1Z3RA

Solution structure of the omsk hemhorraghic fever envelope protein domain iii
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
ISKGLTYTMCDKAKFTWKRAPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGAPDVDVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGELKHQWFQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the envelope protein domain III of Omsk hemorrhagic fever virus.
pubmed doi rcsb
source organism Omsk hemorrhagic fever virus
molecule tags Viral protein
molecule keywords polyprotein
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1z3rA00
2HG0A 3N42F 4FFYA 4GSXA 2I69A 2JSFA 5LBVA 1ZTXE 4GT0A 3P54A 1Z3RA 5GZNA 5H37A 4UTBA 1TG8A 1S6NA 2P5PA 1PJWA 4FFZA 5LBSA 4AL8C 3UZQB 5LCVA 2JQMA 5AAMC 4FG0A 4L5FE 3UZVA 1OANA 1UZGA 2H0PA 2V33A 4AM0Q 4BZ1A 5JHMA 3J2PA 3UZEC 1URZA 2JV6A 3N43F 5IZ7A 3G7TA 5KVGE 2ALAA 5JHLA 2R69A 3UAJA 5KVEE 4UT9A 1SVBA 5GZOA 2R29A 3WE1A 4ALAC 4BZ2A 1Z66A 4UTCA 3C6EA 1OKEA 3IRCA 3N40F 4X42A 5KVFE 2GG1A 3UYPB 5KVDE 3MUUA 4UT6A 3J27A 1OK8A 3N41F 3N44F 3VTTA 5B1CA 5AAWC 5IREA 3C5XA 4UTAA 1RERA
chains in the Genus database with same CATH superfamily
4V33A 2AJUH 2H6PA 4DGIH 3LKPB 4E9XA 3MTRA 5GGQL 1GCFA 1OGAA 1RZGA 2W1NA 3OPZH 2J88L 5KVFH 5IROD 1Q4NX 2FB4H 1FWXA 2P52A 2CUMA 1XAUA 1FNFA 2HUEA 3PWJB 3OSVA 4XPHH 1P4UA 5SWSB 5T1MA 4D0CA 1G6RL 1WGVA 4Q9BA 3S48A 2A6JB 3GBLA 1CIUA 2YO3A 3ZE2B 2NDGA 2K6WA 5E6ID 2P1YA 1A6WH 2WO2B 3MBXH 4YDZA 5K59F 4CMMB 1R0AH 5LLIC 1EXGA 1KTBA 3MI6A 5DRNA 3X1FA 4AKPA 4NC0B 1T0NA 4YEEA 5IMLB 2MQCA 2Z92B 1FLRL 3ECVA 1MW1A 2KPWA 3SBQA 4PJIA 3UZQB 3ZE2E 4Z76A 2CRYA 2FSDA 4MCZA 4F20A 2ZPKH 1Z9SB 5CGMA 5DTFB 5GS0L 5FK9B 3OKMA 5I1JH 4H25A 4RGNB 4R5TA 4WUUA 3NJNA 1JMXA 4X5WB 5JQ6H 3BH8A 3Q2WA 3ZYIA 2BS9A 4M8QB 4WWKA 3VI4F 1KGXA 3V6OC 4L4VA 4N6RA 4YGVB 1BXXA 3FONA 5DR5L 4PV9B 1RUAL 2HG0A 5C8JB 2QDWA 1CIDA 2LFEA 4JRXD 4M4RA 3ULVC 3GS7A 3DLQR 4MMYA 5T3ZL 4H5SB 3SKNA 3FUMA 2PW2B 4JPSA 3O9WB 4XVUC 1QTPA 4P4RA 4UTBH 1NCCH 2AVGA 4KHXH 5DZ9A 3FB7A 1A7BA 4XHJD 5IVXB 3FB7B 4NHCH 4OCSH 1SBSL 2PYFA 2WZAA 4OGQC 1ID2A 3GBNH 1NICA 5D93C 5DMGD 3TA3D 5B4MC 5B7FA 2RFXA 1S9KC 3ROLA 1ITCA 3TVMA 2O6PA 4NT6A 3CHSA 3CVHB 4PJXB 1AVAA 2Z7WA 4PBDA 3RFZC 3OWRA 2GBUA 1U8OA 4M48H 1RQ5A 1A8ZA 1OANA 3AXHA 4IBLT 4DCQA 3IMVA 2F1EA 3UIZA 4U6YA 5IESL 1GAFL 3D34A 4MAUH 2MCPH 3MLWH 4QRPE 5DEZA 2D0GA 2UXFA 3O41A 3HI6H 2F5AL 3KW8A 5PAZA 5F6IB 4NQDB 1LEGB 5HDOA 1BYNA 3ZUNC 2OMWA 1VACB 3D85B 4XWGH 3GZQA 2X7LA 3QQ9C 3OAZK 3DMMD 4K3JH 1JD7A 1Q9OA 4MQ7A 3CHPA 3K2KA 4NERA 4EI0A 5ITBL 2AJUL 5JNYA 3E2HB 1SHSA 3MOQA 3HG0A 4JFPB 3IU4H 3MGTA 4YZWA 3LDBB 3LZRA 3F58L 3SKOB 4UQEA 4IKIA 4YHPA 3PAVA 3UX9B 1XDTT 1XCQA 4EN3D 2EH8H 4ERSH 1NIAA 3BMVA 5BOZG 4K3HA 2V3FA 4CMHC 3WO4C 1TQCC 2OA9A 4XMPH 3NIGB 2CBMA 4MD4B 5JMOC 3SDXB 5B38B 3FSAA 4MWFB 1L4IA 3D0VA 3N6YA 4HDIA 3QUZD 4JMXA 3L6FB 2ZCKH 5I73B 3LVEA 1D5ZB 2K6ZA 4P99A 3SDDA 2X4OA 3CG8A 5SV4A 4HJUA 4MNQE 2GJ6A 4LCWD 4AGPA 3RNQA 4Y7MA 2HKAA 2DH2A 3KL0A 3DSFL 1T66D 5GISL 3C5ZA 2DYPB 2VXTH 3GJFH 4ZSOB 3POHA 4X6FA 4Q14A 5IKCB 3IFPB 1KJ3L 4Y89A 3Q6GH 5DT1H 1IIIA 2ZYIA 1N68A 4ZW5A 3D18B 4APXB 2DLTA 2X4TA 3KYAA 4ANUA 2JCCE 2XN9E 4CVZB 2UZXB 3BZ4B 1NFDE 4FXGC 4XPTL 2DQTL 4QHUA 1WJ3A 4HJ0C 3AFLA 1VADA 5ADOH 1QNIA 1XR9B 1EVTC 1RZJH 3WKPA 1FYTD 4JO4H 4M9PA 1XF4B 2IANA 4RFEA 2APFA 1BX2B 3WHE0 4YDKH 3P2BA 1SXNA 4QEGA 1TFHA 3FW6A 5E00A 3UAJA 3HE6A 3UTSA 5TPWH 1G7QB 4CDHA 4DT2A 4LDOB 4NHCL 3QG7H 2WUBH 1TSRA 1KLFA 2ZP0T 4KVNL 2HVKB 4LNVA 3L9YA 2GVYA 2OTWA 4XRCB 1NC4D 1OPOA 4WW2F 1OTUD 4NNYB 4D8PB 3MREB 2IDUA 3V5HB 3BPCA 4RSYA 4GAYB 4K5LA 1KPRA 3FTSA 5J8OA 2DYRB 2ZICA 5GRJH 3EYUH 3E1F1 2EC9T 3RX8A 2HKHL 2YMTA 2ICWA 2D4DA 4LEBA 4PJDE 3D48R 2Z64C 4MAZA 1JGLH 1ZK5A 4XE0A 3U0TB 6TAAA 4WCYL 3MLWL 4WKZA 1OEZW 3C08H 1UWEL 1E28B 2AQ2A 3FO9A 3AG2B 2HWZL 1HKFA 1EA9C 4IBVA 4E9SA 2R2BB 4PJBA 3J7HA 5C0CE 5B39A 1IEBB 3QNFA 4HWEL 4AKOA 5DJCA 3MV8D 1MXDA 5AYQA 3GXMA 4YNYA 4XP4H 4G6MH 4PWEA 1A6VH 3GJFK 2V2XB 2JQMA 3DYOA 4U0RC 1E0OB 3QJFA 4M9OA 4WEBH 5KSAA 3QISA 4GJTB 1R3LA 1S7VA 3WE6A 1E27A 3VFVB 4XOCA 4WEUD 3TWCH 4N2OA 2ZJSH 1S8DA 3FUEA 1RSYA 1F58H 1ZHNA 1RURH 1T83C 2OL3L 3DHMA 3EYSH 3OKEB 3RNKB 5FYKE 3CVHH 1UB6B 3AXLB 4NWUH 4Y7OC 3W9EB 4QNPE 4HEPA 2OX5A 5L7XL 1Z5LB 1X5IA 4QLRA 1RUKL 2JELH 3QDGD 3BDBA 3QXDB 2ROXA 1U8PA 4W1TA 1DO6A 3RWEA 4PG2C 1YEGL 3S4SG 3DX9B 3ISRA 4IDJL 3U6XS 1R9FA 1YMHA 3BDYL 4GAFB 1XZ0A 2FBOJ 5GGTA 1EAPA 4ADGA 1B4TA 3KG5A 5T1MB 3ES6A 3HLKA 4QJ4B 4PJIF 5IBLC 5CMAA 3DETC 3BH9B 2R15A 4DZBB 1ZMYA 4GXUN 3IDIB 3GXIA 4NBXB 2F18A 3F6LA 3QJHB 1P4LB 1CF1A 2IFGA 2J44A 2F15A 3BSZL 5HDBB 5MERB 2Q87A 1AOZA 3G08A 1BV8A 2XN1A 5BCAA 1EHKB 3N91A 1QUNB 4MJIE 5H4YA 3TU6A 4KDVA 4WU5A 3TXAA 3VD5A 1NLDL 2HCZX 3CVIH 1BJMA 4FA6A 2BSED 1WZ1L 1KIQB 4U33A 1OWRM 3EOTL 3RPKA 3PGDB 4DOHB 2FT7A 3PL6B 3QG7L 1L7TH 3O81A 4G43A 3SYQA 5E7FA 5HDQH 1QNZH 4MJIB 4QXGL 2MKWA 2PTTA 5IK3A 1FFPB 2VLLB 3N9GH 3T1FA 2C4FT 5IK3B 3SGEI 4A38A 3DBSA 5GRJL 1YN7A 2VIRB 2FD6H 3F7RA 3EHBB 2FJGB 2R0WH 1JPEA 1S7WA 2BNQB 1NL0L 3HRZC 4AQEA 1YEDA 3GHBH 4TNEA 5L0QB 1FHGA 1IFHH 1HESA 3VI4A 3Q8CA 3QQ9D 5A2CA 4OZIF 4WHTA 1YEKH 3SD5A 4P5TD 2RCSL 1SGKA 5AW9B 3TP4A 4ZZFA 4G71B 5HHXH 1IGCH 4DEPB 1U0QA 2C3GA 2NW3A 2DW5A 1J9CT 4PUBL 4FS0A 1O9WA 4ZAKD 4M7LH 1PX4A 2BIIA 3QHFH 3VGHA 2A9CA 1NAML 1FFOA 3FO2A 1HILB 4KI5D 3MXWH 2M1KA 1U2YA 4P2RA 1DVZA 2Q86A 4IQHA 1V3KA 4OFYA 5CP7A 1IL1A 2ALWA 1UFUA 4JPIB 1MG2C 3QFDB 4RZCA 4A2EA 3NACL 2VLJA 5C0JA 1KYAA 4OZIB 3PS6A 3ABLB 2OMZA 3ABGA 1WAAE 2A4EA 3UOAB 2DDQH 3CK0H 5IMMA 2I69A 4G7RB 4R8WH 2AEQL 5IB2A 3U6RA 3L2NA 1UWGL 4UT6L 4EJ1C 2D8KA 2NSMA 1KFGA 4KRLB 3MRCB 4AM0Q 3H56A 1DVUA 4P5MB 4ZUVB 1KLGA 1M7UA 2J6EL 4PWGA 4J3OD 4KXZH 5DA4A 3ZZ1A 1HCFX 4HZAA 3FPYA 5IF0A 4EN3C 1UA6L 4PB0H 2CE6A 3EH4B 3WTTA 2NY1C 1QUPA 1M2VB 6PAZA 5D5MA 2DBJA 1FL5A 1CXFA 4JPVH 2WN3A 4DP5X 4HOXA 1FCCA 1UCBL 2Y7NA 4ISVB 5KJRH 4KKLC 1HHIA 4PJCF 1TZGH 3AY4C 2YD5A 3PIQB 3GSRB 4U1MB 2E56A 3TBYB 5EA0L 3TO2A 2HJLA 5I19L 1UT1A 2AQNA 1AI1H 5ICUA 3THML 2WXFA 4DKTA 3IMSA 3G6JF 2B1OA 5AKSA 1XF3B 4K9EL 3WDHA 2VN5A 4GYBA 1T20B 2EDMA 1I3GL 4ZMLA 1FYTA 2R2EA 4L3AA 4GLRI 3GBNL 4UU9B 5DZJA 2E6PA 1G7JA 4TXVB 2CLZA 3HLAB 4TVSa 4X4XA 3MRFA 2IALB 3VRLF 3VG9B 2F54E 3CBRA 2BVOA 4NIYE 3GDCA 3UJJH 2I9LB 4NFBA 4FFZA 1EXUA 4NGHH 5IB5A 1OM9A 4X4XB 1Q9OB 2BZCA 5IM7B 2HFTA 2W60B 2XFGB 2EIKB 4P2QE 3WMSA 1A9EB 5G5DA 1ZGLP 1AYOA 3GSQA 4MVBD 5IG7A 2EC9U 3HE6B 3K72A 1WFNA 5CILL 2Z8SA 5J6HA 4JQVA 4GLRH 4AQ1A 3O8XA 1CZ8H 3T2QA 4D7BA 5BQ7A 2X0WA 4IRZA 3B56A 5AUMA 4HSQA 2NXYC 2EP6A 1G9MH 4A66A 2PXYB 2VUYA 2AC0A 4LHJB 4BKLB 2NY4D 4U1SB 2WLIA 2BVQB 3P11L 1RV6X 4NYLB 1YEJH 1TTCA 3CFBB 2EO7A 4CVXA 3P4MB 3ZR5A 1KXQA 3JTTA 1NAKL 3LKQA 1N7MH 2X70A 35C8H 2HJKA 4X9FA 3B2VH 4N6QA 5D7SH 1DBKL 1ZPLA 2WVSA 4ZBJA 1AD0B 2Q1EA 4OLEA 3ZPDA 4FLQA 3U1SL 5BS0B 3SKNB 1NCBH 2WBJD 4QOKA 2VZTA 2RBLA 3IJSB 3QPQD 1A7QH 4PU2A 4BZ1L 3G5WA 3QJSB 1EGJH 4OM1L 2HT2D 4B96A 3G6AA 4WW1B 2WQWA 1CL7L 3KJ4C 1MQKH 1NGWA 4N22A 5EEVA 2PXYC 2K45A 2Y9RT 3MV7D 4JPIA 3ERXA 1YNTB 1OOWA 2AJXL 4RRPG 2BCKB 1MVFA 4JFVA 5FYKU 3MJGX 3L13A 1HHJA 3N5AA 4FD0A 4KHTL 4MA7L 4Y4HD 5FOBB 4AYMC 2MH4A 3AS2A 5DTFA 3VYPA 1QACA 3EBGA 3WYRA 2FJGA 4AGNA 3NSYA 2HP4A 2EYSB 4LLYA 4U6TA 1MJUL 2NYYD 3BP7A 4I1PA 1FAKT 2WZPA 4O9HL 5FW7A 3B7TA 1RLBA 4W6XB 2NLJA 5IWLC 1XSJA 2ALAA 2E9IA 1H3VA 4JFDE 1S5IH 3PGFL 3SEPA 1GOGA 1KCUH 2CK2A 3BPNC 2E59A 4TOYH 1KPVB 1JTTA 1S3KL 5HVWA 2VW7A 5F88A 1ZHLB 4PRHE 5ISZA 4HFUH 3DX7B 4NZTL 4FEIA 1FL3B 3W2DL 3RY6C 4O4YL 4HC1L 1JGIA 1VLXA 5BOJA 1R3KA 1YN6A 5LNDA 3QH3B 4JFZL 2O26U 3TPUA 2BVOB 4NNXB 2D3LA 4WI5A 2A83A 1E2VA 1PSKL 1P4LA 1CVRA 4XNUL 4PLNC 5I71B 3RZCD 1QLRB 3MBWA 3HA0A 1BXUA 3H4HA 3IKCA 3PL6A 4HG4J 4J8RB 4W70A 1MDTA 1EEQA 1KXTB 3K7UA 1XF3A 3DOIA 1OSYA 3D25A 5KBPA 5J6GA 2ITDB 5DFVD 3MV7E 4WU5B 5CLYA 9CGTA 2BP0A 2NQCA 5CSGA 1L6XA 4X5LA 2LVCA 3QIWD 5K33A 5DO8A 1TJIL 1S7TB 2HJFA 1FFPA 2CA3A 3T1FB 4EIUA 2HLAB 2WJ5A 2Z93A 1QP1A 3MV7B 3E6HA 2VW6A 3FQXB 2AK1H 4BXSV 1JV2B 3OKDB 5D4IA 1AGEA 2X4RA 4APQC 4G8IA 1JL8A 3P02A 4L3ED 3DURB 3HZMB 1P2CB 1SYSA 5HD8C 4OJCA 3MLYH 1ZSHA 2VQTA 4YWGL 2FLBT 2MHAA 1NOFA 4JRYE 1QI5A 3UABA 3FTUA 4GEJA 5I8EA 3FT1A 1N5AA 4PJ7E 4HQQL 2H7WA 4YR6B 4APQA 2G4EA 5E2VL 5B1KA 1W8EA 4NQXA 1OAYH 3U4AA 1W6LA 3O4LD 1OM3H 2A77L 3QFDA 2ZOLB 4P2OB 4A7TA 4N87A 1I8LA 5BMFH 4G8EA 4DEPC 4FOMA 3ZDWA 4JFUA 2Y07H 2YC1B 2IBZY 2XX1A 5FYJD 2VDLH 4PRIE 2C9QA 4BDVA 1G7IA 3H6JA 2VR6A 3S5YA 3N40F 1MFBH 2ZOLA 4P2OA 4FERA 4OUUB 3KPLB 3LJ3A 3ISWA 2H0JA 3BKML 3L1FA 4IEFB 4XN4A 5PCYA 2IPKB 3UADA 4AC4A 3HRZB 4LSDA 3JXAA 2BNUA 3VWJB 2C4XA 4O9HH 1U8IB 1U8KA 3CQQA 3EHBC 3K1DA 4ZYKB 4OCYH 3A6OA 4OQTL 4NJ9L 4E2OA 4EN2A 1OPGL 4X5QA 2WBJA 1S7QB 1GYWA 3RY5A 2XCMC 1NCCL 1V27A 1PNCA 3X12B 3QEQE 1YYLH 4M7ZB 1A3QA 2UVEA 1SBSH 4FLSA 4NQDE 3SDDC 3PL6C 4U1HA 1ZPUA 3G5VA 1OB0A 1R3LB 5ISZE 3P9MA 4UDTB 4JKNA 1D9KD 5B21A 4NKMB 4LIQL 5CM1A 1KBWA 3UJIH 1CE1L 3TPUB 1WA2X 4OJYA 3KLDA 2XN9D 4DKEL 5SWZD 4GP4B 1N3NB 5IW6A 1WC7A 4X0NA 4XMZA 1MY5A 2YA0A 1KUMA 5ISZB 3K8MA 1J0IA 1WBXA 4HIJA 2OMNA 3WIHL 5AOZA 1Z1WA 4WKZB 1NJ9B 2P47B 4PMEA 4W9KC 4G2AA 1EEZA 4OU3A 2ITFA 4JKPH 2CGZA 3O9WD 4KTEH 5E9AA 5GRVL 3ZMRA 2DWDA 3WN5C 1ROWA 4ICXA 4OD2A 4K3JL 4BINA 3X17A 1OB1B 4HT1H 4F91B 5MERA 3EDDA 4YFDB 2NY0B 3PE9A 1IGMH 3PP4H 5H2BA 5I76A 1XR9A 2NZ1A 1X7SA 3SGEH 2YSTA 5CZXC 3QULB 5LBSA 4YH6A 2M8XA 1WPCA 4IU2A 1I1CA 1AACA 3BVNB 3E8VA 2AXGB 2EDDA 1KNOA 2AFNA 3S37X 3ULUF 4QRTA 4UT9A 2P8MA 5F1SA 8FABA 3UC0H 4G6AC 3HI5H 1IC4H 2EO1A 4U05A 1MCCA 3GMMA 5DMKB 1BM3H 3LEVL 3TVMC 2JI1A 5AB0A 5I6XC 3FTXA 2PKDA 4PW9A 3SCMB 4MNHA 2OSYA 4H8QA 4NQDD 4M8VA 4TULH 4DK3A 1IAIL 1J8RA 2IWEA 3T4YA 2PPEA 1NEZB 5GJSL 3T6QC 1ED3A 3AQZA 2A9DA 4QXUH 3PQYB 3HZVA 2DWYA 3MUJA 5CLZA 1EH9A 2IWFA 1WFUA 2P45B 1JZJA 4MDRA 3ZO9A 3OHXA 1I1AC 1EPFA 5HYEA 4HUVA 2XUWA 2X70B 2RH0A 3WO3B 3EJPA 3HIZA 4G9DB 4UT9H 5K93A 1YAIA 3P4MA 2QSCL 2NNCA 4OF7A 4BFKA 4BSWB 1J8HE 1PLAA 1QSEE 2A9MH 3MLZL 3S98A 5IQ9A 5E5UB 3QIUD 2XN9B 3BAYA 4PJHF 1T0MB 5LKNA 3KXFD 1IGYA 2D0HA 2CDEB 3ZHKA 5A3ID 2MFNA 1N6UA 2EE6A 3HS0A 5D7EA 5H94B 4ZMNA 2H9GA 4JDTL 5F96H 4DETA 4YAQB 5E5LA 1HWWA 2IWGA 3I50H 4F7EB 2IXQA 1OAJA 2VLKD 1AZUA 4J6IA 4CAGA 5I2IB 1YC8A 2YD4A 1P5UB 4KKQA 4M5YL 1PD0A 3W1ZA 1G9NH 3TFKD 2AQ1A 3L45A 4JJOA 3SDAA 2BS71 4OIAA 1E3FA 1QEWB 3MREA 1M1SA 1RUMH 1F13A 1CT8A 1WBYA 4DKEH 2VRAA 2WAQA 3GSUB 4X2UA 2X4NA 1F97A 3SPJA 4ZMTA 1N18A 3O2VH 4FMKA 4HLJA 1S9XB 1IKOP 1B9KA 2XA3A 2XETA 5T1DL 43C9B 1UD2A 1VAHA 1UZ6F 1WRFA 5F8RC 1IGFH 1A25A 2WXRA 4I18A 1XXDC 3C6EA 4JFYA 3WMQA 3NH7H 4N0RA 1BFVH 1CZ8L 4OB5H 5IHHA 4G42A 5B4MD 4MMZA 2NY0C 2ZAHA 4Z7QF 2HJLB 4Z3TA 4M4RB 4FQXB 2IO5A 3WN5B 1HHHA 4J3BA 4DKFL 3WAJA 2WANA 3PQYD 2R4RH 1SNRA 1RJZB 1Y0LB 3C2AH 5IEKB 2OW6A 3NESA 4IKJA 2BSTB 3ULVD 1NBQA 1RUQH 4WO4A 3NCMA 3DO7A 4Z3JA 4RMRA 35C8L 5HPMA 1UENA 3RDTA 4L9LA 4ENZA 3BUIA 3RY4A 1Z66A 3BKCH 4HPOH 1A02N 3OAUH 4TQ8A 2BIQA 5JXAH 2WO3B 1UH4A 1AHWA 1QTYT 3EFOB 4HS3B 3IGLA 3WD5L 3K4AA 4C4UA 2JELL 4Y5VA 3OF6A 2HRGA 5GJSH 4HFWA 1T21B 1IGTB 3S8FB 1FCGA 2VDML 1BMGA 3P4NB 4M7ZC 3TZVD 3WJMB 1NCJA 1KTDB 3LIUA 2WLLB 1O7DC 4MD4A 3NPSC 3TN0D 5LGKA 2ZUTA 1UT9A 3EJCA 3VH8G 2X6VA 1U8LA 2FO4B 2KZKA 1UXSB 2G3ZA 4DOHE 1L3NA 1RU9H 1OCZB 4XNMA 2ZOOA 1IAMA 5F6IC 5GIRB 4FNSA 2C7UB 1PKQA 5K9JL 4NQXB 1RZGB 1IC5H 1BZOA 1XIWB 4N2BA 2N3JA 1B4LA 1MCLA 2R0LL 2KL6A 4XXDA 1FVDB 3HPLB 2PR4H 3DUSB 2I07A 5I0DA 5MEOB 3RFZB 4Z7VF 4L3EE 2KUTA 2ZF9A 3CVIL 3BHBA 2E7HA 2MQGA 3C09B 4Y4KB 4KKAD 5DRWB 1DVTA 4DVRH 1PCSA 3HAEG 4J3TA 5D93B 4JFOB 3K2MC 3KWXA 3VNZA 4M62L 4MB5A 4UV4H 4XT1C 3DPBB 4K3DL 3GXFA 5C97A 4D0BB 5LXGH 3O9WC 3AB0B 3O2DH 1M3IA 4YX2H 2R0ZH 4XMXA 1ETA1 4WEMB 1Z32X 4ZMYA 5IFHL 3L5WA 3MV9E 3D7PA 4JM2B 4XH2A 1SVCP 2P48B 1XCWA 2VL5A 4W9CC 1QLFA 4S0HA 1AY1L 4IU3B 1MFEH 5D7IF 4FHJA 4JRXE 2QVKA 4LU5L 4POZD 4X4ME 2FIKB 3JYCA 4FTVD 2VITA 4JFSA 2YEZB 1R3HA 3N40P 3QQ3B 5DVPA 3TTSA 5IJBC 1KENH 1IGFL 2OYLA 3NSJA 2VDQB 1J1PH 5GSVA 4CW1B 1QLFB 3FUKA 1ORSB 2X6UA 3HG1A 4P5RA 3RI5F 1MFMA 4TYUA 4XGZA 4HCIA 5FGCB 1T0OA 4YVUA 3QPXH 4XTRC 3RIAF 3H3KA 1BQHB 5I30H 4P4KB 2GSGA 3V79C 4PJBF 2PTTB 2FWSA 4OFYD 2CO3A 2Z31D 2NMSA 1EEZB 3G7TA 5J13B 1F11A 4LNRA 3S7GA 5B3JF 4HIJB 2KLRA 3ARED 1I8KA 1USZA 2BNRE 3RL1A 4ZG1A 3FBQA 3IDYB 4GKNA 2JJTA 4XP9L 2ZCLL 2WQ8A 3A5VA 3FFCB 1ZXQA 3EG9A 4FHBD 1G9NC 3QZNA 3MLVH 4LBEB 3F64A 2J2ZA 3VTAA 4R8WL 1XGPA 4ZO7A 1DQIA 5JHDB 3MRPB 4N8CH 4M7JH 1V7NL 2W88A 2WXPA 3VO0A 1XTLA 4NKOA 3VXUE 4DKDC 3KPPA 1Z6JT 2XWZA 1IM9B 2GJ6D 5BMFL 1KCSL 1A7RL 5GGRB 1E4JA 2AGJH 3BC9A 2BHYA 3VFVA 3QEHA 3OR7B 2HFGH 2LW3A 1A3RH 3ZZQA 1JRHH 2DEXX 2K9FB 5C08A 1M1XA 1FI8C 2CJTA 5FUOH 1IGTA 4HA1A 4UV7H 4YNYB 4F9PA 1ACXA 1HKLL 2IOOA 4P2QA 5LBSH 3MLTB 4LCWA 1JSYA 4WY7H 4TUOA 3PAUA 3CZUB 5HYQA 2WZ0A 3QWNA 2OR9H 1T22A 2WXLA 4MNQA 3MRLA 3MRHB 1KIPB 2VKWA 4LSUL 5AW1B 2BK8A 3KJ4B 1KELL 4W81A 5DEFB 1HH9B 5JIIA 1AE6L 2IOIA 2WLJA 5ESVA 3OWEA 1G0DA 2FUQA 3RZCB 3LB6C 4FQIL 4K3DH 1YUKB 4YXHL 1VRSA 1KPRB 4N0YL 3O2DL 1XWVA 4AEEA 3CDZB 1MCIA 1D5XA 3CIAA 1JZ4A 2P9RA 5FGRA 3GSNL 1PKOA 4I0PB 5FR3A 1LEIB 5BZXA 1DQJB 4ODSL 4LVOC 4X80L 3ZE1B 1GXEA 5KS9E 1ID5I 3WIHH 2QKIB 4F15C 3O0RL 1UWEH 2F68X 4XPBH 4DEUA 3LQAC 4KK6C 5DZNA 1C16B 4WJG3 3ZMEA 3R06A 4ORGB 4PRDA 2IOMA 4RFEB 3A47A 3IKCB 4PJIE 5DHDA 4CN6A 2P24A 3LH2L 1F1AA 1J9RA 1MRFH 1MZZA 3GSXA 3WUWA 1V5JA 4AKQA 2I9TB 1XF5B 5BRZE 4K15A 1TFPA 1QPXA 3VQ1C 1Q90A 1AS6A 5BUAA 1OY3B 3ZY7A 4TNWK 4ZUWA 1BLNB 1EK3A 3CSYA 2R0KH 2YHGA 2FIKA 3H3PL 4HJ0D 5D70L 3VI3E 1VKXA 3CU7A 3OKYA 3VMPA 1BM3L 5CEZE 4KJYB 4S10A 2R2HA 5DD5L 1XH3B 2ED8A 4U2ZA 3AITA 1QLEL 2I5YL 3VG9C 3ZKND 3VD4A 5DS8A 1LILA 5KANI 4L1DA 5GS0D 5FXCH 3BFOA 1UH3A 2A74A 3T0EE 3KBEA 5CEZL 3MC0A 1N4XL 1X4ZA 1G6RB 3VFOB 1P4BL 3RE0A 4FYSA 1MW3A 5TF1H 3V4PB 3ZE0B 3GMNA 5HPMB 2X42A 3FU7B 4LSTH 1NBZA 4UT9L 4XVJH 5HYFA 5C0BA 4Y19E 2OMVB 2QV2A 2A9ML 2RD0A 3MLZH 3NSDA 1LLAA 4P57A 3QUZC 2LR4A 3EJYD 3GHEL 5EBWB 5C08E 2AJZA 2XY2A 4HH8A 5ID0B 2XQYK 2A6IA 3BSZH 5JNYB 2YD9A 4CUCA 1SHXA 5E6SB 3PUCA 1A6TA 3SCMA 4JDTH 5F96L 3QEGL 5TE6L 3NJJA 4EN3B 3P9WB 2VQ1A 2VXSL 1T7VA 1AP2B 2VO5A 5AYUH 5FO7A 5JDSA 3QZLA 1A14H 2P5EB 5KYUA 3WKYA 3MRKB 2X3AA 4GSDH 2K8MA 3BN9D 1IQWH 2YAOA 2HT4C 1KTDA 3ILQD 5GQBA 3WY3A 4KZDH 3SBPA 3WNJA 1PU0A 4C83A 3E9TA 1O9VA 4FL4C 4Y9BA 1P84K 2BCMA 3GKZA 3CZFB 5EBMA 4LP8A 3SGKA 4I9XA 1A9BA 3NZHH 3MGTB 4LKXB 3HPJA 4ONFH 4QWWD 2VSDA 3NJXA 1OGAE 3GGWB 4ES8A 2YXFA 4O00A 1E8ZA 5DF0A 2A74C 3FH7A 1CGWA 4C54A 2VJXA 4OCRL 2Z4TA 2Y3AA 4QGTA 5I1IH 1F6FB 3LKOA 2IV9A 1DBJH 2F74A 2E7DA 4XMLL 1NSNH 3MJ9H 3GBML 3VE0B 3PXHA 4MS6A 1PIGA 1ZS2A 4JG1H 4LQFH 4TNFA 3I9IA 1MG3C 2FGWH 3CFMA 3HC0B 4TTDC 3VRJA 3TBYA 4JRYB 3TO2B 1QI4A 4E41E 4Q9RH 5MENE 5GZNA 3GNMH 3CDZA 1KTKE 4R26H 4Y5YA 3REVB 1G7PA 2COVD 2XZQH 3W0WA 3WNPA 4QXVA 2FEEL 3DHUA 3F7QA 4S1DC 2YFNA 2R9HD 3PWPE 5EFIA 5L0QC 5F9JB 2NUTB 3CSBA 1CK0H 1FL6B 3FMGH 2Q7YA 4GB9A 4TVPL 5D70H 3T2PA 3OZ9L 4DP1X 4FFTA 2VDPB 2GITB 3OKMB 3KM2A 5KANG 2X4NB 3MJ8A 2EKJA 1XBRA 3PHOB 3IJYA 1ZVSB 1J5CA 4YWGH 1BF2A 1BM7A 1E9QA 2I9LA 1NCUA 2QZ5A 2O1AA 1GY2A 1YQVL 1JZ6A 4HQQH 1BPVA 5TE7L 2NNFA 3IAGC 3IF1B 2PPAA 4EKJA 1BAGA 2AV7A 3B83A 2GEEA 4BYHA 4FZEL 5MI0B 4EI5B 4QXWA 1Q9WB 3F3HA 1E8WA 4UQ3B 1BQSA 2WIMA 1ESOA 4UQIM 2ZP8A 5EBLB 4AH2B 1JZFA 4NHUB 2NXZD 1IT9L 2GBVA 3N04A 5E24E 3CN3A 4JO1H 3GPSA 4N8VB 4KU1A 4LSSH 4P9HH 3GLZA 4S1QH 1P9MA 4TQEL 1FNGA 4O51A 1VESA 1JPTL 4KROC 4XN1A 4N90D 4PJDA 5DC4B 4ZQKB 1HCZA 3WS6A 1QPPA 5TGBA 4CILA 1NFDF 4F8PA 4BSWA 2DWDB 4OGAD 3IXTA 2MOQA 5DJXB 3MNWB 1IL1B 2A6KA 4C4BA 2LTQC 3EFDH 3FYIB 1BD2A 2MMXA 4UYPA 2FJHB 4Q4IA 1JF6A 5TQ0H 4ZTPL 1P7BA 5TF0A 3ZTEA 3OGCA 5BV7H 4RRPA 3FO2B 2PO6D 5FWRA 2R1WB 4X6EA 1BMWA 4P5TC 4LT7A 4Q97A 4OKDA 1CE1H 4GG8A 5CKGA 5I6KA 3LYRA 3HC4L 2H6UA 4XPGL 4ODTH 2QKSA 4E5XA 3NJFA 4XGZB 5CZXD 2VDOB 4RFOH 3FN0L 3KPSD 2ID5A 4AITA 4ZMQA 4U31A 1U9KA 1WZMA 2OR8A 2I60L 4FQXD 4TRPH 1FHNA 4HOZA 4JHWH 5LJYH 3ZIMA 3QDGE 1SLXA 3MBED 4PJFB 5ESAA 1OGTA 4JM4H 5D6CA 3W39B 1WTGT 3MA7A 3PV6B 2Q3ZA 4KPHL 2CMRL 2R83A 2OM5A 5FKAB 4QXTA 3F84A 2ESVD 3CSGA 5ENWB 3EIFA 2CRIA 3UP6A 1RUPH 2GI7A 2VJ8A 3G3LA 1OSPL 1MHHB 2F54D 1V54B 1WO2A 1ZS8B 1ASPA 4QF1B 2V7HB 1EAPB 1ZHLA 3FMGL 2FBJL 1T89A 5EWIL 2Z0UA 1ZTXL 3TCXA 5FYLE 4RX4D 4QT5B 5B1JA 1QUNA 4G8GB 3QZWG 4F7MB 4PD4J 1A7QL 3D30A 2XXFA 3INUH 3MZGB 2DQCH 4PJ5D 1UURA 4X7EC 25C8H 2Y6SC 1S9VA 4Y8DC 4GUQA 1CTMA 3FZUD 3H53A 2X88A 1BVNT 3JUZA 4NPJA 5CGYD 4OCWH 1J0KA 1YEGH 1S9YA 5BZZA 3HJEA 5KVGH 4N5ED 2J56A 2O6DA 3K5SA 2X4QB 1U6AL 4X7TA 3BDYH 1LNUA 3HR5A 3VXPA 2V37A 1HHJB 2V3EA 3PQYE 5DWUL 4NM8L 4FCHA 5GZOD 3AUVA 4KWUA 2YWYA 3U82B 2NX5E 4GIAA 3BUPA 2XZCL 3FT0A 3L17A 1INQB 3IF1A 4FXGB 5EN3A 3X1NA 4AT6B 4BUGA 5LQBH 4FXTA 1TF4A 4LXFA 2O61A 3HAEH 4AI7A 3Q13A 5JO5B 1UEMA 1UD3A 3NFNB 5I8KL 2DQGH 1SJXA 3CLEL 3ECBB 3FL7A 5CZRA 2F1AA 1BGXL 4JFQA 4QHPA 3L81A 3PHQB 4LOEA 2CKNA 4AH2A 3QCUH 3QHZH 4KZ0A 4AV5A 2F9BT 3Q48A 4QYOB 3MRMB 1EUTA 1YC7A 5CU9A 1MAJA 2C1OA 5JHDA 5TGBB 1N5AB 2A83B 3HZYB 4Q6IA 1SDYA 1YEEL 1KCRH 3GMQB 2FO1A 3KS0J 5MHSD 4AV0A 4HMDA 5IV2B 2E7BA 3N2JA 3PU7A 1PJ9A 3MA9L 4UYQA 3S88L 2W0KA 4X98A 4DWHA 5L2KA 1TQCB 2R2BA 4NN6C 4PJBB 4L0YA 2RJMA 5TDPA 3BO8B 4QR7A 5I17B 2DTMH 2Y4SA 4NQDA 1F3JB 4GXFA 5T1DH 3UBXI 1GC1L 2EXSA 5E2JA 3NDYE 1HEJC 3LN4A 4ELMF 2J20A 4HUXB 5JZ7C 1F4HA 2Z35B 2FQDA 3FOMA 5HJBA 4J3OF 3VFNA 2ARJQ 4JM4L 4QTIL 4F9LA 4AEIH 4F33A 2Y7SA 1UQSA 2NQDA 1KG0A 5CSZA 1MIML 3OR6B 1MCRA 1UCTA 3PWUA 1NGPH 1IEHA 1E8YA 3GSOB 3VXQB 5INCB 1OE1A 5KUKA 2HVBA 4NZUL 3L4WA 3U2SA 3H3BC 3Q1SL 4YE0A 3TN0A 3GB7A 3VM5A 4JLRB 4QY8A 3BISA 1ZTXH 1U95A 1WE5A 2YEQA 1S7RA 2F7QA 3W82A 1GHFH 4MJ4A 5BXFB 4S0SD 3D2UA 5HSFA 4FTVE 5A2IH 4YHZH 4LOVA 4IW4C 4OSUH 2FX7L 4D9RE 4NZRH 1DQLH 2GJ6B 4WFFD 1UWGH 4M5SA 4UT6H 2DMCA 1KGCE 1IBGL 1IV8A 3SZ6A 4MQXC 1JZIA 2H0PA 3RILA 2BSCA 4J3OG 2VXTL 4NQEE 1QHPA 5AKTA 1OM3L 3WU1A 4FI8A 4P3WA 2EE0A 4NZDA 4FTVB 2F74B 4F27A 3NSXA 1NMBL 1GC1C 4XOEA 1CU4H 3BUDA 4FP8H 1ZA3A 3HAEB 1YNTF 4XO9A 3F7VA 1IMHC 2VDNH 1GS7A 3DO3A 1TEYA 3V0AC 3B9KC 4NM4L 1IE5A 1MVUA 2V17L 4OLXH 4P4KD 3WAKA 3N42B 5HYJE 2WCPA 1FV1A 1KIUA 4J3OH 4AVKA 4Q6IC 3O8XB 4AOFA 2UYLA 3GJFB 3LXAA 1RK7A 5IG7B 1K6QH 5KBDA 4LLVB 4OZ4A 3TZVB 4X0KB 4PRAB 1VF5C 4GSDL 3V95A 1J1OH 5DUML 2X41A 4F57H 3TEYA 2NTFB 1MCPL 4I9WE 3FFCD 2ATPA 1QR4A 3QIUA 4LHUD 5DRZB 4NNPH 4NP9A 4KOBA 3UBXG 2D0FA 2ZNXA 4GRWF 3EJZC 3L3DB 1E4HA 1CDUA 4YL9A 3APCA 4QRQB 1HCYA 2WINA 3MA9H 3IEAA 4LSQL 3S88H 4LCUB 4N0CC 5F0MB 5C2BH 5HI5C 5D72L 2L7UA 3M6DA 1SXZA 4JDVA 4WHYG 1T1YA 1KN2H 1IAOB 1XR8B 3RTQD 4L37B 2G3XA 5F72S 4YJZL 4MNQD 1TENA 2GCYA 1Q38A 4KTEL 2KZBA 4GMSH 2G5RA 1AJ7L 3DC0A 1MELA 3WHXA 1Z5HA 3S9DB 3KPSA 1NFKA 4PJDF 3QEQA 3FRUB 4TPRL 4F1SA 3BEWA 4HWEH 2FRGP 2YEVB 5HI4D 3MJ6A 5ANHA 4CC0A 4R4NC 3QUYB 4Y1AE 5C0NC 2P80A 2CDGB 2QGCA 1BG1A 3T6WA 1HOEA 1E5ZA 3BCDA 5F7AA 2EDEA 3P9MB 5DURB 3TEUA 4PG9B 2LOEA 4GI9A 3WCYA 5IHWA 1MAML 3MCKB 1TSHA 4FX5A 1ET5A 1UG9A 3GB7B 3VGBA 5CHNA 3BT0A 3PWNA 5G2NA 3LXBA 3EJQA 2VNCA 3QUXB 5DHVA 4YHYB 5IR1B 1GZQB 2NXZC 1D7CA 3PWUB 2JKRM 3IU3A 2ISDA 1IAIH 4QRFA 5FM5M 3KPQB 4HKXB 1UQSB 4JFDD 4YHML 3UJTH 1U3HA 5C0CA 2GC7C 4P5SA 1FF5A 3X1EA 3UMNA 2IWKA 3FSWA 4ZXBD 2H45A 2JIXD 3ZQWA 2EEDA 1QA9A 4KKLD 5HJGA 3ZL1A 1FO0L 4XCCL 4KHTH 3S36H 3WFDL 2VZSA 3QHTC 1ETZB 2X1XR 4LHUB 4JFTA 3RGVA 4M56A 3Q5YA 2Y1VA 1E6JH 1VCAA 5D1QD 1BSIA 4NJAL 4K5MA 4KNSA 1WD9A 5E94B 3RGHA 1A7NL 4IRZH 4ENED 1MF2H 3S5LG 1QRNA 4B9KC 1EX0A 1JNHB 4X5XB 3H9ZA 1EEYA 3CN1A 1OQXA 2NY3C 3N06B 4FQLL 3KPRE 4L9DA 1FZKB 4YDVB 5EU6B 3UTZB 4CMMA 3WIAA 4JO8A 4TLTA 4UTBL 2X9YA 1UXWA 4NS0A 4E0RB 5EHFA 1BREA 1S8DB 5BZDB 3BESR 3ZDZE 5I16B 3PGCB 2FWLB 3LRGA 2YPKB 5IWLA 1LD9A 1XD0A 1G43A 3OKLA 4U1JA 1K4DB 5FUZH 1YNKH 4MCMA 1IILE 2X10A 4GFTB 5C6PB 3RX5A 1KTLA 3LPFA 4PJIB 4UNTA 5EZJB 1WWBX 4K7PY 1S7TA 4ZNEE 3K81A 4HUKB 1MCHA 2XZZA 4U1GC 3BOVA 4B95C 3EFFA 4X6BA 3MUGB 2PPCA 3P4OB 2XPGA 1D5IL 2EDXA 5DA0B 3NRPA 4Z3IA 3U9UA 2W9LA 4JQIL 3D06A 4L4JA 4PJEE 3FT3A 4N5UA 2I60H 1K2DA 3G6DH 1WIUA 2KZ1B 2B14A 1MHHA 3M88A 1BZ8A 4BQBA 2W07A 3EYQD 5HYJA 3E7JA 1HQRA 4XWOC 5HHQA 5ITBH 4D94A 4R97C 3MOAH 2BSRA 4G7QB 3DX4A 5IHZB 2BSRB 3RWJB 5ICYB 4GAYA 1KJ2H 3GSXB 4AC2A 2WQVA 1EHLL 1BF5A 1T3FB 5CLXA 4PJAE 3O3UN 2JVUA 2JKTM 5JHMA 3DPBA 1OSPH 2IDSA 3BCFA 3BP6A 2P7TA 2AK4B 4JRWA 4Y16C 2Q8AH 1YYCA 4D0DB 5BRZB 3L1OL 5EEXA 3NJIA 5CD3A 2FJSA 3OKKA 1PNDA 4A7GF 1E5AA 3BKCL 4UUJB 2LE9A 4HOMA 4F58L 4C56B 1J0ZA 5ACMA 3L1EA 3C6LC 2X9ZA 3DRQA 3EO9H 4PAZA 1N12A 2EIDA 1ORQB 1RD6A 3TASA 4N1HB 3A4AA 3TVMD 4YHMH 2ZOWA 4LGSB 1UACL 3G5VB 2BERA 4M6OH 4YSOA 4J4PC 1GZPA 5GS0C 4R0LA 2C3VB 2FO4A 2FECL 4GW1B 3MRHA 1BZ9A 1RFDH 4JUSA 4JZJA 5DSCB 4LEOA 1GW6A 1RU9L 2V9UA 3D8MA 1MFBL 5DO2C 3EO0A 4FFYH 3KGUA 2FCBA 4QCIB 4Y4FC 4CC4A 1E6JL 3ARTA 3DVGB 4XC1H 2X6AA 3T65A 1QFWH 1JNHA 1E43A 1MWAH 1WHPA 4HSAC 1C8QA 4JO2L 2DJ4A 3LH9A 4OCYL 4B3VA 4E9RA 3LEYH 2WBWB 2XTJE 1ONQA 3SE4C 5C3LD 5I1HL 1OPGH 2VXSH 3GD1C 3QEHB 5E2WL 1YMME 4Y4FA 4YHLH 5HGHA 2DLIA 4LLAA 3S37H 2GAZB 3GK8H 3SOTA 4DVRL 2A6KB 5L6YL 2W59A 5B3JE 3WG7B 4D9RD 5JORB 1PAZA 4MLIA 3FFOA 3ATAA 1T2QL 2ZYSA 3NQKA 5JUEL 3SKOA 4IOIA 4AG4H 4DTGL 1M05B 4H0GA 5F7UA 3ZRSA 1IAKA 3HG4A 3SDCD 4ONFL 4BFFA 3UAEA 2DMKA 4AL8H 4TL4A 4CKQA 3BRGC 4I4WA 2H6OA 1DO5A 2D2OA 1J10A 2K70A 3PWNB 5AL8A 4C59B 4IHOA 4IRSB 3WN6A 5T33L 1UXSA 2AEPL 2QGBA 3DOHA 4W9JC 4F3FA 4S1SL 3LHAA 1P9MC 3SE8L 3RIFK 3TGXA 3IE9A 1AGEB 2X4RB 5EIVA 5J89A 3VH8B 5C9JA 1VFOA 3GUFA 4WHDA 4AJYV 1AZNA 2WWOA 4Z0XB 3E38A 1OP5K 1KN4H 4GKOA 3ROOA 3VXMB 1A5FH 2Z93B 5F6HJ 4IJTA 4BK5A 4BQ8A 3L3HB 2B4CC 2YZ1A 3E80A 3I6LD 2ADIB 4JRYA 3FB6A 5F1NA 3CPLA 5F0PB 3LKRA 5CZKA 3HG1D 5MENA 1QO3A 5KSUB 1OIOA 4RCAA 4PRIB 1TYEB 4E9WA 1KGYE 1FVCA 1CF8L 3F00A 2Q8AL 4Y4HB 3VXME 2IEPA 4GKLA 4Y88A 1J8HA 1QSEA 2K7PA 4GMTH 1X7QA 2DIAA 4YK4C 3UDWC 1NC2B 1DBKH 3HHMA 3OZ9H 1NC2A 4BM7A 1OZTG 1ND0A 3OJDB 5IKCA 4MNGA 4M93C 1TETL 4Y4HA 4C47A 5I66A 1B9ZA 1L9PA 1XZWA 4EUPG 4HGWB 3NZSA 3TIEA 4QRUB 1TU2B 2BY0A 1HOCA 5B39G 2CDEA 1L9RA 3T8XB 4PGEB 3AMKA 3QCTH 5IJCC 5LGHL 1C1EH 1ZEAL 2XBDA 4FYRA 1V7NH 3QEQB 4ONGL 1HS6A 3KPSB 4LHQB 5DHVH 3J2PA 1PTZA 4KO9A 3D6GA 2PLTA 4RAVB 1PLCA 1U58B 4QRRD 5A6LA 2EE9A 1E5UI 4L0ZA 1AS8A 2VISA 1H5BC 2SEBA 1MCBA 1S9XA 1KT2A 4B50A 3KDPB 4BFRA 1OWWA 2H5UA 5LUMA 5EIIA 2YMOA 2B4CL 2CO7B 5HTSA 3PDOB 5I1GL 5DD1H 3SDCB 3MMEB 3BKJL 4XI5C 4B41A 1TQBC 1OTTC 4JFXB 4BK5C 5EBMB 5EIIB 2A4CA 3TBTA 3MV8E 4UTAH 3V6FA 1HH6B 2YXWA 4F7TA 3KDMA 1I9IL 4ABVA 5KSAD 4ALAH 3B2XA 4BKSC 2GAZA 3DDGA 4K07A 3NBNA 2ZONA 3ECUA 3DDFA 1IZKA 3L16A 4N0UE 1T6WA 2WLNA 2VLRD 1T2QH 1ZVYA 4PVLA 1N59B 5DQDL 1FFOB 5GRWA 3MV8B 3RNQB 3UTPD 1AQ8A 2XJLA 1MCOL 4PYHA 4ZOCA 3QULA 4JCLA 1TNNA 4DAGL 3U0WL 1BG9A 4HS3A 3LCYA 4IJ3C 4KO6A 4CNIB 4IBTA 1YPZF 1ZY9A 4X6DE 1OD7A 1U93B 2QFPA 3M1CA 2ICEC 4I5BA 2YK1L 4MAUL 5FF6B 1BIHA 5GGVL 3BPOC 1JHLL 3F6IA 5AEAA 3FK3A 5CINH 1UATA 4GIPD 1KNOB 4KH9A 2OMYA 4LRIC 4AYFB 5L88H 4OB5L 3H1ZA 3SJVB 3KWTA 1MFNA 1MRDH 4NQUA 1AG0A 3AY2A 1JK9A 2C9SA 1BW8A 3QDGB 4GRWH 4QD2E 2I9TA 3D39B 1TJHL 3HMXH 1TJIH 4Z8FH 3UBHA 3V9CA 3D3VB 2OFQA 3FTYA 3CFQA 1RULL 3ZDXF 1UKQA 4WENB 3V55A 4L4VB 4N6RB 1YEFH 3U1QA 1XHHA 4J3SA 5J9PA 2WLMA 4KNUA 3SJVE 2QQNH 4O2FB 2X3BA 3GSQB 4AGOA 1QKZH 1PZUB 4F3FB 4OI8A 3GMRB 2X2UA 4DEWA 3AT8A 5ETUB 1BZQK 2NYZA 2XU9A 2ZSWB 3VXNA 5KSBB 1B0WA 4EMZA 2IADA 1JGUH 5KS9A 4DUXA 4U4BA 4FNLH 5GS2H 1L5GB 3LRKA 4YDJA 1D5XB 4I18C 1XGRA 3CBKB 4UM9A 3LRLA 3T8XA 3HZYA 3L54A 2W38A 4OH2A 3FSOA 5IEHA 3GMPA 1MHCB 2N7BA 1CGSH 3QZOA 3DSFH 2W8CA 2VCOA 2P5WE 2VDMH 2WXMA 3IDIA 3WXVL 4ZFOL 3MRMA 1N4XH 1SOKA 2JNZA 4MNGB 1OT4A 1UWFA 1XBDA 3NRQA 4MA8L 2ZX6A 2BY1A 1SLVA 5H8DA 1F3JA 3A67H 3RA7H 5I74C 4PPTA 3WFDH 5ITFB 1UJ3A 1L6PA 4MAYB 4A7GA 5J11C 5AG8A 5TFSH 5DQ9A 3L95A 4IKLA 4NO5B 1L6ZA 4M3JA 1KWGA 4I0PA 1WBZA 1M7IA 2FATH 1AKJA 1SYVB 1QFOA 2OJZH 3IFOA 1IBHA 4NFCA 5E08H 3ARGC 3UTSD 3UTTA 3KCPB 3JVGA 5F7HA 2LLNA 1Z9MA 2HN7B 5GGTH 2WP3O 4ANKA 1A7PH 1UADC 5K1NA 5T1KD 1FO0B 2VRQA 4RVBA 2VM9A 2GBTA 2FL5A 1JOIA 1HVXA 3HS0C 1ZHNB 2CLVA 5BRQA 1VJSA 3VX1A 5KVMC 5TPWL 4G8IB 5IFJB 1WAAA 2J1YA 1G4RA 4KQ4L 4R0LB 2NY0D 4U3XA 5HI4C 3ZHNA 1ZIAA 1CLCA 1ET7A 2W92A 4ZX6A 5E8OB 3R18A 5KYWB 3C6SA 3ARFB 1HHKB 4G9FA 3PNWB 2G0KA 1GZHC 4WTQA 3G5XB 1HYSD 4ZFFB 2PF6A 1YEEH 5T3XD 1F4WH 1JNNH 5H37A 5IBTH 3V52L 1A1OB 1R5IB 4Z7WE 3T2NH 1NCHA 5LVEA 2N7SA 3ZYZA 3DBXA 1E6OH 2OMUA 1YMMA 5A2BA 2VN4A 2OSLB 3WL9A 3JT0A 2VZOA 4WIQA 5GGVH 4HF5H 2I26N 1I8IB 2ADFL 3QBTB 4N86A 4R4BB 1TYJA 3CC1A 5DJAB 4CC1A 4NRZA 4M5ZL 3NJLA 3AUWB 3MRDB 4NO0A 5EO9A 4NKOB 3VXSA 4Z7NE 4A6YB 2F8IA 3TYFA 1T6VN 1G0YR 4KUZH 1FNEA 1ILUA 1QFHA 3LRHA 5T1LD 5EF0A 3ZR6A 4DQOL 1T4KB 5KVFL 5HDQL 5DJ8B 5H37H 1GS8A 4LZKA 4FG6C 1CQYA 4OIIL 4QMEA 2WVUA 5FV1L 3FQNA 2B9AA 4JL2A 4FLOA 3UACA 3X3GH 1YG9A 3T5WA 4Z0BH 3QNYB 4AQEB 4P23B 3RAJH 3ZHFA 1JTOA 4UT6A 2ZWKA 3N44F 2IIJA 4TULL 4G1EB 4Q6KA 3VFRB 4OTXL 3VW3L 4GSXA 5AZUA 2J71A 5IHUH 5KVDE 3D39A 3GYRA 5TE7H 5DUPH 1KJVA 1Q1JL 4KK9D 3MCYA 3DUUB 4R6UA 2W94A 5HYJB 3T3ME 5T3XE 4M6OL 3GLDA 4JPKH 5GS0H 4A63A 1A7OL 2ZX8A 4PJ8A 1KCSH 1LWJA 5F7FA 3BH4A 1YRKA 1HQ4A 3JQOB 4S11A 1OQOA 2P43B 4WI2A 5JA9A 5I18H 1SUHA 5IBLD 5DLML 2VDQL 4FNPA 4NUMA 2H2PD 2XZAL 2H3NA 3I6LE 3IK2A 3SE6A 1D7BA 2H1LM 2QPEB 4JM2A 4TQEH 2FATL 3MBWB 5HGDB 4GRMA 4CNIA 2EDJA 4NM4H 5E9NA 3D52A 4JGNA 4ATWA 2VMEA 5D96B 2AI0L 5LBVA 4WW2B 2G2PA 5FHBL 1CFSB 2LU7A 4JANB 3ZTCC 4OUUA 3ULVL 3A6BL 4K3GA 3RGVB 1OAUH 4DUVA 4KY1H 3S37L 4YHLL 2JLPA 4KHXL 5CAYB 1E4XH 2IPUK 3AG1B 4TOYL 5L8KB 5BZDA 1Y1UA 5I16A 3B9KA 1HFUA 3QC6X 2A99A 3LZNA 3FSVA 1DVFB 2WSDA 1SEQL 1FZKA 1P1ZB 4YDVA 1ZWIB 5F9OH 4KNTA 4CSZA 3INOA 2NY4B 1RZKH 1SOQA 3VD0A 1N8OE 1MVUB 1KBGL 4EDWH 4HEPG 7FABL 1ZT7B 3O6LH 1FNSH 1UB6A 1MIEH 5KVGE 4LOUC 1DTUA 4AQ1B 1HINL 4OZFB 1CVSC 1K4CB 4A6YH 2H2SD 1PY4A 4KJPD 2JCWA 3TL5A 1G0XA 1A6ZA 3N0AA 4HP5A 1X9RA 3BQUD 5JHDE 5BW7C 2HFFB 2WLIB 5AAMA 4XBEL 3NCJH 1OAXH 1UVQA 3MRQB 2VWEE 4K3EL 4ANVA 3OMAB 3T0AA 2B1AH 4ZOAA 1DJGA 4LLUA 2XQBL 5KYYB 5FEBA 5IB3A 3E8UL 1QSFE 3UAJD 3DJ9A 4BA8A 3AAZA 5ITFA 4KXZI 4UU9A 2PYFB 1UTDA 4L1SA 1MHEB 5LDUA 2DIEA 1F4XL 1KXTA 1QASA 3PJNA 5F21B 3ORJA 3SPVB 1MCWW 3ARUA 3VFSB 1LO5A 1B3IA 2EDKA 4WJ5B 5KOVC 4WO4B 3IMWA 3ZL4H 3UTQB 2O5YL 2MOVA 1MDAA 3L4CA 4FQ2L 2YPLD 5EU3A 1RZKC 2G9HA 3JV4A 5HYSA 4LGPB 3JTBA 3FT2A 4KRPC 3WFEL 3MFGB 4XOAA 5K59E 3BUYA 2ZNWA 5TK4A 4WI3A 4F33B 1W15A 2R1YB 2DEWX 4UAOB 5JPMC 5KYXA 4OV5A 1Y18A 4XCYB 3ARPA 3I3BA 2LABA 4X99B 3DXAA 3MR9B 2J6WA 3B5GA 3FFDB 3MRKA 4M1DH 1BYOA 4PW3A 2DLFH 3T4AC 4U2YA 5E4EB 1AP2A 2ROYA 4N9GB 4ZW3A 3STZB 4PW4A 2IMNA 2CIIB 2DQFB 4P46B 4EXPX 2B4CH 2FK9A 4P49A 3FQ2A 4H88H 5LQBL 5H37G 1BZ7A 4U1MA 4I13B 4CC4C 4Z7UB 1U8MB 5JOPD 5KS9F 12E8H 2P28B 3IDMB 2BO0A 3CZFA 3LAFA 2KT6A 3V4UH 1FQ9C 3LH8A 2K8QA 4XCFL 3FQYA 4YDKL 3ZJAA 2X4TB 3KVQA 1ZA3B 2AAAA 3HAEA 1M7DA 1AGDB 4FTDA 4FFZL 4PQXA 4XTRD 1E4XL 1T20A 1QSFD 1AANA 1E4WL 1SJVA 2CKBB 4LMQI 3VXTA 4Z7UE 1XCXA 2GG1A 4RGND 3PFQA 1ZLDA 3KWWB 4MSWA 1TPXB 4NOBA 15C8L 1B0RA 1QLEB 4PGJA 2ZXQA 3MNDA 2OI9C 4GS7B 4LP5A 3SHSA 5LXGL 3EYOA 4FFYA 3NZHL 3EYOB 2A3TA 4BH8B 2NX5D 4J8QA 5D7LE 1KFAL 3HI1A 3KWWA 1ZLWK 4ECNA 3VD9A 4JY5H 1MIEL 1BVKA 4X8XA 1KGJA 4ILDA 1M71A 5HHMB 3CE1A 2D31B 3DV6B 4DUWA 5DEGB 1OVZA 3K6DA 1S7XA 3L3IA 4GOSA 4K71B 4PGBB 4WHCA 1KCVL 1IE4A 4BXVA 1J5IA 2CCVA 1Z7JA 1R6VA 3KYNA 4A2HA 2PWDA 1ZT7A 3BYTA 3QRLA 5K9OB 4KNQA 3O2WH 2OK0L 1P4IH 1TJHH 3DVNA 2FBRA 1OHZA 3QGVA 2VLLA 1JZ5A 1BQRA 4LE8A 5HHNA 5AD0A 1GYUA 2F53D 1CFTB 3T3PB 4WWKD 3CC5B 4Z1PA 3V10A 2JKLA 2N1TE 4HV8B 2D7NA 2BWDA 1KYOK 3GSNB 3Q06A 1GS6X 3ZSSA 3VFUB 2ODIA 4OD1L 3HI5L 4ZD3L 2Q86B 3TF7C 2IG2L 3TCLA 4E9LA 1F58L 4H1LG 3N55A 5D1XC 4OBSA 4X8JA 3CX5K 3U1SH 2ZXDA 1AXIB 4RNRA 4HWNA 1I3VA 1ZE3C 4FQ2H 1G4MA 4GQ9H 5B7MA 4UMGA 2QHRL 4LEXH 5EORL 1EGJL 2CSPA 5H2BB 4DN4H 4NT6B 1DDTA 1RZFH 3AQDA 5FO8B 3KL5A 4JDEA 5DK0A 1FA4A 3RWDA 3PP3K 5DD0H 3D5OF 5I66B 2CGRH 5TDNA 1AO7E 4P9MH 3VFSA 2IH3B 1BQLH 5FS5A 3L7EB 4LKCA 1X9UA 3FTVA 1YECL 2FHCA 2VDRH 3SDYH 2DI9A 4OJFH 4U6VH 3JWNE 4JW3A 2AMGA 2NSQA 4JJHA 3VXMD 4F8NA 3M17B 4X98B 5L2KB 3NGBC 4D9LL 2A1WH 4XO5A 5I0WA 2W65A 1WC7B 1FGNH 4H88L 4P2CG 1JPTH 3ULUD 2F08A 4HK3N 1CXKA 1HNFA 3SGDI 4XZUB 1U3ZA 1MSPA 3TBBA 4G9FB 1T7XA 3ROOB 1CS6A 2IH9A 2OR9L 2X28A 3B3IA 3C5JA 3FT4A 4JZJC 1A6ZB 2LAGB 1EO8L 4NKDB 4ZO6A 3WS6C 1OE3A 2X2IA 4OI7A 1ZSDA 1K6QL 2I32A 5CXPA 1XZ0B 3EOTH 4M5YH 2SODB 2W5PA 4EDXA 4GH7B 4TTDD 1FRGH 2ESVE 2G0LA 3KYOA 2YOAA 4RISH 5KSVB 4QRRE 3BEVA 3G6JA 1AOHA 3KJ6L 5D7JC 3VD7A 3AS1A 1T04A 1QRNB 2V8MA 1N5YL 3QJHA 4H8WL 4LCIL 3QI9C 3LN5A 3WHE1 1AKJB 1SYVA 5FOJA 5C0ND 2M2DA 1KJMB 2AXWA 4ELME 3RBSA 5IFAL 2TSBA 3BKYH 5EOCL 3UPRA 2A6JA 2PMZA 5F9WC 1ZS8A 3RTLA 1LNUB 3KNBA 2A73B 2OV0A 1DBAH 4JCWA 4M5ZH 4YFLI 5E7BA 5F8QC 5ICZB 5JHAA 1S9YB 3FH5A 2AV7B 1CFSA 4JANA 4Q52A 4ELMB 2Y2YA 5EDXA 4X8GA 2NZ9C 3IN2A 2GHWB 2WB7A 3BN9C 1GOFA 4I9WD 3IU4L 1INQA 4FXGA 4AT6A 3V5HA 2R23A 3C6LA 3CZJA 1E9QB 1T6BX 3F83A 4N9OB 4N20A 3MRRB 3KXFE 2RQ8A 2DJSA 3TYGL 4E9VA 1IGJA 4H8UA 5HPOA 3VFUA 5IB1A 5DVOA 2X4QA 1MJ8L 1SPDA 4CGTA 2Q10A 6FABH 1N26A 5DD5H 4LSVH 5I8CA 3Q7JA 4WSGA 5JIPA 3ETBJ 1XQ4A 5AD0B 3RJDA 1IC0A 3VB9A 1NTDA 4HIHB 2YD0A 2R69H 4NNYA 2YIHA 4V11A 1G7MB 4YLBA 3RBGA 3UDWA 3VB8A 5AVZB 2WXQA 4Z6AT 4G8GD 5B39B 2RTTA 4JRLA 1KF9B 3OB0H 1PG7X 4AEHH 1KJ3H 1BEYL 3S34H 43CAA 3HJ0A 5TF1L 2MKLC 4L37A 1U3HD 5C0CD 2H47C 2VDLL 3IXTB 5D6DA 3IRPX 5I18L 4PCYA 4XVJL 3CMGA 3ZDYB 2KC0A 4L8SA 2GB2A 1KGWA 2XZAH 2GBAA 1BVLB 1S78D 1VFMA 4Q89A 5ACZB 5DK0B 4TNWF 3GIZL 2VT0A 2ZCHL 4GRLB 1QBMH 3NTCL 5EA0H 2Y1YA 3GSWB 5DEJA 3THMH 1IEAB 1EFXA 3CHXA 5D7JA 1ZLWH 1M2OA 3EOAB 3B1TA 2Q8BH 4YSQA 4MWFA 1XGYL 3P3UA 4MBOA 4GFXA 3QI9A 2EO9A 2XXCB 4U6XB 4K9EC 1HZLA 4JRYD 1TEGA 3I6KB 3OX8A 4MGXA 3CN4A 4HISA 1COBA 1YNKL 2NLJB 2V7NB 3N3EA 2XQYA 2CUIA 2YAMA 2L8AA 4HFWB 1J8KA 1L0XA 3FUDA 4N0UB 4WEEA 1X5GA 4ZFFA 3ILPA 2B3IA 3GPEA 2EYSA 1BZ7B 1CDHA 4HIQA 1AQDA 1NMAH 3L5IA 1TITA 2GK0B 4GEIA 5FW6A 4EDXB 3VXTB 1DFXA 3SPGA 4N9GA 2C3WA 1I4FB 3NGBB 3X1GA 5ECGA 2CR0A 2IFFL 1KENL 2H41A 4RDQG 4W9LC 2BSTA 1VEMA 4F93B 4XMLH 4HCRL 4PEEA 2X6CA 4K23H 4X6FB 2QELA 2XQ0A 4HWZA 3T0ED 1NMCB 2BIMA 4PJ9C 3IETA 4UQDA 4X5XA 2ZTBA 4L18A 2E27H 2IQAB 1EHNA 4EI5D 4Y2DB 1EHLH 2EEFA 4O5LH 2FSEB 2P5PA 1JP5A 1NDTA 2HX7A 2O6EA 4L1LA 5C0RH 1II4E 2RHEA 4P23D 4NKIH 3QWOB 5FM4A 3TBVA 2AEOA 4KK8D 4L4VE 4XBPB 1RK0B 5ISZD 4M61A 1VKXB 3K6OA 2IDQA 1KOAA 1Q9WA 1MJ8H 3E9UA 3OZKA 1A6WL 3MBXL 3B7SA 3DXAB 5HHVL 1R0AL 2XWDA 4UIMA 2ZCLH 3NIGF 4NXKA 4R96B 5FX3A 5T3XH 4DPRA 2FJUB 5HYJD 3EH3B 4AZ8B 2P8LB 2N0MA 4NYLA 5AVWB 1D5RA 1BF8A 2E3VA 3MLSL 2NT1A 1PIFA 3O2DA 3MMEA 3V4VA 2OTWB 4XRCA 3VXSD 1OO2A 2RFXB 2EUXA 3DTXB 3EGXA 3ZKMC 5EF1A 3VXNB 1KEML 4FRWA 1DP0A 5DJDB 3JV5A 1EFQA 3DI3B 1FORH 4XNXH 2ED9A 2AXHA 5JQ6L 4OZHB 4XNYL 3RTQB 4PJ8C 5KYNA 1WGOA 2ZXEB 1NIDA 3RUGB 3HCVA 1RZ7L 4FFVC 1OGAD 5E08L 2VRKA 3GIZH 5T1LB 2APSA 4NZJA 3VVWA 3F7PC 1DQDL 5TQ2H 4JVPA 2Q3XA 2Z92A 5E0QA 3WKQA 3UAJC 3W56A 3WHXB 4HMEA 3R4DA 1DEEA 1NLDH 3P4LA 4GS7C 1OALA 3VACA 1JPGA 3NFSH 5KWYC 3M1BB 3B2DC 4L4TE 5IVZB 1I1RA 4A7UA 3QIWC 1BBJA 3BE1H 5HYIA 5IMKA 2ADYA 1Q0EA 4HC1H 3GEWB 4XO4A 1KZQA 4FE9A 5IB2B 2UWEA 2X3CA 1FJ1B 4N0YH 5K5YA 4U3HA 4I3RL 1AO7D 4J3VA 4R7XA 3GSRA 5JW4R 1UFGA 4HH9B 2R0WL 3L6FA 2AF2A 1NMAL 3CZNA 4HVBA 4KJYA 2AEIT 4Z7WB 3BQUB 4IIQA 4JFFA 2DMHA 2J1KA 1FYTE 1J11A 2B1HL 2P5EA 3O4LE 3S2CA 3SE8H 1G94A 2RGSA 4LPCA 2CLRB 2FNBA 2VLKB 4K7PX 1CE6A 2VUKA 4LPUA 3RPBA 3KM1A 1FZOA 3LKNB 4JFEA 1BP3B 3GXPA 3RZWA 8CGTA 3LZFL 3IJHA 5EUOE 4F8LA 2W9EL 1EZUA 1X5KA 4XNQB 4JB9L 1U8MA 1AQDB 1FH2A 4Z5RB 1TQWA 4Z78A 2FGZA 2E27L 2AITA 4HIIB 2EVIA 5EOCJ 5IJDC 4TQIA 4FMFA 4UAOC 5JPMB 2I25N 3UBGA 3C2AL 3FU6A 3FCGA 4FI6A 4XZ4A 4RA0C 1FSKC 2FT8A 2AJ3B 2RR3A 5DZLA 4DZ8B 1MLBA 3X14B 1XF1A 3QSKB 4XXCC 4GMTL 2QVMA 2G5UA 4F7KA 1M56B 4BQ6A 3LMJH 1EAJA 4XVTH 1TETH 2QPFA 2XFXA 2D2CC 1HXKA 1I7TB 2I5YH 5HHOE 4MMXB 3DJRA 4GQ9L 2NCMA 1RL1A 3BZFB 2VR5A 4Q74A 2XNAA 1GIGH 2BWQA 4HEME 5DHXB 2VYRE 3UTQA 1UUSA 1X9LA 5BOPA 4MX7A 3GJEA 1CGVA 4PJCA 1UD6A 2Q9OA 3HC3H 5A43C 2W91A 4XC3H 3T3MB 4URTB 2O5XL 3IFLH 2J8UE 3Q3GA 4OKVB 1J5OH 2ZXWB 3FXIC 2G5BA 4IM8A 2C9XA 4JPVL 4PRIA 2ZYHA 1F45A 2DPKA 2XV0A 5EPMA 5SWSE 2BY3A 1ACCA 1SXCA 2R23B 4AQ1C 3DUUA 3OLDA 4HK3J 2GC4C 2F58L 4QIRA 1G9MC 1UVQB 5CJ5A 3OMNB 1RZJL 1TO5A 5FYKD 5J1AA 4H0IA 1E3XA 4I0PD 1AD9B 1O9ZA 2Y23A 4PP1C 3D51A 2WXIA 5EZJA 4TLUA 4ZT1A 4YHNB 7PAZA 1Z3GH 4MXWL 4CSPA 4KKZA 4JZOA 1CN4A 4BSVB 3G9AB 5E70A 4OZFG 2PWGA 3VI3F 5KAQF 3ZTNL 3T3MF 4XX1E 4GO9A 1NEPA 1KJMA 2FZ3B 4IS6B 4UBDC 2G60H 3MNVA 4FN0A 4PN6A 4WDIB 1T7WA 3LKSB 1FFNB 1RMFH 2HG5A 3QJZA 4MMXC 3FF7A 1MCOH 2JLLA 4XAWH 1NKOA 1OP4A 5GS1A 1KCRL 3BD4A 3RGVC 3HRZA 1FZMA 2V9RA 2VZVA 1N5YH 4A6YA 5JR1H 5FA4B 3UO1H 1WBZB 3HE7D 3IFOB 3H2WA 5D96C 5C0IB 1S7UA 3ARXA 2OJ1A 4XCNB 3P2DA 3PDDA 1DUYB 4A6YL 1E3ZA 3IMRA 1OP9A 4AV4A 1S7VB 3WE6B 4ODBD 4CN4A 1SN2A 5AFAA 3CZKA 3KS0H 1LWRA 1HSBA 1S7UB 3R0NA 4P46D 4L8DB 3TOPA 5ERWB 4HJEA 1TTUA 4PS7A 4ZDHA 3V9FA 3WGVB 2C9PA 4HH9A 1G9ML 2IBBA 1RZJC 5I30L 1DVFD 4DFIA 2DM4A 1W72H 3O6FD 1BD2D 2M83A 1A6VL 2H1PH 4LL9A 1TZ8A 1NGPL 2WQAA 1GGIL 1YAZA 1FLTX 3EG9B 1A4BA 1YEFL 4LGRB 4YHKH 5FKPA 1KY7A 3FCBA 3BP4B 3JWOC 2YQBA 1JXFA 3ULUC 5INDA 4AGLA 3SYCA 4I2XB 1YY9C 3ZHDA 1OLZA 4RIRA 3IJEB 3U48A 4BZ1H 1OXYA 1B88A 2WWKO 4LBEA 3BWZA 1BYPA 2WNKA 4G8GA 3T71A 4N8PA 2OSXA 2DWEB 4TUKH 4ZUSB 5FWQA 4F1ZA 2HH0H 5JW4M 1A6UH 2GJJA 4X5RA 4AYFA 1MNNA 5IB4A 4EZJA 2AS5M 4XPFH 5JIDA 4G6KH 1W16A 5E00B 4BFOA 3FF8A 5DJ8A 4FFYL 2VL5B 1KYOJ 1MWAB 4WFED 4Y2LA 2Z1PA 4WTWA 1RUAH 1UA7A 4A2LA 5IZ7A 4BJLA 2BMKA 1GSKA 1NGZB 4Q2ZB 4KY2A 5F89A 3RTQC 2DB8A 3DGGA 4AZ8A 3HG1B 3VI4E 1I53A 2AMUA 1W6WA 3F8UB 4B9ZA 2Z1KA 2HVKA 4HUWA 1AXTL 1N64H 2AAVA 3E6FB 1FIGH 1WZ1H 1QHOA 4EF3A 4PRAA 2P5WA 2RIKA 4Y4KA 4H1LB 2Z4QA 4N3TA 1EHAA 3AU1B 2G60L 2KH2B 4MZIA 4FQHA 2EKSA 3EJUA 4EI6A 1RMFL 3HS0B 1YNLH 3TO4A 4FMVA 3SE9H 5HY9A 3ZOAA 2CALA 1W0VB 2IF7A 2JCCB 4M48L 4XCEB 3BEWB 1KCLA 2ENYA 4KX7A 4QOKB 3IPBA 1I7ZA 3UTSE 2HLFD 4I1NB 5D7LB 4BZ2H 5I26A 3T3PE 1A1MB 3ARGB 5IESH 4C56E 1NBZB 1YEHH 5LG1A 5EOQL 2XI9A 4LRNH 3HI6L 5T5FH 4K7PL 5JZ7D 1U58A 3T8VA 5I74B 1S3RA 1FO0A 1CGYA 3C8KA 4JRFA 2J4WL 4PJ9B 4DK5A 3L1GA 5BNXD 2QQLL 1NMCC 3OL2A 3QNXB 2X9WA 4NENB 3Q8BA 3QXUA 1RCYA 3O2WL 3HNSL 4KPHH 3PDOA 2R4RL 3FKUS 3PAYA 2V5TA 3CFCH 1GGIH 3V8CA 5ALBH 5CCKH 1MW0A 5AVTB 1NWPA 1CE6B 3QZBA 4Z7OF 4I18B 4AMKL 1IC1A 1MN4A 5SWZB 5A7BA 5DWPA 3ZTJH 3X3GL 4JLRA 2YRZA 4QY8B 5BJTA 4UMSA 4EI5A 3BQUA 5K69A 1H8OA 3EGXB 4EQ2A 5EZLB 1PPIA 4ZMVA 4KX8A 3QDJE 1WIPA 3C60A 1CBJA 5CJOH 4O2EB 1CT8B 3PABB 3AC0A 1ITBB 2YAQA 3PJSA 5AB2A 3PJSB 5EORH 3MAWA 4ETQB 1J12A 2YSSB 1P7KA 2HTKD 4FQXA 1A6PA 3PLYA 4K55A 4AUYA 5F2FA 4QGYA 3L9BA 3SPVA 1BCIA 3MV11 3UTPE 4FG2A 5D2LA 3C60C 4LIQE 4R83A 1DVYA 2N56A 3GMOA 3QDMD 1IO4C 3QR0A 3MRNA 3FN9A 2NRDA 4YBHA 3BPOB 2OBGA 4I4WB 4PGDB 4U6HA 2DWEA 1CLOH 2B08A 4QRRB 2AJSL 1PG7H 2FSEA 2R1YA 3GT6A 2HT3C 1L9SA 3N41B 2CQVA 3D39D 4GG6A 4JG9A 4GIOA 5EU5A 2G9HB 5FHBH 5HYSB 3V5DB 1BQKA 4N0FA 1Y7VA 5GSRA 1JJUA 1AXTH 1N64L 3OJMB 4WUUB 1QMUA 2V5SA 3AM8C 4BUQA 3DTXA 4P5TA 3HZVB 2X0UA 4PJ9D 3MRLB 4WJKB 1KGIA 3HBGA 4JKMA 3T4YB 3I84A 1A9BB 1PAMA 2YPVL 1OARH 2R0ZL 5D1ZD 5F7EL 1OAZH 1GJWA 1BFTA 5D5MF 4MZ3A 3QIUB 3S3SA 3V7MA 4R96A 1MVYA 4XMVA 1XVSA 4A7SA 2ATAA 3U46B 2NX5A 3KXFB 2Z4QB 3U4EA 3UYPA 5IFAH 4M3KB 4OF6A 2JJSC 3SZKC 3VGAC 1G7IB 4Q6YA 4LLVA 2TAAA 3VXUD 4YLQT 3CSPA 3JUYA 4Y2DD 2FYYB 3O3DA 1XGUA 3OHXC 4YAQA 3UZVB 2GK0A 3HN8A 2Y24A 1V7MH 1JZDC 4DPAX 2CHZA 4PWKA 1KV7A 3H9HA 4GRLD 1GRWA 4ZI8A 1SDDB 3AJ7A 4G6ML 4JHAH 4CADB 1EZVY 5IMMB 5IMLA 1XGTA 4TSBH 2HG5B 1N70A 3ARDA 5JOEA 2FB4L 1P1ZA 1T89C 3QZPA 2R51A 1I8UA 2CD0A 2VLJB 5D9SA 3L1OH 1F4YL 2ZUSA 2BJMH 3SYOA 2E9WA 3AS0A 2YRBA 3HMWL 2FECI 5BRPA 3I2CH 2MSPA 3HFMH 3QI9B 2CKBL 2OTUB 3IDGA 4PWIA 4G8AC 4X9HA 5GZND 2V2TB 2ZYRA 1JGUL 3FQ1A 5D7JB 1CB4A 3HUJB 1D5MB 4P3DB 4I88A 1E42A 1ZLEA 3MV9A 3V0JA 3LN9A 3BD5A 4PY7A 4Y4HC 4MHHI 3VYNA 4FNUA 2VC2B 3WFEH 3W9DA 3KPNA 1KJ2B 2EIZB 2VKXA 3U7YL 1BXAA 3FS9A 3I85A 4U1HB 2F6AA 4C4KO 4WI4A 5JIMA 1A9VA 5AW0B 1MWOA 1UM5L 1BZ9B 2DYSB 4JZJB 1JVOA 4MFHA 1GYAA 1JTPA 1NOAA 1P5VB 1D5BA 4ZUTB 3WFBL 4YS4A 5IIEA 2YKLH 1KXHA 5FW8A 1YY8A 4R90H 2EXYC 3C5XA 2WNWA 2D7TH 1PG7L 3BJLA 5ESQA 5FO8A 1PY9A 2C8NA 2DKSA 4X6DB 3RWJA 5ICYA 4GY4A 4Z95H 2APWA 4IRSD 1QG3A 2VR4A 1H3WM 1I75A 4F7MA 4A37A 1I7TA 2YD3A 4NN7B 2E8YA 1I3RB 1HIMH 1MFDL 1L0PA 4G5ZL 1CICB 1FZJB 3SQRA 4UM8A 1KCUL 3G5ZA 3PGCA 3ZTNH 1TLMA 3FQNB 3PNRB 2CR6A 2NZ9D 1M9SA 2QR0A 2NXYD 4DP6X 1GYVA 5JIKA 2FNWA 1F90L 1SJHA 4ZPTA 3QJOA 1FGVH 1IAKB 4JFZH 2CCLA 1J05B 4RMVA 5C0BD 4F7CB 5CEXB 4UNIA 5KVDH 3ZRCC 1F3RB 3QAZC 1GZHA 4YQXH 3VXSB 2VLJD 3HS8A 2EEAA 2C7UA 5FCSH 3IKKA 3LV3B 1NL0H 5D6DC 4WI0A 5DJ2B 3NZUA 3QG6A 1TVBB 5C7XH 3EF7A 1S7XB 5TE4H 3ES6B 2VM4A 3D87B 3VU1A 1HYSC 5FKPB 3LQAL 3MV7A 2JCCF 2N1KA 4LLQA 3TESA 4GQRA 4UINL 3DX3A 4ZMPA 4UQCA 4JFHE 4F2MB 1R3JB 4LCCA 5EPMB 5E8DL 3OQ3B 2IAND 4HS8L 5HDLA 2BOBB 3GLEA 4HX1A 4PHZA 4A2MA 4PLJC 4HXAH 3EBAA 1U8HA 3TONA 4DP9X 1OHQA 1WT5C 2JQAA 3T77A 1NPNA 4HPOL 4AYGA 3L7FA 2DTSA 1W0WA 2WYIA 1WSST 4YFEA 4WU7B 2XWTA 1FZMB 5BPPA 3QJVB 1TPXC 3UCQA 2QHRH 4WGVB 5E5MB 5DDHB 4HJTA 3NRFA 1JWMA 1I1AA 2HPTA 1R19A 3SN6N 2JK5B 1C8PA 4WUKH 1KEMH 1HDMB 2OULB 3FOLA 2W0PA 4JFYB 1G7QA 2EXYD 4XNDA 3CX5J 1UYWL 3MCKA 4BIKA 3GTNA 5AAWA 1WFTA 1TCRB 1WP6A 3DYMA 5E8PB 4WFGE 5KJRL 4V1DE 2ZUVA 3AROA 4ANXA 4P4KA 1CQKA 4Z78B 4K94L 3GHPA 5FUCE 4NEHB 4PJEF 4DO4A 3QH3A 3ULVH 1CFQB 1HIML 2IPTH 2ZKXA 4JM0A 1P5VA 1KLFB 2EZ0C 3QUXA 4NLAA 5DHVB 4H44C 1AFVL 3RB7A 2KQMA 4PP2B 1FYTB 3QDJD 3MGOA 2VDOH 2J1WA 3S35X 1MCWM 1TZIB 2LV4A 4KRPB 1UEYA 3ZGHA 5IB3B 4KTGA 1CUOA 3I3EA 1YNLL 1VGEL 1DANT 2ZKHH 1SOSA 2JIXA 4HUUB 5DXWA 5EC1B 4PJHE 4WO4C 1UKSA 1YYML 1ILSA 2CA4A 4N0CD 2NY3B 1N59A 5EZIH 1C08A 4LCIH 3FRUA 3EADA 4KZEL 4PJ9A 5I8OL 1C9SA 2EINB 1LK2A 2D7OA 1DUZA 4X8JB 4JFDA 5F0JB 3ULUE 4AXWA 3NSCA 2BOCB 4OLVL 1C5DB 2CJSA 1E4XI 1UXWB 1WWCA 2XV6B 2YPLE 4PP1D 3G5YB 5D1ZA 3G6DL 3QXAB 5ANMB 1C12B 3WUZA 1ZJAA 2DWTA 1NSNL 3MJ9L 3OPUA 3SKJH 2UY6A 4KJQD 3IXAB 4XMKL 1GY1A 4TUUA 4ZUVA 3FTZA 5G55A 3VRIB 3WDIA 5IUSA 3R0MA 2GK2A 5EUOF 2G2RB 1RJLB 2CZNA 3FHAA 2G2RA 4PREB 5KSAC 1I8MB 4U7KA 4N0UA 1JGEB 3P11H 4AE1A 3EXLA 1EO7A 3LNDA 1R5VB 4KH2A 1P7QD 2QVTA 5D1ZC 2CXGA 3STZA 4NCC2 4JKKA 4XO3A 3Q44A 3UTTD 1KTCA 1AD0A 1T1XA 1F6AB 3LB6D 2WMPA 1F6AA 1UJTA 1QPKA 3QUXC 4YHYC 4H13C 3HOGA 1MPAH 3CFEB 4P2QD 3LKQB 3MXVH 4MJHA 5JOPE 1ZE3H 3CVHL 1OK8A 1X5LA 4X9IA 4FCAA 3L8QA 3S5LB 3TIDB 6PCYA 4ZS7L 3R8BB 4EAEA 2CJUH 5DUBB 1CTOA 2FEDC 1E7UA 5MEPA 1LM8V 4NZRL 3UAAA 5FFOA 5B22A 1DZBA 3P54A 4ZTOL 2G4GA 2R69L 4M8RA 2UUDH 3WUWB 4MMZC 1OD9A 2NR6D 4NQEA 2YXVA 2PYEB 5DC2A 4LVNC 1G7JB 4DPCX 1MNUH 4AEHL 4KFZC 3US0A 2R69A 3WMPA 3HHSA 4MA8H 3R7RA 4TTGA 4M29A 2DLFL 3VWKC 4R7VA 2Z8RA 3ATFA 3QXWA 4MS8D 4ZK8A 3BSHA 2XXMB 2MCG1 5KSBF 5DK2A 1JWMB 3WNOA 1MCNA 3ARRA 4W6WB 3W0WE 1NUNB 3EUUA 2BY2A 4WRLA 4ABQA 4PGEA 4GP5B 4JO2H 5DS8B 2XWBA 3IBEA 3T2OA 3VD1A 2ILLA 2YARA 5I8CB 2F8OA 3MYJA 4GW5B 4LAJH 4GKZB 4WWKB 4G43B 1ZRUA 3PGFH 3L48A 4GRWE 3VGGA 3MGOB 3C5ZC 2B39A 3B1UA 1OP5H 3FHQA 3V0VB 5JDJA 3O9WA 4YHIB 2IH1A 3V0HA 4EUPH 4YBQC 5FHAH 2Y1ZA 1XMEB 3SB3A 5FYLD 1QSFB 4OAWA 4OCXL 3O8XC 3QWRD 4Q6IB 3S3DB 1HNGA 2CO4A 4P23C 1BJ8A 3RWCB 3KD4A 4LARL 4XP6H 1KFAH 1AGBB 2ATPB 2ITCA 2H1XA 1BFOB 4DPBX 4X80H 5E8NB 1U8CA 2MCPL 3AMLA 3S97C 3O0RH 4OLZH 4Z7IA 4A67A 3TJPA 3HR6A 4EN3A 3CJJA 1EFXB 4QHKI 3GF8A 4U3SB 3NK4A 5KYYA 2P5WD 1F18A 1DBBH 3BVVA 4PJXE 4LSPH 3V0DA 1LMKA 2A6IB 4GI8A 4C4KT 4GRLA 4F8QA 4H4NA 4RMTA 1RJLA 3CGTA 3U6RB 4KRMB 4M7KH 1WITA 3D50A 3QHFL 5JOFA 1J87A 4B27A 3IFNH 3F85A 4L8SB 3DTDA 4C58B 2YKKA 1ECZA 4LEOB 5D5ME 2DLGA 3QRGH 3RNKA 2A5UA 5DZPA 1NBCA 1TVBA 5CJQL 2PETA 2V0AA 5DJ0B 4GINA 4ALAC 2QVFB 5LWYL 1LP9B 1KBPA 3A6CL 3OKDA 1HC1A 1ASOA 1SN5A 2ZCKL 4MNQB 4W9DC 3FT4B 4OFKA 1U92A 2OMBA 1OV8A 1N10A 5D1XA 4LF3B 3DJTA 3ILPB 4XN5A 3U9PL 2EC8A 5DQJA 1CURA 3QJUB 4B3EA 3PV6A 4P3CL 4JAMA 4M6NL 3MA7B 4MA3B 4J6RH 5D71H 5JHLL 1ZEAH 4IIZA 4AQ8C 4R0LC 3D2UB 2VDPH 3GS0A 2QADB 3N50A 2HH0L 4OR1A 4WO0A 3TF4A 5D1QA 3MRJB 1BDYA 4ZMXA 3QFJB 3HBPA 3PDGA 1O6SA 5LNGA 2OAAA 2ITDA 2UV3A 4JHUA 2V7HA 4EKXA 3I9PA 4JZNA 2AK4A 4YIQB 2VDQH 3DOSA 4YEFA 2ARWA 4Z7VE 5MEND 3KPPB 1ECYA 2UZYA 4WWOA 1XF5A 2QT6A 3ATDA 1EO5A 3N44B 4NN6B 1MF2L 3JTSA 5I75B 1JN6A 2AI0H 2JJTC 1DQDH 1YDPA 4MAYC 2WO4A 5CD5C 1VZGA 1OZUA 3TM6A 5KG9A 1OB1A 2YLHA 1AI1L 2WAHA 1T7ZA 4FC3E 2VAAB 2OXGB 5TTRA 2Z91B 4O02A 2IAMA 4N2HA 3P9LA 1FIGL 2VJ0A 4K9EH 4ALAL 5MEQA 3FN3A 3U25A 4NZFA 2G30A 1YEDB 2ENPA 1F1DA 2ZXGA 1W8OA 3J27A 1Y07A 5BS0D 3OG4B 1YEIL 1B4RA 4LFHD 4ZO8A 1OL0A 2CAKA 3KLQA 4MASA