1KMGA

The solution structure of monomeric copper-free superoxide dismutase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEQSTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide Dismutase
publication title Structure and dynamics of copper-free SOD: The protein before binding copper.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1kmgA00
4A7SA 5KBKA 4BD4A 1BA9A 1CBJA 1CB4A 2C9VA 3K91A 2LU5A 1SDYA 2Q2LA 3F7KA 3F7LA 4N3UA 1E9PB 3KM2A 1IBHA 2XJKA 3CQPA 4N3TA 2Z7WA 4BCYA 1KMGA 3RE0A 1L3NA 4MCMA 3CQQA 1TO4A 2WKOF 1SDAB 3H2PA 3GZOA 4U4IA 1IBBA 4A7GA 2AQRA 1XTLA 1SXBA 3QQDA 3HFFA 3T5WA 1OZUA 2C9SA 4A7QA 1N19A 4A7VA 2ZOWA 1SXCA 3GTTA 2R27A 2AQPA 3KM1A 1JK9B 3ECUA 1SXSA 1UXMA 3PU7A 1F1GA 1E9OB 3GTVA 2E46A 2VR7A 3GQFA 3KBEA 3SODB 1B4LA 2ZKXA 1PZSA 1F1AA 2WWNA 1OAJA 1IBDA 2ZKYA 1OZTG 1SXAA 3LTVA 2AQNA 1YAZA 1OALA 1RK7A 1Z9PA 3H2QA 1ESOA 2E47A 3KH4A 4OJAA 2NNXA 3L9YA 2C9UA 1Z9NA 2Z7UA 2GBVA 1DO5A 4MCNA 3KH3A 1F1DA 1E9QA 3HOGA 1BZOA 1Q0EA 1U3NA 2AQSA 2WKOA 1SOSA 1FUNA 1MFMA 2WYTA 2ZKWA 3HW7A 1B4TA 4BCZA 1S4IA 4FF9A 1EJ8A 2JLPA 3QQDB 2WWOA 2Z7YA 2GBTA 3ECWA 3MKGA 2AEOA 3GZPA 1TO5A 1E9PA 1SXNA 1UXLA 1DSWA 2AF2A 2V0AA 1YSOA 1YAIA 3KBFA 3ECVA 4A7TA 1EQWA 1N18A 1SXZA 3GZQA 2WZ0A 2SODB 5KBLA 1HL5A 2AQQA 1XSOA 1JCVA 1SPDA 5KBMA 1PU0A 2Z7ZA 2WZ5A 3L9EA 2AQTA 2JCWA 2WZ6A 1JK9A 2XJLA 1COBA 1OEZW 1AZVA 2K4WA 1E9OA 1QUPA 1SRDA 5CU9A 1HL4A 3CE1A 4L05A 1IB5A 1XTMA 2GBUA 4OH2A 3MNDA 4A7UA 4B3EA 2APSA 2VR6A 1F18A 1IBFA 1E9QB 4A7GF 2WYZA 3S0PA 2VR8A 1PTZA 1P1VA
chains in the Genus database with same CATH superfamily
5IFJB 3S8FB 4HFUL 1NC2A 2OMYA 3F6IA 2YD8A 3QUXC 4TMPA 3GTNA 5GSRB 4BELD 1URLA 2ERJC 2P9RA 3VYOA 4NRZB 5E4EC 1L0XA 1UWYA 3PWVB 2ZUVA 4RQQA 3RA7L 2BRRL 2EIZA 4L4TD 4OZIA 4UIKH 4EF3A 4JFEB 4RMRA 2ITDA 4WLCA 2WXHA 4M29A 2YA2A 3U46B 3QBTB 1H6EA 4L5FL 5EF3A 2GTWB 2P7TB 5D4JA 1QA9A 4DAGH 3MNVB 1JZFA 2R0ZL 3UC0H 4XCEB 1KJ3L 3WFHB 4F3FB 1F86A 2MEJB 1FG2B 2OMXB 4YE4H 4K9EH 3RGVD 3OF6A 3DBSA 4PPTA 3QJFA 1W0VA 1T22A 3UPCA 2A0LD 4G9FE 3BZEB 4MSWA 1NCDH 3OG6B 4KOCA 3L3OC 4ZQTA 4OAWB 1QFUH 5C07A 4EI5B 3H9ZA 1A7PH 5AG9A 1INDH 1NEZA 1NMAH 1F4YH 3EYQC 1EJOH 5GISL 2ZYIA 5EO9B 3HUJB 1C5DB 3SE4A 1I8IA 3GMOB 4WO4D 4RLDA 4ONHA 3KPOB 3CDZA 2NZ1A 2X4RB 4QRUB 4YPJA 2CR6A 2EIDA 4ZRGA 1NUGA 2HRGA 3FQ1A 1YA5A 1S46A 2D7OA 4UMGA 3PF2A 2VRAA 4HBCH 2ED9A 1AXSB 2BCKB 4ZBJA 3DV4A 3MLSL 5C0RL 4K5NA 3HS9A 1ZVSB 1BMWA 3F04A 1A6UL 2UX6A 1WFNA 1AHKA 2WAHA 1Z9LA 2JLLA 4K3JH 1G7JA 4UU9A 3LIZH 1FGNL 4YXLL 5I5RA 2J2ZB 3OAZH 2VN4A 1NKGA 3T2QA 3QNXB 1D5IH 1P7KA 4H8HA 2MIZA 3UG4A 2EIKB 4AX3A 3H54A 4B9ZA 3H9SE 4F8TA 2Z64C 3V0WL 3V0VA 2R9HC 1Z3RA 3OD3A 4MRCA 3STLA 5B1JA 1NIBA 4Z7WE 3AU1A 4PRHA 4MQXD 3DURA 5F7LB 5DRWA 1SVCP 3B7YA 5F9JA 1UATA 2NDFA 2X89D 3GIVA 4MJIE 3AC0A 3LNIA 3PJSA 4HS3B 4ZFFA 5AQ0A 3EJRA 1IAIL 4L05A 3HCVA 2D7TH 1K6QL 3U9UB 2NXZC 5AAPA 1EZVY 5T5FL 2OX5A 1IBZA 2ICEB 4CRPA 4EUPB 3MBED 4ZMVA 4Y88A 2W9DH 4OKDA 4BD4A 3FCSA 2UZXA 1B3IA 4AL8L 3KYOA 4HJJH 4PW9A 4D3CH 3FTVA 5I6NA 4D0CB 1RZKH 3PHSA 4OD1L 4B5EA 5EORL 3PWNA 4Z23A 4CVZB 1L4IA 3IFLH 3OHMB 1TZGL 3C8HA 5GS2H 4Q58C 3P30L 2I9TA 3MJ8B 1E6JH 3FB5A 1OV8A 3QPKA 1USZA 2H26B 3P3YA 4G7SB 4OD2A 3TXAA 4LLUB 2L7EA 4HX1B 1YHPA 3GMNA 3P0GB 1N8ZB 1UZGA 4YHMH 1ZLUH 4PG2C 3BZ4A 3SPGA 1TQWA 3CSYB 3I3BA 4UAHA 4PJEA 4QHNB 1FYTA 3RWEA 4MDJB 4ZTOL 4Y5XC 1JK9B 3PQYB 5IB3A 3TONA 5E9DD 1CLYL 1ZLSL 4OJEH 4ZPVA 3N3EA 4E9QA 3DETC 1NPJA 3MTXA 4X99A 5FWQA 4BZ1H 1S7SB 4YIQA 4E42B 5HHNA 4TNGA 1KV7A 1OOAA 1YEDB 5CIPH 4B53A 1GTNA 3S2AA 4KZ0A 3T71A 4ICWA 1TPXC 3PGFL 5EU6D 4FMFA 5EPMB 4R2GC 3CZUB 1G9ML 4OFIA 5E5RB 2CDFB 5BO1H 5LGHH 2D2CC 2C1PB 3ABZA 32C2B 2K70A 5IM7A 2WCPA 2WLNA 5CKGA 2ARJQ 4PRBA 2Y5TA 3HMXA 5T1KA 1ADWA 3NIFB 5IV2A 2FWSA 2HVKA 4K3EH 4FG6C 4QRRB 4PS8A 3CVHA 4X0NA 4AQ1B 3OGOE 1IARB 5CEYB 1MNUL 4XXCC 2EXTA 3DX4A 5K93A 2DI8A 3NJJA 3UJJL 1KB3A 3UTSA 4K3HA 5LN4A 5D7IB 4G59C 1KLUB 2VLRD 4PJIB 1EEYB 1UM4L 3K6NA 4JFZH 4X5RA 1EA9C 5IB5A 4JR9H 2JMRA 2FT8A 5CSBA 3T2NH 5D7JB 5IMMA 3D0AA 3WOVA 2DLGA 1SPDA 2CJ3A 4WI5A 5CM1A 3IU4L 5D2NB 5DDHA 3WKMH 5C0GA 4GAGH 1THAA 1W80A 5FYLH 2NY4B 3IXAB 1PZ5A 1TVBB 1A7QH 2CA3A 4IBQA 1CJYA 2YSSA 4DP8X 1AE6H 2MPAL 5C3TA 1P0SE 4Y1SA 1NC4B 4M1DH 4IRSD 5J5EA 1XSKA 1TMCB 4PJDE 3BYYA 2C8NA 2W5PA 2VJ8A 4B3EA 2OTWB 2FIKB 3ARSA 3RUGB 2OQJB 4BWUA 3FT4B 4DT2A 4R3SA 1T66D 2CH8A 4Y5VC 3U30C 3PV6B 1CFTB 1SYSA 1Y07A 4UZSA 2BVOA 3GSUB 4GAJL 4XNMA 3H9HA 4XVUC 4ODXB 5EZJA 2Q7YA 4PP2B 4E0RA 5AKSA 1K8DA 5GGSA 3UYPB 4OBSA 5ID0B 4X6FA 3ZT7A 4KX8A 3QDJB 1DFBH 1N5YL 3B2DC 2K6YA 1IVLA 1NH6A 2FYYA 3QQNA 4J12A 1QFWM 4FQ2L 4BFGA 3LKOA 1F6LL 1JXGA 2CLZB 2FRGP 1DO6A 2Q8AH 1ONQB 3TASA 5C0CA 3R19A 4LPCA 4XMTA 1WWBX 1RFDH 4HPYL 4U1MA 3KNBA 3AG3B 2HFGH 5TE7L 5FUOL 2WN3A 3EJYC 1XEDA 3EF7A 5JQ6L 4QGYA 4RIRB 5FYKU 5CN3A 3VVWA 1C1EH 2VQ1B 3SPIA 1QFWH 5BS0B 5IFHL 2MFNA 3MJ7B 3V4PL 2W91A 3PWJB 3SKMA 1GZHA 3K5RA 4IGBB 1GVIA 4XP5L 2CIIA 4PV9B 4G8GA 4GSDL 4K23H 1TTAA 3DLQR 3RVTC 3JYBA 2CKBL 1FFNB 5J57B 3E8UL 1HDMB 3CH1B 4S1RH 1UEYA 4JKWA 3IDMA 2VM4A 3X1BA 4EN3C 4ANWA 3HE6A 3B6SB 3PGCB 2BZCA 4G70B 1U8LA 3T6VA 5D1QE 4W4OC 4HEMA 1N3NB 4LL4A 5DZLA 1J0ZA 1J0IA 3KLKA 4LIQL 3QR0A 4EI6A 1BF5A 1E50A 2EYTB 5KEZA 3CXHK 3EO0B 1OTTC 4PJ8C 3KYAA 3ZTEA 1H9DA 5CKAA 4XE5B 1DQVA 4HSQA 1RZQA 1NMCC 3CN0A 3VRIA 4XXWC 4LBEA 1EFXD 2F9BT 4CC4A 3OKLB 1PD6A 3IDNB 1AS6A 4ATWA 3BAWA 1GAFL 2DJ4A 4MS8C 35C8L 1NGQL 1IC7L 2PP7A 2J1XA 2WNXA 1CF1A 5AUMB 1OAQH 3L08A 1TXKA 3NBNA 3AADB 1A22B 2CHXA 4XNZB 2YFNA 2LU7A 3IFPB 2J8UF 5AFAA 2CK0H 4OZHA 1A5FH 2OI9C 4GKNA 3U4BH 1KGCE 3V5DA 4YSTA 2JXMB 2WZ6A 2XWCA 3N0AA 1JPGB 1S7XB 2OMTB 5DZOA 3RVVC 1MRDH 1BZ8A 1Y6KR 4M3KB 3ZE0E 2FQGA 4LGPB 1U95B 3F8UB 4KC3B 3D30A 3OLEA 5EU3B 5F3BB 4G9DB 3ZDZB 4AZ8A 3MLPA 4WI0B 3VTAA 5F71A 4U0RB 4NQEA 3V4PB 5A2JH 1I4FB 3VFNA 1OY3B 3CFMA 4MMZC 3OAWA 2AMUA 2PYEE 3HI6H 3KPSB 4WI2A 4Y1AA 2L0DA 4WUUB 3HHSB 4NPKA 2GITB 2GUOB 2CKBB 3LQZA 4M61A 3SGKC 2ESVA 4XMLL 1THCA 3MGAA 1JRHL 5D7KD 3W0WB 4QXUL 2OFQA 2X9YA 1F5WA 4Q6YA 1IBHA 4WTXA 3T77A 4MAYA 3NFPA 2DIEA 1J5OH 4JDZA 4EVNA 3M1CA 3SKJH 2ATAA 3WNKA 4JQVC 2DQ6A 1DVFB 4FFZL 1EHAA 2ATPB 3IM1A 2VDNH 3MR9A 4ETQB 5EBWA 2E8YA 2CIKB 2F1EA 3FTGA 4OIFA 1DVYA 5ESVB 1UKTA 5DGQA 1ASQA 4QPEA 4WUKL 1F90L 2IH3A 1DQDL 4RGMC 2HJFA 3HN5A 3OPUA 1QW8A 4JJ5B 1IVTA 2XT1B 1UWXK 4TKWA 4S0TD 1OW0A 1BLNA 4P0DA 5I76A 1XB6A 4YHYB 5JYMA 1QABA 4OZGB 3DHUA 4ODSL 2PCPB 1MCFA 4GKOA 1NGYA 3L7EA 3Q06A 2ZYHA 4WK4B 1CVSC 4AYID 1J9SA 4D9QE 1YAZA 5D1ZA 5I1GH 3IDXL 1MFAL 4JHVA 4ODWA 4PTTB 5F7FA 8CGTA 1BF2A 1T3FA 3LKSA 3HN3A 2O1AA 3OX8B 1NWPA 4U0QB 2OYLA 3CDGA 5EC2A 4R4FL 4Q6IA 4HWZB 3DX3A 2XVLA 1I1CA 2KQMA 3CFCL 1KUMA 2HMIC 4DW2L 4N0CC 4JFQA 3O6ML 2ZP8A 1T04B 2N1KA 4M1CC 1PDKA 4TF4A 3TIEA 1YYMH 3HLAA 3QRFM 1IGJB 1I8KA 3L5JA 1G84A 4MZ2A 5C0EB 1O5DT 3U0WL 5D7LB 2VR5A 2WQSA 3NMEA 3MV9E 4Q9RL 2YD0A 3U2IA 5B1KA 1KGUA 2J25A 2B0SH 3TNNB 2YBGA 2IWKA 5E8OA 5BVJB 5D1QC 4ANKA 5F7MC 5I16A 1R1CA 3RNQA 4FG2A 2AJVL 2WKGA 3QXAA 2HLEB 4U6YA 5EIIA 3SKOB 5EC1A 1MOEA 2LQRA 4XO5A 1CGXA 1KCRL 1DN0B 4FTVE 2EZ0D 5A2KH 4R96A 1MF2H 1ZHLB 3QUMA 4LKXB 3TBVA 5E6ZA 3UADA 4F2MA 3KPMA 3ARUA 4F9LA 4YHOH 2V2TB 1P4LA 1OP9A 3NACH 5CGYD 2EILB 3B2VH 5BPPA 1BYPA 2YD4A 3DSFL 3FRPB 3O2DH 4JRXE 1T20A 2GJ6B 4PJFB 1W15A 3U9PL 1S7VA 4N6RB 1A3LH 1FV1A 1JGDB 3HE7A 4FG4A 1CBJA 4BK5A 3QH3A 4V33A 2ITCA 3R1GL 1HINL 3QCVH 4U6VH 1R3KB 3W9EB 4AIZB 2K8MA 5I2IA 1BPVA 2AGJL 2YJLA 5HXMA 3GJEB 4IW4C 1VEMA 4PWIA 4F91B 5C7ZA 1XB3A 2OCCB 5DTFA 1XB8A 1IIIA 3L2LA 2BOBA 5FV2A 5JHLL 1WYJA 4NO0A 5ACMA 4GMSL 1MCHA 3OJVC 4FLSA 2Q5BA 2EYRA 5SWSB 3DBXA 3QZLA 4M3HA 3TPUA 3C60C 3FRUA 4NT6B 3DRTA 3OKKB 5H94A 3G5XA 2LTQC 4K8RH 5DZ9A 2FD6L 1JGEA 1VERA 4JGJA 4YFLI 1G7PA 2P45B 4OJDH 2YMTA 1T21A 3QORB 5I75B 2V2WA 4P2RD 2QSTA 1TQBC 3DX7A 4IOFC 4M62L 2DTMH 3BOVA 3CH8A 5DZAA 4L8DA 5IUCA 3RBSA 1LNUB 1RHHA 5HGGS 3T4AB 5DD6B 4Q9QH 2K45A 1U8HB 4UDTA 1T03L 4D8PA 3IRZA 2V9TA 3CUPB 4Y5YA 3OKMA 5BRZE 1WIOA 4GG6F 3L4UA 4NZTH 1PSKH 1W8OA 3BQUA 4KHTH 3GMQB 2UWEF 4TPRL 5CJQH 3WGVB 2QKIC 3IDUA 1L6ZA 1MVUB 3MUJA 4EOWL 5BOZG 5KBNC 1YRKA 4AQ8A 3CCHB 4NWTH 3DX8B 4W9EC 3TBWB 4TULH 3RKPA 2AJYL 3IE9A 5I1EH 3S96A 3AAZA 2WXIA 1KCSL 2Z4QB 4I9WD 4MMYB 3MREB 2ATKB 5IHZB 3AT9A 2B1HL 1W0WB 3REWA 5A6LA 4U3CA 4DJMA 5D6CB 2FR4A 1HXKA 1AMXA 2BVPB 2Z93A 4KKBC 1X4ZA 1OT1A 5F7EL 3VFUA 1IUZA 4Z7NB 1WRFA 4ORZC 3HTLX 1L3WA 1HYSD 4N2OA 3S6CA 3L7FB 3VXSD 4QRQB 1WAAF 4O2FB 3X13A 3H2PA 3UBXB 4PGDB 1TVDA 2H4EA 2NXYC 4UAOB 3RVUD 3FFDA 3V5HA 3WTYA 1KBWA 2PNDA 2GJRA 4XHQA 2QVMA 4YDVB 3VFVA 3H1ZA 1OD9A 1XCXA 3K4DA 5EV7A 3KM2A 2XJKA 5HGHB 12E8H 1DLFH 1KXVA 4S1QL 3LHAA 5BZWB 3QI9D 4FNLL 2F53E 4YDJA 3C2AH 3VI3E 4G5ZH 4FNPA 4GKSA 1ICTA 1K4DA 2A6IB 3CVBA 3BVUA 3DX6B 4HJIA 4JO5A 4LNRA 3SY0A 5JOFB 4ZK8A 4Z3IA 1E67A 1AIFB 5TFSL 1BOYA 1ZA3A 2F8IA 4Z7IA 1MCPH 3CFBA 5TPWL 4Z7VA 3F12A 4NQDA 1EDQA 4NXSA 2O72A 3GTTA 1G7LB 1PKQB 2C1OB 4KITB 5HHOA 1LEKB 4PY8I 4ZSOE 1CICC 3PFUA 1E9OB 3EYFA 3KVPA 5IGXL 2OP4L 2ZAGA 3MCYA 3RDTA 4YUEH 5IVOA 1FG9C 3NJNA 2H8PB 4UDUA 2EE3A 3PWLB 2F7QA 5DI8B 3GBEA 4GKLA 3G5ZB 5JA8B 2WP3T 3K0WA 3MBXL 3RL1B 1VFUA 2AQ2A 5F0JB 5GS0C 5EZIH 4O2CB 1QRNE 4AQEB 2V5TA 3BGFB 3GYRA 2CG9X 1WE5A 2HT2D 5FO2A 5E51A 2E6QA 2ZSWB 4ZMWA 5EDSA 1Z7JA 4QRTB 3ZE2E 1AGDA 1D9KD 2R2HA 2DLTA 4NQXA 3VRJB 4Q74A 3APFA 4QKXB 1VFMA 5DJ2A 1KXTA 3WS3A 1KB5B 3EKCA 4BXSV 2VXQA 2XN9A 1HQRB 1P5VB 4PRNA 1V7MH 5KSUB 1SXNA 3QDMB 4GXVH 2AF2A 3C6LC 4BSVB 1GYVA 1P84J 2DQUL 5I8EA 3AXLB 1X9QA 5TF1H 1HSAA 4GKZB 2ZF9A 5KJ7E 1R3HA 4TVPD 2EH7H 4KZDL 1IM3A 4JO3L 4MDIA 1A1NB 4PJCA 1HQ4B 2I7SA 2FB4L 2AQQA 1HE8A 1IGFH 4E9RA 3U83A 2EP6A 2JB5L 3BT2L 1EXGA 3CFIC 3HNTH 2YUVA 5K9QG 4IHOB 3P02A 2OR9L 5GIRA 2NY3B 4X4XB 4JG9A 3WKQA 3BQVA 4GO9A 4NHCH 2XU9A 3NGBC 3BWAB 3QUXD 3LB6C 1JPFB 2X4PA 5CU9A 6PCYA 2A77L 5EZOL 1LDPL 3UZQA 3WJMA 1VPOH 1FH2A 3MNDA 3ML8A 1MAML 3I6KB 3ZE1B 1TEYA 5ITFB 4OLUL 4NPYB 1LWJA 4APQC 3MRDA 3HC4L 1FVDA 1XGRA 2IPTH 2C3XA 4PY7B 4DGYH 1TTFA 4JQIL 3F5WA 1LD9A 3BIAX 2XQYG 3FBKA 4Y19E 4R4NC 5KVGH 3N42F 2Z92B 4MASA 5ADOH 1RJYB 4JM4H 3P2TA 5CJBA 5D93B 1JNLL 4KKQA 4O5LH 3MRHB 4L3CA 1DYZA 2H3XC 4WFED 4CW1A 1HJCA 4KTEL 1Y7VA 1XCTA 1BXAA 5DCCA 1CFNA 2CO1A 4DGWC 3HG1A 3GSRB 5DEFA 5KSVA 3FQXB 3HNVL 1JV2A 4KMTH 1FGVH 2Q87A 1P4BL 2DKMA 4M5YL 1XH3A 2CM6A 5DJ6A 1U91B 5I1HH 1KFGA 1NMBH 1U2HA 1UEMA 2A6DA 5T1LD 1WAAE 4JFFB 2CO7B 4AYGA 2F5AL 4UTAA 3FU7B 4OM0H 4HIHB 1UCTA 3IMRA 2GSGB 3KPNB 3NRFA 3HFMH 4NM4L 3BEWA 1KCKA 2PF6A 4KHXH 3TO4C 3D08A 1KZQA 5ALCH 3DA0A 3UTTB 3UEQA 3QEQA 4X4ZA 3W9DB 2JCCA 1KJMB 1B4RA 2C9UA 1ILSA 5DQJA 3POHA 4HG4J 4QOKD 4FXGB 2EEXA 2B59B 1B0RA 3OKOB 4H25B 1WIUA 4PGZA 1K9TA 4E36A 3BP6B 1YEHL 3GPSA 2VL5B 1DEEB 3BO8A 4HYTB 3T3MB 1TU2A 4M6NH 1NCNA 1G6RH 3X12B 2Z7YA 3S3JA 2F18A 1OCRB 5GZOC 3QPQC 3T0WA 1NAMB 3ARTA 3MRBB 5LAXB 4A68A 5CUSL 2DI7A 1DSWA 1TITA 1NICA 4WFHD 1RVFH 2XNAB 3DOSB 2OMYB 2R9HD 5IEKA 4WHDA 3PNWA 5F8RC 5IJKA 1D5BA 4DGIL 1Q9OB 1FBIL 1FL5A 4OCYH 8PAZA 4RQQB 5FHBL 5JXAH 1TNNA 1Z9SB 3C9NB 4P07A 1BQRA 2ZSVA 5K1NA 4ZOAA 3D4ZA 5FYJH 1IU1A 2AK4B 5DZVA 1RPKA 2NXZD 5FF6A 5F88A 1QA9B 3FFCB 1EWHA 2CRIA 2ED7A 2P5EE 4TV3A 4N20A 2XV6B 3RIKA 2V7NA 2OW7A 3POCA 3LIZA 3Q2VA 4FA8A 1IIKA 3IDGA 3QE5A 4Z76A 3CVIH 3VE0B 3WJJA 1T0MA 3QJFB 4O2EA 1W0VB 3TA3A 1XZ0A 2AQ1A 2ZD0A 5KTEH 2Z4TA 4MA3A 3MLVL 4P46D 5I18L 1RIUL 2HTKC 4J39A 1P6WA 5FA4A 3HPJA 4U1IB 4MJ4A 3GXUB 3W81A 1EBPA 2VDRH 2XKNA 2CJTA 3B7TA 3T6WA 2IF7A 1NSNL 3MZTA 3VFRB 1FIEA 1AGEB 1WO2A 3O8XC 1RSFA 5FKPA 2AJXH 1PPIA 1NAKL 1KCVH 5EO1B 3PWPA 4K2UH 2AQRA 4GW1A 5G4MA 4D9LL 5D70H 3NP4A 1Q0XL 3CDZB 3EDJA 1NGZB 4V1DA 5JA9A 3CSPA 2MOQA 3SDYL 1AGFA 2FJHB 4ZOCA 5E94A 4F57H 4DZBB 5B3SB 3KPTA 4I85A 2A6KB 3OMNB 4KY1H 5J1TC 4NX0A 4L4TA 4J6RH 5D1XA 2WBXA 4LRIA 1MRCH 4IIZA 1WUNT 2XFXA 4BSJA 1G0YR 3IETA 1R34A 2Q20A 3VFTA 4RZCB 3ULUL 4JB9H 1P7KB 2Y6SC 4FG6D 4G9FD 2I9LB 1J11A 3MRIA 1UXSB 3DOIA 3NSCA 3VGGA 1S7WA 3IFOB 3CBJB 4OFPA 4QXGL 3ZJAA 4YFLF 4BZ1A 4WNQA 4PRHB 5ABZA 2EJ1A 5EFIB 2QGEA 4P06A 1XF4A 4NKDB 1JP5A 3GHBL 4JDTH 2BSEA 2A7BA 4JHZA 5CIPA 4UQ3A 4NUQA 4S0SD 1U92B 3FB7B 3BC9A 5EOTA 3HCVB 2AXWA 1S3KL 3BE1H 4GNKB 4KVPA 5K59E 3HMXL 5DLMH 4DESA 1FVEB 5I15H 5KJRH 1S9XA 4LKCA 4DUXA 4PRPD 3W5NA 4HIEB 1DJSA 3IDYB 4GIOA 4WO4A 5KUKA 1EERB 1CDHA 1KIRB 2OZNA 1MLCB 2H1XA 5KVFE 4B41A 4OKVA 5EU7E 3PHQB 1KENH 4H8UA 4UT6H 2Z31A 4OZFG 2IPUG 2R1WB 4DP4X 2X1WL 1MPAL 2XTSA 3D85D 4WIQA 1ZS8A 2WZ5A 1L7TL 1E5ZA 3T6XA 2XZAL 4JZJC 2I9TB 4JKNA 2YRBA 1D2PA 1JHTB 4YNYA 3G6AB 3K6IA 3DMMB 2Q8BL 2JJTA 5BW7C 1HL4A 1QLRA 4V11A 1GYAA 3VWJD 5IVNA 1QFOA 2J8UA 1FYTB 5AVWB 4GSRA 2QADD 1PKOA 2ROXA 2X53A 2YPKA 2JK5B 5ICUA 3MBWB 1ZHKA 4RSVA 5EA0L 3VGAC 4PJ7F 3KLSA 4BFIB 4MJID 5J11C 1AACA 5LXGH 2WXLA 1O7SA 2ZPKH 5GGVH 1PLAA 5ECGA 4KK5C 1AYRA 2K7PA 5DD5H 3ENEA 4HLJA 4ZS7H 4XNUL 3O3DB 1BG9A 1KFAH 4JEGB 4AM0A 2IAAC 2Q1EA 3EOAA 1UWXH 4I77L 3GSNH 1QLEL 5I23A 3O9WC 3DYMA 3RILA 1JZDC 2EADA 5HY9A 2V17H 4N2BA 3EJUA 3N1PC 1NCCL 3WLBB 1WEJL 4PRBB 3S5LB 3MA7B 3MODH 1T1XB 2Y5TB 3V55A 1JZ3A 3EYSH 5T1KB 2VLKE 1WGOA 5IOKA 4OB5H 4LEOB 2ROYA 1CPUA 2HVKB 4TL5A 3Q13A 3RVTD 3J07A 4YSRA 5J13C 1MH5B 4ZQKB 4KFZC 3OZKA 1EO5A 3EHBC 4EN3D 4Z9KB 2FX8H 4BSWB 2DF3A 4RFNC 4N2EA 4AXWA 3CLFH 5B8CC 1KC5H 1OAJA 2VABB 5JIDA 3DKHA 1EZVX 2RD0A 3AWEA 4GRLB 4ELMA 5IJCC 2E47A 1EAQA 1OTTD 4DFIA 3IVKA 3OV6A 2R1YA 2A9CA 2DQJL 5TE6H 3P4MA 4K94C 4PR5A 3R8BB 3BVVA 1MHHA 4Z7OB 4U49A 5DDHB 3QJHB 2BY2A 2MRYA 5DVPA 2ZYRA 3OKNA 5IIEB 5E9DA 2YSSB 5DHYB 4WHYG 4HFWA 3QR2A 4X7SH 3GUFA 4ODVH 3MROA 2F19H 3EH1A 4QJ3B 5HGAB 1TZIA 1ITBB 2A74A 4KROC 2N59A 4MCZB 5EU6A 3WE6A 3NDZE 5H2BB 2D4DA 1SYSB 5KZCB 5J9PA 2EKSB 3AT0A 2J7LA 1HKLL 2Y7QB 4Z7QF 3NCBB 1UHVA 1QLEB 5CD5C 4MXWH 4NXKA 1MREH 2EH8H 2UY6B 4HKJA 2Q7YB 5A2FA 1A8JH 1I9IH 2VDQL 4KFMA 4WV1B 1J18A 3MNWB 2IALA 5E8DL 2DQFB 5BJTA 3L9EA 2C4FU 3Q6GH 3KPLA 3SDDD 2MTPA 3A6OA 1KTJA 2A6JA 1UENA 4JDVA 2DIJA 2FYYB 1JPTH 3QCUL 3CLEH 2C3GA 1EHKB 3KMDA 25C8H 2GFBA 4CAGA 3FQYA 1T83A 2VLRA 1HL9A 4GSQA 3QP3A 4K7PL 2L7QA 1IFHH 3BUPA 4N8VG 3G04A 1ACYH 2B3IA 1DDHB 1T0PB 3GRWH 5EU7C 5JPNA 3LH9A 5F7HA 1C5BH 4M43L 5IB1A 4UCFA 2BNQB 1YNLH 4MMXA 2CIIB 1ZHBA 4G8GB 4N0RA 5ILTL 2VDLH 4QRPE 1UB5B 2QQNL 4IRSA 2IAMC 3ZX1A 5IOPA 3ILQC 2ENQA 2HG5A 1RURL 1NLBH 4QY8A 2ZUXA 4HEPG 2E9GA 2XRAL 5T1DH 5AW0B 4P5TD 3I6GA 5HHVH 4UNTA 1QX1A 2VXSL 4FZ8H 4RDQG 4JG0L 5D55A 4RWHA 3CX5K 3HAEH 2FQDA 2ERJB 1X7SA 4X8GA 2J4WL 2XV0A 3MCKB 4LBEB 2BP3A 3U1SL 1K5WA 1Z2KA 1A1OB 4DIXA 2HKFH 5HVHC 4X42A 2FX9L 2VDQB 3A21A 4QRAA 1FPTL 1KBBA 1WVZA 2HMID 3OPZH 4AG4H 1RULL 4NZ8A 3SOTA 2DWDA 1ESOA 3B83A 4M1CD 3T8VA 1YQVL 4KDWA 4L23A 3SD2A 4EEEA 4Y4KD 4GKNB 5HHPB 3V5DB 3LKPA 4YBLC 2BX5A 5HI3C 3UYOD 1JVOA 1KBKA 4MLSA 3BKML 1UD2A 1FWXA 1IGCH 3G5YA 4MWFA 2QV2A 1VGEL 1CGYA 1GC1C 3BWSA 5LBVA 3LVEA 4ZX4A 1QHOA 2KBGA 4CU8A 3G3LA 2NY5C 5D1QD 3L3OB 2CUHA 4J4PC 2IQ9H 1VSCA 3VFNB 1NBQA 2HSIA 3RWFA 5I1LB 2O6PA 1FL6B 2KDGA 2BVQB 5I8KH 3ARXA 2WQWA 1IC0A 4GFXA 4G6JH 1BD2A 2ESVB 1A64A 3EJZC 4GG6A 1G9NC 3VW3L 1J05B 2ZWZA 3JWNC 4PREB 3V95A 3QIUC 1NDMA 5KSBF 2B7DT 4EVNB 5DJDB 4XNYL 3ARDC 5AYUL 4BH8B 2YD3A 3NZUA 4PJ5A 5JW3H 3MV7B 3K71B 4NFBA 1PG7X 1XZWA 5ES4B 5EULV 5DMKA 5IJVA 1U8QB 5AYQA 3IJHA 1QSZA 5EBWB 4P59H 3FTGB 4LL9A 1IZJA 1UJ3A 3APMA 5A2IH 1KGCD 4NB7A 1E2ZA 3QFDB 1H15A 4ABWA 5C0IA 4UINL 1JV5A 5EEVA 5I76B 3QUML 4HMCA 4R90H 4UT7H 1VKXA 3CBKB 2LU5A 5C09B 3DK0A 2NZ9D 2VLJB 4G8FB 5IKCA 1WP6A 2P3YA 3NZSA 2QSCH 2L7JA 1F02I 2XZQH 5D1ZB 2PYED 3C60D 3U7WH 4XNQB 3ASNB 3O2DA 3EDFA 4NQTA 3LKSB 2XQYK 4WHTB 4X4MA 3P9LB 4WFGE 1F6AA 3DGGA 1QBLL 5AW6B 2OYMA 4Q6IB 5JXED 1UFGA 2WMPB 5IK3B 4RFEA 3BJLA 3Q8EA 5LCVA 4WEEA 5I71B 4JFQB 3SDAC 1TVHB 4OF0A 2OJZL 3T0EC 1FCCA 3EUUA 2ZX7A 3VXTA 2Y1AA 3U6RB 5FYKH 3CAFA 4NUJA 1CFQA 4H2CA 4FQ1L 2DD8L 2CMRH 4HBQA 4M9OA 3KPRE 3SQRA 2VQUA 3FN0L 4NYLA 4HWNA 3KYNB 3P77B 1E4KA 1BVLA 3QFGA 3H56A 1XGZA 5I16B 4A2LA 2EACA 3TFBA 3NJHA 2LR4A 5KVDL 4J3SA 4KRPB 3I6LE 3QXAB 3HZYA 4XMKL 5AW9B 5A7BA 1EEZB 5J12C 3SE6A 2O5NA 4NN6C 2VAAB 2VQ4A 4D9QD 4IM8A 3AS2A 4HP5A 3QQXA 2W0FA 5DFTA 1LILA 2NW3B 2ENSA 2VYRE 3QUMB 4LLYB 4R96B 3TBVB 4PS3A 4ALAL 5MEQA 1QW9A 4M7LH 4BINA 1S3RA 3TCLB 1I85A 2FEEL 1GGCH 1J9QA 3H53A 5EU5B 3WSQL 3WXWL 2DH2A 1R6VA 1TPXB 3QH3B 4YSQA 2BIMA 2ITCB 2W80C 4R2GB 2BXZA 4X9GA 1GYCA 5KSAA 1K2DB 5I2IB 4MRBA 3MFFA 2BNUA 4PWJA 2VSKB 3LNGA 3MV9D 3ARZA 4WI7A 2W1NA 3L3IA 2CCVA 2B1AL 3KXFA 5DTFB 3II3A 3CV5A 4JFDA 2OMBA 2X6MA 1X9LA 3GBMH 3ERXA 2UVFA 4GP5B 3T1WA 4MXVF 1RMFL 2NXYD 1BVNP 4UBDC 4P04A 3DBXB 1F2XK 3L3DA 3VB8A 4LCYB 4A7UA 1MQKH 3DRTB 2Y2TA 5H94B 2MCPH 4XCFL 5A6IA 4G6KL 3A24A 5JOEA 4NI6A 4M5ZL 2XV3A 1MW1A 3V7AG 4FTVD 5GGTH 3CN4A 4PJ9C 1T21B 4PI2A 3W3BA 2BSSB 2A38A 2V2WB 3MLXL 3MN8A 1LP9F 1TFPA 1VACA 3MRPA 4LARL 3DX7B 2HX7A 1Z3GL 3ZZLA 4YMPA 2J1WA 4PRDB 4JRXD 4N1CA 1S7QA 3APDA 4GBXC 5C08E 4RAUB 4PJHB 2R8SL 1RHHB 4FP8H 1LO3L 4KO6A 2D7PA 1RZFH 3IMSA 4JKPH 1O6SA 2OM5A 4NM8H 4TRPL 4UDTB 2B2XL 1MQ8A 2Y4SA 3UAJA 1RPQA 1HSBA 1Z0NA 3LYRA 3A6BL 4ODTH 1XMEB 2DQEH 1F4HA 4JREB 3N50A 4DTGH 4JGMA 4S1SL 1YJDH 1JN6B 3CPUA 3U30B 5A7EA 1X5LA 3BH8A 4GJTB 4NNYA 2KUTA 3F2LA 5D96C 2ZCLH 4TTDC 2YXMA 3ZTJG 1FNSL 2IANB 3D5OF 3N2JA 5GS0D 2ZNWA 4MNQE 4Z7WB 2DS4A 3N5AA 5GZNC 1LL1A 4QD2E 4Q6KA 5JHAA 1BXVA 4X6CF 4YHNB 5JORB 1LGVA 5CJ5A 3PABB 4WY7H 5DHVB 4WU7A 3KH4A 5T3ZH 4AUYA 3NZ8A 3RHWF 1YC8A 2OCFD 2V5RA 4QXTA 4LPWA 2WK2A 1AGBA 1PX3A 1CXHA 5DJYB 2CLRA 1A66A 4DQOH 3B9KA 2BJML 4ODHL 4HD9A 3C6LD 5I5MA 5IHUH 3JBG7 2G3NA 4XB3A 4GXUN 3RP1A 2EIBA 3S34H 4P2RA 4QRSA 4PMFA 1LO5B 2FBRA 1DBMH 2ALWA 5E95B 2GBTA 1XO8A 1U6AH 1UXWA 5KS9E 4Z7UF 2VR4A 1Y18B 4JO8A 3X13B 3SY6A 1UXLA 3HS0C 4L0YA 1B0GA 4BUGA 4PS4L 6PAZA 2VXQL 4KH9A 4BA8A 1EHNA 4PB9H 4LSVH 5FO8A 1AR1C 4TNEA 2R2BA 3RY4A 5A43C 5FB8A 2IC2A 4M5SA 5C8JA 1KY6A 3GF8A 2Y1ZA 5CZVH 3Q2CA 2P28B 2LGNA 3KPPA 5EMYA 2PPDA 2EECA 2OYPA 1IGYA 4GKSB 2JI1A 3GNML 4PJ8B 1SDDA 5JQIB 4LNRB 3ZHNA 1RUQL 1XFPA 2IPUK 3CZJA 4C57C 1EX0A 1O6TA 3LEYL 2BSDA 5E1HB 1AZVA 1LEIA 1ZA3B 4PSRA 4QRFA 5JO5A 4IEFB 1LE5B 3TFKC 1GR7A 3BWUF 1D5ZB 5CZKA 1KB9K 2J5LB 4R4ND 5FM8A 3GI8H 2LOEA 3ISYA 5ID1A 4FULA 4YWGL 3EG9A 1D6VH 4LHUA 1N7MH 3TO2B 3OR7A 3BKYH 2FSDA 1JWMB 1V05A 4I3RH 1NEZG 2PR4H 2LU3A 2OI9B 3GMPA 2ZG1A 1Q1PA 4H8WC 4GQQA 3H7LA 4DN3H 1BFOA 5CR8A 2WYHA 3WJLC 2XKUA 1I9RL 4ELKA 1TJIL 3VXSA 3GMLA 2DWSA 1ZY9A 1BFVL 1AQKH 2G9HA 4JL2A 5E1AB 2C9PA 5IQ7L 2G60H 4XVOA 1LO4L 1NFDF 5IVXF 1AFVL 1TT6A 2CBQA 2F53D 3TBCA 3EFOA 4BFKA 3D07A 4HZLA 1RQ5A 4RGNE 3WS3B 3TO4D 1JUFB 2XN9B 2O4EA 3AGWA 1OIOA 1J5IA 1JXJA 3QI9A 2G75A 4UIKL 5CN1A 2A73B 1URZA 4PM1A 1J8SA 5SWZB 3GUTA 1HSAB 1R3HB 3QB7C 4DAGL 4FA7B 4H20H 3V6OA 1Z9PA 2GBAA 2PXYC 2R1XB 3BISA 4N4YB 3AMKA 3AXHA 4PJCB 3UC0L 3X1NA 4NQCE 3FN9A 2EDJA 2O61A 4YE4L 4JVPA 4K9EL 5GZOD 3D4CA 4AGNA 5K9QI 3PDOA 5F7NC 4QKTA 2I26N 2I32A 1A25A 2X4QB 2Y69B 3VX0A 1FUNA 3X17A 1U3JA 1BZQK 1QRND 3FPYA 1NCDL 3UZQB 2A9BA 2WLYA 1QFUL 3B3BA 5C0ND 4D0DB 1INDL 1NMAL 1RJLA 3KR3H 1F4YL 1KTDA 1EJOL 3HG5A 3OWEA 4M4RA 4NCDA 4Z3JA 3Q3GA 2VW7A 5CLWA 3VXRB 1TYJA 1J0KA 1T6BX 1FVDB 2X6VA 1HHHA 3FCTB 4PGEB 2G4EA 3U6XS 5ENWB 2R23B 3PGDA 5HHXH 4ODBD 1AQDB 2C9RA 1LD9B 1T5WA 1GS7A 3QUGA 1R17A 5C9JB 1HL5A 5MEPA 3VGBA 1SBSL 3MHZA 3HZMB 4Y16C 5TJWK 4GT7A 4GI8A 3TH3T 3BH4A 1AMYA 1Y0LA 1UA6H 4HBCL 2X4SA 2VN6A 1U2YA 4L3CB 4CW1B 3P9WB 4Y2LA 4LLMB 1ED3B 1EDHA 1F2QA 1XCTB 4J23A 1MLBB 4U3HA 1CFNB 3G6JE 4BUHA 4J7RA 2HTKD 2P1YA 1JWSA 4LPXA 5DEFB 4QHMB 1S9KC 4K3JL 1I8UA 3CZKA 5DJ6B 2X2IA 3LIZL 3O8XD 5B1BB 3H85A 1OP5K 5K39B 1D5IL 4M6MH 3WDIA 1CB4A 4B9KC 2MQ3A 4QYOB 1UA3A 2C3VA 3HB3C 4AVIA 3D9AH 4XGZA 3ZZSA 3QQ3B 2W0LA 3NJIA 4KK8C 5AYTA 4XBMA 4XZ4A 1NTDA 4E5XA 3QUXA 1FNLA 3ATDA 3GD1C 1L5GB 4ZXBA 1VHPA 1WFJA 3K2UH 5EB9A 3COOA 4AH2B 3MRCA 2W60B 4AI7A 2D7TL 1ZD6A 4I18C 4PJ7A 4X6DA 1IAII 3S9DB 4Y19D 3DARA 1M6UA 3OWRA 4Y8DC 3HS8A 2DMGA 3DOHA 4R5VA 5GJSH 2NSMA 1ZA6B 2W9DL 2F2HA 4WU5A 3BO8B 4NN5C 4HJJL 4FQXA 4OCLC 4LLDA 4D3CL 1RZKL 4ODUB 2E27H 4C58B 1MFCH 5CR1A 1PEWA 1SLVA 1A14H 3IFLL 3KL5A 4DNLA 3PAUA 5IEHA 4DUWA 2DQMA 2I25N 4LASH 1E6JL 3GMRA 5BQDA 1ET8A 3L45A 1FL5B 5D6DC 2UXFA 4P4KA 2YAOA 4YHML 4XXDA 5BMFH 2C9QA 2UVEA 5CLXA 1F6FB 3ZDWA 4MCNA 4B9FA 4RGNC 3TT1H 4WCYH 2CJUH 1Q0EA 2V7NB 3F83A 4KJYA 3TIDA 5T8IA 4BZ1L 2BP8A 5E6IC 2NTFA 4Z76B 3QNFA 1D5XA 5ADPH 4S2SB 2XKSA 1TQBB 5H8DA 3TA3B 5FECB 5AW3B 3FCBA 1FZKA 3WHXB 1X9RA 2Z91B 5I8CA 2CU9A 3NIDE 1AD0A 1JZ7A 4XNXH 1EQWA 3W82A 2NY2C 2P42B 3HPJB 3LD8B 4JVUA 4MJ6A 5BO1L 4QOKA 2XKNB 4MTMA 5LGHL 2AVGA 1XR9B 3UBHA 3NJGA 3AS1A 1L9TA 3F00A 1F58H 1TJXA 4EZMA 3FUNA 4N0UA 3LN9A 4XMVA 4GW1B 4Z3FA 2ZICA 3CVCA 4UM8A 3FNKA 3T2OA 1SF5A 4OCWH 2QDWA 4ZS6C 4FQCH 5EO0A 3VXMB 2CO6B 4JFZL 5EEYA 3VWKC 4AJWA 2FATH 2JF1A 1CFSB 1SYVA 2N4IA 2P5ED 4JR9L 4XTRD 3T2NL 3VGFA 4L3AA 1LE9A 4DWHA 4X5WA 5D2LA 5D1XB 3AG1B 2ZXQA 3G5VB 3O9WD 4XH2B 3O11A 2Q2LA 4PBDA 2EEAA 1EV2E 2IOIA 4P2QD 3WKML 4YHPB 1Q9LB 4GAGL 5I1AB 5FYLL 3EIFA 1IKNA 2XFXB 3AT8A 1A7QL 4GP4B 1UD8A 2DYPB 3VFTB 1CF8H 5I1DB 1AE6L 2PTUA 2AXFB 4ZNEA 4M1DL 5DQ9B 3MRIB 2NYKA 1EAOA 4OLXH 1S7WB 2PW2B 2DMCA 4WNQB 2JKTM 4WKZA 1IM9D 4CC0A 4P46A 4ABQA 1JFQH 1A4CA 1PYWA 2EXYD 3W57A 3KD4A 4UQ3B 4XZUA 4QO1B 5EOTB 3RIAF 1U0QA 4P9HH 2VITA 2X10A 3GSNA 4Z0XB 2QPEB 4MA1C 3VI4A 4MNGE 4IYKA 4P99A 2PW1B 3MLTB 4YDMA 3C5ZA 5F3HB 4YDNA 4ANXA 5FM5M 1S9XB 2YR3A 4LKCB 3ULAB 4YR6A 1QQDA 3F6LA 4Y5XA 4X2UA 4XVSH 1DFBL 1DSFH 3TZVC 4OKVB 2DLFH 4NC1C 4TQHA 3RWIA 3FQTA 2Z31B 3QXVA 4Q7DA 3I75B 2Q8AL 1YDPA 2P8MB 3KGTA 3P4OA 4J3OH 1KGIA 1SOXA 3S4SA 3C8KB 5L2KB 3O4OB 1RFDL 1ZS8B 4JFOA 1IQWH 2Z7UA 4N1EA 4EQ2A 4HV8A 4P3DA 2HFGL 5D8JH 1FNAA 1E9QA 4AMXA 3HI1B 1PZUB 1QYGH 5F7KC 3BWUC 4YNYB 3LQMA 3RIFF 1CICB 1C1EL 4PJ6A 1QFWL 1SEQH 5G2NA 2NNAA 3BPCA 3QUYC 4I2XE 5CP3H 1JZGA 1DJWA 2J8UB 4GUPA 4LLWB 5BQ7A 2YPKB 2R0ZH 1CC3A 9PCYA 4K23L 1ZHKB 3TVMC 5LJYH 3HZVB 2O93L 4G9FA 3WMPA 4S1RL 5C0BB 1SXZA 4JGUA 2Y06H 7FABH 2EDEA 4P23C 2VUYA 3V8CA 2I07B 4UOW0 2BVUA 2YGVA 4N26A 1OB1B 4AJYV 5FEBA 1WHOA 2IBGA 3STBA 2AABH 4FA6A 4I88A 3MUHL 3IK2A 1B0IA 4H1LA 1T89C 3L6FA 4O51A 5JW5B 4QTFA 4GY4A 4P8QA 2CLVA 3SPVB 4FNQA 4G6MH 4NAQA 2YEVB 2R51A 2BP5M 1F3JA 4PRPA 3B8YA 3VGDA 3WY3A 1WA0X 4ZT1A 1NCAH 4U2YA 4OCMC 2W9EH 4U1NA 3BW9B 3WL9B 1L9SA 1OAQL 2XN0A 3HPLA 4JCWA 1LK2A 1QEWA 5KSBA 1QSEB 2Y7NA 3QNYB 2VE6B 3Q8BA 4UQBA 4X7FC 2N1TE 2CK0L 4DVBB 4JZOA 1IBYA 2X9ZA 3D85A 1A5FL 4P2OA 4KJWC 3DYOA 4AXWB 5L88H 1M53A 3RL2A 3U4BL 3QUZC 4NENB 2WLIA 1R5IA 1QUNA 1MRDL 3PXLA 4G1EA 3C09B 5TK4A 3NPSC 2XTJB 4DCQB 3ZKMC 1HHIA 3K6SA 3IVKB 4YLQT 4W9IC 3RBGA 5JDJA 3GRWA 3P4MB 4PR5B 3VWJA 5IW6A 4L9LC 3RJDA 4WWOA 3LZFH 2W38A 4MVBC 5DO2C 3GSWA 3PY9A 3IJYA 3OKNB 3Q7JA 4PLJD 2Y1VA 3SBPA 3UTZA 4I8DA 4B7IA 4CN1A 8FABA 2Q10A 3HI6L 3PNRB 3EJPA 3ABGA 3EJTA 4APQB 2N56A 2G5BB 2RQEA 2R4SH 1IC5H 1JRHI 5EUOE 2A74B 3N41F 3VMPA 3RPKA 1J5OL 4HUUB 3SCMB 2VLKD 1WK0A 4XHJC 1G9HA 3SKJL 2X70A 5HI3D 1TEGA 5T1MB 2LLNA 4M7JH 4APXB 1HI6A 2HX9A 4ZD3H 2YUXA 4J3OF 2VDNL 3HAEA 3SD5A 2MOVA 2IALB 5EIIG 2IH9A 1RJCA 2WTRB 5BJTB 1HWGB 4J4PD 1DO5A 4QF1A 2A6JB 1G4RA 2DMHA 2HWZH 1YEGH 2CGYA 4EN3A 2F15A 2QELA 4JM2D 2GIXA 2E7LC 1JZHA 3VSQA 2DL2A 4LCUA 3H9YA 1OARH 4W4OA 5TH2A 3EJZD 4FQQA 5AZEH 3IJEA 3HNSH 2D31B 1A4JB 4NWUH 3QIUD 5IQNA 5JPNB 5I1GL 3D34A 3M17A 1JFHA 1XBDA 4J3XA 3V8OA 5EEXA 4PGCA 3ZBMA 2J44A 1NDGA 3ZZQA 1Q9KA 2OPCA 1C16B 1H19A 1ZHBB 2BFVL 2UYLB 1CLYH 5EF1A 4DPAX 1IAKB 4OIBA 3NRPA 1WBZA 5IOPB 3SDXF 3L4YA 3U25A 3F05A 4ES9A 3T04D 2VN3A 1YYML 3ARPA 2WQUA 4YHLH 1YLBB 3L3GB 4XN5A 1ORQA 4ZO6A 3L4CA 4MJ5B 3KPQB 3FO1A 2DB8A 2P5WE 3GIZH 3T3PF 3BDXA 2CDEB 2B0SL 1KN2H 4OT1H 4P5KB 4YZFF 4HS6A 2GABA 3SBWA 1KPVA 3MRQB 4NO5B 1NFIA 2E5EA 3TJHD 5AB2A 3SDDA 1Q0YH 1FFPA 1FC2D 3VSUA 2AI0H 4Y2DA 4JUSA 1U58A 4MMZA 4WENB 1CGWA 5LNGA 1RJZB 3FU8A 3BFOA 4QNPE 4DO6A 2DQHH 1SDAB 4PJBE 3SDAD 1MAKA 2BS71 5T3XE 5E8NB 2VMCA 4F58H 1MF2L 5TK2A 4HQQH 3LKPB 3LOWA 4YHOL 4DEPC 3TTYA 4WJ5A 1A6PA 3NACL 4F7PB 1TF4A 3B2VL 1IQDB 5LKNA 3O2DL 3Q6FA 2EUZA 2OLDA 4FEIA 5EZLA 4JQVA 1A3LL 4MWFB 4QRPD 3CU1A 3MRFB 4JY6A 2EXSA 2PLTA 1BPLB 2C7UA 3QCVL 4U6VL 2HJKA 4HZ1A 4F80A 4ZO9A 4UM9D 3N1QC 1NL0H 5DK2B 4JFEE 1ET7A 3GJFA 2KH2B 4HF5H 1UH2A 1DQJA 4PWEA 1J1OH 1BD2B 4NO3B 1JPSH 5T3XD 3PUCA 4ZFQA 5CCHE 3VGEA 5FA3A 1FJ1B 3WNNA 1AKPA 4GG6B 2FJGB 4L29A 4P5TA 2UWEB 1NDMB 3FSWA 5KW9H 1Z9OA 4K5LA 3VCLB 4PJ5B 2PP9A 2BY3A 2IQAA 2UZYB 1EZSA 2LV4A 3FS9A 3JUYA 3OTTA 4FN0A 4S11A 2BSTB 2IV8A 4IU2A 3ZPDA 1BF8A 4K8RL 3SYAA 5IJVB 5FV1L 1QWHA 2OMZB 3QIWC 3IJHB 4OUUA 4X6CA 2CA4A 2EVJA 1GHFH 2YC1B 4ETYA 3QJZA 2VDKH 2JVUA 4F9PA 1FDLH 1N5YH 3VQMA 4ZW3A 4BGDA 5EEWA 3HUJE 3MX0A 1H15B 3NCMA 2N7BA 1JAEA 2DTML 4WTQA 5C0IB 5KYWB 1U8IB 3CJJA 4FEMA 4R7VA 5FFLA 4Y4KA 4Q9QL 5A2LH 2EICA 1RHFA 4TSAH 1JZ8A 3AGVA 2E76C 4NBZB 5IKCB 5DK0A 5FUOH 4FOMA 3VJ6A 4GW4B 2PPEA 2BMKA 4UBDD 4Y4HD 5GGUA 2W0KA 2WGNB 4KO5A 2B15A 5DZNA 4NIKB 2FUTA 4NZTL 4JANA 2A5UA 3UGXA 5E5MB 1PSKL 2FL5B 1FFRA 4PCTA 5D1QA 5CJQL 3EO1B 1I3RA 1P7BA 2H3NA 3VGHA 4NWTL 1IMHC 4TULL 5FM5O 1I82A 5I1EL 4UV7H 3DX9B 1OF2A 2ADIB 4IU3A 1M71B 2AK1H 4L5FE 4Z8FH 3ATFA 1TUPA 4S1DC 3J27A 2YSTA 1YO4A 5DJCB 4J1UA 2IBZX 2H9GA 2A9NH 3LN4A 3RGHA 5HHQA 1HZHH 1UWEH 1CFQB 5I66A 3S3CB 1T5XA 4CDGC 4N86A 2ADGB 4MCMA 3B9EA 2VNCA 4NYLB 1R5WA 4D94A 2WXGA 3UP6A 4QMEA 5F1OB 1KGWA 2BINA 4L8SA 1D7CA 4ZPTB 3GEFA 2JI3A 1SLXA 1OGPA 4HGMA 4TTDD 1NJ9B 3HZYB 1WPCA 5ICYB 4W9KC 1RZJH 4YHKH 2VDPH 5J1SC 1VFBB 4OLYH 5GZND 4G1MA 3VGAB 1NM9A 2XIIA 2W0FB 1R47A 2EDMA 4W9HC 4DEWA 1I9JH 4AENB 4FNTA 3QZPA 4WFGD 1AKJD 4YS4A 4G7YL 2BY1A 12E8L 1DLFL 3BESR 2PYEA 2E4FA 2R29H 1M05A 2GVYA 4EBQH 1CS6A 3C2AL 4G5ZL 3CFJA 1YY9C 4YHZH 5KSAB 3TT3H 5JXEA 1NFDA 5IVXA 2ZG2A 4XRCA 5D9SB 5JR1H 4AKQA 3K4AA 1JG9A 5T3XH 2DN7A 3EGSA 2FWUA 3FULA 2NMSA 5TDOA 2GT9A 1ADQA 1MCPL 4A55A 1QD0A 1KBVA 3L3IB 3KXFB 5F7BA 3MOAH 3PQYE 3QA3B 4ZDHB 1YZZA 4XMLH 4JFDB 3KPRD 4QLRA 3CHSA 2F1AA 3VG0H 2OSXA 5EOQH 5J13B 1SQMA 1U3YA 4P3WA 4MS6A 1MHEA 2WYTA 2JKLA 3EHBB 3LEVH 4YUEL 1AR1D 1PIGA 3MNZA 4JRYD 3L3DB 4PVMA 5B8CB 2PO6A 1INEH 3I6LD 4HJEA 1TO5A 3FUHA 4FFZH 2GHZA 1JNHB 3L1EA 3D0VB 5FO7B 1J88A 4IRJD 4ONGH 1OANA 5EZIL 2QKIA 4F27A 2VN7A 5GSVB 2EDXA 4ZW8A 1ASPA 1F90H 4RGOL 1TQVA 1VACB 4TNFA 2YLKA 3ARVA 4L4VB 1BREA 3NIFE 3X3GH 3MOBH 3WN5A 1S7QB 4R0LA 5GGRB 4ZX3A 1BM7A 1WQVT 2VQTA 3H4FA 4QRRE 3TFKD 3LXUX 1UD4A 2BIOA 2HH0H 3VXUB 2D3VA 1OP5H 4HAGA 1O6SB 3D7PA 1VFOA 4KI5F 4EI5C 1D5MB 1HSBB 5LNDA 1V7ML 1HVXA 3C6EA 4HHAA 3ABMB 1W8EA 5D7IE 4UIMA 3HIZA 4GXVL 3L1GA 4PJIE 4KROB 2P8PA 3VG9B 4YC2B 3QYMA 3OKDA 2FQEA 5TF1L 2JKSA 3N42B 1G7QB 5IVZA 4DP0X 2EH7L 1X5ZA 5LHDA 5D2NE 3WG7B 3EH4B 1NGWB 3B9DA 5I74C 4UQIM 4MB5A 5TQ0H 3HNTL 2YJQA 1DVZA 3KGUA 1RK0A 3QWOB 5E23A 1VEPA 1LLAA 1OAUH 1JDAA 2XWTA 2NR6C 4MYWB 1E90A 3NCYP 4NHCL 1B4JH 3CG8A 1CYGA 1T0OA 3PPSA 1NGPH 4FGMA 1VPOL 1AGBB 1GS6X 3RUGE 4OZGF 1YQ2A 4U6HA 3B9KB 2QVFB 4L8BA 1J5DA 4A63A 5C08D 1ZT7B 4FTVA 2IGLA 1K5NA 4HWBH 5DFVD 4NOBA 5CSGA 4QRSB 4BFOA 4PJAF 4DGYL 3RZCC 3I02B 2PXYD 5F6IC 2ICWJ 3OHXC 1UXWB 2BS9A 3QO0A 4PCSA 3W39A 3FO2A 3QDJE 2Y22A 5KVGL 2WLMA 1B0GB 5ADOL 2X0WA 3KBHE 4JM4L 1V3JA 5L7XH 2IAMB 4DP6X 1OQXA 2YD7A 1AI1H 4O5LL 3NK3A 1IE4A 3DHJA 4N85A 4O02H 2ICEC 2Q0ZX 2X6BA 4F33A 2B9BA 1A9EB 4MNQD 3GKZA 2PN5A 4F5CE 4IMKA 4KMTL 1FGVL 2XZCH 1UJTA 5BS0E 5GXBB 5I1HL 4BQ8A 4F8OA 1NMBL 5JOPE 1H6FA 3S37H 4QR7A 1RUMH 2D03L 4X7TA 2AXGA 2F74A 2X2JA 2H6OA 4KRLB 4N2MA 1UYWH 2AJSH 1S8DB 4OM0L 3MKGA 4RMVA 2OW6A 2XG5B 4OGXH 1AHWC 1RLWA 3WE1A 1OPGH 3HFML 3RY6A 1BG1A 4KHXL 2WJ7A 2RH0A 3SGJC 3EG9B 5DUPH 2Y25A 4LHUB 5ALCL 4JFXA 4Y9BA 1YYLH 1KLFA 4W9FC 3RWJA 4Y9CA 5EDXA 4GG8B 1PD1A 5IBLC 4AM0Q 3U4EA 3TBYB 2ZCKH 3HVNA 4ELKB 3LH2H 3QHFH 5CJ8A 1CN4A 4PJFF 1XCWA 4M6NL 3GSVA 3Q43A 1G6RL 3GMLB 3A4EA 3SJVB 3WFBH 2M8XA 3WIFA 2FHFA 3TN0B 4HH9A 5GJTL 3HB3D 1WA1X 2HVJA 4LDOB 2KDYA 1RVFL 2CBPA 1YPZA 3VD3A 4KK8D 5F44A 1PF3A 5EEUA 3I3DA 4OCYL 3STZA 5G5DA 3FO0H 4G8AC 4HDIA 3E1ZA 3ZYIA 2P26A 5JXAL 2VDOH 2XWBA 4XBEH 5GRZA 4KRNA 4FYTA 2DH3A 1BVZA 1JVKA 2Y7LA 4NRXA 5FYJL 4TOYH 1BJ1H 3ARDB 2E0PA 1RU9H 4LCCC 1GMIA 3S37L 1QG3A 4AQ1C 3GUTB 5F9DC 3BP5A 4AL8C 1KTRL 4G42B 1KB9J 2IWEA 1NLDH 3RB5A 4KJQC 2EO7A 3US9A 2G0KA 4RDQF 4L48A 3V0FA 4Y2OB 1FNEA 3JYCA 3IKKA 3CVIL 3O6FC 4U6XA 2IVFC 3BEVA 1HEHC 3KPSE 1N10A 4TM9A 4WUUE 5AALA 5KTEL 2J5WA 5D7JC 4PH8A 3L3HA 1NPNA 5HDBF 3P1VA 3X14A 2Z34A 5D2NC 3W0WE 3EOYG 4TN9A 2KI6A 2ICCA 2NY0D 3VTTA 1HT6A 5E03A 4NJAH 2VDRL 4LIQE 2DQGH 3GLEA 3FT0A 4EDWH 4IS6B 3C5SA 1PZSA 3LAFA 5IB4B 2AJXL 4NNXA 4J2QA 1KCVL 4E41B 1HHHB 4Z1PA 3D2UB 3UERA 1N6VA 1TZ8A 4K2UL 2D3NA 1BJ8A 4RGND 1E4WH 1U93B 1ECYA 2IH1A 2P8LB 3QWNA 5D70L 3FUEA 5DJZA 5MEPB 3ZQXA 4GIAA 1WIPA 1G6RB 1OGTA 2F53A 4N2KA 1PLCA 4NOFA 1QAWA 1VADB 2PPFA 4PBVC 1WA2X 3VFOA 2GBVA 2V2XB 1GKOA 4IKIA 5LWYH 1Y0LB 3ARQA 4NDMA 5INCB 3T0EB 3GMMB 2NQCA 3AM8C 4F57L 5JZ7D 3GS7A 1G9MC 1KT2B 1KCUH 3BUDA 4KY1L 4LPVA 4OZGE 5CEXB 4J6RL 4NQCD 1AZUA 1S4IA 1EJ8A 1E8YA 2NY2D 4JPIA 5DEGA 1S9YB 3VFPB 1MRCL 2R7EA 2A83A 3QHTC 1T7VA 3IMTA 3KDMA 4ZSOA 4EO5A 1AD9B 4UI2A 2WZPD 3DUSA 2VW4A 4JB9L 5LG6A 3LKNA 4JQXA 2C3VB 4LAJH 4G8EA 1KNOA 4GS7B 3SYOA 3IS1X 4QUOA 3HC0A 3LMJH 4E5XB 3EAKA 1YECH 4ZXBB 4JDTL 1QRNA 4ZS6D 1JF6A 4MJJA 1BQHA 1QNZH 5J7CC 2NCEA 1GS8A 1PIFA 5D7LE 3M1OA 4IGBC 4PJ7B 3BE1L 3S98A 2EYSA 5DLML 4WGVB 5I15L 5KJRL 3ZKNC 1CXEA 3ZMEA 4K7PX 2WV3A 2JJSC 3JTTA 3CX2A 1HXMA 4FQXB 3SHSA 3PPEA 2ZWNA 1KENL 2WHVA 4GRWH 4UT6L 5HYJB 3JWDH 2Y7OA 3KEHA 1U4EA 1DBJH 1WFMA 3MUY1 4KKNA 1IGIH 2XX0A 5EWIH 5IEHB 2X2HA 1HZKA 3X11B 3PDDA 5AVUB 4HWUA 5AAWA 2R2EB 4P4KB 4AGQA 3TBTA 4GQZA 5CGMA 4LSRH 3ELQA 3CFKB 5AOZA 1MW2A 4XC3H 2GJ6E 4PJFE 3O3EA 1FN4A 4XNZC 1T1ZA 2P46B 1DQLH 1JJUA 4EDXB 5I28A 5MENB 1OSPH 2V3DA 1EANA 3A5VA 1JXFA 2VLMD 4NFDA 4H0HB 1KJ2H 5LXGL 2ZPKL 1TCRA 1BWWA 4PJ9B 5GGVL 2L4OA 5DD5L 2GI7A 1EHLH 4U7KA 4ZS7L 2ZKXA 5E4AA 4DP1X 4HIIA 3MO1A 1T6WA 1NKOA 5I8CB 3DVFA 1KFAL 2Z35B 2VWEE 5EOCJ 3EJJX 4GBXB 5J6GB 3DROA 1KTKE 1QPPA 3GSNL 4AGMA 2D0HA 2PETA 3CFDB 2WOBA 3NEOA 3UROR 4PHZA 1FE8H 4PJGF 2V17L 3H2QA 4HKZA 4Y19A 5SWSE 2OK0H 5F7WC 3FO9A 3MODL 1EIBA 3DVIA 2XPYA 4O4YH 2CHZA 3MA9H 3UZVB 3GXFA 3QUYD 4NQVA 3L4TA 1UT2A 3ZUCA 2VZUA 4OB5L 1CD1A 3X1FA 2YD9A 1LMKA 3FT2A 3TVMD 4X98A 1BIIB 1NDTA 1T1YA 5D96B 1OPOA 2WKOA 5DVKA 3VFWB 1MFMA 4G80B 1XAUA 4AJ0A 4Z0BH 4Z7QB 2VUOA 2FX8L 3OAUH 5EN2A 3NAAH 5DS1A 4P23D 1Z5LA 5MEOB 3CLFL 3NJXA 1KC5L 1E7UA 4FLOA 2XG4A 3LRSA 2AMGA 3ZDXF 4WDIA 2B1OA 3QIBA 1MCJA 2MSPA 4ADGA 1RZIB 4KZCA 4AEHH 4X5WB 1E28A 3F01A 4HUVB 5E6UB 1CO1A 3G7TA 5GGRY 5CF3A 4X8XA 3BCDA 3K72A 4TVUA 1RP9A 1YNTF 4U1HA 5CP3A 3HHRB 2OXHA 2QT6A 5FK9A 3V4VH 3LV3A 4FKEA 4KVNH 4BE6A 1QBAA 1F00I 4X7SL 5FIEA 2F5AH 4ODVL 5FW6A 5BZDB 4HK3N 2F19L 3O0LA 1CE6A 1A6ZA 1E27B 1UM6H 4L9DA 4WKZB 2FTAA 4MQSB 2BSRB 4DVRH 1B9ZA 4KJWD 2CXKA 1ZS2A 4JZJA 2BOLA 2VW6A 3NCFB 4ESKA 1XH0A 3QUZD 1A3QA 4GRWF 3GSNB 4MXWL 2AQ3A 3C5ZB 1MREL 2EH8L 5MERB 1RUPH 2FZ3B 1I9IL 3EYUH 4M02A 1A0QH 4DF9A 1QQDB 3Q6GL 3FFOA 4WW2F 5DO2D 4Z7NE 1I3VA 1NGXA 4IKJA 1JPTL 4UQCA 3QJRB 2PWFA 2XWZA 3CLEL 3FOMA 3ZL1A 1IC4H 2PKDA 25C8L 3P4OB 4HLZH 4ANUA 3EOBA 1MVFA 1P5UA 2LU4A 4HUCA 1AP2A 5FGBA 3VO0A 4BKSC 5H37A 5L8JB 5M94B 1IFHL 1FBIH 2DICA 2P5EA 4NIYE 1ACYL 1KCBA 1V10A 3GRWL 3ZKXC 1JGUH 3O9WA 3QJOA 1BQKA 4WK2B 1C5BL 4P2QA 1PLGH 3BPCB 2P4AB 3PL6D 1YNLL 2O6CA 3L5HA 4KQ3H 4E9WA 5FKAB 2HLAA 2LE9A 5BQ7B 4Z78A 1CGSH 3TA4D 1I1AA 2VDLL 4XPGH 4BCXA 4FXKA 2Q76A 1OOWA 1NLBL 2I24N 1EEUA 5A3IC 1IM9A 3DPBB 5T1DL 4LGRB 4XNAA 3D51A 1PKQE 5HHVL 4FZ8L 1S2EA 5FXCH 5LBSH 5F72S 4KMLB 3V52H 2ORBH 1EGJH 2TSAA 1WT5C 2APVA 5ICXA 1HYRC 2EDTA 1F3JB 3GSXA 3VAEA 2YRPA 2HKFL 2JLPA 4W9CC 3E8VA 1BBDH 2XSKA 4JG1H 4U1NB 3MV8B 1LK2B 4OZIF 1IILE 1MW0A 2K0RA 5KSBB 3OPZL 4AG4L 4L0PB 1BFTA 4GI9A 3S3BB 3SBQA 5DJ8B 3WY2A 4P2OB 5ICZA 2PWDA 5CBEA 1ZE3C 1I7RA 5ANMB 2IWFA 1BZ7A 1R19A 1DBKH 2VERA 2BVTA 1I7TA 5DD3H 1A7OH 4CKVX 2AFNA 3WIIH 2YAPA 4KK6D 3BPNB 3RRQA 3O2WH 1PU0A 4G1EB 2CRYA 1IGCL 3MRKA 2HB0A 5FOBA 1X5YA 5TDNB 3EDKA 4HCRA 4QHLA 4XODA 5IW6B 4R5TA 4JFPB 2ZXWB 1LO0H 1YN7A 5AW2B 3ARBD 2DLEA 2IQ9L 3GSWB 3QDME 2K4WA 3IDIA 4HJ1A 3D39A 3UTZB 4JY4A 5I8KL 3T4AC 1F97A 1S7RA 2WQXA 5F8QC 4FHJA 4G6JL 2VDLB 4PIBA 2AP2A 3EFFA 5F89A 3LQAH 4C83A 2X1QA 1I8LC 1ZANH 5ANHA 5J3HC 4ENZA 3RU8H 3V0HA 4M7LT 4Y16B 5JW3L 3NA4A 2X70B 4NJ9H 2OR7A 1S3KH 1MIEH 4U7SA 1OD7A 3SZ6A 2P49B 3NJFA 1JMXA 1M1XA 3IMUA 5HYQA 3HAEB 4P59L 2DIBA 2ICWA 5I24A 1BVNT 1DR9A 2FGZA 3CVHH 1KCLA 3QAZC 5IBTH 2J8OA 3TNMA 2YAEA 3LIUA 3TM6A 3ZE1E 1JYWA 2WLLB 5I1IH 3KVQA 43C9B 3SPCA 4R90L 5DURB 3TBSA 3RJOA 4UT7L 3GHPA 3EZJB 4H8PA 2HLFC 2BOCB 2IGFH 2J43A 3IGAA 1GY1A 2ZUWA 5K69A 4PVBA 2B14A 4OI7A 2KC0A 1CT8A 2HUEA 2XZQL 4MQTB 5IR1B 3MRGB 3U7WL 1DQIA 4A6YB 3DHPA 4JM0A 1S7TA 2NX5A 1ACZA 1CK0H 4LVEA 1NDGB 1IEBA 3ZYOA 5FCSH 1Q9KB 1CMOA 1SMOA 5HDWA 4X4KA 4PRAA 3IBOA 5J6HA 4AT6A 5DC2A 3IRCA 1UQSB 4MJ2A 2EVIA 1MW3A 1NPUA 3KGSA 1WBZB 5ECJE 1U8CA 3MV01 2WXKA 1KEMH 2YAMA 4JFFE 4UUJA 2ODIA 3CXDH 5IW3A 1HH6A 5ALBH 1UZ6F 2PWEA 3DDFA 4MJHA 5FYKL 5JIIA 3LNDA 4FERA 2VLKA 1ZIAA 2VZ1A 4HPOH 2CMRL 3KYMA 4RRPM 5C0DB 2JKJA 4L3FA 5CCKH 1UADC 4HS6B 3UTTE 1J8HE 2FT7A 1ZHNA 2XOTA 4RCAA 5FFGA 2CNZA 1P1ZB 4FFYH 3N6YA 5IWLC 1OT4A 5AKRA 1X5AA 4FTDA 4BDVB 2DMKA 4Y2DB 4NEHB 5DHMC 5KYUB 2XC8A 2WVVB 4ENEC 3KEDA 4JM2A 3INUH 5KUMA 3L13A 4PJEF 5GPRA 3T3ME 2TRYA 3BSGA 3WYRA 5DA4A 1XCQB 3BKCH 2B08A 1GZPB 5HJDA 1NBYB 5E6IB 5JPMA 3S8WA 4M7LL 3QIUA 4WJ5B 3T8MA 3FJTA 5I0YA 2ZE0A 3QXTA 2AKRA 3Q6FB 3QPXH 4YK4B 3SQBA 2BWDA 1UG9A 3IGLA 1GGCL 5GRWA 1LP9B 4M8VA 2V7HB 3BKJH 1AZRA 4GT0A 3BGFC 4MZRA 2C7UB 1QFHA 5SX4H 4RAVB 3KLHC 1A7RH 3INOA 1U3HB 2AK4E 4YVNA 2HT4C 4HALA 3RDJA 2MCMA 5IW1B 4N9GB 2P5WD 2WD0A 5EUKA 5ETUA 1A6AB 1PZ2A 1GYUA 2F6AA 1VCBC 2YPLB 4YDLC 1MFEH 4AYFA 5JIQA 1W72H 5FA3B 4KH2A 3GBML 4PB0H 1EMTL 3HC3H 2P80D 2M1KA 4H7VA 1JWUA 4JPSA 1IBBA 3FSAA 4P49A 3ARGD 3FN3A 4ZUSA 3CMGA 3RX5A 1MQKL 2VLLA 3BSHA 1N0XH 2MCPL 3W11C 3MJ6A 4LF3A 3IJSB 1NEPA 2X41A 1SN5A 3ALPA 1ZOXA 1IFRA 4PWGA 3VWKB 3U48A 2ZIDA 2RFXB 4NP9A 4OUUB 4X6CB 5JDSA 1YY9D 5GGTL 4HAFA 3SPHA 5I17A 4JBSA 5KG9A 4H88H 3VFGH 2GSIB 2NY3C 1H3VA 2GJZA 3GB7B 4Z7OF 3BP4B 3SDAA 1EVTC 5BCAA 1KIUA 4E9LA 4TL4A 1MWAH 2KZBA 3LTVA 4TSBL 4FP8L 1PCXA 1RZFL 4JKPL 4NM8L 3AWFA 3GT6A 3FQWA 5EEZA 3WELA 3VJ6B 1XX9C 4JFED 4ODTL 4QRPA 4DTGL 5I6KA 2R29A 2H32H 2YRZA 1YJDL 4Z7UB 3TCTA 5FUZL 2H3NB 2ZCLL 3R4RA 4MA1B 4JPWH 3CVDA 3NJLA 2E7HA 2V8MA 1OM3H 1ZXQA 3SE9H 5F7YC 2XQBH 4M03A 2YFOA 1OF2B 3QG6A 2HJLA 5CZRA 4GEIA 4LHUG 3TZVB 2DEYX 3ESOA 4WY7L 3VQLA 1KJVA 4R26H 4WW2C 1QLFB 3ECVA 3PWUA 2H9GB 4ONFH 5T3ZL 3V5KA 1UUSA 3LN4B 2DBLH 4EI5D 5EBLB 4PRHE 3IBEA 3V4LA 3ES6B 1FNGB 2FCBA 3OGCA 3MGOA 1AGCB 4XB7A 4DQOL 4HJGA 1FP5A 4LB8A 2ZUUA 2NYYC 3S35H 1R5WB 3AG2B 3KG5A 3V0IA 3ZKSD 4FQHB 5IHUL 1TDQA 5GGVY 3NSYA 4B5ZA 3S34L 3QVAA 4ZAKB 4JFYA 4U05A 4BRVA 5C0FA 3QRLA 1DBML 2OMWA 1GJIA 2KZWA 3BXNA 4CDHA 4N2GA 1FZMB 1U6AL 4ZFZB 2IEPA 3CN2A 2MKWA 4TNVK 4FFVC 4K73A 3C08H 2ZXGA 2ZJSH 1AAJA 2KKQA 2Z8WC 3KWWB 3JVFC 2BIPA 4LSVL 4PB9L 3NJKA 3B4NA 1E5BA 3ILDA 4EKXA 4H0IA 4OQTH 3IEAA 4FKKA 4FXGC 2TAAA 4HETA 1MXDA 3EFDH 3MLWH 1WZ1H 3EOTH 4Y4HA 1KYOK 1EAPA 1MCQA 3E80A 4CN6A 1JMZA 1KLGA 5CZVL 3I2CH 3RWHA 4UYPA 3IJ7A 4KMQA 3Q9QA 4EKJA 1CFMA 3RE0A 4OFQA 1WBYB 5CBAB 1NFDB 5IVXB 4XRCB 4IBUA 4TTGA 2AZUA 5TDOB 4J8RA 3K6OA 2GT9B 1HCFX 3B34A 1FYTE 2KQNA 4TQPA 2GPZA 3SB3A 4LDLB 3T1FA 1P9MA 1G5AA 2A1WH 1GTFA 1N19A 3GI8L 1E5UI 1F41A 3VW3H 4JFWA 1EUTA 2PYFB 3BP7A 3ULUE 1BYNA 1D6VL 2ARJB 3QRGH 3ZDYF 1N7ML 3BKYL 4OV6F 4X5XA 4I3RL 4FX5A 3K80A 2OL3H 1K8IB 2PR4L 3QXDA 1XIWA 2PO6B 4OZHF 3CLWA 4W70A 2NLJA 4DN3L 2WIMA 2SEBB 1B90A 5IROC 3WS6C 2G2RB 5IMOB 1E2VA 3LEXA 1FSKC 3FUFA 2KPWA 4ZMAT 3KGRA 4HWBA 1MJUH 2OTUB 1AQKL 1HHGB 4DPRA 4OSUH 3L9RA 2G60L 4KDVA 4R0LB 3BZFB 3HR5A 5E2VH 4XOAA 3UCRA 2FLBT 3ZO9A 4Q2ZA 1M57B 4XCYB 4YFDB 2EDYA 4LVHC 1I53A 1VGKA 4PP1C 1SOSA 1E42A 3QWQB 5K9OA 2ZAHA 3FOLA 3F3HA 5I1CH 4XPHH 4O02A 1RL1A 2DYRB 4U1KA 1FCGA 3PQYD 5IVZB 5IBLD 3DVGA 1QBLH 3QQ9C 4H20L 3E6FA 4BEIA 1QI5A 3BYTA 4Z7OE 1IFGA 2X28A 4KKAC 4LQFH 2EEFA 3EGDA 2XXGA 1U4FA 4IBWA 4E5XG 2XWTB 4KJPD 3TL5A 1T1WB 3ARFD 1VZGA 1EVUA 3RNKB 1S9VB 4Y9FA 4R4BA 4U4BA 5FUZH 3D09A 4JRYA 1C5CH 3LXAA 2C34A 5BVPH 5F1NB 2XJLA 4IJ3B 5C0JA 4R8WH 3OKEA 1J9CT 2EC8A 5E2WH 5B3JF 4X0KB 3KR3L 4IRJA 2B9AA 3V6FB 2YQ3A 4QRRD 4HUKB 4YH6A 1IAOB 3MGTA 4JMXA 2CCWA 3BJ91 2V5SA 5HHXL 5B1JC 5C92A 3WAKA 5TGBB 4HSCX 2XETA 2XPGB 1R5VA 4M5TA 2EIJB 4FJYA 1NCGA 3BUIA 3CXFA 2IPKB 5KBPA 2X2UA 2FLRT 1ITCA 3VXOB 2NW2A 4QWWD 1UA6L 2DQDH 3KWTA 5ABDE 3D25A 3HZKA 2B39A 5D7JD 5E56A 4GAYA 3FQRB 3DC0A 4M6AA 2ZOOA 2Q3ZA 1A21A 2YEZA 2YUWA 3PHAA 2NY4D 4F7EB 5CEZE 2AAAA 2NDGA 4POYA 4NFCA 1SHWA 3OZ9H 4A7VA 2CR3A 5DMIH 4TNWK 1NC4D 4KKZA 3WIHA 3RFZA 2RB8A 4M6ML 1J9RA 2BNQE 2AXGB 4M93B 3UTQA 4W6XB 4D0BA 1TOXA 4G8GE 3ATEA 3D9AL 4KV5E 3RVXC 1T7XA 1F3RB 2B4CH 4NC0B 5B39A 3QRBA 1C12A 1U8NA 4UQ2A 3ALWA 5HI5C 2J20A 4Z5RB 4LOFA 4Y4FA 1M2OA 4FNUA 1T4KA 1XDTT 3T8XA 4EMZA 1NBVH 4EUPH 3K2UL 3OQRA 4WWID 2V3FA 4JFXB 4Z77A 5CJXA 4H13C 3L81A 3MLYH 3H3KA 1H8OA 2DEXX 2VDMH 4U2ZA 4F37K 5C0AB 2I69A 3EO9H 5GJSL 3U4EB 3QDJD 2ZXCA 4ZMYA 3MI6A 1EHXA 2YKLH 4N6QA 5HGDA 5FYJU 3HN8A 4H40A 3ULUC 4MD4A 4M1GH 4XWOD 3GSVB 4GUCA 1MN4A 1DLHA 3EF4A 3MLUH 2KHAA 2GEEA 4IBTA 1MFCL 2QVTA 1A14L 4PQXA 2X05A 1MCCA 4PJGA 3RJQB 1NA8A 3FB8A 1XWVA 2YMOA 4LASL 1N64H 4I4WB 1HILA 5BS0D 3NFNB 7PAZA 5JOPD 5IG7A 2XWBB 4HUMB 2X3CA 5BMFL 5JIMA 4IGBD 2DWEA 2OAAA 2CHWA 1SJHA 3IF1B 3FONA 3GGWB 3Q05A 4W68A 1VEOA 4LESA 4CBZA 1BMGA 4TS6A 1LQSR 3TT1L 1ZDQA 3AREA 4WCYL 4NHUA 2CJUL 1MCSA 3QIWB 1R75A 1ZV9A 3SE8H 1ZT4A 3BAJA 5ADPL 1KELH 2AJZB 2WYIA 5GRXG 3BEVB 1ZTXH 2V3EA 4GRLC 4R97C 1XD0A 2QR0A 4XX1E 3L3HB 5LBGA 3GSOB 3LDBB 2ESVE 2VZOA 2X7LA 3OXSA 5K1JA 1DDTA 2JWYA 4XNXL 3L3JA 4WSGA 3WEMA 2ENYA 1P1VA 3E3QC 4LO9A 5ESQA 4F7CB 1RUKH 2MPVA 2OMUA 4NC2B 3SE3A 5KS9A 3DV6B 1NBZA 2GC7C 2C9VA 4JG5A 1F58L 3D05A 1NOFA 1QSFA 3C5SB 3V4UH 5KVMC 4NNXB 4YGAB 5IY5B 1NWOA 1BECA 1ZJAA 4HG4K 1XF3A 2IH1B 3UP1A 3HG2A 4ZG1A 3S4SG 1DBBH 2HTLC 4PIRF 4XO3A 4W9LC 4FNSA 3FQNA 4BUQA 1AXIB 3WMQA 4OCWL 2WVSA 3UFIA 1U3ZA 4DOHB 2WPGA 3K8LA 3OSKA 4LAQH 4FQCL 3ZK0A 4ZMXA 1E8XA 1U8KA 2AJ3A 5B3JE 4LEBA 2FATL 5EBMA 4FI7A 5C09E 2GYSA 4B97A 5DZJA 1FRGH 4P5RA 1ZSDA 2VLJE 4WGKA 3TP4A 1DJHA 2J3SA 2Y24A 5BRPA 1TYRA 2O30A 1JZ2A 2JB6A 4XBPA 1YUHB 4WUUD 3GS0A 1DQTA 1DE4A 1V7NH 3CIQA 3CZFA 1CF8L 4V2CB 3ULVH 3BN9C 1M7UA 4GP8B 1L9OA 2AV1B 3W0WD 4ZOBA 4G8EB 3THMH 1PAMA 4OLXL 1KJ2A 3IKCB 1KNOB 2ZKMX 3JTSA 2MHAA 5AAMA 5B21A 4H1LG 4NRYB 1OWWA 3WKNA 4LSTH 5FDYA 1BQHB 1DVFD 2FUQA 4HUWA 4HKXA 1GZHC 1M1SA 4AVJA 4P9HL 5KANI 3B5GA 1G7IB 1PY4A 4NUMA 5IF0A 3NIGF 2EYSB 5JW4M 3IMBA 3ELAT 2V6HA 3T4YA 4LLVA 1X6LA 4MB1A 3HE6C 3PHOA 4XVSL 1DSFL 2NNCA 3LKRA 3V0DA 1T7ZA 2DLFL 3VRLF 1BFVH 3N44F 4O00A 2PTTA 3GRBA 3WTXA 1E2WA 1GGBH 2PABA 2EDHA 1I7UB 4G7RB 4HCIA 4UNVA 3CSFA 4GRMB 1IQWL 3AROA 4YSPA 2IWGA 1S9WA 4Z7VF 3KLAA 5D8JL 3GPEA 1MHCA 1QYGL 4CC1A 3TBTB 1DJYA 3P11H 4OJYA 4JDEA 4F2ME 1SEQL 1WZAA 4CL7A 2YQGA 5IMLA 1QASA 1QFWI 2IFGA 2VAJA 1PX4A 5GRUH 3O3EB 3B8SA 2WZPA 1FLTX 4WNSA 4UTAH 5JHDB 5CLZA 4XP4H 1XL4A 2F68X 2Y06L 7FABL 2KL6A 4N24A 3V4VA 5D7LD 3X1EA 2M26A 5GS3A 5DEJA 2GKIA 1GOFA 2OR8A 3FYIB 4KXZI 1BA9A 2AABL 3DVNA 1TJGH 3H2WA 5F7UA 3D52A 4WSKA 4N9OB 3S5ZA 2VZ3A 3HAEG 2WLKA 3AACA 3U1PA 4G6ML 1N0LB 1FZOB 5HTSA 4LCWA 3VFSB 2XA3A 1NCAL 4PG9B 5DHXB 3OMAB 1X9UA 4B9IA 2W9EL 4F24A 1JE6A 3PAVA 4FJ6A 3N41B 4TQEH 1KPUB 2M83A 3P69A 1ML0A 2Y36H 4X98B 1I8MB 4MAYC 3G6JA 3P2DA 1N70A 1SBSH 4R6UA 5I74B 4PJCF 3TYGH 5L88L 2W8CA 3LRSB 2GJ6D 3QIBB 1AS7A 4MD5B 4PJHE 1EDYA 2YGPA 3ULVF 1CYXA 3F6JA 3LVTA 1F1AA 5F93C 3JWOH 4NS0A 1TKWB 5I9QB 3WCYA 3T6QC 1GGYA 2DM3A 3WUWA 3FHAA 3LZFL 2HX8A 4FZEH 3K1KC 1OW0C 1Q4NX 3V6ZA 2OJEB 1E4XH 5BZXA 1A3RH 4R84A 1HOCB 3LV3B 4KAQH 1IV8A 3QULB 2IANE 1ES0A 3VFMB 1UVQA 4A37A 3O3AA 1A6ZB 3RZCB 1HHKA 5IT2L 5SWSD 1RZGB 3JT0A 5F6IB 2R4SL 3OHXB 1IC5L 4PTUB 5D1ZC 4AYBA 5E8PA 1MXGA 1AQHA 5BV7H 2E3VA 4QLWA 4TUOA 2Q3AA 3K74B 4FAAB 5AENA 4JLRA 4Y7MA 4Q6IC 5LBSA 4M7JL 1U8MA 3QZWA 1BCIA 4ZD3L 4NQSA 3SDXB 5I71C 3QUYA 1EGJA 1FFQA 2D3JA 3QORD 2EDLA 2JSFA 4MQ7A 1KIPA 3KCPA 1ZT1A 3IMWA 4KVCL 2ZUTA 2ZONA 4WAFA 2HWZL 4N0FB 1FL3A 1VIWA 2BNRD 1YEGL 3FOMB 4HK0A 3T3PB 2FBJH 1DUYA 3NSJA 1JPST 1OARL 3FF7A 1N68A 1P5UB 3DXAB 3N04A 5AZEL 4OV5A 5DUBB 3OB0H 3HNSL 4M3JA 5B7FA 2OZ4H 1AHWB 1H3PH 4NWUL 2W88A 5J3HD 5AKVA 3PP4H 1T89A 2JTYA 3N43F 3DYPA 4XWGH 4ZO7A 4KRPC 4G43B 4BA0A 3U0TA 5K9KA 3M1BB <