1Z3RA

Solution structure of the omsk hemhorraghic fever envelope protein domain iii
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
ISKGLTYTMCDKAKFTWKRAPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGAPDVDVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGELKHQWFQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords polyprotein
publication title Structure of the envelope protein domain III of Omsk hemorrhagic fever virus.
pubmed doi rcsb
source organism Omsk hemorrhagic fever virus
molecule tags Viral protein
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1z3rA00
2JV6A 4UT9A 5JHLA 1OANA 4AM0Q 3P54A 2JSFA 3N41F 1RERA 2GG1A 1TG8A 3VTTA 3N43F 5B1CA 3C5XA 4UTCA 3UYPB 4FFYA 5LCVA 3UZVA 4L5FE 1ZTXE 1Z66A 4UTBA 5H37A 3UZEC 1S6NA 3N44F 5GZNA 3J27A 3UAJA 5AAMC 2R29A 2V33A 4X42A 1OK8A 1OKEA 5JHMA 3WE1A 1UZGA 4GSXA 2R69A 3G7TA 5KVDE 4ALAC 5AAWC 5LBVA 1URZA 3MUUA 3C6EA 1PJWA 4BZ2A 2ALAA 2I69A 1Z3RA 3IRCA 4AL8C 4UT6A 2JQMA 4GT0A 3J2PA 5LBSA 5KVFE 4UTAA 1SVBA 4FFZA 2HG0A 2H0PA 5KVGE 5KVEE 4BZ1A 2P5PA 3UZQB 5IZ7A 5IREA 3N42F 3N40F 5GZOA 4FG0A
chains in the Genus database with same CATH superfamily
5I2IA 2EIMB 2UZIH 3U36A 1CYXA 3QUML 4OUUB 4C54A 4JG1L 4WFGD 1SZNA 2UYLB 1RZIA 4N20A 1DN2A 4HJGA 9PCYA 3QJTB 4MCNA 2PXYD 3WSQL 2P8MA 4MRBA 5HDOA 3O4OC 3JWNE 4Y16B 1FO0B 2CCVA 4EVNA 2Y7SA 1JPEA 3NAAL 1YECH 3WI9A 3T77A 4PTUA 3HG5A 3OKNB 2EC8A 3IDGB 4EAEA 1BPVA 1ZVNA 3WKQA 1AYOA 3D51A 3WFBH 2O5XH 3WXWL 2AQ3A 1UKSA 1Q8MA 3EYQD 3QIUA 3P3SA 4OM1L 5KSVA 3BUTA 1MUJA 2IAMB 5EU5B 3MRNB 2EE0A 4HIXH 3K4AA 1ORSB 5JLZB 3KPRE 2X4UB 2DL2A 5AALA 1SDAB 3L4CA 1U8KA 4WW2B 1DVTA 2YPKA 1FVDB 3DLQR 4PP1C 1TTAA 2YEQA 2EVIA 4O2CB 3UJIL 4F80A 4A04A 4J4PC 1GJUA 5SWSD 4Y2DB 4KK9D 4R4FH 3RVWC 5GGQH 2XICA 2Y7QB 3MRLB 4HPOL 5I5JA 2QQLL 2R59A 4V1DE 3UROR 1PLGL 3F2LA 2FNBA 3LMJL 1JWSB 1U92A 2R0KL 3CK0H 3ZYZA 4HUVA 1ID2A 4ATTA 2YJQA 3DTXA 4L4TD 3P02A 4JFED 2AABH 3GTTA 3IPBA 3X14B 3BRDA 4ZUUB 3AY4C 4X8XA 4XWOD 4RGND 1N4XH 1AC6A 1NUNB 3FN9A 1QASA 1U3HD 2IH8A 3BH8B 4LCWB 3LTVA 3FTVA 4HXBH 5D1ZB 1OOWA 4GG6E 1NFDF 5CWSB 2D73A 4AL8C 4ELMB 5E8NB 1SN5A 3WTVA 1NOAA 3H0TB 4EDXB 2X4SA 1S9VA 4A7UA 5IMOA 3V7MA 1ZLSH 4OD3H 5HTSA 1AQDB 1CQYA 4JFFD 5E8OB 1BEYL 5EU4A 4WWKD 5IEKB 4GMTH 2DW5A 1MHEB 5EORH 2A38A 3LNGA 5I74B 3M17A 4UQ3B 2BH0A 3BVWA 4OFPA 3PGDB 1RZJL 3I9IA 3GSUA 3IXTA 2NSXA 1MCKA 1AG6A 5IY5B 3O6ML 2D31A 2EADA 4JQVC 5C92A 2VLLA 3RDTA 4HWEH 4Z3EA 3OL2A 2JI2A 2NCMA 5F97E 4ODVH 2BNRB 2ENSA 4Y1AD 1QI4A 3H3BC 1ADQH 1H5BB 2OTWB 1KBKA 3GO1H 5CZVH 4B41A 3MKGA 1KIQB 5CJ5A 3DO4A 2VDNL 5HYJB 1W80A 4NQVB 2Z31B 1IE5A 4KDTC 3N41F 2BP0A 4B9FA 1N0XH 5I75B 4OKVA 1WWAX 1CIUA 1OD9A 1QMUA 1THAA 1TO4A 2EZ0D 4H1LB 1NJ9A 5CM1A 5K1NA 1UGNA 2QFRA 4WI0A 5BVPL 3IDNA 1OAKH 3OAZH 4Q14A 4S0HA 3V4UH 5LGKA 1EANA 1FAIL 3ARED 2VR5A 3QQDA 5GS3A 2IPUK 2ZUYA 2R56L 3QI9C 2YR3A 3V4VH 3EAKA 3VFPB 1OGTB 4ATWA 3V0EA 2GSGB 1R3LA 3KPOA 1MWOA 3EJZD 3QH3A 3MU3A 3WO4B 1PX4A 2PCYA 3M1BB 1RI8A 1BD2E 5E4AA 1IGFL 1M6OA 1P84J 1I1AC 3HE7A 3DECA 3B9EA 1DJWA 2J4WH 4E9VA 4AC2A 2XFXB 1HTYA 2Q7NA 2YRBA 3IDJB 3C6SB 4QGYA 4BUGA 5AFAA 4DUWA 1IL1B 2K1MA 2DLEA 1E28A 4IYKA 2J1XA 2APBA 2DQDH 4H25B 4QRRE 4OZGE 4N2EA 2V3DA 1OP5H 1IX2A 1SF3A 3UTZB 3VI4F 4ES8A 3SGJC 4Y2OA 2XYBA 2W60B 5D6DC 2RFXB 4PI2A 4JKPH 5F8QC 3UACA 4EN2A 3V4LA 4MXQD 5DHDA 5K59E 2JKXA 3V5HA 3NA9H 4PBXA 4AUYA 3I9PA 1NDMB 3ZMNA 4QTHA 3BVVA 4G8GD 5JHLH 3B6SB 2CLVB 2YC1A 4LCVA 3B8YA 3KPNB 2K0RA 2OW6A 1J8HA 5C0FB 1AXSA 5ERWB 2Z0BA 2WP3O 4X8GA 1BFSA 3KPRB 4P2OB 2ARJA 4RMVA 4M7LT 4YBHA 4JHVA 2XBTA 2F8OA 4U0QB 4YXKH 1WK0A 5DQDH 4HIEB 2ZPKH 3DBSA 2VN7A 4H5SB 1JZGA 2ZXCA 3SCMD 4V1DB 4XCFL 2AFNA 1NCJA 2DIAA 3GNML 4FG6C 1E7UA 4G7YL 1UCBH 2AJZB 1MRCH 4P46C 5LG1A 1PEZA 2NYKA 1X5GA 1MPAH 3BMVA 1NWPA 4HCFA 4YHNA 2BCKA 1NFIA 4HH8A 3UEQA 4Z0BL 1QR1A 4O2FA 4UB0L 1JFQH 1N7MH 3WS6A 3OD3A 3OC8A 3DVIA 3EHBD 2FEJA 1RIUL 5CLTA 1WICA 1AY1L 2X4OA 1J8SA 2BRRL 4GG6B 5KAQG 5TE6L 4WNJA 1ECYA 2CKNA 2DQTH 2BDNL 4NSKB 4YZFE 4EI5A 1YN7B 3O3BA 1BXUA 1LO0H 2QQNL 3RL2B 1A0QL 2QVIA 3RU8H 2X89D 3N44F 3U6RB 2R1XA 4M1DH 2E7LA 2BVQB 3S97C 4ZO7A 5L4FA 3IMBA 4ZUTA 2P26A 2JF1A 1SM3H 3DA0A 3SKUD 1PZUB 5HVGB 3FUKA 1LK3H 2YUWA 5JZ7D 3W5NA 3ETBJ 4QRPB 1KPUB 3IGKA 2JQAA 4I9WE 1A25A 5LG6A 4GNKB 5HHOE 5T1JA 3ARFA 3KNBA 1JD7A 2KYIA 3AXHA 5AW9B 4BQCA 4F9PC 2RA1A 3HAEB 4PJIF 3KLAA 4ZT1A 2X28A 2YD9A 5LGYA 1F1DA 4YGVA 1L9RA 1U9KA 4U2ZA 2A9AA 3PG2A 4M1GL 4JPVH 5D4QA 1M4KA 1N67A 1WYJA 2GITB 1CLVA 3HR5B 4K71B 1BF2A 1MIMH 4LU5L 1B4JL 2J6WA 1TZIB 5SWQA 2FZ3A 3VUAA 2VDPH 2A77L 2O5ZH 5CZXD 1CF1A 1E40A 5L2JB 4NDMB 2IQ9H 2BS71 2IDSA 4ZX6A 3VU2A 3BPOC 3IMSA 3HHMA 5IB3B 3BHBB 4J8RB 4G5ZL 3G9VA 1D9KB 3CBRA 4OLWL 3IS1X 1PD0A 2I32A 5C0CE 3B9KA 3GSQA 2GJRA 2N1KA 2XQ0A 1SLVA 4XPGH 4YHLH 2H9GB 4HUXA 1CVSC 1U8CB 3RL1B 5BMFH 3HB3B 4JGUA 2WWKT 1FORH 4XH2A 4PJGF 4Z3IA 3O9WA 4ZXBA 3PNRB 4L29A 4UILH 1BD2B 4GUPB 4LLMB 3BP6B 2E6QA 2VUYA 4Z1PA 3SN6N 2Q8AL 3NH7H 1CPUA 2ZKXA 5K5YA 4FXGC 4JM0A 4ZPTA 1YMMA 3DNKA 3SJVA 3DRQB 5DXWA 4JN1H 3WFEL 5A3IC 2IF7A 4FQQA 1IUZA 2HP4A 5A16B 2G60H 2ZOKB 1RH8A 4Z7VE 5DSCB 2OJZH 4QRRB 4OZGB 3FU6A 1DBBH 3BXNA 1XBDA 4JFSA 2PR4L 2DJSA 5GZOA 3CDZA 1G7QA 3VFGL 1AXTH 1W0YT 3P30H 4KROB 4R4BB 2NY3C 5ACZB 1IBYA 3CFCH 3QDMB 4ODTH 3NG5A 2DLHA 1DN0A 5FYLD 5KSAC 3U1SH 4DVRH 2FX8L 4GKSA 4OCSH 4XN2A 4BDVA 4I18C 1G9NC 3EYVA 2XY2A 3QUYA 3AG3B 1NBZA 5DJCA 4I3RH 4G8EA 2GC4C 3LKPA 1C5BH 1HWHB 5G4MA 3ZGHA 4EQ2A 3BW9A 1F8TH 1H3XA 1UQSA 1ES0A 4OCRH 2O61B 3DK2A 2ZWZA 3FU8A 1MFEH 2A0LC 5E95B 3ZTJH 4FP8L 2VUOA 4CKVX 1VIWA 2RGSA 3QIBA 1INDL 1USQA 3PXLA 3DBXA 2NZIA 4FTVA 1CE6B 2XTJC 3LKOA 4P9MH 1DQMH 1A4CA 1JHLH 1CFTA 1NDGB 1BAFH 3DIDA 5DVNA 4A2MA 1VA9A 1TOXA 4M62H 2Z35A 5I6KA 3C6LA 4RAUA 2M26A 3KW8A 1UWGH 2W81C 3UC2A 2Q3XA 4MJ6B 2JLPA 1GY1A 2C3VA 4WTXA 4OJCA 5MHSE 4XP5H 4G3YH 1XAKA 1OARL 2VLKB 4O5LH 3L1EA 4P23D 4LOUC 4X6FB 2Q76B 4XHJC 2K70A 3D9AH 5DYOA 1S7RB 1GZHC 3F6LA 1LGVA 4QWWD 3U1QA 4ELDA 3HUJB 4LSRH 3ZZSA 3CD4A 5JXEA 3IAPA 1A6VL 3RBSA 1X5MA 2XWEA 3WHXB 3HZVA 1VFOA 3NIFE 2KKQA 4MBRA 3GS0A 4YNYB 1T5WA 2W0KA 1HNYA 4FJ6A 4NGHH 4EIGB 2N7BA 3WNIA 1UG9A 1HILA 2B5IC 3MREA 3HC0B 2W9DH 2YPLA 3RZCB 4M6MH 1UA3A 1H3UA 1Q9LA 1KBPA 4MAYD 3CLFH 4YSUA 5HHOB 5E6IB 2B8OT 3A4EA 2QMKA 4FG4A 2UWEF 3MRGB 4QOKB 1MSPA 4U49A 3SYOA 4TVPE 2C7UB 2BJMH 3H6JA 4JKNA 3QO1A 4QLRA 4XNUH 3IJSA 1EXUA 2DEWX 5IVXE 1EAPA 3WYRA 3F8UB 3KMDA 2DIBA 1HKLH 2LGNA 4CMHC 1BOYA 2G5BB 2IADA 4LNRA 3NRPA 2XRAH 3L1OL 4GPVA 4ZFFA 2WLZA 4FQ2H 3HNTH 4PP2B 5GSRA 1YUHB 3S5LG 3V55A 3TBTA 3OHMB 3EFOA 1NAMA 2BIIA 1I7TA 3B9DA 3VXSA 4AEHL 3OWEA 4WEBL 2ZYHA 5C0CB 3RWFB 1A2YB 4RWYL 2AQ2A 3APDA 1G9EA 3HHRB 4GBXB 2ED7A 3GI8H 5DWPA 3UMTA 4C56D 1MFBL 4XO9A 5AD0B 1XH0A 4UTCA 5ICYB 1Q9OA 5LB1A 4YHYB 5HHXL 4LVOC 3D6GA 3MJ9L 3UCQA 4LP5A 4LGSB 2O5NA 5KVDL 4UV7H 4AQ1C 4HMCA 1M05A 5M7QA 1QFUL 4HMEA 1R3KB 3VWJB 3WEXA 4HS6B 4NUJA 1T20B 2R39A 4PBWD 4S1DC 2B1HH 3ECUA 1J1OH 1T1XB 3VRIB 5KVGH 5LGHL 2FVNA 2BXYA 4Z7VB 1YJDL 3H9HA 5BNXD 4YBLC 2WJ5A 3APNA 5F6IB 3FT2A 4JG5A 1KBBA 5TK2A 4XB3A 4UQ2A 1VACB 3QEQE 4YZWA 1Q0XL 3MV7A 1FLRL 4M9PA 3V0JA 4WHTA 3GBML 3B2DC 4HZ1A 4IGBB 4IRSA 5L2KD 4JFTA 1HEHC 5ITFA 3QG7L 4F2MA 4G1MA 2WAHA 2KLRA 5FGRA 3WN6A 5AVSB 1I1YA 1QKZL 2B77A 3BAKA 5L9DH 2BVPA 3IJ8A 3P4MB 3MBEB 5HY9A 3MUUA 3IFNH 3ZO0A 5IR1B 3FRPA 5KBLA 4YE0A 4MSWB 1Z5YD 1QFWM 3LD8C 4G1EA 4WKZB 1JN6B 4NZ8A 4NZUH 5ICXA 3NCBB 3W2DH 2ZUXA 4GO6B 3D0VA 4ZMXA 2EDJA 1DSWA 4IDJL 1IAOB 1I1CA 3MJ7A 5EOTA 4IBWA 2CLZA 1KLGA 3VVVA 3GMRB 3GSWB 5IBUB 3HI5L 5I1CL 2XI9A 4TULL 1JYNA 2I9TA 2JQMA 1A6PA 5DHVB 4YDJB 4JGMA 3SZKC 1QD0A 3MLXH 3SQOL 3UZVB 2CDFA 5FCUH 4I0PC 3CFQA 1RP8A 2BW4A 2VN3A 3MRPB 5JTWA 4Z0XB 4B9YA 5CUSL 4O00A 4A38A 4LCYA 4GAGH 4LVNC 4PHZA 4NQSB 1MLBA 3RIAF 2FBJH 5J89A 3MXWL 5KYNA 3H3KA 4HPOH 3X11B 1SXZA 3FZUD 4FXKA 4P2YA 4Z77B 5IKCA 3TBVB 3H85A 3H9SA 4DCQA 5FWQA 1M53A 3N40P 3I02B 2CK0L 2DQIH 2P5EE 2DH2A 3DVNA 3ZUNC 1MHHA 3GZPA 3DTDA 3EADA 4BUQA 1QRKA 4MCYB 4WW1B 3ZTJG 1NPNA 4MMZC 5MENA 4NNYA 2HH0H 3IBOA 4ZW8A 1ZSDB 4QI3A 4WW2F 3NCJH 3STZB 4X5XA 4EBQL 2VQUA 3DX7A 2WNXA 1JGEB 3RJDA 4ZAKA 3KXFA 1BW8A 1N5YH 3QORD 1MQKH 2A9NL 5IJDC 3HE6D 1QTSA 2BP8B 1MJ8L 4LPTA 5ALBH 5GRZA 4I3SH 3VSVA 4AT6B 3OGCB 3Q8FA 1MAJA 4N5EC 4F7KA 2OX5A 2FQEA 5BXFA 4IBYA 3T0DA 4JHZA 3S36L 1O6SA 2WLMA 3WS3B 2VC2L 4A7GF 3L45A 4JHAH 1AQKL 2B3IA 1RZJH 3DROA 4NUPA 1TQVA 4Y89A 4DO5A 4XMTA 4UBDD 2H6UA 3F84A 1BVKA 3D39E 5KBNC 1N8OE 4GAFB 3QUXD 3ZK0A 2WJ7A 4ELMF 4HJJL 1L9PA 4Z7NE 2XA8L 4IRZL 3MOAH 43CAB 5B7MA 1ETZA 2R0WL 3JWDL 5KN5B 5MEQB 2D4DA 2C8NA 5GRJH 3BDYH 1T4KB 5BQ7B 5EO1A 3SGDI 4HC1L 3LRKA 3RNQA 2X1WL 2FBOJ 2R9HD 3CU1A 4X4YA 3VFRA 2HFEA 3CFBB 1KXHA 4DZBB 5JIQA 3LQZB 1D5XB 3F6JA 1MF2H 3C6EA 5I2IB 1PG7W 1JXGA 4JX0A 3U36B 4Y2DC 5SX4I 3AABA 2HB0A 2Y6SD 4DGIH 1RZIB 2DKSA 4HJGB 1AZZC 4PY7A 3IRCA 5M95B 3UYRH 3LN4A 4TNEA 4CSPA 1DFBH 4LLAA 1A8JH 1XO8A 2P8MB 4GW1A 4XR8C 4EVNB 2J6EH 4UYPA 4LK4A 3T77B 4PTUB 3SKNA 5LBSA 1GJWA 2ESVA 3FN3A 1VZIA 4Q7DA 1BA9A 5F70A 1E7VA 4M3KB 3MLZL 3P2DA 4UINL 5JIMA 2SEBA 2OFQA 3EYUH 3PL6C 2HG0A 3QHFL 4IK7A 1SY6H 5CBEA 1TENA 1BJ8A 2HN7A 2BFGA 5KSVB 5A7EA 5DMKA 1MUJB 2PKDA 3BP4A 5FS5A 4AMWA 1J8HE 5GGSA 2CJTA 3PXHA 4UT9L 5AW4B 1A6AA 5CHNA 4F9LC 3RFZA 2JJVA 2YPKB 4HK3J 4LEOA 5F7WC 4PG2A 1KEGH 1BQHA 4XNXL 1SBSH 1GIGL 5A2AA 3FCUB 1NC4A 5HGDA 4KRPC 4X6CA 2I26N 3SDAA 2MKWA 4WI4A 1P7BA 1U92B 1F18A 2FJSA 1UWYA 5IGXL 4HUVB 3DTXB 1WFNA 4JFZL 5D1XD 1Q4NX 3CMGA 3U4BL 4BWWA 3WU1A 3TBBA 2BSCA 5EH1A 4LSPH 1EZUA 3CG8A 3CX5K 2IDUA 3CN2A 3ZQWA 2NLJA 4J3OC 3OR7A 1W72L 5I26A 2WM0A 4NIKB 5T1LD 4AYFA 3GMOA 3G5ZA 1EDQA 1M9SA 2X4SB 1IFHL 2HWZH 1S9VB 4BH7A 5I75C 5DS2A 4QO1A 4OFVA 2L4OA 3BO8A 1F42A 1UM6H 2DM2A 2LAGB 4KKBC 5IMOB 3LPPA 5JW4M 5EU4B 3WD5L 1NAKH 2NR6D 4TTDC 4PGDA 4XWGH 2IH9A 3G5XA 1R75A 3M17B 4HKJB 4WFFD 3NCWA 4N8PA 5FGBC 1H3PL 4LEBA 3GSUB 3IXTB 3CDGA 1YJDC 3ZKQD 3DXAA 3TH4T 4B95C 2X38A 2D31B 2VLLB 3RDTB 3VXME 3EO0A 1TJIL 4LRNL 4X7DC 1NCDH 3SOBL 2WQUA 3GBDA 3E7JA 2E6PA 3MLSL 4PJCA 1I9IL 3LEYL 4PYGA 2AK4D 2PETA 4QEGA 2FSEA 1U8OA 3QJUB 4ILDA 1Z5LA 1H0DA 3UEZA 2IV8A 5IHWA 1T66C 3DX8A 5SWZA 4KZCA 5FF6A 1GGYA 2PYEE 2VRKA 2X88A 4OKVB 5AVWB 3Q13A 1MHCA 1NJ9B 2NPLX 1IKNC 3Q6FA 1XL4A 3RQ3A 5HVWA 1LE9A 4WI0B 3IDUA 1EHKB 2IAAC 3IDNB 4DK3A 4H88L 2WINA 4GG6F 5F1IA 4NCC1 3EOTL 3QQDB 4Z7NB 1MCHA 4JZNA 1D5ZB 2G75A 1RZPA 3OKLA 3MBWA 2D7QA 2IVFC 3MUZ1 1R3LB 3DMMA 3L3OA 3QH3B 4HJSA 3BSHA 4NT6A 3ZYOA 2WWOA 3JYBA 5ADOH 1REIA 3S34H 1O7VA 3G5YA 1OCWL 4OCYL 1KYOJ 2QZ5A 1M6OB 2GJ6A 3HE7B 4M03A 4MZIA 4XXCA 3RHWK 4CILA 3J8F7 1SJVA 1YMME 5B4MD 1CO1A 2QSTA 3O3AA 3I6KA 4FFYL 5FC9A 4PJ8D 2DEYX 3T71A 1E28B 2BC4A 2VDQL 4MZ2A 4JO1L 4BEIA 3GRGA 3HCVA 5I6XB 5DJ2A 4LF3A 4X4KA 5JIKA 4FLSA 4Y2OB 1L7IH 3KJ6L 3RRQA 4D3CH 3QRFM 2DLGA 4YDLB 5EUOA 1Y6NR 3SKMA 3WUWA 3V5HB 1L9OA 1WV7T 2PPEA 3T4YA 1YA5A 5IWLA 3NESA 1A4AA 5J6GA 3LDBB 4QTHB 2V9UA 1YEWA 5IHLB 1L0XA 2YC1B 4DF9A 2WP3T 3LQAL 1J8HB 1AXSB 1OY3B 4W9DC 3AWGA 1ZHKB 4F2EA 2PCXA 1IGCL 4KITB 5ELIA 2H26B 2ARJB 4X4ME 1BZDA 4XVUD 1KACB 4S1SL 4XC1L 4HPYL 5EDXA 3MTXA 1LK2A 2HFTA 4KXZI 3ARQA 2F58H 1RSYA 4L8SB 2GIMA 2OZNA 4AY0A 2PR4H 3HS9A 1LXMA 5FYJH 1WH0A 2K45A 1GHFH 4HGMA 3CE1A 4XPFH 5DK2A 1TJGH 1HHKA 4FTVE 1A21A 4JQXC 4BZ1H 1CDHA 4HZLA 3APCA 1QTYT 1BVNT 1MCPL 3IM1A 1WHOA 3ZR6A 3RWEA 5EBGA 3W56A 4YHNB 1BHGA 1HZHH 2BCKB 1NFIB 2Q87A 1N68A 3JWDC 4O2FB 3WKML 1TZGL 3QQ9C 1JYXA 4OZGF 2VOTA 2DOCA 3O0LA 1TTRA 1A1MA 5CCKH 3AXIA 1DVYA 2BSDA 1UM4H 2ILLA 3DV6A 2X4OB 4ZNEE 4TQ8A 1XIWA 3QEUA 5KUKA 3ULUD 4QRBA 4CMMA 2QJDA 4JDTL 1DQTA 4XCEA 5D1QD 3STLA 5K59F 1KYDA 5T5FA 4PV1C 1YEGH 3ARGA 4N0YH 4EI5B 3O3BB 2NY4C 4EDWL 3VGFA 4HIIA 1MWAL 4TXVB 1FIGH 5DVPA 3FBQA 4XNMA 2X6CA 1WVZA 4N2CA 3VSTA 2R1XB 5E4EC 4A6YA 2W0FA 1UYWH 5FW8A 4ZUTB 1MRFL 4OGAC 5KYUA 2AEWA 3KS0J 1DFXA 1Z3GL 3K6NA 4XBMA 3TJEL 4EKJA 1NA8A 4B0MM 2YPLE 4XMKL 4ONFL 4PRBA 3EO1A 1OARH 5D2LA 3HB3C 1NCBH 4IKIA 3SD5A 3ARFB 1OB0A 5TQ2H 4GAAA 3CBJB 3KLAB 2A4CA 3EUUA 1HHHA 5FA4A 2EIKB 1A4KA 3CFIC 3HG1A 4XN5A 1MELA 2ED9A 1DR9A 1L6PA 1LO3H 4PBDA 2YEVB 3H2PA 3P77A 4YLQT 4UTBL 1I9RH 5SWQB 2FZ3B 5AOIA 1T22A 3BIKA 4MA7H 1AHWC 4PJFA 1HKFA 4N2LA 5C09D 1MIEL 3PP4L 2AEIT 2UY6A 3PLYA 4KROC 3PCYA 2EDLA 2PXYA 1T6WA 3MNWA 2CKBA 3HMWL 3RWDA 1Z5HA 3B9KB 3GSQB 1OCZB 2E46A 3KCWA 2ICCA 2AANA 1XR9A 4NFBA 2VXVL 3HUJF 4YZFF 3BWSA 1YPZA 3E38A 4HUXB 5DD3L 1T2QL 4MGXA 1EK3A 3FH8A 1SQ2N 2WAQA 4XH2B 2GCYA 3O9WB 4ZXBB 4L29B 4MB5A 4ORZC 4JREB 4LAJH 3KLKA 2CCWA 3PHOA 2EH8L 2HMID 5INCA 4ZPTB 4I87A 2JCWA 5B7FA 1YMMB 1RULL 1ZV5A 2LTQB 3KL0A 3SJVB 3T0VA 5FOJA 3L9RA 5SX5K 3GXIA 4FQQB 1UH2A 4URTB 4YHIA 4AV4A 2IOIA 4XCCL 1A02N 4EZLA 1ZJAA 1A6UL 1CFVL 4ENED 3KLSA 5JOPE 4ORGA 2Z64C 3U0WL 3BXNB 2JWYA 2XIBA 1IFGA 3M7OA 3VXOA 4RMUA 4GXUM 5GGVL 3AM8C 3CDZB 1JZIA 1G7QB 2HKFL 5FFGA 4MKTA 1WQVT 2NY7L 1DN0B 4L4TA 4L5FH 5IP4A 3DI3B 4LLDA 4F2ME 3EJCA 4GKSB 2Z0UA 2IMMA 35C8H 1YDPA 5ESQA 4BDVB 3QWNA 4HSAC 3EYVB 1IC7H 3QUYB 4UT7H 3LB6C 1NBZB 2Z8VC 4J23A 2Q0ZX 3ARDD 4FOMA 4G8EB 1NOFA 1CCZA 4KO7A 4BFGA 3LKPB 5BUAA 1SVBA 3BW9B 2V17L 1AGDA 4A2GA 3Q6GL 2XZQH 1H3WM 2N7SA 3BOVA 5DURB 1ES0B 4PYHA 3WAJA 2O5YL 2ZUUA 1DEEA 4HD9A 1WZKA 2O6CA 3NSCA 4OCWH 5L4MA 4J1UA 3QIBB 5LGJB 4JFFA 3DBXB 5EWIL 2E27L 1JPSL 4FTVB 2VRQA 4WWKA 5FW6A 3LKOB 1HJBC 3C5ZD 1CFTB 4MASA 2CO7A 5ABDE 1FNAA 3RJOA 2BZ7A 2Z35B 4L1TA 3VB8A 3C6LB 1X9LA 4RAUB 4B9CA 4D0CA 2F1BA 4FERA 4N2NA 2Z92A 2ID5A 3K8MA 4Z7VF 2H3XC 3P40A 5I1EH 2C3VB 2C1PA 3UTSA 4GO9A 4JG0L 5T5NG 2E86A 3GXPA 1VAHA 1CDUA 3H9SE 5DYOB 2G5UA 4IDJH 2IBBA 4XVSL 4Y1AA 3U48A 3AQDA 3BISA 4MCMA 4V2CB 2FJGB 3GZQA 2YOCA 3ZTEA 1TEFA 4M1CC 3Q8CA 4TQHA 1FZOA 5D96C 4F3FA 5FAAA 1FZKB 4BFOA 1UOLA 3Q2WA 1J5HA 4RX4D 3HZVB 4P99A 5MENE 1W8NA 1I8UA 1I85C 3BZFA 5E2VL 3LVTA 4BFFA 3PF2A 4RMRA 4EOWH 1EGJA 2AJUH 1T5WB 4Q6IA 4N2OA 2BSRA 2LFEA 3DVFA 1E4XI 3KXFE 1HILB 4L1LA 4L2YA 3OXRA 2YPLB 4XE0A 4AGQA 1XFPA 1YQVL 4FA8A 1GTNA 2EDYA 1Q9LB 3RTLA 3JZYA 3LV3A 1J5IA 2ZX6A 3C2AL 3BAYA 4LP4A 2ICES 2YHGA 3MLYL 3ZX1A 4F15C 5EOCL 2DWSA 4N0RA 2QDWA 3T3PB 4NOFA 3OHXC 4JFWA 2KBGA 3QO1B 3IJSB 1EXUB 5JUEL 4YDKH 1EAPB 3MUY1 1CBVL 2I24N 3U9PH 3AB0C 2E7DA 3H4FA 2FWLB 3F12A 2X10A 5F6IC 1K4CA 3RIFF 1ETJA 5E1IA 4LNRB 5F7BA 3FUFA 1BFVL 2A1WL 1OGAA 4ZFFB 1E6JH 5TTRA 3F05A 3GHEH 5GSRB 5HPOA 5L6YL 2DBLL 3AMKA 3TBTB 5JOEA 2EEFA 3EFOB 4PTTA 1NAMB 1I7TB 3VXSB 3MGOA 4XNYH 4OGXH 2APSA 1IC1A 2P8LA 3MO1A 3FUEA 4WDIA 3ARBC 2JNZA 1B9ZA 4G8GA 3CFUA 3D18A 5KYWA 3KYKL 4GI6A 1MEXH 3MZTA 4X0NA 5E8DH 1AKPA 1M05B 1AXIB 1KCBA 2WLYA 3WEXB 2X0VA 4WRLA 4PRHD 4XPAL 5FO7A 4NUJB 5ID0A 2DKMA 1NIEA 1A8ZA 2ZT9C 3KVDD 4NN5C 1QPXA 1PNDA 3DX0A 4R8WH 4XP1H 4KX8A 3SE3C 1Y6KR 4KOBA 5C7XH 2XQYA 2J5LB 3IDIA 2EYRA 4PLJC 2IEPA 2F54D 5CLXA 2ZWKA 3FT2B 5KOMC 1HFUA 2PCFA 2IBZY 3MV7B 4HV8A 1HWGB 4WHTB 5E99H 4IRSB 5BV7H 5IVXF 1JZ2A 2NZ9C 2R27A 5EC1A 5ITFB 1LD9A 3IU3A 4G1MB 4F2MB 7FABH 1SXSA 3O2DA 1B0GA 1I1YB 2HLEB 1KJ2A 4NQVA 1F1GA 2BVPB 2FEEL 5JPMA 5HY9B 3E0GA 3WGVB 3FRPB 1ZEAL 2WWNA 2WWMD 3TA3C 4G1EB 1RFDL 2WN2A 3K72A 5ICXB 3ZZQA 5C86A 3D0VB 4XVJL 5GGRA 1I1RA 3OPZL 5EMYA 4AJVA 5D7EA 3MJ7B 4NPKA 3EZJB 5EOTB 5K9JL 2CLZB 1KLGB 2VM4A 3DGGA 4LOVA 1O9ZA 2I9TB 3CHRA 2E9IA 1SFDA 1Y6MR 3RWJA 2D03H 3SYPA 3IMRA 1M3IA 3LVEA 4I3GA 4AI7A 2X89A 1BQLL 2CDFB 5LO7A 4Y5YC 1F4AA 3OKOA 2Z7ZA 3QWOA 3GKWL 1UWXK 5I1AA 2VXQL 3WFDL 1KPRA 4FFZH 1C9SA 4LCYB 1WWWX 1FCGA 3LIZL 2CBOA 1KBVA 1EFXD 3ESPA 4AVJA 1MLBB 3MNVA 3SZ6A 1SFHA 4E9YA 2OXGA 4NNPL 4TPRL 4ALAC 2MFNA 3HNSL 4HALA 4FXKB 3MFGB 1UEMA 4PPTA 3O8XC 1JNNL 1JGVH 3H9SB 2F5BL 4DCQB 3UYPA 4R0LC 4RGOL 3DVNB 2ZX7A 1MHHB 3EJYD 5DD0H 4S1QL 1JD9A 4FI8A 1GC1H 2Q20A 4ZFQA 2HJLA 4NO0D 3QWRD 1Z3RA 5DDHA 4NNYB 5MENB 4OFIA 2LU4A 1WIPA 1YG9A 4ZTEA 4X5XB 4OSUH 4GLRI 3DX7B 1LL1A 3KYAA 1L6ZA 3O11A 3KXFB 4ZAKB 2A5UA 2VLRA 4NQEA 3BPNC 2V7HA 3HC4L 3LXCA 1FPTH 4G7SB 5DMIL 2J57A 2NUTA 1NMBL 3KM2A 1INEH 1FG2A 5D7JD 4K55A 2D0HA 5DHYA 4XN8A 1AR1C 4LHUG 5FFLA 5BRZE 2L7EA 1K2DB 3R1GH 4X8CA 2YD5A 2E76C 2OX5B 5SWZE 2CQVA 1UCTA 3ARYA 1OSPH 1O6SB 2JELL 1U42A 1HXMA 2CDEA 2WLJA 4J5VA 3NA4A 5GS0H 1H3PH 1VZHA 3DROB 4L2LA 4PJAA 2DYSB 1I3RA 1JZ6A 4WSJA 2DQJH 1L3NA 1RV6X 2WUCH 5ACMA 1BVKB 5J1SC 4KXAA 3VD9A 4LSUH 2F5AL 4NLAA 2ZIDA 1T6VN 1E27A 2H3KA 3IKKA 5AOMA 4NZRH 4OGYL 1I3UA 2ZJSL 4LRNH 4PGBA 3QIUC 1ETZB 3SE9H 2IGLA 4U6VH 4KUCD 3QIWD 5EO1B 1R24A 2P44B 1I9IH 1JVKA 5F7UA 4GI8A 2AEQL 1RHHA 1ZA6A 43C9A 3X12A 3LNHA 4LEXL 4LCCA 4X4YB 3POCA 3VFRB 2QZQA 4L8CA 4ABVA 3JVGA 4YXLH 1TQSA 1NBCA 3W37A 4Z3TA 2NNFA 1HXKA 3RGBA 4ZD3H 4ZS7H 4YVUA 2OBGA 2Y36L 5A7BA 4N3UA 1ROWA 2NX5A 1XSIA 2EDTA 5F9WB 1KIUA 1QFPA 3LN4B 4E36A 1KCRH 3UH8A 3H6AA 3OKYA 2VDKL 1VLXA 2DWTA 5T3ZL 3CFNA 3CPLA 4XHJD 3GIZL 4TNGA 1RUKL 3K5SA 2MCG1 3SKNB 2ESVB 2FEDC 5I24A 4KAQL 3FAXA 2H8PA 2YSSA 2SEBB 1KGCD 3LPFA 1HCVA 1NGQH 3FK3A 4ZW7A 3QDGE 5CBEB 4H8WL 3TCLA 4GSUA 2HN7B 3NIGE 5DMKB 3BP4B 4LXFA 1FN4A 3VDAA 4MS6A 4HCRA 5GGSB 3WNMA 2W91A 1A6AB 1XCWA 1MH5B 4CRPA 2J56A 5CHNB 3CUPA 3RFZB 1KJVA 4LEOB 4PGCA 2J8UA 4Z7NF 1O75A 4TRPH 2C5DC 4DKFL 3MN8A 2AJSL 1BQHB 4R3SA 4U6HA 3KYOA 4P23A 2J1KA 2UV3A 2ALAA 2JE8A 3FO1A 2RCSL 5F1KC 1NC4B 5HGDB 4X6CB 3CIAA 4G7VH 4Q6KA 4KGLA 5EOCJ 3BVXA 1MFCL 2BY3A 3LZFL 3QFDA 4WUUD 5CJOL 4R7NA 5ECJE 3ZKND 3STBA 5FO8B 1OHZA 3PHQB 3QZLA 3LQAH 3VX0A 1UM5L 4MD4A 5K69A 1TSRA 3CVHA 4WO4D 2NLJB 3QCUH 4NCDA 3OR7B 4PLKC 2EEBA 2YQ3A 4GJTB 3V7AE 4POUB 1GAFH 4C8XA 4M5SA 4GRLC 3D12B 4S1SH 1JXDA 5EOQL 3UIYA 5KVEL 4AYFB 3GMOB 3G5ZB 5K39A 4XAWL 4LCIH 4BK5A 3S5YA 1FHNA 4MAYA 4F7MA 3TBWA 4BH7B 2V9TA 4O51A 4P5TA 4QO1B 1Z0NA 1ONQA 4Z7UA 1AD0B 3BO8B 2FEEI 4M5ZL 5F7AA 2ICWA 4M8RA 3VFUA 5FPIA 1EHLL 3OZKA 3G5VB 3N40F 3FSZA 3MAWA 3PHSA 4PGDB 1ZKAA 3ZU8A 3G5XB 4KK8C 1TYJA 3RVUD 4OZFA 1QQDA 4U3XA 1ZLUK 4LSSH 4MJ2A 3WG7B 3CDGB 1J05A 5ISZD 3GI9H 4MA1B 4ANVA 1ZLWH 2PP7A 1BZEA 3WKMH 1TZGH 5D2LE 5HHPA 5FKPA 3EO0B 1J9TA 3PQYD 5CLWA 2L04A 4IIQC 4L4VA 5EA0H 2AQPA 2YXVA 3DUUA 3SDYL 2K6YA 3BN9C 1U93A 4NQDE 2Y7OA 1S7TA 3UTTA 5FWRA 1BDYA 4PJCB 5I0XA 4BSJA 2WXRA 1UJ3C 3RZWA 1U8OB 1Z5LB 3GXNA 1H0DB 3HG1E 3WL9A 1QNIA 3OLDA 3PWJA 3QPXH 2GABA 3DX8B 3HG0A 5SWZB 3CVDA 5ALCH 5FF6B 1KXQA 3KLLA 3QFJA 1QYGL 5AUMA 1WF5A 2X7LA 3C09B 4PJFE 5GJTH 2DQUH 1MHCB 1CICC 4WFGE 3ZJAA 3Q6FB 2YA0A 1LE9B 3MLPA 3FUNA 3O0RH 4Q8BA 3SBWC 3FHQA 4AJWA 5F1IB 1IC4L 1BOGA 2X4QA 4K5OA 5F3BA 1RUQH 2G75B 3AUWB 2OYMA 3EDEA 3OKLB 5DUPH 4RIRA 4O4YL 4YQXH 3MBWB 3IK2A 4X5RA 4NT6B 3DMMB 3L3OB 5CU5A 3ERXA 3GLZA 3D7PA 2FECL 4PRAA 3GSNL 3LX9A 4L18A 3G5YB 2NXYD 2GJ6B 3QC6X 3HFMH 4K2UH 3QQNA 2BSED 4U1NA 1JZHA 1DCEA 2AJ3A 3BVTA 1VCAA 3JTSA 4ZMWA 3UJJL 3CX2A 4DVBA 3DYMA 3N1GC 3O3AB 4N1HB 3I6KB 4WWOA 3B56A 3DHMA 2BC4B 3F04A 5DJAA 3WJJC 1VENA 3ARPA 2OKMA 3FQNA 3HCVB 1M2OA 3QS2A 3BDBA 4IHOA 4LF3B 4X9HA 3CBKB 1TZHA 3HFFA 3RPKA 2JB6A 4ETQA 3CIQA 2AQRA 4AGMA 3RY6A 4FQPA 3VGHA 1GYCA 5EUOB 3SKMB 3ZPDA 3MRFA 1MHPH 3T4YB 3GUTB 3OM3B 4UDUB 2EIZA 4E9TA 4L4TE 5J6GB 1UZ8A 4TLKA 3PGFH 3WS6C 2ARJQ 2DWDA 3NIGB 4QTIL 5IESH 5DVLA 1MFAL 4G6FD 3FYEB 4W81A 4X5WA 5KSUA 4P04A 5LAPA 1M57B 1OPGH 5J12B 5CXPA 1DSFH 1LK2B 1OWWA 2A83A 4NENA 1OAJA 2NQ3A 2E7LC 1WBZA 1RPQA 1S9KC 1BZ8A 1IT9H 2V2TA 2QVMA 2HKFH 3OAYH 5DK2B 1HHKB 4M43H 3LS5H 2EDEA 2UUDK 3S2CA 3IB4A 1BVLA 4HZLB 3A0OA 3RWEB 3VQ2C 5CCGE 1BQ5A 4KVPA 1HCZA 1P5UC 3IRPX 3CXDL 5I30L 2ZP0T 2H1LM 1HNGA 5JHDA 3UTSE 4BZ2H 1F4HA 1HS6A 2FJUB 2EVFA 4Z18A 1A1MB 1NBYA 1LDPH 4OTXL 3DV6B 1T80A 4P5SA 5DC9B 3QORA 1DTUA 4GXVL 1XIWB 3B7TA 2WXKA 1T0PB 3QEUB 4HWBL 4XPTL 4BFIA 4CMMB 4GOSA 4XCEB 2PTVA 4LLWA 3RTQA 2D7PA 1U8IB 2ADFL 3STLB 5KJ4A 3ARGB 4K7PL 3T08A 1I31A 4A7TA 5HJBA 1IQDA 1TQUA 1KCWA 4QHKI 1AZVA 4LL4A 5T1KD 3KH3A 4XNMB 2VISA 1Q0YL 3W0WD 1MCWM 4A6YB 4JQIA 2W0FB 5ES4B 1MCSA 1C12B 3AXLB 2HLFC 3N91A 5AYTA 1T83A 4KI5C 2NY5H 2I9LA 4PRBB 5EZOL 3EO1B 3N42B 3WGUB 5D2LB 5LJYH 1SLUA 1XCXA 3QPQD 3E80A 4JREC 1A7PL 2KZBA 4H8WC 1FNLA 1J5DA 2WB1A 5E2TH 1ILSA 2BP5M 5I6OA 1HHHB 1KCSL 5FA4B 4Z7QE 2XZZA 2ICEA 2L7JA 4XAKE 3HG1B 2ZWNA 3P77B 5IJKC 3QQ4A 2W94A 4X4XA 4HMDA 4HJ0D 1T22B 3L2NA 1PZ5B 1OPOA 5A2IH 4BM7A 3R8BB 1OGAE 4JRFA 1LWJA 4PJFB 1WS8A 2IAND 2DZEA 2UY6B 2YARA 4XOCA 1OTSD 2PXYB 2YN3A 1A3LL 3MNWB 2CKBB 4PVNA 3K0YA 4G43A 3LXUX 1M1SA 3RWDB 4DPAX 4U1IA 1TITA 4FQXD 3FH5A 1XR9B 4N5UA 1LO2H 2WXFA 3AS1A 2IPTL 1YPZB 5C0GA 1TSHA 2AV1B 4NJAL 5I1KH 1F0LA 2PYFA 3JZ7A 4DGYH 1KB5H 5AB9A 4G8GE 2GCYB 2X6MA 5C6TL 3HG4A 2K9FB 2V3FA 3K4DA 5DO2C 4DZ8A 3PHOB 4JO4L 3E6FA 2G3NA 5AOJA 5INCB 4FQLL 1L7TH 1ZHNA 4OT1H 2ZCHH 3ZT7A 1QHPA 4YHIB 4MRCA 2DLIA 1GGCH 4XBPA 3VYOA 3S3JA 2FH6A 4IU3B 5B39G 1FL6A 1MLCA 4ORGB 5FEBA 2YRPA 1S3KH 3ALWA 1KXVC 4LFHG 3R0NA 4D0BA 1CF8L 4PR5A 3C5XA 3GJEA 3VXOB 1RJLA 3ZE0E 3S2AA 5TK4A 1SQMA 3RGVD 3BKCL 2P4AB 3T3PF 5JOFB 1FYTD 3DV4A 1UB6A 1BM3L 4XBGA 2VDOB 2OL3A 3NCXA 4L4TB 2RD0A 3DRTA 5DR5L 3V8CA 1A1OB 4LLDB 4N28A 2R51A 2UZXA 3P73A 2VDRB 4G42A 5IB4B 1YDPB 4MA3A 1BQRA 5ESQB 3HRZC 5F89A 3WEOA 4WTWA 4RGNB 2P1YA 4UYQA 5DJZA 3FYIB 4BFEA 1A6WL 4A2HA 3DETC 1GGBL 3T4AA 3WIHA 2BCMA 5I8OL 3IPFA 3DJZA 5T1LA 1AGDB 3KW7A 4HDIA 4B3VA 2DMHA 4HS8L 1QWHA 2ZOUA 2XBZA 3LJ3A 2VN6A 1FA4A 2W07B 3KVPA 4J1UB 1U8HA 4WWKB 3QZWA 2B2XH 2OR7A 4JHWH 2NR6A 5AB1A 1EXHA 1WISA 4KNTA 2CO7B 5DFVC 2YD3A 1BGXL 2XWZA 1X9QA 3B5GA 5KBMA 4XP6H 3DYOA 3GPEA 4LHUD 1D7DA 4D0CB 2B1AH 4UZGA 2Z92B 1T7XA 1WFJA 4HT1H 3PPSA 3WO3B 2C1PB 1T1WA 3UTSB 3VFMA 4L4JA 1ADQA 2OYLA 4IOFC 4A7QA 2ALWA 1FNEA 2Z91A 3VI3A 4JRWA 5DMJB 1JNLL 1R0AH 3WJLA 5FYJE 4HX1A 4P2QD 4PJ9A 5HDBB 1G1KA 1MCLA 4U1MA 5DRXA 2AK4A 1P9MA 1JVLA 1FZOB 1M1XA 2WQAA 4F3FB 2PCPA 2X12A 1KFAL 4OI7A 3JQOB 3K80A 4PVMA 3QO0A 1E6OH 4TUUA 2VUKA 3K91A 1IM9D 3BAWA 3BZFB 4Y9FA 1A6TA 5BVJA 1GJIA 1HL4A 3BDXA 1CYWA 2DAVA 5AZ2H 3MCG1 4Q6IB 1I8KA 5F1NA 1ICTA 2QELA 2VLRE 4NQEE 3OXRB 1ZY9A 4XP4H 3M45A 4NC1E 2K8MA 3II3A 4UIKH 1E90A 1O6VA 1CLOH 3LV3B 4XC3H 1E9PA 5IB2A 1JYWA 3DPBA 2GBUA 3K2MC 1MI5D 1JZ5A 3B2UD 2IH1A 3B5TA 4FYRA 3GHBL 3GJFA 4UV4H 2OAAA 5AW3B 4DPBX 3EXLA 4M5YH 4PJAE 3AG1B 2XNAA 2HXAA 4EN3A 1CI5A 4G6JH 4IMLA 3T6XA 2OZ4L 2WYHA 3F12B 2QT6A 1K4CB 4EF3A 4JGNA 5E08L 4DAGH 2BNUA 2YMXH 3VGAB 1OGAB 3IMUA 4DW2L 3X13A 4PJ8A 5IFAH 1C5CH 4X7CC 5E1AA 1RXLA 3CQPA 4PTTB 5DHXB 4UOJA 3W3BA 1P1VA 4IRSC 3MGOB 1GR7A 1II4E 1MCOL 1T0NA 1NMBH 2ZX5A 2P8LB 5IHUH 4FQJL 3BQUA 5ESVA 3QJXA 3MO1B 1T7VA 4F58L 5FYKL 4WDIB 3CX5J 3H54A 5EIIG 3GXDA 1MRDL 4MXWL 4UI2A 1VERA 2JELH 5FYLE 3VB9A 4CN6A 1CGSL 4G8GB 4YHPA 1CXFA 3D18B 1VADA 4WEMB 4EXKA 5KYWB 2WXIA 4L3AA 1Q1JH 3S7GA 2NX5E 3FN0L 3VW3L 3WLWC 5FO7B 3BZEA 1ASPA 2OSLA 5A6MA 5C9KA 2Q7AA 3H42L 2R4RH 5ILTH 3THMH 2JFCA 1YNLH 2AJYH 1E5ZA 3GS7A 3IDIB 2EYRB 4XMPL 1CGTA 2FD6H 3V52L 2YPVL 2GY5A 4L1DA 1I9JH 3LH2H 4ODHH 4QY8A 3C60D 1MREL 1PL3A 2PCFB 3OZ9L 4PJ5D 4NRXA 3ZE0B 5IOKA 1KLUA 1YQ2A 3FHAA 1OTTD 4P4KD 4KO5A 3U30C 4HV8B 1KWKA 4CDHA 3NSJA 1LD9B 3IU3B 3NFPA 4E9WA 3NJFA 2VXUL 1B0GB 2G9HA 1LEKA 1XB8A 3L6FA 3CSBA 1KJ2B 2C9RA 1KCVL 2J8UE 2WXMA 3DJRA 3EFDL 1ZA3A 4HH9A 2F0CA 1ZPLA 2GT9A 4I0KA 5IUCA 5JPMB 4GSDL 4TSAH 2G4GA 2VDKH 3EHBB 3SBQA 2EUVA 4DGUA 3K72B 3ZMRA 3GIZH 1TR7A 3H2QA 5I1HL 3NRQA 5GGRB 2B0SH 5IG7A 3V0HA 4AYGA 4D9LL 2WGXA 2WZPA 5D1QA 1AE6L 2BM3A 5CZKA 2F53A 4M7ZB 3DGGB 3OAUL 1M7DA 5J13C 3BCDA 4PS3A 1CFQA 3BZ4A 3RWJB 2K3TA 3ZBMA 15C8L 3WNLA 1G9NH 3SDDD 3NJIA 5CMAA 5F7EL 4K8RL 3GMPA 3OKOB 4FQ1L 4OJFL 3QWOB 3REVA 4ZG1A 3FMGL 5I1AB 1DBAL 1JPFA 4OFYD 1MDAA 1FSKB 1KPRB 1A3QA 3TYFA 2YBGA 1YHPA 4G83A 2HRLA 4HVBA 3B37A 2OXGB 3T0EC 4WF7A 5E2UL 4ZTPL 1AFVL 4Z7UE 4ZFGH 4XVOA 4MTMA 3TWYA 1MFCH 3UYPB 5I9QB 1BYPA 1Z0MA 2NW2A 3B83A 3HPJA 2R2HA 12E8H 2HJLB 3HKZA 5HD8C 1I8MA 4KTEL 5DDHB 4TNVF 4QHLA 4AJ0A 2QMJA 2QHRL 4ZZFA 3BE1L 4L4VE 5EOQH 4QYAA 1X4ZA 3FUHA 3H2WA 3O11B 4PJXA 2VLRB 1F58H 4NQEB 2V7HB 4ZX4A 3MV11 4J4PA 4X6CF 3UTTE 3HI6H 2CSPA 2NUTB 1FG2B 3X3GL 5DHYB 4J12A 1G7IA 1OAZL 3BKYL 2W92A 5GS0D 1R5WA 2HT4C 1ET8A 3LKSA 3PAZA 2N1TE 1IE4A 3QPKA 4YSOA 1HXMB 2CDEB 1KXQE 4XNBA 3QFJE 5H35A 5GGTH 4PJAB 1IAIL 4AYMC 2QGDA 5FGSA 1I3RB 2D0GA 4HQQH 3LB6D 1F2XK 3OAZK 2BZCA 4M7KH 1DL7H 4B60A 4C4KO 2ZUVA 1E27B 2Y3AA 1WO2A 4DJMA 4NQXA 4XB8A 1HIMH 2FR4A 4PGBB 4XO8A 3IU4L 3I9GL 3FONA 2E0PA 5H8DA 5J56B 4L1HA 2WB7A 3JUYA 2VMJA 1AO7D 4XXDB 4KJPC 1R24B 8FABA 2UXGA 2OI9C 2E4TA 4UTAL 4DQOH 3ZSTA 2V5TA 1RHHB 4WVRA 1ZA6B 3FQYA 43C9B 5L88L 4LCCB 5KJRL 4L8CB 4X9IA 1FUNA 4YXHL 5BO1L 5DC2A 4GKZA 3L5HA 5DEGA 2HRGA 2Y9RT 4HAKA 3GRWL 2C9QA 2A73A 4UNTA 2NX5B 3IETA 4XNQA 3SDAC 3TEUA 1KIUB 1WAAA 2R4SH 1NCNA 3ARDA 4JQVA 4W9HC 2F7OA 3ALPA 1OP5K 5EEZA 3VQ1C 1HAWA 2IMNA 3MBXL 3TTYA 1G6RL 2J20A 5HVHB 1ZTXL 3CPLB 1NOLA 4J3VA 1BVNP 3REWA 3KEDA 1HXYB 3TO2A 2EDOA 4W68A 4O4YH 2F2HA 1WZ1H 1I75A 3MCYA 2P45B 2H8PB 1WZAA 2YSSB 4M29A 3V4PL 3VMOA 4ABWA 1U4FA 2JV6A 3B2XA 5LBGA 3S48A 4XMWA 1MZZA 3TCLB 1CDBA 2BHYA 2X0WA 4GAYA 4GRMA 4KDTA 5JHBA 3C5ZA 3K4ZA 3RAJH 2ZTBA 2D3NA 2YKLH 3VG0H 2W59A 2V6HA 4KV5E 3CUPB 4OLEA 1BZQK 1PG7H 1XF4A 1KJVB 3HLAB 4I5BA 2J8UB 4LLYA 4WHYG 3BEVA 3H7LA 4R3SB 3QHZL 4U6HB 3KYOB 2RALA 3S35L 4GUQA 4OI8A 4P23B 5MEPA 3FO1B 2WBWB 5H2BA 2JJWA 4ODWA 4OB5H 3FU5A 3GSOA 3ARSA 3EBAA 1RUMH 1CR9H 3QFDB 4R7DA 2MCPL 2WLKA 2Y5TA 1CE1H 1WBXB 2CR0A 4XP9H 4B9PA 5I0YA 1CLZH 4MS8C 2PP8A 1I1AA 1MCNA 4AITA 5EV7A 2EVJA 2VMDA 3EJPA 4RX4A 1HYSD 3Q0HA 4MD4B 4PHXA 5BW7A 4J3SA 3CVHB 3L5XH 3ML9A 5JHDE 3N85L 1GH7A 5BOPA 3SKOB 1UURA 2WCGA 4H8VA 3EW3B 3E3QE 5K39B 3HMXL 1A7NH 2VR3A 4F7MB 4MAYB 3SGJA 3TBWB 3Q9PA 2COQA 1G1OA 3RX5A 4O51B 1QLEH 4P5TB 3DGCR 4Z7UB 1ONQB 5D6DA 3VFUB 2ICWB 3BGFB 1SYVA 4XPBL 2ZCKH 3NIGF 1PFOA 2W9EH 3QQXA 4QTFA 2CGZA 3AU1A 2ED6A 2ATKA 2C9SA 4HGKC 4HSCX 4IKKA 4OZFB 1QQDB 3W38A 2HA1A 3O41A 3TEWA 3GBLA 3T09A 3CNKA 5E1HB 4IDLA 1KV3A 4Z8FH 4LKCA 3QCTL 5HHPB 3RLSA 3D4ZA 3QEGL 4YS4A 2R7EA 3IAQA 4L4VB 5IQNA 3DUUB 2OMZA 1TKWA 4XXCC 3SY6A 1U93B 3K2UH 3MRHB 5CR8A 2C26A 1NGZA 4ZFOA 1S7TB 3LNFA 2V3EA 2AJVL 3UTTB 1AZNA 2ITEA 1B0RA 5GRVL 4Z78A 3DSNA 2DMCA 3FCBA 3WL9B 2V8MA 3PWJB 3LS4L 1F90H 4B6ZA 1G7PB 4LFHD 1JHTA 1VPOL 2J71A 4EZKA 1HESA 5D7LA 2NMSA 3KLQA 4Q9RH 4M3JA 3RWCA 4P46A 3WFZA 3QFJB 1J9QA 2DTSA 5AUMB 2X7LB 4FEMA 1UXLA 2KHAA 5CLZA 2X53A 4OCNC 4FX5A 5KW9H 4JL1A 1T7ZA 4PRHA 2NY0D 2J44A 1CTMA 2HFFA 4Z95H 4S11A 1KJ3H 3GPSA 3TA3D 4HHGA 1DBKH 1BOGB 1TUPA 3EGSA 4JRXD 2X4QB 4UAOC 5F3BB 4TUOA 3OLEA 3RJQB 4OLXH 1TETH 3BKJL 4RIRB 5BZZA 3IJHA 1GW0A 4DIXA 4PRAB 4K8RC 4PIBA 2DQGL 3F64A 3G6JA 5B1CA 5LXGL 2UZYA 1UT9A 3W5MA 4U1NB 3UDWA 3IDXL 1ZVSA 2AJ3B 3JTSB 4TN9A 2FJHA 4TLTA 2IWGA 3L4TA 5H37A 4DVBB 4BV1A 2OP4H 5D2LF 4DO4A 5DJAB 3ZZLA 1S3RA 3FQ1A 1N8ZA 3FQNB 4KO9A 4U2YA 3MLUH 2DQCL 4W4OC 1TZHB 1ZGLA 2JB6B 2CLRA 4U6XA 4ETQB 1IAII 1P69B 2NY1D 3TO4C 1CQKA 3WMSA 4F9PA 3JWOH 3O8XD 5JO5A 3QYCA 5LVEA 4O02L 4UWQB 3F5WA 3MRFB 4Y5XC 4PJHE 3CCHA 2EIZB 1UZ8B 3AS3A 3DOSA 1ZV2A 1KXTB 4L3FA 4XN1A 3Q44A 3V9CA 3GLAA 2DWDB 3GLEA 1BIHA 4AIZA 5FR3A 3S88L 3VDBA 4PJFF 2BW5A 2DV6A 2JI1A 5E51A 4Q0XH 5FUZL 1MFDL 5KSUB 3PS6A 3W11C 4L48A 2CJUH 3BJLA 5F96H 3QJHA 3EFFA 4WFEE 2F8XC 2A83B 4HLJA 4NENB 1QNZH 3NJVA 1I8AA 1SMAA 1DBMH 3WNNA 5JORA 1WBZB 2EXYC 1DZ0A 3P4LA 2V2TB 4PGEA 4GQZA 3D34A 4OF0A 1T5XA 5EU6D 2V7NA 3CC1A 1BVLB 2O1AA 2CIKA 3AMLA 4GT0A 4Z7WA 4WFHD 4U1KB 3QR0A 4NO0A 3QWRA 1ZCRA 1L9SA 2H1PL 1LTXA 5KVFE 4FXGA 1U8MA 4Y4KC 3GS4A 1ULVA 1MCQA 2YMTA 2AQNA 5JHDB 2Y72A 5SX4H 4UQ9A 2X1XR 1J0JA 3GBNH 1JP5A 1RZKC 1NBYB 5LDSA 4TVPL 2V37A 1AIFA 3VI3E 5A43C 3QORB 4BFIB 4FFVC 4OBRA 4LLWB 3RTQB 3CHXA 3MUJA 2DPKA 4PWHA 5CFHA 2O6DA 1MFMA 3ARUA 5HHQA 4YHZL 1IQDB 1CTNA 1OGPA 4FI6A 4NBXB 4FA7B 5AQ0A 4YDIH 1P84K 5K9QG 1HWWA 2F1AA 2XV0A 3BI9X 3ECQA 4U1HA 5C0BD 4HXAL 1BWWA 1EBAA 2PXYC 2VISB 2ZNWA 2K6WA 4ELKA 5KSAA 1UATA 5HP5A 3EIFA 5E9DE 4I18A 1QEWA 4H2CA 3P54A 2R69H 2I9LB 2JKRM 3ZKSD 1Z9OA 4UQIM 2MPVA 3SE6A 5AL8A 5DWUH 1E8YA 1ACYH 3L5IA 4IKLA 2CRIA 3EYQC 3ATBA 1S5IH 5GIRA 1ZRUA 3UJTL 4P3CH 1PBYA 4YHKL 4H1LH 2FEDD 3MRMA 3ULVE 4NN7C 5ANMA 2JKTM 2DQMA 2ICEB 4MHHI 2CHWA 2X70A 1HEJC 2E9GA 4M6NL 3KPSA 3QQ4B 1RZFL 4X4XB 4TNFA 4JMNA 3BKMH 3E6HB 2NRDA 4QRAA 4MZRA 2PMZA 1T3FA 5BCAA 2AMUA 1E9OA 4EQ3A 3VFSA 4ZMZA 1ZLEA 3DGDA 5EULV 2CAKA 1W6WA 1OAYL 1NFKA 3KAAA 4G43B 4HFWA 2NSMA 1E4JA 2Q3ZA 2WV3A 3JUZA 2X05A 2OM5A 4FNUA 1I7UA 4U1IB 5JW3H 5HDBF 2QTVA 1UH4A 1P4IL 3UG5A 4XWOC 4RGNC 4W9ZA 1CZ8H 5C0GB 4FG2A 4MNGE 4PW3A 2PYFB 3UC0H 2DQHH 1U3HC 1G7MA 1P5VA 2ZXAA 1YEHL 3S36X 1YEFL 1SMOA 4LNVA 4DZ8B 3L4WA 3JWNH 2BMKA 2XKUA 4PLOB 3E6FB 1EHNA 1LNUB 4ZUVA 1ZHNB 5E08H 2Z65C 3SE8L 4DUXA 4CVUA 2XN9E 4J6RL 1FV1A 1IGYA 1PD1A 4NAQA 4XBPB 4L9LC 3L3KA 4TKWA 2YFOA 2VO5A 4JW3A 1FL6B 1MLCB 4WWKC 4D0BB 1E4WL 5F0LB 5D2NC 3L3HA 4PR5B 3GJEB 5EO0B 1RJLB 1TPXB 4JR9L 4HOZA 5D8JH 2CUIA 2F7RA 1KMGA 2XG4A 1TQBC 1VF5C 3L7FB 4L3EA 4WUUA 3K6IA 1UB6B 1ZIAA 4FI7A 2OL3B 4FLOA 1CURA 3OZLA 1R3IH 4PB9L 4GUCA 4KK8D 2UZXB 3P73B 2CUHA 4G42B 3SE4C 4BE6A 4MA3B 2WQ8A 5F89B 3UPCA 1B2WL 1YLBB 5DJZB 2QQKH 4OLZL 4RNRA 4FF9A 4I77H 4OZHE 2EECA 3SD2A 3T4AB 5DJ8B 5C0AD 3LAFA 5EDSA 1F6AB 4J2QA 1WFUA 1FFPA 4TQEL 5T1LB 4HDIB 5I8KL 1GKEA 1O7DC 4CJ0A 1OF0A 2DI8A 3BN9D 3Q9QA 2GK0A 2Y4SA 5D1QE 4X7EC 2F53E 4JRYD 1AIZA 1Z6JT 2FB4H 2MIZA 4NNXA 4QR7A 2EZ0C 1RZGA 2O26U 1EJOH 1U8HB 3LZOA 1P6WA 2Y1YA 3QZWB 2EVGA 2WMPA 1SXNA 5CKAA 1KTDA 2JSFA 3OMZA 3MLVL 5DRZA 5EZJA 1U6AH 3AREC 3VA6A 4AQ1A 4MCZA 5ISZA 4N2MA 5KS9A 1KCVH 1Y1UA 1MAML 3RA7L 4ANKA 5CF3A 4M61A 5JQ6L 1UFUA 1T1WB 3EJZC 3PQYA 3VFMB 3J27A 3TNNA 3BSZL 2OLDA 1R5IA 2AI0H 3P11L 4OIIL 3VI3B 2IQAA 3ZE0F 4K9EL 4XNZC 4ERSL 3RWGA 3OLIA 4PJ9B 5DRXB 4U1MB 4FZ8H 1PJ9A 4Z7OE 3TXAA 1K3ZA 2PCPB 2OSWA 5GRUL 4QUOA 3QO0B 3ZE1E 4DKEH 4YSQA 2YXWA 3TZVB 1A4BA 1A6TB 5BVJB 3HAEH 1UT1A 2VDML 1WTLA 2XOTA 5E9DB 3VWKD 5A1AA 1I8KB 3FQUA 1OAUL 4CU6A 2N4IA 4JO3H 4PJXE 4X2UA 4MXQC 2VJ8A 1J1XL 3S8FB 3KJ4B 3IGAA 4RDBA 4MAUH 4MMYB 1EMTH 1HYRC 5E2UH 1A7RL 1BLNA 1E9PB 5E5RB 3DPBB 1JGLH 4RBPK 1KGJA 2IH1B 1NMCC 3INOA 1P2CA 3VXRE 1HQ4A 3GJFB 1JF5A 4GB9A 5ICZA 4DEUA 3DJSA 1LP9A 1NM9A 2BSEA 2XNAB 4EN3B 4IMLB 5A2FA 5IQMA 5T1MA 4UQCA 4PS4L 4I0PA 3VXUA 4NZTH 2VLMD 2BNUB 4JM2C 1CGVA 1EH9A 2QHRH 4S1RH 1Y07A 4PV8A 3X13B 4PJ8B 1QFHA 3SCMC 2AVFA 3PWVA 5E1AB 5GJSH 3ZTCC 4F1ZA 1XT5A 4KVNH 5DZJA 2JB5H 4YHML 1D6EB 2G4EA 1T0NB 2WKOA 3WTTA 1QBAA 4PM1A 3BQUB 5ESVB 5F71A 1QRND 2Y1AA 3AY2A 3EBIA 4AEIH 4MNGB 5DZAA 1VHPA 4N2IA 1JPST 2R2EA 3BWAA 1X7SA 4H1LG 4YHPB 3EHBC 2Y23A 1VADB 5MI0C 3NZHH 4KKZA 2VXTL 1OCOB 1T1ZB 3AVEA 3BUDA 2OSLB 4B0MB 3BZEB 5CAYB 1PPIA 1FH5H 1ZLVK 2XN9B 5J1TC 5KTEL 5D72H 1RU9L 4XGZA 4N0UA 2IALA 2OQJA 2WYTA 5ITBL 3IFLH 3QWQB 3MODL 4KX9A 2WSDA 5IW3A 4QY8B 3K3QA 4NRXB 3HPLB 1KLUB 5L0QB 2BNQE 4ZQTA 1N64H 2I60H 2E74C 2PO6D 1PKOA 3MVSA 4O2EA 1D5MA 4YXHH 2MOGA 1MJJB 5JZ7C 4XO4A 5I15H 3MYZA 2AC0A 4PJAF 4NI6A 2GUOB 5DD5L 1Q1PA 3N1MC 2QSCL 3WY2A 2G9HB 2XDHA 4RAHA 1LEKB 2HLFD 3L6FB 4GXFA 3T2OA 3S4SA 3RYMA 1YC7A 4HH9B 3U0TA 4HG4K 1ZA3B 1RK0A 1PDKA 2GT9B 5F7NC 1FL5A 2QPSA 3JWNG 4KJQC 4WNSA 2OK0H 3KWUA 5DD1H 2ITDA 1IIIA 4LASL 4L9DA 4YFLF 1OT4A 5IG7B 1MW3A 1NCOA 3FSVA 3CLEL 4KJWC 3H3PL 5TFSH 3VM5A 3GBEA 4NQUA 4TSCH 5D1QB 3Q48A 2F53B 3ME0A 2Z93A 1J0HA 5MERB 3DURA 3VD7A 3EXJA 1M7DB 1IGML 1OTUC 1USZA 1H15A 1CFQB 3VGEA 2XXMB 1MZYA 1RAMA 3OG6B 2XWXA 4RMBA 3W0WA 3GK8H 2CGRH 1PLCA 5CMAB 3N0AA 3GMPB 3REVB 5D71H 5H4YA 1JPFB 4KUZL 5FYJU 3TYFB 2XJKA 3SDXE 1ZGLP 2H6PA 3BWUF 1FE8H 4R90L 3LY6A 1L9QA 1OOAA 3HNVH 4GQQA 4YHOH 4DESA 2I5YH 3GEWB 3DUSA 4R7XA 3B2PA 1CS6A 3RBGA 1A3RH 1PKQA 3I3DA 5TPWL 3NIDE 4JCLA 4Q97A 5BS0A 1BIIA 1K8IA 3WMQA 3NDZE 2NW2B 4FFTA 4Z7OB 2FO8A 3HPJB 3O4LD 2E9BA 2R2HB 4U05A 5DVOA 3MCLH 3Q43A 5DO2D 1MCRA 5D5MA 1I8MB 2JCCA 1UTDA 1IJ9A 2ITCA 4RMTA 1F6LL 5PCYA 1T5KA 2J88L 2WZ6A 3P9LA 2J8UF 1JPTH 1P4UA 2VAJA 2AZUA 3EH4B 3ZDYE 4OD1H 4F9LA 4KJYA 3KLHD 4KTDL 1AS6A 1FDLL 1BZ9A 4MNQE 4YOKA 4LCCC 1RLBA 4PJXB 2QVFB 4AZ8A 4DZBA 1JL8A 1ZXKA 2EXWD 4NHCH 1G9ML 1KULA 3JVGC 1BYOA 1PS3A 4HOXA 5CD5D 4FQXA 1A65A 4L37A 1G7IB 1IKFH 3FFCD 1R5WB 3LKSB 3ABMB 4XPBH 5CEZE 2ZX8A 1HHGA 6FABL 5D7LE 3VXRB 2FGZA 3D4YA 3NJHA 4JPKL 1SLWA 3CN3A 5H35B 3LRHA 5JNYA 3CFDA 4FNRA 1RERA 4XMLH 4C4KT 3TF7C 3MRCB 1TG8A 3BUQA 2J43A 3DETD 1BVZA 1QLRA 4UM9D 2MNWA 2X9XA 1OWRM 2APWA 3P9MA 4JN2A 4M56A 4OV6F 3IFPA 4NQXB 4D9QD 5F7MC 2FR4B 3FONB 2I25N 4Z7UF 4OQ1A 3L17A 1QX1A 2OMNA 8FABB 1ANUA 2UZIL 4JDZB 4ADIA 1MG2C 1H6UA 3MJ9A 3RGVA 5LWYH 3T8XB 3G6JE 3RY4A 4UT6H 3PDDA 1FYTA 3HJEA 1HU8A 2AW2A 4JANA 3BAEH 4XE5B 4GKZB 3SEPA 5IFJA 2EXTA 5FGBA 5KJ7E 3E8VA 3PFUA 5EF1A 1SOKA 2A73B 5E6YA 1YECL 2Q6WA 2GW5A 3IETB 4G6KH 1AKJA 4XNQB 3GIVA 5AVQB 1NCUA 3ARDB 4K9EC 1AQ8A 4QWWC 4A7SA 3L3IA 2VKXA 1SJHA 4DKAA 3KBFA 4RA3A 2FAUA 4QHPA 3WFBL 2O5XL 1J18A 3MDJA 5IVOA 2NY6C 3REWB 3EJJX 2ZAHA 4R7VA 3TO2B 1HEZA 1B4TA 1G4RA 1QFWI 3S37X 5CCJA 4LARH 3MYJA 1QSED 1URLA 1W9XA 3MGAA 4BQ6A 2MPAH 3KWVA 4HIXL 1Z9LA 3Q01A 4RMSA 5LXGH 2GC7C 4LIQH 2HPOA 3PWPA 4X80H 1FG9C 3C5ZB 3IGUA 4PRPE 1RZ7H 5D7KD 3O3DA 3H4HA 4NFCA 2AEPL 4R4FL 1DCLA 5GGQL 1IKNA 1RPUA 4LLYB 4LMQE 1XF4B 2CDGA 4I5BB 5T33H 1S7XA 2F19L 3BEVB 3MLWH 3WY3A 3WMPA 3CK0L 5DHVH 1TQTA 3GGWA 4HF5H 5MEPB 4B5ZA 2HT3D 4Y4FD 5H2BB 5LCVH 3X2QB 4HJ1A 3V0FA 3TV3L 2AABL 2IWFA 1G7LA 3GSOB 3MNMA 2LHAA 5LAXA 2KLTA 1N4XL 1QR4A 4R7DB 2Y5TB 4LPUA 2DDQH 4Z7WE 1KB9K 3E2HC 4P48A 1I1AB 4MNHA 2OTPA 2Y5EA 3VACA 3TFKD 1IM9A 4HXBL 2QEJA 1OZUA 4X9YA 2R23A 4YWGH 2X9ZA 4WJG3 5JIPA 3F7QA 5GHWH 4HIPA 2XKNA 1ZLSL 4OD3L 2J1ZA 4KNSA 1Y18A 1N6QH 2F7IA 2G2RA 4GMTL 4PW9A 5EORL 2HLAA 2WTPA 3LZRA 4N8VG 4GKNA 1AGCA 1UACH 4F8NA 3BD4A 2X09A 1M42A 4XMZA 2P43B 5BZWA 2DD8H 3QHTC 2W5PA 3NIDB 1MI5A 1PNCA 4JBSA 3SBPA 1FVEA 5I17A 5E2WH 1TVBA 2WBJC 2NTSP 3AU1B 5HJGA 2ATKB 4HWEL 3VSQA 4ZYKB 3EJSA 4K7FA 3O41B 1NIBA 3ZHFA 1BBDH 4ODVL 4KV5F 2P3YA 3FSAA 3S37H 5AL0A 3U9UA 1V3JA 4LKCB 1ADQL 7PAZA 3GO1L 3ZDYB 2R7EB 5CZVL 4JCWA 4TVPH 3LH8A 2O6PA 2OMZB 2V33A 4ALAH 3W39A 2YGPA 4ZFOB 1NGZB 5JIHA 2K7PA 5ANME 4HULB 3UPRA 1B0RB 1N0XL 4N90E 2CG9X 4Z78B 2L3BA 3DSNB 1QVOA 3L2MA 2XTJE 4JQXA 4N2DA 3KPSE 5J0BA 1BLIA 1B3IA 5L8KB 1OAKL 5D7LB 2GAZA 2DICA 3V4UL 3RWCB 2YAEA 4P46B 4MVBC 3U46A 4IRZA 3V4VL 3QC5X 5EU3A 4PRHB 4E5XA 2AK1H 2FSDA 2HFFB 1PYWA 2ZE0A 3IE4A 4HC1A 3EGSB 3NTCH 1UC6A 2Y1ZA 1G9HA 4TUOB 1K6QH 1BBJA 3FOMA 3SYAA 4PEEA 1F4WH 3WTXA 2J4WL 4FNTA 3IJHB 4Y16D 2WGNB 4EZJA 3HBGA 3QUMB 3G6JB 5J4MA 2EKSB 1CB4A 4M6NH 4EI0A 2UZYB 5EZIH 1ZVSB 2DQDL 4JFXA 4NPYA 1NKOA 2FJHB 1FHGA 3BVNA 5JXAH 4Q2ZB 2EE9A 3FZUC 1AVAA 4DN4H 4P9HH 4JKPL 4KXDA 2C3XA 3IJYB 4OCXH 1N8ZB 1LWHA 1TDQA 3NA9L 4GLRH 4IQHA 4QHUA 1EDHA 5EN2B 5E8EA 4BUHA 4P5KA 2CLRB 2EIDA 4U6XB 1A47A 1EVTC 4O9HH 3I50H 3T0ED 4KZEH 3B34A 5JHLL 2CXKA 5JO5B 4ZOAA 1P4IH 1XV8A 2NCEA 1EEQA 2MNUA 3F5WB 1EJ8A 4L3EE 1EAJA 4WUUE 3CCHB 5IQ9A 3NJLA 3US1A 1KTJA 1PCXA 4Z3FA 3DOSB 4UT9A 1HQRA 4CC0A 4KK5C 3D2UA 3GMLA 3CFTA 4P59H 4YXKL 4AIZB 2FYYA 4FABH 3MRBB 3HE6C 1AHWA 5DQDL 3SE8H 2KDGA 2ZPKL 2HVJA 3TNMA 4HBCH 3BPOB 4OFYA 3QJHB 2CUAA 3OVUB 3HZYA 3SYQA 4Y9BA 3EFFB 3UBXG 5HHMD 1UCBL 3PFQA 1MRCL 4LCWD 1ED3A 1JI1A 1S78D 2ZAGA 4MQSB 5D1ZD 2RH0A 2WXGA 2AJXH 1MPAL 2CM6A 2O72A 3DIFA 2BXZA 4PGEB 4V11A 1T03H 2HT4D 4UBDC 5IEHA 1T5XB 2V7NB 2WUBH 3MA7A 2CIKB 1JFQL 1N7ML 1SUHA 1V7MH 3KPPA 3T65A 4Z7WB 4HISA 3QUXC 3UAJC 3WTSA 3II1A 1W72A 4NO0B 4PJDA 3MI6A 1VSCA 5KS9E 1R33A 1AS7A 4FXGB 1U8MB 2HVBA 3B1UA 2MCAA 2EDNA 1RL1A 1HX0A 3M86A 3DX1A 2DQTL 3L95A 2QL1A 2R9HC 5AVUB 2QGBA 1AIFB 1CUOA 2ZWSA 1LO0L 4KC3B 5LN8A 4Y7MA 3DJ9A 2J5WA 3AGWA 4KJPD 3RU8L 5IBUG 4OFKA 5T3XH 3EJUA 5HHQB 4M1DL 3AM8A 4PJHF 3RUGA 2BNRD 4MJID 4U1GB 2EO9A 1KYOK 2Y6SC 1SM3L 4BWUA 2EAEA 1YYMH 5C8JA 2BOCA 1LK3L 4U1HB 3PV6A 5KSAB 1S8DB 5LN4A 4ELKB 3ZY7A 4TQPA 3CVIL 3Q2NA 4K94H 4I18B 3BVDB 2Z31D 4BSWA 1QEWB 4K23H 5KG9A 3CZKA 3TJHD 1P4BH 2CBQA 3I3EA 1WP6A 3BSZH 1MOEA 3MV9D 1SOQA 2IH3A 5DUJA 3MNZA 4JPVL 4RISH 1H8SA 4ODSH 5CGMA 2G30A 2VDNB 1ASOA 2X2YA 4KMTL 3MRMB 5ANMB 5L8LB 2WTRA 3OC5A 2VDPL 4ZSOA 2EKJA 1Z2KA 1TXKA 2X70B 4NQCE 4WJ5A 1OP9A 2XTJB 2MEJB 3B43A 3I9AA 3APMA 1WFIA 2NNRA 3KPSB 5J6SA 3I2CH 5JW5A 3VXUE 4YEFA 2VDMH 3DIVA 1HSAA 1T3FB 2XXGA 3KG5A 1E9OB 1TJHH 1TPXC 4UDTA 3VFSB 1ESOA 3WTUA 1C5DA 4XPGL 4YHLL 5HYSG 1ZTMA 3VI3F 4HFWB 5BMFL 4XCYA 1G7JB 1FORL 1SEBA 1MY5A 1I7UB 1U3YA 5D1XC 4KNUA 4UILL 5LKNA 4F8PA 6PAZA 3NH7L 2OMUA 2KLSA 3L9YA 4BFNA 1G7MB 1P5VB 4G9FE 4JN1L 2ISDA 5J7CC 2G60L 2VTFA 1U30A 4FFYA 4NWUH 3U6XS 4D8OA 2BMKB 1I85A 2OJZL 3D69A 3ABZA 4CKQA 1E5YA 1HAUA 4W9EC 4P3DA 2ITFA 4FXTA 1DBBL 3PP3K 1IGYB 1FV1B 1KG0A 3E8UL 1XZWA 4N0UE 3L3KB 2AS5M 1AXTL 2B5IB 2CO1A 3NSXA 2H6OA 5E9AA 3PUCA 4YMPA 4ODTL 3CFCL 3KPRD 2NR6C 5CSBA 3BT2L 3L3HB 1I3GH 3U1SL 3GHPA 1CTOA 3ULVF 4OCSL 2JQZA 2XG4B 1YN6B 4L3EB 4WUUB 4RETB 3QUGA 2Q5BA 4HA1A 5E70A 4WCYH 3SHSA 4BXSV 1XH1A 4I3RL 6TAAA 3OHXA 4GP5B 4L8BA 4RWHA 3MUHL 3P0VH 4V1DD 4ZBJA 1C5BL 5CO1A 3S0PA 2C9XA 4A2DA 1KENH 4IKJA 5MEOA 1JZFA 2APXA 1JHKH 3TS8A 3UXFA 1UVQA 4OCRL 1BM7A 2VSCA 1FBIL 1JK9B 1F3JA 1JYVA 1FFPB 1YVLA 1T2JA 3TH3T 5DUMH 1AZCA 2AEOA 3H56A 4KKAC 4HAGA 5HGBB 1TFHA 2AAVA 2GK0B 4URKA 1XTLA 1OHQA 4ZW6A 1BAFL 2WNKA 2YD8A 1ACZA 4IHBA 4M62L 3S8WA 1QSFA 1FWXA 1RZGB 1VRSA 1QABA 3S3DB 4H0LC 2WMPB 3NDYE 1KTDB 1H8OA 3W0WE 5DD5H 4LVOB 1JK8A 1S4IA 5DRZB 4XP5L 2MOVA 4G3YL 4NZFA 5EZJB 2UY7A 5F0PB 4O5LL 1B0WA 1BAWA 3VGGA 4AQ1B 4MCZB 5DFAA 1I53A 4U3SA 4JFYB 5KS9B 5ISZB 3WFCH 4GAJH 3D9AL 1E2ZA 4RGMC 3LRSA 3DX2A 2E4FA 4M61B 4HK0A 3VD4A 2EACA 3FF7A 3PQYB 3TNNB 4LSRL 2ZG1A 1R5IB 4YBLB 3TBCA 1U3JA 3FULA 3NQKA 2IQAB 5C08D 3VGDA 1PKQE 1MWAA 3RWGB 5BS0E 4AK1A 3TEZA 1QFOA 5B4MC 1HK6A 3QGVA 4K8RD 2HYMA 1GOHA 3MV8A 3TPKA 3WTYA 4BK8A 5D5ME 4NGHL 3NK4A 5KEZA 2VZSA 1JMXA 2WVVA 2CHZA 1X5AA 2W9DL 5M94B 2FLBT 2OCCB 4M6ML 4RA0C 4OZHF 3A24A 4ACPA 3CLFL 4R5XA 2HT2D 3C87A 4Q4EA 1B2YA 1SN2A 1YY8B 2AKRA 3A6CH 3IGAB 4P5RA 1U8QA 3TA3A 3LD8B 4R90H 3ULUF 3T1WA 3EH2A 2BJML 3V9EA 4UM8A 4XNUL 2UVEA 1D9KD 1BLNB 3MA9H 4LL9A 1FFTB 2W65A 3M6DA 3FRUA 1RZ8A 3VQMA 1HKLL 1FYHB 3D8MA 3ZRCC 2J3SA 5DJ6A 3LHPH 4Q6YA 4UTBA 1P2CB 4P06A 2NUPA 2XUWA 1KZYA 1HQ4B 4W6WB 2XRAL 2P52A 5ICZB 4BFJA 1LP9B 4TLUA 2YGOA 3WAKA 1QHOA 5T1MB 3LEVH 1MJ7H 4I0PB 3VXUB 3GF8A 2XVGA 4Y5YA 1BD2D 2F1EA 1SHMA 4PV8B 3UPAA 5IVZA 3PWVB 2CGYA 3GI8L 4YE4H 3MRKA 5L0QC 2NY2C 5HYJE 5D93C 3VRJA 4LVNB 4KH2A 3UERA 1G9MH 2BPBA 5JPNA 5DD6A 5B3JE 5D7IA 5IIEA 3O8XA 3V0IA 4QRRD 4UV7L 1MAKA 5KVDE 2CZNA 4Z7OF 4C58B 2GHWB 2E7MA 1URZA 2X1OA 4ABQA 2X87A 1J9CT 2BRQA 4R0LA 2R2EB 2ZOOA 3BWAB 1OSZB 4U0RC 2B1HL 3ZE1F 1F5WA 4OFDA 3HKFA 1J1OL 5KVGL 5CP3A 5GQBA 1T89C 3ET9F 4MMZB 1HHIA 3M1OA 3ZLQC 1A3ZA 1A64A 1T1YA 3QE5A 1HOCA 3QZMA 4HEPA 5HGAA 1DJYA 4DK5A 4G6FB 4WENB 1A4JA 1U58A 1XD1A 4PJXF 2H0JA 3FU3A 4JO5A 4K3DH 4XGZB 4N0UB 2IALB 2EINB 2R29H 1E4HA 2Y2TA 3D3VD 3FTSA 3U7AA 4MXVE 5C3IA 4FFVD 4B9IA 3ZT5A 1NL0H 1RKRA 1QO3A 2CPUA 5E7BA 4C59B 1HE8A 4O2EB 1D5MB 3PWPE 3Q8EA 5EU6A 5L9DL 3AS2A 2FYVA 5CSZA 3IFNL 3M07A 4IRJC 3IT8D 2BFVH 2X2IA 1PAMA 5C07E 3DVGA 4L8DA 4NZUL 1N26A 3W2DL 3S4SB 5IJBC 3O3UN 2KDYA 3U0TB 4YUEH 1RK0B 1PDKB 3Q1SH 1FL5B 1OE1A 2OCJA 3A47A 1KELH 3QCVH 4JB9H 4JFUA 4QRTA 4WJKB 5C0EA 2ITDB 3FO2A 2YUVA 1BREA 3CQFA 1IBGH 5AW7B 5K1JA 1U95A 3KBPA 1YY9C 3ME0B 2Z93B 3MLXL 3NPSC 3DURB 4GINA 5FCUL 2XX1A 2CO3A 1H15B 2VYRE 1VEPA 4KQ4H 4P2CG 3CHSA 4OGZA 1IAIM 3IDYC 4GQPH 4N0CD 1GXEA 4GAGL 5AKTA 3W0WB 5AKSA 5L7XH 2FBJL 3IPEA 2Z1PA 2AEPH 4L3CA 3F58H 4LSVH 5EIIA 1AP2A 3RX9A 2F19H 2X6UA 3T1FA 3CU7A 1BVOA 2H6PB 4KMLB 4KWUA 1FRGH 2CU9A 2DQIL 1ML0A 1NZRA 2EDDA 3V79C 3TV3H 3NT0A 3DUSB 4IMKC 4WI6A 2YGNA 1PKQB 1AACA 5BS0B 5I0VA 2HMIC 2HH0L 1I82A 4I9WD 2GBAA 3U2IA 1BIIB 1IJNA 1K8IB 3PL6B 5HHOD 3NCJL 5E6ID 1SOXA 2VERN 2VJ0A 1KPVA 5D5MB 4ENEC 1RD6A 2ITCB 2R1WA 3EYOA 1MCCA 3R7RA 1N5YL 1MQKL 1ZLWK 4WEEA 1LE5A 4I2XE 3FQRA 1JI2A 2VE6A 4K3JH 3DX6A 5ALBL 1BZ9B 4AZ8B 4I3SL 5LBVA 1TZAA 1XTMA 1XB3A 2YA2A 1Y0LA 4HLZH 1A7QH 2AF2A 4JUSA 3LN9A 2X4TA 1KB5A 4KRPB 4L37B 4JHAL 4K7PX 1PEWA 4DWHA 4WNQA 5C0CD 3TURA 1F56A 1HHGB 1R5VA 3QDHA 3N1QC 4H40A 3UIZA 1NFDA 3PGCA 4QRPE 3ARDC 1K8DA 3QJSB 1MDTA 1W16A 2FO1A 4N86A 3MOAL 5JNYB 1DQQA 4AH2A 5ICUA 3CFDB 5CP7A 5DYFA 3X1EA 4DT2A 4IBSA 3ECBA 5FFOA 5GRJL 1OQOA 1QLRB 3BDYL 1K3IA 2ZQKA 3P9MB 4JN2B 4J3UA 4UNUA 3IFPB 3SDXF 5KZCD 4GRLA 3RKPA 1CD0A 2E9WA 2E59A 4WV1C 4ETYA 2BZDA 3B7UX 3VWJD 5EEUA 3AS0A 3V6OA 4QJ4B 1PAZA 2VQ1A 1MF2L 3C5ZC 3OKEA 4APQC 4PV9B 4CC4C 1TLMA 3NIDF 4NFDA 2BVOA 1H3TA 2IV9A 1G1YA 3R0MA 3RGVB 3KPTA 1CG9A 1XXFC 4DGIL 1FYTB 2I07A 2CALA 3W9DA 1J86A 4JANB 1XHHA 5D4IA 3UYRL 2XYCA 1MVYA 1DFBL 5IFJB 4YSCA 5TF0A 5SV4A 1AGFA 1RIVH 1M7UA 1F3RB 2HAZA 3ARRA 3WN5C 4IGBD 2ZX9A 2J6EL 3WENA 4F7TA 3HN3A 3ZDYF 2Q6WB 1AKJB 2V9QA 3GIVB 3MRQA 4LSQH 2Y2YA 5C0AA 3L3IB 2XWJA 3RWIA 2WCSA 1J10A 3EYUL 3X1NA 4IIQA 4B97A 2Z9TA 1SY6L 4X9GA 3MBED 4UNVA 1MW1A 1HEZB 1JWMB 3KYMA 4P4RA 3MYJB 5GGRY 4X6BA 3UG4A 5BW7C 1UJ3A 4M48H 2M83A 5HDRA 5EZLA 2ODIA 4MMXC 3DPDA 5AOLA 5CGBA 4ZMAT 3IN0A 3IMTA 1CMOA 3PWPB