 4K7PY 1OE1A 4B6ZA 5F6IC 3BPCA 3EH4B 4HIXL 4H4NA 4ZSOE 5B1JA 3LEXA 1CLCA 4NQDA 2VXSL 4PN6A 1GYVA 4FKEA 1CVRA 4P2QA 1Y6MR 1CD8A 1UCBL 3KNBB 3LS4H 4BUGA 2UZYA 1KCVL 3BAEH 1UJ3C 4G7YH 3UMTA 4JO4L 3FONA 4GIPD 1O6TA 4UCFA 5K9KB 3RUGA 4Z7AA 1HIML 4A1RA 3PXHA 4XMTA 4DP9X 5I5JA 4GG6F 2X6UA 3FQNB 4G7SB 4RRPM 4P59H 5J13C 1Z5YD 3SCMC 4L3EE 1IQWL 2BNRA 2W92A 5T1LA 4QHLA 4OLZL 4UQ3B 1OF2A 5AAMA 4WFGE 2ESVD 3AITA 4FQIL 4WY7H 2GAZA 3EOTL 3E2HB 2XWZA 4J3TA 5JPNB 1IL1A 4O2EB 4BA0A 3S37L 1YJDL 3SY0B 4QTIL 2H1LM 4TVPH 1P2CA 4PJBB 1HYRC 3KPRD 1AAJA 4A55A 5IUSA 1FFRA 1RZGA 4FQ2L 1KFGA 4C8XA 4EUPB 4NJ9L 5B3JE 2YWZA 4KKCC 3V0IA 3PWJA 5DC0A 3WENA 7FABH 2LV4A 3PWVA 4N2GA 4JO1L 4ZX3A 1P4LA 3E6FB 5EU6D 1ET5A 3VU1A 4I3SH 4XRCB 2G75A 4EI6B 3WFBL 4LRNL 4AYSA 1JZ6A 5DDHA 1UM5H 5EOQH 3UPRA 3VGHA 1JZIA 3GO1H 4M61A 3BP6A 3SDXB 1MJUH 4JKKA 4P5MB 4DGUA 4D8PB 5CGBA 2AVGA 3N40P 3KPQB 1OW0A 3CN4A 5IOPA 4NZDA 1H3GA 4OGYL 5D2LB 4JM2C 1AQDA 1HNGA 5CD3A 1TJHL 5C6TL 3ZTNL 5HYQB 4M7ZB 4FLRA 5KS9E 3VMOA 5JXEC 1D2OA 3QC6X 4N24A 5B3SB 4WWKC 2FQDA 3FUNA 5FB8B 1ROWA 2OX5A 4PEEA 1Q0XH 1UM4L 4YVUA 4K71B 1U8HA 2MCAA 1GW0A 5FFLA 4KZEH 5ESAB 2P5EA 3L3OC 3BGMA 4MNGA 4QCIB 4L9LC 4W70A 3RFRA 3LAFA 4MLIA 3VWKC 4LKXB 1AACA 1YMHB 1OCCB 2CJUL 3BPOB 1O75A 4K5LA 1X44A 3FFCE 2MWCA 3ARGB 5CHNA 3QPXH 4ZUVB 3T2NH 4ZT1A 4AMKH 2I60L 1K8DA 3ZMNA 1SHWA 4IEFB 1FGVH 2DM2A 3T3MF 4ZO7A 3WFDH 4LVHB 1U8CA 2NMSA 4UTAH 1I9IH 1B4JH 1JPEA 1MFBH 5A2LH 5FM5M 3I9PA 2EABA 9PCYA 2J55A 1ZS2A 4NUGL 4ACPA 1A4CA 3TN0C 1TITA 1U91B 2FJGB 4J3XA 5E7BA 5TQ0H 3ZYJA 3TL5A 4U2ZA 3UYPA 2NQCA 3VG9C 5J1AA 3QCUL 5INCA 1ZGLP 2ZYHA 2Y5EA 4DP8X 3HE6C 3DJRA 4ATWA 5C86A 1QFOA 4XCCL 2VQ1A 3BUDA 1BQHA 3EH3B 2APBA 5KZCB 4DOHE 3ZKXC 5I6XC 2AHIA 2ADJA 1NM4A 4FFZH 4HIJA 1JNHA 3QDME 5EEXA 2I5YL 2NZ1A 3SOTA 4AYDC 2IXQA 3ARFA 1QFWL 2JJUA 4NSKA 2R51A 4KKCD 3CFCL 2OCFD 3IDXL 1JGUL 4M4PA 3U30C 3AY4A 4FG6C 4IGBC 4ODSL 3DDFA 2PCFB 4UQ2B 4Q9RL 5GGRY 5DT1H 1IGJA 1M7DA 2H26B 2CU9A 2VDLB 3LPFA 1KLFA 5F0MB 4F7KA 3LXAA 4WK2B 2P48B 1FO0B 1CI3M 4UAOC 5J8OA 2DPKA 2ILLA 2V7HB 4YK4B 1JZDC 4N6RA 3DNKA 3QH3B 2X1WL 3QWOA 1CE6A 5MEOA 1A6WH 2K4WA 1LDPL 5BUGA 5EF2A 1UA7A 1QA9A 2WYZA 3QZWA 1B4TA 2ENYA 4WHCA 3I6GA 2UY7B 3MLVH 2YGPA 4JM2D 3INOA 1Q38A 3VA6A 3MROA 1R5IB 3WY4A 3RVWC 5JXED 4C4BA 2VQTA 4WWKD 1CQKA 2R29H 4XO3A 3PAYA 4JGNA 4GFTB 3VB9A 3OHXB 1YPZA 3DO3A 3UAEA 5DD3H 3S9DB 3NFNB 5F9WB 4U2YA 3OZLA 2FQFA 2B8OT 2IV9A 4LB8A 4LSVL 1NEZA 5IFHH 1NCDH 5HHMD 4FFVC 1IGTB 4QO1B 5F7FA 3NZHH 1AGBA 4HX1B 1UTDA 4HSCX 5I17A 1J8HB 2C1OA 2MHAB 2ZIDA 2YD7A 4ONHA 3FO2A 4XPBH 4BINA 2DL9A 3DA0A 2YPLD 4NCDA 3GRWH 5D7LD 1ITCA 2P80A 2NTFA 4G7VH 1ZA6B 3PFQA 2PWEA 2FATL 3HC2A 5KVFL 2XWTA 1TOXA 1BLIA 4WV1A 3KEHA 1QEWB 3HE6D 3MLYL 3D2UA 4N2FA 3AG2B 4HHAB 5DMJB 3TYGL 1CIDA 3G5XB 4RWYH 3F01A 5GISH 5GSVB 4QR7A 4BE6A 2PYFB 4G1MA 5A2CA 2JB6B 2NXYC 3NQIA 3GHEL 4XVTH 4UOZA 5IMLA 2DQMA 4HUNB 3LHPH 4LESA 4JCMA 3C87A 2GABA 2GHZA 5C0RL 2LABA 3AVEA 3BAJA 2YKLL 1UG9A 3H3KA 4FG6D 2ZKXA 1N0LA 4E9LA 4ZQTA 3K4AA 1IEBB 4OLWL 2Q8AH 1UH3A 1CFNB 2VZSA 1CD1B 1ND0A 4FNTA 3HG0A 4K07A 4P46B 2WINA 4NPYA 3SQOL 4PJ9A 1UB6B 3MBWB 4PY8I 4TVPD 1E40A 1TQSA 3UAFA 4IBTA 1MAKA 5IQNA 2FRGP 1DVFC 4TNEA 2JTDA 5F71A 4WFFE 4ZFOL 4LLMA 2APTA 2JH2A 2VDMH 4N68A 4HOMA 5D5MF 5IGXH 2IDUA 1MFUA 3JTSA 4HJTA 4MNQB 3ROLB 3PYCA 3RVWD 1PGRB 3KXFB 3M86A 1PL3A 2HFTA 1FH5H 2FK9A 5EUOE 1LE9A 1DUZA 4KPHL 3E7JA 3I3EA 2WO4A 3TOPA 2N1KA 1BPLB 3CMGA 1K8IB 2DWDB 4K3JL 5EH1A 3SJVB 2CKBB 3X1NA 1U3ZA 1X7TA 2JJTC 2WXQA 3HHSA 5FO9A 2YOAA 1RZIA 5I74C 5DJ0A 2OBGA 4DKEH 1DEDA 1GS8A 3TEZA 5D1QD 4XAKE 4JR9H 4LSUL 5GS0L 3ILPA 5JR1H 2NCEA 4JM4H 1XAUA 2IF7A 1J88A 3QSKB 4ZMVA 1MSPA 1P9MC 2VN7A 4JRXD 1PSKL