1KMGA

The solution structure of monomeric copper-free superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of copper-free SOD: The protein before binding copper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1kmgA00
3T5WA 1HL5A 1SXNA 1U3NA 3QQDA 1EQWA 2C9UA 1YAIA 2APSA 4A7SA 1SXBA 1QUPA 3ECUA 3H2PA 4B3EA 2XJLA 1CBJA 2AQTA 2AQPA 1BA9A 2VR6A 1SRDA 2LU5A 4BCYA 1IB5A 3F7LA 1IBDA 1JCVA 1IBBA 1SXSA 1Z9NA 1OZTG 1S4IA 2AQRA 3K91A 4U4IA 1N18A 1DSWA 1HL4A 1E9QB 1OEZW 3KBFA 1RK7A 1CB4A 2JLPA 3HOGA 1MFMA 3GQFA 1SXAA 1DO5A 4FF9A 1SDAB 2R27A 2AQNA 1B4LA 1E9OB 1SPDA 2C9SA 3GZOA 2ZKYA 4A7QA 2SODB 3HW7A 1COBA 2Z7ZA 2VR7A 2JCWA 3CE1A 2ZKWA 4BD4A 2WWOA 4MCNA 1L3NA 2Q2LA 2K4WA 3CQQA 3HFFA 1PU0A 1UXLA 2C9VA 3SODB 1E9QA 4MCMA 1XTLA 2AQSA 2WYTA 3KM1A 2E47A 2WYZA 1F1GA 1E9OA 2XJKA 4A7GF 4N3TA 3L9YA 1OZUA 1BZOA 2WKOF 4N3UA 1F1AA 4A7VA 2NNXA 1YAZA 2VR8A 1OALA 2GBVA 3ECWA 3L9EA 4A7GA 1FUNA 2AEOA 1PZSA 2WKOA 3PU7A 3KH3A 3KBEA 1UXMA 5KBLA 1B4TA 4A7TA 1OAJA 1F18A 1N19A 1P1VA 3GTVA 2ZKXA 3RE0A 1EJ8A 3KH4A 4A7UA 3KM2A 1PTZA 3LTVA 4OJAA 1E9PB 4BCZA 3MKGA 1JK9A 2V0AA 4L05A 3GZPA 2WZ6A 1IBHA 1SOSA 1YSOA 2WZ0A 1JK9B 1SDYA 3CQPA 2AQQA 3ECVA 3F7KA 3GZQA 3GTTA 5KBKA 2GBUA 1SXZA 2Z7YA 4OH2A 2WZ5A 1TO4A 5CU9A 5KBMA 1Q0EA 3H2QA 1SXCA 1E9PA 3S0PA 1TO5A 1F1DA 1Z9PA 1KMGA 1XSOA 2WWNA 2Z7UA 2Z7WA 1XTMA 2ZOWA 1AZVA 2GBTA 1IBFA 2AF2A 1ESOA 3QQDB 2E46A 3MNDA
chains in the Genus database with same CATH superfamily
4UQ3B 1U3NA 5I0ZA 1XF3B 1ADQA 1V7NL 3GXNA 5I76A 1FYTE 1EFXB 4LRNH 4WEBL 2C9PA 3X3FL 1ONQA 4IRSC 4D0DA 4PCSA 2KS0A 1JNLL 5CSGA 3D39B 4B9GA 2AVGA 5FYKD 3LS5L 5HI5C 1HQ4A 4AENA 1A65A 1JE6A 2ENQA 4C56D 3EBHA 1WCBA 1PEWA 4MQXC 3RVWD 3H6AA 3MBEA 2XBZA 5I1DA 4EKJA 4I1NB 5C0FB 1L9NA 1X5KA 1DLFL 2XXFA 1FJ1B 5KBPA 2A74A 4ODTH 4HDIB 2A6DA 3RIKA 5TH2B 4PLKC 1ZS2A 5C7XL 5IOPB 3QUMB 5FWQA 5FF6B 3WNIA 4WKZB 3SDAA 3FTGA 4OCYL 4QRSB 4DFHA 5CEZE 1OQXA 5EU6A 5CD5D 4YSPA 2F0CA 1UVQB 3VM5A 4IU2B 4Q0XH 4EI6B 3OXRA 2OYKA 5FV2A 4FG6D 5AAPA 4RRPM 1MCQA 3EZ8A 2DJMA 3MUHL 3QQNA 2DY2A 4GRWF 1UWGL 3IDNA 4HZLA 3QWOB 5HHXH 4XPFL 3ULUH 5CJOH 1J0JA 4CBZA 2FUTA 3LEYL 2XA8H 3T0BA 1X5YA 3V5HA 1ZSHA 3P4LA 3FUNA 3IDJA 4WO4A 4QYOA 4X7DC 2X4OB 3FU5A 3F6LA 1LP9B 1B88A 5SV4A 3RURA 3RGVD 2QR0B 3EAKA 4PB9H 1A7OL 4Z77A 2H26A 4OGYH 1JWMA 3VACA 4H8VA 3NCMA 2BLFA 4U4BA 1AAJA 4GW1A 4Q9BA 2EIEA 4JLRB 5JQHC 1CFTA 3TV8A 1NEZA 3FHAA 2FO4B 4PJDA 2FSEB 3AZUA 1U9KA 3HCVA 2PETA 3QRLA 4X7FC 1FIEA 4PB9L 4J3UA 4PP2B 5CU9A 2W80C 5MHSE 2YFOA 5DHDA 3TBTA 4F92B 2FYYB 3H55A 3M7FB 4AG4L 2PN5A 1DTUA 1I7UB 5AENA 4KJQC 2IFFL 5EEYA 1FAIL 2WTRA 2P28B 3ZN6A 3L1OL 1QP1A 3MRGA 1DVFB 3DHMA 3L45A 2B16A 1OV8A 4YPJA 3H42L 3FB5B 2FO4A 3QXTA 3HPJB 2K8MA 1D5ZA 4HS3B 3MNDA 5JIPA 1KV3A 5DA4A 5I0XA 3GRBA 5ILTH 2VN3A 3LRSB 3LN5A 4Y16C 5EOCJ 2A9NH 1ONQB 5AB2A 1S7SB 4XP6L 5E4OA 4LL4A 2D3LA 3ESOA 3TBCA 4J8RA 4O02L 4YDJA 3RFZA 3F7LA 1TLMA 1FO0H 3LNGA 4HFWA 3VGGA 3QXVA 4FXKB 1JZ4A 5D1QA 1WUNT 4IDLA 3IGKA 4M5ZH 4YDVA 5JXEA 2X4NA 3G3LA 3SD2A 4ZZKA 4Y9BA 2VDKL 1P7HL 1QAWA 2YWYA 2V8MA 4PTTA 2A6DB 1U58B 1DLFH 2VN5A 2YPVL 2Z6FA 4UT6H 3BW9A 5EEWA 1XF4B 4A7QA 3ULVD 5LLIC 3QQ9D 3HI1A 1KGIA 1SYVA 3SDYH 5DJZA 4MA3B 3NSFA 4JG0H 3X12A 1KBWA 5CZKA 5DJAA 5F3HA 3QG6B 3QDME 4ZRGA 4YSQA 1JNLH 5CF3A 1U8HA 2Q2LA 5DJYB 3IN2A 1QI3A 2GUOA 4G11A 2XKNB 4FXGB 4WLCA 4LK4A 2J1YA 5TDNA 3CK0L 3OSKA 3NGBB 3VAEA 2XYCA 5BZXA 5JIIA 1G7QA 2C1PA 1MFAH 2R29A 3FO2A 4KV5F 4MD4A 4KDWA 4L8SC 4KUCD 4LIQL 5K1VA 4O5LL 4ZFFB 2XWTB 5SWZA 1EGJA 4J3BA 1T6VN 1C16B 4WI5A 2B9BA 4ZUTB 4WFHE 2XQYK 2FLRT 1UJ3B 3HMWL 1UM5L 4UILL 1INDL 1XGRB 2X42A 1PKQA 4GSQA 1I3RB 3CXFA 4F58H 4OF3A 2OZNA 2OQJB 3E6HA 4YSTA 3ZDWA 3Q05A 4GINA 1WZ1H 1OTUC 4JN2A 3B2XA 1U33A 1FGNH 4U3SB 4ACTA 2DH3A 1G7IB 1OCCB 1NCBH 4G8IB 1FC2D 2EE9A 5AUMA 4KKNA 3VXRB 3MHZA 2XG4A 3AC0A 3V6OC 4CA4A 1ET5A 2B8OT 3KLSA 4FN0A 4OTXH 3EFOB 1GJUA 3S98A 2FX7L 5EUOB 4OV5A 4QKXB 3DV4B 2J8UF 1MREH 1PF3A 2WXKA 3QUYA 3RVUC 5I1IH 1RZPA 5B8CC 3QBTB 1CD8A 1CICC 5INCA 2HRHA 5IVOA 4MSWB 2CRIA 4NQDB 3DK0A 1N3NB 3G04B 1UYWH 1OOWA 2QPDB 4FOMA 1C1EL 3VXRA 1A6TA 1NH6A 4E9QA 2DZEA 1ET8A 4XO3A 3G5XA 5ISZD 3ZRCC 2HLEB 3AROA 3HPJA 1EEYB 4XPFH 3S34L 2BY3A 3US0A 1IU1A 1NOFA 3IS0X 2R2EB 4N0YH 4TUKH 2WOBA 3QNXA 1TEYA 5DQ9B 1AY1L 5DHVB 2CGYA 5T1KD 5D8JH 4UF7C 5BS0B 4YDLB 2NDGA 3ZU8A 3ULVF 4MSWA 1KJ2A 2AQTA 1AO7A 2VR6A 4F93B 3G6AA 5EU7C 4A2LA 1JCVA 2Q0ZX 4HPHA 4X6CF 3RNQA 1TUPA 3NIFF 5DMGD 4UDUB 1KJ2L 3DIVA 2HJLB 4K3DH 4OD1L 3EO9L 4J6IA 5L2KA 2AEPH 4M3JA 1MDAA 1JZGA 4FXKC 3H3BC 5KOMC 1KIPB 4BSVA 1CICD 2KPNA 1FLTX 2DQFA 5CAYB 3VG9B 1X7QA 3FQWA 1CI3M 2AXWA 4Y16B 4YHIA 4CDGC 1QD0A 1U2CA 1FVDA 3MJ7B 4PD4J 4XBGA 5EZLB 1BM3H 3VD3A 4TNGA 8FABB 4FQXA 5IW3A 4LLQB 4UIKL 4G9FB 2AJUL 4KKAD 2XWCA 1JGVH 1V7NH 3WAJA 3VI4F 2ZKHH 2EH8L 3DX9A 5C09E 5TFSH 1S7TB 1IARB 2VLME 2K6YA 4EIBA 3UG5A 5I23A 1LEGB 3UTTE 5I1EH 4ELMF 2VXUL 3D7PA 3QWOA 4I9WD 2NY4C 2B59B 4JKNA 2XIIA 2NT1A 4PBXA 2AK1H 1KCBA 2DPKA 2E8ZA 2D0HA 3EYUL 4XPHH 4FYQA 4Z0XB 2X09A 2WQRA 3C9NA 4MDIA 3B3BA 4UAOC 3UG3A 2YUXA 1V7MH 2HFEA 5CHNB 1BZ7A 4FNLH 3EGXB 3ZYOA 3FN9A 4PVBA 4G7VH 1LEGA 4UT9A 4MJ2A 5J89A 4NO0D 3O3AA 1GJIA 2UY7B 1NL0L 4U3CA 2G60H 4YR6B 3BP5A 4PRPD 2GHZA 1LTXA 3QFDB 4NN7C 4EOWH 1EFXD 1G9HA 4HMCA 1CMOA 2A83B 4AYFA 3HEIB 1F00I 2AV1B 2QFRA 4E42B 1OW0C 3QUYB 3SPCA 5I1AA 3MLXL 4R4BB 1K5WA 1I1AA 4MLSA 1FFTB 1S3RA 3DSFH 1OAKL 2EDLA 1FNEA 4JRXA 3BZEB 2XACC 5AVRB 1IUZA 3DROB 4XNMB 3FFCB 3RPBA 3EF4A 4Y4HC 3HI5L 2CK2A 3VE0B 2DQJH 3K8KA 3PWPB 1EEYA 1Q4NX 3DHPA 1DJXA 3AWEA 3T0XA 4HWZA 5CILH 3VD1A 4E0RB 2XN9E 4GQQA 2PYEE 3BZFA 4MJJA 4E42A 1FPTH 1A22B 1VCAA 4NC2B 1PYWA 3QI9B 4J28A 3L9BA 1I8UA 1FYTD 1DBJH 1CGTA 1QX1A 1AXTL 4H2CA 4XMWA 1IB5A 3G6DH 1AD0B 3NRPA 4HSAC 4ZJ9A 4FEMA 3W9DB 5BVJB 5E2UH 2OMUB 4X5RA 4BEIA 4A55A 4ZW5A 2JE8A 5FUZH 1U91B 1AACA 2OSLA 3OKOA 4YGAB 4TUUA 1OF0A 2EECA 3QIWB 2AQNA 3FOMB 5DJ2A 4BRJA 5I6OA 2JJSA 4KKRA 5GS0D 4HSCX 3HHMA 5FDWA 5IBTH 4APQA 5KN5B 3R19A 2NY5L 2Q8AH 1A6WL 3RWEB 3UTSE 2B2XL 1KB5H 3RWGB 3LCYA 3GNML 3S4SA 1OGPA 3V0DA 5IJCC 3MV9A 3LKNA 3WS6A 2LAAA 4WSJA 3DDFA 4D2NA 2JKSA 2F54B 1DVFD 1IFGA 2VO5A 1TMCB 3C6SA 3GI9H 3ILQC 4GG6A 3ZMRA 4GO9A 1RSFA 5A3IC 3LQMA 3MOAL 1GSMA 1X5JA 4KFZC 1E3FA 4OT1H 5C3LD 4H0IA 3SCMB 2EXWC 1BOYA 2G3MA 3WFZA 2MNUA 4MTMA 1KCKA 5I71C 3MZGB 1FF5A 5I18H 1F3RB 3KWXA 5E2VL 2J2ZB 2AP2A 4TSAH 4WI0A 5GRUL 3D2UB 3MLRH 3PG2A 3L5WA 5AQ0A 5IF0B 1QYGH 4HEPG 1Y18A 2CHXA 1H3XA 3QNFA 2E27L 3GSNA 3MX0B 3MRBB 3NQKA 2ODHA 1KCLA 3QQ3B 4KOCA 2EDRA 4PFEA 3D3VB 1KLGA 2EKJA 1NBZA 1ZHBA 1WT5C 2D7TH 4NYLA 2LLLA 3GXUB 4Y7OC 1D7FA 1YY8B 4G3YH 5I1HL 3ALPA 3IDXH 5AVWB 2HFFB 1ZIBA 1JNHA 5FYKU 4A2FA 4X99A 4K7PY 3OZ9H 3GTTA 5DZLA 4PS3A 3V0WL 1KBKA 1FVEA 3DSNA 4QMEA 4AK1A 4YHZL 1J10A 5C0EA 3D69B 2Z4TA 1Q0EA 3RU8L 5IEKA 3PL6D 4YDMA 2W94A 4YHPA 3W0WA 2H32A 5DMIH 2EE0A 4PV8A 15C8L 1T4WA 4AMXA 3U82B 4JMNA 5EEXA 6PCYA 4QXGH 1NAMH 3VMNA 4OLZL 1P7QD 1VZGA 4UQEA 5ADPH 2AQ2A 3UPAA 3B8YA 4KKPA 1OTUD 5CM1A 2X6BA 5CINH 2W9EL 4JFSA 4QOKE 1OT2A 1F0LA 2AI0L 2ITCA 3INUH 1AXIB 2PP8A 1BBJA 1T6WA 1IM3A 2Y2YA 3SYAA 3DGGA 1A9EA 4I4WB 4NHUA 4HG4K 3VRLF 5EA0H 4ZNEA 3BO8B 3OKKB 3OVUB 4ZMZA 3H3PL 2BOCB 4X6EB 1CXKA 3OG4B 4GAJL 4KY1H 4L0ZA 4X7TA 4AV4A 4QWWD 4M9PA 2VQTA 4XC1H 3TTYA 2DKUA 1X4ZA 3NAAH 3O45A 3HG3A 4OIBA 4ACPA 1GAFL 4P23B 3SDDD 5IREA 2ZF8A 2Q6WA 2VDPL 1UZ8B 2PCFB 5MEND 3H7LA 3VXNB 3QXAB 4QOKA 1XCWA 4XVUD 3DLQR 3U1QA 1S78D 1QUNB 3HZYB 5HDBF 4JO2H 4LSTH 5EBLB 1YEKL 1I1RA 2PWEA 3VNYA 2NYYD 1SDDA 1X44A 4J6RH 1ZS8B 2DM2A 2FD6H 4BBWA 4Y9GA 1RI8A 2EIDA 3EO0B 4PGBA 3HMXA 3P2TA 1KENL 2WQWA 4PIBA 3F00A 4JHWL 2EH7H 1S6NA 5GJSL 3VA2C 2Q6WB 1MEXH 4IBQA 1UD2A 4JCWA 3U30B 1F5WA 3NIGB 5GSVB 4PRBB 3W9EB 2EAEA 1EO8L 1N8ZA 5E4EC 4ZMQA 5KSBA 3IU3B 4FTVA 4OZFH 2AHIA 3A6BH 5JW4N 2WKOF 4N6RB 2ADJB 2OULB 3LPFA 4Z0XA 2XZAH 3PS6A 4MS8D 1YEIL 1HEZB 3BAWA 3FUEA 2NNCA 3A47A 2I27N 4JHAH 4RETB 4ZMWA 4TULL 4U6TA 3D3VA 1KLUA 1CZ8L 4MMYB 4WHYG 1OCRB 3NPSC 4G1EB 4JO1H 1TZAA 2MEJB 3IYLW 5J12C 1QR1A 3FB7A 1TNNA 2ILLA 3DUSB 3HG0A 1I1FA 4JRYE 2F61A 4J3OH 3MRQA 4HLZH 5E6ID 1IGCH 2UZXB 3K6DA 5C08B 5CWSB 2YARA 2ADJA 5IQOA 4LBAA 3NIGF 5KVEE 4F8PA 4K7PH 3GZQA 4DUWA 4HUWB 3FNKA 5HTSA 1CE1L 1ZMYA 3A0OA 3HRZA 5JA9A 1UM6L 3QZPA 4KXBA 4NKDB 1BD2B 3LDBC 1HIMH 1M7DB 1NCCL 2R9HD 5CZRA 2OMTA 1VERA 4L0YA 4TYUA 1KPVA 5KSAB 1ZXKA 3NJIA 1DSFL 5DJCB 4MRBA 4HWNA 3WJLC 4DWHA 3I6GA 1T1ZB 4J7RA 3DIFB 1LLAA 1PY9A 1O6SA 3LIZA 1T03L 4DT2A 4GQ9H 2EDWA 2OI9B 1MW2A 2YK1H 4N0RA 1FDLH 3L54A 1DJIA 5D7IE 3Q8BA 5LXGH 3QJZA 4UANA 5DUPL 3VXSB 5C07D 4G7YH 3EFFB 4N26A 3KCPB 3PV7A 3GBNL 3BT0A 3BN9C 1J5CA 1NFAA 3JV0A 5GGVY 1E4HA 4PLJC 3V0EA 1JRHH 4PWHA 4MNHB 2Z34A 4NLHA 1A3ZA 4TNFA 3MBXH 1ZLSH 4CADA 3IMSA 1IC5H 1LWHA 5DMKB 3DO7B 2ICWI 2O4EA 3LB6C 1FFQA 1QTPA 1TFHA 3O8XD 4UM9D 2BIPA 3GLEA 4S0SD 1KN4H 4G5ZL 5I75B 4RMUA 1PLCA 4LBEB 2C1OA 2XWZA 3LHAA 1CJYA 4WV1B 1RFDH 3VWKB 5EEUA 1OO2A 5ESAA 4BH7B 5HY9B 4MCNA 1MW1A 4HCRH 2Z93B 4J1UA 3S2CA 1F41A 1X6NA 3IE9A 4PMEA 4RSYA 5FO7A 5KAQG 2YKLH 2NX5D 4MCZA 1JV2A 4PWIA 5CXPA 4ZMAT 3V52H 1QNZH 2Q76A 5BO0D 3IXAA 4XB8A 1U3HC 3NZ8A 3D12B 3L3JA 4HCRA 1G9NH 2ZXWB 4XTRD 4JDTL 4ZOEA 3N43B 2KZ1B 3MA9L 1FUNA 4Q6IA 4AYBA 3EYQC 5F9JB 2Y3AA 5CUSL 1XH3A 2Z91B 3GI8H 2H2SC 2X0VA 2AMUA 5M95B 4Y5VC 1L0QA 2XPYA 3SE9L 3L3OA 4W9CC 5D2LA 1T3FA 1F18A 4F5CE 3ARPA 1BD2E 3SSGA 3DPBA 1I7RB 4EN3B 3QUZC 3RPIB 3SE3C 1BJ1J 1CDJA 1VZHA 4O9HL 4PG2A 5B3JF 2IH9A 2GUYA 5AW5B 3FT2B 3FU0A 1C08B 5C08A 2R8SH 4GT7A 5J12B 3GMRA 4TLKA 4FABH 5BMFL 1JPSH 2MMXA 4CU7A 3U46A 1MVYA 3VXSD 1M6OA 1QLFB 2WGXA 3L95B 3M1OA 3T3MB 3L3OB 5KYUB 3DC0A 4Y2DD 3D39D 4KBPA 3D50A 3F7YB 2X44D 5KBMA 3IN0A 4KO6A 5DEJA 3TH2T 4POYA 3HRPA 1N5YL 1QBML 1UB5B 5PAZA 5BO1L 3CZSA 4MZIA 4IW4C 2RQ8A 2JWYA 3GBDA 1EUUA 4DGIH 3Q8EA 3SE4C 3ECQA 4ORZC 1MNUH 4XVSH 2NNAB 2VUYA 5E99H 5T5NF 2PPFA 5I8KH 4XVOA 4G8EA 3M88A 2VKWA 5I2IB 1XD1A 4LEXH 1QFUH 4PJ8C 1BZ9A 1TJIL 1S9VA 3UZEC 3VQLA 1ACXA 3UEZA 2BSCA 4DP0X 2WY3B 4NENA 2GK2A 4LPXA 3I85A 3TBWB 4BQ8A 5B3NA 5B1CA 7FABL 4WKZA 2FE0A 5JHLL 2LU3A 4Y1AD 3AM8A 4U7KA 1A8ZA 4KI1A 1TU2B 4TNVF 3MA9H 3PWVA 1SLUA 3LIZL 5F9AC 3KBFA 2YOCA 2WQUA 1QFWH 2H4EA 3MCLL 2NTFA 2JH2A 3WHE1 1AXSB 5KSBE 5G55A 4ZYKA 3ZT7A 2CO6B 1VENA 3BUPA 4OIFA 4OD3H 1NKRA 3S8GB 4HZLB 4KVCH 2JB5L 3BUQA 3H9SB 1X5AA 4YHYB 4XN7A 3BAJA 3TEXA 4TPRH 1UJ3C 4PGCB 2EICA 3K46A 1KYAA 1EXUB 2ZUXA 2K4WA 4XNQA 5LNEA 1N68A 2RD0A 5DVNA 1GYAA 1WBXB 2ATKA 3IJHB 3TCLB 3GYRA 4NO0B 1O6VA 1UUSA 5J9PA 4KPHH 3A3YB 4Z7OF 1JIBA 1XDTT 2W0LA 1KN4L 5CSBA 1FNSL 3BAYA 4YHOL 3FTZA 3JYCA 4NUGL 3C2AL 1U6AL 3MV11 2P42B 5HHPA 1CLOL 4YDKH 4RAVA 3MBXL 1HZLA 1MWAA 2FJGA 5D7JB 3LIZH 1AR1B 5GGUB 3VFUB 1JF6A 3KYOA 4PB0L 4H8WH 1J8RA 4PLKD 2VERN 3SIKA 3ZTJG 3QORD 4Z7OE 5HYSA 5E2TH 4U1NA 3B7UX 1VCBC 1U8MA 5E08H 3CZKA 3RWFB 4PS8A 5F7UA 5H2BB 2Y7QB 3ZR5A 2H1PH 1NBCA 3STBA 5C0BE 2HT3D 4L05A 3FO9A 3T8MA 3ZTNH 4F1SA 3R18A 4MS6A 4UWQB 4W9JC 2XZQL 3QRGL 2UWEB 1E4KA 4OZHE 3HJ0A 1BPVA 5DVMA 4HIHA 4ELKB 1MNUL 3FOLA 1AYOA 4HFUL 1WTLA 3QO0B 1UWYA 1EVUA 1CC3A 1G1YA 1BBDL 4HWBH 1E7VA 3LN5B 3WNKA 1RURL 3GIVA 3B9KD 5J8OA 1NFDA 2WOYA 1N5YH 1Z0MA 1U95A 1W72A 3ULVE 1IV8A 3S35X 4DFIA 1U8NA 3UTQB 1JHKH 1C5BH 1JXJA 1NKOA 2X12A 3U4BH 4J2XA 2R2HA 2Z7UA 4WK0B 3OKEA 4HJGA 3LMJL 1REIA 4N2FA 3EYFA 3S3SA 4AEHH 4AVHA 1S8DA 1A6ZA 4LFHG 1G6RB 2CLRB 4FABL 1T0PB 5BMFH 4JW3A 2ZX7A 2Y1AA 4JFXB 3X1BA 3FO0L 4XXWC 4PP2A 5B3SB 1NMAH 3ZE1F 5IJKC 1OP3H 2YJQA 4Y5YA 4JJ5A 2HRPL 1OK8A 3FH7A 2Y22A 1WFOA 3I3EA 4AENB 2DWXA 3A4AA 4NWUL 3M1BA 1ZKAA 2IAMA 3IU4L 3CZGA 1CDYA 1NGYB 2WXJA 4OLYL 4LGPB 2K0RA 4GKZA 3QJVB 2XVBA 4ZUUB 4GP8B 1G9EA 4HS3A 3FFOA 2AZAA 3FZUC 2B1HL 4LHUD 2JMRA 2WXLA 4TSBH 2QDVA 1HOEA 1JZJA 1M56B 1XIWD 4LASH 1JYWA 5CLTA 1HAWA 2ZUVA 2IH1A 1JPTH 1FNAA 1S5HA 4PJ5B 1KBPA 3D25A 4NRXB 2D7OA 1BIIA 3R8BB 1OANA 4GXVL 4Y19D 3SE8L 1Y1DA 5HI4D 3VCLB 4BCXA 1A3RL 1PU0A 2BNRA 4G72B 4YDVB 2G2PA 4QXTB 1LK3H 3REWA 3ZYZA 4JAMA 3CSYA 1ID5I 1MHCB 4YSUA 1SN2A 5EMYA 3E80A 3PQYB 4GSRA 1MY7A 1YMHB 2EJ1A 5IG7A 4DCQB 5DEZA 5I26A 3T77A 1NCDH 1QEWB 2RB8A 3PWPE 1I8KA 3L9EA 5F1NA 1XVSA 4F91B 4D0BA 4P07A 4BA0A 1IGJB 2YEQA 1JUFB 1T0NA 1VSCA 3QR1A 4LVHC 2Q7YA 3C6LD 3Q1SH 1T89C 1UD6A 1A14H 7TAAA 2NY4D 5DRWB 2B3RA 3NCXA 5AB0A 4Y4FB 5C0AB 1FAKT 3INUL 5DFWH 2LOEA 1M7UA 1XR9B 4WZ9A 1D3CA 4WHCA 1WA0X 1G1CA 1FZKB 2DEXX 5DZOA 3G6JE 2OTWB 3HCVB 3GK8H 1W6LA 4H20H 4ZW6A 3FTUA 2XVGA 1V55B 4ZQTA 1WIUA 2P5ED 3HG1D 4I77H 5J6GA 2WZ5A 3LN4B 4OLEA 4N8CL 1IAIM 4R7DB 5EO1A 4ZOCA 3ML9A 2ZX5A 4GXUN 1EHXA 1BQLL 1MI5B 3TFBA 3RL1B 5FWRA 1VA9A 4Y9EA 4LL9A 1LL1A 2CO2A 1LGVA 3WIIL 4AZ8A 4ECNA 4XCNB 3JTSB 3G7TA 4Y19E 5IESH 3SDCC 1QA9A 2OCCB 3L9RB 5TGBA 4V1DB 1G87A 1AS8A 1U8KB 3T2NL 5I6LA 1OW0A 3FRPA 4R7NA 2FQFA 3BXNA 1T22A 1NDMA 4GAYA 3UTTB 1H9VA 1B3JA 3RX9A 5GJTL 2RIKA 4BFJA 3TN0B 1KTDA 3VFOB 4Z76A 5JQ6H 4PGDA 1IGFL 2P24A 5K93A 5IHUL 2QPEB 4Y16A 3D39A 2X4SB 3LNEA 2XZCH 4RIRA 3PREA 4XNYL 3UIYA 4KZDH 2PW1A 1B4JL 2F9BT 3HE6D 4PJEB 1MFUA 3OR6A 1DQVA 2XX1A 1BQHB 4IYKA 1QWNA 5SWSA 4FRWA 5C0CA 4JFQB 4KJYA 4OT1L 4XP1L 4PJ8A 1BX2A 1MCEA 3B1TA 5FF6A 1TKWA 4GI9A 4JMXA 4XP5L 2VKXA 2IAND 5MP6H 2CLZA 3UJTL 4NM4H 4CN6A 2X4RB 5KUMA 2R39A 2YD4A 1R1CA 5AOZA 4LEOA 4NKIL 3EDKA 4JFTA 1F02I 4D8PA 3WFDH 3NA9H 1QFPA 3K71A 2WYZA 5AEAA 4GRMA 4XCEB 2CIIA 4QXVA 2ROXA 3GMOA 1F8TL 4NQVA 3NJXA 4NUPA 3W9EA 1H6FA 5L2KE 4W4OC 3MRFB 1QEWA 2WVSA 1JG9A 3AQYA 1P5UB 1OY3B 1MWAB 4FQCH 4QTHB 4DP8X 2QQLH 3NFNA 3EO1A 1IC4H 2PCPB 3MJ8A 2QL1A 4NSKB 4R4BA 5KJRL 1FNLA 3R4RA 3NJMA 5D93B 3KYMA 2KMWA 2MCAA 1ASOA 4KY1L 4P4KB 4B9FA 3FYEB 3MO1A 3M1CA 4OIIH 2IV9A 2OSYA 3IVKB 1LDSA 1IAMA 3W11C 3GXPA 3MV7E 3WUZA 2GEQA 4GSUA 2E7CA 3C8HA 1YSOA 3MNMA 4RQQA 1WVZA 2NR6D 2XKSA 3BEWA 1WEJH 4GMTH 2VO8A 4JGJA 3RPKA 5JPMA 4E5XG 1N59A 3LNIA 5DEFA 1QRNE 5AOMA 1VIWA 1D5MB 3RTQB 4QXGL 1AQ8A 2PXYA 4TQEH 4M4RB 2NR6A 5FYJU 4NQDA 4XXWA 2BNRE 5EUOF 1E90A 1A7NH 3WEXA 3AM8C 2WSKA 5ANMA 3MRLA 4PRIE 3UEQA 1OP5K 3R06B 2I9LA 3Q5TA 2CD0A 4HIIA 3QNXB 5DQ9A 2JSFA 2UY6A 3LKRB 4JFPA 4Z7WB 1MFDH 1A9BB 2HFGL 5HDQL 3APNA 1SMAA 1HTYA 5LCVL 4ZFGH 1U93B 4XP4L 4HULB 1M71A 4LLAA 1OSPH 1I8AA 4OKDA 1JZ5A 3P73B 5CIPB 5D4HA 1MCLA 3B3IB 2IAMB 4RRPG 1T2QH 2VDRH 3NIDE 3MROA 3QDMB 3REVB 5IFAL 3ZDYE 4ELMA 2FEJA 2VZVA 4KHTL 4BZYA 2NXZC 1TZIA 1KDJA 1SOQA 2I9LB 5I18L 5AKVA 3TU6A 3GK8L 4GNKB 5JXAL 1KPRB 1I7ZB 3NH7H 1FO0B 3FSZA 4W4NA 1FLRL 3QEUA 4QHUA 3V7AE 3MLYL 5HYJD 3V4VH 1W72H 1HN1A 3CZFA 3ELAT 3V6ZB 4EBQH 2BIQA 4CL7A 5IMMB 4OZIB 3F12A 3BD3A 3CD4A 4D3CL 3GI9L 4TNVK 4Y5XC 4Y5XA 4HU2A 4FXGA 4U1IA 4NXSA 3SPGA 3ZJAA 3MRDA 3DYPA 3QUYD 1O6TA 4P04A 3ZGHA 4FAAB 4X8GA 3D30A 3IMVA 2ZSWA 1ZHKB 4WUUD 2JIXD 1A6WH 1H8LA 3WN5C 2HJKA 2G2RA 5C07E 1BXXA 4GY4A 5C0ND 5IBTL 1KFAL 1ZHBB 3ARSA 4NYLB 3O9WB 4UNUA 1GR7A 5FYJD 3CZFB 1HOCB 5D1ZD 4Y89A 4YZFE 5HGAA 4YNYA 5CCGE 1KGUA 3LD8C 4NQSA 1XEUA 2ZQKA 5FIEA 3OLIA 1GIGH 2BW4A 5E5RB 1R4XA 3LKPB 1DUZA 1JNNL 1NUFA 3FF7A 3EXLA 2YFNA 5GS2D 1DVQA 2QQKL 4DJMA 3U2SB 4Z18A 1FC1A 2YGOA 3KGUA 5SX4H 5SWZD 4GS7C 1EJ8A 4ZFOB 1M3IA 2B20A 3KPQA 1KLFA 4LSVH 5B39B 3SDAD 1TZGL 3MV8E 4G7RB 1II4E 2XG4B 5DC2A 3QAZB 5L0QC 2HYMA 3Q2VA 1HILB 3ARBB 4MAUL 4KK6D 1UB6B 4KNQA 2DQTH 3X2QB 3CDGB 3X1FA 3QULA 1MELA 1RPQA 3QNYA 1ZE3C 2DI9A 4S1QL 2HN7B 5KANG 1GTFA 3FB6B 2ED7A 3NIDB 5INCB 5CKAA 4KFMA 3CCHB 4LSUH 5KYUA 1ZGLM 5E6IC 2GB2A 2CBPA 1KXQA 2ZOKA 3JTSA 5D9SA 5JDJA 3MRNA 2I25N 4KI5C 3M17A 1UB6A 3U9WA 1EDQA 2FDBP 2I26N 5L7XL 4HT1H 1BYPA 3MGOB 3P4MB 6FABH 2XV6B 3I6LD 3WEAA 3KYAA 3GSUA 3V0VA 4G8EB 2QZQA 4ORGA 2AJZB 4L1LA 1JAEA 3L4YA 4PSPA 4ZX6A 5F1KC 2X5PA 3NZHH 4PRHD 1WAPA 3SJVA 4TRPH 2BK8A 2VXTH 2JIXB 2Y07L 3MROB 3D2UD 1IAOB 4M48H 3REVA 3ZZQA 4U1GC 5AAMA 1ZK5A 4POZC 1RHHB 4LSQL 3WIAA 1C5CH 3AAZB 4ZDHA 2ZNXA 3WS6C 1QRNB 2R2CA 3CLFL 5HGHA 5LQBL 4NQCD 2DQHH 4KQ3L 2EYRA 3AWGA 3CH8A 3LRMA 4FHJA 3WXVH 3B2VL 2ZPKH 1IAIL 4FFYL 1IVLA 3BO8A 3OKKA 4NZTH 4ZPVA 5H4YA 2YBRA 4U1IB 4ENEC 3AS1A 3HB3D 4ABUA 5BV7B 2K6WA 5MHSD 4M1GL 4PEEA 3QDJD 1ZANH 3GDCA 1G7MA 1YN7A 3KNBB 1GHFH 4IQHA 4KHXH 2CGZA 2R69L 1PCXA 4Z7VB 3KPRE 4MMYA 3ZIYA 1IEAB 3QCUL 4CSTA 1MCIA 4QWWC 4Y8AA 3T1FA 4A7GF 1OIOA 1P5UA 3L3KB 1N2RB 3EBAA 4K7PX 5BQDA 3VXQB 4JKWA 1DBBL 1OAQL 4P59H 3OHXB 4F8OA 2YUVA 2LU4A 4HH9A 5AW6B 5ABDE 5BVPH 2GY7B 4KZCA 3MBEC 1PDKA 5F7MC 2F7PA 3WFCL 1KLFB 1YYCA 2WBXA 3MO1B 4EEEA 5B39A 2CCLA 3NEOA 5GSVA 5GRVL 2NW2B 3Q13A 1O9VA 1QFHA 1A9VA 1NUDA 4H8UA 3NSDA 4WY7L 5ACLA 4EO5A 1MFBH 2YZ8A 4MJID 3HHRB 4WUKH 4DQOH 5E1AB 5DJCA 3RA7L 5FW7A 1DVXA 4BKSC 2XQ0A 3HPLB 1QBAA 2H2SD 3QWQB 4BKTC 1N6QH 2WM0A 4ISVB 1I7TB 4OF8A 1P53A 3L1OH 5IHZB 1PAMA 5E2WL 4OF0A 5L4IA 2G9HB 3D69A 2YAFA 1R24B 3TIDB 2PTVA 4PRPA 1D7CA 5CO1A 3CG8A 5E6RB 3RWDB 1BVLB 2H6UA 4E41E 5JOFB 5GGQH 4ATTA 3S88H 3DJTA 3FT3B 4OI9A 3RNKB 3L2LA 3VFWB 2UZXA 3PWJB 2MHAA 4G6MH 2XI9A 4YSDA 4HJUA 3MCKA 4XO8A 5HYJA 4DO4A 5C0JB 1BG1A 4AMWA 1ZGLP 3CX5J 1KCUH 2OMVA 4XAKD 5LGYA 1QW8A 1ZOXA 3DBXA 4S1SH 4F7PA 2OMTB 1S7SA 1T1XB 1N6VA 4AJVA 3DRQB 4J23A 2CKBL 1U3HB 4MMZA 3RVWC 3FCGA 3DKHA 4BK8A 3MNZA 5CEXA 3PWJA 1DQJA 4WI8A 4HAFA 4CJ1A 1MCKA 3VRJB 4MCYB 3QO1A 3C60A 4NLAA 4YL4A 4U1JB 4MJIB 2LW3A 4NX0A 1USQA 3RA7H 4ZUUA 1Q38A 4LNRA 4N0CC 2EXTA 1MCHA 3DTXA 3S35H 4DW2L 3N2JA 2NY5C 4J4PD 3CK0H 4P9MH 4DN4L 3J2PA 1P4UA 1FZOB 2YOAA 4CU6A 3OJMB 2X4TB 3QNZA 5D5MB 4NZUH 3SGKC 3A4DA 4S11A 4X98B 5E6IB 4TLUA 2NLJA 2GAZA 4GW4B 5I16B 3LXCA 4I0PB 4P59L 2D0GA 3O9WA 5IW6B 1UC6A 3U48A 3V6FA 2NXYB 1A4BA 2X40A 4PI2A 5DD5L 3L9YA 1L9PA 1OZUA 1JPGA 2GCYB 3C75A 4M61A 1N0XL 4U7SA 3KPTA 3GHPA 1M42A 3QCUH 4AJYV 4BGLA 3IAGC 3KLHC 1UFUA 1WFIA 1UKTA 4PP1C 3FQUA 4RLDA 5EF2A 4DO6A 4TSCL 2BVUA 1XGQB 4OSUL 1SEQL 2DV6A 1A7BA 5FGCE 2MCG1 3F84A 4XAKE 1XGRA 1ZGLB 4EN3C 3F5WB 2ITDA 3VXRD 4A7UA 4RGMC 4DSYA 5I16A 5IQ7H 2I60L 9CGTA 4U1HB 5JNYA 2BRQA 4NEHB 5EIVA 1RMFH 3VFSA 1NCWL 1GYCA 5ILTL 4DPRA 2V7HA 2ENYA 1K3ZA 3TS8A 4L18A 2J44A 2WZ0A 2EZ0D 1I8IA 1I75A 2H9GB 3P9LB 5IK3A 2AQQA 1WISA 1E8ZA 3AREC 1HCYA 1OGAA 2YQGA 3EFOA 3KCWA 4ODXB 2R1WB 2OMWA 4QDGA 2WQVA 1QSFD 3FONB 3VH8G 3ZRSA 3DPBB 3VGEA 2J1WA 4QHMA 3GHEL 1SJVA 3SYOA 3RNKA 5D4QA 3RZCB 1A6PA 1GTNA 1TETH 3DPDA 1WSST 3MGTB 4NO2B 3ZR6A 4FMFA 2ROYA 1DVTA 4KNSA 3QIUD 4R9HA 5F3BB 1FSKC 2YKKA 4P46C 3RL2A 4NNPH 4X4XA 2N0MA 1IJNA 2JI1A 1P6AB 4OQTA 2R1YA 1MRDH 3MUGA 3QRFM 5AYUH 2W0PA 3F64A 2BM3A 3L2NA 2AK4E 1EZLA 3CFBA 4YLQT 4PR5B 1IBDA 5IJDC 1EEQA 2D4FA 2V2WA 5T3XE 2FJHB 5KBNC 1S9WA 3W39A 7PCYA 1BGXL 4KKAC 3IMTA 3T0EB 5JZ7D 3CVHH 3D4CA 4U3XA 1XGZA 4IS6A 4G43B 3VXUE 4IGBC 3LRKA 5G4MA 2WVTA 2D7MA 3IB4A 1ERNA 2MOGA 3C8DA 3VFRA 3M7OA 4XMVA 4JDEA 4TTDC 5A2BA 3UL4A 2AJSH 4XNZB 3ARTA 3ZL2A 1TZGH 2NY0D 1JZHA 3UYPB 4FQIL 1Y6NR 3UPCA 4NJ9H 1N26A 1I1AC 4JO1L 3WLWD 3WUWA 4QY8B 3W0WE 1UZGA 5KVFE 3ATFA 1E4WH 2CR0A 2OP4H 3C5ZA 1O7SA 3ARGC 3RVVD 5AALA 3PP4L 1J88A 2ZAGA 2FNWA 2XZAL 2QSCL 1BAFH 2YQ2A 2YQBA 3UO8B 2JKRM 2FX8L 2IPKB 2L7UA 2N1TE 2FLMA 3LZRA 3U4EB 2NZ9D 3EOBA 3BFWA 3K3QA 4R7XA 1YAZA 1AOHA 4ZFQA 3CFEA 1VGEH 3H9HB 5DJAB 1EO8H 4HD5A 4QRSA 2BWIA 5EUOA 4OV5B 5FYLE 2JLLA 5FCSH 5K9KA 4EIGB 3TESA 1HINH 3EDDA 1KENH 1ASQA 2QQNL 1FRGH 3BKML 3KLAA 4MX7A 1TCRA 1JZ2A 1DCEA 5AG8A 2A73A 1PD6A 5KW9H 3MLYH 4BZ2L 1GW6A 5K9QG 3F7QA 4O2CB 4X0KB 1DDHB 1IBHA 3FN0L 2FBRA 3ZL4L 4FZ8L 3BKJH 3ZSSA 5HI4C 4JGUA 2XVKA 1H8NA 2QKIB 3US9A 3LNHA 4WFED 5L9DL 2H47C 4JCMA 4MQSB 5G2NA 5CCKL 1SLXA 2F1BA 2VLMD 5K9JH 1ACYL 3LZNA 3DJ9A 2QMJA 1Z2KA 4NKOB 1MFCL 3HZKB 4ALAC 1G7PB 4JJ5B 3NZSA 2AK4B 3SPVA 1NTDA 1KPVB 2H26B 4D9LL 5M7QA 1I3VA 3LXUX 4HC1L 1G9ML 3FO9B 2D2CC 3KPSD 1ZLUK 2ODIA 2ENSA 3VX1A 3WN5B 1U3ZA 2FLBT 1NLDH 1T7WA 4AY0A 5I2IA 4WFHD 4Y2OB 2AI0H 1DN2A 3IFOB 5AVYB 2OA9A 2YPKB 2CAKA 2H3NA 4M7LH 5GRYA 2RTTA 3CZJA 3KWWB 1P6FA 1ID2A 2APSA 3ESVF 5IVNA 1A9BA 4ONFL 1WA2X 4RCAA 1RZJL 3G04A 3I9GH 1X9RA 3HG5A 4U4IA 3T2OA 4KUZL 5I15H 4B27A 4WFFE 2H1LM 2DWEA 4G83A 7PAZA 3KPMB 4OB5H 5EC1A 1SXAA 1MHCA 2XRAL 2VXSH 3OZ9L 3MN8A 2ZJSL 2R27A 4D0CB 2XWBA 2JKJA 3ZT5A 3DWTA 5F89A 1HH6B 3QUMA 1SJHA 2OV0A 1T66D 4JDZA 4RZCA 5EZIL 3HI6L 1C7TA 3P11L 4UYPA 5JHDB 4XNQB 1FI8C 1MRFH 2V17L 3MLVH 4J1UB 2DLEA 3E2HC 3Q1EA 4KI5F 1LO2H 4UZGA 4TVPD 4MCZB 4HPOH 4UNIA 4X6DA 2WHVA 2ATPB 2E7DA 4PUBH 4LPCA 1OP4A 1G7JB 4ANXA 4JDVB 4NAJA 2ZXEB 3MLSL 2ZCKL 4U1SA 3MPCA 1ADQH 4U6VL 1OAYL 5TE4H 3V7MA 5E6UB 1W9XA 4AZUA 1V05A 2A6KA 3B9KB 5GZOC 1PFOA 4W81A 3RTQC 5GGSB 3PRZA 2DS4A 1K4DA 3IDUA 4X5QA 3L5WB 1P1VA 3CLEL 5DXWA 5TDNB 3T4YB 4HXBL 2OYLA 4AQEB 4P2OB 2B2XH 2NY5H 2Q8AL 4FE9A 5ETUA 2VJ0A 5IB2A 5CSZB 3AG2B 4NJAL 4FX5A 5IW1B 3Q6GH 4WFFD 3L3IB 4FMVA 3IGFA 4AKOA 3LN9A 1T7XA 2JCCA 2OL3B 4IU3A 3NCEB 3WTSA 4WJ5A 5D5MF 1JD9A 2HTLC 1RZ8B 4Q74A 3VU2A 2XZCL 4XNYH 1G7PA 1M9SA 4JREC 1O9ZA 3BVTA 5A6MA 6TAAA 3MAWA 5D2NB 2VXVL 1A3LH 4OUUB 2DQGH 1VZIA 4I1RA 4ZS6D 1PZUB 4JY6A 1T0MB 2VLKE 1Z1WA 5GJTH 5I1LA 3L3OC 1UEYA 3ARGB 4GG8B 1CD9B 4J4PA 1XIWB 1ESOA 3MBWA 1EHKB 2R1YB 3BT2L 3MV7A 1IKFL 4Z0BL 4PRAB 1ZSDB 3GSNH 1BGXH 5E6SB 4G9FD 1RSYA 2P8PB 1OGAD 3TYFA 3RDTB 2VSKB 4A66A 4KGJA 4E41B 1D5IL 2CLZB 3I9GL 5IROD 1F6FB 1RXLA 3MV7D 3E1ZA 3D0VA 3VWJB 4AOFA 4LGRB 3LKNB 5T1LA 3RY4A 2V37A 3P02A 1UGKA 1K2DB 5CZXC 1TQVA 2JELL 4QGYA 4PJFA 3ZHFA 1RUML 4LAJH 4M5YL 3RILA 1NCNA 1D5XB 3BPLB 4ANUA 3IFNL 4MQ7B 1WZAA 3J7HA 4FCAA 4L29B 3RP1A 4WGVB 5DHVA 4NUMA 4X7EC 2BO0A 4QHLB 3TF7C 4DGVH 3O6LL 4MBRA 3WUWB 2VLKA 4NCC1 3B5HA 4JPVL 25C8H 1RZQA 1NMBH 3DHUA 5FM8A 3C5JA 1MAKA 3BAKA 1CG9A 4IHOA 3PXJA 5TJWK 2NUTB 5I5RA 5I5IA 4YBQC 4ZD3H 4KKQA 1FG2B 5DQJA 4IIQA 4NGHH 3NESA 1OM3L 2M83A 3BPOC 3H9HA 3V5HB 1HE8A 4MZ2A 4EMZA 4O4YL 4L4TA 1CDCA 3E7JA 2OZ4A 1CU4H 4PJIB 4G80A 2VLKB 5IQ7L 3QQ9C 2BVYA 3PU7A 1TCMA 3KE0A 3EJRA 1RLWA 1UXMA 1B4TA 3BZ4A 2YD6A 5IIEB 1W6WA 2EVHA 2W0FA 3FUMA 1CGXA 3OAWA 3K71B 1U41A 3VI3A 1CXEA 1GS6X 2JKXA 2Y06L 1DDHA 5IKCB 1YO4A 5ES4B 2B59A 4XZ4A 2GJRA 4BM7A 2WO4A 3BGFB 2P3YA 1CFNA 1Q94B 3EUUA 4PJCB 4X9HA 4A67A 4AT6A 5FB8B 1H9DA 2NSQA 1E28A 4AGOA 1A1MA 3O0RL 4GRLA 5KJ4A 3HIZA 3MRBA 5A2AA 5CJXA 4FQ2H 1JGIA 3H54A 1PAZA 3ARVA 3EGXA 1VRSA 1E3ZA 2YD5A 5A1AA 5E9AA 3UTQA 3LDBB 1LE9B 2Z8SA 1OSZB 4DW2H 2VZOA 4LVNB 5DO2D 2DW5A 2VXQH 3FC8A 3GMLA 3L4ZA 4K15A 4AH2B 3BKYH 4ODWB 5LGHL 4FQHA 5CFAA 2EDYA 2VDQB 1TENA 3PDOA 1FO0A 4JQIH 4Z76B 1G7HA 5I6MA 1SXNA 4IBVA 4AE1A 3EHBB 2PXYB 2QLVB 2NR6C 1RPUA 2FEEI 1JWSA 1FFOB 4R83A 1BW8A 1RZFH 1UYWL 3U6XA 3RX5A 1G6RH 2VQUA 2H32B 5FDYA 5BCAA 4PJAA 1VKXA 1JK8B 2X4NB 4IDJH 1DUYA 3AXHA 4GG6F 3O8XB 5IMLA 2ZSWB 4TNEA 4JE0A 2UZYB 1MREL 2PTTB 2F7OA 4E0RA 1E27B 2LTQC 1U3JA 4X4ZA 4N2LA 3SKMA 1Y0LB 2Y24A 3WFHA 3LKRA 2Y72A 2J1XA 5T1DH 3TBYB 1SFDA 2Q5BA 3CU7A 4FA6A 3X3GH 3UCRA 3SZ6A 3FW6A 4CGUB 1FFOA 5E08L 4DQAA 1SY6H 2O5XL 4E9LA 2YN3A 4OQTL 4W70A 3B6SB 3VXTB 1OD9A 1ECZA 4IRJC 1XCQB 2ESVE 4KNUA 4MKTA 3GJFK 4PB0H 2CXKA 3W0WD 2CHDA 2DICA 5E2WH 5DZ9A 2KUTA 4HLJA 2O30A 5B3JE 4L1DA 3C2AH 3M86A 1S46A 4GSXA 4PJEF 4AVKA 5LGJA 4LHJB 5FDWB 1RULH 4OFIA 4BRVA 5J7CC 4AGMA 3ZQWA 1N7ML 3W5MA 4WUKL 1RZ7L 3QIWC 5DLML 2WBJD 2QADD 3FUHA 3N1FC 1YRKA 4F9LA 2VDRB 4I0KA 4K2UH 3CSPA 5KSVB 2KPWA 4P06A 4WENB 3Q06A 1LILA 5EO9A 3ETBJ 1P7QB 2APBA 3U9PH 3L08A 1MSPA 4KDTA 2GK0A 4Y4FA 2GTZA 1Z9LA 1XH0A 5EBWB 2WB1A 4EDXB 3GMQB 3QDGB 2WAHA 2IFGA 5F9WB 2ADGB 1KTLB 2ARWA 1DBBH 2X87A 3MKGA 5DS1A 5D2NC 5KSAA 2MTAA 4WWPA 2JI2A 2H8PB 5ECGA 3UJIL 4YNYB 2WV3A 3DTUB 4A04A 2OL3A 4IRJD 4IKIA 2F58L 4IU3B 3U30C 5J6GB 5CGYC 1OB1B 3O4OB 4RGNC 5C0GB 4F3FB 2YXVA 2X1XR 4KKLD 2Y7SA 4L5FL 4XMKH 4J3WA 2BOCA 3U9PL 5E00B 3T65A 1T83A 4XP6H 4DEUA 1MLBA 1WYJA 4MA8H 3QYNA 5TGBB 3WKYA 4FGMA 4OJEH 2VC2H 2X70B 4M5SA 5E5UB 5BQ7B 3O4OC 3I50L 4UV4L 2NCEA 3DJZA 5GZOA 5FUCE 2NSMA 1VPOL 3I75B 4N25A 4N9GA 1G7HB 3H42H 2FT7A 4KRPD 4Z7IA 5C09A 3ZDXB 4U31A 5EBLA 3BSGA 3L7EB 2OS7A 2X6CA 3VXUA 3BN9D 4PRIB 4L3EE 4YS4A 1ZT4A 1WUZA 4RA3A 1BG9A 2PUQT 4FNQA 1R46A 1JWUB 5EBMA 2ZE0A 4YHPB 3EBIA 3W0WB 3B3IA 4BH7A 3AABA 1AD0A 3OAYK 1UKSA 4JFDB 4Z7WF 1PQZA 3V6OE 5EU5A 4Z7QF 2B5IB 2X6MA 2H41A 3DIFA 2V2XA 3GM8A 1AGBA 4K5MA 2E9GA 4PRBA 3PWVB 4HIXL 4BSVB 3ZYIA 4XCYA 3P2DA 5L7XH 4RAUB 4PRIA 3WY3A 5LB1A 4HDIA 1INQB 4G7SB 3FBQA 1R34A 3ESMA 3QIWD 3B6SA 4O9HH 1BHGA 3VXTA 3TIEB 5LN8A 3UTSD 4Z7QE 4X9YA 3QORA 4IDJL 2NCMA 1T6BX 3EDJA 2PP7A 1WS8A 4TOYH 5C6WH 3S36H 5ANHA 1QBLH 3A5VA 3FUDA 1YDPB 3T9WA 4GOSA 5KS9E 4NQEB 1S9XB 1H5BA 3KXFD 1H8OA 2DI8A 2XA8L 1GGIL 1E6OL 1I1FB 1SYSA 3FTYA 3QR0A 2Z8VC 4QRTA 4POUB 5GZND 3NDZE 5DD3H 5CD5C 3JV4A 4EI5D 3N91A 1A7PH 4RWHA 12E8L 1SUHA 4M8QA 4OZHF 2E6PA 2IADA 3SBQA 4LHUG 2COVD 1ZPLA 3M07A 4CMMA 2FGWH 2ADGA 3ARGD 4P5TC 5TF0A 1N8OE 3L3JB 3ZOAA 5HXMA 3TA3C 3PABB 3K0YA 2HCZX 4PTUB 5A7EA 5I5MA 1AFVL 2PNDA 4Z7AA 3WNNA 4BSWA 1OAQH 3EF7A 4L9LA 1ZLEA 4L3CB 3CH1A 1ZLWH 5DEFB 4EQ2A 5B4MC 5BV7L 1YEJL 5JW4R 1XT5A 4XVJL 3ARXA 1X9LA 3EOTL 3U36A 2FTAA 3B5TA 3WYRA 4Q9QH 5J1SC 3HBZA 2ZOKB 2WANA 4JFYB 3GMMB 1X6LA 4AC4A 5HYQB 4OU3A 2B1AL 1CXFA 2CHZA 3APMA 3NRFA 1UH3A 5ICUA 1M53A 2FO8A 4ISVA 3T6XA 4PV1C 2AAAA 1F6AB 1OWRM 2PO6B 5I1DB 2VIRB 3O2WL 3VJ6A 1WRFA 1M6OB 3AVEA 4A1RA 1BVKB 5B1KA 4Z5RB 2DQHL 1EO7A 4KQ3H 4TMPA 3GJFA 1ZEAH 4Y19B 1JJUA 1T2QL 1XIWC 2VDRL 1C5CL 3BIKB 4A7SA 1EVTC 1RK0A 3LKSB 1IQDB 3DOHA 4KXCA 4NDMA 3TZVD 2VQ1B 3O81A 1SBSL 4RAHA 1VF5C 2XXMB 4MD5B 2HFGH 5HDQH 2B7DT 2VDNB 3A4FA 3NSYA 1M7IA 2HLAA 4OLVL 5CEZD 2A6IA 2DKSA 4B9CA 4OF6A 1CIUA 3I2CH 4QRAA 3G6JB 4HQQH 3NN8A 4N6QA 4WWOA 3BJLA 3O4LA 2DYRB 1MW0A 3TV3H 3BHBA 3UJJH 2XN1A 5IB3A 3BPOB 1J1OL 4AQ1A 2Z8WC 2BNQD 1T1WB 1I82A 3ZLQC 3EFFA 1F90L 4ZXBD 1AGFA 3UCQA 5F7HA 4XHJD 5D7JC 3WFEH 2TSAA 5D7JA 2DLFL 4RRPA 4TQEL 4LPYA 4R5XA 2XKNA 1JFQL 1RUKH 2BSSB 1WFJA 2CH8A 4J3TA 4KROD 1V54B 1SVZA 4TUJA 5TK2A 3P9WB 5GRJH 1PPIA 4LQ1A 4Y4KB 1HHJB 2W9DL 4FFZA 1IKFH 1HHGB 5JTWA 2A1WL 2V7HB 5JXEC 3N41B 2P5EA 1RU9L 2VR5A 1I4FA 1RL1A 3SDXB 1I8MB 4YWGL 4XN2A 5IF0A 1BCIA 2J72A 2P5WE 1UXSA 2VE6B 3MV9E 2OL3L 4UYQA 2QV2A 4HALA 3S96A 2EVFA 4WU5B 1E3XA 4MWFA 2CNYA 5F97E 3H53A 3MNWA 1BF8A 3IE4A 5IHHA 3SKJL 3NZ8B 4MMZC 5AW3B 3S2AA 3IFPA 4E68A 1U95B 1DEEA 3WXWH 3F7RA 3MFGB 4EF3A 5TDOB 1L3WA 4FQCL 3RVXC 1PY4A 4HWEL 4F37F 4PYGA 3SDCD 1ANUA 1AHKA 2FECI 2BVQB 2I32A 3PWUB 1QI4A 4BWUA 3UAFA 1KCVL 2J71A 4GBXD 4MA7H 4KKCD 3NA9L 3DX3A 1W80A 4CC1A 3OPUA 4JFOA 4L0PB 4LFHD 4LLMA 2FEDC 4F7EA 1LEIA 4IMLB 4OD2A 1JP5A 3K6NA 3TJEL 1BZ9B 1NPJA 4ODUA 1DQMH 4IBTA 2VZUA 1MWAL 2YXMA 3VFSB 3GBML 2Y7QA 3DMMB 3FQXB 1ZDQA 3FO1A 4I9WE 5DYFA 1CR9H 5F6HI 3MCKB 5HYJB 5ALCH 2NQDA 1I3GL 1LMKA 1N4XL 3R4DA 3MBEB 1SHWA 1JXGA 3QWRA 1T80A 4HIQA 3QUXD 4JFZH 2QGDA 1XR8B 5JW4M 5ADPL 4I4WA 4NHUB 3F05A 2OMWB 2EDMA 3VTAA 4JANB 1ACZA 1Q90A 3RVTC 1B4JH 1M7XA 2JJWA 3K1DA 2VN4A 1PLAA 4KWUA 15C8H 1CCZA 1AS6A 2EADA 2V33A 4YXHL 3AY2A 3MR9B 3LZPA 5FGBA 2KQMA 4K9EC 1YY9D 4W9EC 5IVXA 2BZCA 2OZ4H 2AQRA 2NY1B 1MRFL 1OSEA 2V17H 2WXMA 3MLVL 4ZFGL 1G5GA 2AXFA 3SGKA 4G6JL 5F3BA 5JHBA 1PSKH 1QUNA 2DIBA 3HI6H 3HZYA 3P11H 3PUUA 2CIKA 3T6WA 1G7QB 2C1PB 1ACCA 1GZHC 2UWEE 2VB5A 1NCJA 4G3YL 5BUAA 5L4FA 1AZRA 4P57A 5LWYH 2E7LA 1D6EA 3C8KB 4F2EA 1JF1A 1ZTXH 4FNUA 4OVVA 4OB5L 4X4ME 3JWOC 4ZAKD 4CW1A 1T2XA 1C5DA 2JI3A 3HNVL 4XO5A 1P7KA 1A7NL 5KWYC 5EDXA 4JFDE 1ZWIB 1L6PA 4LOVA 1L0PA 2FT6A 3M1BB 4C55A 4CC4C 5B39G 5CZXD 1AQHA 5GRUH 5BRQA 3OQRA 1KN2H 2UWEF 2WIIB 3KLAB 4L4TE 1NIDA 4DEWA 1U58A 4FEIA 1F1GA 1QHPA 3OKNB 2GT9A 2JJTC 3WNMA 1BFVH 3KPNB 2AJXL 2E74C 3HBQA 4Q58C 5DI8A 2MQCA 1I1CA 2OTPA 2UXGA 4PJXF 4JLRA 3V5KB 1R5IA 3MVSA 3FK3A 3MLZH 3Q3GA 4ZO7A 1XGQA 4P4KD 1PDKB 3T6ZA 4MFHA 1ZWIA 4HC1H 2GUOB 4OIIL 3T6QC 3UABA 4K23H 4AITA 4D9LH 2QDWA 1PJ9A 2OKMA 4LEEA 3GNMH 4ZNEE 2DI7A 1HU8A 2Z0UA 3QUMH 5D4IA 1B6UA 4Z95H 3F7PC 2VQ4A 1UOVA 4HLZG 3LS4H 4PREA 4UU9B 2XWDA 4OCXH 1B0GB 4AMKH 5HSFA 3RTQD 1DL7H 2LAGB 2X89D 1MCOH 1QLFA 2VJXA 2IDUA 3L95A 2APWA 3BWUC 4FHKA 4UTCA 4BZ2H 4XX5A 4HKXA 5DRNA 1AE6H 3QUGA 4QCIB 4Z7UA 1W0VA 3PGCB 1AXTH 3MRKA 5BS0A 2NY1D 2X9WA 3JWNH 3TPUB 3UMTA 3DTDA 3LEVH 4Q4EA 3X1NA 1GOFA 4DEPB 4HHWA 1GS7A 2WSDA 3ARDB 4FL4B 2CO4A 1HSAA 1JPST 2EINB 3BWAB 2PO6A 3SBRA 3SGEH 2XLLA 3TA3D 2ZCLH 1PIFA 4NHCH 3RX8A 1GC1C 2RALA 4YBHA 5F9WC 3NJGA 3T5WA 2AITA 1W0WA 2QVIA 5JO5A 2C9UA 4LVOB 5AOJA 3Q2CA 1C8QA 2E59A 3DYOA 1Q1JH 2BJMH 3IETA 1JWSB 3E9TA 1OAKH 1TIUA 2IV8A 1H5BC 3S5LG 4AZ8B 1HDMB 1Z9SB 4XNAA 3MLXH 4XOEA 3VRJA 4F8NA 2GJ6D 3K4DA 1KY6A 4B9KC 1MFMA 1BFOB 2QSVA 2OMUA 1KIQA 5I8EA 3VSVA 3ZTCC 2G60L 2C1OB 4H88L 5H37A 1COBA 3D51A 1DN0B 4YSOA 1A2YB 5A7BA 1CFVH 3V6OA 1FZOA 4GI8A 3IETB 1E4XH 2RAMA 2COQA 3TO4A 1CL7L 2P47B 5T3ZL 3LOWA 3F6JA 5EWIH 1RURH 1YMMD 2XDHA 1G84A 1Q0XH 1OTSD 1ZEAL 1OT1A 4PTTB 1KIRA 2PO6D 4I77L 5I8CA 1MG3C 5EUKB 4MB3A 2G2RB 3IDNB 1QTSA 2HT2C 1XZ0B 2VXUH 4I5BB 3CFEB 2D3JA 4N3UA 3U1PA 1I3UA 4R97B 4RNRA 4NN5B 3MMEA 3ASOB 1I1YA 1XL6A 5GS1C 1EEZA 2JXMA 4TVSa 2AJUH 3NG5A 4UIKH 4UINH 1DUZB 3AITA 4UV7L 1HC1A 2WCGA 4ZQKB 3WGVB 3CSYB 3X11A 3FQYA 4E5XA 1HKFA 1KIRB 3OB0K 3KL5A 2JQAA 3D0LA 2A4EA 5E6ZA 3WL9A 3H7BB 2VITA 2QLYA 2LQRA 1BFSA 1CFQA 1UZ6E 2VH5L 3AADB 5DS2A 4KROC 4NUGH 4PJDE 4XHQA 3L9RA 5DMJB 2GJ6E 3BUTA 1FNSH 4YPGA 5DF0A 5JPNC 4ZXBB 1AFVH 2QVMA 4X7SH 3BZFB 2QKSA 3MV7B 3QULB 1FL6A 4DOHB 4EVNB 4IM8A 2KDGA 1GPOH 2AJYL 2IPTH 4UQCA 4Z7WA 1NFDB 2A0LC 4WO0A 5HJDA 1UT1A 2MPVA 4ALAH 3CFDB 2O6FA 2ZCHL 4P2OA 5LBSL 1B9KA 1UZ6F 2P8MA 2C7UB 1E9PA 4GRWH 5I6XB 1GJWA 1CFQB 3HNTL 4NQCA 3DECA 4OM0H 4LASL 4QAMB 5EIQA 3MRNB 5BRZA 4GI6A 3SN6N 1FZKA 3JTBA 3FRUB 1TZIB 1J9RA 3CXDH 5DZAA 1CLCA 2WYHA 3EW3B 3WKMH 3TJHC 2ZUYA 4NPKA 3OLEA 5T5NG 3RUGF 4M4RA 4GBXC 1SXBA 3LPGA 3POHA 2QV4A 1OP9A 3QZBA 1RERA 5DVOA 5F71A 3MUJA 4E9YA 2NRDA 4O2FB 1KBBA 5IY5B 4ZO9A 4P9ML 3MA7A 1TJIH 1DSWA 3OKLB 2GIMA 2OLDA 3BSHA 4BUHA 2F54A 3R06A 2NTFB 4R7VA 3S35L 1M1SA 1T4KA 2BS9A 5FKAB 5C1MB 3V10A 2UXVA 2KDYA 5F89B 2HMIC 3TWCL 5I8KL 1B4LA 3SDDB 3ULVL 4XVSL 5C8JB 1GGYA 1BF5A 1H19A 3G5VB 2Q1EA 1MHEA 1MQ8A 3UIZA 4A6YA 1FE8H 1ZIAA 1K6QH 3QH3B 4P2CG 4N90E 4YSAA 2VLJD 3MDJA 4LARL 1T20B 3DMMD 3G08A 3KPRA 2XYBA 3TCLA 4XVUC 2AS5M 1BEYH 3SJVD 2XSKA 4WW1A 1IX2A 3HS0C 5BVJA 2OM5A 2CM5A 4MB4A 1AHWC 1FYTA 1NIEA 2I85A 4FKEA 4AQOA 3VFGL 3NBNA 1WITA 1KTBA 2JCCF 3DA0A 4K94C 4F24A 5IV2B 4DK5A 2EIMB 1UT9A 3I50H 4UV4H 4J5VA 4KZ0A 3BIBX 4KTDL 4O00A 3OB0H 2HFFA 1Z6JT 1OE3A 2WN3A 3OBAA 1ES0B 5L4JA 2X4RA 5KYYB 1GXEA 2DIAA 2KBGA 3CHPA 5GGQL 4GKOA 4AVIA 4PHXA 4A7TA 4L5FH 4APQD 1MI5E 1MFVA 3LRHA 5T33L 3QIBC 2IWFA 2G5RA 5CUSH 3OPZL 1QWUA 1RKRA 4R2GB 3ABZA 3P0YL 2YPLE 3MRFA 4JDTH 4YDKL 2Q8BH 2J6WA 3CXDL 1MF2L 3ULUD 2ZYIA 3D05A 4EVNA 5A2FA 4HF5H 4QCIA 5BW7C 1SXZA 2FBOJ 3C5XA 4W9HC 2VAAA 3WIHL 3I6KB 2YKLL 5EFIA 1RP9A 3AW5A 1LK2B 4WDIB 3WKQA 3PAYA 4EPSA 1MJUL 4NCC2 1RZKL 2ZG2A 1L7TL 4K2UL 5BVPL 1QA9B 1XGPA 5HYQA 4OBSA 4Z3FA 2AAVA 4V1DA 3ARBA 4PJHA 2QJDA 4FZEL 4JM4L 3VFNA 1XTMA 4MQXD 2GIYA 5BRPA 4NQDD 3P9MB 1HNYA 1TJGL 1MF2H 2YZ1A 4P4RB 4LPWA 1HNFA 2F1AA 1TTUA 4WQOA 2FIKB 4RESB 3B2MA 4LIQE 3SQRA 3JWOL 1CFBA 4LQFH 1IGTA 1HWWA 2UV3A 2UX7A 3K5SA 3NCJH 5ICXB 1KEGH 1HJCA 4KHXL 4FULA 1M2VA 3OJVC 2XPGA 4G6AC 4N8VA 3DJSA 1MAJA 5FK9A 4D9RD 4M1GH 5JHDE 3T0AA 1RK7A 2BCKA 4YHKH 4FFYH 4M56A 3D18A 1M7IB 4YSSA 4XWOC 1IEAA 5A6LA 1BVNP 2F2HA 1QSED 4Z7UF 5T3ZE 3QUHA 4LLDA 5C3IA 3WXVL 1D6VH 3QG7H 1DSFH 4GP5B 4IJ3C 5LQBH 1BZQK 1EZSA 4NKMA 1HH9B 1TYJA 3V9FA 5BO1H 4PCKA 1GSKA 3K8MA 1D5RA 4UTBA 1N0LB 1BEYL 2ZG1A 3UTPE 4A6YH 2R15A 3SKUD 2Z93A 4CMHC 4G1EA 1SLVA 2X89A 3ZHKA 3PQYA 3MACL 2VW6A 3NABL 1LMIA 1RK1A 5ESQA 3QFJD 5KYXA 1UOLA 4GO8A 2C3HA 2H32H 4N5ED 4XPGL 4OF7A 3MBED 1ND0A 1AD9A 4NNYA 2BY1A 4NC1C 1I4FB 3SDXA 2FYVA 4HEMA 3C09C 3QNYB 3KG5A 5F44A 2CK0H 2BNUB 1QO3A 4LKXB 4Z7VA 1Q1JL 2BJML 3DJRA 4X6DE 3RWJA 1L9OA 4XNUH 5DZJA 1BVLA 4KJWD 5ECJE 4AX3A 2E6JA 1Z3RA 1XO8A 3SPIA 1AGEA 3QJRB 1A6VL 2OXGB 5KZCB 3WU1A 4NKQB 4QHPA 2AV1A 4NQQA 5I1AB 2JV6A 3JVGC 3JVGA 4G8GB 4JUSA 1E50A 3FCSA 1S7VA 1TQCB 2F5BH 4X6FA 1CVRA 4Z7OB 2BP8A 3CHQA 2DQMA 3QXWA 3FBKA 1UM4H 1BAGA 1L0XA 2JIXA 1LWJA 1AE6L 4XZUB 2EDTA 1QSVA 2IPTL 4M8RA 4OGAC 1HXMB 1WG3A 5AVSB 5E9DA 1HILA 2ZX8A 2YN5A 3K72A 4QRBA 3GMLB 4AH2A 5JUEH 4GG8A 4N90D 4IOSD 1MCOL 2OSWA 1XIWA 4R8WL 4LSTL 3OM3B 4GKNB 1R17A 1WJ3A 2X4QA 2HPOA 4OCXL 2UY6B 2ICWA 1OB1A 2EP6A 3NZUA 1KTCA 2YXFA 43C9B 2KYIA 5B1BB 4AIZB 5F3FA 5D7HA 1XF3A 3IJSA 5C0IB 3L13A 1KJMA 3HC4H 4HA1A 2ITFA 2N1KA 1S9YB 4N8PA 3TBWA 1LDPH 4UV7H 5CLXA 1PL3A 3MR9A 3BWUF 3MLZL 4NFCA 5I1GL 1S5IL 3WCYA 2PF6A 1L0YA 1Y0LA 2IQ9H 3GQFA 5FHBL 4TM9A 2CKBA 5IROA 1HT6A 1LO5B 4ZS7L 4KTEL 1FLRH 4GQ9L 3HAEH 4A39A 3HW7A 3R7QA 5EF3A 4YHYC 2EC9U 5AW0B 4PJ9B 2JELH 1XBRA 3GF8A 1CF1A 5EBMB 3W81A 3KBHE 4F27A 1SYVB 2KLTA 2ZUTA 4ELDA 2Y5EA 3OGCB 4ZMOA 4CUCA 5IFAH 4LKCB 2X4UA 3D2TA 4G6KH 1UGNA 2DYPA 5DS8B 2IMNA 4HGWB 2GJZA 4DKFH 4P3DA 1T83C 4JVWA 3T04D 3SCMD 3BMWA 3EOAA 4AXWA 2N3JA 1NC2B 2X41A 1CLVA 4LXFA 1Q9LB 3P4OA 4A2DA 4S0HA 1OK0A 4MNGA 4NQSB 5KVDE 2XNAB 3APCA 3FCBA 5F7AA 1R6VA 2VR8A 4G6JH 5TF1H 5FFLA 3KDPB 2MSPA 3OZKA 5JHAA 2JTYA 3MRCB 4JPKL 5A2KH 1H3GA 3EZJB 4UOW1 1BWWA 3KYOB 5AVVB 3ZY7A 1J05B 4DAGL 5DFTA 3L5XH 5CLWA 4LCUA 4QRRD 4IK7A 4HMDA 4CVXA 5LNGA 4KDTC 2EZ0C 2K1MA 1OD7A 3T3ME 1UACH 1N5AB 3CN2A 4I88A 2N7AA 4S1DD 1SY6A 2VZ3A 4BDVA 4NRZA 4AM0A 3N43F 4LCIL 4P48A 3ML8A 1GVIA 4OZ4B 3S3CB 5KEZA 2FSEA 1HEJC 1LEKB 5TPWL 2WLLA 3H9YA 4WDIA 1JOIA 1PIGA 4PV8B 1DQML 3KPSB 1OGSA 1WK0A 4ESKA 3LEXA 5FOJA 1OCOB 1LXMA 2H45A 1QACA 2RFXB 5CD3B 4GKSB 2M26A 3N9GL 1IC4L 3OJ2C 1AKJB 1NFDF 3LZOA 5AFAA 3GSWB 3FUFA 4NQTA 1OAYH 2R56L 1QQDB 3RIFF 2GI0A 3WN5A 3D87B 1UD3A 2G2NA 2R29H 5DHYA 4AMKL 4LF3A 3C08L 5LUMA 2OJ1A 3BHBB 1WGVA 3JSSA 1YA5A 1T5KA 3VO0A 2BOLA 5KJ7E 1QEXA 3ATAA 3H2PA 2IDQA 4GIAA 3V4PH 3A21A 4NKIH 3FQRB 4R2GD 4HK3N 1AO7B 4HIJA 4FA7B 1PD0A 4WWNA 1F3JB 5JW3H 4XXCC 1IKNC 4NO0A 2YC1A 4YWGH 2VZ1A 2Z64C 5CCJA 1NPNA 5DJ0A 4MNGE 3VSTA 4XN9A 1A7RL 4WNQB 1UT2A 3K0WA 1U8LA 3V6FB 5TTRA 3NCYP 4WO4D 1U3YA 3LNFA 2ZUQC 3VXRE 1FFNA 2FATH 1ETJA 1KC5H 2NX5E 5LBSA 4S2SA 4C83A 2QMKA 1KB9K 3KPLB 4W9IC 4RFOH 4OBRA 5F96L 3GZKA 1L9RA 5JQIB 3FSAA 2I07A 3CPUA 3WNLA 1DJYA 4MCMA 3HNVH 5D7IB 3GB7A 2XV0A 4OFQA 1SYSB 4G43A 2Q86B 5FYKH 3S37H 1XWVA 4LLYB 4FTVB 5KYXB 3BYTA 5DK0B 1XMWA 5GGTH 2VMEA 4HGKC 2AV7B 4Y9CA 3L4CA 4HQQL 4YAQA 1NQBA 2ZXAA 3PWUA 2F8XC 2ENPA 5AD0B 4YLCA 1NKGA 3NEXA 5I71B 1P7BA 5J0BA 3FTGB 4PN6A 4TUOB 1MDTA 4P2YA 2WKOA 4JRYA 5G4OA 2QGEA 1F4AA 1URIA 1JCKA 2A9CA 3DUUB 2ICEA 5J3HD 1ADWA 1N19A 2J20A 3KBPA 3T6VA 4GLRI 1ACYH 1TQTA 1I3RA 2B4CH 2X1QA 3GB7B 4FD0A 4ZTEA 5H37G 3ZDXF 4JVUA 5GSRB 2CJUH 5IVXF 4XX1G 5JLZB 2I69A 4RMWA 3ILPB 3DVGA 2WZ6A 3GLZA 3O2WH 3OKEB 5JIMA 2P5EB 2ZD0A 2WCPA 1NDTA 1WFUA 5J11B 4FQ1H 3CBRA 1UG9A 2ZKHL 4JRYB 4OM1H 3VXOA 3MRIA 2B1AH 2CGRL 1E42A 3WEOA 2OBGA 1J8HB 2QQNH 3Q01A 3O6MH 3BP7A 4QXUL 4L4TD 1KT2A 3G5ZA 3WFBH 3QEGL 3SBPA 3F58H 3WELA 3V0GA 1R9FA 1JWMB 1ETA1 4ZTPH 2R23B 3TJEH 1F1DA 4JPWH 4OUUA 3I6GB 1IJ9A 1QI5A 1DBAL 1UWEH 3X13A 1I8IB 3MLUH 1A02N 2DWEB 1CGWA 2G0KA 2ZOWA 4U05A 1A0QH 3QVAA 4Q6IC 4MXWH 1CPUA 4KKBD 2PPDA 1T04A 1FYHB 1XGUB 3KPOA 3UPRB 5FM5M 4PRAA 4XCCL 5A6IA 2FGWL 4QHMB 1ZSDA 2HH0L 4B3EA 5CP7B 4WRLA 4B96A 1C5DB 4EI0A 1M1XA 3MNZB 5CEXB 2ZF9A 3CXHK 2G30A 4Y4HB 2OL3H 2P1YA 1E0OB 3D85A 3M8OL 4PRPE 2HUEA 3ARUA 3COOA 1XXDC 2FQEA 3WSQL 1XF2A 4OGAD 3W9DA 4H8HA 3VMOA 4F7MA 2X7LB 2ZYHA 3SDCB 3UPRA 3GXFA 1KZYA 1WZMA 3CVHL 5BZWB 1GYVA 1ZTXE 4ETYA 2WLMA 2DYPB 3Q5OA 3JTTA 2X4TA 1PLGH 1YN7B 2CRYA 3KNBA 4H25B 3B2UD 1KG0A 4GRLC 4NWUH 2DWYA 5FV1L 5JOPE 4FFVD 3MJ7A 3D85B 1LP9E 3BZDA 3LJ3A 2FBJH 1C12B 2YSTA 4RGNE 4YIQB 2O26U 2OQJA 4PJ9C 1NMAL 2VW4A 3Q8AA 4N2EA 3VQMA 3FO0H 1J1OH 1JPGB 2GCYA 1CDHA 3NYKA 4B6ZA 2QPSA 5FA3A 2AC0A 5AD0A 5B1JC 3BD4A 4PVNA 1HL9A 3FRPG 3MRRB 5J57B 4NN6C 1QPXA 4NRYA 2ID5A 5LGKA 3QUXB 4L4TB 3FOLB 5I8OH 1S7WA 1L9SA 1L5GB 4HP5A 3TT1H 4F58L 3DETC 3REWB 5D93C 5IB4A 1JF5A 2FYYA 1MAML 4IMKA 4JDVA 4M6OH 4OJAA 4U1SB 5SX4I 4HFUH 4WW2B 2DLHA 1HYRC 3KLKA 4WWKC 5FA3B 3HC0B 1N64L 2R2HB 3O6FB 4K7FB 4WTWA 1JK9B 4O5LH 2X3AA 5MEQA 4Y2DB 4JG1L 1DQDH 2D03H 2DMCA 4XPTH 2OK0H 3DXAB 2QVTA 2VC2L 4XP9H 2GQHA 5L8KB 3MBWB 4M03A 4PWKA 2H1PL 1AG6A 4PRPB 4PS4H 4XMPH 5D55A 2BPBA 3D39E 2QFPA 3P0VH 5DD6B 5IEHB 4GPVA 2WWMC 1EAPB 3GPEA 4OSUH 5ITFB 4JEGB 3S0PA 1PZBA 2VR9A 3EJPA 4BFRA 2PYED 3EYSL 4BELD 5T1LB 1NCAL 4BXSV 5DT1H 1ASPA 2YPVH 2K9FB 3PWPA 4UT6L 4G8AC 5GHWH 3UYRH 4AJWA 4YDLC 4LF3B 4RMRA 1NEZG 3DETD 3GJFB 3D34A 3L4TA 4YX2L 2WJ7A 4W9FC 1KIUB 3KYNA 3ZSTA 4KGLA 5DTFA 2F54E 5CEYB 1AG0A 2DDQL 1BAWA 1PEZA 2R0WH 1USZA 4NZUL 4JY4A 3K6OA 1JVOA 3ULVC 4B9ZA 3OQ3B 2BP3A 4ZUVB 1QR4A 1UCBH 5I1LB 4YVUA 3LVEA 3CDZB 1HYSC 4CVZB 3G6JA 1VFAA 2W65B 4N2NA 3RHWF 1U8KA 4TUKL 3B9AA 2E0PA 1S9KC 1D5BB 5FO8B 1TQBB 3B7TA 3SDCA 2A0LD 1VFMA 3KGTA 2P5EE 1QZNA 5EN2B 4LAQH 4BZ1H 2WXNA 5FM5O 4KNTA 4NIYE 1FAIH 1UEMA 2XQBH 4FKHA 1EXUA 1N6UA 1GZHA 1I1YB 2JTDA 5EO0B 3D08A 1EEZB 2JXMB 1HH9A 4RIRB 5D1XC 2FR4B 1Z66A 4YIQA 4YBQD 1UXLA 2C4FU 4Z23A 3KW8A 4U1MA 5EF1A 4PJFB 5F9DC 1KCUL 1KYOK 3BESR 1PY0A 1PW3A 2GT9B 2DMKA 3SDXE 2NQ3A 2IG2L 4YHLL 1ZLWK 3X14A 2MOQA 1EUTA 2NXZB 3Q9QA 4U1KA 3DX2A 3OL2A 4ZUSA 1FGNL 2WAQA 3LZFH 1WZ1L 4ODHH 4WI0B 5DZVA 3N42B 1XSKA 2LVCA 3UAAA 2AXGB 1P7QA 2L8AA 3RWFA 3PXLA 4DGWC 1N67A 5ABZA 4QRRE 4UILH 4ZO6A 1UA6L 2JK5A 2XQBL 1E9PB 4JR9L 2Z8RA 2MWCA 4I5BA 5HHXL 1ZAGA 2W95A 3BVDB 3HBPA 4QJ4B 4GXFA 4APQC 4HIIB 4R7NB 1BF2A 3BUBA 3KLHD 2NNFA 3VH8A 3UTTA 4X99B 5DUJA 4WEEA 5DD1L 2GYSA 2PXYC 3U6RA 3B7RL 4OW6A 3TBTB 3HR5B 5I1JH 5AVZB 3F3HA 3VI3B 4NO2A 2DQUL 1UOWA 5DRZA 2OX5A 4QOKD 3BWAA 4PJDF 3EXJA 3I9IA 4JZNA 4H5SB 4PRNA 5C6PB 3OR6B 5CJ8A 4W6WB 5GHWL 4IK6A 3SHSA 3NFSL 3IAQA 3T8XA 3UYRL 1TEGA 4F9PC 5L2KB 3BH8A 3SKMB 1WPCA 1J0KA 1NCAH 5L88H 5C09B 1I1AB 5AWNL 2YR3A 1ZJAA 2X28A 4PJHE 1D9KB 4M5ZL 5EG6C 3ZTDC 3FZUD 4QHKI 1GHFL 3B9VA 3CHSA 1NDGA 3TASA 5FX3A 2FWUA 5IB1A 2UUDH 1TTGA 3VXME 2UX6A 4NNXA 3N06B 1XCQA 2P8LA 2YGQA 1A1OA 2A9NL 2ZG3A 1RP8A 1CG9B 1OEZW 4HKJB 4QRPB 4P23A 3BYYA 4DETA 3JWDC 2CIIB 3TXAA 1RULL 2H2PD 2VISA 1K5NA 5DD0L 3EGSB 4XGZA 2OMBA 3AGWA 1JMZA 2PR4H 3CLFH 4ZPTB 4F15B 5JHDA 3HVDA 3ZMEA 4PJEE 1IC5L 4DH2A 3ZKND 1IC7L 2HP4A 1UA7A 1V3JA 4JR9H 2J5LB 4OJCA 4LPUA 4WV1A 5D6CA 3TBVA 3TJHD 2N7SA 1DVUA 1JTTA 3MSPA 3ZBMA 5FUOH 3T08A 3UBXI 1VADB 1W8EA 1E5UI 2Y9RT 4ODHL 2GK0B 4HCGA 4Z7UE 1YECL 5DUPH 4OLWL 1SVCP 1KPRA 5DEGB 1G0YR 1QNIA 2YAPA 4YE0A 2QGCA 1QSFA 2DEYX 5I75C 1FFRA 2APVA 4V1DE 5KYWA 4Z8FH 3FFDA 2F8OA 2WZPA 2IBBA 4BWWA 3WTUA 1MQKH 4OGYL 3SOBH 3ZTJH 3JV5A 5KS9B 2BSDA 3BLBA 4NQDE 1SM3H 4YXKL 3QEHA 1NCCH 4AQEA 4L1TA 3PCYA 2GSGB 4Z7QB 5CJQH 3LPPA 5F7BA 2LABA 3U83A 5C6TH 1K3IA 1ZE3H 4OZGE 2WKGA 3B56A 3PUCA 3FU9A 5GPRA 2MFNA 3MRLB 2FH6A 3QSKB 1ZVSA 1JZFA 2YLHA 4IBWA 2YPLA 5EV7A 2J12B 5K9QI 1R3LB 3ZVVA 4HKXB 1A7QL 3NA4A 2YMOA 3LPWA 2GBUA 3U6RB 5C0AE 4PPTA 3D85D 2YA2A 1MI5A 3QEHB 4XRCA 3S4SG 3X1GA 5J6HA 3QJUB 1U93A 1MCJA 3T2QA 5GS0C 4KY2A 4PYHA 1TVHA 4QRPD 3EG9A 2X4PB 1J9CT 4XCCH 2H7WA 4JFDA 1HSAB 3BOVA 2B5IC 3QZLA 4ZBJA 5AZ2L 2V9TA 1NDMB 4GAYB 3TFKC 3U0TB 3MOBL 4ODTL 4AT6B 4NJAH 4TXVB 2JJUA 1TMQA 4DGYH 4H40A 3GXMA 2WNWA 3KPPA 3IXTB 4NZRH 4FP8H 1YNLH 5FS5A 3G6AB 2F6AA 5D1QE 5GJSH 3D0VB 4Y1SA 3O6ML 4QXUH 4E2OA 2EUZA 3N40F 3QPQC 1DLHA 4FTVD 4PJ5E 5EC2A 1E7UA 3MLTA 2BIIA 1BPLB 4PS4L 4XMPL 3SPJA 4G8GE 4C47A 5L2JA 1WCBB 3IF1A 4MGXA 5CNHA 1INEL 1YEFL 5KSAD 4JS7A 3HNSL 3CFCL 3NACH 3IWUA 1ITBB 4X80L 4MLIA 5D7LA 4AE0A 2B4CC 3FQWB 3MRJA 3DGGB 2Z7ZA 1N64H 2CUIA 4K5LA 2VLRD 1A64A 3KWVA 3V0HA 2CJUL 3QQ4B 4M93C 3TO4B 3QWNA 2VM9A 2XV2A 1MH5A 4ZW7A 3C5JB 4XC1L 3RLSA 4QO1A 3O6FD 2VLRA 1KLUB 2R4RL 2VYRE 3OR7A 5E51A 3O6LH 1MFDL 2ZWNA 2J1ZA 4ZOAA 3UC0L 1HI6A 4G6AD 5HP5A 4W9DC 3BDYL 4Y1AA 3WFHB 1W8OA 3H8NA 1LE5A 4POZD 4JKMA 3R0NA 5EIIA 4MAYC 2VXSL 5BRZE 3FPYA 4Y2DC 1UWFA 4GW5A 1PG7W 2AEIT 3HZMB 3S37L 4JO3L 3HA0A 3C9NB 4MDIB 3NPSB 1X7SA 4GMSH 3VI4A 3HLKA 2G9HA 1PNDA 2FBJL 4F3FA 2A9AA 1CURA 5AKRA 2YEVB 1FFPA 3S3DB 2IF7A 2K3HA 2VITB 4Y0GA 1M7DA 4HJ0D 2ITDB 2UY7A 2WW8A 2NY2B 5KVGH 5AYQA 3BD5A 1CICB 5LBVA 4D9QD 4QRTB 1DJZA 4OZHB 3I6SA 5LAPA 4M1CC 3TC9A 2R0LH 4YO0A 3T2LA 1XMEB 1O7DC 3CZEA 3PL6A 2EVGA 2WMPA 5J13B 4NAMA 2WP3O 1A25A 5IMKB 1BEXA 4WFGE 3HS0B 3V9EA 1LJMA 2F68X 2LLGA 2YAEA 1T1YB 2XWJB 3EJZC 4K73A 4I85A 5T8IA 2IDFA 2ZXBA 2EILB 4XWGL 5CJ5A 2WO2B 5FC9A 5F9OH 4Z3HA 2HH0H 2EIZB 3O8XC 1T89A 1AMYA 3RFZC 1EZVY 3F85A 3VW3H 3C08H 2ZYRA 3FO1B 4WV1C 4XOAA 3HKFA 1YQVH 3NT0A 5JHMA 2XG5A 2A6IB 2J73A 3FL7A 5DMKA 1NC4D 2B0SL 4H8PA 3FT0A 3FCSB 4YDNA 3ABMB 1ULVA 1UWEL 4I8DA 4YE4L 4CILA 1E6JH 1FL5B 3RG1C 1FRGL 1M2VB