4IQHA

Crystal structure analysis of dysferlin c2a variant 1 (c2av1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
128
structure length
128
Chain Sequence
ITHMLACLLVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alternate Splicing of Dysferlin C2A Confers Ca(2+)-Dependent and Ca(2+)-Independent Binding for Membrane Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Dysferlin
total genus 22
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4iqhA00
2JQZA 3CSTA 2K4AA 2K8MA 4EZKA 4KZ0A 1E8ZA 1DJIA 4NPKA 5CCJA 3QR1A 4IHBA 3DBSA 3R7QA 2CM5A 1A25A 3RDJA 4LT7A 4FADA 4WWOA 1RLWA 2WXKA 1E7VA 2CJSA 2WXJA 4PS7A 3R7RA 2CHZA 4HVBA 5CCHE 3NZUA 3IM1A 5G2NA 2FK9A 1E8XA 2WXHA 4WEEA 4ANXA 4FULA 4ICWA 1K5WA 4FJYA 2WXFA 2WXPA 4FLHA 4F1SA 2N1TE 4L1LA 2WXLA 4BGDA 1V27A 5H4YA 3W56A 5H4ZA 4ICXA 4XE0A 4AOFA 1RH8A 3L4CA 1DJZA 2A4ZA 1WFMA 3QARA 3ZIMA 4GB9A 2DMHA 3OHMB 3QK0A 3TL5A 3LJ3A 2CM6A 2YOAA 3OAWA 2Y3AA 4HLEA 1BYNA 2NQ3A 4L1BA 3S2AA 2R83A 1YRKA 3QAQA 3NSJA 1BDYA 3N5AA 1TJXA 2Q3XA 4TS6A 2A5UA 3L16A 4URKA 1DJGA 2WXNA 2NSQA 1W16A 1E8YA 4OVUA 4V11A 5EDSA 3RPBA 3HN8A 1DJHA 2WXGA 1GMIA 2NCEA 2Z0UA 4QJ3B 1RSYA 3IBEA 4FHKA 4EZLA 1E8WA 3MJWA 3L08A 3PS6A 4OVVA 1DJXA 2DMGA 4TV3A 4LDCA 4QAMB 2X38A 5JHBA 4ANWA 2EP6A 3NZSA 5G55A 3KWUA 3TJPA 4AJWA 2Q0ZX 2ISDA 1BCIA 2CHWA 4FJZA 1UOWA 3L17A 4F92B 3F01A 3F05A 4WAFA 3JZYA 3L9BA 4Y1TA 1QASA 2BWQA 5KJ7E 4L23A 4FHJA 3PREA 4G11A 1TJMA 4QJ5B 3ML8A 3M7FB 4XZ4A 3PYCA 4XX5A 4J6IA 4KZCA 4F91B 3L54A 2V4LA 3P2BA 1WFJA 4WWPA 2WXIA 2WXRA 3PRZA 4TUUA 1E90A 4NP9A 3ZW3A 3DPDA 3PFQA 3T8MA 3FBKA 3ZVVA 5CCGE 4DK5A 3FDWA 3SD5A 3APCA 3L13A 4PS8A 1UGKA 4IQHA 3CSFA 2KI6A 2B3RA 2ZKMX 1QATA 2WXOA 4QJ4B 3F04A 4ANUA 4PS3A 4A55A 3APFA 4JPSA 1W15A 2RD0A 1CJYA 2ENJA 3HIZA 2UZPA 4GNKB 3KWTA 5T8IA 3ML9A 4ANVA 4F93B 4Y1SA 2YRBA 4LCVA 2WXMA 3TWYA 2ENQA 3ENEA 2WXQA 3QR0A 4NS0A 4MJJA 2LHAA 4BFRA 4FA6A 1E7UA 2D8KA 4WWNA 2K3HA 3APDA 4L2YA 2CHXA 2CJTA 1DQVA 1DJWA 2ENPA 3QJZA 3W57A 1DSYA 5JHAA 4KITB 2K45A 3F00A 4NPJA 1DJYA 3B7YA 1UOVA 4EZJA 4DNLA 2FJUB 2CHDA 2QZQA 3HHMA 2QZ5A 1HE8A 3GPEA
chains in the Genus database with same CATH superfamily
4MJ5B 4QHPA 4XVJH 4Q0XH 2CRZA 3OKOA 3QORC 4LFHD 2NY3C 4PI0A 2WIMA 1RLWA 1XGPB 1H3GA 2YFNA 4O9HL 4XRCB 5D1ZA 1L3NA 3TVMD 3QG6B 4XMPL 3ZKXB 2XG4B 4Y4KB 1WRFA 4YMPA 5E6IA 4U1LA 2F6AA 3KR3H 4OJEH 1KCKA 1NGPL 5MERA 2A74B 4X8CA 1KB5A 4YXLH 1Z5YD 1DJZA 1NCDL 1RJYA 35C8H 5IQNA 4WJKB 1A14L 2XTJB 5D71L 3LAFA 1OQXA 4QOKE 4AGMA 1QRND 4A6YH 2CM6A 2QKIA 1IV8A 5HPMA 1YO4A 5GJSL 4X5WA 5GS1C 5IB3A 1E4XH 3TJHC 1U8CB 3VU1A 4CSTA 5DMGD 3SPJA 1QNIA 2F61A 1EHXA 2R56H 1W72A 5L88H 1QLFB 4B0MM 3GBLA 4PW3A 1DE4A 3TURA 3BN3B 1B2YA 4TNVK 5DJDA 3ISWA 2ARJA 1XD1A 2VQ1A 1KCSH 3IF1A 4KROB 3SQOH 3MPCA 1M6OA 3SDCC 5LHDA 3OR6A 5D4QA 4IBTA 3U0PB 3TIEA 2G3ZA 4TSAL 5EULV 3N41B 1SDAB 1YNKL 4ZQKA 3BRDA 3UX9B 3W9DA 4YZFF 2PPEA 1QHPA 3PG2A 4HW6A 3ZQ9A 4KKAC 4M1CC 1QTYT 5CJOL 4E5XA 3VXSD 2F08A 3V7AG 2HG5A 1AZVA 1BIIB 1JS4A 2GTQA 3TCTA 3NCJL 4P2QA 4NKIL 4OUUB 1YC7A 3L5XL 3QUYB 1OLZA 5F8QC 3W81A 1UXMA 5IEKA 1FG9C 1MJ8H 1E5AA 3D4ZA 3EFDH 4KNSA 5DURD 5SWSD 3FMGH 3WTSA 1FHNA 1W0WA 2BRQA 4KK5D 5BUPA 4OQTL 1J0KA 3MRLA 3SB3A 1FBIH 1A6WL 5FYJE 1RZFH 4G43B 3G6AA 5F89A 3CH8A 2O6EA 1F4XL 1JZ4A 4QPEA 4Z6AT 1KMGA 1UA6L 4IGBC 4XNMA 3BYYA 1S3KH 2FUTA 3DRQA 4OTXH 5TQ0L 3KPQB 3CFKA 3RJQB 4GAYB 3CVHH 1NFDA 1RIVL 1YQVL 3SJVA 2FJUB 1I7TA 1AS8A 1SRDA 4WFGD 3MLPA 3N91A 5HGDB 4P99A 4N8CL 4YR6A 4BK8A 5ICXA 3OXRB 5IGXH 4CC1A 1RUAL 2B14A 2ZCKL 4P5KA 2N1KA 3IJHA 5I71B 3NIDB 3RDJA 1OGPA 4PJIB 3VXUE 3U1PA 2MQGA 4D0DA 4QHUB 2FZ3B 5IQMA 3NZUA 1RXLA 3BW9B 4BQ6A 3O2DA 5EZJA 5I6PA 2AABL 4MAUL 3IDMB 5I9QB 1P7KA 4MJIA 1ZLEA 2XTJE 1NCAH 1UB5A 1MW2A 5C0CE 3KGTA 1HKLL 4PRID 5K9OB 2JJVA 2DJ4A 4PBDA 4J8RA 3S35H 1PX8A 1DQLH 2H1PH 3WENA 5C0RH 5JXED 3QFJA 4IU3A 4BQCA 5BJTB 2Z92B 1IQWL 3K5SA 4MB3A 5F93C 2KZBA 3FCTA 4FQHB 3NCEB 1TLKA 2BSSB 1MCIA 3G5ZB 4XP1L 4OV5A 4Q9BA 1CG9A 1MNUL 2Q3XA 4MMZB 3PHOA 4D9RE 2VM3A 3F58L 3CFEA 4S11A 3AREC 4XPAL 1U8MB 2R7EA 2ZOLB 3QO1A 4YDJB 4K3DL 2AW2A 3K6FA 3FB8A 3MROA 3VQ1C 5MEQB 2BY3A 1T6VN 4HOMA 3B2DC 1EUTA 1UATA 5CP7B 3D50A 4HX1B 1PQZA 3ALWA 3V6OE 5IVNA 4JK0D 4XHQA 3RHWK 3WIFA 1NDMB 2FWLB 4O02L 5KVFE 5BXFA 2MCPH 2MTPA 3KLSA 4KMQA 4BKSC 4UT9L 2CHNA 3FUIA 4UYQA 4DEUA 1RUML 5HYIA 1ZPUA 5CZXC 4HS3A 5C97A 1AD9B 4G59C 3WTVA 2HT2D 3ZL1A 1QACA 3O3BB 4M43H 3US1A 4WKXA 2EH8L 4Z78A 4L8DA 3SD5A 3HZMA 2NR6C 2VDPH 4ZMAT 4BFKA 3EO9H 1U3HC 3P54A 2XKNB 3MUJA 5T1DH 4XO4A 4XNYH 1WPCA 4C4UA 1QFWI 2AJ3B 1ORSA 1GOFA 3DMMA 3DV4A 4UOJA 5F7DB 3HZVA 4L0ZA 3QIWC 3MLRH 5DD1H 1VRSA 5KW9L 3DO3A 4PJ9D 4OCYH 3B2UC 4BXSV 4EBQL 4OZIA 3RWGB 2R23B 4JFFE 2I32A 3EJZD 1QBLL 1A9BB 3DX7A 2WBXA 4HBCH 2F15A 4JY6A 3UAJC 2LLGA 1XGTB 3CXDL 4AYDC 2NXYD 3T0VA 4TUOB 1NEZA 3TONA 3MXVH 3PGFH 4FL4B 1QMUA 3Q5OA 2BP8A 4LCUB 5IM7B 3VGGA 1WFUA 3MRKA 2NR6D 4AEFA 1KJ2B 4NKOA 4R7NB 1KTLA 5DJAB 1AC0A 1RU9H 4Y16C 1TVBB 1IBFA 1S7WA 3CSBA 1CS6A 4HKBA 3KYKH 5F2FA 3EJRA 3VFRA 4JPKH 5TK2A 5CP3A 1ECYA 2FWSA 2SEBA 2MKLC 4I89A 2JKSA 4MZRA 3RTQB 2X87A 7PCYA 3PAZA 5C3IA 2ZSWA 2DS4A 4NQDA 4XCNA 1GR7A 4DN4L 1YEEL 1YEJL 4Y5YB 2P80D 1U36A 1PZ3A 3LEVH 1OGAD 1PAMA 2XN9A 4FMVA 4NOBA 3WY4A 2IPTL 4GSQA 3WN5C 3S97C 1FVCB 1GHFL 3WJMA 1II4E 1HILB 1Q94A 5A6MA 4PRHD 1KBKA 1H6EA 3P9MA 4BH7B 3Q05A 5DYOA 1G7QB 1Z0NA 1P0SE 2AVFA 3BPNC 1A3ZA 4NWUH 4BV1A 3AZUA 1QLRB 5IQLA 3T8XB 4TNWK 1UG9A 1LJMA 2BX5A 3NJLA 3QIBC 5SX4I 2A9ML 2AMGA 2KLRA 4OD3L 5F7FA 3NABH 3QWOA 3QPQC 3PWPB 2F0CA 3I02A 3PDOB 4TLUA 1T1ZA 2QVFB 3GC3A 4Y2OB 2AK4E 2VR5A 3SSGA 1MUJB 4V1DB 1TTAA 1RJZA 1UZGA 2WLIB 1OTTD 2UV3A 1KCRL 3VVWA 1NAMB 2X4RB 2UWEA 5AG9A 2IV8A 2UUDH 3RX9A 3C6EA 4ZYKA 2X1OA 3ZDXF 1QSEB 1ZKAA 2JKWA 2ARJB 3QHFH 4C4KO 3VM7A 5LNDA 3ZE2F 1Z9SB 3BMWA 2BJMH 2DTML 2Q7NA 2WWMC 3QYMA 4W9KC 4A55A 1QABA 3IMRA 2FX8H 5D7IF 4Z3JA 1S9VA 3KPOB 4PCSA 3US0A 4YVUA 2D2OA 4H2CA 3DNKA 2WIIA 3BP4A 3V6ZB 2ITCB 3WHXB 2ADJB 4MMXC 3TWYA 3V4VH 3WNMA 3OAZK 5D8JL 4FA6A 3NN8A 1HHIA 2CMRH 5ALBL 4XNUH 4PLNC 1TITA 4NFDA 3V4PH 3RY5A 4HKJB 1YNTA 3MKKA 4DTGL 4UQCA 4HFUH 2ZUXA 3Q1SL 5CZVH 3WDIA 4LQFH 1IE5A 5A7BA 4PB0H 2YXWA 1WDAA 3KYMB 3QE5A 5E1AA 1IGTA 2YAMA 4JFPA 2EDJA 3ILPA 2QQLL 4O2EB 4OF3A 5J11B 3FT1A 4DHLA 3KLHD 3ILDA 3B2UD 4EZKA 3TESA 3UZEA 4MSWB 4X0KB 3SPVB 4L4VB 2H2SC 1WZKA 3ZT6A 3ZTNH 5E8DH 3MNZA 2V5RA 5H35B 1XCXA 2H7WA 3ZPDA 5DR5H 1MCFA 2E8YA 5INCB 2XYCA 4JY5L 1KELL 2XRAH 5D6CA 3MA7A 5KOVC 4BE5A 2EDFA 2QMKA 4NJAL 1DQMH 3RFZB 1AGDA 2CBTA 5IJVA 1PY9A 4I77H 3KYNA 3RIKA 4BUQA 2DM4A 4HLEA 4Z7OF 5EA0L 1IC7L 4LCYB 5CEYA 4UTBA 3GI9H 2VW6A 4MA1C 3CIQA 3EYSL 2X4TB 2OMXA 4M61B 2AK4D 5DRNA 2EUXA 3JWNH 3EO1B 3N6YA 1ZHKB 2Z0UA 3L3JA 4FYQA 4OLYH 4YBHA 4L48A 2BNQA 4U6XB 1B90A 1A1MB 5DRXA 5KSBE 3CFKB 4J5VA 5J89A 3ASOB 4GAYA 5IVXE 1EDYA 1NBYB 2DMGA 1Y6KR 3FN9A 2CUAA 3O3EA 2PETA 4JFHD 2QSQA 2Z7YA 5GSVB 1LK2B 2OXHA 4UQ2B 3QVAA 4X2UA 3ZIYA 2X53A 3QDMD 5B8CA 1JMZA 4P2RE 2YRLA 5A2KH 2YGOA 2A73B 2FE0A 1N26A 3RGVB 3MJ6A 3ZMNA 1ITBB 1S7WB 3SOTA 3HJEA 3D48R 4ZOBA 4I3GA 1OWWA 4Z9KB 5EUOF 1NGXA 1RY7B 3CX5K 2UY7B 4PJXF 2QFRA 1NL0L 3LDBC 1MG2C 5F7NC 3ZL4L 3BO8A 4P05A 1XO8A 4ZFQA 5EBMA 3RZCC 4PJDF 3TO2B 5JTWA 5DCCA 3FSVA 3VFPB 1E43A 4MVBD 1V3KA 1WE5A 3VXQA 5CEZH 2M8XA 3TBTA 4WI5A 3MOBH 3V0AC 1FGVH 3F04A 4EN3A 3OB8A 3X11B 5DC2A 4PJHB 3FTSA 1TXKA 4P59L 2KQNA 4M5YL 4K3HA 4OZGF 2VE6B 2E5EA 3KPTA 4KI5E 5CJQH 3MLYL 4L1HA 5I66B 4PJ6A 1MFUA 5MEOA 1N6VA 2DPKA 4OBRA 1E27A 4F8OA 2HSIA 3WHE0 4B27A 3N40F 1NEUA 3GPSA 4GMTH 2WMPA 3ZUCA 1EO5A 4HWZA 4N5ED 4NI6A 4YFDB 3B9KC 3OLEA 2FLMA 5CP7A 2Q8AH 2QQNH 4LPTA 1LMKA 1T0MA 1GGBL 3C5ZC 4LLDA 2H0EA 2Q86A 1EFXD 3SY6A 3GSRB 3LQAC 3QB7C 3GB7A 4AMXA 1G5GA 1ZHKA 4OKDA 2YRPA 1F2QA 2GIXA 3H4FA 3N9GL 1NZRA 5HYFA 1E4XI 1FYTE 1NBVL 3FT0A 2GUOA 4X8GA 5CFAA 2MH4A 1QSFD 2R1YB 4YDIH 5GGUA 1L9PA 4I0PB 1KB5B 1AQ8A 5DMKA 2VLMD 4PREB 1GZPB 4MA3B 4Q0XL 4XBMA 1ZXQA 5B8CB 3LXAA 4E41D 2BMKB 1D5BB 4WUUA 2AFNA 2XWTB 4N28A 1X9RA 2XWCA 3QQ3B 1LHZA 2OZNA 1CD1B 3MX0B 4PU2A 3ARBD 3PUCA 4OM0L 4JRYA 3DPBB 1A9EB 1HQ4B 4GW5A 3S8GB 5DQ9A 3AGWA 2XPZA 4KKQA 5DZVA 4FJ6A 2NX5B 2UX6A 3D3VA 3D4GA 5CSZB 5IEKB 4YHOL 3BSZL 4QR7A 5D71H 3VXSB 2OULB 1TETL 4HUUA 3WCYA 2CA4A 4KRPB 4XBEL 4ODWA 3BRFA 4G9DB 1EEZA 2W81C 2X38A 4JFUA 2XN9B 1CLYL 3ILPB 4O2EA 4A1RA 2BSCA 4M7ZC 4K3GA 4MDIB 2C26A 4BBWA 5G4NA 5D72L 1WFTA 1CZ8L 2NNXA 4BEIA 1GYWA 2FD6H 3TJEH 2IV9A 2AQNA 4X6EA 5GGTH 5CU5A 3V5DB 1NFDF 1XB3A 3VWKB 4FHBD 1GGIL 5KG9B 4FTVD 3FRPB 1G7MB 4HU2A 4DUWA 1IBGL 4JFOB 4KKPA 2J5LB 4IQHA 1MFMA 1UC6A 4DGIL 4KJWC 4AV0A 5TQ2H 1KJ3H 3TASA 2HLEB 3GQFA 1FSKB 3EYFA 5IMKA 3SDCB 5ABZA 3CVDA 3NGBC 1KTKE 3DIVA 4P46C 4JL1A 3T65B 3FQ4A 3IDNB 4QXUH 2Q1EA 3G6AB 3TN0B 3FUJA 3VH8G 3GXFA 4XNZB 1KC5L 1RMFH 5GRJL 3TEZA 4OZHA 1DO5A 1K72A 1RVFL 2GSGB 1J1PH 2WLIA 3QHTC 4PRBA 4R7VA 4Z7NE 4PGCA 4D8PB 2CJTA 3DWTA 3F6IA 2VMFA 3J27A 3P3SA 4N5EC 5I28A 1GW0A 2NX5D 5JHAA 3RURA 5L4MA 1OAXH 4I2XA 4PJ8B 4XP6H 3P11L 5CGTA 4LSQH 1S7RA 2WZ0A 2DQIL 5D7KE 3QWOB 3EGSA 5KSAA 4KVCL 3H3PH 4RLDA 2K3TA 2NY2C 4AKOA 1FIEA 1JGEB 5T3ZE 5FGCE 4AG4H 1U8PB 4JQVC 4ZFOA 5IJKC 1HHJA 3KYAA 3CSGA 2FLBT 1IAII 2LVEA 1X7QA 4H25A 5DEZA 5BZZA 5KTEL 4XVTH 1NGXB 2F5BL 1UA7A 3NIDF 3IMBA 3VB8A 1P7HL 1WUZA 2E4FA 2LFEA 2OTPA 4R26H 3UABA 4W81A 3LY6A 5D7LD 4BSWB 4MDIA 3Q2VA 5DC0A 3QDGA 1DP0A 2VUYA 2BWDA 3GMNB 4X99B 3WBDA 5BVPL 1WFMA 4LL1A 1R0AH 5DO2C 2ESVE 2XQBH 1KTDA 1URLA 3QAZB 5BV7B 5D1QD 5IJKA 1A3RL 1T03H 5IFJB 3WO4C 1M3IA 3WJLA 3FSOA 2Z4QB 4YDJA 1DDTA 4PP1C 4DGWC 3OKNB 3WXWH 1IGML 3KCWA 3VA2C 1B0RA 3T0EA 1MEXH 4RZCB 4P3CL 3HE7D 4OFYA 3QNYA 4PGEA 1EFXA 3FC8A 4JM2F 2VLRE 1QR1B 3TYFB 5C2BH 5EIVA 1KBWA 4DK6A 2EEXA 2ZWKA 2H8PA 2X40A 5FKPB 1OF0A 4QTHA 5H37A 1H8NA 4CRPA 3QA3A 1HWHB 4JDVA 1MRCL 1X9LA 2WYTA 3TBWB 1U8KB 5FFOA 4BD4A 4PRBB 2JI2A 3FO0L 4HSCX 3WJLC 3X13A 5DQJB 1INQA 4ALAL 1Q38A 4RVBA 1A7RL 4LSVL 4ABWA 5IFHH 5JQ6H 2BNRD 3DPDA 4KTEH 4ELMF 3LS5L 4LO9A 1FNAA 5BRZB 3GJFB 3OXRA 3LXUX 4FXKB 3CU1A 4JFVA 4QHMA 4YR6B 3MOAL 2OPCA 2MCPL 2HKFL 4WW1A 4P23B 2E7MA 4UT9H 1MIEL 1M7IB 5GGRB 4BKLA 5LQBH 3H56A 1M42A 1G87A 1T7ZA 4AE1A 1A0QL 4AMKL 4JM0A 2A83B 3AC0A 3WFBH 2JJTA 4H0IA 2R8SH 1KUMA 1FVDB 2VDQL 3GS0A 3LZLA 1SPDA 3O6FB 4UTBL 4XBGA 1G7PB 2YEVB 3BEWB 5E1QA 5IJBC 1A1OB 1IBYA 2AV7A 2CUMA 5EB9A 5EFIA 4KK9C 1MVFA 1P6WA 4KVNL 3IU3A 5H37G 1OEZW 2DAVA 1NLBH 4WTZG 5D7IB 4MAYA 1UD2A 3X1NA 4UV7H 5C0AA 2IBBA 2VWEC 1HE7A 4OZ4A 1Q0YH 3L5WB 4PYGA 5DMGC 5LJYH 2K9FB 4MD0B 1WYJA 4GT7A 5CM1A 1OO2A 4P5TB 5CR8A 5AVUB 4S1DD 1CYXA 3A24A 1Z9MA 1VEPA 4BUHA 1GAFH 3S88L 3ARXA 3GJFH 4OGYL 2JFCA 2WVUA 4M7LL 4HJEA 3MRDA 1P5UA 4BZYA 2ORBH 1QLEH 3TZVC 2CDFB 4JO4H 1FH5L 2Z93B 2EXWD 3LD8C 4FZ8H 2LQRA 2B3IA 1D9KC 2PCXA 2ZOWA 4GSDL 4MCYA 2WP3T 3WJJA 5JMRA 5C0GA 2D2CC 2HRPL 4LSSL 3MLSH 4GP8B 3ALXA 3D6GA 1L9SA 5HI3D 4EI5D 3N0PB 5CAYB 4GXFA 3P2TA 2VLME 1A4KA 2YD8A 5DFTA 1NQBA 4U1SB 3D39D 3EZ8A 2W07B 1LDPL 2X09A 5LBSH 1PDKB 4JJOA 3GI8H 4JO1L 3DUUA 4NZDA 3S5LA 1P5UC 2MKWA 4LOEA 4DKAA 5LWYL 2YUVA 3QUXA 5BS0A 2BNQE 4WNJA 4X5RA 3H3BC 2P1YA 1I1AB 4PV9A 1OGTB 32C2B 1QSFA 1FRGL 4PRNB 3RYMA 3TJPA 5GGVY 4LARH 2OP4L 4HIEA 5MENB 4OBSA 2ZTBA 5C0IA 2R2EB 4KUCD 1U93B 4K3EH 3IS0X 4TQ8A 1QASA 1A8ZA 3KDMA 4ODXA 1TU2B 5B38B 4N90D 1HHJB 3TM6A 4W9JC 4BZ2A 1OM9A 4ZODA 3DVGB 1P5VA 3TBVB 1UCTA 4KMTL 4PJEE 4UNIA 3MZTA 5DD3L 3SYCA 2W5PA 4LGRB 2DYSB 4KHTH 2IPKB 2BW5A 4KFZC 4PJXA 4JW3A 3QHZH 1WF5A 1PLGH 3OKKA 1KDIA 4I3SL 4IRJB 4R7NA 5HDRA 3VAEA 4AK1A 4ZMXA 1KGJA 5FDWA 1I4FA 1MRDH 5BUAA 2UXVA 4MCZA 2C9VA 3CQPA 3QG7L 4FNPA 2IAMD 4UT6H 4YDVA 4DW2H 2AAVA 3BZFB 1KPUB 1JV5A 5LGYA 2OYPA 2NW2A 4B9IA 1N8ZB 2AXJA 3SGDH 2G0LA 5ECGA 5B1CA 3VI3F 2Y1ZA 5BO0D 3A67L 3WE6A 2IGTA 4NNPL 5FAAA 1PD6A 5EOCH 1ORSB 3DMMB 3DV4B 3MRLB 2B0SH 4JFOA 5EIIG 5A2BA 1JPTL 4HF5L 4YXHL 5DWUL 3QH3A 4YSDA 4AQ1B 3ME0B 4YSOA 1SY6A 3DX0A 2OZ4A 4JFDB 1VFAB 2DWYA 1JZFA 1EXUA 2NY7L 5E0QA 1TMQA 4OCLC 4XP9H 1F4YH 5D8JH 5GGRY 1W6LA 3REVB 2DQGL 1AY1H 1FAIH 2IMNA 3R19A 4G6KH 4KXBA 5ALBH 4N2BA 1W6WA 3VXNA 4O5LH 5HYSA 1DSWA 1CUOA 2ZUTA 4R96A 4PJ5B 4TUJB 3IXAB 3OXSA 4YWGH 2K78A 4LCIH 4PRNA 4Z76B 2JF1A 4ODWB 3BGMA 5FYLH 1BLNB 5CLWA 1ZLDA 1MCLA 4MQTB 4U3SB 2CU9A 1IAOA 1A6PA 1FO0H 4Y2OA 1F11A 2XG5A 5AZ2L 2YPVA 3L81A 5E8DL 5CMAA 3HVDA 1XH3A 5C0AD 1BFTA 2W1NA 2NQ3A 4BFGA 4BRVA 1O9VA 4RISH 2OCFD 4XO5A 5EZOH 5B39G 2MSPA 4LEOB 1HU8A 1QFPA 5DA4A 2Q5BA 5SWSA 1SLUA 4QNPF 3MUGB 1UWXK 1R19A 2VKWA 3MODL 4OVUA 3B9KB 3RPBA 3MNWA 1QO3A 2LW3A 1HXYB 3IMVA 4HV8B 1DQML 4XMLH 4PCYA 4MTMA 4Z0XA 1K5NB 2NR6A 5L6YH 3B9VA 4UT6A 4WVRA 3UTPE 2W9LA 1IC1A 4QLRA 3C08H 1IC7H 1UJ3B 5KANG 3GBDA 2YD0A 3GI9L 4MJID 3RWFB 4MX7B 4FX5A 1TNMA 2MJWA 3MCKA 2D7PA 3PQYB 1NCCL 4KDWA 5J9PB 2X0VA 2JTYA 3NJJA 2JELH 3OJMB 1SJXA 5MEQA 3FQXA 4QRBA 4FCAA 5E8OA 1EV2E 1FC1A 3MREB 4YDMA 1RZIA 1KB9J 4YLQT 1W91A 2R29L 5IQOA 4PG9A 1FORH 4OZFA 4PS4L 4HJIA 3MO1B 1MHPH 3KLQA 3QCUH 4I0PD 1EA9C 3PWPE 1TO4A 3V0FA 1RZJL 3G9VA 1IT9L 2XYBA 5EZIH 4PJHF 4WK4B 3T0WA 4Q52A 3RZCB 4IRSD 4FI6A 4GT0A 4GSUA 3T6QC 1ZT1B 1VADB 1A6TA 1P7QD 4HUVA 4PD4J 3SKOB 4PIRF 1OCZB 3QUZC 4XGZB 3ETBF 3LPFA 3WS6A 1V3MA 2YK1L 1P1ZA 4A39A 4ANVA 3NG5A 2BY2A 5FOJA 3DVNB 1NIFA 4XWOD 3W0WE 5D2LA 5EOTA 3ZYJA 2X70B 1ES0B 2GK2A 4WI0A 2DQDH 4D0BA 4R4FH 2FQGA 1IQDB 3QNFA 4WU5B 4TLSA 2OMVB 2VDNB 1W0WB 3O2WL 2FHFA 4PJIA 3RKDC 3GS7A 1KCLA 3QR2A 2WOBA 3X3FL 3WDJA 3NEOA 2DM2A 4ZMYA 1P1VA 3SCMD 5BZDA 2H2PD 2GFBB 3A3YB 1FFNA 3D5OF 2AJZB 3KAAA 2I26N 3MNMA 3P4OB 3B2MA 3Q8EA 4RWHA 1FE8H 1PMYA 4KKRA 2X88A 3FTGA 2Z8SA 2H6PB 1IFRA 4QXGH 1G9MC 5AVRB 2B16A 1EAPB 4MQ7B 3QT2A 3ZDXB 5C7XL 1RZKC 9CGTA 3LNDA 4QTHB 2BMKA 3WELA 5HGHA 2R0WH 2WKOF 4WSJA 5B21A 2X6UA 1WUNT 1GGBH 3BKCH 3PQYA 2XBZA 5FWQA 3DX9A 3N85L 1Q4NX 3DGGB 4H8WL 1HCYA 4P5MB 3CK0L 4KX7A 1YYLH 2B9BA 1JHKH 1UXSA 5DQ9B 2VN5A 4HS8L 3L9EA 5AZUA 4RMRA 5GS0H 2FB4L 4HU8A 4R90H 3WHE1 4S2SB 3BKJH 2DQUL 3RVWC 4AUUA 4BHUA 5DUML 4UQ9A 1HHGA 2WXGA 1GMIA 3ZRCC 5DZOA 1SN5A 4B95C 1QD0A 3BGFC 4QRPE 4CNIB 2ZT9C 1SGKA 4XGZA 1SBSH 2W60B 2R9HD 4TNEA 1A9VA 2NTFB 3VSTA 5GGVH 5ILTH 2CHWA 3PXJA 3CQQA 1UASA 1WP6A 5A1AA 3F01A 3SJVD 4R4ND 3D25A 3CH1B 4IJTA 2EILB 1NAMH 3QNZA 3SKJL 5JUEH 3BZEA 1BVKB 2HT4C 2IDFA 3M7FB 3PYCA 5CD5C 2X2UA 5E2WL 1DL7H 4M1GL 2YLHA 4R96B 1IC4L 5I1JH 2F1EA 1G7IB 4NOFA 5FUZH 4KZDL 2BOCB 3R0NA 5CS7A 2UY6B 4DK5A 1F86A 1L0QA 3QXAA 3IVKB 4DP5X 4MJ5A 4QO1B 2GAZA 3FOMA 4KVPA 3U2IA 4AGQA 2AK1H 5C2UB 3BH9B 4AZUA 2E9WA 3GNMH 3VGBA 4Q4IA 3EXLA 5C0NC 2A2QT 5IB2B 4AV4A 4R83A 3RILA 5DK0A 2ICEC 4LRNL 4PM1A 3X14A 4FI7A 4CBPA 5JXEC 4QHLB 2XZQL 2XG4A 5HDWA 4LDEB 4UQAA 4MD4A 4JFZH 4ADIA 2ED8A 4ZO8A 3MRMB 4NT6B 3MRIA 1GY1A 3I2CH 5DS2A 1JGUH 4TSCH 3I84A 3MRJB 5ID1A 1AO7A 3IN0A 3RWIA 4WTZA 4KJPD 5CSBA 2MRYA 5D2NA 5EDXA 1CTOA 1UD3A 5KJRH 1ANUA 1NGPH 3CFIC 3POHA 4PR5A 4MCZB 5DU7A 5B3JE 1E9QA 1VCBC 4HPOL 5CIPB 4I3RL 4KZ0A 4NNYB 4B41A 1J1PL 1QEWB 1MHEB 2ICEA 2Q76B 1V54B 5GJSH 2HWZL 3KLLA 5ALCL 3K4AA 1OAXL 1JWUA 4DUVA 5L88L 1SXAA 4AI7A 4TNVF 4NXKA 5EC1B 3EFFB 1EEZB 1BQUA 4AVIA 5JIMA 4JG1H 5FYJL 1NM4A 3H3PL 4ELKB 3QIUC 3TCLB 4FXKC 3RGBA 1EGJL 1SZNA 5C7ZA 1HIML 5IY5B 1SVCP 3RUGF 2VYRE 1UKQA 3V79C 4XB3A 3JZ7A 1AOZA 2XHNA 2BO0A 1SUJA 4L1BA 3HPLA 4M7KL 5DGRA 2A9BA 2EE2A 1TTGA 3BVVA 4GRLC 3SO3B 3S9DB 1JK8A 3BLKA 1DUZB 2JIXD 1G7LB 4HIIA 1I7ZA 2A77H 4ECNA 4LNRB 3UACA 5KSVA 3V9EA 5IB3B 1VB9A 4HCFA 4QOKA 3C12A 4XCNB 3QIUD 1CGYA 3RBSA 1UOWA 1RULL 2HLAA 2P52A 4DN3H 1IGMH 3BZ5A 5IUSA 5E6ZA 1OZUA 4JPQA 4P3CH 5G5DB 1CLOH 4RETB 1WV7T 1IGCH 3BE1H 3HKZA 3ECBB 5E6RB 4GRLA 1H3UA 3O8XD 3UYRH 2OSYA 1G9MH 2G5UA 3T6ZA 2WTRB 5LB1A 3BH8B 2WQXA 4AEIH 1QNZH 2UYLA 3T8MA 1T83C 4PJFF 3G5WA 4HIHA 3KPRA 5FPIA 4JUSA 3WKPA 5DHVA 1PTZA 2K7PA 4WIQA 3M1CA 4TYUA 3DX3A 3FO0H 4TULL 1F11B 2XG5B 1FL5A 3U46B 1NAMA 2HH0L 4BINA 3O6ML 1UM5L 4HK3N 1CR9H 1XIWA 2VW4A 2PMZA 5KVGL 5HHPA 4K7FA 5T8IA 2FNBA 2QLYA 4JHBA 4XCEB 3S36H 1QEXA 1KGCD 4YDKL 3CHQA 2QGCA 3L4TA 4XCFL 4YSCA 1FNSL 4XMKH 1R5IB 4JR9H 3QUKA 3IFPA 2F54D 1EDHA 1PBYA 4KRPC 2IAMB 4PN6A 4LFHG 4A6YA 1IEBA 3O8XA 4H4NA 1IEAA 4N25A 1MOEA 3WXVL 1EJOH 2ZCHL 2JB5L 1KBPA 1FLRL 3R8BB 4Z3IA 1ZLUK 1NBCA 4R2GC 1FPTL 3C6LB 3FQRA 2WLMA 1BQHG 4HHAB 2E86A 4GOSA 4ZFZB 5EUKB 5HVWA 1FGNL 3VACA 1KGUA 2ED7A 1IBBA 2JIXB 2XWJB 3BIKA 1IILE 2IPUK 3UP1A 5FM8A 2Q9OA 3EOTH 2GQHA 3S98A 3QWRD 3K6DA 5KVDL 2FBRA 2WYIA 4PMEA 1JE6A 1CURA 4XNQA 3LRMA 2ORBL 4J4PA 1C1EH 1SM3L 2YARA 3NCYP 4NN7B 4JO3L 4XNQB 3P4MB 3CFCL 3HS0A 2D4DA 3MKGA 1AGDB 2L8AA 1PLBA 3GHPA 4M7ZB 5GHWH 1L3WA 1ZIBA 1QFOA 2DQEH 1AACA 2TSBA 4LSTH 1Q9KB 5IVZB 1MCWM 5AVVB 4H2AA 5HVGB 3ZE1E 2QVIA 5GGQL 1OSYA 3H85A 2APXA 1FFOA 1C12B 3ASWA 4IGBB 4ZUTA 4XPTL 4OT1L 2W65B 3SY0A 2WSPA 3TNMB 5T5NG 4L3FA 4L23A 1DVZA 2EDEA 5E4OA 5LWYH 1HINL 1L9TA 3MRHA 3EF7A 1S6NA 2JK5B 4N0UA 5F21B 5B39B 1Q9WA 4PJ7F 1TJGL 5IWLC 2W92A 3MLRL 3TNMA 3WOVA 4X4YB 3NJNA 4GKSA 4UAHA 3ROLB 4F2EA 5JNYA 3A4EA 4PJ9C 1JAEA 3I3EA 4HBCL 2RA1A 5I6KA 3L2MA 3GLEA 4K94H 4MB5A 1ORQA 2B3RA 3CN4A 3FTVA 3DX9B 2CCLA 4WI7A 5KSAC 2RMNA 1BF8A 5MEOB 2B15A 4JPSA 4PJEB 4JJ5B 3RWCB 2VQUA 3VFWA 4N1HB 1DBKH 3P3YA 2M1KA 5EBWA 3DJRA 1KXTA 1X7SA 2PYEB 3LPOA 4KV5F 3V10A 2YMOA 1B0WA 1P5UB 3L1EA 1ZDSA 4OZIE 3QHZL 4N2DA 1DLHA 1R1CA 4PWIA 5HYSG 2VR9A 3MGAA 3X11A 3AABA 4RRPA 2VR6A 1GYAA 5FX3A 1XL6A 2V5MA 3QXAB 3IVKA 5DD6A 3QWQB 4TPRL 3T04D 2IFGA 2HFEA 3GSNA 4HKZB 4XCCL 1A3QA 1JDAA 1ZCRA 3HHMA 3LJ3A 3U30C 1NMAH 2PCFB 2OMUA 3H6AA 3L1GA 3LSOA 3FQNA 3QZBA 4PJIF 2VM4A 5C09E 3R4RA 1G43A 4L5FH 2BHFA 1KG0B 2FL5A 3IU3B 1EBAA 3SODB 5EU6A 3AY4A 2YJQA 2WXJA 4G80A 4X50A 4DO6A 4YAQB 4FQLL 4NRXA 5ANMA 5FF6A 1AZBA 3RVUC 3WLWD 1AQKL 2W60A 3VDBA 1L7TH 3PIQA 2NY4C 1ZGLM 1YYML 4G42A 2EVGA 1CFVH 1J5DA 2FWOB 4HPYL 3QC5X 3QO1B 1P4UA 2IGFL 3MU3A 2GYSA 1CO1A 1XF5A 2EKSA 2QPDB 4MRBA 3VDAA 3TEXA 3R1GL 4K7FB 2EEAA 1DBAL 3SPGA 3V4PA 4AQAA 4BFEA 5JW5A 4QRFA 1S3RA 2MNWA 4HC1A 1Q72H 1UZ8B 4XPFL 3VXOB 1RZGB 4U6HB 1NC2A 2AEPL 3QQ9C 5CILH 1J12A 1P84J 4MNHB 3JTTB 4NDMA 4PVNA 1TTBA 4N2LA 3B43A 3MCKB 4IOIA 3WV0A 3HC0A 2CQVA 3QHFL 4NIYE 4OI8A 1TR7A 3TFBA 2F7QA 3C5XA 2XPGA 1EH9A 3NAAL 3E38A 1YVLA 3FU8A 3UGXA 4DP0X 2L7QA 3V0VB 1MCEA 2J1YA 1U95B 2XWBB 4PJFB 4QIRA 1MCDA 4PJCE 2OQJA 4GI9A 4FOMA 2W59A 4Y4KD 4NO3B 3GMRA 1KDJA 2OJ1A 5I74C 5BRZE 4B9FA 2YPLD 4AKQA 3DX7B 3KJ6L 2VW7A 1KLGB 1NANH 4ISVA 3KEHA 2XN1A 1EMTH 5I1GL 2PYFB 3ABKB 1Y7VA 4UOW1 2UWEE 4X6DA 4X7TB 5E1IA 4F93B 4PIBA 3OXSB 1SFDA 4X83A 5D1ZC 4ZTPL 3ZTNL 1JCVA 4DP2X 5LXGH 2A3TA 4BK5A 4U7KA 1JRHL 2IAAC 3WN5B 2DQCL 1KJ2A 3H4HA 1M9WA 4NKOB 2QADC 3WTYA 2YBGA 5DR5L 2DWEA 2NNAB 4BQ8A 2JI3A 3WE1A 1M2VB 3REWA 3BT2H 4FQXD 2QTVA 2RB8A 1D2OA 1S4IA 1WA1X 3LX9A 4KXAA 3IJ8A 3VFSA 2WQAA 1ZK9A 3QXUA 3CJJA 4NYLB 1WAPA 2TSAA 3NT0A 5ITBH 5JLZB 4HPHA 3GHBH 3QQ4B 4J8QA 4QRRD 5CLXA 1EXGA 1T89C 1E5UI 1HHIB 2PP9A 3E6FB 3JWDH 4L3CA 4U1HB 2FK9A 4IRZL 4BUGA 5KN5B 4PRIB 1FZKB 2IG2L 3CLWA 1MIMH 3SDAA 2CDEA 1H6TA 2EYRA 4FL4C 4HIHB 4ODSL 1MCQA 3K6IA 4GFTB 3O9WC 3P73A 1P9MA 4MNGE 2VXUL 2R0KH 2VGLM 8CGTA 4X9IA 2EDTA 3JWNG 4M6NH 1I9RH 4PJ7A 5CZXD 3S37H 4P0DA 3PU7A 1RZIB 1KN2L 1BZ7A 3LKQA 1KXTB 4PGBB 5DJZA 4FA7B 2DBJA 1NUGA 1DJGA 3B3BA 4KI5F 3HNTH 1KV7A 4GQQA 5ESQB 1MWAA 2DICA 3MRFB 2V2TA 5LG1A 3SDAC 3ABZA 3EH3B 4Y16B 3OMNB 1GMEA 1MUJA 3T2OA 4LCYA 5CEYB 4HUMB 5IVXA 2PYFA 2ZWNA 1CE6A 2JNZA 1NGZA 2AJUL 2Y7OA 4IHOA 5DZPA 5E6IB 4DPRA 4O2FB 4A04A 4M61A 4MAYD 5CCKH 3NFPA 5F9AC 2XWXA 2ZP0T 4J27A 1SY6H 3BKJL 3FCBA 4IOSD 2KUTA 2J8UA 4JQXC 2F19L 2P4AB 5SWQA 4KZEL 5ESVB 5CO1A 2VLJE 4F57L 3FQ1A 1U6AH 4ODUB 4L1TA 2EDBA 3FCTB 4FQHA 5K1NA 4RNRA 3DPBA 4HKXA 1WT5A 3SHSA 4XXDB 2OI9B 3WO3B 3WAKA 2UZXB 3CFDA 3MV8A 1CU4H 4UB0L 5K39B 1DBML 1N5AA 3TA3C 4HCRA 2EXYC 4CKVX 4OAWB 4OGQC 1FVEB 5T1LA 1U3HB 3ZE2B 2P5EA 5F8RC 3RAJL 4OD1L 1EJ8A 2B1AH 2FBOJ 1NOLA 4ANKA 1HC1A 3Q3GB 1A4JA 1XR8A 5DT1H 1KGWA 1MY7A 3PWPD 2ZYSA 4KGJA 2R1YA 3IS1X 5DQDL 5GGUB 4JCLA 2MOGA 3QW9A 1COBA 2F58H 4MJJA 3MLXL 1H19A 4GKSB 3EF4A 3T0AA 3BYTA 3K4DA 1UXLA 4MASA 4P5TA 1YEIH 2VMEA 3IDYB 1MDTA 2QV2A 3ZZLA 3D39B 1UOVA 4KQ0A 1GGUA 4LRNH 4BWWA 3RFZA 2J88L 1NWPA 1YC8A 4NGHH 3FT3A 1N19A 2O5ZH 4HEME 3UC0L 5F7MC 4HA1A 1IFHH 3ZZSA 1E27B 4IGBD 3MRFA 3F7VB 2WKOA 1AZNA 1CXIA 2ZUWA 1OAZL 3MLVH 4HXAH 4MMZC 4YHPB 4I18B 3WFCL 4ZD3H 2GI0A 2Q3ZA 2TRYA 1LVEA 3D39E 3EGXA 3MJ8B 3VFTA 3Q5YA 4BH8B 3QIWD 1W0VB 3FHAA 3H0TA 3X1EA 3DUUB 2OMUB 2HWZH 1DBBH 2EJ1A 4FZEH 3QDMB 4Y5XA 2LGNA 4EUPG 2AJXH 1BVKA 1NCGA 4JDZA 1MZYA 1BMZA 5F0JB 3IAPA 3U7YL 4CDHA 3K8LA 3BMVA 1MFBL 1OK0A 3Q06A 1YMMD 2UY7A 1CZ8H 5KSUA 2YPLE 2R2EA 2DLHA 4MMZA 3CZNA 3T2NH 2A73A 3E0GA 3CDZB 1CFNA 1H3WM 5E8NB 5GRYA 1F0LA 1X3DA 4PJEA 5I19H 1ESOA 3C2AL 5IB2A 1UB5B 1ZV9A 2B5IB 2H6UA 3RNQB 2VSDA 2PKDA 4X5LA 1NPNA 1ZXKA 3FOLB 4FHJA 4JZOA 4MDJB 1QFWL 5BQ7A 5GRJH 1HOCB 3FTWA 3L4WA 5FYKD 4XH2A 2CLZB 4GQZA 3TA3D 1MAMH 4NRZA 4G6JL 3FSWA 5I6OA 4UANA 5ADPL 2FYYA 2NMSA 2O5XH 1KB5L 4NERA 4NZRH 3RWEB 5HPOA 4QRSB 1LE9B 2EDRA 3GMPB 3S3BB 3HBZA 3Q2LA 1I1FB 3FBQA 5IW1A 1EAOA 2F8OA 3GK8L 2ZF8A 3QXVA 4CN4A 3FUKA 5DJCB 2XIDA 1ID5I 1INEL 4G71B 4GAGH 4U6VH 3DX8A 1MVUA 2Y7SA 4H0GA 3TV3L 1I3GL 2VDOB 1Z6JT 1G9ML 2WKLA 3QI9B 4LPCA 4XPGL 4LP5A 3KMDA 3VI3A 1ZHLA 3P3RA 4F2MB 2MWCA 2O61B 1SDYA 3EFFA 4K15A 1H5BC 5I16B 5IHBA 1A7PL 2AXGB 1MCOH 3CFJB 3C09B 4G5ZL 1OSEA 4NQVA 2DJUA 3HJ0A 3MACH 4S1QL 2P43B 4FDWA 2A9CA 3CVCA 5D70H 2A1WH 5CEZD 3N43F 3VYOA 3KXFD 1FNGA 2XNAA 1DJYA 2WQRA 3FO1B 4IKLA 4P4RB 4K2UH 4PJXB 1RAMA 1B4JL 5HGGS 2P42B 1C16A 3NP4A 4PRIE 1IQDA 1NDGA 4NI3A 3S36L 1MG3C 3SKUD 1IEHA 1Y07A 2BM3A 4C55A 4IHBA 5DMKB 3D3VD 2BIPA 4LAJH 3RVWD 4MGXA 3NEEA 3GBML 3V6FA 5FXCH 5EUKA 3IJEA 4JB9H 2A83A 5J3HC 2NY1B 4XBPA 1FL6B 2H26A 4UTAL 1SYVA 4DP1X 1EXUB 1IKNA 4G43A 5F89B 4YSEA 3AAZB 3EFDL 2I5YH 4FLHA 5DD5L 3WL9A 3VJ6B 1E9OB 1OTUC 2AEOA 3AG3B 2EAEA 3PP3H 4R5TA 4XX1G 3QIBA 2X1WL 2CBPA 2W0LA 5K69A 2DI8A 4A2HA 4XE0A 5T1JA 5FB8B 1KGXA 2B1HL 5EZPA 2BVQA 3GMLA 3BN9D 3WI9A 1E4XL 2Z8RA 4Y4FC 1OPOA 5E5UB 1KJVB 5JNYB 2Y72A 2EXSA 2B7DT 4NCC1 5E94B 3LN4A 4NFCA 1W16A 2L0DA 2R2BB 1QQDB 3D0LA 1WBYA 3MRNA 5ENWA 5FLVA 1SEQL 1ZA6A 1MFEL 1FZOA 5E6IC 5D55A 2ZX5A 3CH1A 2K8QA 5C0BD 4LIQE 4UZSA 3GT6A 2CDFA 3I9PA 4PVMA 4X5XA 1SXNA 2D0FA 1F18A 4M5ZH 4TSAH 1DUZA 5DRZB 1SM3H 4HGKC 4Q89A 1YNKH 4NC1C 1YY9C 2QKIC 2XV6B 3MUY1 4AYBA 4XB8A 5JXEA 4G7YH 4FYSA 4MQSB 4F8PA 4QJ5B 4XX5A 3WFBL 2QELA 2FGWH 5D1ZB 1MFCH 1AHKA 3P9LA 3P9MB 1GC1C 1ND0B 3T2QA 4Y9GA 3WG7B 4PBVC 4UUJB 1KLFA 4RQQA 5G5DA 5DD0L 1QSEE 1NINA 1MNUH 5DJYA 1TZGH 2X4QB 3BFQG 3PP4H 4G8GB 2XSKA 4XHJC 1JXFA 1KOAA 4P2CG 3CFBA 4CW1B 1ICTA 3O2DL 4G3YH 3Q6FB 1QYGL 4ZFZA 2VCOA 1SMDA 3RWHB 15C8L 2X05A 4PP2B 2NY3B 1T1YA 1HHKB 5EO0A 1JBJA 3EJSA 3RWJB 2W0PA 4Y1AB 4XNDA 4K94L 3BEVB 1S3KL 3VB9A 4APXB 4PLOB 3L3GB 4IDJH 2EDXA 3QIUA 4N3UA 4PJ5D 5E00A 4FXKA 4QHMB 4X6CE 5C0AE 4APXA 1NSNH 4NWTL 2K6WA 1HKFA 2NY6D 3ESOA 3MRMA 3QFJB 4IU3B 3ZMEA 2AITA 3TIDA 2X1PA 4F7EB 3G3LA 3HE7A 4OFYD 2HRPH 4FADA 1YEFH 4YZWA 5I8EA 3V5HB 2NLJA 5DVOA 1ZK5A 1E28A 3V8OA 2UZYA 2Z34A 1F1DA 4MJ2A 2C3XA 2GFBA 1UA3A 1JSYA 1R3LA 1RUPL 4PJEF 3CTTA 5AAMC 3V5HA 5DZAA 4K71C 3KS0H 4JNXA 3FRPG 1MCPL 4RWYH 4YVNA 2IDTA 5K39A 1RK1A 2JKTM 1KCUH 4HZ1A 4UDTB 4J2QA 4Y2DA 4HK0B 4LSDA 1NOAA 5BNXD 2ADFL 3N06B 1EUUA 1MFNA 3QJUB 4K07A 4EBQH 1EFXB 4QTFA 1ZANH 2J4WH 5I17B 5IT2H 1UEMA 2CK0L 3TFKD 5D5MF 1L6ZA 3VI3B 3N5AA 3CDFA 2HX9A 3NQIA 4TS6A 2ZNXA 2YUXA 4JFYA 1J9SA 1WJ3A 4LK4A 3A6BH 1W80A 3GZPA 3PNWA 3FB7A 5CBEA 1QA9B 4HT1L 2QSCL 2NY0D 4MRCA 4BCYA 3TO4D 3Q13A 2CPCA 3KYKL 3T4AA 1SXBA 2Y2TA 4FG6D 4HJ0D 4OZGA 3ULUD 3CPLA 1A66A 1Q72L 4HUWB 3OMZA 2NX5E 4PV1C 4ZUSA 4U1KB 2FO8A 3BLPX 4PJCF 1QRNE 3I6GA 4WGKA 3HZ3A 3O3DA 2WWNA 3TFKC 4Y16D 4YPJA 1Z9OA 4JLRA 1JFQH 1B88A 2DB8A 2EYSB 2FQEA 1RQ5A 2OM5A 4QHNB 4PUBH 1OSPL 2VTFA 1S7XA 2P26A 4CC4C 2B9AA 4H1LA 1JPTH 1JPFA 2APBA 4HF5H 1I8AA 3CUPB 3RHWF 1BQHA 1XWVA 2V2WA 4X4KA 32C2A 1OGTA 1U3YA 4XC1H 4WWKC 1ZLVK 3VFNB 4K23L 2CXKA 3D0VA 4S1RL 1S9YB 4LVNB 3HPJB 1RP9A 4XAKE 3IAGC 3MVSA 4HK3J 5FA4A 1G7HB 3N1FC 4DZ8A 2DKUA 3K74B 4PG2A 5FHAH 2HTKD 4NRZB 4FGMA 3DSFL 4C83A 3BJ91 1QPXA 5I1IL 3UGEA 1MJJB 4Y2DB 3CXDH 4BH8A 4OJYA 2Q76A 1W0VA 3OG6B 4BELD 5BO1H 2AEQL 1JXDA 2X4NA 3JT2A 3H9SE 4FLSA 5HPMB 4CC4A 3G5XB 4JFTA 4N1EA 5D1QC 4Z7VA 1AQDA 5FYLD 2D3VA 4XZUA 1C8QA 3K2IA 1SQ2N 1T0OA 5D7JC 4NPKA 3JV6B 1JRHH 4U1MB 3RU8H 3DXAA 1GKEA 3CDGB 4FMKA 4Y4KA 3NSYA 1EHLH 1JDCA 1J0IA 3HS0C 4Y19E 3HRPA 5EU5B 3L45A 3CDGA 5C0DB 3FQNB 4TRPL 3X1GA 3VI4B 1R46A 3OKEA 4POYA 1VGKA 3HPLB 2CZNA 2VZSA 2YMTA 3B1TA 3U4KA 3NSDA 2DWDA 1PZAA 2BK8A 4NJ9L 4ODBD 2BSED 2P7TA 1CLVA 3BIBX 4G6ML 4YK4B 5A43C 3WFHB 4CU7A 4V2BA 2CMRL 5E5RB 5B4MD 4PGDB 2YD2A 1HNFA 2XWBA 5HJ3A 2Q8BH 1RUKH 4G7VL 4WUUE 3IDYC 3WKMH 5IMOA 5DFAA 2EIBA 3I9AA 4WGVB 2A5UA 5CZVL 1XF1A 4YQXH 4KROD 2ADGA 4HJSA 1RJZB 1N10A 4OZIB 1OTUD 3TBVA 3FAXA 5I16A 3MLTB 1VPOH 3SE4A 4NQCB 1H6FA 1DJHA 1RURH 1UYWH 1VGEL 5BMFH 1CL7L 1FFTB 2XC8A 1JWSB 4HXBL 1MHPL 3QCUL 5HJGA 1SXSA 2Z65C 4WTQA 2A9NL 4D7BA 1AGCB 5D7SL 2EP6A 4ENZA 1KN2H 1HT6A 3MUGA 4WFFE 5CD3A 3ULUH 5KSBB 1BJMA 2O61A 2ZIDA 3MR9B 3DA0A 4P49A 1TTUA 4JY5H 1T5WB 5HHOA 3Q9PA 2OAAA 2XN9D 3SQRA 3ARFC 3W39A 4A2LA 4AC4A 3OSVA 1NMBL 2EXWC 4Z7UB 4ZDHB 4YS4A 2IFFL 2Q10A 1SMAA 5F7AA 1B0GB 2EDQA 1RHHB 4R4FL 4QYOB 2E7CA 3QPXL 3II1A 4XXWC 5I76B 1BVNP 2X10A 3QUZD 5CKGA 3OTTA 1T4KA 1NICA 5J12C 3BP5B 1YN7B 4UQDA 3L6FA 1DSFL 3HAEA 4B9ZA 2PTTB 2WY3B 5I18H 4BFJA 2H8PB 3U4BL 4WEUD 4OLYL 2AF2A 1CT8A 2Y36H 3AU0A 1MCKA 4E68A 1NGQL 3AUVA 1C5BL 4JM2C 1BAFL 1OP9A 1GW6A 4R8WL 4JQIA 4WWNA 4XTRC 1XMWA 1MCRA 4HISA 3OF6D 5GZOC 4NO0D 3Q1SH 4ZMQA 4OZIF 5D2LF 2H0PA 1BFOB 2OR8A 4J1UA 4XB7A 2G9HA 3VD4A 1IGYA 4EZJA 3QDMA 4M56A 4NQEB 3PWJA 4XAWH 1B2WL 3TO2A 3CN1A 5EUOE 3EYOA 1H3XA 3QXTA 1K3IA 5KVMC 1MI5D 5HHQA 2FGZA 3SGJC 2EKJA 3IDMA 1WBYB 3MRNB 4I18A 3UGUA 2FB4H 2IADA 3MYJA 1P69B 4ETQB 2IAMA 4A6YB 5GS0D 1HTYA 2J20A 3FUMA 3HFFA 4TUKL 3MMEA 1N6QL 2OR9H 3FFCA 2LLLA 1LM8V 4EI5B 1CQKA 1R3KA 4GB9A 4OCXL 4ZOCA 4Y19B 3ECWA 1EX0A 4RBPK 2I69A 4GBXA 4R9HA 4L4JA 4I9XA 2DQFB 3O3BA 2VDLH 3MJ9L 2Y7QB 4NCDA 1E4KA 4PP2A 5EO0B 5KS9B 4U1NA 1BF5A 3QPQD 3GJFK 3U7WL 4Y89A 4PWHA 5I1JL 2WBJD 3L3IA 3RTQD 3V95A 3CSYB 4N9OB 5F3BB 2DJSA 2OTWB 1BHGA 2AXFB 4X6DF 2OQJB 3WD5L 5IHUH 4GG6B 1ET7A 2XQYG 5FKPA 1QTSA 3K1KC 1HOCA 4DP4X 1LK3H 4FLQA 3RVTC 4YHLL 1T0PB 5F7EL 3SBRA 3NRQA 1CD1A 3H9SD 2FX9H 4JJ5A 3RWCA 4TVPL 3SCMA 5C9JA 4LCUA 1J5IA 4ACPA 1RFDH 3KVDD 2J8UB 3QJXA 2CKBA 2GEEA 4RFOH 1ASQA 4OF0A 5GJTL 1CXKA 4FFYA 4BDVB 2GY7B 3QUMA 1I1AA 3QEQB 4LBAA 4Q14A 4PV9B 1C7TA 1IM9B 4PPTA 1XL4A 4JS7A 4G6JH 3BSZH 5DK3A 1I3VA 4MJIB 2O5XL 3HBPA 3FN0H 2QR0A 4JDEA 1BZEA 3BZDA 3CLEL 3QEUB 3BFWA 1T89A 4M8VA 2AERT 1F45A 2V2XB 3GK8H 4K0OA 1KULA 3FU3A 1PLAA 4PJGF 3I6LE 4WO4D 1ZSDA 3FJTA 1Z3RA 2I24N 3A47A 2XWZA 3U4EA 4TQEL 4JPWL 2JMRA 4S10A 4IIQB 5A2LH 1MAKA 4DKEL 1JFHA 3LTVA 4JVPA 4M6AA 3VNYA 2E46A 3DGGA 4MNQB 3UBXA 2XWTA 1AE6H 1UZ6F 3TWCH 3ZGIA 3GRWA 1V7NH 2OX5B 2ZOTA 5IQ7L 4F8NA 5EV7A 4KRMB 1E2WA 4AQ8C 4W6WB 4HS6A 4AYFA 4NKQB 3TT1H 3N9GH 3BP7B 4PS7A 3OR7B 2A1WL 4WHYG 4NRYA 1NBVH 1DDHA 1OY3B 1E65A 1EDQA 4K3JH 1XH2A 4EKJA 1MF2H 4X8JB 1KPUA 3QUXC 5JW3L 2WXPA 4N2MA 4RDBA 3I9IA 4YNYB 2ZOKA 3EOYG 3QEQE 4ZMVA 4J23A 3LNIA 4YHZH 2ZG2A 4Z0BL 1CCZA 4WNQA 4WO4C 3WFEH 4RGNC 3KHQA 3E6FA 3BHBA 4GQRA 5EU4A 4Q97A 4FFZA 3BPOC 3AS2A 3W0WB 1E0OB 1OM3H 1TZIA 1WICA 5HI5C 2X6VA 2Q7AA 1DQTA 4K9EL 5FUOH 5IB1B 3IFOB 4LCWD 5DJXA 4C4KT 4WI0B 3BE1L 3H55A 3INOA 5HVHC 3WY2A 4P5SA 4YHOH 4G80B 1H15B 4H25B 4F20A 1Z9SA 2VLKE 3L95A 2YMXH 3GXPA 2AP2A 4OIAA 4B3EA 3TV8A 2OFQA 2CR6A 1XQ4A 2EVJA 4MKMA 1RZQA 4OD2B 4OLEA 2WINA 5BOJA 1BOGB 2MHAA 3P0YL 2VXQL 4Y1AE 3VX0A 4ZAKA 4P2RA 2FWUA 3JV4A 1J7VR 4XO8A 3BEVA 3X17A 4G11A 2EUWA 4XN7A 3VFOA 4ZAKB 1KTDB 4EEEA 3FFDA 5GGTL 2XTLA 4KPHL 4NQXA 1KLGA 2HPTA 4NQTA 1S7TA 1CBJA 5AW4B 4CBZA 1USZA 4M5ZL 3VA6A 4FE9A 1I8IB 3E1ZA 3PABA 3OLDA 5H8DA 5IVZA 4AL8C 3VRJA 3JWOC 3RIAK 1K4DA 1K4CA 4PRHB 3N43B 1F58L 4L2LA 5EEXA 3APFA 1MEXL 3QQNA 4I13B 1F3RB 4N86A 1O7SA 3RVXC 4QNPE 5H35A 5HXMA 2R4SL 4IRZA 4XTRD 4B97A 1NPJA 4L8BA 4Y1SA 1HFUA 2XPGB 4U4IA 1RZFL 2V7NB 5JOFB 2ZCHH 3LRSB 1F4XH 2BLFA 4G1EA 5AG8A 1Q9WB 4WNQB 4BIKA 4XVUC 2P7TB 3TBCA 3WS3A 1XF2A 1QFUH 3QQDB 5SWZD 5JHDA 2YA0A 2EIDA 1WBZB 4JHAL 5HHOE 3EG9B 3DX6A 3H42H 1MW3A 4JPIA 3TBYB 3EOTL 4P46A 3K5RA 4KO7A 4WI4A 4ZPVA 4A7SA 1A7RH 1PKQA 4JFYB 1OTSC 2XBDA 3Q44A 2OMTA 1EEUA 2ITDB 2W8CA 3L9RA 1MCSA 4I48A 3CC5B 4LVOB 4HD5A 3SQOL 3W9DB 3ZDXE 5T5NF 4L1SA 1N70A 4DIXA 4EMZA 1XIWD 2CRIA 1PLCA 3OD3A 2HZHA 4GO8A 4OD2A 2KLSA 1BZ7B 1WIUA 3LKQB 1SUHA 5GHWL 3QRFM 1EPFA 4IOFD 3S35L 5CJOH 1BG1A 1TT6A 3L7FA 5C3TA 4N0CD 5TK4A 4QTIL 3ARBB 2QBWA 2E76C 1EZVX 2V5YA 4MD5B 5I0VA 5EUOA 1UXWB 2JK5A 5KVEL 3IPEA 2J12B 4JFQA 2NW3B 3NZ8B 1SVBA 3BXNB 3FO2B 1NLBL 3QEHB 3RIFK 2ZF9A 2CCVA 4Z7UE 4YL9A 5AVYB 4PGCB 2GSGA 5AOMA 4Y4HA 4Q9RH 2F5AL 4LVOC 4XPAH 1FZMB 2ZONA 1F6FB 1NCWH 3TBTB 2EDNA 1UJ3C 2OTUB 5E1GA 5FKAB 5DZJA 2ZXDA 5D2NB 1M1XA 2AGJL 4J1UB 3U83A 5KVFH 3KWUA 3BH8A 4MNQA 2X6MA 3UBXB 3U9PL 43CAB 3ARGA 5K9KA 4AM0Q 5T1MA 2PWFA 2BZCA 3FTUA 3DMMC 2FAUA 1NCUA 3BWUF 3A6BL 3MFGB 3FF8A 4E42A 4B50A 4NQCE 3W5NA 1ADQA 3F6LA 4XN4A 3SYAA 2BZ7A 3OLIA 3X1BA 4RFEA 2YAFA 2EACA 4WI2A 1ZS2A 4MA8H 4Y4HC 1YG9A 2VJXA 4FLRA 2K9UA 3WFZA 4KTEL 4U05A 3RA7L 3PGCA 5AW6B 4Y5VA 4XP4L 1CD0A 2GC7C 3CSFA 2HKFH 1YAIA 2OYKA 1GYVA 5LQBL 2FLRT 1UUSA 2W9EL 4F8TA 2I60L 3IDXH 4P07A 4D7PA 3L4VA 2ICCA 4OFQA 4AMKH 1INDH 1H3PH 4OZHF 3SE9L 2BXZA 4XRCA 2DQFA 2H1PL 5C0RL 1CG9B 4QKTA 3MLZH 4YHKL 3NJMA 3ZGHA 5F70A 2IH1B 4PUBL 1TQUA 1XBDA 2NY5L 3HZKA 4DKFH 3V0VA 1U95A 1KIPA 4HWZB 2E56A 2FIRT 1YN6A 3IN2A 1I8MB 1X4XA 2NQCA 3VTMA 1N0LB 4AIZB 4M8RA 5HY9B 3MXVL 3PGFL 2J1WA 1YYMH 4J4PD 1ZTXH 3CCHA 4KKLC 1Z66A 3FS9A 3KPSE 5FUCC 2AXFA 1P4IH 2IH9A 4M3JA 3OLGA 1DN0A 2COQA 1RJLA 2PR9A 3MNZB 3ULUF 5I75B 2NNFA 2GSIB 3E9TA 3G7TA 4DKDC 4KHTL 5IHLB 1CD9B 2E3VA 1PD0A 3L1OL 3NSCA 1M7DA 3VXOA 4I0PA 3K2MC 5I8KH 1NC2B 4JPKL 2VR3A 4HFWA 1D6VL 3FFDB 1BD2E 1XB8A 3VRLE 2PCFA 3LSOB 5F0PB 4EIUA 4AITA 3UEQA 2F8IA 4G83A 3BPOB 4Y2NA 1RUMH 1A6UL 3K8KA 2ZX7A 1Z7JA 3MRCA 4XVSH 1WIOA 3CHSA 2DM7A 3OMAB 2A4ZA 1A3LL 4R6UA 2VDOH 4I2XE 3VH8B 3OGCB 5ID0A 1JTOA 3MN8A 4NLAA 1PJ9A 4NNPH 4WJG3 1ADWA 1A6ZA 3VGFA 3EO9L 1A4AA 1WSST 1HESA 4NO2A 1WAAE 4L8CA 5T1DL 4JFFA 2QLVB 3QRLA 3S8FB 3HI6H 2AJYH 3SDYH 4NJ9H 4JREB 3I74A 3QXDB 1ZGLP 1NBYA 2VMJA 4PRAA 2BOBA 5D1XE 3OKKB 4IRJA 3PS6A 3FB8B 3AGVA 3ARSA 3B6SB 3K71B 1AO7D 3ROLA 2ZOLA 3G5YA 3QULB 1NM9A 2FH6A 3RDTA 1MVYA 3GRGA 5LG6A 1GA2A 4Y0GA 2WHVA 3TH4T 4DZ8B 2GB2A 5E6YA 1TVHB 2AJVL 3TP4A 1EMTL 5I1GH 1RURL 3EJUA 4AYFB 1EHKB 5AQ0A 3BO8B 2P5WE 4DPCX 3W3BA 1XH3B 3KXFA 4ZT1A 2J1ZA 4NRYB 1ZD6A 1AAJA 4NKDA 2WBJB 4RGOL 4XNBA 1RU9L 4IMKC 5F0LB 4RAHA 3KPSA 1C5DB 1U8JA 1VLXA 2PYEA 1OF2B 3MV7D 1KENH 3VFSB 2FJGA 2QADD 2P48B 2HG0A 1HHGB 1HI6B 2IC2A 3UJJL 3HC0B 1F5WA 1DVYA 3B9DA 2DLFH 4KQ3H 1BA9A 3UAAA 2IOMA 4DN4H 1W72L 3FOMB 3GSUA 3RVVD 1RZ7H 1WTGT 2P5PA 2VLJB 4X7FC 1JVOA 1KPRA 2X4SB 2ZUYA 3DROA 1R24B 3P4NA 3V4VL 2P80A 4LLVA 2J8UF 2ZX8A 2BVOB 4ODUA 3BOVA 4ZFFA 4LCWA 3V4PL 3QNZB 5C70A 5IOKA 3BZEB 2GIMA 2IDQA 4W4OC 3SGDI 3WTUA 3LQMA 2NUPB 3QFJE 4O02A 1DVFA 3AM8A 3LN9A 2QQLH 3JTSB 2Q6WA 2F53B 1NAKH 1YEDA 2NT1A 5JXAL 5FEBA 1YMHB 1QFHA 3UO8B 2Y6TE 3RIAF 1R3JB 2H41A 4M6NL 2A9MH 2MPAL 2DMCA 3LS4H 4NC2B 5ESQA 2IANE 3S5ZA 3RJOA 2IBZY 4D0CA 5F9JB 4YE0A 1DFBH 2ODHA 5CMAB 5ANHA 1UH2A 4HULB 4RESB 2WVTA 3HNTL 2HVKB 4A7TA 4P23C 5AENA 4UI2A 1Z3GL 3LXCA 5D7HA 1KPVA 4F15B 3QDAA 4FQ2L 1BZOA 2DN7A 3B2VH 4APQD 3F7LA 3KGUA 5CGYD 3UC2A 2OMVA 2XZCL 3AT0A 3NFPB 3HUJF 4V1DD 1JHLL 3A23A 1W0YT 2X6BA 3SJVB 1MJ7H 4QRPD 4F58L 8FABB 1FNEB 2KC0A 3O9WD 4Z7NB 2OJZL 1T04B 1YUHA 3PDDA 1QPKA 3CNKA 3HG1E 1DLFL 2R2HB 1HAWA 3L3KB 3VWJC 2OR9L 1MHHB 4XMLL 2MCMA 4P23A 1BXXA 2OBGA 5EBLA 1EZLA 2X2HA 4Z7VE 3WNOA 1J8HD 1M56B 3DXAD 2LOEA 1AR1C 1A2YA 3Q7JA 5J06A 1TUPA 1GSKA 1MCNA 1MFDL 5K5YA 2JELL 1UEYA 2C4FT 2CO6A 1KIRA 3K6NA 1XR9B 3RNKB 3OB0K 3BKCL 3KPRE 5ANMB 5F9WC 5FF6B 1GZHA 5C9KA 2OJEA 5HHNB 4Y4HB 4D0BB 1BZ9B 1HZHH 4AKPA 3MLXH 1X5GA 4BXVA 3ZXAC 2DTSA 2J71A 1P1ZB 2QT6A 2FO4A 3FT4A 4GAJL 4AJ0A 4P46B 1KIUB 3V4VB 3EYOB 4D8OA 3WU1A 4NN6B 1JNLH 1JV2A 1E4WL 1FGVL 3OR6B 1D2PA 4C83B 4MLIA 4DUXA 4PHXA 3GXTA 3MBEC 1JXGA 4K94C 4PI2A 1JZ5A 2YR3A 5DHMC 1XCQA 4JRLA 1HL9A 3TF4A 4C58B 4LLWB 2FRGP 4WHTA 4BFRA 4P06A 1WZ1H 1N64H 4HS3B 4Y9BA 4P4KD 5GJTH 1JZ8A 1X5XA 2P45B 3ZSTA 5FW8A 2J6WA 1UQSA 2KBGA 4LMQI 1KBVA 1LP9A 2JLPA 3FRUB 4KHXH 3DTXA 3SKJH 3NACH 3MXWL 3O3EB 4PJXE 2UVFA 3RWFA 3VD3A 1JK9B 6PAZA 3KYMA 2X6CA 1JGDB 1Q9OB 4XVOA 3QUZA 3SE8L 1U91A 3OL2A 4UT7L 3L3HB 4N2OA 4UNVA 1R9FA 4FXTA 2R0ZH 3FU0A 4PGBA 1A6VH 4U1NB 5DVMA 4TQEH 5EWIL 2YGNA 2BVPB 2AK1L 3WFHA 3CHXA 1L9NA 3JWOH 3NGBB 5IVXF 3OVUB 3WN6A 4DKEH 4H5SB 1ZT4A 4MCYB 2P5ED 1GKOA 1U21A 3WTTA 1V7NL 2V7HA 3EUDA 4LOUC 5G4MA 5KZCB 5LGHH 4H8WH 1IGJA 4H5SA 3VU2A 1TYJA 5I8OL 1HI6A 1PF3A 5I73B 4XMZA 3C2AH 4NO0A 4W70A 2Z8WC 4NQCA 3TT1L 5IM7A 4Y7MA 5GGSY 4OZFH 1HJCA 1I7UA 2FSEB 4JDTL 1X7TA 1QBML 4OM0H 3STLB 3ATBA 5TPWH 3MV9D 3HE6D 1ES0A 2YUZA 1PG7L 1K6QL 5EU6B 1DANU 1ZJAA 1S9WA 3FKUS 1QHOA 2JI1A 3PGDB 4NSKB 4NZRL 2CKBH 2AZUA 4ZMPA 1I8MA 3E8UL 1NH6A 3SBWC 5E4EC 4MQXD 3OJDB 5ALCH 2X0WA 3KWXA 4HKXB 1JZ7A 4DVRL 1MRFL 1G0DA 3ETBJ 4YUEH 1BM7A 4WGWB 4WFHE 5C0FB 4JFDD 4QY8A 3WE6B 5GZOD 1WA0X 3DTUB 2FD6L 4LESA 1BQHB 2XKUA 1FNLA 4KZDH 4BH7A 4QMEA 2BSTA 2GT9B 1KJMB 4F9PC 2L7EA 4P2OA 2A6KA 2X5PA 3KW7A 5CCGE 5CR1A 1GGIH 1ZDQA 4Q9QL 4W9ZA 1R33A 1NWOA 4GMSH 1VKXA 2W80C 1ZA6B 2OL3L 2KH2B 3MBWA 4KX8A 4NENB 4OCMC 1KJ3L 3KBHE 4ANUA 4NO5B 5FDYA 2HFGL 1JDDA 5GQBA 1OKEA 3SQBB 3D33A 1DN2A 3GUTB 3VXSE 3VQ2C 4N6RB 4QYOA 1ILUA 2V37A 2BFVL 3MGTA 2CRMA 3FOLA 5K9JL 5DJZB 3SGJA 3H9YA 5CJXC 1RZPA 1OP5H 3HOGA 2IWGA 3WLBA 2OSXA 4IOSA 1EXHA 1Y0LA 2NY0B 4NQUA 3D52A 4NZTL 3UYPA 3D0VB 2WCGA 4Z23A 1OF2A 5CWSA 5EBLB 3KYNB 4MFHA 1J9TA 1ND0A 4GSRA 4XP6L 2QQKL 3UYPB 4U2YA 1WGVA 4UT9A 1SQMA 1S7XB 2EDOA 2AQPA 2YZ8A 1T0NA 5ISZA 3RPIA 5DURB 5SWSB 2GJJA 2LU5A 2EIMB 4OJFL 5GISH 4ELKA 2B1HH 1XGTA 3DBSA 4ZZKA 1KY6A 2YD6A 2EEBA 4X98A 3VXRA 5EN2A 4KO6A 3QUXB 3RNKA 4F9LC 4Z8FL 4Z76A 2B2XL 2APFA 2Q86B 4IRJD 4L4TD 3NDZE 5HHME 4ONGH 1M9SA 2BVUA 4JFHE 2I07B 1KJ2H 2D03L 5JDSA 2LTQB 3RX8A 5FYJH 2Y7NA 3Q8AA 4OCNC 2XV0A 4H0HB 5T1KB 2Z3FA 3KM2A 3U1SL 1R3IH 1I8LA 5D7EA 1VSCA 1N2RB 3QZWB 1MXGA 4FNRA 2PYED 4N2GA 3S3JA 5E1AB 1R0AL 1UM4L 4OLZL 1F6AB 1HCVA 1W9XA 2BS71 2Z9TA 4HHGA 2HT3D 4M7KH 4XCFH 1X9QA 3JV5A 1KIQA 2OW6A 3STZA 3FO9A 2NPLX 5J6HB 1AGBB 4BSJA 3KR3L 1O7DE 1I9JL 4M1DL 2FGWL 2NCEA 1F3DH 2I9LA 4FFYL 3RUGB 3IDIA 5DVPA 3W0WA 1NCDH 4PJHE 2ZICA 3ARGB 4J3OD 5K9KB 2DH3A 3BQVA 1G7JA 1OZTG 1Z9LA 1OB1B 5DD0H 3MBXL 5KBLA 1I3RA 2HT4D 4U1JA 4KDTC 5AVWB 1FPTH 5JOFA 3WMPA 3BVNB 3PP4L 5E95B 5J6GB 3CSYA 1X5JA 4FLOA 4YZFE 2OR7A 4G9FD 3VXMD 1TSHA 4IRSB 5JO5B 3WNLA 1P4BL 3D08A 3MNDA 3MV7B 4BK5C 4BWUA 2AXGA 4HZAA 15C8H 3CFUA 4KK8C 5J5EA 4MMXB 5DRWB 2YIHA 4N2EA 4V33A 3U9PH 1G1KA 3CVHA 4JFEB 1J5CA 1T0NB 3NCBB 3SKOA 5KTEH 1H0DB 2HYMA 1G7MA 5FFGA 3ZYZA 2GIYA 3CFJA 4JO3H 1JI1A 1OE3A 3FB6B 1BFSA 4JN1H 2ENJA 1DJSA 1QP1A 4L8SC 4MA8L 4GNKB 4ZUUB 3U4EB 4AQ8A 3P77A 1OARL 3U6XS 1QFWM 1CK0L 1TTRA 2FJHA 2H6OA 3K46A 3FQWB 4E9XA 2LHAA 1CICB 3QIBD 4XP4H 4WKZB 4XNXH 2D8KA 3X1FA 2EYTA 2X4QA 1BGXL 4G8GA 4PWJA 2CD0A 5DEGB 2D7OA 3JUYA 3Q8CA 3QZNA 2HVBA 5IMMA 2AQRA 2QKIB 3LRKA 4X5WB 4ZUWB 1PKOA 1DO6A 4RWYL 3S3DB 3C6SA 5EHFA 2AEWA 3ECUA 3HI1A 1W8NA 1SMOA 3VCLA 4FI8A 1ZV2A 5A2CA 3UJTH 3LIZA 4KXZI 4JZOB 1D5ZB 2O4EA 1ZANL 2J4WL 1XCQB 1TENA 4PJDE 1U8PA 5IBUB 4ZFOB 4ORGB 5IJCC 4X5QA 2BHZA 3Q1EA 1X6LA 1E8XA 4GRLD 3DVIA 1XXDC 2DYPA 3ARFD 4L4VE 5IB5B 3FT4B 4ICXA 1NUNB 3ROOB 4FD0A 4OZGB 5DJ2B 2ZX9A 1I1YB 2OSLA 3L4UA 4XWGH 5KVDH 1CICC 4XWOC 1QQDA 1E6JH 4FABH 5D1XD 4HBQA 4ZMZA 4JFFB 5K9OA 4NAQA 4JQXA 4YHMH 1B3JA 3UEZA 3WUWA 4ZSOA 4EDWH 2Y25A 2CO7B 5LBSL 4A63A 1F4HA 3HR5B 5IFAH 1PY4A 1HKLH 5LDUA 4YFLF 4JHWH 5I8EB 2PXYB 4LSTL 5DVLA 4DEPC 1QX1A 5INDA 4GPVA 2C9PA 4XN5A 2D31A 2WZPA 1OTTC 2VABB 4J3OH 2V7HB 3F83A 1MQ8A 4RMBA 2XQYA 3NZHL 4HOWA 1AKJB 4YHPA 1WA2X 4WI9A 5FM5O 2DY2A 4GKZA 4RRPG 4X7SL 4DKTA 5IW6A 4RZCA 3FAWA 3MDJA 4KVNH 4LARL 5DRNB 1AKJA 2P3YA 3HUJE 4IRSC 4W93A 1KYOJ 1TLMA 3SDYL 3V6FB 3VD2A 5IBLC 1QAWA 4XBPB 1HHKA 1XZ0B 1N18A 3U48A 1BREA 1E42A 1I8UA 2NQDA 3BAEL 3QUMB 2ADGB 1INQB 5FHAL 3CCHB 3QGVA 3DTXB 3Q6FA 5SV4A 3VSUA 5M7QA 3DX2A 2AK4B 3RTLA 2IVFC 4X7EC 5AW0B 4IBVA 3GMMB 3VTTA 3N42F 5AWNH 1PZ5B 3IWVA 1P6FA 3HRZC 5E7BA 2ZKMX 3I3BA 4AW4A 4DQOL 1CD8A 3KCPA 3W82A 3IGLA 4L4TA 4N2AA 5KS9E 1UH3A 3OZKA 2UZPA 3NPSC 4UQBA 5TGBA 1QVOB 2X3CA 1ZTXE 1AS7A 4H40A 4WU5A 3RJDA 1U8QA 3ARGD 1AZCA 1C08B 1BM3L 1MFAL 3T6XA 3MLSL 4QRAA 1BAWA 1H8SA 3FN3A 2IBGA 1DVFB 5E70A 1UM6L 2ESVD 2YC1A 2F1BA 4KNTA 4WZ9A 3VFNA 2FIKA 1L9OA 3C5JA 1ETA1 1Q90A 2H5UA 2LTQC 5HDLA 3ZO9A 2GCYB 5IKCB 1SHXA 1NMAL 4G9FB 3UZVA 3CE1A 5L4JA 4LSRL 3DOSB 4I4WB 1C9SA 4AZ8A 1E8ZA 2FEEI 4AEEA 1YEGH 2G4EA 4LLMB 4YXKL 1P4LA 3GZOA 2LFGA 3LKNA 2WVVB 1BVLA 3QIWB 2XFGB 2H0JA 3WKML 3IETB 1B6DA 4GJTB 4TVSa 1C5CH 3DYMA 2GI7A 3PXHA 4KBPA 2R4RL 4JZJB 4UMGA 2QSTA 3O3UN 1JZJA 4LGSB 4FQQB 4XI5D 3EJZC 5CU9A 1G6RA 5JZ7D 2R1WB 5BZWA 3C60C 3FPYA 2ZX6A 2HT3C 3F3HA 3UTSA 3FCSA 1ZWIA 1OXYA 3DTDA 1TVDA 4XCYB 2XI9A 3GDCA 3UP6A 2WSKA 2WWKO 4G5AA 3E8VA 1EANA 3ZDZE 2W91A 4JCMA 2B8OT 5GZNA 5EOQH 3KPNA 4AE0A 3G04A 1Z3GH 3FT3B 3DJZA 3UPRB 2GHWB 5FCUH 3U9UA 5C0BB 2JH2A 2GUOB 3O3DB 2VZTA 1GRWA 3CLFL 2YA2A 4C8XA 5B1JA 3B7RL 2FQDA 3LEVL 3O6FD 3GMRB 4GEJA 3GSNB 4HKZA 4L4TB 5HJ3B 3MJWA 1N6UA 3NJIA 5DMIL 3UTQB 3GUTA 4QAMB 3IMTA 3LIZH 3ZL2A 2JCCE 2A38A 1ZE3H 4N1CA 2JKJA 2Q0ZX 5E2UL 1E2VA 5SX5K 1FN4A 2B0SL 1DSFH 3ABLB 2ERJB 3WS6C 4E9SA 5EEYA 12E8H 3S7GA 2ZXAA 1A1OA 2AV7B 1ETZB 1YZZA 2V17H 3S4SG 4JRXE 1NGQH 4G70B 4QAWA 2B4CH 1TFPA 4PJBA 2B4CC 1HEJC 5F96L 3QNXB 5LNEA 3PWLB 5JPMB 2X41A 4XODA 2WLJA 4NUMA 3C8HA 1CFQB 5DS8B 4Q6IA 1U33A 2G60H 2JWYA 4UM9D 4LCIL 4YK4C 4OV6F 4QI3A 4JCWA 3NCXA 5TF1L 1KTCA 5AW1B 4A66A 2XXMB 3WFDH 1FZJA 2YZ1A 1WWBX 4POUB 3VFPA 3W39B 2YRBA 3ULVC 4I0PC 1WO2A 5C0JA 3MR9A 2YEZA 1SJVA 4O4YL 4ZSOB 1WS8A 1CFSA 5DQJA 4ENED 1IAKA 3OHXC 4MDJA 4B9KC 4OGAD 3FTZA 3IPBA 4RISL 1GJIA 1DSYA 4JO5A 4YDVB 4BHUI 1GZQB 3BWZA 1BXUA 3O45B 2BP0A 4KY2A 3MODH 3F7YA 2UZXA 4JRYD 3W9EB 1N6QH 3PWUB 3NJFA 5I66A 2L4OA 1I31A 1N5AB 5D1QB 4RQQB 1U92B 3T4YA 5L6YL 5E08L 3BUBA 4JMNA 1PPIA 1T5XB 5A2JH 3I6LD 5CJBA 3P40A 3G6DL 1CU4L 3QISA 3QNYB 4LEXL 4PGEB 4RX4A 4UB0H 4XNUL 5F7DA 3R7RA 1RZ8B 3OX8B 2AJ3A 3OKMA 3EGSB 4BZ1H 5M94B 1MIML 3MGOB 2VL5A 4PJIE 3RAJH 3ZUNC 4MCNA 2I85A 2VXQA 2R69A 5TDOB 4GKLA 5C0IB 1ET8A 1NGZB 2R0ZL 2YKKA 1DQDL 3L7EA 4KAQL 4P5TD 4R7DA 3SBQA 2DMHA 2WC7A 2BOBB 3KLDA 1T6BX 3O0RH 4MA7H 1RHFA 2BSTB 2GT9A 4WY7H 5HYJD 1NA8A 3ULAB 1TVBA 3NK4A 2OXGA 4WFFD 5DJAA 4PQXA 3OBAA 1S9KC 4N85A 5LGHL 4NLHA 4M62L 4LEOA 1ORQB 5DUMH 1PCXA 4PRDB 1AHWB 4TVPH 2O5ZL 3UC0H 1CICD 1T04A 1YUHB 2UVEA 3HMXA 4OZHE 3FB6A 3L08A 1IC5H 4XAKD 3BN9C 2JCCB 5JHBA 1XX9C 1YYCA 4MXVE 3V5DA 4RSVA 3L3KA 4UIKL 4GSXA 5K9QG 1V3LA 1FFPB 2KQMA 1RK1B 4LSUH 4UDTA 5TPWL 1BEXA 3EYVA 2K7QA 1DEEA 1V10A 4TM9A 3P0VH 3HBGA 1UZ6E 4YIQB 5D6DC 1P53A 1NTDA 2BSBA 2CO7A 2VL4A 2E59A 4NC0B 2IALB 3WAJA 2H2SD 1GVIA 1DUYA 2VRAA 5HYQA 1IKOP 1A4JB 1FJ1B 1XR8B 1E5YA 1XHHA 1GYCA 2QMJA 2WWKT 3OB0H 1NIAA 4LLYB 4Y1AD 1BFOA 3Q6GL 3RGVA 2V8LA 2R1WA 1T7XA 5BZWB 3J07A 1VCAA 2UXGA 2NUTA 4EIGB 1MWAH 2EDWA 2QV4A 4QRQA 5I0ZA 2R0WL 2XY1A 3D87B 2A6DA 1FYTD 3DOHA 3ZHFA 1NMCC 1AE6L 4HQQL 3BQUB 4EUPB 3FRPA 3VW3L 3T2NL 4UTCA 1LD9B 3FUFA 1GC1L 4RRPM 2GJPA 2OK0H 3DJSA 3RDTD 4DAGH 2G2RB 4Z7QF 3CXHJ 5MP6H 5TFSH 3UTTD 3KM1A 4Y8AA 1U2HA 5E2VH 3ZLQC 4O51A 3B37A 1MF2L 3B5HA 1JGUL 2AK4A 2HA1A 5K1JA 1KXQA 2X2JA 2A74A 4FA8A 4YC2C 2Z64C 5I2IB 3FB5B 4LZKA 4XR8C 1QFWH 2XU9A 4K71B 4O51B 4L1DA 5F3HA 4JMXA 3V2AR 4Z0BH 3O9WB 1I1FA 4NQSA 3TYGH 3ULVH 1DZ0A 3RBGA 5DZNA 3N1GC 3S3PA 1KPVB 3D9AL 4I88A 3N42B 4ZW7A 1J1XL 5GRVL 1RD6A 4M3KB 4EI0A 1UH4A 1U58B 3ZR6A 1VHPA 1I9EA 2F7PA 3GEWB 3DMMD 1FFOB 2WOYA 4ABUA 2ZXBA 3HFML 3K72A 1V27A 1D6EA 4YJZL 2YMXL 2VM9A 4M1GH 1EGJH 3SDDB 2VN6A 1MLBB 4HP5A 4WK2B 1DBBL 3EDKA 1HEZA 4N22A 3OAWA 1ZOXA 1BW8A 2Y3AA 1EAQA 4F37K 2QPFA 5MEND 4F7PA 3KGRA 3B7UX 2MOVA 2WLYA 3NSJA 3AWFA 3LKSB 4LCCA 4PJAE 2DKSA 3GNML 1Y6NR 1GZHC 4Z95L 1P6AB 3CZFA 3DRTB 4OKVB 5T1LD 3G08B 5BZXA 5CGBA 3T1FA 3ZSSA 4UOZA 5AKRA 3KPMB 3DUSB 1FP5A 4P2AA 5J7CC 2ZOKB 3HC2A 1NFDB 2MNUA 1KB3A 3OF6A 3OAUL 3B34A 3T8VA 3VI4A 3HZYA 1PVHA 5J4MA 3KNBB 3LRHA 1LLAA 2ITFA 4TSCL 3L2LA 4UF7C 2XJLA 3CG8A 1M57B 1Q1JH 2NW2B 3VMOA 4ZMNA 1HILA 1Q94B 5DD5H 3GUFA 2E8ZA 5CUSL 5B3JF 1AZUA 1MAML 2ICES