4IQHA

Crystal structure analysis of dysferlin c2a variant 1 (c2av1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
128
structure length
128
Chain Sequence
b'ITHMLACLLVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dysferlin
publication title Alternate Splicing of Dysferlin C2A Confers Ca(2+)-Dependent and Ca(2+)-Independent Binding for Membrane Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 22
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4iqhA00
2ISDA 2NSQA 4LT7A 4WWPA 3SD5A 3QJZA 1W16A 3L08A 2CJTA 2ZKMX 4EZJA 2Q0ZX 4OVVA 4FJYA 2WXQA 4PS3A 1DJIA 4QJ4B 4WWOA 4TUUA 1UOWA 2WXJA 3B7YA 1E8ZA 3CSTA 3L16A 3QAQA 3GPEA 5H4YA 4F92B 5EDSA 1CJYA 5CCJA 1K5WA 4DNLA 1BCIA 2WXPA 3F04A 1A25A 3MJWA 4JPSA 3T8MA 4Y1SA 3FDWA 4BGDA 2WXOA 3QR0A 3PREA 3RPBA 4URKA 4LCVA 2R83A 2WXHA 4L1BA 5G2NA 5CCGE 2NCEA 1E90A 2RD0A 3APDA 2K45A 3QK0A 2UZPA 4G11A 5CCHE 4HLEA 4AJWA 4FLHA 3L9BA 3QARA 3F00A 3LJ3A 4QJ3B 2K8MA 2ENJA 1YRKA 3RDJA 4XE0A 4ANWA 3NZSA 1QASA 1W15A 3PYCA 3IM1A 4EZLA 2CHDA 1RLWA 3L54A 3NZUA 4KZCA 5JHBA 4FHKA 3ZIMA 2A5UA 3ZW3A 3L17A 1WFJA 2K3HA 3QR1A 1QATA 1DJZA 4DK5A 3F01A 3PS6A 2K4AA 4WWNA 1E8XA 4EZKA 1E7UA 3TJPA 4FHJA 1WFMA 1GMIA 4NPKA 3W56A 4F93B 2DMGA 3DPDA 2WXIA 2B3RA 3FBKA 1DJHA 4FULA 1E8WA 2WXNA 4XZ4A 3PRZA 2ENQA 1E7VA 2DMHA 2Y3AA 4FJZA 4KZ0A 1TJXA 1DJGA 1HE8A 4QAMB 4TS6A 3TL5A 3ML9A 3HIZA 3APCA 4GNKB 2WXLA 2YRBA 3CSFA 3P2BA 1DQVA 4ANVA 2WXGA 2KI6A 4XX5A 4AOFA 4L23A 1RSYA 4WAFA 4J6IA 5G55A 3ZVVA 4F91B 1BYNA 2D8KA 4MJJA 3R7QA 3F05A 2CHZA 2LHAA 4QJ5B 3IBEA 4ANUA 5H4ZA 2CM5A 5KJ7E 1TJMA 2CHWA 3L4CA 2V4LA 4GB9A 4IQHA 4PS8A 1V27A 5T8IA 1DJYA 4L1LA 3TWYA 2FK9A 4F1SA 2Z0UA 4PS7A 4TV3A 3OHMB 4HVBA 4OVUA 4ICWA 4L2YA 5JHAA 3N5AA 2QZQA 2WXMA 4NPJA 1DJWA 1DSYA 2CHXA 3S2AA 3HHMA 2WXKA 2N1TE 2CM6A 2X38A 3ML8A 3OAWA 4FA6A 3KWTA 1UGKA 1E8YA 3JZYA 3R7RA 1UOVA 4Y1TA 2A4ZA 4IHBA 1BDYA 4LDCA 4FADA 2Q3XA 2WXRA 4A55A 2NQ3A 2FJUB 3HN8A 3ENEA 3L13A 3M7FB 3PFQA 4KITB 3KWUA 2JQZA 4BFRA 3APFA 4WEEA 4NS0A 2WXFA 2CJSA 1DJXA 3W57A 4NP9A 1RH8A 2YOAA 2EP6A 2QZ5A 4ICXA 3NSJA 4ANXA 2ENPA 2BWQA 4V11A 3DBSA
chains in the Genus database with same CATH superfamily
2FJSA 3JTSA 3GXNA 2QVIA 3GSOA 1FE8H 2GUOA 4PRPA 2ZKMX 2OYKA 2Q86B 2DQUH 2HG0A 4UU9B 1AR2A 1KEML 3GJFH 3LKSA 3CSTA 4M5YL 1YJDL 3IDIB 3ZDXE 2F7PA 4LEOB 3ARUA 5DDHB 4OFPA 5FXCH 3U1SH 3L6FB 5FGCE 3MR9B 2COVD 3EO0A 3VYNA 1IM9B 2OKMA 5HJDA 2Z31A 4LLYA 4Y2OB 1I9IL 2WCSA 3UP6A 2Y5TB 5FC9A 2BRQA 1AMYA 3S4SB 5JA8B 3MJGX 4MJID 3FMGH 1T04A 1XF1A 4HQQL 1P5UB 4JQIA 1KBKA 3MLPA 1A65A 3TM6A 4N5UA 3P0GB 3WY3A 5TQ0H 3MRLA 2CO7B 3IMRA 2DLTA 2AK4D 1OAKL 3HRZB 3KLLA 1DANU 1HK6A 1UEYA 3FF8A 5GGRY 2Y25A 3KPRB 1T0NB 3CVHH 4NGHL 4PJBB 4NIYE 5MEQB 1JD9A 4PI0A 3U4BL 3KJ4B 4MDJA 4LQFL 1PZ5B 2O26U 1BQSA 2Y72A 1E8WA 3IFLH 1VZIA 2HTKD 4OLWH 2VRQA 4KNUA 1KG0A 4L23A 4Z7WE 4NJ9L 4WHTB 5FOBB 2GT9A 2VLRB 3GUTB 5E2UH 5GGQL 4X6BB 2ARJB 2FWOA 2IALA 2QGEA 1EO8H 3MBED 1BM7A 4H8WC 3I75B 5DC2A 2ZJSH 1FFOB 3UO1H 3K81A 5BVPL 2HTKC 2QZQA 4PS4L 4N2OA 2ZX5A 3DX8A 2EEXA 1C08A 4N9OB 4U1HA 2LE9A 4WV1B 3QIUA 4Z7WA 4IU2B 2WAHA 4PRIE 4ONGH 3GPSA 3G6DH 4RAUA 2HFEB 1CLYL 3HC0A 4G6KL 3FW6A 1IBHA 3TEUA 1FHNA 4JM4H 1L6XA 2CG9X 3V6FB 5KG9A 3BISA 3EG9B 5E5UB 2BM3A 3MBEC 2EP6A 4OCMC 2AV1B 3LX9A 3EJSA 2I25N 1VIWA 2BIMA 3EJQA 4H26A 4E42A 3LRHA 2BIIA 1W6LA 2WLYA 3OJMB 1NGYA 5I15L 2JMRA 4JZOA 4KKLD 4IIQC 4OM1L 3WL9A 4F7EA 4KXDA 3V10A 3DSFH 2GQHA 4PRIA 1CT8B 5EEZA 3MOQA 3FHAA 2J43A 1U8LB 3F7LA 4FLSA 5GSRB 3UYPA 5JMOC 5LQBL 4LHUB 1DN0A 5I30L 1CTOA 3L3JB 3DX7B 3QQDA 3GLEA 1BYPA 5DMIH 5TH2B 4MA7L 4XBEH 4V1DB 2WQWA 5IVNA 3MRBB 3GZPA 1K8IA 2PR9A 4L5FE 3OXRB 2A1WL 2PCFB 2QLYA 4ONFH 4LL4A 4YHIA 4DZBA 1MCLA 5F3HB 5IB4B 1E65A 4AG4H 4KKLC 3ARSA 4PUBL 4UDUA 2JJTA 2VUYA 2JELL 5CLYA 3BI9X 4MXWL 3SB3A 3DVFA 4NLHA 1UZGA 3D50A 3MJ8A 3OQRA 4DKFL 2YC1B 3FXIC 1BG1A 4LEXH 4CJ0A 4WI7A 1ZA6B 5EEXA 3W11D 2K70A 4PW3A 4IEFA 4IU3B 1GHFH 3VFOA 4P06A 4WW2F 3QXWA 4M43L 1DQMH 3NSCA 1EZUA 1W80A 3SKOA 5L4IA 1BXXA 4OLZH 4UT9H 2MNUA 2EH7L 4Z7VB 5GGUB 2VCOA 3MROB 3O9WA 2FJHA 1FLRH 4I89A 1UA7A 4FYSA 4MYPA 1IGYB 4N8CH 4XCYA 4DW2H 2VMEA 1DJGA 1ZGLM 3SE4C 1I7TA 1KTBA 3KL5A 5GRXG 5TDOA 2AV7A 4DP2X 1FPTH 2X1PA 4MDIA 3W11C 4Y4KD 3STZB 1UM6L 1JZ5A 1MIMH 2APWA 1QLEB 3PHOB 3KLHD 2CDEA 4JRFA 1HHJB 3UCQA 2H47C 3NDZE 4KO9A 3MLVL 4PJXF 3CLFH 3TVMA 5AALA 3I74A 4U1IA 2FGWL 4NRYB 3ZL2A 4RGOH 2W9LA 1KJ2H 4P2RE 4QYOB 5F6IB 1FH5H 5F7NC 1E4KA 3MLYH 1DANT 4BKLA 4IGBB 4WVRA 2NY6D 4HKXB 5CN1A 1MNUH 2J57A 5DZ9A 4ZUVA 5CEZD 2K6YA 1BAWA 1R19A 1T21B 3VXMD 4Y4KC 5FGRA 3RFZC 1P84K 4YDJA 1T20B 5EU6D 4QXGL 3C75A 3TU6A 3IVKB 3KLHC 1NBYB 3PABA 3QB7C 4G6JL 3MYJA 4ZMZA 1RSFA 2FR4A 3LH2L 1XIWD 3BUTA 4FQHA 2CJSA 3IU4H 4P2RA 5MHSE 2VDOH 4NSKB 3BDYH 3VUAA 4FQPA 3ZR6A 4A2LA 1ID2A 4MB4A 2NY6C 4J12A 3X1BA 1JNJA 4KNTA 1GKEA 2VKXA 4OJCA 4M5SA 4QOKD 4PJGA 2FD6H 1T0OA 5A1AA 2EDEA 1XR9A 5EEUA 5EEVA 1A1NA 1AS8A 2I5YH 1KXTA 1ZIAA 2RIKA 1F3DJ 1QWHA 1XIWC 2WQUA 2XDHA 2EO7A 3VXSE 3B9DA 4YDIH 3M86A 3MNVB 5DRZB 2DJSA 3GEWB 5EOCL 1D2OA 3DECA 1XF5A 3DV4A 3FFCE 4U0QB 1N8OE 3KPQA 3SO5A 3IJ8A 5ESVA 5T1MA 3DYOA 4FZEL 1BQUA 2AS5M 3ZE2B 1I8MA 1T80A 3K46A 1QI4A 1QASA 1J8HB 2QTVA 5T1KB 2JH2A 5D71H 3H0TA 2O72A 3FUKA 5IHWA 3VXSA 4ZTOH 2ZAHA 1A7BA 1HOEA 2KZKA 4KOCA 1XF4A 3IDJA 3AW5A 4FQLL 1SXBA 4Z3GA 4FG6D 1QA9A 1LD9B 2EH8L 1JPFB 3FFCA 3OAZK 1GIGH 5BNXD 2ZWSA 3BVTA 4GRMB 4PTUA 5E56A 4EUPA 3D2UA 4N9GA 1B4JL 2ZP0T 4GH7B 1IKOP 1P53A 3BPNC 4S2SB 5GISH 1MREL 4M56A 5JXEA 4QD2E 5T33H 5J1TC 4TUJA 2J8OA 3DX6A 3H7LA 4NCC1 1JYWA 1P7QD 3OWEA 1TPXB 5GXBB 3NZ8A 2R2BB 4RESB 1ORSB 3LOWA 2OMUB 5B4MC 1WCQA 5AW3B 4O2EB 4JFDB 3RUGF 3ZVVA 1HC1A 2VM3A 3K3QA 4J3UA 1IAIH 4JFHD 1JZ7A 2XX1A 4JO2L 1UQSA 1AXSB 1KCSL 3GB7B 4NBXB 1GGYA 1Z3GH 3BKMH 2EDDA 4UT6L 5DJCB 3GSQA 5T8IA 3RWEB 3W5NA 3LN5B 4WO4B 4HUVA 3SSGA 4ZXBB 5JHAA 3H6AA 1BAFL 3MACL 4Z0XA 1U8NA 4WJKB 1A7PL 4YQXH 1SOQA 3HMXA 2NY1B 3JWNE 3L3IB 5FLUA 4G8FA 3A4DA 1SN0A 5HHOD 3WJLA 4BDVA 4MLIA 4YDKL 3IDGA 2DTMH 3WLWD 4WKZA 3I6LD 2OMXB 5K5YA 2AITA 3L3KA 2QQNL 2AP2A 4MKTA 5DD0H 1BLNB 3PWPE 4E9YA 2AGJL 3ZHFA 3DTDA 2OI9B 1E9QA 1E6OH 2LW3A 4XPFL 4XP9L 1ZT4A 3G5XB 5DUMH 5HGAB 2V5RA 4HFWA 4UQBA 3ETSA 2OA9A 2JV6A 1AIFB 3L5XH 7FABL 5JOFB 2ROXA 3UBXI 4K2UL 3MXVL 5FEBA 5JPMB 4XP4H 2OXHA 5DQDH 1UYWH 2YN3A 2D2OA 3RTQD 3T0ED 3UTPD 3OF6D 2ICWA 4YAQB 3RWHB 1FV1B 4MNHB 4JEGB 4DEPC 4X7TB 3WLWC 2ZWZA 2EYSA 4HJJL 2WZ0A 3PWPA 1TQVA 3AU1A 1ZLVK 4P3WA 2IC2A 3VFSA 1R3LA 1ZRUA 3W1ZA 4WW1B 4IK6A 4ZMVA 3DHPA 2DW5A 3MRGA 5D4JA 4M6NH 2A73A 4QNPF 3KL0A 2HCZX 1A0QH 2H4EA 2X6VA 2FWSA 5CCHE 1ES0B 1GOFA 2NLJB 4ELDA 4WF7A 3IDMB 2NY2B 3QUYB 3GSRA 2A7BA 2MWCA 1QEXA 1U8HB 2HFFA 2PP7A 4NI6A 3T0EC 3H3BC 3MDJA 3SJVE 2IFFL 1SDAB 5ALBH 1FFTB 1JI2A 4K8RL 3NUKA 2AQTA 5EZOL 3IJYA 4W9IC 1RUAH 3RU8H 3NPSB 2QVKA 4ES9A 4OLVH 1RIVH 2F53E 3FCGA 5FDYA 1XH0A 3ZDYF 2DQJH 3TO4D 3W56A 1MI5E 1W0VA 5J11C 1M1XA 4FG4A 2O6EA 4OLEA 1A4BA 1QFUL 1G6RH 2FWLB 1F1DA 2P7TA 2ATPA 2VLKE 1YEKL 4JCMA 1XXDC 4IRSA 3O9WC 4A63A 1K2DA 3DOSB 5CLZA 5F21B 3NH7L 2AVFA 1M7XA 2DH3A 2F53A 1F4AA 3H54A 4WKXA 3LXBA 5I8EA 4F9LA 3P69A 3HI1A 1GVIA 4FYTA 1TJGL 4JUSA 1MI5A 4Y2DD 3NCFB 3O3EA 3P0YH 3TO4C 3VFNA 1NIDA 3GBML 1AJ7H 2Y3NA 5IB2A 1KCRH 4WTWA 4QGYA 1IFHL 2B2XL 3CX2A 4NWUL 1RUMH 5KN5A 1ZPUA 4U1GC 4P5TA 1H5BB 1SJMA 2OTWB 3TVMC 1KT2B 1DLFL 2Y0SA 3ECWA 5IQ7L 3BKCH 2P8PB 4QCIB 4R97B 5FUZH 2B1AH 3N41B 1IVTA 4F5CE 2X4QB 1YC8A 3G6JE 3ULAB 1HWHB 5JPNB 2FJUB 5C0JA 3IFNH 1MELA 5EU4B 2ZKHH 2F54E 3RWJA 4Y2DC 1EERB 1P0SE 4FQCL 1B4RA 5C0ND 6FABL 2X4PA 1JK9A 4RMSA 4MMYA 1N3NB 3M7OA 5GGSB 2C9PA 3GJEB 2Z0BA 4P2QD 2UZIL 3M8OH 1BQRA 1SJHB 1QVOB 1U0QA 4KQ0A 1ZHKA 4LBAA 1BX2B 4YHLL 1JZ2A 3IT8D 1IO4C 4GRWB 4F5CA 1NMCB 2ZSVA 4PS3A 3G6JA 3V6ZA 2CO6A 2C3XA 2QFPA 4DP9X 2XIDA 5F2FA 2DQCH 3B37A 3U6XS 4Z3FA 5C0EA 2E9GA 1P84J 1X3DA 2F54A 2NMSA 4N8VB 3JV6A 3OKLB 5HHQA 2C3VA 5C0NC 4LLUB 4NNPL 3VH8G 2AFNA 2WZAA 1BJ1J 3ARQA 4LVHB 1H9DA 1D5XB 2Z1KA 3K1KC 5KVFL 3QIWD 3TBWB 2RR3A 4WFGE 5GS1B 4AQEA 2WLHA 1E9OB 5B8CA 1PEWA 3V5DB 3GINA 1DQIA 3HBQA 4JMXA 4F8QA 1TTGA 4PBXA 3RDTD 4C56D 4K94C 3WXWH 2VLJE 4LNRB 1MHPL 4MGXA 5M94B 1IGCL 2NRDA 3QHFL 4G7SB 1EHKB 4JPKL 3WEBA 1MW2A 4ZMYA 1QBLL 2GB2A 1YDPA 2AQSA 2YD5A 2NY0D 3QIWC 2CUAA 4DCQA 1WWAX 3S8GB 2OP4L 1CURA 1DQKA 4IIZA 4QLRA 1CQYA 1ZLWH 3WNJA 4MYWB 4YHPA 3BT2H 2V17L 3PCYA 3QJSB 4FEMA 2O4EA 4XXDB 4NHUA 4OR1A 3VXUB 4XWGH 4ZFOB 2VLJA 2LLLA 3RDTC 1FVCB 3OJ2C 5EUKA 4QR7A 3DDGA 4NNYB 5ICYB 4E0RB 1OAYH 1H15B 4N86A 4P3CL 5AG8A 2VXQH 3QRLA 5E6ZA 4EDXB 1R9FA 3MMEB 4OGYH 2ZG2A 3QUXD 4QRTA 4UQCA 2KLTA 1IT9H 1ZTXH 3DMMB 2R1WB 3LXCA 4HWBL 2ZPKH 4HK0B 5JXEC 1WA2X 2IDSA 3BUYB 1QRNE 2NY0C 1D6EB 3EFDH 3WEXA 2GITB 2XZZA 2QQLL 3DRTA 5EU5B 3W9EA 4UINH 1G7JB 3HR5B 3C6SB 1MFNA 1CLOH 3QUML 2ZOOA 4WWKD 2HJLA 3EADA 4LMQE 3O3BB 2I60L 3JV4B 5EBLA 2Q7YB 1ZVSB 1L9SA 5CBAA 3FT3A 5KUKA 3UC2A 2ZCHH 3MCLL 1KBWA 2YA2A 4BCXA 2Y06L 3ZK0A 4ZX5A 3B9EA 5BVJB 2CQVA 1HKFA 2GSIB 3SYOA 4PJDE 5D7LE 4DGIH 1QRNA 1T4KA 3C8KB 4OZGE 2J6EH 4HIEB 2ITEA 1Z0MA 4FFTA 4KZDH 5E2VL 1PS3A 3L7EA 4PI2A 4NQQA 4PJ9B 3GKWH 1TOXA 4HSQA 3T6VA 3ET9F 3V52H 4AM0A 4U1MB 4DO4A 5AG9A 3G5ZB 3FQTB 4WWKC 5HVHC 1K4CA 1OD9A 5KVEH 3II3A 4KHXH 1EHLH 4KPHH 3STBA 1PZDA 1XH1A 2BRRH 4YDVA 1M7DB 4G5ZL 4HISA 3HZKB 5F88B 5FO8B 5JIMA 4NUGH 4DEUA 2ZX7A 4WI6A 5T3XH 3V5KB 2QADB 4EDWH 4PJDA 4X4XB 5D7LA 4OZGA 1NOLA 4HS3A 1SF5A 3WIFA 4HH9A 5FO7B 1I1YA 4HF5L 4LPVA 1SDDB 4Y1SA 5JXAL 1T1YB 2D31B 4GI6A 4LXFA 4Z5RB 3QXAA 4LAJH 3NIFE 4JREC 3D07A 2WUBL 4PY8I 2B3IA 4JMNA 4KY1H 5FAAA 3FU9A 1FA4A 3B9KA 3VI3A 3U6XA 1IEBB 2DQGH 4I5BB 1FG9C 3GMQA 3QULA 4YFLF 5ERWB 5GS2D 1QLEH 2X4TA 2WZ6A 1JGIA 3TF7C 1LEGA 3GMNA 4OJFL 1QWUA 4TQEL 3ARYA 3PIQA 3GIVB 3OLEA 5E6IB 1A22B 2AJSH 1SXNA 3QJUB 4M61B 4QTIL 4ZTPH 4WW2B 3W0WE 1UM4H 2PR4L 2OSYA 2AKRA 1ZSHA 1YPZA 5AZEL 2AMUA 1GTNA 4KGLA 4R90L 5H94B 2ID5A 1HE8A 2IAMD 4NBZB 4HV8A 4AIZA 1KCVH 4K3EH 3GBDA 3NGBC 4Q8BA 2NY5H 3FO0H 1PG7H 4NHCH 1Q0YL 3D25A 3F64A 1HZHL 1HH9A 4MD4B 4U6HB 1MJUL 3L4WA 2Y2YA 3W0WA 2XHNA 3Q13A 2MCAA 4XCNA 4PTTB 4G8EB 1KN2H 4L1LA 3F7PC 1OSPH 4DAGL 1E3ZA 1QI5A 2H2SD 3AU0A 3OHMB 1FVEB 4MNQE 1J9CT 1F4WL 1PX8A 4JDTH 3RA7L 1OAUH 3AXLB 5D5MF 3HE6A 1CDBA 2G75B 5INCA 4ZT1A 1L9QA 5KVFE 1RZ8A 4O02L 2QT6A 4PJEE 1KB5B 3IRCA 2J55A 3S5LA 2NX5E 1UXSB 3H55A 1J5DA 3JV0A 2YQ2A 1F3DH 4LASH 5GRZA 3NN8A 4C4KO 3DO3A 1JTTA 1NC4A 5AKRA 1XAKA 5E6UB 2N0KA 3QYNA 2BNUA 5GJSH 2VDKB 2CGZA 4CU6A 2PP9A 4AE0A 5HJGA 4OF8A 4LSQL 4M02A 1UT2A 4U7MA 3ZT6A 1NC2B 3S88H 5FYLD 1TZIA 1NAKH 2FUQA 3EDJA 5IFHL 3GBEA 4MB5A 1B2WL 4PJEA 4ABQA 3DX9A 1F2QA 2NX5A 2VM9A 5LVEA 1IILE 2OL3L 3HPJB 3OPZH 4FTDA 4L4VB 1TXKA 3HNSH 1IM3B 2OSXA 3KZ8A 4Y1AD 2G9HB 1RVFL 4Y19B 2JJSA 2BMKA 3HZMA 5IW6A 3IYLW 2BFVL 4LSVL 3UBGA 1NBZA 4YBHA 1DVUA 5EOTB 2V8MA 4HXAL 4Z76A 2I26N 1ITBB 3KS0J 4YIQB 3TJHC 1MRFL 1H3VA 3I3BA 2YD3A 3U4KA 3V0IA 3D9AH 1BVKB 4D7PA 4KX7A 5I8KL 3SY6A 3VU2A 4JL1A 4HWZA 4JDEB 5H2BB 4AJWA 2AVGA 5FFLA 2DM2A 4BFGA 1ZHLB 1IFGA 5EOQL 1BVOA 3UTOA 5D8JH 5IR1B 3H1ZA 1N5AA 3C6LD 3UTTB 4ZD3H 4OIFA 1HXYB 2APTA 5DJ6A 1ETZB 1NPUA 3T6QC 3MJ9L 5L4JA 2Y2TA 5DRNB 4R4BA 3WDIA 5IUCA 4PJGF 4WZ9A 2PYED 2J1YA 2X7LB 5F1IA 1HEJC 2FQGA 5IOPA 5SWSE 4FA8A 2WBJA 4ZFFB 2P5WE 2R7EA 4LGSB 1KSRA 2IGFL 1MFAH 3LZRA 4OLUH 3QZPA 5BZWB 3DSNB 2GIYA 4JO3H 4JZNA 1WEJH 1X5YA 3QUMA 1XGPB 2JE8A 1OWWA 1S7VB 3U0TA 4J3OH 5E9NA 2D3VA 2HVKB 1J0JA 3RILA 2Y23A 3B43A 4XWOD 2R23A 1YEEL 3VD7A 5MERA 1Q8MA 5FV2A 3OKEA 4G82A 1SEQH 5JMRA 3RGVB 3VFPA 5B1CA 4YBQD 5SWSA 1PLGH 4QY8B 3QUZA 4JLRB 3RUGB 3RAJL 3S36L 2P5WA 2FYYA 3FRPG 3U0WH 2DWTA 1M3IA 4RGNB 4X9FA 3GNML 3QXVA 2ZXEB 5JA9A 3CHSA 5SV3A 4PEEA 5EN3A 1T03H 4PAZA 4MJIB 4NQCE 3FOMB 4LOFA 3BE1H 3VD0A 4Y0GA 4HHAA 3UZEC 4BSWA 2HKFL 1TVBB 3CQPA 4XWOC 1ZT7A 4LP5A 1DSWA 3KYMA 1MJ7L 3T77A 3T0AA 5LDSA 2AK4B 2Z4QA 3E6HA 2VR5A 2ZP9A 1R0AL 2N7BA 3ME0B 3EOTL 3NSJA 4FP8L 1JP5A 1UCBH 2Z64C 1DQQB 1G7LB 4J3WA 4C47A 43CAB 2P42B 5E9DD 4NQCA 3WNKA 1N12A 3VFTA 4NKOA 5LBSH 1F41A 4XX1G 1S9YA 4Z0BL 3KPNB 3K71B 4CMHC 3AS1A 4XPTL 2EDTA 1TYEB 2HRLA 4NP4L 2CALA 3AWFA 1JNLH 4WI5A 4BSVA 1IQDB 1J9QA 4LSDA 3HG1B 5D2NE 1T7XA 2GG1A 1E6JH 2XG5A 1OCOB 3B9KD 4HKJA 3DHMA 1MHHB 2GI0A 1JUFA 3GSNL 5DWPA 5A6MA 1CE6B 5C0RL 3GHBL 4AI7A 4PLKD 3FT2B 5D1QA 2LGNA 2K45A 2YUWA 1UZ8A 3ZTNL 4K9EC 4G83A 1MQKL 1R5WA 3BN3B 4N3TA 1OALA 1J05A 3UTQB 3VGAC 1ECYA 2NNRA 2V2TA 1KCKA 2DWEB 5IOKA 2H45A 3MRPA 4IIQB 4KDTA 5MEPA 3NFPB 1XMWA 1WFJA 1OP5K 1N2RA 3B9KC 3MLZH 3LMJL 3KMDA 2F8VA 2G3XA 2Z7UA 4JFFE 4KMQA 4X7SH 3A3YB 5DD6A 4FHJA 1J0IA 4HCFA 2OAAA 2YXMA 4P4KA 3ARED 4PLKC 5DD3L 2JKTM 5ALCL 1JXFA 3WY2A 3FB6B 3ZDYB 4A2DA 4BUQA 1NDMB 4XMXA 3AADB 1Q94A 2EABA 3OSKA 5IT2H 3NJFA 2BZCA 4U7KA 5F0LB 2V9UA 1FI8C 3HPLB 1PAMA 4W70A 3GI9L 2F1AA 4WI0A 1DFBH 4JFFA 3L3OB 3CBRA 4FTVD 3U2JA 2CMRL 1OPGH 2W81C 3TPKA 4F7TB 1RULL 1TU2B 4W6YB 4M4RB 3PQYB 1AHWC 3EBIA 5T3ZL 4QLWA 5KWYC 3MUGB 4PGDB 4YHOH 3CE1A 2AJVH 2NXZD 3DPBA 4PRBA 1WHOA 3KW8A 2OMVB 1OQXA 4PWHA 5I1GL 1NC4D 4KVCL 5I5MA 2MPAH 5EUOB 4NYLA 5HDBE 3J27A 5GZOD 2E8YA 1OOAA 4RFNC 4BBWA 4QRSA 2VR4A 1MXDA 3H2QA 4IHBA 4UM9D 2VDMH 2OL3A 3L3HB 3SKNB 4JQVA 3WN6A 5SWZD 4Q9RH 2JK5A 4LLVB 5EN2A 2XA8L 3HE6C 1BVLA 3WCYA 2M2DA 1FL3A 3FN0L 5FHBL 4IRZH 1MWAH 2F61A 1SJEB 1MJ8H 2NXZC 3FUIA 4M6ML 1YEGH 1HQRA 2BX5A 3VGGA 4WWPA 1JTOA 2E7MA 4NPYA 5FYJD 4D9LH 4L8CA 5EO1A 1X5JA 3BEWB 1ZGLA 1U58A 1WH0A 3QEHA 1NGPL 1P2CA 1E8ZA 4PLOB 4HA1A 1UH3A 1OM3L 3BP6A 5AL0A 1NAMH 3HUJE 4ZUSB 2EXSA 1TJHL 2C1OB 3RFZB 4P48A 3G6AA 1T5WA 2LQRA 1U8KB 3MJ9A 4C54A 2CDFB 4WJ5A 3LIZL 3AROA 1D7DA 2R0KL 3PNWB 2JJSC 5IEKB 3CN3A 4OSUL 5E7FA 1H3PL 4P5MB 2FEEI 4L0YA 3U36A 3QWRA 2CR6A 4N26A 2AXJA 4UV7H 2FH6A 2W38A 3IGFA 1NM9A 2NY6B 3WTYA 5E00B 3BLKA 3CUPB 3HUJA 2M8XA 5F7EH 1IAMA 4U1SB 5FIEA 5I6KA 2IH3A 2WYZA 5EEYA 2X88A 2YEZA 2YGVA 2X0UA 4OCYH 4EI6B 4JO4L 4UMSA 5EU6B 5FA4B 4BFIA 4JQXA 4TLTA 4ERSL 1ZV5A 4DKAA 3GSOB 2WOBA 2GUOB 1FNAA 5LJYH 2VL5B 4PRPB 3SZ6A 1LK3L 2DDQL 3LEVL 3OC5A 3TCLA 4N24A 1EAOA 2WLJA 3R8QA 1LK2A 3IDXH 5C8JB 1JGEA 3C6EA 2Z92A 1OE2A 1S3KH 2GJ6E 2VABA 3EO0B 1TQCB 4HUKB 4UF7C 5I1AA 1KUMA 2Z31B 2WBJC 4I3GA 4LLYB 3MCKA 4J3XA 2GBAA 3B5HA 5J3HD 2VMDA 4J6IA 4PWFA 2B0SL 2VB5A 4HW6A 1BSIA 4FG0A 4PBVC 4MBRA 4JGNA 2BW4A 3FH7A 5F7MC 5IQNA 2BWDA 4H20L 3QJHB 3A4EA 3ZY7A 1T04B 4U4IA 4ODHL 2EADA 1KC5H 3CXDH 5I74C 2G60H 4DP7X 3TESA 3P4NA 3ZDXB 4NUPA 4L4TE 3GMOA 2VZ1A 1RZ7H 5F1SA 4CMMA 4OZFB 4BFNA 1PZ2A 3MRLB 4X6EB 4W9CC 2GJ6A 2W59A 4AL8L 5LAXA 4XBPA 3QORD 2DOCA 3MTXA 5E6SB 3ETBF 2VWEC 3O6MH 3BPNB 5J3HC 3LQZA 1BEYH 2ZCKH 5AB0A 4JHAH 3ZL4H 4MDJB 3GC3A 2NY7H 2J5WA 3LTVA 4HEPG 4V33A 3ZR5A 2EICA 4DETA 3JXAA 4DTGL 2R29H 1YAZA 4O4YH 5FHAH 1RY7B 4ZQTA 5FV1L 1CLZL 1HNFA 4GIAA 3U48A 4E2OA 2PW1A 4GRLD 2BW5A 7PCYA 2IGTA 1KG0B 2EDRA 4HJ1A 4Q4IA 4YZFF 9PCYA 3QORC 4JKPL 1SMOA 2GT9B 4KTGA 1H8SA 4H2AA 5D72L 1IC1A 4HS8H 3HW7A 2IALB 3FONA 1K6QH 1FWXA 3RB7A 2BNQD 1MUJB 1ZLVH 2HLAA 5ETUB 3CAFA 5F6HJ 1G1CA 2FLBT 3ULSA 1E9PA 3J7HA 3SE6A 5I0ZA 4F8NA 3BPLC 4NJAH 1ZA3A 4KJPC 4U1HB 4TVSa 3DXAE 3QIUB 4GRLC 4JL2A 4Z7WB 5I1CL 4I3SH 3IMBA 2E86A 4JPIA 3TT1H 5F9OH 1EGJL 4RAUB 3FU0A 4X5LA 2MMXA 3PL6A 2V3DA 1T2QH 3HC0B 3S37H 1A14H 4TLSA 4LFHD 1HWGB 3KLQA 4TN9A 3VFVB 5KG9B 1Q9WA 1Q0EA 1BLIA 2ZSWA 5D1QC 4FMKA 2AQ3A 1Z9NA 4H26B 4DEPB 1E4XI 4E42B 5I6XC 1NMBH 4IS6A 1UWEH 4IOFD 3CZKA 2GJRA 4AXWA 1S8DB 1NGYB 4JZOB 3DXAA 1IL1A 4PJDF 2V5MA 4UIKH 3WL9B 3ZSTA 4F7EB 4PRIB 1YEJL 4NKDB 3EJRA 1NCNA 4LU5L 1DN0B 4QAMB 4OCXH 3SGDH 4H0IA 1Q0XH 3R1GH 5IREA 5JO5A 2GC4C 3P0VH 3QQDB 3TEYA 5HPOA 5I1DA 1TKWA 2W8CA 3A0OA 1FFQA 3N42F 4GBXA 4B9CA 1K8IB 3VI3F 5AENA 2BHZA 3WN5A 4AEHL 4DZBB 4UV4L 1JMZA 4UDUB 3WD5H 4ODVH 1L5GA 4MAYD 3MJ8B 3KBHE 4KAQL 3SOBH 1UHVA 3R0MA 4IHOA 2QSVA 3LKNB 4Y8DC 1QSFE 5L4FA 4MRBA 2K0RA 2QVMA 1VPOH 4IEFB 4KQ3L 3VFOB 3ABGA 3JWDL 1T7ZA 4NFBA 2FBJH 3J07A 5JUEL 5L9DH 3SKOB 1YPZF 4FNTA 4NCC2 1RV6X 2VZSA 3EO1A 2X1QA 2VLMD 1FNSH 2AEQH 1SFDA 2HVJB 2PWGA 2VXSL 3EJTA 3KS0H 4OD2A 4B5ZA 4UB0L 3O9WB 1WA1X 4P5SA 1CDUA 3UH8A 1HWWA 5IB5B 4W81A 3N1GC 3QDGA 3IJ9A 3AGWA 4XCYB 3NFSH 3V4VL 1JHTA 4FE9A 1QSFA 5TDOB 2AV7B 3LIZA 4MDIB 1NFDF 2NZIA 1UZ6F 2EDLA 1RZIA 5HYJA 1OE3A 2CDEB 3F85A 4QJ4B 1JMXA 3VFWA 5DJAB 4U1GB 3L16A 2G2RA 4C4BA 4NRZA 5B1JA 3TVMB 2EDQA 4U1IB 4XVUD 3L4TA 4NQSA 1J0KA 3T0XA 1MW3A 5E2TL 1O9WA 4MWFA 3WE6A 1X9LA 1YMHA 3T8MA 4DUVA 3ZIYA 2ZONA 4MMZC 3L9YA 4BKLB 4ZUVB 2OSLA 2NXYD 4JZJA 2E74C 4AYFA 5KAQF 4UQ2A 4MRCA 4ANKA 1WUNT 2OYLA 4FEIA 3CU1A 4K23H 4YDJB 5TDNA 4GAYA 5TTRA 4ORGA 3VFUA 1E0OB 3PABB 2AMGA 5KVGL 3MYJB 1FFNA 2G4GA 2FR4B 1S9KC 4FQHB 3FYIB 1CD0A 4XVUC 4PWGA 3REWA 5I8OL 3NIGF 4OFYD 5LN4A 1UJTA 4XVTH 2JI1A 1FSKC 4P2OD 3EXLA 2NXYC 1QBMH 4XO5A 4PVMA 4HUUA 5I1KH 5HBBA 4GFXA 4TVUA 3DK2A 4R5TA 4PJGB 4XI5C 2Y6TE 3ULVL 3OGCA 4LEBA 3FKUS 1XR9B 3QS3A 2IPTL 1L0QA 4JQXC 1SQ2N 3KPTA 2CNYA 3UX9B 4DKDC 2C4XA 3MBXL 1A1NB 2VR8A 1OGTA 1IE4A 5IHUH 1KXTB 3U7AA 1FO0L 3DJSA 1HEHC 5DMJB 1WAEA 2E9IA 1Z9LA 4I0PD 2LABA 2O6FA 1FUNA 1MFDH 3RY6A 4XN7A 1XF5B 5A6LA 3DV4B 5ESAB 3U9PH 5C6PB 4YDLC 3KPQB 2WSKA 3GHEL 4L8BA 5ESVB 5T1MB 4H8WH 5F3FA 2DIEA 3LCYA 1I8MB 1DQJA 1R24A 3NTCH 3V7MA 3P3TA 5HI5C 3P73A 2VDLB 3H0TB 1H6FA 1IAIM 5CGTA 2IANA 2E7LA 2IOIA 2R69L 1CG9A 3VVVA 3NJHA 4CC0A 3KVDD 3GBLA 3NA9H 4UT7L 3X1EA 4I0PC 3RWIA 2EXYD 5E08H 1QA9B 3FFCB 1KFAH 3AM8C 5IKCA 1S7XA 3GTNA 4RH4A 4KKQA 4PTUB 5D70H 2BS8A 3D2UB 4N9GB 3QI9D 5FUCE 4MA8H 4EUPB 4UZGA 2GW5A 5I1LA 1A5FL 2Q1EA 1TENA 2X87A 4TUJB 3DX6B 2NY0B 4HP5A 2GTQA 6PAZA 3NZ8B 2DLIA 3NACL 5DJYA 4BWUA 1JWMA 3FQXA 3LPOA 3BD4A 3GRWL 3KPLB 1EGJA 4G9FD 2XWEA 5CLXA 5K9KA 3ARDD 1UQSB 1K5WA 4GMTH 1T3FA 4TNVK 4LSSL 1RERA 3LKQA 4UNIA 1FBIH 1IKFL 3QI9C 2GJZA 2P5EE 3H9YA 1QTPA 1DE4B 4Z0XB 2QGDA 3CQFA 3EUUA 4YHKH 1C1EH 1U8NB 4YHYC 1CI3M 5I9QB 4MQTB 4G8FB 1ZV9A 2RH0A 4BDVB 2CK0L 2WYHA 4XN1A 4L1HA 3HB3C 4DIXA 4HBCH 3WHXB 3IDGB 3HC3H 3K8KA 2VXVL 15C8L 4YWGL 1CICA 4MD0A 4WKZB 1VRSA 2ZCZA 5JTWA 3SQOH 3L3KB 5D1XE 3ARFA 4WWKB 5HVHB 2PKDA 2BVTA 3I2CH 4LOUD 5E8PB 3ESNA 2P5EA 2H26A 2WTRA 4JR9H 1NMAL 1G4RA 4LESA 2JJVA 3DHJA 4HFWB 1DQDL 3BOVA 3H3PH 1VA9A 2A0LD 1KMGA 5TE4L 4XVOA 4RCAA 3QJFA 2OW6A 1RHHB 4OCWH 1CZ8L 2ICWB 5FM4A 5FYJU 4YPJA 1IKNC 2VDQH 3EJPA 4R26L 1A8JH 5D1XA 5I16B 2EYSB 4JREB 4YDMA 3PWPB 3AU1B 3CNKA 4MKMA 3VFSB 1R3LB 4LOUC 4M7LL 4Q9QH 2VQ1A 2WXGA 2VDNL 3MRGB 4F1ZA 1JZ4A 2XT1B 4BE6A 5DC4B 4K07A 4JFQA 4P9ML 3CFDA 1VLXA 3FZUD 1BZ8A 4BFEA 3GSRB 2HFFB 4G8IA 1F18A 2VN6A 2CLZB 4WY7H 4DGYL 3KWVA 3V4VA 4KMTL 1DTUA 1OOWA 1WQVT 5HHVL 2Y36H 3IJYB 3WN5C 4EBQH 3WMPA 2EJ1A 3D69A 4DFIA 5JIQA 1QNZL 2X2HA 2IBBA 5AOMA 3U30C 2HAZA 4IKNA 5BUPA 2H0PA 2V7NA 3WMSA 4FABH 3D0LA 2VZUA 2AAVA 1FYHB 3VO0A 5FLVA 2WBWB 1SBBA 4YHZL 3NJMA 5KVGE 4NQXA 5IVXE 1PYWA 5AFAA 1W0VB 3FZUC 2VR9A 5E8OB 1M1XB 4HZLA 3BVDB 4HUMB 1PFOA 4DGWC 3H56A 2P7TB 2ATPB 4ZS7H 4WHDA 2Q10A 1TDQA 5CEZH 4IRSB 4J23A 1K2DB 4GIPD 2F53B 5ESQA 5I8EB 3B8SA 2WUCH 4A6YH 4YMPA 3ULVE 4NC2B 4Y2LA 3IFOA 1MI5B 5GRYA 1GPOH 4FF9A 5AUMA 3O3EB 3VFNB 5IVXA 4RGMB 4DWHA 4UOZA 3CZNA 2H3NB 1XFPA 5IB2B 4JHWL 3RL2A 1WWWX 1X6NA 3U1PA 3AQZA 3MREA 3WKML 5KN5B 4P5TB 2G3MA 5T5FL 2APVA 4PJ6A 3D85A 5EU7E 2BS9A 2GK0A 1WICA 4NXSA 1G7MA 2X1WL 1YEHL 4OV6F 2PYFA 5C0JB 3VD1A 4JZJC 1BJ8A 2DD8L 4G80A 1NEUA 5KSAD 3RWJB 3FSZA 3KXFD 2X4PB 1JK9B 3SQBA 3SBRA 1N6UA 4MMYB 4JFEE 3BMVA 4Z8FL 2C9VA 2PXYA 3H6JA 4AE1A 4D94A 3VFRB 4TULH 2VISA 1BZDA 2YZ1A 3FBQA 2KH2B 4OZFH 1CXHA 4JFSA 3DJZA 5E8EB 2Q5BA 2YPKB 1GSKA 1S7SA 2FECI 5KW9H 1V7NH 3F7QA 2ZSVB 4JM2D 1O6TA 2G5RA 3G6JB 3ZX1A 3X3GH 3QR2A 5DEFA 4K15A 4TVPL 1T22A 2G3NA 5C0EB 2BP0B 2ENYA 4HGMA 3ASOB 4HXBL 3JV6B 4EQ2A 5HHQB 4J3OG 1EV2E 2X3CA 4JFEA 4D9QD 2VIRA 3BP4A 1QZNA 4X0NA 2R69A 5LG1A 1AS6A 3Q2CA 5BV7L 3R7QA 4J1UA 3GS4A 2ITCA 2AAAA 4AQEB 1YQ2A 3BGFC 3S0PA 2IAND 4M62L 4XMVA 3ZRFC 5HDQL 1GH7A 5DO8A 4KZEH 3MV01 5L2KD 1O6SA 2R0WL 3H9SD 1GXEA 2ARJQ 2L7EA 4I4WB 5AVZB 1NBCA 4L3AA 3V0GA 4BWWA 4GOSA 4M1GL 4ZK8A 5CU9A 3CCHA 4CKVX 4RFOH 5JOEA 2YSTA 1NEZG 3EYUL 4AGNA 3VG0H 1H3TA 2C9SA 4LZKA 4N0FA 5HTSA 3VH8A 3CN2A 1LDSA 1TITA 3CZUB 1YDPB 3UZVA 4DCQB 2DQUL 3WIAA 3Q48A 3AY2A 4HKZB 4YHPB 4L48A 2FVNA 1JGVH 1R1CA 2ILLA 5D7SH 4NHUB 4XMKH 1J5CA 4UTCA 4QEGA 2VLJB 3U1SL 2ENPA 3GDCA 5EUKB 4Z1PA 1RPQA 4TTDD 1JYXA 4HIPA 3IF1A 3D39D 4LCWE 5F44A 4OF0A 5C7XH 1YA5A 5JW5A 4WQOA 4I1NB 3FMGL 4OTXH 4DGVL 2QTEA 2XIIA 5AZ2L 3DRTB 1O7SA 3W9EB 4L29A 4R96A 1N4XH 1ZPLA 4GUCA 5TQ0L 3TOPA 1MH5A 1U93A 5FB8A 1YC7A 3VA6A 2DMBA 3CSGA 2F15A 1J1OH 1B88A 5EBLB 4DSYA 3D3VA 4JFPB 2J8HA 1WIOA 1E90A 4RVBA 5CBAB 2E7DA 4LCWA 4PREA 3CVHL 3L9BA 3QARA 3F00A 3V95A 2IG2L 3PDDA 5TDPB 3WTVA 2O6CA 1ZCRA 1XGTA 1QRNB 1T4KB 4OCNC 2D73A 5LBVA 4BFOA 5KYXA 3AWGA 2ESVD 3C87A 5SX4H 4MDRA 1OP5H 3L7EB 3QAZC 4CMHB 3OKMB 2AANA 4NZ8A 4KXBA 4PMFA 1UD3A 5JDSA 4HS6A 4AM0B 2B08A 1NLDH 4OAWB 5LN8A 3C60D 4YDVB 5E2UL 1KCLA 4H25A 2QFRA 1A66A 4PJDB 1EO8L 3CIAA 4OZGB 5D7LB 4HS3B 4QHUB 1N5YH 5FW7A 4HH9B 2ZJSL 3UO1L 1MVFA 3WIFB 4HJEA 1I1YB 3FFDA 1PGRB 3QQ9D 4LDOB 1RFDH 1DUYA 1G9NC 3QXAB 1INQA 4ELKA 3EBHA 5CIPB 4PN6A 1QFWH 2AW2A 4KX9A 2HG5A 4BQ6A 4ONGL 2XTLA 3N42B 4M48H 1MCSA 3B9KB 3G6DL 43C9A 3VMOA 3C60C 5KS9E 3VI3B 3WFHB 1I9JH 4YVNA 5JDJA 5T1DL 3GMQB 3CD4A 3QULB 2X4TB 4GUPA 4JM4L 4D3CL 1NJ9A 1KPVA 3D0AA 5IV2A 3SGDI 1LEGB 3GMNB 4N8VG 5BJTA 1HVXA 3QQ9C 4ILDA 4FRWA 4JG1H 3CHXA 4GKLA 5ILTH 2UYLA 3ESOA 2B1HH 3LNGA 3NIFB 4OCRH 1IBGH 3E0GA 4YGAB 1LDPH 5I1HH 3DSFL 1M53A 2VQ4A 1YCSA 2AKRB 1KCWA 1HILA 1YPZB 3FUHA 1CDHA 1XZWA 2K7PA 2XRAH 1OANA 2J6WA 3ATAA 3IJSB 4K71C 5J56B 4HAGA 3NEXA 3DBSA 3VGDA 4AIZB 3EFOA 1DR9A 5DMIL 1F86A 1AHWB 1MVYA 4LCIH 1A6VH 1Q4NX 3GXTA 4XBEL 5T5FA 5CN3A 1URZA 4M8QA 3ZO0A 3D25B 3N1MC 3BPOC 4I9WE 1HH9B 1NFDB 4ONFL 3W0WB 4AG4L 4TVPE 3ABZA 4XCNB 2EDBA 3KPSE 5JHLH 5C0FA 1F42A 5DJZA 2GABA 4KBPA 5KOVC 3NEOA 5DMYA 2P52A 4LEXL 2OX5A 1L9PA 4DERA 2ZXWB 3HE6B 1GHFL 5INCB 3P2TA 3GFUA 1RZ8B 1F02I 1DQML 1VGKB 4PGEA 5K69A 1BF5A 4IKLA 3S5LB 4M93B 4OLZL 2IXQA 4UT9L 5A3ID 3CZJA 4AGOA 2NXZB 2C3HA 3NN8B 1QAWA 3F2LA 1NC4B 2DEWX 2BNUB 3WFZA 3KPSA 3IM1A 3O2DH 3RYMA 1RLWA 4JRXE 3G3LA 4N8CL 4DW2L 1PY4A 3ULVC 5JR1L 1QSED 4WGVB 5ACMA 3MNWA 3K6IA 1FPTL 1TZIB 4NM4L 1F45A 2HA1A 1S3RA 3NIGB 4PJEB 4W6XB 3U83A 2J1ZA 1H0DA 3BGMA 4B50A 2NX5B 5E95B 1AQKH 3WNNA 3QO0A 3BWAB 3ZE1E 2APXA 4Y4FD 2LFEA 3CLFL 3DI2B 4B9KC 1RUPH 2BMKB 3V4UH 4JO5A 1H8OA 4RGOL 1DBMH 1KJ2L 4JRXA 5MHSD 1FH5L 3MLYL 2Z65C 2AJYH 3QCVL 4BXSV 1PQZB 4U7SA 1MNUL 3UMNA 1EUTA 2GSGA 2H1XA 4HIXH 3DVGA 1SPDA 1YNKH 4O2CA 4HWZB 4DUWA 3GJFA 1AKPA 2H0FA 3R8BB 1U3YA 2E9WA 4X6FA 4BXVA 1N5AB 3CU7A 5DJ2A 3IU4L 3OXSA 1ZD6A 4HK3N 2J72A 4TQIA 2VDOL 4N1HB 3BDYL 5L0QC 1PFCA 2X3AA 3CN0A 1Q1JH 1EDYA 3ATDA 1PIFA 1P4IH 5CU5A 3Q43A 5F1IB 4K5MA 1USZA 3N40F 5IOPB 3CN4A 3D06A 3ENEA 2GTWA 2FD6L 3DRQA 3ZXAC 2WBJB 4DK6A 4WEEA 2R7EB 2Y24A 4HWNA 3WUWG 1SEBA 5IW1A 3CIQA 1U91A 4QO1A 5AB9A 2I5YL 4JZNB 2HPTA 4F15C 3FSAA 3QUMB 3G9AB 1SXSA 4PD4K 4FQ2H 4CJ1A 1LE5A 3VD9A 2IV8A 4YDIL 5I74B 3VCLA 3OTTA 2R1YA 3U0TB 4LAQH 4X5XA 1PZSA 3CVHA 2R23B 3BIKA 2YS4A 3CX5J 3NJKA 5CJXC 5MERB 3T2LA 2HT4D 2C9AA 3WXVH 2XOTA 5SWSB 3D3VD 3QUZB 4U3SA 2P5WB 2FYYB 5I0VA 5C92A 2CBQA 2HLEB 5I5IA 1U8CA 4QWWD 5D71L 4MJ5A 4YSEA 3EJJX 3SY0A 4ZTOL 4RDBA 3NRPA 4HHAB 2WSDA 5FUOH 3V4PH 1ZT7B 3KYMB 2ED6A 2VN3A 3T77B 3IDYC 2Z4QB 3E6HB 4CBPA 4K55A 2J1KA 3CH8A 3QORB 2EIKB 4CGTA 1J10A 3RVVD 3P2DA 2YEQA 2BVOB 3FRPA 4FGMA 4M1CD 5GISL 4LQ1A 2J5LC 1XF2A 1DUZB 4QWWC 5GHWH 4NQCB 2G5UA 4L1TA 4ABUA 3RJQB 5D6CA 5IWLA 4YH6A 3I02A 1S9YB 4QRAA 2WXIA 4FQIH 3UPCA 1DDTA 1SBSL 4XX1E 3CXFA 3BPLB 3B2DC 3A22A 2HJFA 4WEMB 3FUDA 2EIDA 5GS2H 3O6FA 3BKML 1MCRA 1Z3GL 4GRLB 4ZI8A 3FO9B 2X09A 4KRMB 4G43B 2XG5B 4HKJB 4EI0A 3RVVC 1BMWA 1MRDH 1MZZA 4M1CC 4AOFA 5JIHA 4YSCA 1JUFB 4YQXL 4L8SA 2D8KA 4FFVC 5CS7A 4RNRA 1M1SA 3EUDA 5FCSH 5D1QB 1JWUA 4G8AC 4CKQA 1ROWA 3ATBA 1UZ8B 2DTML 2Q8AL 3T0VA 5I6XB 1R5WB 4BH7A 4GB9A 1C16A 2D9CA 1J05B 4Z7OF 1OAQH 3D08A 2XXFA 5DD0L 3PGCA 4TQHA 2V2TB 2FGZA 1M2VA 3MRPB 5MEPB 2H1LM 1CDGA 1E6OL 1U30A 4TRPH 4ODUB 5DUML 1BFTA 2ZYSA 4OJAA 1N2RB 1SGKA 2ZOUA 3S98A 3L5XL 5DD6B 5IBLD 1HINH 1UYWL 5C0BE 4RMBA 5GZND 2A9CA 3KL3A 3P4MA 3SJVD 1PSKH 5CJBA 4KI1A 1Q94B 4JY6A 2X05A 4BZ1H 1YMME 5L6YH 3VMNA 2MTAA 5ID1A 1SF3A 4HCRH 4WI0B 4UNVA 4GXVH 4GSUA 4M6NL 4I13B 1X5GA 4JFFB 4UT9A 4KJWC 3QRBA 5AW6B 2H0JA 4UAOB 2WXJA 5CCKH 3APMA 5IBLC 4K3HA 2Y1YA 4WK4B 3QHTC 2JKSA 5J5EA 2WZ5A 5ADPH 4DESA 4HSCX 3DPBB 4PRBB 4XN9A 5ALBL 2EIMB 2VLKD 2QKIC 4NLAA 1YMMA 1RUAL 2EKJA 3C5SA 2P28B 3Q01A 5KTEH 1LVEA 4NYLB 1MCOH 1CFQB 1GZQA 2ETWA 1A1OA 2WINA 1RIVL 3LV3A 5FYLH 2EINB 1T1XA 4WHYH 8CGTA 2DQJL 4QRSB 4X6CE 1G6VK 2J44A 4PVLA 1YRKA 2IIJA 1JRHH 2BXZA 3PP4H 4H88H 2EIZA 2JK5B 5F0JB 2R2HA 3MC0A 5EN2B 1BVLB 5DSCA 1KJ2A 1FL3B 3N2JA 4AZ8A 3S3SA 1JPGA 3ARBD 4OJEH 1G6RL 4LPTA 4LHJB 1HQRB 1E7UA 3EHBD 5HDBB 1EWHA 4NPYB 4ZMXA 2A38A 4L8CB 2P9RA 4AQ8A 5EO1B 1KDJA 3S35X 3KBPA 5IVXF 3CSYA 1ZGLB 4MMZB 1U58B 4Q74A 3O0LA 3QEHB 1HKLH 1P2CB 3T09A 2ZAGA 1LE9A 3BP6B 3L1EA 3CHOA 2KQNA 3P0YL 5BV7C 1AJ7L 3VFMA 5AVRB 3FTWA 4N90E 5IHHA 3G6AB 1T5WB 2YWYA 1I3RA 1KBVA 4ZO6A 4GW4A 1UGNA 3ARBC 1RUML 4DEWA 4WJ5B 3ULVF 1Z5YD 3EHBC 4HJGA 5DC9B 5FUZL 3U36B 2XTJE 3FQWA 2B4CC 1FSKB 5AL8A 3TCTA 3MI6A 1ADQH 5BW7C 5HYEA 3SODB 5C7ZA 2NXYB 3N04A 2ZKHL 5IF0A 2WB1A 1HZLA 1QX1A 4HOZA 4OFIA 1VFOA 1YYCA 5A2AA 1OHZA 1XSKA 2R51A 4OLYH 1RURH 2IH3B 3FT9A 3T1FA 2VNCA 2YEZB 2CHXA 5ADOL 4BFIB 4HDIA 3BH9A 3M8OL 1J9SA 1GA2A 1F00I 3NEEA 1EHAA 2P46B 3DGGA 2FEEL 2MKLC 5LGHH 3II2A 3TCLB 1UWGH 3OM3B 3BKYH 4FFZH 2FX9H 8FABA 2YN5A 1LK2B 2MRYA 4HUNB 2DQCL 1JGEB 3RBGA 2Z92B 3QC6X 3UTSE 1MNNA 4YDLB 1XQ4A 3SPCA 3ZL1A 2VZ3A 2VABB 1ZT1A 4MXQD 2OTUA 4KNSA 5INDA 3MCKB 4M3JA 2Q0ZX 1GS6X 3OAYH 4BWTA 3BN9D 2XZAL 3NCXA 4XBGA 2GJJA 4AV5A 5JORA 4WNSA 5F9JA 4LSPH 3ZE0F 3RVXD 2BOCA 3P4NB 4I0PB 1JXJA 3E6FB 3GMOB 4FQ1H 3WXWL 2YR3A 2HRHA 3UJIL 2GJ6B 3VSUA 2WLNA 4DF9A 4XBPB 4P23D 5D7JA 2H6UA 1DVFD 1WFIA 3APDA 4G6AC 3AQXA 4F33B 4MXQC 4K9EH 4PD4J 5HGHA 2J88H 2MOVA 3LQZB 4YFLI 1JERA 3OZ9H 4N2IA 4PFEA 4TUOA 2P24A 2VXTH 5C0GA 4KK6D 1HIMH 3F84A 5CIPH 3BT2L 1PPIA 2CU9A 3GLZA 3RVXC 1NCCH 3WNIA 1IEAA 5GRWA 4POUB 3SOTA 1ZJBA 5J13B 1TF4A 2LVEA 3GQFA 2J1XA 3O6FD 4YK4C 3WSQL 2PW1B 3ZKMD 1OAYL 1I3GL 2VXQL 4X4YA 3BAJA 1HYSC 4IKJA 3EO9H 1IT9L 1ZTXL 2NYYD 3FONB 5ISZE 4YHYB 4Y9EA 3EFDL 3QQNA 5BQDA 1NFIB 2YK1L 3HB3B 2F19H 2HLAB 4KK6C 2Y1ZA 5JYMA 4BZYA 2M1KA 1CXLA 2VE6A 5IJVA 2NR6D 2WMPB 4PG2C 4UINL 2CBTA 2Z3FA 4HEPA 4R8WH 5IWLC 1ED3B 5SX4I 1E9PB 2ZUSA 3OMAB 3Q2WA 5GRVL 1OARH 3RZWA 3U7YH 2YMXH 4WAFA 5F7KC 1ZA3B 2A9NH 3OAUH 3VXNB 3O6FC 1CO1A 3VX0A 2ZCHL 2UZYA 4JPIB 1QD0A 2BINA 5KSUA 1VKXA 1EVUA 5ISZA 4JN2A 5IK3A 2NYYC 4DGIL 2NNAA 4X6DE 4F7MA 2J6EL 1IV8A 4S1SH 3NJXA 1Q9WB 1TQSA 4PVBA 2ZSWB 4MXVE 1DSYA 4JKLA 4PJFE 4IS6B 3GKWL 4ZSOE 5AW4B 3V52L 3ILDA 4MHHI 1JN6A 4YHMH 2ZKXA 1EHLL 2JIXA 3DXAB 4KHXL 1IL1B 2NTSP 4KPHL 2O5NA 4BUGA 2BRRL 3TXAA 1EFQA 4FI6A 1QEWA 1JIBA 4NUGL 5T3XL 1J5IA 3OZLA 4EDWL 3N44F 3Q8EA 2MH4A 3P4LA 2OULB 4X6DA 3GF8A 3VRJA 1ZHBA 3GIZH 3PDOB 5JO5B 3UABA 3JVGA 1E28B 2QDWA 4R84A 2P80A 2Q20A 1E4XL 4TNFA 4PJFA 5I1DB 3R06A 1TKWB 4F7PA 3EH4B 5IHZB 4ZSOA 3EDFA 5B1KA 4GBXB 4F2ME 3FT1A 5DMGD 3CVIH 4JFXA 3RGHA 3D18A 5F0MB 3O4LD 1FC1A 3WN5B 4KJYA 1XWVA 3U30B 1H3UA 3L1OH 1TYJA 1L5GB 3K4ZA 2O61A 1QLEL 2X44D 4HPYH 1G6RA 4IHOB 4WDIB 5T1LD 1CF1A 3UIYA 1ZLDA 1A6PA 1J87A 3TBBA 4IBUA 2D7QA 5FYJH 3PDGA 1SDYA 4F2MA 4IOSA 3MOBH 2AJSL 4JGUA 3EO1B 5DMGC 4ZTPL 1FYTE 4OD2B 1JNHA 3L4ZA 1UM4L 1CTMA 3WFBH 2DI9A 4XVSL 5E4IA 3ZIMA 5L8LB 3QDGB 1P7BA 5A2FA 1ORQA 4FZ8H 5A2JH 2D03L 2G30A 3BC9A 1JHTB 5B7EA 1KCVL 1QSFB 2DQEH 3N55A 3PS6A 1MCWM 1U2YA 4OZFG 4ZMAT 1V54B 4IRJA 2NY5L 2DYPA 3FO0L 4GSQA 3BQUD 2ITDA 1PG7L 4Y4HD 4NHCL 5IGXH 2V5TA 1RZIB 5HYJB 5DCCA 5I75B 4FULA 1FYTA 3VFWB 3G5YA 1A02N 2G2RB 2XKUA 3KPRE 4NRZB 5E2WH 4ES8A 2WO2B 2Y5TA 2F9BT 1XAUA 3MLTA 1A7OH 1KN2L 4NQSB 4PJBE 4Q58C 3S97C 1OSPL 4AQ8C 4PJAE 4FC3E 3WE6B 4GW5A 1YMHB 3QJTB 1XCWA 3CSPA 4OD3L 3O8XD 4JDTL 1P5UA 5GS3A 2OSLB 4JZJB 1OAUL 2Z8WC 4HGWA 4A7VA 4AYFB 2NUTA 4UQ2B 2ZOKA 1M2OA 4OGQC 3TBVA 3QE5A 2ZUVA 3BQUC 4Y4HC 5TDNB 4GAYB 4UMGA 4LASL 2QELA 4ORGB 4CRPA 1SOXA 1TZAA 4XC1H 2OZ4A 2VLRE 4OVUA 5GJSL 3L5WA 4PJBA 3ECUA 4PJAA 2B77A 4WI9A 5IQ9A 2N1KA 1OE1A 4D9RD 3LZLA 3L81A 1DDHA 3O8XC 3R7RA 4Y1TA 3S88L 1NAKL 4MMXC 2EUWA 2HJKA 2WV3A 2OLDA 1CDCA 4HUUB 3V0DA 3BSGA 4AH2B 4WU7A 3SGJA 2FHBA 4WNJA 3ZOAA 3HNSL 3KGSA 4X8JA 2VLRA 1I7UB 4B3EA 3QP3A 1HL4A 3BGFB 3WTTA 4Z6AT 1BP3B 1X5MA 2RACA 3DKHA 1P6FA 2XTJC 3P40A 1TCMA 1BQKA 3CZEA 4JUTA 5I0XA 1EA9C 2YPLE 1IC7H 1HHGA 1ZTXE 3JV5A 1OWRM 3UJJH 4YO0B 4L8BB 1KN4L 2EE6A 5EDSA 4TSCH 4W9LC 1I85A 3QEGH 3CFCH 3U25A 5D8JL 1DQJB 4D0CA 5CUSH 3C08H 4U1JA 4ZMTA 1LQSR 3P73B 4EI5D 1BXVA 3HFMH 1NCWH 2IANB 4JDZA 2HT2D 5C2BH 1CG9B 2VXQA 3GSUA 4GUQA 4LB8A 3SE3A 3GSWA 4N2BA 3MV7D 3LQMA 2YPLA 3RWIB 3VWKA 2WVUA 1HNYA 4GAJH 1F58H 5IKCB 3SDAD 1S7XB 4V1DE 3MRIA 2RB8A 5HI3D 5E99H 4XCFH 1XGYH 5D7JC 1OAJA 1MFAL 4OLUL 3HMWH 5I1LB 1HEZA 2C9RA 3B7UX 3EDEA 4N2GA 4UUJA 2FNWA 3SKUD 4JO3L 1OXYA 2ICWI 5C0AD 2CO4A 1H19A 5KVEE 3KD4A 1QZ1A 4QRRD 1MG2C 1JWMB 2HT2C 3FQXB 4LRNH 5DJYB 2WWOA 3LSOA 3QPXH 2PN5A 1SEQL 3MNZA 1XD1A 4LVEA 5T3XE 1PLGL 2EYTA 5K9KB 5I76A 1FZMA 1T3FB 2J6EA 2OR7A 1AGEA 3PNRB 3DIFA 3LKQB 3LXUX 3TL5A 1IBFA 4H5SB 5HI3C 3D39B 2GJZB 3F12A 4MHHG 3QUHA 2D9QB 4RISH 4BUHA 1W2KT 3FQUA 3RVWD 2V2XB 1T03L 4PCYA 4KI5D 5EIVA 2IOMA 3N6YA 4JCWA 5I0WA 1ZXQA 3QAZB 4B97A 3UMTA 1KB3A 4JKKA 1MFVA 3ZGHA 3ZKQD 2X2JA 4ATTA 4D8OA 5GGUA 1NZRA 2E5EA 5BQ7A 5KZCB 3MROA 2P5EB 2H26B 2WTRB 3M1OA 4U1KA 5KVDL 3S3JA 1RJYB 4Z7OB 1KYDA 1MIEL 1UCBL 1GGIH 4WUUA 1SNRA 4L9LA 3UO8B 4JCLA 5C09E 3OHXA 2O6DA 2PNDA 4HJSA 4OFKA 3MZTA 4KI5C 3IK2A 3HKFA 3QJFB 5LBSL 1A6ZA 3HN8A 1FC2D 3W2DH 3F65A 3STZA 1WUZA 5AW1B 1ASOA 5D1XB 3FK3A 4FFYH 1SUHA 4O2FA 4LGPB 1JNLL 4K7PH 2VQ1B 4ZBJA 5LBGA 3RKDC 2NW2A 1BV8A 2OCJA 5C09A 2BVUA 5K59E 3BVWA 4JFQB 2N0MA 2BDNH 3CFDB 1I8KB 4ODXA 5AKTA 4NQEE 1VCBC 5LWYH 5CCJA 3DX0A 2AI0H 4JJOA 3Q3GA 5D7IF 3PJLA 4PWKA 1T20A 4DHLA 3V4VB 5DTFA 5JNYA 2WC7A 1I7RA 1OCWH 2AXFA 3QZBA 5TPWH 5G2NA 5G5DA 2V6HA 1F97A 1VZGA 3MLZL 4K71B 4UQEA 2VN5A 4X7SL 1SQMA 2LU3A 4JY4A 1MFCH 1YNLH 2MIZA 2EAEA 3OG6B 4UOW0 1Z0NA 1MSPA 3JBG7 4DQOH 4NQEA 1JHKH 1PYWB 1NCJA 5B22A 1J11A 4HZLB 5IJKA 1NCDH 4FG2A 3ROOA 5C07D 4WI2A 1XSJA 5BO0D 5IT2L 4FCAA 3NCCB 1OGAE 2WKOA 3SIKA 2E7CA 2C4FT 5EF2A 2WIMA 1BXAA 1DFBL 5ESQB 1RPUA 3P9MA 4GKSA 1CGWA 1PLBA 1OPGL 1GGBH 3MNVA 1JOIA 3Q7JA 4LO9A 4PWJA 3IFOB 1JRHI 5IVXB 3NSDA 3WU1A 4IRJC 3ILQC 4OQ1A 1S9XB 1W72H 5J1AA 3RL2B 4YHOL 2AJVL 1JWSA 4HPHA 1ILSA 3MREB 1OGAA 3MRKA 5DRWA 3DC0A 2VJ0A 4MB1A 1OT1A 3MV9A 4PJIE 4PP2A 4YX2H 3QEQD 1CD1B 4K7PX 1NINA 2KC0A 2VDPH 3D85B 3L2NA 2GK0B 5KOMC 4ANUA 1G0DA 3RIKA 4BK4A 1G7MB 4Q9RL 2YD4A 2PYFB 1HCZA 2WZPA 4ZUWA 4G80B 1JPFA 3NJVA 4ZDHA 2C9UA 4X80H 1E42A 1MWAL 3FU6A 4IRZL 4XNDA 2FIRT 1MJ8L 1BQHG 4K3DL 1YEGL 2VISB 4PJCE 3ARXA 4PJIA 4D9LL 1XCXA 2CNZA 1S7SB 2SODB 2YD9A 2R2BA 2XKNA 5DEFB 2OMTA 1SMAA 2CKBB 2OMUA 4J8RB 2FSEB 1T22B 3WFCH 2MCG1 1JS4A 1NAML 2BSED 3LPGA 1RPKA 1IRAY 4JFEB 4XCCH 3BP4B 4KH9A 2CJTA 4PJCA 3T8VA 1R6VA 3GWJA 4ZXBA 4J1UB 2FECL 4ZFOL 1FGNH 2ITCB 3SHSA 1NCIA 4PYHA 1WAPA 5L0QB 4UV7L 4DN4L 1O6SB 3OR6B 4L9DA 3UAJA 2W80C 1E5UI 1BWMA 5BXFA 3HVNA 5F7EL 2OMXA 3BZEA 3ZE0B 5E24E 1MCWW 3CCHB 4OCYL 1JV5A 4WGWB 1BLNA 5ENWA 4KVNH 1NEPA 1AHMA 4KRPD 4N0FB 3AWEA 4YHNA 3VH8B 2RAMA 5FO2A 1LMKA 4M5TA 3O3DA 1AO7E 3SE9H 2Z7ZA 3UZVB 4F15B 3RIAF 3IXAA 3S36X 3OB8A 4LMQI 5JPMA 3IDXL 1Q90A 5DZNA 4DFHA 4L4TD 2OYPA 4G7RB 5I0YA 3SE3C 1ETJA 4XAKD 3VWKC 1S3KL 1WT5A 2L7UA 4XXWA 2G0LA 3IF1B 3QQ3A 4NO0D 1NEZA 5LB1A 3WFDH 2KL6A 3KW7A 1YN7A 4ABWA 1AO7A 2IWKA 1NIAA 3TN0D 5JW5B 5MEND 4N0CD 1BFOB 4IBLT 3ZQ9A 1KC5L 3CXDL 3VACA 2G60L 2ORBH 5JIIA 12E8L 1QWNA 3BVVA 5JW4M 4L29B 4R96B 1RZ7L 1FG2B 1PX3A 1MH5B 1U93B 3B2UD 4JB9H 5FB8B 1G84A 4U0RC 3IDYB 4FXKC 3HS9A 3D3VB 2ZKWA 3L4XA 2LHAA 4LCWB 3O6ML 5LBSA 4HX1B 2RCSH 3BUBA 2NY4D 4N2NA 2W94A 1BEYL 1LTXA 2ZCKL 3RL1A 1GS8A 2J5LB 4JHAL 3ZL4L 5CGMA 1XGTB 4NERA 6CGTA 5KYXB 4N0CC 4JAMB 1CB4A 1QFWM 1DBAH 2R29L 4O4YL 1KTDA 5FHAL 1A4AA 4NQVA 4HS6B 4W1TA 3B2UC 1KTJA 2EXTA 4JO1H 5AW5B 3D30A 4Y16D 4A55A 4CVXA 1JPTH 2X4RA 3ALPA 4H25B 2B9BA 1B6DA 2NY4C 3B2PA 5T3ZD 3FCSA 1KGYE 1C5DB 4L9LC 1EJOH 3OHXC 3U2SB 5FDWB 2BIPA 1PMYA 3WOVA 3FFDB 3N44B 5E8NA 2EDOA 3MN8A 1DUYB 1T4WA 4NJAL 5KJRH 3PY9A 2ERJC 3CHRA 4WWOA 4ELKB 2Q76A 1KV7A 2HG5B 4KI5F 4Y16C 3TT1L 5IFJA 3C5ZA 2Q6WA 43C9B 1KT2A 1OTUD 1T2QL 3PHSA 1A14L 3DUHA 4GUPB 5FYKD 4HLZH 1KPVB 2C3GA 1KXQE 5IV2B 1EZVY 1YG9A 1WO2A 4L3CA 4YSDA 4HOWA 1UD2A 4WHYG 1A9EA 5BJTB 1AFVH 2NCEA 5EB9A 5BRQA 1UWEL 1CD9B 1X7QB 1CFTB 2UYLB 3LNFA 4PCSA 4ZMPA 1N3NA 3VYOA 4BFJA 3GJEA 3HE7A 4UIKL 4YE4H 4X6DF 1A21A 1PX4A 4NZTH 1D5BB 1HILB 3VXRD 1KLGA 2PTVA 3QHZL 4MXVF 1KYFA 3ELAT 4CC4C 1OTUC 4PJFF 2DBLH 3CFMA 1ET5A 4OCXL 1EFXA 2XX0A 1Q0XL 1XXFC 3R1GL 4I1RA 1KXQA 1YQVH 3EFOB 1R5IA 3S8FB 3HNTH 4P5RA 1JF1A 3K5RA 3HI5H 4N8VA 2QQQA 4M8QB 4KKNA 2PPDA 5IJKC 4E41E 2QKIB 4K5OA 2D2CC 1QW9A 5C6TH 1OCRB 4JG0H 1KLUA 3MV9D 4HSAC 5HHME 1X5ZA 5C0FB 5KSVA 4DOHB 3JYBA 5DJZB 3QZNA 4IRZA 1MWAA 3ZYOA 3MA7B 3SOBL 3IFPA 5JOPE 3X3FH 2YQGA 1V10A 2OX5B 1LO4L 4QRPE 3T65B 5IEHA 3FO1A 1VPOL 2XXCB 4X9IA 3VXUE 3LPWA 1O7DC 1F3JB 2FBJL 4PGEB 5J12C 3IBOA 1MY7A 2BSRA 5L9DL 4E41A 2HX7A 2IXQB 2N7AA 1SN2A 3SDDA 1FNSL 2AEQL 3WTUA 4RAHA 1LLAA 4GIOA 4L37A 4PS7A 2EDJA 1A9BA 1NAMA 2CGRH 3KPSB 4KXCA 5AVQB 2EC9T 3SYAA 4Z23A 5IUSA 4AKQA 5F1NA 4HMDA 4JGJA 4G42A 3NFSL 4L3ED 1H8NA 3GXFA 3RX5A 2Q7AA 3T0WA 2FHFA 4QRPA 3MNWB 4PLNC 5BO1H 3WKPA 1OY3B 5BV7B 3Q9PA 2J8UE 4X7CC 1CDJA 5CXPA 4ZFOA 3Q8FA 2ZF9A 1H0DB 3BGMB 2X41A 1TCRA 1UURA 2BZ7A 3LQAH 4CA4A 2X9WA 2YJQA 3QO0B 1OTTD 4Z7AA 4E0RA 4NS0A 4XP6L 3D48R 4A1RA 5EOCJ 1FNFA 3QRGL 3MMEA 4NEHB 3WG7B 4EJ1C 1YEIH 3Q5OA 4JRXB 2R1WA 4MJ2A 1MCKA 1I9RH 4N2DA 2MOGA 1NBVL 3QJZA 3AG2B 1X5LA 2J4WH 3L3GA 3QZWG 2FZ3B 2GSGB 5F89B 4LIQH 4QKTA 2J8UA 2PTUA 3DVGB 4I3RH 5JW4R 4IBTA 2X6AA 4O2CB 1CFVH 1R3HA 2GPZA 4RMQA 4K23L 1UEMA 4N3UA 3AG3B 2Q7YA 5F7FA 3GJFB 1MVUA 1CTNA 4X6FB 2QHLA 2EACA 1E3FA 4NQDE 5DJ2B 3OXSB 4GQ9L 1RU9L 3TA3A 5I5RA 5BVJA 2ZXDA 3RJDA 4XVTL 2R0ZH 3EBAA 3EBGA 4HIEA 2W9EH 2RD0A 5DHMC 1ONQB 3UAJC 1QBML 5I1KL 1PZBA 2F7QA 1AAJA 2GTWB 2Y9RT 3DRQB 4U1MA 1T5XB 2DJ4A 1E27A 3G5ZA 4RMRA 4NX0A 1U4FA 5EZIL 2CUIA 4MAUH 4XH2A 2L4OA 3MOAH 5IW1B 3HJ0A 1U91B 4QO1B 4NQDA 4XB7A 5F88A 4DK5A 1KCUH 2P4AB 5IHUL 4XVJH 4AEFA 4PHXA 3SDYH 4Z78B 1LE5B 2DQDH 2YAMA 4X4XA 5EC1A 4AQ1C 2A83B 3TV3L 3VCLB 2R1YB 3TTSA 1I1AD 4X5XB 2I7SA 4G8GE 4DO5A 1MFDL 2IF7A 5FO7A 3UPAA 2R1XA 3BIKB 3CVHB 4M7KH 3B7TA 4N28A 3U9PL 3JT0A 1ZEAH 5E23A 1EJ6A 1XH3B 1T1YA 4Z5RA 1WT5C 2D7PA 3O41B 4H8WL 4U3SB 3QXTA 4ODSL 1LO2L 4XXWC 1KJMA 1I4FA 4F24A 3NTCL 5FCUH 2R29A 3I3DA 1U8CB 3JVFC 3WUWA 5SWQA 4MJ5B 1IEBA 3T3PF 1G9NH 1Z66A 2IDFA 3IN2A 1KZYA 3FTUA 1D5ZB 4XNXH 4G8GA 3NA9L 3QCTH 5E08L 1URIA 1KFAL 2JB5H 1HSAA 2Y7QA 1RIHH 4YK4B 1KBGH 5E6IA 1PNCA 5D70L 2FO4A 3IMSA 4MA8L 3QDJE 2HTLD 4W4OA 4J27A 4WW2A 5JW3L 1A7QH 4JPVL 1TQUA 2Y69B 4P99A 5HVWA 4DP6X 1XF2B 2DLFH 4QXUH 2OXGA 2W9DH 4YDZA 5E5RB 4PJXE 2WKGA 3BD5A 4EIUA 5D6CB 4YUEH 3L7FA 3I02B 5DUBA 4OZIB 4FNLH 5DFWH 4PV9A 1P7HL 1N6QH 3W57A 1KJ3H 5KAQG 2OMWA 4EOWH 4GMTL 2HJFB 5DJ8A 5LNEA 3O6FB 3QDJA 1M42A 4WFED 4M4PA 1T7VA 2JLPA 2HTLC 1FNLA 2F1EA 1IFRA 4YHKL 1C1EL 2C9QA 2RA1A 2VMJA 3PV7A 3VW3L 4J3VA 5F9WC 4L8SB 3PHAA 4PJXA 1SVCP 3PXJA 4RNRB 1OO2A 4YPGA 4HMEA 3HC3L 5GGTH 3AXLA 3NSFA 4NZRL 3ARGD 3RWFB 1C16B 1NA8A 3PP3K 3SQOL 3L45A 3PGCB 1UXSA 3I2CL 1M2VB 4LOVA 3T08A 4NZUH 4A2EA 4Y19E 5D7IB 5B3SB 4JR9L 3C5ZC 4MSWB 3SBWA 4H0LC 3H3PL 4JFYA 2AJUH 3G9VA 4KRNA 1NC2A 5C6WH 4X8CA 3P4MB 5DWUH 4HU2A 4PJ8D 3ARGC 3M45A 2VDQL 5EBMA 5ECGA 3X13A 3R4DA 4A2FA 2WWKO 3ZW3A 1XTLA 3K2UH 4JY6B 4MS8D 3ZPDA 1IM3A 2BNRE 3QG7H 2G9HA 3LZFH 4Q9QL 2AXGA 4JX0A 1NGXA 4AENA 1HZKA 5J89A 4UOW1 1N59A 3QA3A 4XGZA 4P46D 1EZLA 1HTYA 3VD4A 1YY9C 1KEMH 1EEUA 1G0XA 3BO8B 2VZOA 3PRZA 3HG2A 5DJXA 1ACYH 3T9WA 1Q9OA 1QUNA 2G9KA 2C7UA 3UZQA 5MI0B 2VJ8A 3FUJA 3CLEH 5E1GA 4PJ8C 4WY7L 2A6JA 1FZJA 2C1PB 1JZEA 3TNMA 5CR1A 2KI6A 1E40A 1YMMB 2BNRA 3C5SB 1I9IH 2CKBH 5GGSY 3ZN6A 5K59F 4EBQL 4JFUA 3NQIA 4XN2A 1GZQB 5DURD 4EN3D 1A1OB 4NO5B 3LV3B 5DUPH 3RX9A 3LNIA 2AEWA 4ABVA 4FABL 1EBPA 5DEJA 4P46C 3HCVB 2UWEF 2XZCH 2VXUH 2R2HB 3O4OC 3MV11 2IBGA 3A67L 3IPBA 4NO3B 5I73C 3PAZA 2X7LA 5DSCB 4XMTA 1KJ2B 5IB3A 2WKOF 4D0DA 1H3WM 4PH8A 4AZ8B 4B9JA 1IGFH 4BHUA 2OK0H 2DH2A 2QL1A 1JPGB 3MFGB 4ZFGH 1OAKH 4ZS7L 3SDDC 1TTRA 4FLQA 5CEZL 2VOTA 2W0LA 5T5NF 1UH4A 1AOHA 1X4XA 3ESUF 4RA0C 2BERA 3DSNA 4X8GA 3SPIA 4EN3C 4A6YL 2WUCL 2O1AA 3CSYB 1EO5A 4MJIE 3ZHKA 1EXUB 1S7VA 1Z7JA 3CDCA 4OF5A 1GPOL 1LE9B 1IJ9A 2IMNA 2IPKA 3VFMB 3ZZ1A 4PR5A 4JE4B 2EECA 5AW0B 4CN6A 1I3RB 3KVQA 2CLRA 2VO8A 3BH4A 2AK4E 3HS0C 4GW4B 3B5GA 1DVYA 4EZJA 2K1MA 4FNRA 2WLLA 1AYOA 2Q9OA 1HHHA 4HJGB 4PP1D 5E4EC 4LP8A 3D52A 4U33A 2I24N 3FQWB 3L1GA 5EORH 2E8ZA 3O8XB 2DN7A 4JPSA 1OTSD 3GBNH 2V37A 5IF0B 4YSQA 1FZKA 3H9HA 4XPGH 3KDMB 3WKNA 2E9BA 5HGDA 3K2IA 5HJBA 4URKA 2AK4A 3BH9B 1AYRA 4TULL 1YLBB 4QHPA 3ZGIA 1BECA 3BIBX 3IJHA 3NJJA 3BAYA 3ZTDC 5KW9L 4CAGA 5EDXA 1V7NL 4G6KH 4LK4A 3TA3C 2XTJB 3X3GL 1ODAA 8FABB 3R19A 3TYGH 2GHZA 3QFJD 4Q52A 2OV0A 5CJOH 3CC5A 4QNPE 1CK0L 1OTSC 5D7HA 4PJCF 3U6RA 3RY5A 3S9DB 2YEVB 1ZT1B 2RALA 4FJ6A 2OTUB 4F20A 2NYZA 3SPJA 5CFHA 3SO3C 5JHDD 3P9WB 4AM0Q 4XBGB 5FKAA 4I77H 4LFHG 2F5BH 2HSIA 2P8MB 2GTZA 5JORB 4KZEL 5F9JB 3PJSA 3FT2A 5I30H 3DX3A 2BOCB 3MBEA 3SDXE 2JTDA 3ZDYE 4FX5A 2DQIL 1K72A 4RFOL 5FM5M 4QT5A 4PRHD 5FYKU 5D7JB 3KLSA 1MFUA 3VG0L 1E2WA 3MLRH 1II4E 3D8MA 4I8DA 3IBEA 3SPGA 4ACTA 2YXVA 5HGHB 3AT0A 2X4UA 1ACZA 1G9HA 2J56A 2DIAA 3HZYA 4TUOB 2HT3C 4D8PA 2P24B 3MRHA 4AUJA 4HVBA 1J1PH 4ICWA 5C0GB 2GY5A 3SDXA 1JGVL 1EJFA 5D7SL 4XMKL 4CVWA 2GI7A 2AQQA 1IEAB 3FB6A 3E38A 1XVSA 2ARWA 4BA8A 1JJUA 4M43H 1UGKA 3EGSA 4XP5L 3ZUNC 4PG9A 5I6PA 4ZNEE 3P4OA 4M9PA 4Z95H 4W4OC 4FNUA 5C7XL 4UM8B 4XO8A 1OCZB 5AAMA 3BPCA 2QR0A 2Q87A 5C0AB 4OTXL 4JN1H 4U3HA 2ADYA 4KXZH 4OIAA 3PGDA 4YE0A 5D55A 2AF2A 2VE6B 4ZAKD 1MXGA 5IJVB 5L2JA 1N4XL 4YBLC 5ICUA 4OJDH 3L08A 1BD2D 1UM6H 3MUGA 1N26A 5GSVA 4K9JA 1KGIA 2YAFA 3TPUA 4JFWA 3A4FA 3KE0A 3CFNA 2UZYB 3DTUB 1JF6A 1Y18A 1VKXB 5ISZB 3HTLX 4JN2B 4KGJA 5B3JE 2NNAB 3EJCA 2B20A 3SKNA 1MCHA 1BFSA 3L3HA 3SE4A 1AMXA 2CXKA 3W9DB 4KKCD 2GUYA 2HVBA 5IQMA 2M83A 2A6IA 1PF3A 2UZXA 3P77A 4ZAKC 4FI7A 1WFOA 1JSYA 3DDFA 3BLPX 3GK8H 5DA4A 1JN6B 5DHEA 1UH2A 1SJEA 2R2EA 5DVLA 1NLDL 1D9KD 4PJHE 4APQD 4QOKE 3JZ7A 2AHIA 1B3IA 3MSPA 3QIBD 1QEWB 3LH2H 1MLCA 1INEH 1I8UA 3DVNA 4KKPA 4X6DB 3MLXH 3VRJB 1ZHBB 1PY9A 2K3HA 1LO3H 1IZKA 2CD0A 3RLSA 2BCKB 5D7EA 4B7IA 1WCBA 5CEZE 4PJFB 1RFDL 3R06B 4F7PB 1MCIA 4KKCC 4XO4A 4Y4KA 3RFZA 3OLIA 4JFXB 1M57B 3D18B 5KBMA 3FH5A 1DJHA 4PJHA 5EU6E 2CDFA 1UACH 5F96L 5CD3A 1D9KC 4KJYB 4FS0A 4M48L 1S2EA 2NQDA 4PBDA 1I9JL 1W6WA 1KV3A 3QIBC 4QDGA 2A9MH 4G5AA 2XY1A 5C71A 4NAJA 2X5PA 1G6RB 3B7SA 2VZVA 3KYNA 4YXKH 3MKKA 1S7QA 3GSVB 1XGRA 2XLLA 5EOCH 4JG1L 5ILTL 5CEYB 4A6YA 3VXMA 2B1HL 4FQXA 4FMFA 4PHZA 1QHOA 2ZAIA 2B4CH 1IBGL 4OCRL 3OJDA 4OBRA 4RDQF 5EU6A 3MUUA 4AT6A 5I1HL 1JNHB 4TLUA 5DHDA 1R46A 3OSVA 2VL5A 1XIWA 2XRAL 1ORQB 2W60A 1T2JA 3B6SA 5C8JA 4AMWA 3BZ5A 4FQLH 1BDYA 2DY2A 1A6VL 1KIRA 1N19A 2DYPB 4IRJB 3QWOA 2ITDB 2GIMA 2YGPA 4QOKA 2LTQB 1IEHA 1J8SA 1FYTB 3G5YB 4N0UA 4EZMA 1TEYA 1OGSA 4XHJC 5B1BB 1UC6A 3NQKA 4KNQA 5JHLL 3MLTB 2AEPH 2ICCA 1MREH 3BP5A 1K3IA 3HAEH 5EF1A 2XWZA 3QJHA 4GW5B 2XQYG 2B9AA 2VQUA 1SVBA 2VH5H 4HGWB 3OX8A 1G43A 2NUTB 4N87A 4OZFA 1PBYA 2ZOKB 4YFDB 3VJ6A 1H8LA 4X6EA 3TBVB 3TP4A 1IQWH 3X11A 1N0XH 1U3HD 4GMSH 5CBEA 3QWQB 4PGJA 5GIRB 4OCSH 4QHKI 4TNGA 3DX4A 3NCYP 4K94L 1H6UA 2C8NA 4HKBA 1G7QA 3L5WB 3O2DL 5AW9B 4XPBH 3RY4A 1JYNA 1PCSA 1BZ9B 4QTFA 3QEQB 4PJAB 2SEBA 4U3CA 4WFHD 5CHNA 5IQ9B 2XWDA 3B2VL 3VXTA 3CFBA 3CMOH 1NTDA 2Y5QA 3DO7A 3W5MA 3CV5A 4C57C 1DDHB 4X50A 2Q2EB 2HJKB 2VDLL 3T0BA 1HOCB 2KPNA 4JFHE 4WU7B 4UOQA 2NY3D 4P57A 3WY1A 4PIBA 5JHBA 1U3HC 1A3RH 4X8JB 1Z1WA 1RUPL 3VRIB 5AOLA 1DBML 1OKEA 1WZAA 2Z34A 5ACZA 3TBYB 2J8UF 1MUJA 3NJNA 2AJYL 1P7QA 5HHOE 5ETUA 1UWFA 3ZZLA 4HIXL 3ZKSD 4KK5D 1HHGB 5CLWA 1IMHC 3I6LE 4NXKA 1E7VA 2DMCA 3ABKB 3B3IB 3HNVH 5C3LD 1IBBA 2NY3C 4FKKA 1FFRA 3PUUA 4D0CB 2YRBA 5I24A 4U1JB 4XOAA 1GZPA 3S3CB 4C8XA 3JWOC 2DPKA 4N8PA 3V8OA 2RQEA 5GGVY 4JDZB 3VFVA 1AQHA 5HHOA 1Q1JL 2AZUA 5EEWA 3GSUB 3T3PB 3GSWB 5F9DC 3T0EE 2YPLB 3VWKB 1P4IL 3BT0A 4RAVB 4O00A 3B1UA 1U8OA 4MCMA 3P3SA 3REVA 3K6SA 1UA3A 3HMXL 3MRIB 1S8DA 3N5AA 3BRFA 1N10A 1CFNA 5AYUH 4WFFE 1TNMA 1HEZB 3OBAA