1KMGA

The solution structure of monomeric copper-free superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of copper-free SOD: The protein before binding copper.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1kmgA00
1XTLA 5KBMA 2WZ6A 3T5WA 2VR8A 3F7KA 2GBUA 1JK9A 1SRDA 1RK7A 2AQPA 1YSOA 1BZOA 3KH3A 4FF9A 1COBA 1E9QA 4A7TA 1OAJA 4BCYA 2AQQA 2ZKYA 1IB5A 3HFFA 1FUNA 3LTVA 2JLPA 4OJAA 5KBLA 3GTVA 2Z7YA 1CB4A 3K91A 2Z7ZA 2E47A 1U3NA 1BA9A 2APSA 1F18A 3GZPA 2AEOA 3MNDA 1TO5A 4BCZA 1ESOA 1F1GA 1N19A 1P1VA 3H2QA 4A7SA 2AQNA 1XTMA 1JCVA 2ZKXA 4U4IA 1CBJA 2Z7WA 1EQWA 2WKOF 2C9VA 2AF2A 1IBFA 1SXCA 2JCWA 4A7QA 1L3NA 1OZUA 1F1AA 2NNXA 1Z9PA 2GBVA 1S4IA 3ECUA 5CU9A 1IBBA 1N18A 1SDAB 3KH4A 1XSOA 1B4LA 4MCNA 2WWOA 2Z7UA 1SPDA 3KBEA 3L9YA 3ECWA 1EJ8A 2ZKWA 2WYTA 4A7GF 5KBKA 1E9QB 2C9SA 3S0PA 2AQSA 4BD4A 1AZVA 4A7GA 2K4WA 4OH2A 1HL5A 1SXAA 1E9OA 2AQRA 4MCMA 3MKGA 2SODB 1DSWA 1Z9NA 1HL4A 3KM1A 1YAZA 3GTTA 3F7LA 3HOGA 4L05A 1OALA 1IBHA 1YAIA 3GZQA 2XJKA 3ECVA 2WKOA 1E9PB 4B3EA 1OEZW 3L9EA 4A7UA 1SXZA 2GBTA 2ZOWA 3CQQA 1DO5A 1UXMA 2VR6A 3PU7A 3GZOA 4A7VA 2R27A 1MFMA 1SXBA 3QQDB 1JK9B 1F1DA 2C9UA 1UXLA 2XJLA 2E46A 2LU5A 1E9PA 1Q0EA 3RE0A 2WZ5A 3QQDA 2WWNA 1SXSA 1IBDA 3CE1A 3H2PA 3KM2A 3CQPA 1PZSA 4N3UA 1TO4A 1PTZA 1SXNA 1SDYA 3SODB 3GQFA 1B4TA 1PU0A 1E9OB 1KMGA 3KBFA 2V0AA 2VR7A 4N3TA 2AQTA 2WYZA 1QUPA 1OZTG 1SOSA 2WZ0A 3HW7A 2Q2LA
chains in the Genus database with same CATH superfamily
3NCXA 1CF8L 5DJAB 5D1QA 1TKWB 3FUEA 4ZNCD 5INCA 2YN5A 4PWIA 3G7TA 5E6IC 4LKXB 2J6EH 4WFHD 4Y4FB 2EYSB 3WFBH 1BM7A 3ULUL 1U8MB 1H9DA 2GJZA 1HHGB 2I24N 4OFQA 4X5WA 5HVGB 5DC9B 2XQ0A 1KLFA 5J0BA 2DEYX 4OLVH 5BZWA 4EUPH 1KTLB 4C56A 3OMAB 4HJJL 2V5MA 1U41A 2FJGA 3EJUA 3GIVB 4K73A 3MZGB 2ZWLT 1F8TL 4P2YA 5F7KC 3B2UC 1FIGH 3JTTB 1AI1H 2P52A 4LSTL 4WFGE 1OE3A 5K69A 3W38A 1FL6B 3DXAB 3V4PH 1MFCL 3FUJA 3V5DA 3D7PA 5DRWA 3TFBA 4N0CD 5FUOH 2DWDB 2G4EA 3QWNA 3NCEB 2AQNA 4DZBA 3H3PH 5JTWA 1A1NA 3OMIB 1RZQA 2ZWZA 4FP8H 3HC3L 5HGBA 4HUUA 3LKOA 4XN2A 3C6SB 3NIGF 2X87A 3ZE0F 2EDTA 1QOKA 5D7SL 1WP6A 3MLVL 1F6FB 2WKLA 3MRGA 4L1HA 3U4EA 1MJ7H 4JQXC 4JCMA 3QNYB 4XB7A 4YBLC 4XN9A 2NQCA 3C08L 3UG3A 4DK6A 4JM2A 4FQ1L 3FPXA 1VB9A 3P30H 3UGEA 4FQLH 5A6IA 2APWA 4GO8A 4Y9BA 5DEJA 2WQSA 4MMXB 5E2VL 3WKMH 2FX8H 4F91B 5E94B 5T3XE 1CDGA 3FT9A 4X80H 3NMEA 4Z7NB 1BYNA 5KAQG 3K8LA 5I73B 2YPVH 1UOWA 1E6OH 3QHFL 4OW6A 2OXGB 3AS2A 1SF3A 4XH2A 4YLBA 4ZMZA 4U1HB 4AH2B 1NFIB 1I7ZB 3LHPH 3NPSC 4OJDH 1U8LA 1I9EA 5AVVB 1IAKB 2WMPB 1X5ZA 3VRJB 5C2BH 2QGBA 3RVWC 1D5MA 4M43L 4W9ZA 1HOEA 4CN1A 4R6UA 1IM3B 2XLLA 4N0RA 5IBTL 2IMMA 4P5TD 1EMTH 3JVGA 3VGFA 15C8H 4ZFFA 4KZDL 1ED3B 1WZLA 2ICWB 3O4LD 4L3EB 1QFWL 1QHOA 4G8IA 4N85A 3RFRA 3FN0H 3GMPB 4X7DC 3S3SA 1FV1B 1HN1A 4KKZA 4P5KA 3G04A 3MCYA 4XNYH 3GO1L 4X0KB 1WA1X 4JX0A 4HISA 5T5FL 3R4DA 4LNVA 1P1ZB 4XHJD 2E4FA 1U0QA 3I74A 3T3MF 2FX9L 1AGBA 1KTLA 4NQTA 1KMGA 3NK3A 3DV6A 3NRQA 4NEHB 4GW5A 1UZ8A 1A14L 4HVBA 1NUNB 3HW7A 4ZZFA 1GCYA 2NSXA 5DUBA 3I50H 4Y1AD 4BWTA 2GJ6E 4JDVB 2ZOUA 3VQLA 1RCYA 3FQNB 4H0IA 2WQXA 4JFXA 3WNIA 3QPQC 1T0MA 4TVPE 3ZO9A 2DY2A 1PMYA 5LQBH 2H2SC 3TH3T 1JV5B 4YSSA 3RUGF 1KFGA 3QWRD 4JFFA 4JRYE 4OFYD 3V4VB 3UBXB 4ZYKA 2IALB 4FABL 5C70A 4PFEA 3DUSA 1U8JB 3BWUF 3L54A 5ABAA 5JHLH 3QDME 4PRPB 3UOAB 1T21A 4JR9H 5D1ZD 2OW6A 1J9RA 3WGVB 2XZZA 5CGYC 1JZ3A 5T1JA 4M56A 3K4DA 3MFGB 4M02A 1I8KB 3BUDA 2ICES 5IOPB 3HAEB 5FA4A 2V17H 2YFNA 3MRKA 1MCNA 4HKXA 4B6ZA 1BLNB 3MRRA 3W9DA 1XAKA 2IOMA 3IDXH 3NGBB 1HKFA 1GC1H 3SPJA 3MRFB 4MQTB 1F5WA 1QFWM 3PNWA 4W4OA 5T5FA 4AVJA 4XVOA 4U1KB 5FDWA 1CXHA 1ZOXA 2WWKT 1TQBC 4PWHA 3TYFA 3LYRA 2PETA 1U2HA 4XXDB 3X3FL 5D7JA 3GDBA 1ZSHA 1XMWA 5D1XC 1YEGH 2OJZH 2OMTA 4HBCH 3ZR6A 3JVGC 3LDBC 1HOCA 2IIJA 3IF1B 3SE8L 3T0AA 1LHZA 4GAJL 1HINH 1T5XA 3JV6B 4FMFA 1N8ZA 5HGAA 4LHQB 2VXUH 3RTQA 1IBYA 2NY6B 3O2VH 5C09D 5DVOA 1QSZA 5GPRA 3J07A 5KUMA 1XF4A 3QFJA 4EZLA 3K5RA 2OCCB 3DGCR 5FO8A 2FX9H 1YYLH 1NCNA 2OCJA 1O9ZA 3DX2A 4RLDA 4EVNA 1WHPA 1KLFB 1IM3D 3ABMB 3L2MA 2WV3A 3KW8A 5A2FA 3NCMA 2GSMB 2UWEE 1DO5A 3IGAA 2VMFA 5CEZH 4R4NC 4YHNB 5ISZE 3F5WB 5F1OB 1XGYL 5JHDA 4BA0A 4LSSH 3H7BB 3QXAA 4JG9A 3TNMB 5C3IA 4HPHA 3V0GA 1ILSA 3C8DA 3ZKMC 4Z3HA 1YEDA 1XGUA 4NUMA 1L9SA 2ROXA 5KYUA 3FB8B 1U2YA 2CRMA 2QLYA 2OXHB 1N8ZB 3EH4B 4YHIB 4F2MB 1YMME 2VLRE 1QUPA 2NZ9D 1RZJL 3JV4B 3ML9A 4V1DA 5EF1A 1AO7D 2GITB 3SDDC 2JWYA 3PWPD 3WD5L 2VAAB 1BZEA 2HT4C 4ODWA 4FQIH 5HDBB 1EDQA 2ZJSL 5IHUL 1NJ9B 4O5LL 2CHWA 5DFTA 3T2NL 4G2AA 1FRGH 1J0YA 1HSAA 3ALWA 1I4FB 2OMZA 3O45B 4Z0XA 3SOBL 5HHOA 2QLVB 4S10A 4HV8A 3VXMD 5HDQH 2PTTA 5D6CA 5KYXA 2FO1A 5EBMB 3B7TA 2YKKA 5T3XH 1KGWA 2XQBH 5DJ8B 4OGXL 4X6DA 1KDIA 1RMFL 1U3NA 1U6AH 2YPLA 5DT1H 2OR9H 4O58L 1E2ZA 4KJYB 4PIRF 5D7KD 5JW4R 2OJZL 1VKXA 3JWOL 3RWHB 3W56A 2ZT9C 4E9TA 1C5BH 2VZ3A 4DP5X 2IPKB 1Z3GL 1F6AA 1SY6H 4WNQA 5T3XD 4JO8A 1FHNA 3IJHA 4N86A 3RHWK 5JDJA 5CZVL 2X53A 3BAEH 2X1WL 3FBKA 5KS9A 4U1JB 5TE4H 4M7KL 4JFVA 5T3ZH 3SJVE 4OGZA 4NKMB 4IU2B 1JZIA 3GRBA 1USZA 1IBGL 4AUJA 4NT6A 3HHSB 4O4YH 1W0YT 3KLAB 4QT5A 1P4IL 5B8CA 4Y5YC 3MRDB 4TQIA 1R3LA 4HS3A 4BA8A 1MIEH 3I3DA 4Y5XB 3WUZA 3LNHA 2V2TA 2I26N 3LZPA 4BD4A 3BUBA 1UZ8B 4JVUA 2QGDA 5DRZB 5F89A 3R7QA 1IKNC 1RZIA 1ZGLM 9CGTA 5IMOB 3AMKA 3IDYB 1HL5A 2M83A 1NMCB 4GAAA 3LQAL 2NY6D 1EZSA 2QFPA 4N8PA 5C09B 1VENA 3BUQA 4E0RA 1A6ZA 1TR7A 5C3LD 1YNLH 2GTWB 4P3CH 4ACTA 3JT0A 1QSEB 5GRZA 4WW2A 5ENWA 4JY5H 4RMBA 2A4CA 1LP9F 2P1YA 4JZJA 5KAQF 2X7LB 4ICXA 4ODTH 2Y36H 2NQ3A 3C6LD 3K6OA 3NFPB 4KI5C 1JGUH 2P4AB 4QXTB 4EDXB 5EUOA 1IL1A 3OJDB 1ZA3B 4JREC 3SE6A 2EKJA 5AD0A 3S35X 5DSCA 2YAMA 2J88H 3GUTB 2J57A 1EGJH 3OB0H 2DOCA 1PZSA 5D1QC 3VFUA 5AVWB 5LB1A 2AKRB 3US0A 4JPIA 2GEQA 2QHRL 3E80A 4MB4A 5AOLA 4V2CB 4DP8X 4DN3H 3QZWG 1CURA 3DRQA 3MV9B 2EYTB 5K59F 3W9DB 3NH7L 3CXHK 3CJJA 2COQA 3DA0A 3S7GA 2VITA 3E8VA 3IN0A 2R0KH 2H1LM 5JW5A 4OCWH 4L4TD 5HGDB 3OX8B 2VQ1B 5I18H 4AG4H 5LDUA 4K7FB 3EUUA 4HUVB 1AHWA 4BUGA 4IOFD 1FL5A 2XI9A 2EEBA 2X5PA 2Q86A 3QH3A 4XX1E 3VYNA 1A47A 2AS5M 4AQ8A 4QRSB 5E5MA 4HWEL 5JPMA 2JQAA 5IHLB 4BCYA 5H37H 3TA3C 1SHXA 4LGPB 5B7EA 2X4RA 2CK2A 1UEYA 1CXKA 1QYGH 4FQQB 2JLPA 4IOIB 4F57L 1EWHA 4F7CA 2J8OA 4Q4EA 1NAKL 3ARXA 2ORBH 4DPAX 1AYOA 1G7JB 4ZPVA 2QPSA 5FCUH 3VGBA 3AW5A 1OM9A 2AEQL 1N7MH 2FLMA 4X9IA 4JM4L 2X6UA 2MCG1 4MQ7A 4G7SB 2PW1A 4PJCB 2CLRB 4NOFA 4GG6E 1ACCA 1CQKA 1RXLA 5K5YA 2BWIA 3BZFA 3GSWA 5AZ2L 4WI5A 4FMKA 1M3IA 1MW2A 3CK0H 4ZOAA 2R23A 5B1JC 3IJEB 3FXIC 3QHZL 3WHXB 4F7PA 1UH4A 3VU1A 3CC5B 3O8XA 3BP5A 5K39B 5ACLA 4J5VA 2IBBA 1NC4A 4CMHC 3D6GA 2WTRB 3GSRB 5E4OA 1P9MC 3U48A 3KLDA 3MODL 5AW7B 3UPAA 3SE4C 3P11L 4N2AA 4AQEB 1EV2E 1S5IH 1ECZA 4LSUL 4TTDD 4WFFD 2OP4L 4OH2A 5DHYB 3T8VA 4TNWF 4HSAC 4CJ1A 2D0FA 2AJVL 1Z9NA 1JMZA 1WS7A 2C3VB 4OZFG 5I1LA 1R1CA 4XBPB 4Z3EA 5IFAH 3I9GH 4FTVE 4KVNH 3V6OE 3MHZA 4KVCH 1G7IA 4NQDD 3VI3A 4IIZA 4IBQA 5HDOA 5I19H 2WQAA 1TG8A 5IW6A 5KVFE 2DQUH 5ANHA 2YLKA 1THCA 4NNXA 1DEEA 7PAZA 5K9OA 3NCBB 3A22A 1E6OL 1Z66A 5CCHE 4AQ1B 4M5SA 3U7YH 2WXJA 1TZ8A 3N44F 3GGWA 3Q48A 2CUHA 4N0UB 4OR1A 4O02L 3Q5OA 4MJ5A 4AEFA 1BM3L 4ZAKB 4Z7OB 4NFDA 1O9VA 4Y4KC 1L0XA 3I2CL 1Q9OA 4YHOL 5LBGA 1ULVA 3BFQG 5GS0C 1U95A 2I32A 3LN5B 4F57H 4HK3N 1UJ3A 2R1XB 4AUUA 4HKJB 3OHXC 3VRLE 2FB4H 1KV7A 1MRFL 2HLEB 3OLEA 4BV1A 1PS3A 2F19L 3EYVA 4R97C 2NXZC 2QV2A 2PWFA 3L5XH 5FUCC 1DZBA 3G08B 3KL0A 3F58H 3NACL 2HFGH 3I6GA 2ITDB 3Q8AA 4OZFA 4QRQA 5FYKD 3D18B 3NCWA 3NT0A 2MCMA 5KYUB 5DZJA 1HDMB 1I7RB 5AW3B 5IV2A 3ZDXF 3VXPB 1TU2A 2MNWA 2ZF9A 2VDLH 5IMOA 5HPOA 3FCTA 2C1OA 4RDQG 6FABH 3JYBA 1VESA 1HXMA 4LRNH 1TZAA 4KKQA 5F7FA 1MZZA 1OTUD 4UQAA 1XB8A 4U1LB 1P5UC 4YHPA 3UH8A 2FEJA 5LN4A 3IJSA 3ZE1E 5JZ7C 5KWYC 4PJAE 4U0RC 1BFSA 1P69B 2ZKXA 3FCSA 4MHHG 2D7MA 3HPLB 4NSKB 1INQB 3MBXL 1KGJA 3FRPB 4OT1H 1NSNL 1S7QA 5HYJA 3OZ9H 3ETBF 3TASA 1UJ3C 4AY0A 3GB7B 4KJYA 4C4BA 4JZOA 2ZUSA 2KERA 1KN2H 2FUQA 2WNXA 3GK8L 4PI0A 3BAXA 3UDWA 1EO8L 5EHFA 2X9WA 5GS2H 1S2EA 1MHEA 1WIUA 3OB0K 3LKQA 4K3EH 1H6UA 1S9WA 1YEEH 3IDXL 1J5HA 4MJ2A 4YHKH 1T6VN 1BFTA 3SE9L 5F7LB 1RUQH 3TVMB 1NIAA 2H3NA 4W70A 3B7RL 5CILH 4MMYA 4L4VE 2UY7A 1TJGL 1DSWA 3L3GB 5BZDA 4ZFQA 3AMLA 3V0WH 3C60A 2TRYA 4NP4L 4WUKL 5AVYB 1J0ZA 2CQVA 3NIFE 4OLEA 3WUWB 3LZQA 3S5ZA 4DVBB 1M7DB 1E50A 1Q94B 5ESVB 5KVGH 2JIXB 5J9PA 3ZW3A 1RUPH 1TIUA 4L0ZA 2XZCL 1NGYB 4XN1A 3MRHA 5C2UB 1BQSA 4UQ3B 2ADIA 2A9MH 4WHYH 3PJSB 2VJ0A 1MFMA 4UTBH 4BK5A 4A39A 1UXSB 3ZHLA 3QP3A 3ULSA 5DHVB 1NDGA 4JB9H 1NM4A 1MHHB 4FNPA 2J8UB 4FA8A 3MQIA 1MHPH 2DLHA 2OTUA 2NCMA 4M6NH 2HCZX 5IQ7L 3CH8A 1SVZA 5C07D 2J71A 4X6CE 1QNZL 3VXPA 3ESMA 3OMZA 3IVKA 1JZ2A 3LIZA 4UT6L 2BO0A 2A6JA 1YN7B 2J44A 2Z31B 2KPWA 5EBLB 3V0DA 3UZVA 4XWGL 4YC2B 3WTUA 1CGYA 4KROB 1UA3A 3QARA 1C5DB 3FT4B 3S5YA 1XXDC 3F6JA 2V5YA 3L3KB 4XBGB 5LG6A 2WOYA 5FUZH 3UAAA 5TK4A 5EU6D 3ZHDA 2VZVA 1RP8A 1G1YA 2AXGA 4JRYD 1EFXB 3OF6D 2CLVA 4P23B 1EPFA 5EU7E 1T7ZA 2P45B 2R9HC 3HEIB 3G5ZB 4QGTA 4HQQL 3GMNA 5DVLA 1Z7JA 4LCIL 4MCYB 1N0LA 2G5RA 1Y6KR 4V2BA 3R06B 1UFGA 4P2RA 1IGJB 2CNYA 5EIQA 4NRZB 3T8MA 3FO9B 1I8LC 5HDQL 3S8WA 4X8XA 3MBWA 4EI5C 3ARTA 4Y5YB 4MCZB 1X6LA 1N3NB 2IBZX 3OG4B 3SCMD 4YX2H 1JMXA 2DKSA 4NJAH 4HMCA 3A4DA 4JRLA 2D31B 1I1YA 2VDQL 4JHUA 5JOPE 3GXMA 3FO2B 3DUSB 3KPLA 1LDPH 3JWOH 1JPFB 4J3OF 2DN7A 32C2A 2J7LA 2Y2TA 1KTDB 2BINA 4YIQB 4DTGL 2H47C 2VE6B 4PTTB 2H3XC 3LN4A 1TQCB 5AVUB 3AB0B 3NZUA 2HH0L 2P24B 3F5WA 4LL9A 4RRPM 1WEJL 2YARA 3FFDB 3K74B 3KYAA 2CDEA 2X6MA 2AXHA 2ZAGA 4X7EC 4ZFOB 4DH2A 4UBDD 4D9RD 2VDOL 3O11A 1A65A 1KDJA 3A0OA 4PJIF 4ZSOA 2IBGA 4FZ8H 3F64A 3KD4A 2G3MA 3ECVA 1ZHLA 4O2EB 2WKOA 4B3EA 1HDMA 3ZKQD 3QO1A 5J12B 4PJCA 1P53A 2IOOA 2QV4A 4OZFB 2EIZA 3UROR 4YFEA 5GRVK 5H35A 5FO7A 5F9JA 4QHUB 4WU5A 3RE0A 1NCIA 4KTEH 3IJYA 1J8KA 2BNRA 4F37K 3IETB 4XNDA 3FFDA 5D7JB 2J1YA 1SXNA 2JNZA 4G9FA 1GGBL 5TGBB 4OFKA 1HFUA 2V0AA 3C75A 4FFYL 3MLZL 3P9MA 3MZTA 5CEZE 4NO0A 1I53A 4OF7A 1G6RA 4GP8B 1U8LB 1U6AL 5DT1L 2CJUH 1U8QA 1AHWB 2PPCA 4XPTH 4G1MA 4AQ1A 2OXGA 3DETC 4R7DB 3IWVA 3TF4A 3VXQA 4W1TA 4OFPA 1CC3A 2HUEA 1KYOK 4ETYA 2Q6WA 3O41A 4JM2C 4HGMA 5DJCA 5D8JH 1N3NA 4J2QA 1KXQA 2ZOTA 1EXUB 3X1GA 3A4FA 1KXTA 1T4KB 2MOGA 2ATKB 3MRJB 4HZLA 4IBWA 4PGCB 1IGJA 5AKTA 4OZGB 2FGZA 2WANA 3REWA 3UZQA 4GP4B 1QW9A 2AK4B 5JQ6L 5AW1B 1O6TA 5E1IA 2P8LA 3D5OF 3TT3L 4DP7X 3EZJB 3B8SA 3G5VA 3H3PL 3KYMA 5CSGA 3VD1A 2CBMA 3DOSB 1QG3A 1NEZG 2RR3A 2YLHA 1I9IL 2P44B 5FM8A 3SDAB 4KTDH 3SCMB 5HGBB 2DBLH 1UKTA 5ELIA 3U9PH 4JCWA 1T20B 1MJ7L 3N5AA 3EDKA 2R23B 4TNEA 4NRYA 3MJ9H 5DS2A 3FQWA 4C55A 5HHPA 3FB5B 1O7DC 1MLCA 3MV7A 3GSWB 3QFGA 5DS8B 2AEQH 2F8IA 2XFGB 4FQ1H 4MWFA 5FCUL 5JW4Q 8FABB 2AQSA 4KDTC 2BHZA 3AREB 1R5WB 4IKKA 3IVKB 3R8QA 1ZK9A 3BWSA 5CJOL 1ZHNA 3QAZB 2IAMC 4AOFA 43C9B 4HMDA 1B2YA 1S7UB 3ERXA 2E6JA 2XIIA 3NYKA 1UASA 3RZWA 2Y1AA 1IGTB 4A2LA 3MACH 5A16B 3U1QA 4TVPH 2IEPA 2MSPA 4JFTA 4N2DA 3VGAC 2QQNL 1NOFA 3LKRA 2VDNL 2AK4E 3CFCH 1GS6X 4Q9BA 2FQFA 4PVNA 4QI3A 4WNQB 3HNVH 4C58B 1YPZA 1FIGL 3ECBA 4PRDB 1M1SA 2BZCA 3OLIA 3GLDA 1BAWA 1V7MH 2BCMA 3CXDL 1M7DA 2WWMD 3GO1H 3HZKB 2NXZD 4LIQH 3LV3A 4NZ8A 4Z3JA 1V54B 4BH8A 5CSZB 4ZS7L 4OFDA 3GEFA 1DJZA 1T04A 1HWGB 3MLUL 3QORC 4L8DB 5D7JD 4K5NA 3HI6H 4KKLD 4EE2A 5DWUH 2IWGA 4R8WL 5KSBB 4PJHA 2D8KA 4LPWA 3RWCB 3T2PA 4M6OL 5SWZD 4YK4B 2YEVB 4MJIE 5IUCA 4ZFZB 4WEBH 2VWEE 3T0EE 1KBGL 5JIPA 3ESOA 4KK9D 4NB7A 3ILDA 5JQ6H 3VVWA 4RGNE 1NCWH 1TTGA 2DQCL 2NLJB 4DZBB 4YHLH 2R1YA 2J5LC 4N8VB 1LP9A 4ONGL 3VYPA 3QHFH 6TAAA 2VERA 2C9QA 2Y7MA 3BZ4B 3DWTA 3G5YB 2JKIS 3V7MA 3PL6C 1IKFH 3MX0A 2BVOA 4GMTH 1QP1A 2XICA 3POCA 3BFOA 4DNLA 3L3OB 4PSRA 2WBWB 4MJIA 2EDMA 4G80B 1J8HA 1J1OH 2G3XA 1CE1H 1SF5A 3ZQ9A 1IC0A 3QWRA 3UTQA 2ESVB 4QTFA 3OC5A 1ZVHA 4HHAB 2BZ7A 2DPKA 5B38A 1FNGB 2WVTA 1F4XL 4XNZC 2E5EA 2XCMC 4IRSD 4XVTL 4E42B 4PGDB 5EH1A 2XQYG 3PFUA 3ZHFA 3RGVD 2VDQB 3UDWC 4MA7H 3RVVD 4IU2A 4QNPF 5DUPL 5FM5O 2QBWA 5KBNC 2BIHA 5SWZA 4TVPL 2ZWKA 1GPOH 3LKNB 2WXNA 1JGDB 4X6FB 3AC0A 1MCLA 3C8KB 2JH2A 2RACA 3DKHA 5JXAH 1Y18B 3K2UH 3OKLB 3PP4H 4GQ9L 3GI8L 1PDKA 1CGTA 4FLRA 1WWBX 5L4JA 4TNFA 3G6DH 4K3DH 3O3AA 4OCXL 3TTSA 1AQDB 2XX1A 3OQ3B 4P99A 4GIOA 3VFWA 4ONFH 4ELMF 3T77B 2J5LB 4OM1L 4P5TA 4X0NA 3ZTCC 2Z4QB 2JJWA 3U4KA 5ICXA 1GZQA 3NZSA 2L3BA 2PTTB 5E6ID 1HL9A 3U6RB 1GOHA 4POYA 1OGAD 3L4XA 5CEZL 1I8AA 3IKCA 5HDLA 3HZ3A 3DTXB 4G8EA 4L4TE 4H1LA 3ZSSA 4EOWL 5FAAA 4JR9L 3GHEH 1C5CH 5C8JB 2ATKA 1UXLA 4X4KA 4K15A 4X6EA 2X4OA 3SE9H 1CGSH 4KTYA 2JJTC 5K93A 3MUZ1 5I6XC 1UCBH 5DJCB 3I9PA 3OHXA 2EUZA 4R4ND 2NTFA 4N90D 5A3IC 3B5GA 4NIKB 3MV7D 2WXPA 4TUKH 4G6MH 5HYJB 2YGPA 4OGYL 3GMRB 2X2JA 2DTMH 1JXGA 1Z9SB 5HHMB 3V0IA 3WE6B 1H3PL 5FYKL 2EH7L 4NQSA 2VAJA 4MA3B 5IQ9A 4NWUH 1PQZB 2DS4A 3ZDZE 2V2WA 4QCIA 1CFQB 2DKMA 4YHPB 4WO4C 4KY1H 1A7PH 4PGEA 4PLOB 1FL3B 4OI9A 3B9KA 1T4WA 1XCWA 1HH6B 2X4PB 2JSFA 4QEGA 5DRXB 4RX4D 3MCKA 7CGTA 5EOQH 2DDQH 2XTJC 2RTTA 1HYRC 5E23A 2EVFA 5CD3B 2HFFA 4IIQA 2KC0A 1XF2A 2FT6A 1JPSL 3NRPA 1IGCH 43CAB 1C8QA 2GUYA 4RMUA 4N0FB 2LVCA 4ELMA 1OF2B 4EJ1C 5IJKC 5I1JH 5JOEA 4UU9B 3MROB 3DO7A 1MFEL 4IJTA 1XZ0A 3RI5F 4JKWA 1AXTL 3H2QA 1D5IH 2XTJE 4JY6B 4MAYC 3IF1A 1QSFD 1ZLUH 2R51A 4XXCC 3VRLF 1FN4B 2Z1PA 2A6DA 4PJEB 2ZX6A 1TMQA 5L8JB 1ODUA 1A1MB 5HHME 1NKGA 4IGBC 2XUWA 4YSPA 1KXTB 3QEGH 2E7LC 4YGVB 1E28B 1SPDA 2AK4A 2V7NB 4TQ8A 1FL5B 2JLLA 1Y6MR 4CN6A 1T04B 3D08A 2EZ0D 1OW0A 1J8HE 3MJWA 4OCYH 4NS0A 2YQBA 2QGEA 5AKSA 1USQA 2FGWL 4EKJA 1MDAA 3ARRA 2CDGA 3W0WB 2HX8A 2W07A 1T5KA 3MRBB 4HDIB 2G9KA 4UTBL 5C0BB 1B2WL 1O6SB 5L2KA 1UXWA 4LSVL 2NQDA 1KTKE 3CMGA 5TPWL 5T33L 1FE8H 1NCDL 5C08B 3HLAA 3RX5A 2R29H 2GTZA 4L05A 1EUTA 1FZOB 3DYPA 3JUYA 2L04A 5IT2H 2C4FT 1QSFE 3VG0L 3M88A 4GIAA 1AHWC 1KGXA 2BMKA 3QDGD 4WW2C 4DTGH 2XXFA 2AXFB 4Q2ZB 3QUYD 5TE7H 3KCPA 1NIDA 3CXFA 4UM9A 4DGYL 2CK0H 4LLDB 5IVXF 3VAEA 2NW2B 1XL6A 4Q8BA 1A7BA 2BK8A 2WQ8A 3TT1H 1DE4B 1ZHNB 2AJUH 2VUKA 2IPUG 4JFPB 1QA9B 3PAVA 2XVBA 4X83A 2D0GA 4QHPA 4BSJA 3ORJA 2DH2A 1ZTXH 3QO1B 2WB7A 4HEME 3CAFA 1T03H 1V05A 1YEKH 3FB5A 3MV7B 2ZG3A 4UT9H 3ZOAA 5F9JB 2A77L 4MX7B 4RA0C 2YD7A 2XWBB 4HX1B 4K9EC 1CK0H 4FXLA 8PAZA 4Y16B 1UA7A 3L6FA 2FJSA 4HIIB 4KJPC 4AQAA 4L5FE 4LOFA 3L8QA 1URZA 1T7WA 3VJ6B 1LE9A 1OL0A 2DJSA 1H6EA 4XWOC 4LKXA 2G75A 4YJZL 3DGDA 3EGDB 1IARB 3A6BL 3D3VA 4HUNB 3MRQB 2OSLA 4I3SH 5IQNA 1RUKH 1WFMA 5EC2B 3CU7A 2I60L 1IB5A 5I19L 2LLNA 1MUJA 2D0HA 4AIEA 3T08A 3CSGA 2VKWA 5ITBL 4AM0B 1CYGA 4JAMA 1NCBL 1TQCC 1X9UA 3BIKB 4U6XA 3SDDA 2B3IA 1EXUA 1IC1A 3U0WL 2CO1A 3PLYA 5CJQH 5T1LD 3NSYA 5DLLA 3A6CH 1S78C 5CN2A 4LVNC 1X9QA 5EU6A 1F1GA 2BXZA 3FO2A 1TTCA 3ARFD 2H6PB 1NBYB 4UMGA 4G8EB 3SE3A 1JGUL 4XT1C 5CMAB 2X40A 4UTAA 3QZNA 4ZO7A 4JM2B 1KYFA 2XV2A 3FSAA 4I0KA 4NPJA 3VRIB 5IFHH 3O6FD 2YZ1A 4QXUH 5AKVA 2EP6A 4IOSD 5ETUB 1QW8A 3C6SA 2EDEA 3G6JF 1WBYB 3ZHKA 3IMTA 3UGUA 5GZNC 4ZOBA 1YJDH 4X9HA 3RFZA 1CUOA 1ASQA 4RQQB 4NENB 3ZUNC 2JB6A 1ILUA 4V1DB 2JKJA 1VHPA 5J6HB 4GS7B 4HIJA 4YDVB 4KNUA 4YHIA 1IEAA 3GMLB 2OAAA 3HVNA 4J2XA 2ZQKA 5JIKA 1L0QA 3IDNB 1NFAA 1ZY9A 1UM4L 2P5WD 4KAQH 1P84J 1OCCB 4KMTL 1JNNL 2Y22A 4L4VA 3L5HA 2GYSA 2DBJA 3VI4F 3I9GL 1QSED 3NJMA 4KVNL 5BZWB 4XAWL 3Q05A 3MCKB 3IPFA 4FQXC 4MLSA 1LK3H 4M00A 1FZJB 5TDNB 3TIDA 4JFSA 3LPWA 2B14A 2F7RA 4G72B 5D71H 1WG3A 1TCRB 1L3WA 1MHHA 2X28A 3IE9A 4EXPX 5EFIA 4LLWA 1IM9B 4LRIC 4IRZL 1OAQH 1ID2A 2ERJC 4L18A 1UD4A 5SX5K 5AB9A 2DF3A 5I1DB 4U1SB 3PDGA 2WQRA 5EF0A 1AE6H 5C0EB 1OGSA 5I5RA 1IVTA 1D5XA 1MI5D 1UD8A 1WT5A 2UVFA 4YHOH 2QT6A 3ZHNA 3GMOA 1YEEL 2HKHL 1LEKA 3SO5A 3L3GA 5BZDB 5KVFH 1J7VR 2CGRL 4KX7A 3MGOA 5KBMA 4PJ9C 2VR8A 3TVMA 2RFXB 2R69H 4QXVA 2ODIA 5TFSL 1SJHB 1GSKA 1LEGB 1THAA 1BXUA 2YR3A 4P46D 3CPLA 4S11A 4ZUTA 3WLBA 1UENA 4MB3A 1BOGB 3K6SA 2AQQA 5DA4A 4HK3J 4L37A 2DYPA 3B5TA 3QO0A 4P4KD 4R26H 1DFXA 3EBAA 3QDJB 3ISWA 3TXAA 4L48A 1XR8A 4J39A 1ZVSA 2DQGH 3CDZB 4FQCL 2VDKB 2X6CA 4XHQA 3QRGH 2QQKH 1FFNA 1KIQB 1JYNA 3EJTA 2VZSA 4DZ8A 4DUWA 4LL4A 4AYDC 1SBSH 3X13B 2YMXL 4PYHA 1QSEE 4LLUB 3D50A 2QADB 5F7NC 4AK2A 3C8KA 4KGJA 4OLWH 4PCYA 5GRVL 4P2CG 3V4UL 1F1AA 2A6JB 5LGYA 3SJVA 3TBTA 3EF4A 3R0NA 3MR9B 1CT8B 2ZYHA 4TSCH 4APQC 4F8NA 1Z32X 3MV01 5JOPD 3B3IB 5IWLC 2QTVA 3NA4A 4TXVB 2WNKA 4PQXA 1RPUA 1IIIA 1MKFA 5DD6A 1AKPA 1JWUA 4LO9A 3GXTA 4XXWA 2AANA 1QACA 3WKQA 3LIZH 3MRPA 4LQ1A 1KCKA 4BHUI 4WY7L 3L5JA 4PVMA 3N41F 4NZUH 1WCBA 4HSCX 3L4ZA 2GEEA 1WHOA 1Z9OA 3FF7A 2GK2A 1BF8A 3QR2A 2E7DA 4YEEA 5JUEL 3DMMA 5ALCL 2C1PA 5HHOE 3E8UL 4K5MA 5E9AA 3HMWH 1M6UA 4OCNC 4KKPA 4P2AA 1EO7A 4HLEA 2ENPA 5AKRA 3BCDA 4EN2A 1PAMA 3CN4A 3ILQD 1SLWA 4QYAA 5GGSA 3HUJE 5H4YA 4G70B 1HESA 3D0LB 3T2LA 4ANXA 4TNGA 5D72L 4F7CB 2C9UA 4YDNA 3RKDC 1FFTB 3P02A 2ICCA 4YE4H 1JZ6A 1NGQL 1KBWA 4N2FA 4FQQA 4HWBA 4YX2L 1E5YA 2H1PH 4FKKA 4OM1H 4ZAKC 4ONOA 2O6DA 2EXYC 4CSTA 3GT6A 1OP9A 2UUDK 1FVDA 1LMIA 1AGFB 1WLHA 3M8OH 3QUYC 4GUPA 4GXFA 5CF3A 1NSNH 4NAMA 3L16A 4ZW5A 1SBBA 3MUHL 1QVOB 5GRUL 3WENA 2PXYA 1VA9A 4QKTA 1XX9C 2GK0B 1RJZB 4LESA 2K7PA 3GPEA 1CDUA 1J5OH 2JV6A 4NO5B 3L3OC 2K0RA 4KKCC 1X7QB 1ZHBB 1Z5HA 2OTWB 3KPSE 1CLVA 4QOKA 5DTFA 3BSZA 1DJGA 2FX8L 3MI6A 5C7XL 1OAJA 2VO8A 3QI9D 2FJFB 3BP6B 2JKRM 2NUTA 2MKLC 4GKSB 3MBEB 2HJFA 4P4KB 3LSOA 3H9SA 5KYYB 4MAUL 5KBLA 4JRXA 1CFMA 3C5SB 1KB5A 5E8OB 3HC2A 5J13C 1YJDC 3STZA 4ZX4A 2XPGB 1JF6A 2ED6A 1ML0A 1RUPL 5MEOB 5ID0B 4RRPA 1EAPA 2VLRB 4E41B 3BD4A 2MTAA 3RY5A 1A9BB 4C57C 2ZCKL 3QUXC 5HHQA 1MWAB 2HG0A 3CN2A 5FA3A 4PAZA 3LD8B 3QZOA 2B0SH 4G9FE 1QI4A 2AABH 1JPSH 4IOFC 3BPOB 5AUMB 3ECWA 3QIBB 4ANVA 2HJFB 1ED3A 4MJ5B 1D7FA 2W60A 2Y1ZA 4NKMA 1YC7A 3TBYA 5CHNB 1C5CL 4NQXA 5HJ3A 5CEYA 5DJYB 5DEZA 1X5YA 3BEVA 4AVIA 1KCRH 1URLA 2XWJA 4Y5VA 1H0DA 3B9DA 3DGGA 3IKKA 4RIRA 4UQ9A 5AQ0A 4JL2A 1EJOH 1Z0MA 4XP6H 1KG0A 4EN3C 3GI9L 5C0RH 3CSYB 3ZE0E 1IC5L 4LU5H 2IH1B 2F54E 1LD9A 2AV7B 1FVDB 5CGTA 5I1AA 3UAJD 4L1LA 4FNRA 5CJ8A 3EADA 4OIIL 1C08A 1RULH 5D6DA 5GIRB 5FV1L 4LVOC 1CLZH 3BVTA 2R1WA 4KY1L 4LBEB 2ZX9A 4X99A 5I75B 1DLFL 1FDLH 5JHBA 2WO2B 3NFPA 5FM5M 2OMXA 1CG9B 1NQBA 3KJ6L 2QZ5A 1CVRA 1GY2A 3IETA 4M5YL 2J5WA 3RU8L 2BNUB 5E56A 3INUL 2O5XL 1TQUA 4PD4J 3L3KA 2BP8A 1RZ7L 3CFKB 5I17B 5DMJB 3FUDA 3MROA 3DO7B 4IRJD 4Z0BL 4OIBA 4M7JH 3LMJL 5HPMA 1NICA 2DM4A 5CU5A 5ID0A 3BVWA 1ZT1B 4XNMA 1CFSA 4BQBA 3Q2CA 4FFZL 2EEXA 4PJHF 2E56A 5LNGA 3U36B 2NY1D 2Z91A 1MXDA 4N6RB 4GNKB 3VI3F 4RETB 2H26B 2OI9C 4WTZA 2PCPB 3OKYA 1SFHA 2J2ZB 1B3IA 1VACB 1Z9MA 4JQVC 2E47A 4Y2DA 3V5HB 1UUNA 3M86A 4BK4A 1QSFA 1DBML 4DW2H 2QPFA 3QG6A 5B38B 2O26U 4LHJB 1S7WB 4AENB 5I1KL 2AMUA 3IU3B 1UACH 2WY3B 5B4MC 1YPZF 1AJ7L 1PY4A 2N0KA 3EYQD 2I07A 1I82A 4FQPA 1J9SA 1E27A 4OGQC 4F58L 2JTDA 3RWHA 4K8RH 5CZVH 4XHJC 3LDBB 2GPZA 3S5LB 2EE0A 1BVNT 2Y7LA 4M6OH 3UO8B 4Z7IA 5I76B 1MHCA 3MLTB 2FJUB 4HIXH 2FD6L 4HGWA 2GW5A 4ZODA 3UJJL 3Q8BA 4DZ8B 4NN7B 3FN9A 3TN0D 4BSWA 3QIBD 4RFOL 1YVLA 4GUPB 2VN7A 5CLYA 2X4SB 3WN5A 4X8JA 1OTTD 4TRPH 5EO1A 5JO5A 4IQHA 2H7WA 4TYUA 4FFYH 4FULA 3N85H 2R0WL 5ICZA 1DANT 2EQDA 4GOSA 4NCC2 3TO4D 4K9EH 4OZGF 5A2BA 1ZA6A 4UOJA 4K2UL 4ZUWA 3OPZL 1GZQB 4OUUB 5EIVA 1EFQA 1HH9B 2IDTA 3MFFB 1AI1L 2ZP8A 1E7VA 3W81A 5EEXA 3S9DB 1PKQE 1JUFB 4NQED 4JO3H 1N59B 2VR5A 2E7CA 4ODTL 1FGNL 2GITA 1W8NA 2V5SA 5BVJB 1Q1JH 1E90A 1QLFA 2JQMA 5DEFB 1QR1B 4AIXA 4KGLA 2XQBL 1HI6B 2AJSH 5GS1C 1JCKA 5DC4B 3ZTNH 1Q0YH 5F96L 4R7LA 4LNRB 4XRCA 3G6JE 4KXZH 3CFIC 1EBPA 3K2IA 3LS4H 2NYZA 4GMSH 4U1SA 3S3JA 2WAHA 4ABQA 4R2GB 4B95C 4N90E 2A73A 3AAZA 3IDYC 1AQHA 3S8FB 2F61A 4Z18A 3MOAH 1T22A 1DUZA 3HI6L 4V1DE 1F8TH 1JPEA 5F9WB 1RZGA 4FADA 1OW0C 2ADFH 3RIFK 4LEXH 2BSCA 4Q0XL 1M42A 3U0WH 4ENZA 1QABA 1I9RL 1QLEB 3D18A 4OU3A 3KLHC 4S1RL 1PYWA 3D85A 4XN5A 5GXBB 1KWKA 2IAMD 1PZDA 4ZI8A 2CAKA 1ITBB 4IU3B 4BDVA 3ECQA 5BVJA 2JB6B 4KRPB 1WTGT 2EUWA 5FW6A 2MKWA 5FV2A 4MJ6A 3OXSA 2XZQL 1PIFA 5HGAB 4NBYB 3FT2A 4BH7B 3SDAA 3RGVC 4P5KB 4M6ML 1JHKL 4OD3H 3ET9F 4Q89A 3FU7A 5I1GH 5L88H 1IFHL 5I24A 5A2IH 4JG5A 2NW2A 1CFTB 3HR5A 4IBZA 4DO4A 1WICA 5E2WL 3NCJH 1IQWH 5D5MF 2IANA 2G60H 2IBZY 2JKNA 5G4OA 2WJ7A 4LOEA 5EOCH 1JNLL 2DQDL 4OZHB 5LHDA 5TFSH 1DEEB 1JWSB 3OVUB 5DQJA 1S3KH 4PJDE 3BKCH 3GSXA 4P57A 4FQ2H 2ID5A 5AALA 3MRIB 4PJIA 3SDAD 2ZKMX 1KZYA 4JL1A 4AH2A 1A7OL 2WVVA 4L9LB 4P2QB 5L7XL 4JN1L 4ODHH 1Y0LB 3QR1A 2R2BB 1U8JA 3PP3H 3TN0B 5E94A 3FB8A 3KYKL 2WLNA 2W8CA 1OCZB 2YBRA 3D85D 1YEDB 3BUPA 2A2QT 1BEYL 2EYRB 3G5WA 4XMKL 5CCJA 2IFGA 2FATH 1PLCA 2PWDA 4U49A 1MH5A 1MRCL 3D12B 1I8IB 5I0VA 4ZBJA 5C6WH 1TVDA 2ZYIA 5AUMA 1TFHA 2B1HL 2WWMC 4UTAH 5KTEL 4TMPA 3T4AB 2EC9U 3L3IA 3HI1A 1KY6A 3UJIH 3BVDB 3DX1A 2NY4D 3ATEA 1AGBB 1O5PA 3SPHA 2VLMD 4BRVA 5DJ0B 3CCHA 4XO4A 3TCXA 4KDTA 2HG5A 2MCPH 3VXME 5EC1B 4F5CE 1EAPB 3ZE1F 2W59A 1MNUH 4YFLI 4JFZH 4AJVA 4PLKC 1NAKH 1W0WA 2AJXH 5IEHB 4ZZKA 1X9RA 2FECL 1XGPA 5IMKA 2J6EL 3HS8A 3G5XA 1XGZA 3BDYH 4NBXB 4TPRL 5GGSY 4RQQA 4L8BB 1BECA 3WFZA 2RCSL 3FQRB 4FG2A 3M6DA 3H6JA 3SO3C 5FO9B 3CH1B 3E6FB 3HN8A 2VDMB 3W0WE 5AG8A 4M7ZC 5M94B 3ARBC 4G6ML 5I1GL 5L88L 1UYWL 5DUPH 1F4YL 1X5LA 3OKDB 1GZPA 2MEJB 3LN4B 4OKVB 4WHCA 5DJDB 1UOVA 3WE6A 5CKAA 4MNQE 5DTFB 5K1JA 3QQ3A 4CRPA 1OP5H 2VN6A 5EOCL 4F8LA 1CPUA 4HKXB 2VMCA 3QIWD 4NNYA 1OAYL 3VXRE 4NQCD 4OGAD 2UXVA 5EBWB 5D7SH 1GA2A 3HIZA 2YMOA 3EYQC 3QNYA 1ACYL 4UNIA 2ZAHA 3NSJA 1OIOA 3ZT5A 1UFUA 3TPUA 4OZHA 1MRDH 1OB1A 3I6LD 4QXGL 1FFRA 4EZKA 5E51A 3LPOA 3T8XB 4N22A 4NFCA 4K3GA 4ELKB 5HY9B 4OCSL 5SWQB 3N06B 5F7HA 3F04A 1GZPB 3IEAA 1GOFA 4O00A 3TWYA 5KSAC 3SBWC 1BBJA 3DVGB 3LH2H 3QJSB 3QIBA 3VMNA 5D1QD 4AWJC 4G7VL 4PY8J 5F44A 3RY4A 1LE9B 2YSSB 4JE4B 4K8RC 2BSEA 4L3CB 2FNBA 2QSCL 2OMUB 4P49A 4PJDB 4XGZB 4N0YL 2AEPH 4JFYA 1TYEB 3EOTH 3ABLB 2Y0SA 3LY6A 4GBXD 1I8MB 1N4XH 4ONHA 4NBZB 4PW9A 4E5XG 3N3EA 1XZWA 4Y0GA 4B0MB 5FFGA 1LL1A 4BFGA 3EOBB 3KXFE 1CICD 3BC9A 1J05B 3FQXA 3JBG7 2Q7YA 3QSKB 5LAXB 5A6LA 5KYNA 5IJKA 2OYMA 5LUMA 5EEZA 4PGZA 4R2GC 2UWEB 1HL4A 3CFDB 2ZXQA 1FG9C 3D39E 4X4XB 1VLXA 2VL4A 3O6KH 3P4MA 5HYFA 2Z64C 5IOKA 3GXNA 4GKSA 1AD9A 5IGXH 3GBML 4UT6A 2ZWYA 3TO4C 3FFCA 3AU0A 2CRYA 3BAJA 2EAEA 4HJ1A 4GXVL 3EO1B 4MTMA 2NW3A 2O6CA 5I30H 4HLZG 1Z6JT 1NFIA 2YPKA 3ETBJ 1XSJA 3Q2WA 4KZCA 2OMBA 2OSXA 1M7UA 4JB9L 3I75A 3OBAA 1EJOL 2JE8A 4U3XA 1MG3C 3ARZA 1HEJC 1WZMA 1ZLDA 4U6VH 1G1OA 3WBDA 2V4LA 5A43C 4XMTA 1ZPLA 4Y5YA 4B27A 12E8L 1LO0H 5D6CB 5DURD 4HKZA 1JGLH 1M71A 2VSDA 2W91A 3D2UB 2IAAC 2V37A 4LP4A 1U3HD 4S2SB 3RWFB 2XV6B 4KKBC 2NXYB 1CFNB 3GSNA 3LEXA 3LS5L 5D5MA 2OL3A 5EUOB 4R96B 1JAEA 1YEJL 3C5JB 3ZVVA 3OAYH 5GJSH 2QKIB 4K71B 3TYGH 1GMIA 4MDIB 4FF9A 2ZXWB 5EG6C 4XO8A 1DP0A 1DQQA 3S37X 5DYOA 4TQPA 5F3BB 1X4XA 3ULVC 2R2EB 4M5YH 1NCCL 3ZDXE 3KXFD 3QJOA 5DZ9A 3LEVL 4IGBD 3BSHA 5DQDH 2JVUA 2D7PA 2L7UA 5C3TA 2BS71 1L9QA 2QKSA 2J12B 5CJQL 5C0ND 4BFKA 3FT0A 4PJGA 4PG9A 4PRBB 4YL9A 5I26A 3HRZA 3V5HA 2K9UA 4OLVL 2C9VA 1G9MC 5D1QB 3WJJC 1YQVL 1FG2A 1OLZA 1BPVA 5HYEA 4TNWK 4EPSA 4JRYA 3PWUA 3KE0A 4X5XB 3UTPE 4IDJL 4DF9A 2VLLB 4LDLB 2F5BL 4IKJA 3DVNB 1G0DA 3OAZH 1HEZB 1Z9LA 3Q43A 5DO2D 4JFOA 1R24A 4ZNEE 1BD2A 1NTDA 1PLAA 1IZKA 3N55A 1CK0L 5FYJU 3DHJA 4XPBH 4NRYB 5ECJE 3ZJAA 2F7PA 1MFNA 1MFVA 2R1XA 4KH9A 4R26L 2ICEA 5DFAA 3VX1A 3F84A 3OKNB 4WZ9A 1CDIA 4G43B 3DK0A 2JKSA 4KK6D 5GRYA 4I87A 3VRIA 1KEML 1DQKA 1C7TA 3DI2B 2DYPB 4QJ3B 3PWVA 4X99B 5D6DC 4HV8B 1QTSA 4JM4H 4A2HA 1I4FA 2OMZB 2Y1VA 3O45A 1UXMA 2BSTA 1DQJB 4S2SA 4OCWL 4QJ4B 2WK2A 3RGBA 3ASWA 4AEIL 2VDOB 5ADPH 2QDVA 3QPQD 4Z0BH 2FTAA 1HYSD 1U3YA 4R97B 1NWOA 1AH1A 2CUMA 4XN8A 4FYTA 4A55A 1XF3B 5CLWA 5I1LB 1MPAH 1HCFX 3IGFA 3DUUA 5I8KH 1BAFL 2HRHA 1AMYA 3AUVA 4PLKD 5J06A 4RZCB 2RHEA 2OZ4L 2WZ0A 2DQ6A 2DQEH 2CGRH 4UV4L 1KBPA 1EVTC 3BSGA 2HFEB 2FEEL 3CLEH 1QBMH 4G9FB 2VRKA 4WO4D 5EO0B 4NOBA 3CFNA 1MFBL 4I0PB 1NCOA 2HTLC 3MDJA 4L8BA 1P7QD 2J55A 1XH2A 2A1WL 2IG2H 4YR6A 3T0VA 43C9A 1DL7H 1YNKL 4XGZA 1HE7A 1MDTA 4M1GH 2Q8BL 3OZLA 4NI3A 3VD7A 1BPLB 3HHMA 3MX0B 4NZDA 4QRTB 5A2LH 3HS9A 4MQ7B 2CKNA 3E6HA 2P80D 5T1LB 1F18A 5CAYB 4GRWB 1DQIA 3MYJB 4Z77B 4K55A 1VGKB 4FZ8L 2BP8B 2YKLH 1NEUA 2E6PA 2PWHA 2YMXH 2IDCA 3B8YA 5E00A 1UVQB 5KN5B 4LSUH 4HKJA 3S3BB 2B4CC 4UM9B 4GSUA 1J1PL 3QG7L 5DMKB 4HWBH 3REWB 1I9IH 2CKBA 2HTLD 4PS8A 3P3SA 4C56E 1OB1B 2Z8RA 3VXSE 3MNVB 4WI9A 2FB4L 5BV7C 3ULVL 1CGUA 4LSDA 5FKPA 4MCNA 1MH5B 4CADB 3D39D 2AAVA 5J5EA 1WFJA 4FRWA 5J1AA 1CTNA 2VE6A 2OZ4A 2EYRA 1OAZH 3VD2A 4NNPL 2R7EB 4DEPB 3U9UA 4R7NA 4O9HL 3CHXA 5A7EA 2X4NB 3IFPB 4HCRA 4CU6A 4G7QB 1MCRA 4CN4A 2JCCA 4AX3A 2L8AA 3PRZA 2PR9A 4EF3A 2XX0A 4FJZA 1VGEH 3EGSA 3ZE2B 1Q0YL 2CO6A 3VFMA 4M1CC 4F7TB 1G7IB 1PFCA 3FU8A 3QE5A 2BSSA 3RG1C 3VNZA 3EXLA 2CO7A 1KEGH 2AKRA 4D8OA 2ADJA 1M2VA 1A6WH 1TZIB 3QQNA 5IB5B 4XNXH 1A8JH 1JP5A 1JZJA 3MNVA 3N40F 4HA1A 4EXKA 1O7VA 1ZVNA 2NNFA 5D93C 3QJUB 4LEEA 4DN3L 4C4UA 3VFGH 1EJFA 3AZUA 4ERSL 4NUPA 1A21A 1UB6A 5F7DA 4HBCL 3FOLB 3GZOA 1DQDL 2AHIA 4MCYA 4HUXB 4OT1L 3VWKC 5I1HH 3BKYL 4GSDH 5JLZA 1DQML 3L3DA 4K3JL 2X9XA 4NHUB 3HPJA 5HD8C 2VR4A 5B7MA 3SEPA 1QSEA 4J3OG 5I15H 5FOJA 1IEBA 3GIZH 1IVLA 4E0RB 5AOJA 1I7TB 2E8YA 3GIVA 2ZE0A 2D3NA 1J5DA 3S34L 5L9DL 2N7SA 4TS6A 4PH8A 2NMSA 3GKWL 3U9PL 3VCLB 3GSVA 3C8HA 4J6IA 4WEBL 2D03L 3P1VA 5LVEA 3ZKNC 3IE4A 4Y4FA 4DEPC 3T0EA 5E8DH 2PO6A 5ISZA 3OTTA 4FXGC 4MXWL 2PP8A 1IO4C 2HFGL 1UB6B 4G5ZH 4UQDA 5F7DB 3L1FA 5IQ9B 3QRLA 5DF0A 4YIQA 3VXMB 2YGNA 1RJYB 3WXVH 1OGAE 3NFSL 2IQ9L 4W4NA 4KRNA 3TIEB 2FVNA 3MRJA 4XRCB 4RNRB 5IVZA 1UYWH 1Y0LA 2LHAA 1ACXA 4JPSA 4OQTA 2NX5B 3KWTA 4QPEA 3ARFA 4OLYH 1YPZE 2UYLB 4ABUA 2VDNH 3BWAA 3IFOB 3PHSA 5CSBA 5E08L 3TEWA 1BVKA 2NDFA 3SBRA 3WAJA 3L5WB 5K9QI 4M6NL 1R9FA 4B9YA 3U9UB 1ADQL 1AIFB 5BCAA 1FYHB 3HG0A 4PCTA 4LKCB 1CLYH 2FH8A 2WTPA 3SYOA 2CXGA 2QTEA 1TTAA 4XPHH 3NN8B 1MELA 1OK8A 4NC1C 4TNVF 3IRZA 5DC2A 2J1XA 5TGBA 5FO9A 4CU8A 3AQDA 3MXVL 5EU5B 4JKNA 3WIIH 4RWYL 4N2CA 1S9XA 3F85A 2Y2YA 1Z3GH 3W0WD 1NUDA 4J3OC 5I74C 4MAYB 4B96A 5GZNA 2HLFC 2VN5A 4FYSA 1UWYA 2Q76B 3KM1A 1S78D 1H3WM 1YAZA 2ERJB 2P5EB 3SDDD 2AQ3A 2W95A 1KB5H 1N64H 4LEBA 4P9HL 1AP2B 4U7KA 1U58A 3LNFA 3BGMB 2XG5B 5T3ZL 3OGCA 3FU5A 2BRRL 2JB5H 4FQJH 3W39B 3PAYA 4X5WB 3T09A 4LCYA 2VRAA 4GO9A 4AKPA 4CDGC 1N4XL 1F4YH 4FEMA 1W0VA 2YA2A 1AKJA 4HS3B 1KJMA 1FNEB 4NT6B 2C1OB 5F7YC 3QDGA 4WW1B 4O5LH 2GJ6D 1HK6A 3TV8A 1ZCRA 3BEWA 2V33A 3QFJB 2BY0A 1KPVA 2GJPA 1R5VA 3ZX1A 2VDRH 4Z7UB 4Z7VE 4F9PC 1B4RA 4BEIA 1R3IH 1HKLH 1WF5A 1QD0A 2ZKHH 4P23C 1E9OB 4JJ5B 4G8FA 1D6EB 5LGJB 1LDSA 2BPBA 1PCXA 3KPRB 4H26A 4KUCF 4ZUUA 4GEIA 3BQVA 2X2HA 3N43B 4IBUA 4OUUA 4N6QA 2HTKC 1MRDL 4XBEL 5J4MA 4HU2A 4P07A 3W2DL 1VF5C 1OARH 1JUFA 4U3HA 2UZXB 4XX5A 3TH2T 4QTHA 4NC0B 3HNTH 3F2LA 1C5BL 2ZXAA 3FTGB 2DI7A 3AS0A 1IGYB 4NAJA 4AGMA 5EOQL 1OGTA 3SQRA 4JO3L 3VXSA 1N0LB 4IIQC 1KJVB 3V52L 1PX3A 2O5ZL 4ZMXA 3V7AE 1S9WB 5TE4L 5C0AA 4ECNA 4XMXA 2LTQB 1U8OA 3JTSB 3BQUD 4PI2A 3CHRA 2EKSA 2NX5D 2EXWD 4PCSA 3L5WA 4F9LA 3ZKMD 5LLIC 1A6TA 2G3ZA 5L2KD 3NZHL 2F58L 2JKLA 5FFOA 1UG9A 3CQFA 3U30B 2X38A 1OOWA 4G83A 4JZJC 3ECBB 2FH6A 3KPRA 4H26B 1SJEB 2ITCB 1XL4A 3IU3A 5HYQB 1EDYA 1WJ3A 4UQIM 4EO5A 1YC8A 3STBA 1MJJA 1D5XB 5E2UL 1OHQA 4Y5VB 2Y9RT 4P59L 2JELL 4S1DD 5JR1H 2FSDA 3FC8A 4ZG1A 5CHNA 4DJMA 4Y88A 1WK0A 1HXMB 2BSED 2H26A 4RGOH 3FHAA 3IJSB 4XPTL 4EN3D 2Y3AA 2UWEA 3EFFB 4GRMB 3RY6A 4S1RH 3BJ91 3U36A 4BKTC 1DFBH 1UA6L 3SDXE 3FQNA 3QG6B 1W91A 4B0MM 2C9SA 4HXBL 5LXGH 3D52A 2UZYA 4I1RA 4Q6IC 4A38A 4QR7A 3L3HA 4Y2DB 3CHSA 5SX5H 3FU6A 3KZ8A 4U4BA 3DV6B 3H4HA 5GGVL 4K5OA 3CK0L 2XG5A 4W93A 4HSQA 4MJIB 5FO8B 1J11A 2P5WB 3FL7A 5D1XE 1KCUH 1GZHC 3QUZB 2MIZA 3D9AL 2H2PC 2BS8A 1S7SA 2CLRA 1JVKA 3HI5L 1CR9H 1L0YA 1DQQB 3BT0A 1NGXA 3O3UN 5DVKA 3MODH 5LJYH 1OEZW 2C8NA 2ZOWA 4NXSA 4TF4A 4KX9A 5HYSA 2AJYH 4MMYB 2EDJA 1JRHL 5E8OA 1F1DA 1XCTB 1MCCA 3NIDF 2Y07L 5J3HD 25C8H 3G6JA 1FH2A 1JNHB 2AP2A 3GRWH 3M46A 1A7OH 3KYOA 1MIML 1E8ZA 1QHPA 2CLZA 5DVMA 2FJFA 2NUTB 1FVCA 3NEOA 3T1FA 3SYQA 4ZAKD 3V6OA 1NDMA 5I8EB 1FNLA 2YOAA 3ARGA 2AV1A 1KEMH 3L1OL 1JI2A 4U1HA 2YPLE 4ZX3A 1QZ1A 3EJJX 3BYYA 1CD0A 4AITA 2DI8A 5F7WC 3W9EA 4AYID 3V0JA 1RJLA 2FEEI 1I9RH 4KJWD 5KYWA 1Q4NX 1T80A 3IFOA 4HJGA 5DQDL 3FTXA 4RMWA 3WEBA 3CFMA 4NKDA 3PQYD 3K0WA 4UM8B 4IKLA 1N70A 3II3A 1BX2B 4QRRB 5F1IB 3S36X 3RWIB 4HK0A 2W60B 1DHKA 3LRHA 2XZQH 4ZPTA 4QMEA 5I1CH 5AB2A 4E5XB 1MOEA 3TEZA 4PJEE 1FVCB 2FJHB 4WGVB 3LKPA 5GGUB 5IW1B 5I8OL 3RWJA 5L6YH 3QDJD 1TQWA 1PNCA 2ZP0T 1QSVA 4FI6A 4ZW6A 2H9GA 3RGVA 3U0PB 3Q06A 2FIKB 2V3FA 4YH6A 1RZKL 3LEYL 2EXYD 4B9IA 4PREA 3H2WA 1SMOA 4NKIH 4PB0H 1AR1B 3NTCL 4PG2C 1JZDC 1BZ9B 4NQDE 2QADD 2IPTH 2X3BA 4L8CB 2WKOF 3ZIYA 4O2EA 4DQOL 2RH0A 4MYPA 3CXHJ 1PZCA 4A6YL 3F7VA 1VADB 3O0LA 5SWSE 3KH4A 2R56H 4TSAH 1KENL 2WBJD 1RPQA 5DGQA 3QZMA 4Y5XA 2V2TB 3LKPB 3QCVL 5IW1A 3CIAA 5K1VA 3SDAC 2ZOKB 1Q72H 3GKZA 3UYRH 4S1SH 1PQZA 2XQYK 1AZNA 5JYLA 1N8OE 5F88B 5BRZE 2JKTM 1PAZA 4KRLB 4KKLC 4TVSa 3HRPA 2OJ1A 1MCJA 1UD5A 3MBEA 2LFEA 3SO3B 4MJID 3UC0L 4GW1B 5GJTL 4R90H 2ZD0A 3D87B 2EILB 4UOW1 5HD8D 2CO7B 5JW3L 1E8WA 4OJFL 2VJXA 1EAJA 3PWJB 1A7RH 3A67L 3QXUA 2VQ1A 5CKGA 3CHPA 3WNMA 2DLFH 1MCBA 4ES8A 2WYIA 4MQXC 1M56B 2R29A 4LVHC 2I9TB 2J1KA 4ZD3L 3QRBA 1TJXA 2DL2A 2HX7A 2NDGA 5ESQB 3SPIA 3OKEB 3V0EA 1H0DB 3WO4B 4R7DA 1U8OB 2VW7A 3SGJC 2B1AH 1IE5A 1TJHH 1RY7B 5DMGD 5KBDA 1O7SA 4NQXB 5HJ3B 2FRGP 3EDFA 3IS1X 1EXHA 3QCTL 1XF5A 3C5ZC 1L7IL 2VZOA 2MPVA 3V0WL 5ICYB 1H19A 4BRJA 3OV6A 1YY8A 3D0LA 3O2WH 2QL1A 4FHBD 1LE5A 1UWXH 4ZS7H 3T0EC 3AQYA 3DJSA 4G42B 4FQ2L 1EFXA 3VE0A 1FSKC 1UZGA 5CZRA 4GMTL 2P46B 2BC4B 2GFBB 4MJ6B 5I9QC 3ZTDC 3QUMH 3VWJC 5LDSA 2HKHH 5KVFL 4FNSA 2IH3A 2YZ8A 2L4OA 1E0OB 4ZO6A 3BZFB 4H0GA 1PEZA 3TJPA 2ZOLA 4DEUA 3OD3A 3T4YA 2UUDH 3X14A 3V4LA 5EC1A 4I85A 5AOMA 4ZO8A 1KB9J 1UWEL 4DQOH 1OAYH 3HUJB 3QI9B 5B1KA 1PL3A 2BZDA 2OL3L 4PRIE 4A37A 1NCTA 1ROCA 3H7BA 1A22B 3GKWH 2BY3A 4Y9FA 3S34H 1GPOL 1X3DA 4G82A 4WU7A 2NZ1A 4N8UA 3JQOB 3NP4A 4UINL 3MXWL 4NO3B 1DN0A 1EERB 4U1IB 2ESVE 2O6EA 3BP6A 3U2IA 3X1NA 4AJWA 1BG9A 4DUVA 2BNQB 3P3RA 1FPTH 4M3KB 4NQVB 1JN6B 3H3BC 3F62A 4HGKC 4G5ZL 1TDQA 4QRPD 3FTVA 2MFNA 1S9VB 1E40A 1YG9A 2J4WH 5B3NA 1UUSA 3KR3L 3B9VA 3TN0A 4WI0A 4C56D 2DQHH 4MZRA 4G8GE 4WTXA 1MW0A 2GBVA 5CILL 1C7SA 2XFXA 4UBDC 1QATA 5T1KB 5C2BL 1XVSA 1FFOB 3NCYP 1ZXKA 2XU9A 4U6YB 5I16B 1Q1PA 2Q10A 4ZD3H 2CMRL 3GSNB 3LEXB 4UF7C 1MQ8A 5EOCJ 3GSOA 2MHAA 2BHFA 1KTBA 1GKOA 1JNHA 5IW3A 3EJZC 5IIEA 1NPUA 3VXSB 3RB5A 1CMOA 1N5AB 3KLSA 1MLBB 4UV7H 4PUBH 1S7VA 3ZK0A 1NCAH 2CKBH 4NM8L 5IK3B 1JDDA 3BRDA 3PGFH 2XPZA 4LARL 2CM5A 5C0CE 1MEXL 2AQ1A 4NKQB 4PJ8B 5GISL 4AZUA 2HVJA 1JXJA 1A4CA 1XSKA 1XBRA 2V5TA 3CQQA 2PR4L 2DKUA 1QNZH 2D2CC 2H6UA 2NX5A 5JDSA 1TPXC 4HCIA 3TNMA 2NW3B 4YNYB 3RA7H 1KJMB 4CDHA 4PJ9D 3UTTE 4K94C 5DZPA 4B9ZA 1YEIH 5LQBL 3QFJE 3DOIA 2JI2A 3K2MC 1BBDH 3QAZC 3LRGA 3EFFA 3UTOA 4ODXB 1WQVT 4MASA 5H4ZA 1HEHC 3IFLH 2BRRH 2IQ9H 1KLUB 2ZONA 4MNGB 5IG7B 3NJIA 3WTVA 3GXIA 2JCCF 3HC4H 4LLVB 4ZMPA 1JTOA 1J5OL 3IDNA 2HUHA 1K3ZA 3L6FB 5E6UB 2YQ2A 5DHVA 2CO3A 4DESA 1NAMA 4KTEL 2GBUA 4HPOH 1L9NA 5E2JA 1OSPL 2XBDA 3NQKA 4QKXB 5FX3A 3L7EB 4HH9B 4OV5B 4NHCH 3QIWB 1IC4H 5ERWA 1G84A 1TJMA 4NUGL 2OX5B 3RFZB 1W9XA 4J12A 4RMSA 3RX9A 1NCCH 2YD0A 5BJTA 1VFMA 3WDIA 5E1GA 4NJAL 3TV3H 2FQDA 2FT7A 2MJWA 2I7SA 4UT7L 5AOKA 3WLWD 4AT6B 4P2RD 1OGTB 5KSBF 3PXJA 4GFXA 2F74B 3FUFA 5AOIA 3AM8C 4F27A 1DLHA 2HT3D 2IANE 2ZPKH 3TVMC 1PPIA 3ZE1B 3QEHA 3ULVD 2RA1A 2KMWA 4YUEL 1RI8A 4R5TA 4YBQC 2ROYA 2DQFB 1I7ZA 3HS0B 2B5IB 3PREA 4DFHA 1ZRUA 2ZAIA 4JGNA 1I75A 4X6BB 2N7BA 2R4SL 4AKOA 1QFOA 4XH2B 1RK0B 4L1BA 3W0WA 4L8SA 5FK9A 1YECL 1WBXA 2H32H 1ASOA 2EDRA 5T1KD 2VKXA 3QUXD 3PJNA 1TNMA 1RJYA 3GJEA 3N40P 5T5NG 4E9YA 2APVA 3CMOL 2AERT 2I9LA 2VR9A 3GBNL 4UILL 1FORL 3Q01A 2ATPB 2BFVH 3PAUA 4GI6A 1R0AL 2NSQA 2P9RA 3MYZA 3K6DA 1TETL 5AWNH 1AKJB 5IJCC 5JR1L 3PWLA 3E1ZA 3FF8A 4TKWA 3ARQA 4CC1A 3FQRA 4P59H 4GLRI 1OHZA 3LPFA 2NSMA 5E6ZA 3ZU8A 4EIZC 4BE6A 4PJHE 5E00B 4D9LL 4MX7A 3HUJA 3QI9A 1GYVA 1P6WA 2HTKD 3D0VB 3MRLB 5LXGL 1V3MA 1NM9A 2QVIA 3RL1A 3DIDA 2PCFA 3QQ4B 4AQAB 2R27A 2UXTA 4MJHA 2GIMA 5F70A 5MEND 4HX1A 4X4MA 1UZ6F 1OAKH 4GLRH 3ZDXB 1MLCB 3HUJF 5KSAA 3DYMA 4LHUA 4XX1G 2PXYD 3D9AH 4YBHA 1LO2L 3QA3A 2FZ3B 4ZFOA 2LGNA 1A3LH 2VXVH 3BQUC 4XO5A 3EFOB 3LZNA 1CF1A 3GQFA 4WVRA 5DHVH 4EBQH 3ROLA 3QJHA 2D4FA 2OMXB 3BH9A 3EIFA 3UBXI 3MREA 5E5MB 1RP9A 5ADOH 3RWIA 1U3HB 3F8UB 2Y2WA 1INDH 2V7HA 7PCYA 3V9FA 3KPMA 4KROD 2YXMA 5I0XA 5HP5A 4H8HA 1XMEB 5KBPA 3VB8A 1JNNH 5LBSH 2MQ3A 2A9DA 3ZL4H 1FAIH 1T66D 4MBOA 3BZDA 2CPUA 2WXHA 5K9JL 1OOAA 3IU4L 2ZKYA 3HFFA 3PWJA 1A4BA 4OI7A 4HT1H 3U25A 2V7NA 4R8WH 1BREA 2YWZA 5C0JB 4GKZB 1TSRA 3GDCA 5E1HB 2Z34A 4LQFH 3DMMD 4I89A 3QEHB 4KWUA 4PIBA 4PJGF 2EXTA 3A47A 4P2RB 3MV8E 3A6CL 3QC5X 1P4IH 1E4KC 2BFVL 1CFTA 3HR5B 4WFEE 1MREH 1SEQH 5LO7A 3GSRA 2DI9A 4LSRH 1JZEA 4Q56A 2VZUA 2HWZL 1HC1A 1RVFL 4HMEA 3U6XS 3WU1A 1S4IA 3Q9QA 1JPGB 4GW5B 3DSNA 3NJLA 1F4WL 1FCCA 2PF6A 3NJVA 5C86A 3LNEA 5GS1A 3SJVD 2DWDA 2MNUA 3ILEA 4N4YB 4Z7VB 2B4CL 4P9MH 4O9HH 1FCGA 3PE9A 1G94A 1G7HA 2WLLB 3MGAA 1OAZL 3NPSB 1IQDB 3NFNA 5CGYD 2KI6A 2ZCZA 1QZNA 3GXPA 2PCFB 1LNUB 3QQ4A 1B0WA 1YN7A 2Z31A 4LLVA 3KPNB 2PN5A 5B7FA 4AI7A 2NY2B 4MA7L 5J6SA 5E1QA 3HE6D 3L9BA 3GTTA 1AZZC 1MCEA 5DMYA 1KEGL 2ZG1A 5AB0A 1XB3A 2XN1A 5DEGB 2DYPD 4P4KA 3RUGE 2FJHA 2NY4B 2XVGA 4E9LA 1MJJB 1UQSA 4XVUC 3DX8B 2WMPA 3UCQA 2P28B 2VUYA 4L5FH 4P46A 4MA3A 4MQXD 3SQBB 1SOKA 3ULVF 2GQHA 5FEBA 4BXVA 3L1EA 5C0BA 3RWEB 3SDYH 1D5BA 3IK2A 5KYWB 1O5DT 4I5BA 1CE6A 3IDMA 4PJXA 2NY5L 1A2YB 2NZIA 3V95A 2CDFB 2X42A 4FQHB 2I60H 4P5TC 5FOBA 2VJ8A 5HHXL 1S7RA 3B9AA 3MRIA 4PJIB 4WO4A 3VFVB 5KYXB 4TTDC 1ZLWK 3TURA 5AZUA 4WCYL 1F3DH 1HZLA 1A7QH 2X1PA 4F9LC 1WFTA 3Q8EA 4L29B 1BJ1J 1FO0H 4ZMVA 3M17A 3QRGL 4JANB 2ORBL 2O4EA 1CGSL 1PD1A 4N87A 1AOHA 1OD9A 3D05A 3I6SA 3V0VB 2A9AA 4U1NA 3HCVA 4IS6A 3WS6C 4OLZL 1UVQA 2NUPA 3FTSA 4HGWB 3HBQA 1NGPL 3MYJA 4Z77A 1COBA 1VFBA 1M7IB 1MHCB 1W16A 1R24B 1YMMD 5AVXB 1VGEL 2MTPA 4RISH 4TTGA 2XWZA 5E5LA 5E4EC 5CBAB 4J28A 3QHZH 5DJZA 4F7MA 4FZEL 5MENA 3CVHA 4LLMA 5D70H 3CLWA 3RVUD 3A5VA 3EHBD 2DQGL 3QXAB 1XF1A 3OB8A 4FQCH 1XQ4A 1XIWC 2K8QA 1SQ2N 1F3JA 2B16A 4HXAL 1T0NA 1S3KL 2YUVA 2E9WA 4D0CB 5FYJE 3M8OL 5MEPB 2H0PA 3EYFB 3FCGA 1AD0B 2DDQL 3DX0A 2YA1A 5F9OL 2YRPA 1UH3A 1OZUA 1EHAA 1RJCA 5CIPA 4Q97A 2OQJB 4KO7A 5GRUH 4XNYL 4GEJA 2UV3A 4YQXL 2HJLA 5CBAA 1PZ3A 1LNUA 5EZOH 3AT0A 3ULUH 4J4PD 3INOA 2FHCA 3ABZA 4ONHB 4ZX6A 3QJFB 2ESVA 5D4IA 3BKMH 3KPOA 4YE0A 3FH5A 3WJLC 5IM7A 1HI6A 3KVQA 3ZE2E 2XHNA 2DWEA 3HNTL 3MRNB 5HGHA 3RVXC 1EAQA 1IC7L 2ADIB 3B2UD 2J6EA 2QKIA 5DJZB 5MHSD 3ARED 1K5WA 4YE4L 3VGAB 3GXUB 3K4ZA 2K4WA 2OMTB 2VYRE 4P2QE 1G1CA 2EDQA 3DRTB 5LWYH 4XXDA 2EIJB 3TBCA 3IXTA 2NXYC 5JUEH 4M1DH 3K71A 2B2XL 2EIBA 2VISA 1AGEA 2V5RA 3NN8A 2WVUA 1OALA 4JFFE 1F3DJ 1FFQA 4PJHB 4CSZA 4WWOA 1TVBB 4NM4L 1PF3A 3SKOB 4Z6AT 2P8PA 3DBXA 4M4RB 5DQ9A 1QWNA 2FGWH 5D7IA 3ZGIA 4ZFZA 4CW1A 5FOBB 4XBMA 4OCYL 4I9WE 2FSEA 4D3CL 2ED9A 4LSTH 1F6LL 3D0AA 2WLHA 5I1AB 1W6WA 2BIPA 3WY1A 5EF3A 4UUJB 2DYSB 3QUXA 1TEFA 1YEHL 1R3JB 4QHKI 3QQDA 2DWEB 3MRNA 1NGPH 1Y7VA 2K78A 3E7JA 3MLTA 3TA3A 3K72B 4MA1C 1ODAA 3HC3H 1HEZA 4DGVH 3RZCC 1ZVYA 1T2QH 5DURB 2OL3H 3RUGA 1TMCB 2GAZA 2OMWA 1QFHA 2WTOA 3FDWA 2ISDA 3OR6A 3IJ9A 2WXIA 3LQZA 4N2OA 5AW8B 1H5BB 3GMQB 1EVUA 4IBLT 4WI4A 2BNQA 4PB9L 4I77L 4N8VG 4RESB 3RA7L 1XWVA 1VEPA 4E42A 2W94A 3CH1A 3E6FA 3AREA 3N1FC 4JKKA 3SD5A 2DLGA 1QBAA 1LJMA 5F9OH 3HS0C 2OA9A 4M8RA 1FUNA 2ALAA 2VLME 2CO4A 1F0LA 4AKQA 4WU5B 3L3OA 5L0QB 4EMZA 2B0SL 1HQ4A 3V52H 2JF1A 3WMQA 1H3UA 1G9NH 5KVEL 4XNUL 4Q6IB 1AC0A 4WHDA 3UZEA 4PP1D 1TZHA 3CVIH 1D6VL 2RQEA 3SKJL 1FV1A 5FUZL 3TFKD 2DMGA 3F7PC 3HG1D 3GLAA 3QPXL 4JQVA 1PZ5A 3FOLA 3NIDB 3ESNA 4OSUH 5TF0A 4D9QD 1E4WL 3VE0B 2Q7NA 5F9AC 2Y7QB 4HAFA 4XP9H 1B2WH 4ODVL 1U8PA 3INUH 3JUZA 3QDMB 4PRPE 4J3WA 3P9LA 4QUOA 5J7CC 1ZWIB 1IBGH 3GHBH 2J8HA 3QH3B 4RA3A 5GGQH 4H88H 5HY9A 4NP4H 3U30C 4ELKA 4LARH 2VDRL 4PBWD 2EEDA 4QYOB 1YMMA 1D9KB 2EE6A 3FQUB 1E9QB 1UA6H 4PJXB 4X2UA 1RHHA 1BP3B 1Q9KA 2VIRB 5F3HA 2QSQA 1T4KA 3MV9E 1AO7A 3U1PA 3FULA 1QRNB 4V1DD 3TFKC 5IW6B 4MMXA 3D25A 3ZKSD 5FYLD 1G7PA 1Z0NA 4MAYD 3MA7A 4JFEE 4N2BA 3SOBH 2BVPB 3C6EA 3EDJA 2Q8AL 4D9RE 1EX0A 1DQLH 5EF2A 2D7TL 3NIGE 1KN4H 1GGIL 3VXMA 2E8ZA 2R2HA 4PRHE 5A16A 4V11A 4AMKL 1TQSA 2Y06H 4X4XA 1CDJA 5I30L 3K2KA 4N1EA 2QVMA 4NO0B 3QA3B 4XXCA 4XPAL 2HZHA 1N6QH 4P46C 1DBJL 1KY7A 5LG1A 4RDQF 4RFNC 25C8L 3CDCA 3FU7B 3LMJH 3KPNA 3Q6GH 4XCEA 3VFPA 3MLWL 3OGOE 4ZO9A 4JG1H 3V5DB 2GJ6B 4AV4A 5ENWB 4Z95L 4C83A 2WWNA 1YMHB 1R19A 43CAA 1VADA 1A6ZB 1NBQA 3OKOB 3QFJD 4LHUB 4LIQE 4EI5B 4W4OC 3NDZE 5EULV 1TO4A 3TEUA 1HZKA 4Z7VA 2PO6C 4N9GA 1P1ZA 5FW8A 4EI6B 3BAEL 4GW4B 2F8XC 2VLRA 1WD9A 3C6LC 3T4AC 1M57B 2FEDC 4W9HC 2EADA 3F12A 2AEPL 2WINB 3KCWA 1L9RA 3D09A 3DURB 4RFEB 5EDXA 5GZOA 1GR7A 2UWEF 1AJ7H 1IV8A 3ILPA 3I02B 3M45A 3RL2B 3UBHA 2YRBA 5D7EA 1LEIB 1OGAA 1XCQA 1QR4A 1O75A 3OKMB 4R4BA 4U1JA 1MCQA 1XCXA 3X1FA 2P3YA 4PGCA 4E5XA 2VW4A 3K6NA 4K23H 3MLZH 2CGYA 1FBIL 3QJXA 1WBXB 3MJ7B 4GQZA 5D2NE 3BQUB 5KSUA 5IB2B 3BN3B 4X8CA 4QOKB 1YDPA 4P2OD 5IY5B 3OX8A 1ND0A 4MCZA 4JM0A 4NFBA 1Q9LB 1NGYA 2JJSA 4FEIA 4HJSA 1DBBL 1S3RA 3FO9A 1Q9KB 4PJBB 1TQVA 1DZ0A 1QI3A 2VQTA 1KGUA 1NAMH 3MJ6A 4IRZA 4JRWA 2OW7A 2HN7B 3DBXB 3KGRA 2XDHA 3M7FB 2H2SD 2UY7B 4JFHE 4WJ5A 5K9JH 4YGVA 3GSXB 5FKPB 1KB9K 2YK1L 3OJ2C 4PBXA 3WEXA 4LEXL 2R56L 3WFDL 3NA9H 4F2FA 3KLKA 3CFJB 4JMXA 4I48A 1OWRM 5IMMA 4X5PA 2DMCA 6PAZA 1GH7A 1NBZB 3SPGA 4A1RA 3QHTC 1Q0XH 2IMNA 3MNMA 3CDFA 3HJ0A 1YLBB 3FCUB 1KB3A 4W6XB 4UIMB 4XN4A 3RJOA 4Q7DA 1WCQA 1S8DB 1EEYB 1E9OA 2X4QB 4PCKA 4WW2F 2HWZH 3ML8A 4ETQB 5AAPA 1S7QB 4N2MA 2HFFB 1DDTA 1XGTA 1QKZH 4YN3A 4HEMA 3HPLA 4NSKA 5CGMA 4KFMA 3EGXA 5BPPA 1XEDA 3BMVA 3HLKA 2X41A 4YVUA 1T22B 3RLSA 1UH2A 5DFWH 3K4AA 4M4PA 1QWUA 2HP4A 2V3EA 4HBQA 2G5UA 2Y7SA 3N9GH 4YZWA 1RZ8A 1SXBA 1T1ZB 2EDOA 2VW6A 4IBVA 5KSAD 3IGAB 1KTCA 2OP4H 2W0LA 1A64A 3BT2H 3QNZA 4PVBA 2X05A 4AYSA 3NTCH 3OGCB 4FXGA 3T6QC 2BX5A 3G6AA 2SEBB 3FU9A 1B3JA 1FAIL 4OBRA 1X5JA 2UX7A 2C7FA 2ZXCA 4JJHA 3C9NB 3S2AA 4CVXA 1KXVA 1IFHH 3WUWA 3SGEI 2BRQA 1SJEA 2Z0BA 4HIEB 4HUKB 4LLQB 5DDHB 3S4SB 3V4PL 3QYCA 3QZWB 1MFCH 1QTYT 4NZTL 5HVFB 1HU8A 2R0ZH 2J72A 5EN2A 3RNKB 4OZ4B 3TN0C 3HFML 1FYTA 1Q94A 5ESVA 5IIEB 3O4LA 3MLRL 5IJBC 1Q9OB 5KANI 4LVOB 1ADQA 2NY3C 2CKBL 4NM8H 4KQ4L 3BZEA 5ICZB 4D7PA 4ZAKA 3MRMA 4JY4B 4MD5A 5I0DA 5EO9A 4Y16C 1NBCA 4DVRH 4HIPA 4BSWB 4MYWB 3U83A 3APFA 4XVSH 3U0TB 2N1TE 5JW3H 5DD0H 1L9PA 1Z3RA 4LXFA 4Q14A 1AR1C 4HCRL 5F2FA 1R3KA 3FT3A 1FPTL 4HYTB 4NPYA 3UZEC 4DERA 5AW2B 4P9ML 5I66B 1UKSA 4QRRE 1KACB 1ZJBA 4BFRA 4HJUA 3HE7D 5L2JA 2YPKB 3JT2A 2VLRD 5F0JB 3VH8G 4HFUL 1I1FB 1NUGA 1RIUH 1Y18A 2WO3B 3B7UX 5IROA 4ORZC 3VXNA 3CFBB 1T2XA 1IBFA 4JM2D 3FSOA 1JGDA 4MKMA 2B1HH 1L7IH 1A9EB 3VD5A 1GHFL 2BY2A 4ZOEA 2APTA 4KDVA 2DTSA 5IG7A 5EZJB 2OI9B 1CXEA 5E2TL 4CILA 3MRQA 4JRXE 4XN7A 3HMWL 1DEDA 2FBJH 1N5YL 2CMRH 5DVNA 2WB1A 1DN0B 3MNZA 1HNYA 4OKDA 1TCRA 2HRPL 4MD0A 1U9KA 2NNCA 3V7AG 3X17A 3VJ6A 3MUJA 2F54D 3QUML 4BZ1A 5BZXA 5C1MB 1YYMH 3RYMA 1K9TA 3PUCA 4JO1L 4QHMB 5TTRA 1OAUL 4E9QA 1MVYA 1HTYA 5ESAB 1MXGA 2FWOB 3CXDH 4KJWC 4LIQL 4PUBL 3IGLA 1NGWB 1MW1A 3GSQB 3JYCA 4O58H 4XMZA 1BZ7A 5FR3A 5KVGL 3ARYA 2RMNA 1F41A 1SMAA 1GJUA 3G08A 3EYOA 5E4EB 2D7OA 4AJYV 1JBJA 2F15A 4X7TB 4FLQA 1LE5B 3BISA 5CP7B 4L3EA 4KH2A 3PV6B 4BE5A 3FQTB 3JSSA 1SNRA 4YSRA 3GGWB 4F8PA 1RURL 2IWFA 1YUHA 4M1DL 4FERA 4M7LT 3HJEA 2VXSH 2IWKA 3LZOA 2YXWA 5F0MB 2NZ9C 1GKEA 1Z5LB 3BPCB 4KPHL 1M1XA 5C08A 2DJ4A 1T89A 1MZYA 3P4OA 5AB1A 1A7NL 1LK2B 1HS6A 5CMAA 2BNRD 4IRJA 3O41B 2OZNA 1A5FL 2IXQA 3EYSH 3KPRD 1WBZB 4G1EA 4UILH 3SGJA 5D96B 1BZ8A 3WTWA 1AO7B 1HXKA 2QSTA 5DD1L 3KJ4C 3C5ZA 1J9QA 1CLZL 5F1SA 3MKKA 4MXWH 1MY5A 3F7KA 2XVLA 5HI4C 1F90L 2BVEA 3H8NA 1XEUA 1H3GA 3O6KL 4Y4HC 3RWGA 4NUGH 3IJ8A 1RUAL 3RNQB 4GQRA 1Q9WB 1RUQL 2LU7A 2X4UB 4FTVA 4K9JA 4Y8AA 3MCG1 3QIBC 3SPCA 5EC2A 2G5BB 2O5XH 4M5TA 4HUUB 5I5IA 2GB2A 3RU8H 4M8QA 1F97A 3HG4A 4J7RA 4NUQA 4XNXL 1I9JH 2ZOKA 1GS7A 2E4TA 1BXXA 1PD0A 2BNQD 4N2KA 4PJ5A 1R46A 4AK1A 3BKML 3QDAA 3CDGA 5G4NA 3QDGE 2AITA 3SGEH 4PV1C 3UBXG 5J1SC 3HR6A 2X6AA 4HIIA 5C0CB 4Q6IA 5FIEA 4ZX5A 3S3CB 3OZ9L 5MEOA 4FFZH 2OBGA 1L3NA 4YUEH 1KCRL 2VDKH 4G7VH 4Z9KB 4OLUL 1IGCL 5D2NA 3ETTA 1YYLL 3WFHA 3O9WA 2IJ0C 3U0PA 5KVEH 1P5UA 3HMXL 1II4E 3NABH 5JXEA 1KUMA 4Z5RB 1KYAA 1KCBA 3AG4B 5FGBA 4XI5C 3HC4L 1BVOA 1CDYA 3UZQB 4F9PA 2EICA 3QPXH 4FXTA 1KTDA 1A4KB 1OO2A 1XB6A 1VFOA 2AMGA 4N1CA 1ACZA 5GGUA 3MV11 3LRKA 5E6RB 1TTUA 2Q1EA 1XSIA 4NAQA 3WG7B 4EUPG