4IQHA

Crystal structure analysis of dysferlin c2a variant 1 (c2av1)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
128
structure length
128
Chain Sequence
ITHMLACLLVRASNLPSAKKDRRSDPVASLTFRGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLDQGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQVSYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dysferlin
publication title Alternate Splicing of Dysferlin C2A Confers Ca(2+)-Dependent and Ca(2+)-Independent Binding for Membrane Repair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 22
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4iqhA00
3ML9A 3APFA 4QJ4B 3P2BA 4WWNA 3HN8A 4DNLA 4PS7A 3PREA 4KZ0A 3QR1A 4L23A 3L9BA 4TS6A 5G2NA 3TJPA 4F93B 3APCA 1DJWA 3QJZA 4FADA 1DSYA 2ENPA 2V4LA 2ISDA 4F92B 4PS8A 1A25A 2N1TE 1E8YA 5H4YA 2A5UA 3L54A 4XX5A 4BFRA 2YRBA 3L08A 5JHBA 2ENJA 4JPSA 2Q3XA 2WXPA 4L1BA 3RPBA 3PS6A 3W56A 4ANVA 4A55A 4F1SA 4AOFA 4LDCA 3DPDA 3L4CA 4ICXA 3TL5A 4EZJA 4WEEA 3PFQA 5JHAA 1DQVA 3PYCA 4FJYA 3L13A 1BCIA 5CCJA 1WFJA 2WXMA 2DMHA 2NQ3A 4EZKA 3F01A 2QZQA 4HVBA 3TWYA 2WXFA 2CHWA 2FJUB 1BYNA 1E8XA 3NZSA 3PRZA 4KITB 2B3RA 1RH8A 1V27A 4GB9A 2BWQA 2K45A 2K8MA 3GPEA 2QZ5A 1K5WA 2CJTA 2WXIA 3APDA 4LT7A 3ZVVA 1DJHA 2CHXA 4FJZA 4FA6A 5T8IA 2FK9A 3T8MA 4IHBA 3KWTA 1DJIA 3QAQA 3R7QA 3CSFA 1CJYA 3RDJA 3N5AA 2WXOA 2YOAA 1DJGA 1QATA 3F00A 3NZUA 2NSQA 3B7YA 4NPKA 5CCHE 1TJXA 4Y1TA 2ENQA 2CHZA 3ZW3A 4DK5A 2CJSA 4ICWA 2WXHA 3QK0A 1UOWA 4FLHA 3CSTA 4LCVA 2EP6A 2DMGA 2RD0A 4WAFA 4EZLA 5G55A 3F04A 2CHDA 3JZYA 4J6IA 3LJ3A 2WXNA 4MJJA 1RLWA 4F91B 1TJMA 2K4AA 4L2YA 1W16A 1DJXA 3SD5A 4KZCA 1E7VA 2CM6A 1BDYA 2D8KA 4WWOA 3OHMB 3S2AA 1UOVA 3IBEA 3IM1A 4QJ3B 4BGDA 4URKA 1RSYA 2WXJA 2ZKMX 3OAWA 1DJZA 1DJYA 1E7UA 4OVVA 2JQZA 2Y3AA 3HIZA 2CM5A 4FULA 4PS3A 4XZ4A 1W15A 2K3HA 4L1LA 2X38A 3KWUA 3ZIMA 2R83A 2WXLA 2A4ZA 4ANXA 1UGKA 5CCGE 2Q0ZX 1QASA 3FDWA 3M7FB 4QAMB 4AJWA 4QJ5B 4HLEA 3FBKA 5H4ZA 1E8ZA 2LHAA 4FHJA 5KJ7E 2KI6A 4FHKA 4NP9A 4TV3A 4GNKB 4NPJA 3ML8A 3DBSA 3F05A 1E8WA 1E90A 1YRKA 3ENEA 4WWPA 3MJWA 4IQHA 4XE0A 2Z0UA 5EDSA 3HHMA 3QARA 4OVUA 3L16A 1HE8A 1WFMA 2WXRA 2WXKA 4TUUA 4ANUA 2UZPA 4G11A 3W57A 3QR0A 4V11A 3L17A 1GMIA 4Y1SA 3NSJA 2WXGA 4NS0A 4ANWA 2NCEA 2WXQA 3R7RA
chains in the Genus database with same CATH superfamily
3SJVD 1KYAA 2WMPA 2P5WE 4PS7A 5FWRA 2WLIA 1RVFL 1XCXA 4XO3A 3VH8B 3TJPA 2F58L 4NDMA 3D3VE 4R90H 1DBML 3QXAB 5L7XH 3CDYA 3EDKA 3X11A 1MOEA 5KS9A 4MA3B 2X6BA 2GTWB 4MKMA 4HIQA 4BXSV 3HG3A 2DM7A 1PG7H 1A6UH 5C0CD 4HV8A 1G9MH 3OMNB 1HESA 4Y7OC 4U7KA 2AEWA 3EHBB 3STZA 3O2VH 5ABAA 1I1AC 3QS2A 2X6MA 1ZTMA 3QIUA 4EZKA 1FFOA 5GRVK 1W72B 1YNKH 1ZHLA 4F3FB 5JOFA 4U1IA 2V5SA 2Q5BA 1GPOH 5DJDB 3MBXL 3PRZA 4MJ4A 3QFJA 5GGUB 2ZF9A 1LO3H 2KQMA 3E6HA 2EDDA 3QWOB 3RVTD 3DECA 4YL4A 1HZHL 1HXYA 1NBZB 3QI9A 3PQYD 1C5CH 1F13A 2PMZA 1ILSA 3LZQA 3N5AA 2EXTA 3W0WE 3MLWH 1A8ZA 3J27A 2PKDA 1REIA 1Z9LA 4O2EB 4EI0A 3MLSH 2Q8AL 1QLEB 3FO0L 3SOBL 2QSCH 1MRDH 3UJIH 2NUTA 3IPFA 5AW2B 4PJ8C 2CGZA 3VQMA 3QDGE 1S7TA 1MH5B 3GBDA 3VD2A 3UZEC 3DMMC 5C09B 3QDAA 2CKBB 5DVKA 2PCXA 4X5RA 4FQXB 4N5EC 5E6IC 2YAHA 5FM8A 4URKA 4M93C 1ECYA 5PAZA 2A9ML 3GMMB 2H2PC 3HIZA 1XQ4A 3SKOB 3BAYA 3VWKD 5BV7H 5CJ5A 2IBBA 4NFBA 4KTDH 4R8WL 2R29L 4BWWA 4FXKB 3VGGA 2X4UA 2NY0C 1I8KB 3LQMA 1TMQA 2DQIL 4FG6D 4XP1H 2MQCA 2RHEA 2XWEA 5JUEH 2NX5E 4U0QB 2N56A 3VFPB 1Q72L 2YBRA 1LHZA 2HKFL 4D0DB 1M7XA 1XX9C 1J86A 3PY9A 4P99A 1UUNA 1LQBC 5B1BB 1UENA 3IKCA 4Z1PA 4ANUA 3LN9A 4R3SA 4WRLA 1X5XA 3WTWA 3MLTB 1YEDA 4UINH 4V11A 4Y2DA 2D2CC 3IXTA 5LXGH 5F9OL 4OLXH 2JI1A 4FC3E 4GW5B 3S4SG 1J05B 1K6QH 4HHGA 1IGIL 4RNRB 5GIRB 3L5XL 2GUOA 5IB5B 4WUKL 2K8QA 3ZZLA 4ODUA 2NY6C 3QUYD 3IDJA 4BH7A 5BCAA 5F7BA 5KSAA 1S9YA 3LKOB 3OJMB 4GI9A 4CUCA 3QEGH 2WBJB 4PM1A 1C5BL 5FXCH 4Z7NE 4IRJB 2YRZA 2YPLD 3QXUA 3PS6A 3DX6B 4OB5H 5TH2A 1JGDB 4LSUH 3WY2A 3ARFC 3QPKA 4XC1L 5AZ2L 4I1NB 3PWNB 4IU2B 4BYHA 4CSSA 5EUOA 1WFJA 5F89A 5EU6D 1YN6B 4KVCH 1PSKH 3K6FA 4MDRA 2ZP8A 2Y5TA 1I9JH 4Y5XB 2XWDA 5MEQA 3FMGL 3LZOA 4IOFD 4RZCA 4AI7A 3KHQA 4U0RB 5ADOH 2ZQKA 3BEVA 1EZSA 2F54E 4ELKB 1MWAA 3KYNA 2J5WA 5KJRH 2WY3B 4CVXA 1WFUA 3APDA 3ZVVA 4JFTA 3EOTH 3MV8A 4FNPA 3U0WL 2VC2H 2G2PA 1LEKA 3K1DA 1P4LB 1DJGA 3PJSA 3SDXA 4FD0A 4AYEC 1JHKL 2BFVL 4Y4HA 3X12B 1WIOA 5DQ9B 4KAQH 1IT9L 4NC1E 5DWUL 3UAEA 4UNIA 1BF2A 4OD3L 2ILLA 3FQYA 5D1XD 4TN9A 3QUGA 2VO5A 2RA1A 1F11A 1S46A 3AREA 2VB5A 3MSPA 3D08A 5DUBA 3MXWH 2FCBA 1WVZA 1ZVYA 4UANA 4QJ3B 4G6KH 4PJEA 2ZWSA 1DUYB 1DJYA 3NJLA 5FHAH 5GGVH 2A6KA 4DP2X 4JB9L 4HT1H 4BCXA 3W3BA 4DWHA 2HJKB 1I3RB 4LAQH 4UYQA 3F7PC 3L7EB 4P46A 4P05A 3BWAA 1TVBB 1U8NB 4YE4H 2LHAA 4FQHB 3BT2H 2R23B 1T89A 2XV6B 4X4YA 1P5UA 1EDYA 2WBXA 3ULAB 4CVUA 4KGJA 3RFZB 1OWRM 4C4UA 5DMYA 4UTAA 1S8DA 2ED7A 2G2RB 5EZJB 3DDFA 4L3AA 4XB3A 4P2OC 3C6LA 3KVPA 1YPZF 2FZ3A 2R1WB 1FHNA 1ETZA 3M17B 4POZC 1D6EB 2Q9OA 3H42H 1G7MB 1MCWW 1A9BB 4LOUD 1Q1JH 3OXRB 2HVBA 4GG8A 3TU6A 3PPSA 4HPYL 2AQQA 4EI6A 3S3DB 2OMYB 3UJTL 4QHNB 3MLYL 4M43L 3WL9B 1E3XA 2E0PA 5B39A 3FOMA 5HGBA 5DHVH 1GVIA 4MDIA 1A6WL 4OR1A 4ZUUA 1FV1B 1U4EA 1A9VA 2ZWYA 1DFBL 3ZKMC 4YXHH 2A6DA 5BRQA 1TUPA 2JB6B 3O3AA 3BDYH 4K3DL 4LBEA 3MV01 4IRZL 1EDHA 4WO0A 1H5BA 3V4PL 2OPCA 5JW4R 1X44A 5I16A 3O6MH 1J0IA 1ZOXA 4K5LA 4PJHF 1UC6A 3OAZH 4QHUA 2L7EA 4YHYB 4L8DA 3D85A 3DUSA 3HI6L 4X4XB 4FL4C 5C07D 1N8OE 4JHBA 3L1EA 4M5ZL 2EVJA 3SJVE 4G7QB 2EVIA 4LLWB 4E0RA 1A3LL 1O9WA 4N0FA 5ESQB 4JRYB 3WLBA 2QVMA 1CLOH 2H1LM 1AMYA 3QXWA 4PIRF 2K7PA 3QJTB 2XUWA 3ELAT 4RIRB 3WFBL 4L8CB 5T3XE 2BRRL 3C5ZD 4JFDB 3ROLB 5EU7C 3T6QC 2I9LA 1MJUH 1A66A 2MMXA 1OSYA 5TQ0L 1F97A 3P0GB 3DROB 4S2SA 3MA9H 5K9QI 3WD5L 2YEQA 4FLSA 5C0CE 4ZSOB 4PJ9D 2FO4A 1NUFA 2LABA 3AZUA 4Q6IA 3SOTA 5KSBA 1J5OH 3L3GB 4DP5X 2EIKB 4OGYL 1Z3GL 3KYKH 4O2FB 3ESMA 3AT9A 4N6QA 3QYCA 4XOAA 3X14B 2BS8A 5IT2L 1F3DH 4W9KC 5KAQG 2D31B 2CM6A 4N87A 4EI5C 4PRBB 4XMKL 2WVUA 2BINA 3R06B 3FU6A 2XN0A 2XWTB 2Z31D 3CSGA 1BFOB 4NQCA 1ZAGA 2JQAA 4AT6B 3CFKA 3U9UA 5FV1L 4HSAC 3VI4B 5IBTL 4TVPH 3MV11 2VWEE 4X9BA 5FM5O 3GJFK 5GXBB 1HQ4B 4O4YL 4PBWD 3PQYE 1Q0YH 5JXEC 1FNAA 1E8ZA 3AJ7A 3BIKA 4R4BA 3UCRA 3MRPA 3V4VH 1TZIA 1AVAA 3OKYA 4HUUA 5AYUL 3RLSA 3U79A 1XGUA 2CGRH 3GUFA 5FCSH 5CSGA 2R8SL 5EWIL 2HLFC 1RUAL 4YHPA 1F00I 3O41B 3OTTA 2CJ3A 4FI7A 5I8OL 1M56B 4DQOL 1U3HC 1NFDA 4P2QA 2JLLA 4JQIL 3TEXA 3DO7A 4HWEH 2EDRA 4RAVB 2DQFB 1E6JL 4Y4KC 2O26U 2GBUA 4OFDA 3GLEA 1XB3A 2V8LA 4APQD 3FCTB 5DZAA 3BIAX 1H6TA 1SLUA 4X6DA 2QKIC 4AYMC 1NCUA 3P9MA 4I18C 3VU2A 3ZL2A 4UIKL 2P4AB 4L4TD 5DC0A 3B1TA 1G4MA 4NUPA 5BXFB 5AD0A 1UJTA 4WU7A 4HG4K 5B39G 5CJOL 4QRUB 5D4IA 4HDIB 4YFLI 4OT1H 5DYFA 1UFGA 4Z0BL 4QHKI 3MBEB 4YGVB 1EGJA 2BHYA 2XU9A 1UQSB 4Y16C 5J4MA 4UMGA 5E24E 1ZLSH 3GXFA 1SDYA 4C56E 1L9NA 3ABKB 2UV3A 3DJZA 4JO1H 2YN3A 3VI3A 1AMXA 4OD2B 4PJIB 4GRMB 5DJ0B 2XZZA 2ZWKA 5DJXB 2H6PA 1E2WA 2ICEB 3GPSA 4L3CB 4OBRA 3BQUC 3B3IB 3MRDB 4EUPA 2Q3AA 4NO3B 3L9YA 4UILL 4ZXBB 4I9WD 1VACB 3MLXL 2YZ1A 1N19A 1YEGL 3VXQA 5L88L 3RWIA 3T77B 1S7RB 1TG8A 4G2AA 1N0LA 4MAYA 4A04A 3HMWL 4JG9A 2BNRE 2VDRH 2GVYA 1I7ZA 1IB5A 1ED3A 3FTGB 3G9VA 3QH3A 4H26B 3TF4A 2XQYK 1HSBA 2X6CA 3FN0H 3B9DA 4LSQH 3NJIA 1S7WA 1TITA 3CZGA 2GSIB 1T1XA 1QRNA 5G55A 2P5PA 3QHTC 4NQDE 2E9IA 4HJSA 4KRNA 1CPUA 1QKZH 4Y4FB 3FT0A 1P84J 2PTUA 4PUBH 4XMWA 3L4TA 2QGCA 4HCIA 2ICWJ 3DX7B 4M48H 1ETA1 5TDNA 4N2MA 2VZSA 4U4BA 3NIFB 3VRIA 4UNVA 1MRFL 2D4FA 3DARA 4LMQE 4GIAA 5DDHB 1FSKB 3ULSA 1K85A 4A39A 4GPVA 3HNTL 2R83A 4GBXA 4OFKA 3GHEH 5I6XC 1FLTX 2IGFH 3GIVB 4XAWL 3O0RH 2C9UA 5EO0B 4X6CB 3W37A 1F90H 3SCMC 5J11C 2Y4SA 3H9HB 4ELMB 4ENEC 2AK4D 3CDGA 3RY4A 1MI5A 2YFOA 1AGEB 5D1XE 5E03A 2DQHH 4BBWA 1BQHA 2OI9C 4UQ3A 4NQVB 4OGXL 1U8OB 1MG3C 3VDCA 4WO4B 2B59B 4Z7WE 5GGSA 3C6SB 4CADA 3S8GB 2ZONA 3LNIA 1UB5A 5GZNC 2CO7B 2JKXA 2P24A 4XX1E 3BP7B 1F8TH 2MTPA 2H3NA 2E3VA 1SYVB 1TZGH 5HYQB 3NCJH 1E5UI 3L1OL 3OC5A 4ODHL 5C0AB 3QQNA 4X6EA 3IMVA 3APNA 2VSCA 3T0ED 4G8EB 4YXKH 1PY0A 5TF1H 4QLWA 1UXWB 3CPLA 3UBFA 4PH8A 4PJFA 5IZ7A 3BP5A 4XCEB 2WQAA 4M62L 4K94L 4LCWE 1EEZA 5EC2A 4XODA 1S3KH 1CFSA 2G9KA 3IE4A 5AW5B 4F7PB 3DRTB 1O6TA 1YMMD 3HAEH 3U48A 2A7BA 2CHNA 1Y6MR 3A4AA 3Q7JA 1F1DA 4FFZL 1U8KB 1GL4B 3S36L 2ITDB 3PWUA 3D87B 1GH7A 2CQVA 5CD3B 5C0ND 1PCSA 4PGJA 4PWIA 5B8CA 1MFVA 3GXUB 3HUJE 1JMZA 4GXUN 5B3SB 3VW3H 4L5FE 4YHOH 1KCLA 2NY1C 4EUPG 2MJWA 1D5ZB 4PR5A 3HRZA 2P80A 5ELIA 5LAXA 1FZJB 5D1ZC 2BVPB 1A14L 3IPBA 4Q52A 3AMKA 2CJSA 3B7TA 2GTQA 3ULVC 1X6NA 3L1FA 3GZOA 3WTYA 3CPUA 1DCEA 2G0LA 2R56L 5AEAA 1YJDL 4B0MM 5I1EL 3TBSA 1E4WL 4DUWA 1FZOB 4KZEL 4Y5VA 2F58H 4XNMA 4CDGC 5C6PB 5IB1B 1SXNA 4DTGL 4MYPA 2V9RA 3EYSL 1S3RA 2VR8A 2EE3A 2NR6D 3QJRB 5DVNA 3BAJA 2D8KA 4M7KH 1I31A 4IM8A 4OJAA 2XVGA 2Y3AA 1F42A 5DD3L 2CCWA 2W65A 5B1AB 3RHWK 1BXAA 4XXCC 1OL0A 5KBNC 43CAB 3QQXA 3LV3A 1XD0A 4DN3L 3UBXB 4TNFA 5DS8A 1AC6A 1AIFA 3LKQB 2Y24A 4LLVB 1SJMA 4XVTL 3O4OC 3VFSB 4M6OL 4X7DC 1X9LA 4BE6A 1U58B 1F1AA 1N59B 5I9QB 3BO8A 1MLCB 1ZKAA 4IQHA 1CLYH 1NIFA 3GUTA 4OVUA 1HL8A 1Z3RA 1NCWH 2GY7B 1IL1B 1HZHH 2IF7A 4OJFL 1Y0LB 1TVHB 4ACPA 5IB3B 1DLFL 3OKEA 4MJ2A 4Q2ZB 1QI5A 1H3VA 2ZD0A 3FB6A 4YDNA 1K8DA 2WQWA 3K7UA 4NOFA 2IADB 1BQHG 5H37A 4ABVA 3MQIA 1ZVHA 3JT0A 3MRBA 4QRSB 5EUKB 4KZ0A 4AH2B 4GRLD 3FO0H 3SOBH 4Q6KA 2Y7LA 5CGYC 1XZ0A 4AYGA 2X5PA 4TSCL 1AP2A 2D03H 2G60L 2AJSL 2YRLA 4V1DD 5IFJA 4J8QA 5DRWA 5D70L 4GOSA 3ZDYB 1WPCA 3ZQWA 4IBQA 2ENJA 5KVFE 1JPGA 5CMAA 2OW7A 2A9MH 4H2AA 1F6AB 1JZ2A 2CLVA 4DOHB 5IM7A 1W8OA 4GAYB 4JREB 3W82A 3GS4A 4W70A 4WEEA 4JHUA 2KZBA 3V0FA 5CS7A 3E2HC 3Q43A 4NT6A 4R8WH 2R29H 1UZ8A 3C2AL 3KPRE 2I07B 1NWPA 2H9GA 4GKOA 4BSVB 1M3IA 4Q9BA 1L6PA 4UAOB 5T5FH 2VKWA 4PGCA 3MV9D 3NZ8A 2CBPA 4BH8A 5IEHB 2HVJB 5AOIA 3WFCL 3OG6B 4JRXA 1Q72H 2HKFH 1VFUA 1MF2H 4LEEA 5FB8B 4GH7B 2B20A 1AJ7L 4JKLA 1UXLA 3PV6B 4LMQI 5IESH 4ONHA 4L4TE 3C5XA 2HH0L 3GRWA 3EYUL 3SKNA 4Z7QE 3DGGA 3QAQA 2C1PB 5CLTA 1VAHA 2EC9T 4U1JB 4FLHA 1G7PA 4ZMNA 3ZIYA 4ISVB 4AY0A 5A6IA 4CC1A 3DHJA 1DSWA 1IGIH 3IDXH 5DD0H 2CRZA 3LDBB 4DVRL 4TSBL 5HYSB 4WUKH 2X4TB 2CHDA 1IC5H 3MGTA 3RGVD 4ZNEA 3IU4L 4OKVA 4DKDC 4U1LB 5EA0H 1BQ5A 2A74B 5GRWA 2XN9D 3GBNH 2CDEB 1USZA 1OF0A 1W16A 2EXWD 3AS0A 3CQFA 4NO0D 4PVMA 4U31A 5K59E 1C5BH 2BW4A 3O8XA 3OX8A 5DVMA 4CMMA 5A40E 3BN9C 3L9RA 1EJFA 1RAMA 3T0WA 4L37B 4HU2A 4I1RA 4P4KA 2FNWA 5AZ2H 4XC1H 3DURA 3VRJB 3WNIA 4MHHI 4PP2B 5HDRA 3MRJB 5F7MC 3ILQD 4PS4L 5HVHC 2I24N 3QNYA 4ZFOB 3TJHC 2XA3A 2AJXL 3QDJD 1KYFA 1MPAH 3FMGH 3M45A 2FWSA 4L9LB 5ID1B 1E28A 2Y6SC 3WJJA 1O5DT 3MRMA 5HHMD 3SQRA 2YXWA 1ZLVK 3ZUCA 1SEBA 2WXKA 1N8ZA 1U92B 4G11A 1HEJC 3E7JA 3CBRA 2VAJA 3F3HA 4JG0L 3U0WH 1OOAA 3WUWB 4OZHB 3DHMA 1R9FA 3LQAC 1JK8A 1XIWB 3WLWC 1JHKH 3LKNB 5T3ZE 1RJZB 1MUJA 3RP1A 1IBFA 3S5LB 1RZQA 3HG2A 4AE0A 2R9HD 1HYRC 3MVSA 2YKKA 3RVWC 3MREB 3Q3GB 1GYCA 4OD3H 3QIUD 3MAWA 2X1PA 3D07A 2APTA 1EMTL 3VQ2C 4KY2A 4B96A 4R96A 1NTDA 3O0LA 2F8IA 3QFJD 1FVEB 4XX5A 3D2UD 1N9PA 3H3KA 4KV5E 4EN2A 4KDWA 5I1GL 2F9BT 2AK4E 1OCWL 2DDQL 1JPTL 1NUDA 4P5TB 4HXBL 4XI5C 3TBVA 1VZHA 5BQ7B 4JB9H 1VADB 1Q4NX 1ZSDB 1O0VA 2DJUA 3B2UC 5EOQL 3VGEA 5AFAA 3FHQA 4XGZA 5DRZB 2HMIC 5DMGC 1R5IA 5GS1A 1HOCB 4AQOA 4EZMA 3G7TA 4AVHA 2F68X 1U2CA 2NT1A 3CXDL 4XP6L 5CUSL 2HT4C 1ZIBA 1BX2B 2KZ1B 3MRHA 3WHXB 3EDFA 2FBJL 5E4EC 5D6CA 1JBJA 4BRVA 1QP1A 2WNXA 4ZNCD 1EPFA 4X5PA 3T0EE 4ZMLA 2LV4A 3L3HB 3PLYA 2WQ8A 3V4VB 3LCYA 5EIIB 3ZHDA 5E7FA 1VPOL 3NJVA 1SJHA 3ARFD 3BAEL 1MREL 5TDOA 3T8XA 5HDQL 3IRCA 1XCTA 4HPYH 4XPAL 1O7DC 1ROWA 3HC0A 4M43H 1JUFB 2MWCA 3UAJC 4QYOA 2IAAC 1UKTA 3FRPB 1MFDL 2XIIA 4W4NA 4PLNC 1IV8A 1D5BA 1GR7A 4PJGA 1HHIA 1EX0A 3IJEA 1DFBH 1EO8L 2X2JA 5E8DL 2LFEA 2IPKB 2VMCA 4G9FB 4Z3GA 2E6QA 3IJ7A 4I2XE 4AL8L 1AZVA 4Z78B 1DQQA 3REWA 1WS8A 1KIUA 2YAQA 4Y2DD 3KYOB 4O02B 4A6YB 1C12B 4PJAB 4RDQF 3MMEA 3HI6H 4K9JA 4EQ3A 4JZNB 5PCYA 4M5ZH 3RB7A 2YAFA 4HUXA 1PKQA 1FVDB 4GNKB 1A3LH 2KPNA 4GAGL 5KSAD 4ZDHA 4ZFGL 2O6FA 4YR6A 1WGVA 4HS8L 2CPCA 1RZ8B 2WLZA 2ZUWA 4P3WA 4H8WC 4B6ZA 5E7BA 3OD3A 1UA6L 2MKWA 3S96A 5TQ0H 3X13A 3WD5H 5EU3A 1JNNL 4ODSL 3T6WA 2BSRB 2A9CA 4GQRA 1QTYT 1AKJA 3V7MA 3QR1A 3KPSA 4Z6AT 1K2DB 2B1AH 2Y5EA 4KH2A 1H9DA 1IIKA 2WYZA 1QBLL 5E1AA 4DQAA 5IT2H 1UM4L 1JRHI 2O5ZH 4L4VB 3NQKA 4OQ1A 2YD7A 4OCXH 2PXYB 1NBQA 4D0BA 4N9GA 5DMIL 3CCHA 3MV8D 3CU7A 1JD9A 4PD4K 4GRWF 3NSDA 3ALWA 3BPLB 3KD4A 3FCBA 2GJRA 3OWEA 1AS7A 3ARDB 1MFAL 1FO0B 3FHAA 4O4YH 4NBXB 4MQXD 3WIHL 3K2IA 1WA0X 3B5GA 1EA9C 3FQRA 2YSSB 4RAHA 1S5HB 4MKTA 4P8QA 1ID2A 1W2KT 3QJSB 3HG4A 1RP9A 3ZKMD 2MTAA 3VD9A 3H7BB 4PJ5A 5EWIH 1MCQA 4LCYA 3LVEA 5I8OH 2YN5A 4DQOH 4V1DE 3R18A 4K73A 4U6XB 5CJXC 1R19A 3BGAA 4FFYL 3FFCD 4IOIB 2IOOA 4X50A 5FW6A 2DWTA 4XZUB 1G7LB 1J0ZA 3PNWB 1ADQL 4KKPA 2FO8A 2ENQA 3U4EA 1E6JH 1RZKC 1ZVSB 4HD5A 5TE7L 2RGSA 5EN3A 4KNQA 4MBOA 1F3RB 1KJ3L 3QYNA 4L5FL 3O11B 4JG5A 5GJTL 4BZ1H 4Z7UA 4KKLD 3KLHD 3DYOA 4GMSL 4LVHC 3IJSB 4AEFA 4R4FL 1QWUA 4DKAA 1OARL 2WLNA 4BRJA 3DX8A 2F8XC 4PJGF 3JYCA 1FYTB 3SBWC 2OR8A 1H19A 2W0LA 3LEXA 4DZ8B 3T04D 4MCZA 3MV9E 2OMXA 4OAWB 5CJOH 2VXQL 2CIIA 4Z0BH 3MUY1 5D1QC 2Z6FA 1BQLH 1GZPA 1MCOL 3H9ZA 3L7FB 2D3VA 4HCRL 2ZG1A 3ARSA 3FQXB 3HZKA 1SJEA 4JR9H 2CUMA 4Q4IA 1NAKL 4IBSA 4X99A 3OC8A 4N2NA 4TUOA 2WYIA 2J1ZA 5FA3A 4XPBL 4LVEA 4MNQB 1WFNA 3AS3A 2DIJA 2VN4A 4UILH 4XCNB 3ROOA 1OTTC 3W5MA 5C0IB 4ZAKA 3MLXH 2X2UA 2UZYB 2WVSA 1AD0A 4FNQA 4WWPA 1YEGH 5L88H 1ZPUA 2CK0L 4QHMA 2I26N 3V7AG 2E7LA 4EI5D 1MY7A 2XN9E 5HDBF 3EW3B 5HVGB 2XX0A 5SWSB 4M4RA 4BELD 1SVCP 1COBA 1MCIA 4AXWB 4HFWA 5EDXA 2Y1AA 1RZJH 5HPOA 2AQTA 1NCNA 3KWVA 3US9A 4TS6A 5FDWA 3DPBA 2A4EA 1YG9A 3FT2B 4XMTA 5F1IB 4WI2A 1BP3B 1Z5LB 5HD8D 3QJZA 2NDFA 3EHBC 3AWEA 3AM8C 3U46B 4CW1A 1AO7B 3GEFA 1YHPA 4FQCL 3MU3A 3QDJE 5CIPB 3K72B 3MACL 2ZPKL 1XL4A 4BK5C 3SDCA 2UVEA 2Y7QB 4OFIA 5BZZA 4L9DA 4XN2A 2MPVA 3PNRB 2CH8A 4ERSL 2J44A 3RWEA 1QO3A 3M1OA 5KS9E 1AZRA 2B7DT 4J23A 1F02I 4FJYA 4B3VA 1HYSD 3I50H 3V5HB 5C6WH 4XAWH 4Z3HA 1UGNA 1KWKA 1DO5A 5DK3A 2WYHA 5GZOC 1J9RA 4WWID 1S2EA 5ACLA 3GSOB 4JPIB 4MD0B 3P9WB 4GW4B 3BCFA 2QEJA 1RK0A 3AAZA 4P9HH 3MV7B 2FJSA 2WXIA 1E2ZA 2Y1YA 3OJVC 1AQDA 4XNZB 2G75B 3R7QA 4HCFA 4QNPF 3RDJA 4NQCD 1FH2A 4Y16D 3GS7A 2VTFA 4L1TA 3VYNA 1TCRA 2OL3L 3HMXA 3NJXA 1UB6A 2BY1A 1UH2A 3VFNA 2KMWA 4NQED 3MTXA 3FS9A 5FA4B 3U2SA 5FGBC 4YSOA 1WBZA 1OT4A 4W9JC 5E5MA 3SKUD 1ZHNA 3ES6B 2QQNH 4ODHH 4WVRA 3BVNA 4XHQA 4R5TA 3STLA 3WGVB 2CU9A 4LSSL 2YIHA 5H2BA 3VWJA 5E00B 2Y7OA 2CLRA 1P4BL 5KVGE 2YMXL 3N40F 2WXJA 3NMEA 1E65A 1LGVA 2UXGA 5J8OA 3THMH 2YD3A 5CBAB 1D5XA 1GGCH 4P2QD 4U3SB 1OGTB 5DRXB 1DL7L 4AGNA 2QFRA 2BW5A 3R0NA 4FFZH 1RMFL 3RTQA 3VRLF 3MUUA 1GGYA 3IFPB 4TVSa 5DT1L 1Y18A 5LGKA 1JFHA 3LXAA 3ZTDC 3REVB 2UY7A 1OGPA 1O5PA 4NSKA 4BFIB 4Z0XB 2VXVL 2N7SA 1FL5B 2ROYA 5F0MB 1N5AB 1INQB 4GFTB 5JNYA 2R0WH 2VMDA 3JWNH 4XMXA 1MJJB 1A65A 2B9BA 3QHZH 1Z0NA 2OJZL 2ZOWA 3N0PB 1A14H 3R1GL 4NS0A 2FJFB 3OPUA 3SPCA 3OBAA 5FYJE 1EH9A 5GS3A 1SFHA 2XN1A 4UTCA 1X5MA 1OK0A 3NFSH 5BOZG 2RFXB 3AITA 1YJDH 3L9BA 2EE2A 5I1EH 1YPZE 1E4WH 5INDB 3HE6A 4OU3A 2AJZB 3CHXA 4KZEH 1QFPA 3FC8A 1ETB1 4OF6A 5HJ3A 4G80B 4UWQB 2ENPA 4JN2B 4YUEL 1LO4L 3H9SD 3QIWA 1VCBC 5EBLA 4UT6H 5MP6L 4DTGH 3L48A 2GC4C 3KDPB 5JPNC 1PFOA 5DC9B 4K71C 1YAZA 1MW3A 3HE7B 3QDMB 4Y5XC 4MAYD 3OR6B 5DEZA 2CALA 4JFEB 4Z5RA 2PWFA 5HYJE 1J5DA 3A4DA 5DD3H 1H15A 3ZK0A 3N3EA 1OTUC 4AMKL 3PFQA 4MD5B 4CN6A 1IC7H 1J9QA 1BF8A 2F5BL 4DN3H 2BMKB 4Y2LA 2ZWNA 3TH4T 5GZND 4XP9H 1QTPA 2DTML 3FFDA 5FYKD 3ZGIA 3WXVH 4PJHE 3NGBB 1QRND 4X7SL 1GYAA 2BP0A 3OAYK 3H3PH 4F7EA 3QUZC 4M6OH 4HFUL 4OCNC 4KXAA 4QKTA 5KVEE 1UCBL 2FQFA 1KT2B 2VW4A 5T8IA 3UP6A 1XZWA 2E8YA 2H1PL 2YBGA 4LEBA 5GS0D 4OJFH 4QHLB 1HH6A 1N18A 2QT6A 5DHYB 4AIEA 2N4IA 1R6VA 2IBGA 1AGFB 4XN5A 5D9SA 4B7LA 5FLVA 4I1PA 4JPWH 3ZE1E 5I1AA 4KMTL 1JN6A 2GJ6A 3QZPA 1BG9A 3RWDB 4TSCH 1NBYB 4ZFZB 5AVWB 2G60H 2YLHA 3BAKA 2P26A 4UZSA 1OCOB 4L8BA 1EQWA 4ZPVA 4M6AA 3Q5YA 5D70H 1GCYA 1OM3L 1TZHB 1BOYA 3UFIA 5J6HB 2NY1D 3OHXA 4X80L 1FCCA 4G43B 1OQOA 1YDPB 5AVQB 3LZRA 4XO9A 1E6OH 5ISZD 2R39A 4YC2B 4QO1A 1A2YB 3A23A 5DZOA 1MHHB 3CFBB 3LQZA 3BWSA 1K4CA 2PCPA 4MASA 3FUKA 3TT3L 5JIKA 3FFCE 2PYEB 5IJBC 3VXPA 3IJHB 3FH5A 4BWUA 3CVCA 3H7LA 1WJ3A 3WFCH 1R5WA 4NWUL 2CDGA 2OZ4L 1LVEA 4MAZA 4DGYL 1WZMA 4J3BA 1G7IA 2WTRB 4BZ2L 4ODVL 2HH0H 3OXSA 4LHQB 4ES8A 4MZ3A 1AXSA 1TIUA 4RX4D 4J8RB 4WNQA 5E2WH 5I26A 1IBGH 1V3KA 1HS6A 1NCIA 5CLWA 3CSBA 1MW2A 1FVCB 1FNLA 4JMNA 4HJUA 2ITEA 4L23A 4DVRH 2XSKA 4TSBH 1KNOB 3FF7A 3PWPB 4OCLC 2Q10A 4LCUB 2VE6A 3K2UL 3IU4H 3KMDA 4PJCA 3B9KA 3KWWB 4AGMA 1Y7VA 1CZ8H 2KZKA 2IANB 2KZWA 3IGKA 2N0KA 3I9PA 3VTTA 5DS1A 4AIXA 5KYUB 4GT7A 2ZX5A 1KTLB 4X5LA 3IFNL 1JZDC 1WWCA 2N01B 4QOKE 5KBPA 3MC0A 3SY0A 5FYLH 3OSVA 1A6TA 3GKZA 3BUIA 2P80D 3GSNA 1QBAA 3UXFA 2FYYB 3OKOA 3OGOE 2YD9A 4PS4H 3V79C 5DEGA 4MXQC 3KXFD 2OQJB 3WTUA 1T0NB 3OB8A 3V4PB 3CQQA 2VZUA 3HG1E 3AMLA 1MG2C 2Q6WB 3ABLB 5TE4L 5CGYD 3WELA 3HI1A 1XFPA 3P40A 3O2DH 2DQGL 3G5ZA 4FXGA 3KM1A 1KXQA 2X09A 4P49A 3PWLA 3ECWA 3SQBA 2FAUA 1QNZL 3QNXB 4JG0H 1XDTT 4G72B 4IIQC 2FLMA 3VG9B 2EEDA 2P8PA 1JOIA 1UG9A 2YUWA 5LWYH 5IKCB 1BXVA 4ODXB 1T80A 5EF0A 1KJ2B 4GO9A 1BBDL 2Q2LA 1TSRA 2GCYA 2P43B 1RLWA 3VJ6B 3C8DA 5EZLA 1BXUA 4W9HC 1BW8A 3U7WL 5ID0A 1Q8MA 3NZHL 3OQRA 3DMMA 1T21A 2WQRA 3PL6C 4OI8A 3B34A 3QUXA 5KN5B 4QF1A 2MH4A 4MQ7B 1X7QA 2DDQH 2ITCA 1A7PH 3QWRA 1JPTH 1ZEAH 4IMKC 4HXBH 1KB5L 5EBMB 1TZAA 3EYVA 5FFGA 4WWKC 1KIPB 5TF0A 1XGQB 4JY4A 2E9WA 5EOQH 1PVHA 2Q0ZX 4NQCE 3MRCB 2AVFA 2NNRA 5D7LE 3RAJH 2NY4B 5FGCE 4BCYA 3CXDH 3H1ZA 1HSAA 4NQEE 4Y89A 4TKWA 2AQ2A 3CAFA 1DO6A 1IVLA 2LGNA 4X5WA 2WNWA 3QJVB 3VXSE 2R2HA 5CP3A 4O2CA 2HFEB 1JK9B 3CX5K 2NW2B 3GJFA 3IMSA 4WUUA 1UEMA 2FUTA 2ED9A 3BN9D 2WZAA 5DTFB 5D7IB 1KTKE 4N2FA 3T4YB 1I85A 1YZZA 2J3SA 2DWEB 5FC9A 1VPOH 3LZFL 4B9KC 3BAEH 1MREH 1H3WM 3VXRD 2AXJA 1WC7A 5KZCB 1A3QA 1YEFH 2R51A 4P2QE 1JG9A 3MBEC 4C55A 5ALCH 4RISH 3V55A 4ALAC 1MFDH 4NN7B 4U33A 1NOFA 2JKWA 5TDPA 1PW3A 3MGAA 5CP7A 3UZVA 1OSPL 4AQAA 2HT2D 1J8SA 4JRXD 5E8DH 1MCCA 3BVDB 4OM0L 2Y6SD 3WS6C 5IREA 4J3XA 1MAJA 5G5DB 1GGIH 5TGBA 2ZWLT 3MCYA 4YNYA 4LRNH 4ZXBC 1F45A 1S9VA 4NZFA 1O7SA 3CH1B 2VDPL 4NWTL 2X2YA 2VL4A 5KYYB 1T7ZA 3LY6A 3V8OA 5T1KD 3CSYB 2P5WB 3NDZE 3QEHA 2B39A 5E4OA 2W07B 4YBHA 3BPNC 3RVWD 3D3VB 1LYQA 2VQ1B 4NYLB 1ZT7A 4GAGH 3UAAA 5K39A 1BQSA 4ZFGH 1XCWA 1NFIB 1G6RA 3W11C 4RETB 4Q9QL 1JFQL 5F1NA 2ZCKH 4JFWA 3H9SE 1XMWA 3MOBL 3O8XD 3PHQB 1U8QB 1MEXL 3CXFA 3P3TA 2CR3A 1NMCB 4HAFA 4XI5D 4P06A 1CFTB 4ODSH 4V33A 4P4KD 2NTFA 1M6UA 3B2UD 3WMQA 4OLZL 3TN0A 3WO4C 5AAMA 2HMID 1DLHB 5DMGD 3RU8H 1HDMB 3C60B 1FSKC 1DFXA 5K33A 4RBPH 5AB0A 1ZT1B 1MAKA 1G9EA 4KI1A 2Q86B 1EANA 2VMJA 1ECZA 2JCCA 3IFLL 2A1WH 2HT4D 3GMNA 3JBG7 3LOWA 4KBPA 5FYKE 4EO5A 4XO8A 1E7VA 2PP7A 1RIVH 3ZHLA 3I6LE 5JR1L 2XQYA 1S7VB 5H94B 1IE5A 1MCLA 1CICC 1G9MC 5DMIH 5EF1A 2F61A 2HN7B 1DVFA 3U9PH 2YD1A 4OW6A 1CLCA 2L8AA 3W0WB 4JE0A 1M57B 4F2EA 5IOPA 1JYNA 5FM5M 1MFAH 2IQAA 3UTQB 4AJWA 2J4WH 2WQUA 3E9TA 3WIHH 12E8H 2E27L 2Q1EA 3UAJD 4KHXL 2CO1A 2PPFA 3QDGB 4NPJA 2F18A 2Z7UA 1OAZL 3BKYL 2NXZB 3CFEB 2VJ0A 3H6AA 1VFMA 3N44B 1OSEA 3V0IA 5E08L 4NM4H 2BC4B 4KFZC 4I87A 4LQ1A 4A2GA 4BKLA 1I1FB 3H2PA 5I8KL 1PBYA 3DX9A 4HIJA 1U3ZA 3CZFA 1XF2B 1Z5YD 4MA7L 4JVUA 4IKIA 3R0MA 5TE7H 3SE4A 1F3JA 5CZXD 1SN5A 1B9KA 2IAMC 3NIFF 5D7SH 2ZAGA 5GJTH 5ISZE 1RUQL 2UWEA 3NN8B 4WI0B 4R4FH 1OARH 1HHJB 3VD5A 1BM7A 2NX5B 1CVRA 1LDSA 3MGOB 5J5EA 3UTSE 1WAPA 1K5NB 1KY7A 1WSST 4P4RB 4AZUA 1KGUA 4QXGL 7CGTA 2QVKA 2VXQH 1CTNA 3FW6A 2B0SL 4AIZB 3GLDA 3IMUA 1CLZL 4DP4X 4ELMF 5LHDA 2HZHA 3CFUA 3GXNA 3Q5OA 4DEPC 5BV7C 1QPXA 2G3MA 3UZQA 5KEZA 2XQBL 4HCRH 1DHKA 5I82A 3K4ZA 9PCYA 4NKDB 5I23A 3EH3B 4PWJA 3GK8H 1FNEB 4DKFL 1J1OL 2MPAH 1JTTA 2QV2A 4Q58C 4DSYA 2F8OA 5AKVA 4LO9A 5E9NA 3TFKD 1FF5A 2ATKA 2QR0A 4JL1A 4PRPB 2CK0H 4YHZL 4Z7NB 1FG2B 1V3LA 1QBBA 1CU4L 2OM5A 2NY2D 1F4AA 1BLNB 1VERA 4WW2B 1CDGA 5D96B 4JFFB 2HVKA 1N3NA 2COVD 3O9WA 4M7LT 2GIXA 1DDHB 2YPVH 4P2RD 4MD4A 1WE5A 2FJHB 2AJUL 4IS6B 4PJDA 2E76C 4UDUA 2MQGA 5EO9A 5HPMA 1A3RH 1T66C 1VGEL 1HQRA 1TKWB 3HCVB 2DBJA 3SO5A 5DSCB 1FGNL 1XEUA 2QPEB 3JZYA 4OSUL 4PIBA 4Q89A 3TO4B 1KDIA 3G5XB 3L1GA 4JJHA 3ZKSD 2RB8A 4KKNA 1J11A 1WBXA 1MWAL 3RWHB 3KXFE 3T4AC 4EJ1C 5A2LH 2YAPA 2F54B 3QJHB 4FQCH 5DZNA 5EBWB 5A3IC 3IVKA 2FHBA 4S1SL 5E5LA 2B1OA 3UAFA 2DBLL 3L3DB 3V0DA 2FUQA 5FF6A 4FCHA 4ERSH 2DQTL 3T5WA 3DGDA 2W0KA 3HRPA 2W5PA 4PW3A 3CFTA 4UM9A 3RB5A 1E5CA 1PEZA 1JGEA 4XHJC 4X2UA 3KCPB 1AKJD 2WCPA 4NLAA 2GFBB 3JVGA 1H8NA 1KCSH 2ZYIA 3BVTA 5JMOC 4PU2A 1IKNA 3LRGA 1CFBA 2OXGB 3N42B 1Q0XH 1NPJA 2Q2EB 3MCKA 3QORC 4NJ9L 3WEBA 1I8MA 2JTYA 2DL2A 1ZGLP 3IDNB 5IHHA 3KGTA 4BV1A 4L1SA 2HXAA 5IVNA 5T1LA 4HUWB 1JZ3A 4G8GD 2XA8H 4IEFB 2NY7H 2XYCA 3L4XA 4HETA 1LO0L 5F3BB 3ZYZA 2VLRB 3HN8A 3WYRA 3BPCB 3MODL 3AY2A 1U8CA 1IFRA 2M8XA 2IFFH 1CVSC 1YLBB 1G7QA 1AG0A 4DKTA 4I18A 2F5AL 1E4KA 1SDAB 2ZX6A 4G8FA 2BOCB 1P7QB 2DI7A 1JDCA 4UTAL 4LSSH 1ZWIB 2X2HA 3CLEH 2GC7C 4PJ5D 2FATH 3F83A 1CE1L 2O5YL 4CSTA 5IR1B 1R5VB 1T83A 1L6ZA 1BZ9B 3HZVA 2ALAA 3ZBMA 2JLPA 1DL7H 3FQUA 5E1IA 1IM9B 4FA7B 1TZ8A 4O58L 4B3EA 3KE0A 1YQ2A 4GQQA 3EH4B 4YO0B 1B0WA 1JV5B 1RMFH 1U3JA 5JIPA 43C9A 3VXRE 3AQXA 2BSTA 5FKPA 5DT1H 5AAWA 3DOSB 3GYRA 3OZLA 2GJZA 2OSXA 1U91A 3SDDB 3KVDD 2KQNA 3DNKA 4ZMYA 5EO1A 3AS2A 2ETWA 5DRNA 1DANU 2J7LA 4OH2A 2WWKT 4N6RB 1HHHA 3DKHA 5TFSH 5CZRA 2BP8A 2X4QB 3QJFA 5I1HL 2OJZH 3EJQA 3B7YA 4LKXA 5D7KD 2A74C 2WZ6A 3R1GH 2KHAA 3G04A 5CINL 3P73B 2CG9X 4LXFA 7PAZA 3ZDYF 1ZPLA 3LN5B 3ABGA 1T2XA 2CUIA 4B9CA 5C0DB 3U0PB 3V10A 2YS4A 4RVBA 4HJTA 3Q5TA 1GS8A 3FH8A 1KWGA 2VLLB 3SJVB 3NK3A 3MZGB 5MP6H 1PZ2A 4XPFH 3MRNB 3MUZ1 2JJVA 3KPPA 3PDDA 3AG2B 1OSZA 5IVOA 3BJ91 5K9KB 5IGXL 3D51A 2ZOOA 3UTPE 1OAXL 4L9LC 4Z7VF 2K4WA 3FYEB 4ZTOH 4OIAA 5C0CB 3V0GA 5FUZL 2Q20A 2F5BH 3EG9B 2HKAA 1RZGA 5D1ZI 4OLYL 5E99L 1OGAA 1XB6A 3AU1A 3RX9A 5ICZB 2DTMH 3ATFA 5TE6H 5SWQA 1G9NH 2APFA 5E2UL 4BHUA 2E7BA 1BVOA 4KJQC 4OZFA 1CBVL 3SCMA 3MNWB 1MCBA 1XIWC 4S1DD 1EFXA 1TNNA 1E90A 3ENEA 5CU5A 3RA7L 4HFUH 3UTZA 4EXKA 2A83A 1IAIM 4HH9A 5ICYA 1UCBH 2WWMD 3OKMA 3GHBL 2VL5B 1PFCA 3ZRFC 2BH0A 3F7LA 3UADA 2XBTA 1XGTB 4XMZA 3T08A 3VD1A 1KGWA 1TMCB 3FU7A 4JRLA 3ELQA 4IHOB 3F12B 2YFNA 1M6OB 3HI5L 3PQYB 4B53A 5EEZA 1AHWA 1UM5L 1A1OB 4L05A 1THCA 5CZKA 4GG6A 4KMTH 4UF7C 1AG6A 1HFUA 2PO6C 4GO6B 4X6BA 2OMTB 1O7DE 1W0VB 5KW9H 2YWYA 1UACH 5IVXA 2Z4QB 2X3BA 4YQXL 4MNHA 5TPWL 3FTUA 1BPVA 4NQSA 2XZAH 4X80H 4WJ5B 3L4CA 1KJMA 2H32A 1D9KB 3SYQA 4GY4A 4JDVB 1KJVB 3UYRL 1B2WH 2YD2A 3TT3H 3TYFA 3VFWA 1HINH 1Y6KR 2VR7A 2APSA 3RWJA 3BSHA 2BIOA 4GRWE 3ULUH 1A21A 3VWKB 2CHWA 2N0MA 4OZHF 1BFVL 1QUNA 4JFYA 4LLMA 1J9SA 1R3JA 4JMXA 3TO2A 2OZ4H 1WAEA 1EGJL 1BIIB 3SGJC 1WP6A 2X41A 2FK9A 3VWJD 3ZDZF 4ODVH 4BZ2H 5KVDE 4CU7A 3L95A 5I6OA 5IMOA 2M83A 2V2XB 2QQKL 3K3QA 1LP9A 2EABA 1UOWA 4FE9A 1OTUD 1QLFB 2EYTA 4ABQA 3RNQB 3N1FC 3OJDA 5AW4B 5CFAA 2SEBA 4N3UA 3VD7A 5D5MB 4LLDB 2OFQA 4M6NL 1BBJB 3K2UH 1UH3A 2RCSH 3TC9A 4PJBB 1AR2A 3N40P 2JTDA 2AEIT 4CJ1A 3EO1A 4X0KB 4W4OC 3Q0HA 1E9OA 3FSOA 3OZ9L 3QUYB 4S1QL 1ORQB 2ZSWB 3A6BL 5A16B 2FECI 2Z93A 3IFNH 4PJGE 1R24B 1NEZB 3P0YH 5DJZB 1HNGA 5HTSA 3GB7B 1I1YB 1KEGL 4I0KA 1BYOA 1G7JB 1S7UA 2YPLB 5FYKL 2MOQA 1WCBA 5J1SC 1F6FB 2GHWB 3QEQD 5C0BA 4P2RE 3WIFA 1CT8A 4NKQB 1OOWA 1EZLA 4OKDA 2V3DA 1MIEL 2OX5B 3HE6D 3QXDA 5TE4H 2ADGA 4GXVL 5DQJA 4QY8B 5KYNA 5EU6B 1G5AA 4PRDB 4DESA 3QIWD 1ZANL 2YPKA 5GS0L 3V7AE 4AKPA 1QUPA 3MX0B 5CFHA 2WTPA 4OZFG 1KV3A 2XLLA 1QNZH 3BAXA 2W1NA 3R4DA 1TTFA 3SBQA 5ABZA 1IFHL 3U1PA 1R3KA 1ZE3H 2O6EA 3MO1B 2FQDA 4WV1C 4Y5YB 2CRYA 3KPMB 1CF8H 4LNVA 4LLYA 5JMRA 5EEVA 2KL6A 5HDBE 4ZUVA 4E41A 5GGRB 3AWGA 4ATTA 1DSFL 3BPLC 2KH2B 1LE5A 5KSUA 1J8HD 2H6OA 1L0QA 1B0RA 1HAUA 3ARDC 1JWMA 4KI5D 4NAMA 1XSKA 2H26A 4GINA 4PJAF 3U7WH 2ZAIA 5L4MA 3LH2H 3CFQA 2WSPA 5D1XB 2ZOKB 4Z3IA 2WSDA 1RJYA 2WLJA 1IARB 4AJYV 5I17B 1F41A 2MCMA 4L29B 1KB5H 3TL5A 2KLTA 4LDOB 3HLKA 5D1QE 5GGTA 3M07A 4ZJ9A 1O75A 1HNYA 4G8GE 2E4TA 4Z95L 4NBYB 3DK2A 5AKTA 4NI3A 3A4FA 1Z32X 1IGFL 4M6ML 1EK3A 1T0MA 1U8LA 2GJ6D 1RK1A 2XWZA 1RIHH 3IDMA 4LGPB 3V6OC 4Z76B 4N0YL 3DX0A 3VG0H 5D7JA 1M1SA 3AXLA 4CVZB 4UQAA 5F72S 5CN2A 4PGEB 4FQIL 3EUUA 4PRHA 3EO0B 4GAAA 3FSWA 4R26H 1OB1A 4HF5L 4Y1TA 1DBJL 3RPIA 2TRHA 3LZFH 4K5OA 1M2OA 1VZGA 2ORBL 5DO2D 4P2AA 4G9DA 4PSRA 5GSRA 4QNPE 3CNKA 4GUCA 1W0WB 4FMKA 4M1CC 3IDUA 3BZFB 3IDIB 5IMMB 5ESAB 5JW4M 1NCTA 1XR8A 1J88A 4CKVX 2WLLA 1OPOA 2BVTA 5BZWA 2ATAA 2LT9A 3DJRA 3HUJB 2JK5A 3KL0A 3LRLA 4YDIL 4MLIA 2PPDA 5F44A 3CUPB 3V0HA 3WN6A 5DGRA 1P7KB 2CM5A 2XFXA 1B4RA 4UU9A 1ZGLM 1QEWA 4LFHG 4ODBD 4NWTH 3DUUB 1UJ3A 1WHPA 3DXAE 4KJYA 1DUZB 2XWBA 4MA1B 4N2EA 1JF1A 2JF1A 3O3BB 5CJ8A 1T7XA 3ESUF 1U2YA 5D7KE 2GK2A 4KFMA 3GM8A 4TNVF 1FL3B 4KXZI 5IJKA 4W9ZA 3WFEL 2NY5L 4L0YA 2B3IA 2EE9A 3B9KD 1JTOA 3V6FA 4BKTC 1JFQH 1P9MA 3VRLE 4KDVA 3FUIA 3QR0A 1MEXH 3PL6D 1GIGH 4KDTC 2GTZA 3RY6C 3I6GB 3EFFA 5E6RB 2W80C 1NIBA 4WWKD 1XGPA 4MFHA 5GSVA 3H0TB 4OLZH 3HNVH 2XTLA 4BIKA 1JXDA 1WBYB 2FECL 5JLZA 4PJ9B 2FIKA 3BD5A 5D6DA 5DYOA 1WAAF 3WJLA 1T04A 2NUPA 3VAEA 4JY6B 4CGTA 3P3YA 3NTCL 4X4MA 4K2UL 4HUMB 1PZUB 4DUVA 1AQHA 2OTWB 1A22B 3QO1A 4P3CH 5EN2A 1NDGA 4H8VA 1J48A 5MEND 1QSFA 2WNKA 4NKOB 5EOCJ 2H0EA 4WEBL 4HIEB 5AVXB 3TBWA 2Z31B 2GIMA 2P9RA 3VYPA 4PY7A 5T5FA 3AACA 1PL3A 4XNZC 2LAGB 3PCYA 2E27H 4KHXH 5CEXA 3UCQA 1NUGA 4LDLB 4XE5B 3L2LA 3HAEG 4KKAC 3L3OB 3ZDWA 3EH1A 3UTTD 1OAZH 2WZPD 3P54A 4N2AA 4AEEA 1TTGA 1URZA 5I8KH 1RZIB 3E6FA 4HJJL 1SVZA 2PF6A 3QWRD 4PY8I 4M7LL 3OKDA 1J8RA 4NENA 3HNSL 1MHEB 3FRUA 2Q7YB 3K2KA 1DQJB 1ZGLA 4PGDA 3NSXA 1R17A 4EN3C 2OJEA 3ILDA 3ZL1A 1RUQH 1A5FH 5KYXA 3JTSA 5JORA 4APQB 4DEWA 3GSUB 5E9DA 2OL3B 4P59L 2ZXBA 2VAAB 3GRWL 6PAZA 1DCLA 4XNUL 4A7UA 1Q0EA 5D2LA 3NCWA 1AFVH 4L4TB 1MCRA 3QUKA 2B0SH 1IGMH 3T0VA 1BYPA 4XZ4A 2C34A 4WUUD 1GKOA 1XVSA 3AC0A 5EPMB 2AAVA 1LWRA 5T1MA 4UM8B 1MLBB 4CJ0A 4UV4L 5DMKA 3VU1A 1A7NL 5EF3A 3MOQA 1MCFA 2FEEL 2IH3B 4GAJL 5H4ZA 3KLKA 4Y9GA 1CURA 3ABZA 4TOYH 3WENA 3WIAA 4EXPX 3EFOB 4IBYA 5KG9A 4HWUA 2CA3A 3EUDA 1YEHL 5IBUG 4MMYB 4AKOA 4LSRL 2V9UA 4XE0A 4YHZH 3NCBB 2I85A 2A9DA 3ARBA 1YY8A 3IT8D 1CU4H 3K0YA 2ZSVB 2XXCB 1E27B 1CICD 3QISA 1C8QA 2BWDA 3BUYA 2L04A 3VFTA 1WG3A 2IWKA 5FK9A 1NBVL 3RUGF 4AK2A 2AJUH 4HKZB 2X4NA 5E9AA 4C47A 3S0PA 3SE9L 2X9ZA 1VGEH 1JGUL 2KKQA 3QC5X 5L2KA 3HA0A 3BD3A 3I3DA 1FGNH 4KPHL 4OSUH 3TYGL 3JTTB 4A2MA 4JLRB 1UWYA 3SKMB 3FT3A 2XTJC 5SX4I 5FO7B 3QEQE 1JZ4A 1QVOA 4ODTL 1M7DB 3SODB 1Q9WB 5D2NC 3KPQB 4TNVK 1YMHB 4PCTA 1HXMB 1WT5C 1VSCA 4S1SH 3N9GL 2H3KA 3CK0L 4BQCA 2DBLH 2X70A 3NGBC 3TBTA 1L5GA 3HHRB 5ESVB 1SUHA 2VQUA 2EXYC 3O45A 3RKDC 2DQTH 1DVQA 1T22A 3QFDA 3VMPA 4J12A 3VXTB 1DEDA 2HJFA 5B7MA 3HS0A 1RUKL 1S9WA 1J1PL 2IAMD 4K5PA 4QEGA 4YSEA 1M7IA 2VM3A 3OKNB 4A7GF 4R0LA 3QQ4A 4MJIA 2JV6A 3RX8A 5JZ7D 1KFGA 4UDTA 2ZNWA 3IXAA 3ABMB 3DOHA 1J8HE 4U6YA 4PTUA 1IGYB 2QADD 1CXLA 4I48B 2AK4B 3B56A 4YAQA 3QA3A 1EXGA 5JDSA 1DVFD 5FO9B 5C0JA 1WA2X 4OZGA 2CO3A 3PAZA 1ZHBB 2JE8A 4QTIL 1LO0H 1RHHB 3TA3C 2P42B 2FSEA 2P8LA 5HI3D 1ZLUK 2W60A 5MI0C 2VW6A 1GZHC 2F5AH 1EJOL 4R7DB 2FX7L 3CHRA 2J5LB 3K4DA 4PCSA 4KZCA 3VSVA 3O3EA 2A9NL 4B9IA 4UTAH 1EAPA 1UOVA 5L9DL 3DBXB 4LPVA 5E56A 3OAWA 4H8PA 2O5YH 1X4YA 3N6YA 3T0EB 1CD1B 2VDLB 4HMDA 4XWGL 4L1LA 3L3IA 1EXUB 4NO2B 3O2WL 5J6GA 4YX2L 2CR0A 5IQ9A 2XIBA 3H56A 4QAMB 4O58H 1T66D 4MRBA 5F3HB 1HAWA 2O6CA 3B2VL 4NNPL 5LGJB 4JZJB 1NBCA 1YMMB 4QRTB 1FFRA 3DC0A 2J2ZA 2IV8A 2Y1ZA 3ECQA 5I6KA 4JFDE 1XF5B 4H2CA 3K6IA 1DVYA 5T33H 5AG8A 4AYFB 5FO8A 2WXRA 5IB4B 3UDWC 3DLQR 2ADIB 3GMPB 5I0VA 1DZBA 2QKSA 3EYOB 4RMRA 3VH8A 4I2XB 4XN8A 4ZI8A 1XTLA 1HL5A 5C6TL 3NSJA 2PPCA 5I1HH 1EHLH 2IG2L 3QXAA 1X9UA 4DFHA 5C7XH 5IBLD 5CINH 3X1GA 2UUDK 1MQKL 3P2BA 4MA3A 3V5DA 2MRYA 15C8L 3QG7L 3CFJA 4B50A 2VR6A 4JFQB 4WY7L 5LNGA 4XHJD 3ARGB 2YGNA 1YSOA 4QYAA 5JW4N 1CL7L 5I28A 5B1JC 1X5KA 4D9QD 3CHPA 3IMWA 4JM4L 1PZ5B 3UERA 4L3FA 3O6LH 4H13C 3PU7A 2Q8BH 3Q1SH 4TVUA 3QORD 2YUVA 1OAKL 2PYFB 4F3FA 4ZODA 1E5ZA 2A6IB 5IGXH 3BYYA 4YZFE 2FYVA 3P3RA 3FQ2A 2WSKA 5DJDA 5GGUA 3AU0A 3L4ZA 4LASL 4PW9A 1G0DA 1T20B 4JM2A 4OLYH 5E99H 1VDGA 4NUMA 2IDUA 2FR4B 1NBZA 2PTTB 4OUUA 5E2UH 1CBVH 4DPRA 2X3CA 3RA7H 4O2EA 3U1SH 2FB4L 4GFXA 2OSYA 1QHPA 3GHBH 4ENZA 3DUHA 1VLXA 1QX1A 3ILPA 4HIIA 3SPHA 2NT0A 4TTDC 4WFED 2OBGA 1VEOA 5ALBH 2VXTH 5C09A 3GQFA 3RJQB 2CKBA 2W9LA 4XBPB 3HI5H 4JZOA 4BZ1A 3PXHA 4MQSB 4FQXA 4H7VA 7FABL 4GLRH 5MENE 1UM5H 3LSOA 3QZWA 4UM9D 3GMMA 3K2MC 3WI9A 4URTB 3SKOA 3DO3A 3LX9A 4GRLB 3JV5A 2QHRH 4FTVD 6CGTA 4K9EL 3BVWA 1WTLA 3A24A 4A37A 4FXKA 4AGLA 2QTEA 3MJ9H 4YQXH 1GGTA 1QFWI 4MNGB 4N4YB 3T3MF 1I8KA 1B0IA 3UTTE 3M86A 4V1DB 4XXWA 3IF1B 2V9TA 4CRPA 4FMVA 4WCYL 5T1LD 1P2CB 3UYRH 3VFGL 1OT2A 4KKRA 3UPRB 1X5ZA 1U2HA 3US1A 4GUPB 3FZUC 4TXVB 3WFDL 2QFPA 5FUOH 4S10A 1AKPA 5SWZD 1BFVH 3L6FB 3NJJA 2D0FA 5C9JB 1ZHKB 2ZCLL 3MLRL 4HS6A 2APXA 1N64L 4GW5A 1XWVA 1KLFA 2WO2B 4HHAB 4RFOL 4TLKA 3W9DB 3MV9B 4RNRA 5GIRA 1EGJH 2NNAA 4U1KB 5IB5A 3L3KB 3FT9A 4NN7C 4CKQA 5F97E 2WUBL 3LKOA 1UWFA 2QQKH 1I9RL 2DQ6A 4PRIA 5GGRY 4K5MA 2WBJA 6PCYA 1VIWA 4IRJA 4EUPH 2CWRA 3VH8G 3F85A 3DX6A 4O9HL 1MFUA 4FFVC 4JKKA 1LDPH 1V3JA 1F4XL 1VESA 1I1AB 3KPTA 4JHAH 3NIFE 4I3RL 4IU2A 3RGVB 3VA2C 3OZ9H 1YN6A 3A6BH 4XH2B 3HHSB 3LPPA 5FR3A 1D7CA 4YSUA 2XN9B 5E8PB 4NO0B 1DVTA 2OMWB 2WB7A 3TVMC 1KEGH 4X7CC 2HCZX 3S4SB 1A7RL 5J6SA 3ZLQC 3WNLA 1TT6A 3SGKC 2IMMA 3GZQA 4ELME 3BZEB 1NANI 1NMCC 1MIEH 1BSIA 1NAML 2C3XA 3S3JA 4GXVH 4RA3A 3T09A 1P4LA 1FNSL 2VDPB 2PO6D 2BWQA 4PLOB 4OV5A 3X12A 4AIOA 3MI6A 1CBJA 3QDJB 5DQ9A 2IALB 3MNDA 3QCVL 1LEIA 4NDMB 2P3YA 2YD4A 4PVNA 4WJKB 5KS9B 1IFHH 2CJUL 5HHMB 3ETBF 2Y06H 1XF4B 4TVPD 1GHFL 4LHUA 4WHTB 3E3QC 5F1KC 4OLEA 5KBDA 4HV8B 5C0AE 3H8NA 2E9GA 3UABA 3FQTA 1I1CA 1DSFH 1TJHL 2Y72A 1WWWX 3FSZA 5ADPL 4F91B 2OR9L 1CD8A 1ASQA 3AXIA 2PNDA 1WO2A 2L4OA 3PWJB 3GMRB 1EFXD 1I3RA 3QZWG 3RRQA 3QIUB 3L7EA 1LO2L 3UO1H 1ZHLB 5JOFB 4ZK8A 3S6CA 1U8NA 1QZ1A 3QNFA 3FKUS 2R23A 3DK0A 3DDGA 3HMXL 5E2TL 5TK2A 3QFJB 5JW5B 2YR3A 3D2UB 3VXNB 3E6HB 4NZJA 2NTSP 3RFZA 2VITA 3M7FB 2G2RA 2EVHA 5EZJA 4PCYA 4FKKA 3UYPA 2R1WA 1IGFH 1RQ5A 1NICA 1QA9A 1FFPB 6TAAA 1BD2A 1G7MA 1Z9SB 2HWZL 3ZT7A 3OXRA 1R75A 4N0YH 3DGCR 3WL9A 1FA4A 2NUTB 2PTVA 2NY6B 2EC8A 5A6LA 1HZLA 1S7TB 1RZ7L 4FQIH 1FV1A 2B8OT 4AG4L 4HF5H 1H3UA 3KPOB 1U33A 3D18A 4F7TB 2JB6A 4WENB 2JVUA 3CWGA 4FQLL 1RLBA 3FOLB 2EVFA 4J3UA 3ARFB 4WTZA 4OJDH 1EAQA 1IGCL 4WDIB 3G5VB 5EEXA 4NZUL 4X83A 1U4FA 3B83A 4GEIA 4DGIH 2X4UB 4PJXF 3KBHE 4N2IA 3LHPL 4AK1A 4K94C 4QCIB 2P5EA 4LLWA 2H1XA 3K8MA 4XVJL 4JRYA 5ESQA 1YNTA 3IKCB 3VUAA 4RIRA 5FDYA 4OZIF 4L8CA 1YEDB 4WW2C 3ROLA 5D96C 3IXTB 3FNKA 4ELDA 4P23C 3RIKA 1IJNA 3DROA 3WFEH 2NY5H 4RMUA 2V5RA 2E7CA 4ZSOA 1AYOA 3GXMA 5JIIA 4KU1A 3L3JB 4LFHD 4ODUB 1HK6A 5D71L 3JWNC 3TO4C 4QT5B 3IDJB 4PV8B 3L3GA 5ITFA 1KDJA 2ZP0T 5HP5A 1HILB 3AT8A 4O2FA 1V55B 4UTBL 5D7EA 4GSXA 1OF2A 3ORJA 1NLDL 3LKPA 3QWNA 3X14A 2AMGA 4EZLA 1YJDC 4PRBA 3R06A 4F7KA 3QQDA 2XWTA 3LN4A 3QCUH 1BFOA 3GTVA 3IDGB 4MB4A 4NC2B 4PJHB 5C0BD 5HGHA 3NP4A 2M2DA 3ZDYE 1KB9K 4LHUG 1TQUA 5E6UB 1R3IL 3NTCH 5FW8A 1IFGA 1HQ4A 3I9GL 4K2UH 2BNQD 2VISB 5AALA 4OLVH 1MDAA 1I9IL 5MEQB 4YXLH 4RZCB 2Z7ZA 1PF3A 2X38A 3OM3B 1AQKL 5H37H 3HLAB 1MWAB 3GBLA 4CVXB 4HLJA 4A1RA 3MV8B 3BKCL 1C9SA 1JVOA 2ZUUA 4P2OB 4WW2F 3FQNA 3RVXD 4UOW1 1URLA 4Z7VE 1FYHB 1LEKB 3KCWA 1SYSB 3ZE1B 1MXGA 1T6BX 4E41D 3TIEB 4M1CD 4ZMPA 3SDXB 4QD2E 1FIEA 4RAVA 1DBKL 3MFFA 2AP2A 3PFUA 2JJSA 3A21A 2O61A 4FG4A 4CILA 4K15A 4XN9A 5GGQL 4BDVB 2BY3A 5CNHA 4FTVE 4HJJH 4GKZB 2L7JA 4A2DA 5JHDA 2O5NA 5ANME 1DZ0A 4M7LH 4NN5C 1PNDA 1I7UA 5BXFA 1HJBC 4EKJA 4PB0L 2ZYRA 2JIXD 3FFCB 1CFVL 3O6FC 4K7FB 3KDMB 4HDIA 4QRUA 4RMTA 4F8OA 5C08E 2G5BB 4YIQB 1BGXH 3L8QA 3T1FB 3CFDA 2M26A 2WP3T 1Z9MA 2WVVB 5IV2A 4P59H 3TTYA 4FL4B 4OD2A 4PJIA 2WZ5A 3BWAB 3P1VA 5SWZE 1GS7A 5J89A 1XH3B 3GRWH 5DJXA 4XNUH 2ICEA 1JNLH 4L3CA 4WTZG 3B3IA 5D7JD 4CL7A 4Y9BA 4F7MA 5CN3A 4NO3A 4FI6A 2OV0A 1IMHC 3GSRB 4Z77A 4KZDL 2HG0A 3UGEA 1S8DB 3T77A 1S7RA 5BNXD 1WA1X 3EGDB 4M1GH 4FRWA 5JQ6L 4ZUSA 3D39D 4QIRA 4F57L 3WMSA 3FTGA 1E8XA 4C4KT 4Q97A 1YEHH 3V0EA 3TEYA 3O2DA 1KCUL 2BP3A 4EI6B 1S5IL 4F8LA 5LLIC 3SPGA 1HHKA 1NCBL 5HGBB 2GSIA 3AABA 1U42A 4MDIB 1GY1A 5DGQA 3GSNL 1QATA 4Y4FA 1LEGA 1TJXA 2K3TA 3ARQA 4Q0XL 3O3AB 4LBEB 2TAAA 3DX7A 4EI5B 3SE9H 3X17A 1H5BB 5E0FA 3ZDZE 1JGUH 3JWDC 1BEYL 1LWHA 2AW2A 4KPHH 2EACA 3TYGH 3N43B 4XPHL 1HNFA 3UGXA 2UXVA 4ANKA 1ACXA 1MIML 3GHPA 4OCSL 4FNLH 3DUSB 4OI9A 3T1WA 4ODTH 5DK0B 2ZJSL 1VEMA 3GIVA 4H1LA 3L45A 5TQ2H 2XVBA 2XPGA 4HJIA 5DURD 5LBVA 3N9GH 2BVOA 3CK0H 4H4NA 4X6CA 3CVDA 5E5RB 3WLBB 1KXVC 4POUB 1UH4A 2FLRT 3H9HA 3OKKA 3TBYA 3C09B 4NQXB 3A22A 1AAJA 1RUKH 2I9LB 3B2PA 3SE3A 3WSQL 1J1PH 5JQIB 2WW8A 3S97C 3FT4B 5FUCE 3OGCB 4KK9C 3EOAA 4W93A 4WO4A 4EN3D 2B59A 4F9LC 4D9LL 4Y4KB 3ZE0B 1JHTB 1IQDA 2X89A 3C6SA 3DBSA 5D4JA 1E4XI 2A9BA 2FO4B 1ROCA 2K70A 2CO7A 1OQXA 1OHZA 2YSTA 2CR6A 2QKIB 3BP7A 3HHMA 5BRZD 3RX5A 5DFWH 3W57A 4HZLB 1SYVA 5LGYA 5T1JA 5IWLA 1KXTA 1QSFD 3OKLB 3EJUA 4M29A 4QTIH 4XBGA 4JO3H 4ES9A 4WFGE 5BMFL 4NQCB 3F7KA 4Y16B 4XNQB 4XCEA 5GQBA 4XNYL 5TJWK 5D7LB 4FADA 2EDMA 4JFXB 5FGCB 3TEZA 3ARUA 4NQEB 4J27A 4KJWD 4G9FE 2FX7H 4KHTL 1PZAA 1JZEA 3G6JF 1JYVA 1N2RA 3VXSB 2Q3XA 4Q74A 3BIKB 5I6LA 4GG6E 3DIFA 2WKOF 3HBPA 2DZEA 3MRPB 1TZIB 1U8KA 5F7FA 1XGUB 2ITDA 4PJAE 2WLKA 1QSED 4C58B 3L13A 4FYRA 5CD3A 2E6JA 4YX2H 2A3TA 5B1CA 4FG6C 2RAMA 1AZUA 1WFTA 2AQ3A 4QRRD 3TV8A 1D5ZA 4P2QB 2EADA 3B2VH 3QQ9D 4NNPH 4IRSC 1FZJA 4EKXA 2BVPA 3N0AA 2YARA 5EULV 2XTJD 1PG7L 4MZRA 5E9DD 2J21A 3D1MC 3WO3B 4X6DB 1OZTG 4GW1B 2O6DA 2DEXX 3P9MB 1OM9A 3O2VL 4NN6C 5C6TH 5C0GB 1J10A 2IG2H 4WU7B 2WOYA 3WS3A 2EXYD 5ECJE 3VO0A 3WNMA 2OZNA 4AQEB 4XP5H 1EERB 3QG7H 2Z1PA 4PLJD 1CR9H 3SGEH 3JV6A 1NMAL 2DIBA 4WY7H 1GJIA 4UQDA 3CZKA 1YECL 4EVNA 4L4VE 1NSNL 2QV4A 1G6RL 1JZGA 1CL7H 3GMLA 4QTHA 4JM4H 2H6PB 3PP4H 4OIBA 4R5VA 3UBXA 1P1ZB 1PMYA 3H9SB 1IBHA 3HB3D 2APBA 4AL8C 4TNWF 2PPAA 1OAKH 3LKQA 3MLWL 3W38A 1GYWA 4WFFD 1IM3A 3VFSA 4HKXA 1KCRL 4FQQB 3CH8A 4LHJB 4H1LG 4WI7A 2VDKL 2EDBA 5E8OB 3RWIB 1IEAA 4LASH 4MAYB 1QASA 5F1OB 3UJIL 1MLCA 5DS2A 4IOFC 1I3GL 4ZD3H 3QB7C 2F19L 1ED3B 3QH3B 1HSBB 1NMBL 1Y0LA 4R7NB 1BQUA 2DJSA 3IETA 4JN1L 5IB3A 5IEKB 1OW0C 4GQPH 5AW6B 1CE6B 2GAZB 5EZPA 4Q2ZA 4Y5YC 2VABB 2VJ8A 4Y1AD 2IADA 2FB4H 2W95A 1QRNB 3JUZA 4W9GC 4NZ8A 5EUKA 5D5MF 3UYOD 4AH2A 2ZUXA 5CZVL 4XOEA 3NUKA 4Y8AA 4PJBF 2BJML 4YDKL 2BNQE 4FEMA 3FU0A 4PAZA 3V6OE 4HZAA 5TDNB 1JL8A 2GK0A 5FGSA 3AY4C 4XP1L 7FABH 4UQ2A 3T2PA 3ULSB 1UD3A 4BK4A 1DVSA 5BJTB 3VFRB 1F6AA 2OMUB 3LD8C 2B2XL 2DW5A 4GAYA 5JA8B 4HSQA 1ZS8B 4MJID 3PGCB 4X8XA 1BXXA 4CC0A 2VQ4A 3K6NA 2I07A 3BP6A 4ETQA 3MYZA 4BSVA 1WAAE 4N1HB 3EXJA 3SB3A 4L0ZA 2HVJA 4NUQA 4WCYH 5FB8A 1E0OB 2NY1B 1PU0A 4TLTA 1BQHB 3PV6A 2XKNB 2NQ3A 1KYOK 5F6IC 1RZFL 2VR5A 3U25A 3PHOA 5ISZB 1LE9B 1AANA 4N22A 1YY9D 1UWXH 3QEGL 1ML0A 4K7PX 4LVNB 4U1SA 2ZCLH 3MLRH 1HH9B 1WCQA 2K8MA 4U1JA 2H3NB 4RFOH 2OMBA 2XY1A 5AVSB 2BWIA 3T0BA 5JYMA 1CMOA 4LSUL 3TGXA 2MNJB 1V7MH 4LL4A 4LOUC 5G4NA 5HYSA 3PP3K 3BI9X 2LFGA 5IUSA 1KBKA 2FWOA 2WUBH 2JCWA 1I9RH 2N1KA 2CDEA 3HBGA 3CPLB 4LCCA 1B88A 2RD0A 4Y19D 3BP5B 2DF3A 3GEWB 3WDIA 4H25B 2YGPA 3EBIA 3RJDA 3A3YB 4MJ6A 2H8PA 2B4CH 3KBEA 5ADOL 1VENA 5IG7B 4KQ4H 4G1EB 4O9HH 5IHUL 3WFZA 1F4XH 5DFAA 3EZ8A 3V6ZB 5F71A 3VRJA 5I6NA 2JKJA 4I3RH 4MA1C 3D39E 5KVMC 1BDYA 1A6AB 1DR9A 2VUYA 3MRJA 5EOCL 4BHUI 1WWBX 4U3HA 3RVUC 3NEOA 2OXHA 4YHML 2GW5A 5GISH 5B8CB 3E1ZA 4U1NB 3UBXG 5BW7C 1A7RH 4LF3B 4TTDD 5FGRA 2IEPA 4PR5B 4FA8A 1Y1UA 5CGBA 5LAXB 2C4XA 1U92A 1T1WB 2PW2B 3WUWA 3IYLW 2G9HB 2HTLD 3BESR 3C5ZC 5ES4B 3MXWL 1YRKA 3KXFB 3BJLA 5I5RA 2VLKD 2WC7A 1LQSR 3LKNA 4G6KL 5FM4A 4FERA 1PDKA 4ZYKA 1RJZA 3TBSB 3VTMA 5FHAL 1FAKT 3QIBC 2UZPA 3MRGB 3QCVH 4XNMB 3BPOC 2XICA 4ETYA 3MREA 2QLVB 2R4SL 5CGMA 4RMSA 3VXUA 2CJUH 4LAQL 1DE4B 2KYIA 3BOVA 3ZYJA 3C12A 2CXKA 3EJRA 4JJ5B 1GHFH 4K55A 4YE4L 1I8LA 2R2EB 4TNWK 1FVEA 5FLUA 2A73B 3NESA 5AVVB 3WHE1 4U3CA 1FQ9C 4JM2D 3BZ4B 2XV0A 4GUQA 1PAZA 4LAJH 4P5TA 1TJHH 3RUGE 5BQ7A 5ADPH 3ASWA 1M42A 2OR9H 3E2HB 3LV3B 5HDOA 2YXMA 1JPSH 2Z31C 4AZ8A 2LR4A 4K8RH 4CU8A 1DN2A 4KOBA 5LVEA 3S48A 5T3ZH 3ZKND 3BE1L 1HOCA 2J43A 3LIUA 5DWPA 1G1KA 3H42L 4I3GA 1Q1JL 3HMXH 5E2TH 4BUHA 5BRZE 1NL0L 4E5XA 3L3OC 3P30L 5IUCA 3CC5A 4JFSA 3KW7A 3GC3A 4TUJB 3WHXA 2G5UA 3VXMD 2W9DH 4LSVH 1L0XA 2QTVA 2NSMA 1QZNA 5CO1A 3L3HA 4HEME 4U6VL 5J12B 2JMRA 1T1YB 5IK3A 3ARWA 1SOKA 1UT1A 4TTGA 1K8DB 2K45A 4EEEA 1B90A 3N1GC 3MRBB 3K71A 3WE6B 4WSGA 4J2XA 3UG5A 1JUFA 1V7NL 1N26A 1AP2B 1RZ7H 2WLMA 5DR5H 4APQC 2BNUA 1IBYA 1RCYA 4EQ2A 1WLHA 1SOXA 4MMXA 3OWRA 1FAIL 3DYPA 3TVMD 3GO1L 3II2A 1JPGB 3KH4A 4FQLH 1ILUA 1QSEE 3LJ3A 1LD9A 1TQCB 2CLVB 2JJTA 5EOTB 5IM7B 4Z78A 3D06A 3VXRB 4B7IA 4QRRE 2EDEA 3KYOA 4OCRL 5HVHB 2A0LD 4O02A 4NZUH 2DTSA 5K93A 3QDME 1C12A 1VGKB 4A6YA 3B8SA 3ZO0A 4PGCB 4AQ8A 3MA9L 3NZ8B 4BH8B 2XTJE 2UZXA 1U0QA 4JRXB 4JGNA 1M9WA 2ZT9C 3DV6B 2XG4A 5D2NE 2BSSB 4GO8A 3A6OA 5DO8A 1J5OL 3C8KA 4ONHB 3C08L 4PRID 1RZ8A 2WBJD 3RBSA 4NIYE 5I76B 3KYKL 3WN5C 4IRJD 1ADWA 4OIFA 4W9CC 5IMLB 4DP9X 1QR1B 3ZTJH 1ZA3A 5T1KB 1G7PB 1SHMA 2BSRA 2YD6A 4OQTA 1Z2KA 1IAOA 5FHBL 1QMUA 4RBPK 1NKOA 3WY1A 4B9FA 3AWFA 2ZXCA 3MGTB 2EDOA 5D71H 3WEOA 3WUWG 4TVPL 2WIIA 3MRIB 3HR6A 3NCEB 2WQSA 1Q0YL 2NSXA 1KTJA 1NLDH 2E6PA 3O8XB 3OX8B 4P5KA 5F9WB 1TO5A 4DO5A 5I1DB 2PXYA 3RDTC 5F7AA 3D8MA 4P4KB 5JXAH 4OFYA 3BGMB 1JF5A 1MVUA 4J1UA 4ILDA 4ONGL 1LK2B 4R9HA 3SPVB 5F70A 1KENL 3KL5A 4GEJA 3IAQA 1R3IH 2BCKB 1PLBA 1FO0A 2BX5A 4MDJB 4ZO6A 1KG0B 4D8OA 4FXLA 4LP4A 4N1CA 1I9IH 4HWEL 5F9JB 2KBGA 4ICXA 4Y1AE 1MCPL 1D6VH 4BQ8A 1SHWA 3PUUA 4PJ7A 3IFOA 1AQKH 3MRMB 3F7VB 4KY1L 4OCWL 2I7OA 4RMQA 3II3A 2VR4A 1QI4A 1SEBB 4M9PA 1N8ZB 3CZJA 4LHUD 3IMRA 3N1QC 5AL0A 1NOAA 2IDCA 2Y7SA 1XO8A 1VA9A 4E5XG 3GD1C 1XGYL 1M4KA 1JK8B 1T1ZA 3PNWA 1SBSL 2GYSA 4RAUA 1ZVSA 1AYRA 4OT1L 1EZVX 4MLSA 2AS5M 3CDCA 4GAFB 3P9LB 4X7TB 1M1XA 1O9ZA 1F4HA 3IJSA 4XMLH 4JO1L 4AYDC 3BH9B 4R96B 5AYTA 1FYTA 2Y7MA 1ZK5A 3QZBA 2CUHA 3PWPE 4PB0H 4Z7OB 2LU3A 4U7MA 1CFVH 5CLXA 1FN4B 4HLZG 3IAPA 1A4AA 1OAUL 4GRWB 4W6YB 2DM2A 4ZBJA 2P46B 2H41A 4P23D 4X6FB 4XGZB 1Q94B 2XI9A 1BD2D 2BVYA 2VDRL 4BGDA 5IP4A 3KVQA 3IM1A 1KPUA 4NZTL 1EEQA 2XNAB 1UD4A 3FN0L 4QMEA 3I75B 2ARWA 5E5UB 1M2VA 4D3CL 2WQVA 4MNQA 2NQCA 3NJNA 1SUJA 3CLWA 4XCNA 1KACB 5C0IA 4KZDH 2VGLM 2APVA 3EJTA 3T3ME 1FFNA 1GYUA 2V2TA 1AD9B 1QKZL 5C0NC 5JQ6H 1TNMA 1A1MB 4Y19E 5SWSA 2R2CA 1KCUH 1XCTB 3CVHB 1S5IH 1OO2A 5FOBB 4QYOB 1ERNA 1NCBH 5AKRA 1IGJB 1IAIL 5B1KA 1O7VA 1HOEA 4YLBA 4PJGB 1HHIB 3GSNH 3HJEA 3HG5A 3U46A 3QT2A 1DQDH 2P5ED 1J0JA 3O0RL 3BRDA 5C71A 1AO7A 1TO4A 1C16A 4N20A 4NJAL 5CIPA 3K72A 4J3TA 1BEYH 3L5HA 1PD1A 4P2RB 5KANI 4N0RA 3B5HA 3PABB 3RVVD 2NR6C 4XPHH 1C5DA 1XCQA 3WFHB 3WIIL 4MSWA 2JXMB 2AXFA 2DQHL 1MIMH 5F3FA 4MZIA 3FULA 2YO3A 2BZDA 2ADFL 1OAYL 2ZJSH 3V5HA 4ZMZA 4ANVA 4RSVA 2VLKE 3JV4A 4QRQB 1JPFA 3GSOA 4JPIA 4MD0A 4YR6B 3UPAA 4GW4A 1XT5A 3BVUA 1OHQA 2V2WA 4P5MA 1TZGL 4HJ0D 1KCVH 3S96B 3WSQH 3O6FD 3X13B 2G75A 1X5YA 2BS9A 4PWGA 4D9LH 2QMKA 1MHPH 2EZ0D 3MLUH 2CLZA 4DPCX 1AKJB 3KLDA 3VQ1C 1R46A 2DH2A 1G7HA 4LVHB 2UXFA 2QVTA 3RKPA 1S3KL 4HJ1A 2VKXA 1GXEA 1JZ6A 1YN7A 1LXMA 1ZVNA 4GRLC 5FYJU 3BUQA 3BMWA 4N90D 4XBEL 5GGTL 4FNRA 5KOVC 2ADJB 3EAKA 4K07A 4PG9A 4U6TA 4D0BB 4EDXA 2VZVA 3BVVA 2GB2A 2XDHA 1OAJA 2XZQH 4G8GB 3VXME 2BIMA 4I5BA 5CBAA 5HHPA 3CD4A 4K7PY 3U7YL 4TL5A 5DC2A 3P11L 1OGTA 4N2OA 5CP3H 5DRXA 3VSUA 1QNIA 3EJPA 4LB8A 3GJFH 2YKLH 4E9TA 2H0JA 5AVYB 2NYYD 4MA8L 3UC0H 2WIMA 3EGSB 2TSAA 3IFPA 5ANHA 1NGZB 3H4FA 5JHDD 5DFTA 4KMQA 4RSYA 1OT1A 5CCGE 1D5RA 3D2TA 4LCYB 4R6UA 4BFIA 4Z0XA 2IH9A 2MOVA 3BYTA 1E67A 4JHVA 1N5AA 1INQA 4GYBA 3D0VB 1SDDA 4A2LA 5CD5D 2C9PA 1WZLA 5IQLA 2HPTA 3IPEA 2FJFA 1EEUA 3NOIA 4M7KL 3MJWA 5A43C 3D30A 3DSNB 5I0XA 2RFXA 5I2IA 4ZTPL 5INDA 4XXDA 3DJSA 1NCOA 1SJXA 1M53A 2AJZA 3MOAL 5FYLD 4G80A 5FPIA 1CGYA 4JN2A 4LPTA 2BP5M 3LEXB 2HX7A 4FQ2L 2CXGA 3WV0A 4B9YA 2OMXB 4XVUD 3RGVC 3DXAB 1W0YT 4KNSA 4LIQL 3BKJH 4HMEA 5DMJB 4WQOA 1GZPB 5E2VL 5AVTB 1NMAH 3HE7A 4J3OG 2EXWC 4JFEA 4ESKA 1JD7A 1YECH 4JHZA 4KK9D 5HSFA 1NSNH 1J0HA 2TSBA 4NPYB 3HZKB 1G6RH 1CLYL 3E3QE 1SJEB 2J56A 4MD5A 3V4UL 2X40A 5ICXB 1NCWL 4BSWB 1SJVA 1CLVA 5FYJH 2BMKA 3R8QA 4RA0C 4TUOB 4YEFA 5JIQA 1KIRB 4I0PA 4PG2A 1A1NA 1S6NA 3QJQB 1WISA 2V9QA 3ILQC 4YK4C 3ROOB 3B9AA 3L4UA 3PYCA 1AD0B 1KCRH 4PJXE 4MCMA 2VDKH 1WFIA 3L5WA 2W81C 1TPXC 1XAKA 1I3GH 1KT2A 2F19H 3TH2T 2WKGA 3BRGC 1JCKA 4LQFH 2D03L 3QO0B 5C92A 3CHSA 1NMBH 3QZMA 4HFWB 2KERA 4QHLA 3CIQA 4JN1H 1NGWA 3IJYB 5AKSA 4OZIE 5FDWB 1P5VA 1BZDA 2HFFA 4HGWB 3UPCA 4HJGB 5DLMH 5ILTH 1O6VA 5CZVH 1D2PA 1XXDC 1VKXB 1IE4A 2BJMH 4YDKH 1NAMB 3RWDA 4CW1B 4UOZA 3TCXA 1M71B 3CIAA 1NBYA 4XNBA 2R9HC 1CF1A 4MB3A 4ZFZA 4G6JH 1QD0A 2DMGA