1Z3RA

Solution structure of the omsk hemhorraghic fever envelope protein domain iii
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
ISKGLTYTMCDKAKFTWKRAPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGAPDVDVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGELKHQWFQKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords polyprotein
publication title Structure of the envelope protein domain III of Omsk hemorrhagic fever virus.
pubmed doi rcsb
source organism Omsk hemorrhagic fever virus
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1z3rA00
4L5FE 3N43F 5JHMA 3J2PA 1OANA 4UTCA 5B1CA 5GZNA 5KVEE 3VTTA 3P54A 5IREA 3C6EA 3IRCA 3N41F 4UT9A 4BZ1A 3N42F 3N44F 2GG1A 5AAMC 1PJWA 4UT6A 4BZ2A 2JV6A 1ZTXE 4GSXA 3C5XA 2I69A 5KVFE 4ALAC 5AAWC 2P5PA 1URZA 4FG0A 4FFZA 4FFYA 2ALAA 1OK8A 5LBSA 2V33A 4X42A 3J27A 4GT0A 3UZQB 2R29A 2JQMA 3N40F 4AL8C 4UTBA 1OKEA 1S6NA 1UZGA 1TG8A 3UYPB 3UZVA 3WE1A 1Z3RA 3UZEC 1RERA 3UAJA 5JHLA 5LBVA 1Z66A 1SVBA 4UTAA 5KVDE 2R69A 4AM0Q 2HG0A 5H37A 5KVGE 2JSFA 3MUUA 3G7TA 5LCVA 5IZ7A 5GZOA 2H0PA
chains in the Genus database with same CATH superfamily
3VXMD 4G8EB 1YEDB 1NGPL 3D18B 5I5MA 4OM0H 3GXUB 5IJKA 4NO0D 4JO3L 4JQIL 5AW5B 4YZFE 4MA3B 1JCKA 4Q6KA 4DZ8B 2ZICA 4YIQA 1A7QH 3NDYE 1IKNA 3P9WB 5GJTH 3KPQB 1Z9SA 3VTAA 5I1EH 2B1HL 1LP9B 3HMXL 4TUKL 4UT7L 4XBEL 2EZ0D 1EO7A 5EUOA 4AEIL 4KXBA 5A2FA 3PREA 3QHFL 2MTAA 4TVPL 1PZBA 5IV2A 5FYLL 3WIFA 4PP2A 3ZGHA 5DJ6B 3H4HA 1FNLA 1ZCRA 2HYMA 5INCA 1NCJA 5AD0A 1H9DA 3ESUF 5GJSH 4QLWA 4MMZA 2EC9T 1NCIA 3DMMB 4UT9H 2Y6SD 1GGUA 4IRSB 2O6DA 4OM0L 4P2RD 5CSZA 3SGKA 2XYCA 4MB5A 2EIMB 1CK0H 1UEMA 4ZSOB 4WGVB 1Q90A 3QXVA 2PCPB 1RZJC 1MF2L 1A7QL 3U79A 1R3LB 2XWRA 4OUUB 3KCPB 5GJTL 4LAJH 2GTWA 2EXWD 1S78D 1P6WA 3O8XA 4ZDHB 5CEYA 3QQXA 2NNFA 3IDUA 4KRNA 4YSEA 3TJEH 4UM9A 3T0DA 1DBMH 3BZDA 3WMPA 2BCKB 5I2IB 1MCHA 5FHAH 4XN9A 4XGZB 3NIDF 5GJSL 4HIQA 3BLBA 2UX7A 1WK0A 3OR7B 5CGYD 3R4RA 3V10A 3C60C 1EO8H 1SXCA 3OR6B 1CK0L 2VDNH 2WTOA 5ICZA 2W88A 3BP7B 4AIOA 5E2VH 3IF1A 3QCUH 4HQQH 3PUUA 4Y4HB 4GG6E 3IS1X 2JCCE 3KEDA 1DVZA 3L16A 4Z7OF 3ATDA 3N1FC 2APSA 3GSQB 3ECBA 4MNQD 5C08B 4PGBB 3PL6B 3TJEL 2D4FA 2C3VB 3RDTA 4HH9B 1DBML 4QO1A 4XP9H 3OL2A 3NIGF 4J3OC 4HZAA 1A7OH 1XGTB 3B2XA 5JHDB 5JOEA 4PV1C 1W15A 5IVXA 5FHAL 2GY5A 1AACA 5LGJB 4JO4H 4Q14A 1EEZB 2AANA 1X6LA 5EBLB 3B83A 2JJSC 3OC8A 3VGBA 3QULA 3E3QE 2YMXH 3W0WB 1EO8L 3FFCB 1J0IA 4WEEA 3AB0C 2P5WA 2VDNL 5HPMA 3AG1B 2UWEA 5E2VL 3QCUL 4HQQL 3DX3A 3UTTE 2CD0A 5FGRA 5KJ4A 5T3XD 5EEXA 4ZS7H 3RLSA 2DYPD 4DF9A 3MROA 4OZIE 3A0OA 3X11A 5HDBF 2R39A 3GEWB 1Q9KA 3KYKL 4XP9L 2MCAA 2CAKA 3KL3A 4F7CA 2Y1YA 3DVGB 2N0KA 1A7OL 2DIBA 4K3JH 2B1OA 3S35H 4UCFA 4MQ7B 2GEEA 2QKIC 2X6MA 4JO4L 2GI0A 3OWEA 4XH2A 3CFBA 5A6IA 3ZT5A 2YMXL 4TM9A 4XB7A 1M9WA 1DEEB 3B2UD 4ZUSB 3TTSA 2WYZA 4PRHA 1XFPA 4F7MB 1KJMB 5EWIH 1PLGH 3QIWC 1TENA 5EEVA 1T04A 1IC7H 5C0EA 3MRCA 3BZEB 1T1YA 3N85H 1M53A 4B53A 3KHQA 3QYNA 2E8ZA 2Q7YB 1QEWA 4HWZA 2ODIA 4LSPH 1KIRA 4AQ1B 4UOW0 3D4CA 3S35L 4K3JL 2H0JA 3B2PA 4JY6B 3AS1A 4M56A 4PJEE 3SODB 3KL5A 1D5IH 4OJAA 2VQ1A 4H5SB 3E9UA 3CH1B 4LB8A 5E5LA 3KZ8A 2Z35A 5A3IC 1HH6B 3WDHA 2BVTA 3IKCB 2HLFC 3RTQD 5EWIL 3MV7A 1PLGL 1CQYA 4LXFA 1NIDA 2VQ4A 3AFLA 1TQSA 1W2KT 1IC7L 1N0LA 3H9SD 3N85L 2O6PA 5FYKD 1ZLSH 3ZE2E 1MAJA 4Z1PA 2KS0A 1BQ5A 3Q6FB 4LU5H 4PY7A 4A68A 3D85A 3MJ8B 1I1AA 4AKOA 4X9GA 4LSPL 4IBZA 1H6FA 1JPGB 4GG8A 4A7VA 3SYCA 1ZLWH 3N40P 3VGHA 3SBRA 1SYSB 4JPQA 3S2AA 5B38G 2AV1B 1G94A 3MV8D 5GGTH 2W65B 2YSSA 4X0KB 4A6YH 2MKLC 2MKWA 2OK0H 5B1JC 4LEOB 3PWVB 2I9TB 1KGJA 3FTXA 5D9SA 5DWUH 3CZGA 4DSYA 4Z3JA 4QRQB 3WI9A 3BQUA 1VCBC 4GPVA 1ZLSL 4QIRA 3LPWA 2ZWZA 4LU5L 3OKNA 5I1DB 4AGPA 5SV4A 3BZFA 2HA1A 4HP5A 2HTKD 4ADJA 4J1UB 4KHTL 1RQ5A 2FBOJ 4LDEB 1NEZB 3G5YB 5BXFB 1SXBA 3WTTA 2F54E 1W0VA 4M1GH 1TJXA 3RHWF 3BP4B 3CZJA 4G8IB 1AGCB 2WUBH 3BH4A 4YSRA 1RD6A 3GMLA 4KK9C 4ZFOL 4RAVB 2VXQH 3A4DA 4UI2A 3VWKB 1JIBA 1T0PB 5GGTL 1JCVA 4A6YL 3KDMA 4PRNB 3TBYB 2OK0L 2FGWL 3GQFA 2GJPA 5GZOD 1FUNA 2BC4B 5D8JH 4IBUA 2Y7QA 3DHUA 1PJWA 3O3DA 5DWUL 4U7SA 2H9GA 3ROOB 1LO2H 3G5VA 4AM0A 2VM4A 2MNUA 4NNPH 3EBHA 4GIOA 4ELMB 5ISZE 3PNRB 4O2FB 3V7AG 1DVFC 2YAQA 2FNBA 2K9FB 1OALA 3BSZH 5IFAH 3RVVD 1YAZA 1PEZA 4RIRA 2NXZC 3Q05A 4KV5E 4C56E 4NQXA 1AXIB 1P7KA 2NY3C 3RX7A 1U8CA 5AAWC 2WUBL 3F01A 4Y19D 3OAUH 5K93A 4Y1AB 3PXJA 4PU2A 4JFSA 3B7UX 3U0PA 5I6OA 4A2DA 1V3MA 2Y5TA 4LVNC 1EK3A 1XMWA 4MJIE 3MNZB 3W57A 1MW0A 1INEH 3MFFB 4GAFB 4BRJA 4LP5A 5TF0A 4GRLD 2OZ4L 5A2IH 1U42A 4X5WB 1LO2L 2YRLA 1I7UB 3S34H 2FIRT 4NNPL 2D3VA 5I17B 4Y16B 4E9VA 2COQA 5DJXB 1TZGH 5L4JA 3KMDA 4L23A 3BSZL 1S7UA 2FWUA 3FCUB 5IFAL 2N1KA 3K5RA 4J28A 1EDYA 3ULUL 3TEXA 1RZ8A 4KKNA 4MA7H 1D5ZB 4X7TB 4ELKA 1P2CA 1IAIH 3GMPA 1SEBB 1MQKH 2ICEC 3OAUL 4JY4B 2AI0H 2UY6B 1F4WH 5BRZA 4O2CB 4JFZH 5DMKB 2UY7A 4PJBB 4CBPA 1ZGLP 1AZNA 1NIEA 4MQXD 4QMEA 3SE8H 1RMFH 1T22B 1T2QH 4H8WL 4CGUB 1SVCP 2VZSA 3O0RL 4Z76A 1CT8A 3KGSA 1INEL 1C5DA 43CAA 2B3RA 4P2QD 4UTAA 1XBDA 3MA7A 1CE6B 1N10A 4XAWH 3S34L 1MCNA 3ESMA 2F15A 1T7ZA 4NKOB 4AXWA 1C08B 4PRIA 4LGRB 2NXYB 4HF5H 3FULA 3MGAA 2DW5A 1W6WA 5FR3A 4HLZH 3ZHLA 2W8CA 2BOCA 3SDDC 4JCMA 3VI4B 4E9QA 1S7QA 2FD6H 5AW7B 1WAEA 4DERA 1IAIL 1MQKL 3BD4A 1LEIA 2AI0L 5CSGA 4JJHA 5D2LF 3AWFA 5LAXA 4K07A 3HS0C 4XC1L 5JHAA 3RJQB 2WB1A 2AKRA 1DBJH 3W5MA 1QO3A 4BBWA 4UDUA 3NJLA 2HRLA 3CFKA 1M57B 3QH3B 4GRWH 3QK0A 3MBEB 4H8UA 4XAWL 7TAAA 4LSRH 3BO8B 2YAFA 2GC7C 4OGAC 1KFAH 5AVXB 1HHIB 2XNAB 3W56A 4A38A 1AGFA 1JGEB 4W4OC 1U8IA 4UT6A 4B9PA 1AZUA 4K5PA 5E7BA 4O00A 4K3EH 5I6PA 4KK8D 4HF5L 3QFDB 3CCHB 1BIIB 3N1QC 5D7LE 3OKEA 3T3PF 4G43B 4S2SA 2FJFB 2FD6L 1ZK9A 1NIFA 4K9EC 5A16A 1SLUA 1T03H 3FOMB 4IOSD 5CEZD 3QR0A 3TFKD 4WUUB 1HKFA 2VWEC 4ZMLA 5CF3A 1CG9A 1E4XH 1QSEE 2OMZB 3K2UH 1MHHA 1DBJL 2LLGA 1NBYB 4EEEA 4G1EB 3ZGIA 5DHYB 1DQTA 3F65A 4WI4A 3CFEB 3B7RL 1QQDB 3TBVA 4PBVC 2J2ZA 5JOFB 4LSRL 4JFFB 4QLRA 1JZ8A 5HHOD 2E46A 1MJUH 1CGSL 3HUJE 4WCYH 4AMKL 3C09C 5HDRA 2YQ2A 4E9RA 3ARGB 3WLWD 2AXWA 4K3EL 3T9WA 4O58H 2V2XA 4AW4A 5EU6E 4JHUA 5B3SB 4HKBA 4DTGH 3DVFA 1EFXA 5MI0C 3LZQA 2YD5A 4HUXA 5I71B 1T03L 1FFPA 1OEZW 2HKAA 4RMTA 3VRIA 5LHDA 4LOVA 3UYPB 5F3HB 1E4XL 2UZXA 3UZVA 1Z1WA 3K2UL 3NCBB 2GJZB 5F0LB 4EI0A 3S3PA 4XE0A 1WBXB 4N90E 4K3HA 1USQA 4E9LA 3WKMH 1FFOB 2OI9C 1J5DA 4DO5A 1Q9WA 1D6EB 2CLZB 3QNZA 4ELDA 1MJUL 3MJ9A 4WCYL 4J3OF 2J8UF 5ABZA 2L4OA 4GBXC 2WXFA 3KDPB 3LZNA 4O58L 3I74A 3DPDA 1KTCA 2CLVA 4L48A 3TIEA 4AK2A 4BQCA 3PWUA 4IEFA 2FSDA 4E0RA 2A9ML 5A43C 1N26A 2IAMB 1JPTH 2YZ8A 3C12A 4HGMA 4DTGL 3D69A 3BSGA 4Y9GA 3VFNB 1FNSH 1ZSDA 1HILA 2FJSA 3RL1A 4U1GC 4PG2A 3ULSA 3ZHDA 3FNKA 1G87A 3UFIA 4WI2A 2J56A 1NCBH 2Z7YA 2VERN 3GMMA 4HKXA 4WNQA 4WW2F 5DEGA 3UH8A 3VX1A 4L4TA 5I0DA 3RWCA 3WKML 2VIRB 1NDMA 3EJSA 3DYPA 1DYZA 4UQIM 5LCVH 1KCKA 3JT2A 3KLHD 1O7SA 1PTZA 2G4GA 2I26N 3CHQA 4DP7X 3Q7JA 2YLHA 4JN2A 1NAKH 1OW0A 4NRXA 4KROC 2IDQA 5D71H 3B9DA 2ESVB 3N44F 1X44A 2D9QB 1JPTL 1UXWB 3K8MA 3KYMA 2BSEA 3QDAA 1NJ9A 2R59A 5CJ5A 2C3WA 5GGRB 5KYUA 1CCZA 3FCBA 5CGMA 4FNTA 4IBWA 5E6IA 2H47C 4K3DH 4QRRA 3GDCA 2ZXCA 5C0IB 4CJ1A 4AGOA 3D06A 1NCBL 5I1HH 4GW4B 4S1DD 1NAML 4N3UA 5MEQB 3FL7A 3NYKA 1R0AH 5JDSB 4ZAKC 2HN7A 4KQ3H 3T8MA 5GRUH 2G5BB 1JZHA 2WV3A 4WFFD 4JKMA 5LCVL 2CWRA 2ICES 1N9PA 1KCWA 4KGLA 1F3JB 5FLUA 1B4TA 1NAKL 4PRPE 3FT3A 4ZXBB 4R26H 4Y4KA 5D71L 2J43A 5TF1H 4QHUA 2DYRB 1JJUA 3M88A 5TDPA 2JMRA 5IBUG 4MHHI 1D7BA 1KGXA 3BPOB 2ZUTA 1FAIH 1U58B 1ZY9A 4K3DL 3UZQB 1L0QA 3CDGA 1ADWA 1GTFA 4MAYD 1O5PA 1A6ZB 3L3GA 2Y06H 3G5ZA 3VE0A 1FAKT 2IH1B 4I4WB 4QTHB 4YSQA 1R0AL 1BZ7B 4HXBH 3WN6A 4KQ3L 1DN2A 3QZBA 2NY6C 2ZOUA 5SWSB 1XO8A 5EZOH 2X4PA 5IB5A 4G72B 3CFDB 2WOBA 3H4FA 3P0VH 1UWYA 4D9QE 1ONQA 2YGOA 3O9WC 4R26L 1FFQA 5E95B 4DK6A 1NH6A 5TF1L 4HW6A 3N04A 5IROD 4PJDF 2BVOA 3CVHB 3IAQA 4DKFH 3L4UA 4ZO7A 1OSZB 3O6FC 1FAIL 1DJZA 1MCKA 5AKTA 4N26A 2RH0A 3JV0A 1RU9L 3KNBA 2Y06L 5LKNA 1J8HA 1JDCA 1JZEA 1XQ4A 1JXJA 1T3FB 1PEWA 3DGDA 1PMYA 1SY6A 4HXBL 3D0VB 3QUXD 2Q8BH 3CBJB 5EZOL 2N7SA 2PPFA 3Q1EA 1JZ3A 3CC5B 2HB0A 3VI3A 3R4DA 3M46A 3P0VL 2BPBA 1UOLA 1ZDQA 3J2PA 5HVHC 5B1CA 4XMTA 4H88H 4LVOC 3ARTA 2ATPB 3K80A 4AMXA 2IF7A 5DFAA 2B3IA 2J1KA 2VM3A 4LPXA 1JHTA 1F6FB 3LAFA 4TLTA 4DKFL 2FRGP 3TBTB 5TE4H 3QUZB 3BHBB 3HS9A 4H26B 5FKAB 3RX5A 2AXGA 3ARSA 1NBVH 4OCRH 4IS6A 1OY3B 4PJ5D 5IB3B 3G6DL 1T5XB 4EUPH 4XT1C 2ZOLA 1UQSA 3U9UB 3UTZA 4CC4A 4NBZB 2HPTA 4EMZA 2DTMH 5F9JB 2E59A 3QEQA 3GJFB 4GSUA 5EFIA 3BPCA 2Q8BL 2B20A 3IGAB 4WW1A 4PJCB 3BH8A 2EYSA 3UGEA 3LB6D 1RZIA 2XJLA 3DTDA 4WO4A 3ARFB 4P2AA 5I75C 5BS0B 2J21A 2YWZA 1HXMB 4DCQA 3FCTB 4Y2DA 3NSXA 3FO9A 5GRZA 3OJDA 3VXSE 3QNXA 3D51A 1CICC 1WPCA 2OR8A 4MJ6A 1YN6B 5EN2A 2NSXA 3BVUA 3GI8H 1NBVL 4F20A 3RGVA 4W6WB 1IGFH 4XPGH 2JB6A 4I0PB 4MJID 1OB1A 4K5MA 2C3HA 2YN3A 1XF2B 2DTML 4K94H 4AYGA 1FO0A 4W1TA 3A67L 4NT6B 1IM3B 3FB6B 4NPKA 2EXYD 5EUKB 3UBXG 4YVUA 3N40F 2DMCA 2ADIA 4P46B 1GYAA 1ROWA 2PYFB 1A1MA 3C5SB 4IIQB 4ONHB 3KPRB 2EVGA 4ZUTA 5KZCB 5FCUH 4R3SA 4X5XA 1ZVNA 2OL3B 3TBWA 3UOAB 3SDAD 2MOGA 4PI2A 4UQ3A 1A14H 1A7NH 1NC4B 5LJYH 2XKSA 3GI8L 2PWGA 3HR5A 1IGFL 1WTGT 2H3NA 3BIAX 3CZNA 4LLDA 2A4CA 4OVUA 4N9GA 4XPGL 5HDQH 3ROLA 2GYSA 3VFTB 1UWXH 3DHJA 4K94L 4NOBA 4YQXH 4AK1A 2DWEA 3CSBA 4BUHA 2DQIH 1BLNA 5CZXC 2ZUUA 3DUUB 1D6VH 3UC0H 2P8PA 5AVUB 2IGFH 2BFVH 4XCCH 4NXKA 4HPYH 4Q97A 1X3DA 5AVZB 1WS7A 4X8XA 5FCUL 2ARWA 1BQUA 4WEUD 3F7KA 4MVBC 2XQBL 3GRWA 5JHDE 5IB4A 4G1MA 1WC7A 2H2SC 4HSCX 1A14L 4B7LA 4CKVX 3OJMB 1A7NL 1GGCL 3KW7A 1OGTA 2ED6A 1BIHA 1EZVY 1HHKB 3DDGA 3FW6A 3IDJA 3TO4A 1OOAA 5HDQL 2HT4C 4QT5B 4F7TB 4ENED 2CJ3A 3TNMB 2QQLL 4YQXL 1CXIA 4DP5X 3O6MH 5CHNB 3UDWA 2L04A 3WBDA 5SX5H 5I1LA 2DQIL 3UC0L 5DVPA 1S3RA 1D6VL 4AL8L 5E94B 2IGFL 2XWJA 3VWJC 4BZ2A 3EHBD 1AHWC 2BFVL 5D4HA 4XCCL 3D39A 5L4MA 4HPYL 1ZTXE 1UH4A 1G7MB 4JFEB 5D7LD 3D50A 1OGAE 5KVFH 1JGUH 5AOIA 4EZJA 1T80A 2R1WB 3OG6B 5KYWB 4J6RH 3F00A 2R4RH 4L1DA 4LHUG 3N42B 2OMXA 4WU5A 1W8NA 2PW1B 3DX8A 4QRSA 1FG9C 5EORH 1XR8A 5ANHA 2FBRA 1R5WB 2P5PA 1DUYB 3NPSB 1V27A 3NZHH 5B21A 3MUJA 4QRBA 4BK4A 2FX8H 4BSWA 12E8H 2CHDA 4HDIA 3O6ML 4Y1SA 3SQOH 3U36A 2IANE 1LYQA 5DMIH 3KJ4B 1FLTX 5E8NB 1UVQB 3QT2A 4AYDC 3KL0A 1GR7A 5DJDA 3EFOA 3TA3B 2XVLA 4JQIA 3CTTA 2F8IA 2FLRT 5KVFL 3FDWA 3QDHA 2VW7A 4N6QA 4GS7C 2A0LC 4NBYB 1S9KC 5I1IH 4J6RL 3QJRB 2R4RL 2WQWA 3HMXA 4OQTL 1WWBX 1A4KA 2Y7LA 1Z3RA 5EORL 4BSVB 2D7TH 4C83B 4DP0X 4Q0XH 3NZHL 4TS6A 2K6ZA 3H53A 5KSVB 3KBPA 3NJMA 5E03A 1YEIH 2FX8L 3VXNB 3T0ED 1RERA 2DL9A 4P5KB 5JIKA 3SQOL 5JPMA 3BDBA 2R2HA 5DMIL 5IQ7H 2WKGA 1E40A 3FT4A 3GSWA 5L4FA 2Z9TA 2A6KB 4MQSB 5E9AA 4I2XE 1CQKA 4OCWH 1IZKA 4Z0XB 2Q86A 1CGUA 4Y4FD 2X4UB 3BFOA 4FL4C 4FXGA 4RAHA 4WI3A 2LE9A 1S9YA 1YY9D 3DHMA 3KVPA 2HRGA 3U4EA 2NPLX 2B4CC 4HGWA 2QV4A 3I6KB 3ZQWA 4XE5B 5DVLA 5I1IL 4PWEA 5DT1H 3B9KB 5HHMD 4HJSA 3RKDC 5KS9B 1T0MA 3VXRE 3LPFA 2OYPA 4MJJA 4F9PC 1MCEA 2D7TL 4MLIA 3RIKA 1H19A 1U92A 4Q0XL 3OPZH 5AB1A 5CBAB 5KSBF 5MERA 1AIFA 1FVDB 3RRQA 1YEIL 3D33A 2MSPA 5E5MA 3T1FB 1N4XH 2CH8A 4XNMA 3RWFB 4N5EC 3OKMB 4JFQA 5IQ7L 5IM7A 2GJ6B 1NFDF 1SMOA 1WFMA 3SYQA 4LRIC 1BLIA 4OCWL 3BVDB 4UT9A 5KYXB 3OXSB 4JZJA 3ABMB 1T20B 4AITA 2XQYA 2JWYA 3WTSA 2BSSA 5AKRA 3X2QB 5F70A 3KH4A 2XQYK 1RSYA 3MRNB 4W9ZA 1K85A 2UXGA 4R2GC 5DT1L 2EDQA 4APQC 5F8RC 4G8AC 5AVVB 5DEZA 1WBYB 5IK3A 3HKZA 4FFWC 4ODXB 4GP4B 4HWNA 3LDBB 5D1QB 3NCCB 3OPZL 1MLBB 3B6SB 3HR6A 1LD9B 2C1OA 1WFOA 3NP3A 1TPXB 3B7YA 1A8ZA 1N4XL 3WFZA 2NMSA 3HRZB 5CD3B 2QR0B 2HP4A 2IWGA 1URZA 4W70A 1CGTA 2RTTA 4ELME 1YEDA 3NUKA 3VXUE 1AS8A 1XH3B 1XF4B 4P57B 3CC1A 3SN6N 4YGAB 1Y6KR 4MA3A 2LVEA 3QUYC 2C4XA 3WN5A 1IBBA 1WG3A 2R27A 3KPQA 2HX9A 2E74C 4U3CA 2VW4A 4LPWA 4ORZC 2R56L 4TQIA 1D2OA 5AW9B 3V0WH 2ZAGA 4JK0D 3HHSB 4QAWA 4Y5VA 1E2ZA 2XWCA 1CU4H 2IPTH 1UWGH 3BPLB 4TNWF 2NYYD 4PJGE 2MCPH 1XIWC 2WQ8A 2X6VA 4QRPB 4MX7A 2C1PB 1P5UB 1PNDA 1UACH 5EC2A 1VZGA 1VEOA 1P4BH 1MWAH 4UOZA 2JFCA 1M3IA 5E9DD 3TH2T 3JV4B 2DWYA 1G6RA 4X6FB 1KGYE 2D7PA 4OUUA 3KCPA 1BVLA 4XPHL 2W0PA 2Z31A 3V0WL 3DO7B 1QFHA 2HT3C 2J1XA 3L3OA 4PJFB 1NOFA 3ASNB 5F7EH 2JXMB 1QLFB 4Y8DC 1CU4L 4OZHB 5FW8A 5EEZA 4ANVA 1UWGL 1G9NC 4L3EA 3S37X 1NCGA 4G5ZH 5JOPE 4Y7OC 1X5IA 2HJLA 2QLYA 2FYYA 3K6FA 3NJGA 4XGZA 2MCPL 3B2VH 3KLLA 4FHJA 2OMVA 1N70A 3L13A 2F1BA 1UACL 4TQ8A 4DP6X 5L8JB 5K1NA 4TOYH 5IREA 1P4BL 2C9XA 3VI4E 3NT0A 1NKRA 1JHLH 1OQOA 5FA3B 1BF8A 1MHEA 1FFNB 2YQ3A 4JVWA 5F7AA 2AVFA 4FI8A 5C0BD 5KSUB 4G6MH 2E9BA 2HLAA 2QADD 3GSQA 3D25A 5IFJB 5DS8B 5C08A 3SCMB 2K0RA 3CZLA 3ECQA 4F7PB 5GGUB 2OAAA 3PJSB 2NZ9C 1R9FA 1FNEB 1A21A 2PWFA 4UU9B 3KLSA 4NUMA 1JF5A 4RGND 1EXGA 2NQDA 2VQUA 2XTJB 3P73B 4G5ZL 4WWKD 5D4JA 1J0HA 3O41A 1IJNA 5F93C 3B2VL 3SYPA 5L9DH 1MI5B 3PIQB 4TOYL 2ED8A 3AU1B 3JTSB 4X6DF 4NNYA 3UJTH 2ZF8A 4DQAA 1WAAF 1E9PA 3FFCA 3CSFA 5IW6A 1TYEB 3JYCA 2BLFA 1JHLL 5C1MB 5K9KB 1MXDA 3LNIA 3QORD 3H85A 1PY4A 3ZLQC 1PYWB 4C59B 4FMVA 2GI7A 5EHFA 2X4SB 3C5ZB 3I6LE 5TQ0H 1ZOXA 3LRKA 3MRBA 4V1DD 2OKMA 2EAEA 3GIVB 4B5ZA 4BUQA 2F53B 4AUJA 3G6JF 3T5WA 2WVSA 4Y7MA 1W0YT 2YAEA 3DVGA 2E9WA 3QZWA 3RWJB 1ZLWK 4M4RB 5J6HA 3LVEA 5EV7A 5C9JB 2XG5A 3QRGH 1EX0A 4ZFOA 1E90A 2VGLM 3UTSA 2QDVA 5IMKA 5BUGA 2WINA 1KEMH 4A6YA 5L9DL 3HC0B 3C75A 1XH0A 3UJTL 5JIDA 4ZUSA 1MZYA 3GKWH 5D5ME 1KJMA 1SHWA 3MUGB 3WDJA 1ZHLA 1YMMA 3BZEA 2Y9RT 3BAKA 1LLAA 3BP6B 3F05A 3QFJB 5HI3C 4D2NA 4YNYA 4U6YB 5TQ0L 4PJ8B 4NN6C 4FULA 2ZUXA 5CLZA 6PAZA 3FUDA 2H6PA 3MNWA 4XWOC 1QBLH 5J5EA 1U3HB 5L2KD 2PN5A 3F7LA 5HTSA 2XWBB 3QRGL 2VXQA 2IGTA 3FB8A 3I3BA 3L9EA 3C6LD 4H5SA 3CPLB 1YJDC 3HRPA 3BZ4A 5DTFA 1KEML 4EDWH 3RWEA 1FNGB 2BNQA 3LQZB 4FTVA 1P7QD 2ZUVA 1A6TA 3GKWL 4OLVL 1PDKB 2FUTA 3AQXA 5DRZA 2H1PL 1JWUA 3IXAB 5IVXE 1UUNA 3K72B 3WS3B 4YH6A 4PP1C 2WQVA 1T5KA 3GMOB 2KL6A 4JAMA 3N41F 2KQNA 1GY2A 2HG5B 5KUMA 2EDHA 4HCIA 2O5NA 1QBLL 4JO1H 1RL1A 4OF3A 4EI5D 1I1YB 3QQNA 4BH8B 1RZPA 2I5YL 1A8JH 2Q8AH 1J05A 4NQED 4EDWL 3WJMA 3MRJB 4J6IA 3DWTA 4TTDD 4X0KA 2Q6WB 4YBQC 2NY1D 3QDMB 2WO4A 3QJVB 3H7LA 3ZIMA 1ILUA 3DJTA 3GFUA 3NCMA 1ACXA 3ARDC 1N6UA 3SDCC 5EC1A 4R0LA 4HJTA 1AO7B 2XKUA 4N24A 1K5WA 1PZUB 3MRPB 3GXNA 4HIEB 3FQXA 4J3TA 2JH2A 4AJVA 4AV4A 4JO1L 1YY8A 3D3VE 3G5YA 5BXFA 1KV3A 1KT2A 2BS9A 2XWZA 4XMPH 3GSOB 3OLIA 5FYJE 4CN1A 2NSQA 3SE4C 3NRPA 4PJIB 1BZDA 5C0GB 3RFZA 2YXFA 2LHAA 4NKMA 4RX4A 4QYAA 4Y2OB 2A74B 1M1XB 3JT0A 4PRNA 3TBYA 2H3KA 3AT8A 7PCYA 5DC4B 4NX0A 2R83A 1HYRC 4K7PH 1S8DB 5C2UB 3EYVA 4QGYA 2NY0C 3U1SL 3R06A 3L5WA 5F8QC 5T3XH 4XRCB 2PTVA 1KLFB 2HFGH 3LJ3A 5GRVK 4YHIB 2R29H 1JXKA 2CLRA 1BZEA 3VGDA 4N0CD 1XXDC 2BZDA 4O2FA 1RUPH 1UATA 1MH5B 1UXMA 3P11H 4QKXB 4CSZA 1OTTD 4OZFH 4WUKH 5T5NG 5MEND 3ARBA 3ZKSD 2AEQH 4MAZA 3MV7E 4M9PA 4E42A 1HNFA 2MFNA 1F8TH 5EOTA 4PJHB 3KPLB 3RNKA 4ZJ9A 5E24E 1OTUD 2KPNA 4Y1AA 3B9AA 2E75C 2DQFB 2X42A 3CFCH 3I50H 4LMQE 4WSGA 1I8KB 1BFOB 2BFGA 4BKLA 5ESVB 2VDRL 2XX1A 2WXOA 3MLWH 4K7PL 4U33A 5CWSB 5FUZH 5C07A 3A47A 2QEJA 1BEXA 5T3XL 1USZA 1L9RA 5DZVA 3EOBB 3F7VB 2HFGL 5HYEA 1IGYB 3QR2A 4PV8A 1BAFH 2XPGB 5I17A 3CFJB 2D3JA 2E6PA 3LKSB 2BS8A 1RUPL 2IPUK 3P11L 2X10A 4MD0A 1PFCA 4S0TD 4WUKL 5DJXA 5CD5D 2AMGA 2AEQL 3PAVA 2WGXA 1GOHA 4WTZA 4BK8A 1F8TL 4HV8B 3PU7A 2D0HA 2DWSA 1D3CA 4JY4A 3EO1B 3HZYB 1QRNB 4BYHA 4IDJH 4YZWA 1S7TB 1WCBA 3CFCL 3I50L 3PHOB 2B8OT 3G9AB 4JZOB 4XPFH 2A38A 4EXKA 3MLWL 4R7NA 2V6HA 2YD4A 1AXTH 5FUZL 1BQSA 4QJ3B 3MGTB 1MHCB 3ABGA 4FN0A 4H25A 3IAGC 5FYKH 4FQPA 1F3RB 2JI3A 2PXYD 5DSCB 2I07A 4NKOA 1BAFL 4IRJD 2FQFA 3RWDB 1AZBA 4JPIB 2CK2A 4JKPH 3RNQB 3II2A 4NZFA 4M3JA 1FH2A 3I2CH 4L1BA 1VCAA 2OR9H 2HTLD 4QDGA 3VD5A 4R4ND 3LIZH 3O3EA 2E8YA 2ODHA 2V2WB 2WQAA 1QACA 3HMWH 3O45A 2IMNA 2YPVH 2A6IA 2EEBA 1N5YH 2K9UA 3EFFB 2GW5A 3U46B 3VXUD 1HWWA 1OK8A 4IDJL 3SIKA 4YVNA 4XNDA 4XPFL 2LU7A 2QBWA 1GJIA 3IMSA 3C60B 1MCFA 4ATWA 1HAWA 2LOEA 2EIZB 5D2NA 1AXTL 2JIXA 4ORGA 1HJBC 3D8MA 3QH3A 4P2YA 2WZ6A 5FYKL 1NEPA 1BD2A 3GJEA 2B9BA 2XNAA 5JW4N 4P2OD 4U1HB 1JGEA 1F41A 2NY4C 1CFNB 4JKPL 1BJ1H 1GIGH 1YCSA 2VDPH 4X6BA 4KQ4L 1PZ5A 1A6VH 1BIIA 1ZV2A 1FG2B 3CCHA 4Y9FA 3QO0B 2OR9L 2VSKB 2J6EH 3ZL1A 4NIKB 3X3FL 3LIZL 1BWMA 3PHAA 4KKRA 3HMWL 2FJFA 3EOTH 2YPVL 4AIZB 5GRYA 1A4JA 3OB0H 3VXPA 1ED3B 5IHWA 2XN1A 3T65A 3FOMA 1U4EA 4LOUD 3PJLA 3KPRE 2X4QB 5EDXA 3ZUNC 5LG1A 4Z5RB 4BSJA 1L9TA 1JYVA 1G84A 4DGIH 2JQAA 4EIBA 3GIZH 4G1EA 1CDGA 3AB0B 3P40A 5DHYA 1EPFA 5LCVA 2JKJA 3GBMH 3DETC 3VAEA 2OLDA 4JFFA 3ZE1F 4ADIA 1L9MA 3IFOA 4YDNA 3MREB 3DGCR 3MYZA 2Y69B 2LV4A 1GIGL 2VDPL 1DL7H 2P7TA 3HZVA 1H5BC 4I87A 3AC0A 5D1ZD 1A6VL 2Y2WA 3TL5A 4DKTA 2WLLB 2J6EL 3FU6A 3KLAA 4K71C 3TX4A 1JNHB 4BZYA 4LGSB 3T2PA 1I7TB 2XY1A 1Q1PA 1ET7A 4JFXB 1SOKA 2QKIB 2YO3A 1QTSA 4PJXF 4LPUA 3DI3B 1JZGA 4JM4H 3QEGL 2VLJB 1WICA 1KDIA 5HJ3A 2VRAA 2GG1A 3GIZL 2AZUA 1OWRM 4YMPA 2XQYG 2FWSA 1KXHA 1NDGB 5BQ7B 4FX5A 2ZWNA 1FFOA 2ZAHA 1SGKA 5T33L 1G7QB 2R51A 4GI9A 4IM8A 1AY1L 4FQXB 4AYSA 1UJ3C 3FQUB 4BUGA 3TCLA 4CMMB 5H4YA 4M5YH 1UC6A 4WKZA 4F7KA 3X12A 1XGPA 3ETTA 2Q7AA 3PWPA 1NCOA 2EYTB 4JANB 2QGEA 5DS1A 3MLYH 1JVKA 2PWEA 2Z92A 1C8QA 3VFNA 4XHJC 3NZ8B 4LCVA 4J3OH 3BRFA 4JM4L 5I1JH 1O7DC 4ZNEE 3SDYH 1XGUB 4TNEA 4NIYE 1UURA 3BVTA 2DQTH 3WFEH 1TNNA 4HULB 2AV7B 1ETZB 1XF5B 3BWZA 4NHUA 2QMKA 1LQSR 1PLAA 3KYOA 2FQDA 4EBQL 1TQTA 4NFBA 4FXKC 1OD7A 3QDGB 3EBAA 4J8QA 3GPEA 1MG2C 3IWVA 4NO3B 4M5YL 2FT7A 1CYWA 1YN7B 4TTGA 3GTTA 3VG9C 2ESVA 4WAFA 5F7DA 3LKPB 3MLYL 3Q8AA 4JG1H 1ZANH 3IKKA 2Q7NA 3BEWB 3F5WA 4AVKA 3O8XD 4HUUA 3IEAA 1MVFA 3D0LB 2ITFA 5I1JL 5C0DB 3SDYL 4KY1H 3EYFB 3T3MF 4YEFA 4UM9D 3W5NA 4MMXB 2WTPA 4GAJH 2DQTL 3WFEL 1ORQA 3O3AB 1UWFA 2X9WA 4KBPA 4FDWA 2MCG1 4NQUA 2HLEB 3V95A 4JMXA 1IGMH 4WGKA 1X7TA 5CKAA 2WPGA 4R8WH 1HQRB 4RA3A 4XBMA 3ZYJA 4M6OL 1KPUB 5GPRA 1B9ZA 2J20A 2DTSA 1YYCA 3VH8B 1ZT7B 4JM2B 1DVQA 4JDZA 4JG1L 1ZANL 5EU3B 3F85A 1DSYA 1R34A 3LH9A 4TNVF 4D3CH 3PV6A 2WCPA 2GB2A 2WO2B 2ZQKA 2QELA 4KY1L 2O61A 1RVFL 1A6ZA 4MXWH 3RDTD 4GAJL 1G9HA 5DZLA 5HHPB 1XZ0A 1TZHA 1GOGA 2P43B 5HXMA 2IH1A 4QTHA 4FG6C 1IGML 3F7QA 5KS9E 3QI9B 4E9TA 5FGBC 4JL2A 4R8WL 2EC9U 1WE5A 4HKZA 4XBPB 4NBXB 3ZRFC 4K55A 5B39B 3CFDA 1A3LH 1UM4H 2EACA 2VLKB 3BMWA 4WWOA 5DD5H 4CUCA 4P23B 1S7RB 3SKMB 2P5WD 3ULVD 5I73C 3BW9A 4L8SB 4PLJC 4ZPTB 3PQYB 2K3HA 4D3CL 4P3CH 2CJSA 2CO1A 2NY3B 1LE5A 1KXVA 1OSZA 5AKVA 3EKCA 5CEZL 3LV3A 4E41A 5BZXA 5DD1H 3WNNA 3IU3A 4MXWL 4O51B 4BFBD 4QXWA 4XCYB 5C0AA 4FFZH 2P49B 5CJXC 5K5YA 1IAKA 1Y6NR 2XTLA 3QCVH 4MS8D 5I0XA 1THCA 1P53A 4MJHA 3TGXA 1J5CA 3D0VA 5CIPB 1RKRA 1A0QH 1A3LL 4QKTA 1LEKA 1SOQA 5EUOF 4PRHD 1ECZA 4J3SA 4LCCB 5JW3H 3IPBA 1YYMH 2R9HD 2R7EA 1F02I 2CRMA 4P3CL 4U1MB 4YXLH 4JEGB 4BXVA 3E3QC 2VDOB 1KGWA 3QUZA 3FB7B 5C70A 2PTTB 4PGEA 3L3IB 4H26A 5FKAA 1BF5A 2ICEB 3GSVB 3RWIA 1AGBB 3LN4B 2P5ED 4LLVB 5EOCH 4KZDH 4H44C 4NS0A 3U9UA 2F74A 3G04B 1UWXK 4N28A 4FFZL 3PP4H 1PGRB 4XR8C 3FU5A 4ZUWB 1U93B 3QCVL 2B5IC 4UQ2B 1Q4NX 3UTQB 3K1DA 5HBBA 4UNVA 3IGAA 4PJCA 4P59H 3ARFA 3RIAK 4JL1A 4NZTL 1TQWA 3BGAA 5B4MC 4LKXA 3AXIA 1ZEAL 4A7GA 4GUQA 3U7WH 4Y5XA 3SDDB 5EIIB 1YYML 4R7DB 4DGYH 4NUGH 4L2YA 5DO2C 3FQ2A 4N1EA 4QRPE 5C9KA 3D85D 1CXLA 1I1AD 2ENSA 3W81A 3VG0H 3SZKC 5DEFA 5B8CA 1F11B 3HI1A 1JI1A 5EOCL 3VXOA 2YRBA 4KZDL 3HS0B 4QHMB 2A73A 2AJSL 3P3YA 1PSKH 1KPVA 3PP4L 1XV8A 5SX5K 5T1MB 3U48A 4NT6A 2V17H 2JNZA 2Z7UA 4PJ9C 5DI8A 3LRGA 4P46A 3HE6C 4P59L 4U1NB 2CKNA 2PYFA 4PJFE 4IIQA 4N8VA 3VFSB 2L3BA 2WBWB 4OZHE 4TQHA 4D0CA 3BUTA 4OIAA 2ZWYA 5CILH 4NQCE 2IFFH 3BQUD 4FLQA 3WAKA 4NUGL 4DGYL 1FRGH 2YD2A 1K2DB 3K3QA 1ML0A 3FSZA 2KLSA 3NFNB 3VG0L 5CLXA 3ZKND 2KHAA 1QPPA 3MX0B 4OFDA 4M5SA 1PSKL 4Z23A 1CD9B 3IJEB 4U31A 1G4MA 4YPGA 3TPKA 3LPOA 1N67A 3ULVF 4CADB 2V17L 3MBWA 4KQ0A 3QAZC 3QUGA 4X6CB 1A1OB 4KH9A 4XVJL 1DQQA 1OWWA 3C09B 4K8RD 4MMYB 5I6XC 3ORJA 2WB7A 1HEZA 2EEAA 1M71B 2XTJE 1AHKA 5CILL 5E8DH 1FRGL 3LSOB 3X1NA 3NIFB 2N7AA 1NEZG 1PVHA 2LAAA 3KAAA 3L95B 4ZUVA 2XBTA 5BO1L 4LHUD 3B9VA 3DTXB 4IYKA 3V0GA 4EN3B 4F8OA 5KVMC 4JFDA 3H9HA 1IV8A 4FJYA 4XVOA 3V9EA 4YWGH 1TZAA 1NA8A 5CHNA 4A2FA 1U95A 5IQ9A 3NSYA 1HCFX 3QZLA 1FQ9C 2JLLA 4PN6A 2OI9B 1QA9A 5EB9A 2VDKH 3P4OA 4JFEA 5T1KB 3GB7A 1OP5K 4ZFFB 1ID5I 4U7KA 4MD4B 5KYYB 1GOFA 2WJ5A 5HHQB 5HI5D 1R5VB 5BO0D 4M02A 4LEXL 1AKJB 3MXWL 5E8DL 4Z7VA 5H94B 1EXUA 1H3PH 1DE4A 2OMUA 3CMGA 2WNGA 3KPSE 4HLZG 4QHKI 1X5ZA 3D12B 3FPXA 4D0DA 3TPUA 3VFWA 4P5TC 2PW1A 3VRLE 5K9OB 1GMEA 3OMZA 1UEYA 3PV7A 1N5AB 2EKSA 4U1GB 4ZFZA 1DUYA 1TDQA 4G6AD 2FO8A 2W60B 4IKLA 1NAMB 4OBSA 4P5MB 3PWNB 4YWGL 4I9WE 5HVFB 4XXDB 5FK9A 5HYJB 3GSRA 4YHNB 3TZVC 4AYFA 5HI4C 3FTYA 3RA7H 4OJEH 2VDKL 5BRZD 3DUHA 2HJKA 3GYRA 1N8ZA 2AJYH 5I8EA 4H0GA 4L8DB 3UX9B 1A6WH 1JTPA 4PI0A 1ULVA 4DPAX 1T66D 3EGDB 3VDBA 3DVNA 3UXFA 1H3PL 3Q44A 5ACZA 1H0DA 5ICXB 5CBEA 1EMTH 3LZFH 1L9QA 2VKWA 5C09E 5FIEA 2JJWA 1RLWA 3HG0A 1U8JB 4N0UB 4PRID 5H37G 1M1SA 1TJIH 2A6DA 5KSVA 3NFPB 2X0VA 4B9FA 1J5OH 4P5KA 4RMRA 1CD1B 4PV9B 3VVWA 4ZAKB 1IC5H 1JS4A 1ZLDA 3IMBA 5DJ0A 1MW1A 2EE6A 5ID0A 3OHXC 3T2QA 2AJYL 4KTDH 5JLZA 3SDXA 1ZIAA 4NCC2 5HGHA 1HCVA 3FBQA 4GOSA 3I6KA 3RUGE 3HN5A 2VKXA 4M8VA 3B9KA 1EMTL 3LZFL 5E8OB 4DOHB 4X6EB 3S4SA 5LDUA 1DVTA 2UZYA 3FQ1A 1NCNA 3D39E 1TXKA 2FQEA 1TJIL 3P2BA 5J7CC 2EVFA 4LLQB 1AE6H 1J8KA 1FVDA 3V6OA 1QFPA 5T1LB 3APDA 1J5OL 2N3JA 1IGTA 2D7NA 2PCXA 2VQTA 3LD8B 3GS0A 3RWFA 1KACB 1Z3GH 2G0LA 4JQVC 3OKMA 5CM1A 4F92B 3BWAB 2GJ6A 3FUFA 1AO7E 3ZYIA 5HJGA 4AVJA 1CFTB 1IC5L 2PR4H 1J87A 3OXSA 1MWAA 3WY2A 4F91B 5D7EA 3W38A 1AOZA 3O9WB 1X9LA 2VLRB 2IPKA 4KI5D 5KBMA 1WUZA 5F7LB 4O5LH 3VXQA 3R1GH 1L0PA 2B14A 2DMGA 2DEXX 2KERA 1L7IH 4K23H 5FFOA 4HLEA 3O6FB 4PCTA 4CVXA 3V6ZA 2AK4D 2OTUB 5A2JH 3WIIH 3B6SA 1AE6L 4AVIA 1Y1DA 4WDIB 4YC2C 1E7VA 5DYFA 4HS6A 2A3TA 3LNDA 4OBRA 1EFXD 3VFVB 1Z3GL 2AJVH 5HYSB 4LCWD 3AG4B 3FU7A 5CD3A 2QR0A 1G9ML 4GP5B 3BWSA 2PR4L 3VXTB 1HIML 2E7LA 2OPCA 2H0EA 4RWHA 2CHZA 1GCYA 4X8GA 2VJ8A 1T7YA 4TVPE 3UGUA 25C8H 1U3NA 3FU3A 5HVHB 2D73A 1J9QA 1IEAA 3DXAA 3AREC 1G7PB 1JVLA 4LVOB 4P9HC 5FYLE 2BW5A 2OULB 5H35A 2A99A 3DURB 3C9NB 5I9QC 3MNVA 4O5LL 4PJ7B 5B1BB 3R1GL 4TUUA 1HN1A 3QUHA 4K23L 1L7IL 3ZHNA 1Y7VA 2C8NA 5DMGC 4KZ0A 3GDBA 4GQPH 4FFVD 4DEPC 4ZX5A 4EUPB 6FABH 5CUSL 2H8PB 3IFNH 2F7IA 4ES8A 2QFRA 5LGHH 4TN9A 4F3FB 2JJTC 3SO3C 3GMNA 2AJVL 5E6ZA 2XV6B 3VM7A 2X6BA 1T4WA 3KWUA 2APVA 3HI6H 5IW1B 3BFQG 4G7QB 3OKDB 4N2BA 1V55B 4IU2A 3L8QA 25C8L 1PX8A 4PR5A 1AP2A 1MVYA 5AFAA 3NSJA 4L4TD 4AGMA 1JFHA 1ES0B 1ZA3A 2EDJA 5DUPH 1CICB 2WBJA 3LKOB 2GKIA 2WLNA 4S11A 4AZ8B 1U2CA 4OW6A 2ITDA 3QPQD 4HIIB 4AEHH 5LQBH 2AEIT 3DO7A 4DEWA 6FABL 2FSEA 2WTRB 2EH8H 2I7OA 3FS9A 3AU0A 1SOXA 2Y7SA 5I0VA 1HL8A 5LGHL 5TH2B 2NNAA 1P84K 5HPOA 2WIMA 4X9HA 2CRZA 1QFWI 4JUSA 3HI6L 5DJZA 3B9EA 3B1UA 3JTBA 5E6ID 3U0TA 5EMYA 4QRRD 2GSGB 3L4ZA 5HDOA 2Z4QA 3L4WA 5IW3A 1M05B 3GHBL 2XN9E 1C7SA 1NZRA 4WNSA 3V4LA 1I8UA 2JQMA 2V9QA 1RUQH 4QOKE 3BRGC 5D1ZI 4FQLH 4P4KA 2HFFB 3O4OC 4PW3A 4TKWA 5DUPL 3HG4A 4GAYA 3RVTD 2IADB 2IOIA 5LQBL 1OK0A 3KWTA 1ZA6B 4MA1C 5KSAA 2EH8L 2QHLA 4WFHD 4XAKD 3W2DH 4OT1H 1VEMA 5IFJA 4Y4KD 5FF6A 1V3JA 4YO0A 3PNWB 1FNEA 2B59B 4I18C 4KI5F 4CU7A 1SVZA 3DGGA 2RA1A 1C16B 4K73A 3T4AC 4ATTA 5C8JB 5SWQB 4IBVA 1GSKA 4ZS6D 3PIQA 5FUOH 5I76A 3H2PA 5J3HC 3NCWA 1UTDA 1YA5A 1RUQL 4FABH 4FQLL 1L9NA 1KTBA 5K9KA 2XJKA 4OLZH 3DK0A 1G7LB 1RK0A 3VDAA 1E2WA 1N59B 5CR8A 1XDTT 5DJCA 4YDVA 3W2DL 1RZQA 4OT1L 3ILPA 2F18A 2W9LA 3ZHKA 2F53A 1CFSB 1F97A 1KTKE 2WN3A 3N43F 3SJVA 2RFXA 5I1CH 2AJ3A 3QO1B 2DQEH 3H55A 4M4RA 4H1LH 3VWJB 1K4CA 2K3TA 5I16A 3WAJA 1GRWA 4J27A 5FUOL 3HC0A 4XXCA 1J8HD 2DLTA 2Y22A 5K59E 2VJXA 5F7HA 4FABL 1JGLH 3KLKA 4TV3A 1X4ZA 1D5MA 2J55A 1I8AA 3JWNC 3FRPA 4L3EE 4OLZL 1AD9B 4U1SB 5ENWA 5AW3B 1G7JB 3HLAA 1AGEA 3BP6A 3QFJA 1THAA 1VFAB 1KWKA 4QNPF 5ECGA 4UMSA 5GSVB 2DQHH 3MRFA 3MR9B 3KPPA 2KKQA 5D7JB 1TZIA 4BK5A 4N2GA 5I1CL 2HH0H 4QRUB 5I8OH 4KKCD 1KBKA 2FT6A 5FOJA 4XB8A 1LJMA 1FSKB 1FNGA 3UMTA 2DLIA 3X1FA 4B0MB 4YR6A 4NRYB 1JGLL 3QEQD 2GBTA 4A55A 2NT0A 3VFMB 3NJVA 4GS7B 4RETB 4UILH 1T21A 4UBDC 5EIQA 3IXAA 1NGXA 4ABVA 1SZNA 1YVLA 3PS6A 2R29A 2YEQA 4W93A 4WO4D 4X4MA 4B9JA 4X4KA 3GMOA 2DQHL 4OZFA 5HHVL 2HG5A 3TYFA 2EDYA 1BXAA 1EIBA 4XVUC 3OVUB 3PFQA 4Y2DD 2VDQB 2WM0A 3U4BH 2HRPH 4MQTB 5FAAA 5I8OL 1B2WH 3UACA 5CO1A 3HCVB 4KXZH 4N2KA 3KGRA 3MRJA 3AY4A 3RGVD 4IGBA 5F88B 4JGUA 3QC5X 3CBRA 1B88A 4FL4B 4HEPG 2EDXA 1JMXA 4LQ1A 4OF6A 5DYOB 3FHEA 4UF7C 3D48R 3TVMC 3V79C 4UILL 1RJCA 1A9BB 2VSMB 2YJLA 1T1WB 4MYPA 2NTSP 5KBNC 2CO7A 3HFMH 4BE5A 1OSPH 3N55A 4JRXA 4F33B 5IT2H 5HSFA 2AAAA 3SB3A 4I9WD 4HFWB 2ITCA 1QHPA 2GPZA 1LEGB 5DHVB 3U4BL 1HH9A 2HRPL 3QXDB 1BMGA 1B2WL 4DKAA 4S0SD 3B5GA 2KZ1B 2DJ4A 1NQBA 2V4LA 2GAZB 2YGNA 5KVEE 1WS8A 3QQDB 3ISYA 1S2EA 3C6EA 3UZEA 2Z8SA 2WVVB 1W72H 2V3FA 5J0BA 3JWDH 4OCNC 5FHBH 3H9SA 2YAHA 2HVJA 2ZXWB 3DV4B 2WQXA 1AZZC 1PKQB 3DMMC 4N8VG 1OP4A 2CXKA 4M7LH 4ODVH 3VQ2C 3W3BA 1NGYA 2VSCA 4MSWB 4IRSC 4XRCA 1RIHH 3MJGX 1KLFA 3P4NA 1GW6A 2XETA 4N2FA 3HFML 3US0A 1OSPL 4FTVE 5IT2L 1IAIM 3S36X 1KXQA 2MQCA 5DRNA 5FV1L 3LQAH 4G8GB 2O72A 3KPLA 4PJHA 4ZMXA 3MOAH 3OQRA 4N6RB 3TO4D 3EF4A 1FP5A 4IHBA 1NMBH 4DGUA 3VI3F 3CVIH 2DQFA 5ETUA 4F8NA 1EXHA 4G83A 4UQ9A 3ULUE 1NWOA 3UBXI 3B56A 2A2QT 3JWDL 4CAGA 1DN0B 3WELA 2B08A 4M7LL 4ODVL 3DIFA 4HJGA 1RIHL 1I9JL 2AXHA 1RV6X 3EOBA 2YC1A 1I7RA 1IGYA 4RZCB 1XAUA 5DU7A 4KVNH 3VJ6B 1HESA 4U6HA 4MCNA 4UV4L 1FZKB 1ITCA 2ICWI 3P02A 3LQAL 4HV8A 3O4LB 1ZV5A 4LDCA 3MOAL 3PL6C 3ZKMD 1X5AA 3KWWA 4WSJA 1ZIBA 3MOBH 4B9CA 4QPEA 3L5XH 1NMBL 1QRNA 1K5NB 4NPYB 3CVIL 2ZXDA 1S7TA 2F8VA 4K7FB 2ZWLT 3LHAA 5FUCE 2GIXA 5GGSY 2VZUA 3ZDXE 3MC0A 3AAZA 1HE8A 4UQEA 4DKEL 1GPOH 1MHCA 2XVBA 2YKLH 4WI9A 4Z7WB 3KS0H 1QNZH 3HKFA 4M8QB 4U3HA 3P9MB 4WJKB 3RWDA 1R47A 4KVNL 3NMEA 4AZUA 4JBSA 4NQDA 3AS2A 2H4EA 4ZBJA 4AE0A 3AS3A 1XGZA 2DLEA 1BPVA 4G9FD 4JFUA 3BESR 4JRLA 1HCZA 2JKRM 3Q9PA 1KIPA 3MOBL 3C5JB 2X40A 3L5XL 4R4FH 5HGAB 2P28B 4A67A 4I13B 2DH2A 2Y2TA 1FORH 1HHGA 2UXVA 2NW2B 2XN2A 3C60A 1L5GA 2O30A 2ENYA 3VSQA 4HUVB 5E2WH 5TDNA 1GPOL 2YKLL 1MCLA 1QNZL 2ADGA 5T5NF 3NJHA 3HLKA 4MJ2A 3NACH 4U1HA 1FL3A 1CFNA 5DJYB 2CJTA 2A77H 1KC5L 3RWHA 4A2GA 1B0RA 3C6SB 3FAWA 2AJUH 2VDLH 1FG2A 3WNIA 2H32H 5BZWB 4BWTA 4GRWE 2J8UA 1RK1B 5IR1A 3PAZA 2WLIA 1ND0B 2WWMD 4AQ1C 4R4FL 4KVCH 3MLPA 1FORL 2JJSA 1K4DB 3FO0H 1DBAL 4CVZA 4NQSA 1VZIA 3FTWA 2BNRA 3PWLA 4FE9A 3NIGB 5DRXA 3SQBB 3Q5YA 5J6GB 3RKPA 1A9VA 2P1YA 1CS6A 1BBJB 4X98B 3DX9B 3IDIB 2FB4H 3TO2B 1DZ0A 1NBCA 2P24B 2YBRA 3NACL 4WW2A 2ZX8A 1RIUH 2A77L 4R7VA 4XN1A 3VFUB 4L4JA 5D7IB 3S4SG 5I6NA 3HPLA 2AJUL 4FLHA 1QD0A 4JHWL 2WLLA 4PD4K 1N0XH 3ZDWA 4AJ0A 3NEXA 2B2XH 4ECNA 3IFPB 1YEJL 4YBHA 4HVBA 1J0KA 1H15A 3O6LH 3R0MA 1KB5A 3J27A 4KVCL 1WJ3A 5HDBB 3VXMB 1B9KA 2MJWA 4XTRD 1M7DA 4NWTH 4NO0B 4DAGH 5IMLA 2VLJA 4V2CB 1EEYB 1J7VR 3DPBB 3WFDH 2R0WH 2Z0BA 4MNGE 3QIWA 1NDGA 5BQ7A 1UOKA 4WENB 1UD5A 1SMDA 2FB4L 5FM5M 4PG9A 5LBSH 3MAWA 4HUKB 1SFHA 3BVWA 2LU5A 1RIUL 3BISA 3EYOA 4MNHB 1E3FA 1N0XL 2EYTA 2B2XL 6CGTA 5D2NE 4FYTA 3O6LL 4PLKC 2X0WA 3V0VA 2XWXA 4JDEA 4J2QA 5KVGH 2OXHB 1EH9A 1BD2E 1ZE3C 1Q1JL 4PGDA 1XGUA 1EAPB 4P2RB 1I1FB 4NWTL 4DAGL 3MZGB 1YDPA 4MXQC 4OU3A 2M1KA 2R0WL 2AV7A 3I02B 3LNEA 3SPJA 3W39B 1XF5A 3VWKC 2NY2D 5TPWH 5LBSL 4PQXA 3VYOA 4HX1B 2FIKB 1G1CA 1I9RH 4DGWC 2DV6A 1BECA 1JPSH 2PO6C 2L8AA 5IMMB 2ZKMX 2TSAA 3FO1B 1ID2A 3QQ9C 1DLHB 5HYJE 4OZGE 4G70B 4ZOCA 5DLLA 4H8HA 5TD4A 4NKDA 2X70A 3RX8A 3ZDYB 5KVGL 2PR9A 3MTXA 1G5AA 1W8OA 1MY7A 4Z7UB 5AYQA 4PJDA 2VERA 1QSFB 3RZCC 3O3AA 5B1JA 2YR3A 4H40A 3K6DA 1A2YB 1CTMA 3OQ3B 5FYJU 2OP4H 1HXKA 1JF1B 3VFGH 3F83A 1S7WA 3QG7L 1KGCD 3HC4L 5D1XE 5C0FB 3ZQXA 4WI8A 1JPSL 3ZE0E 4RRPA 2OSYA 2G2RA 5E0QA 2VN7A 3M6DA 2FEDD 4Y4HD 4MCZB 5F89B 2APXA 5IB2A 5L2JA 1GZQA 4X9FA 5F1OB 4CDGC 2K1MA 3A5VA 2EO7A 4FQHA 5C08D 4ACTA 2QZQA 3EUDA 1BF2A 4YX2H 1YJDH 4YLQT 2CDFA 2VDRB 1HXYB 4HHAB 3L2LA 2VSDA 1QFWH 3PWPE 5J06A 2GVYA 2IH3B 4AKPA 3ZTCC 3FTUA 2WLZA 2NY0B 2OP4L 4M9OA 1LTXA 1CD0A 1GHFH 1N8OE 3D9AL 1M2VB 2DYPB 3QIUC 4XBPA 4XOCA 2ROYA 5DQJA 2I9LA 3PGDB 3FZUD 5JIIA 3FFCD 1QW8A 2D7QA 1MIMH 1DVFA 4Z7QB 3L4CA 3S0PA 1HZLA 4ZPTA 4O2EA 2Z1KA 1EANA 3L7FB 3IRZA 4LBEB 3FPYA 2IDTA 2BINA 2NXYC 5AAWA 2XPZA 1SXSA 3V5KB 2EJ1A 4YX2L 2ZKHL 2PYEB 1YJDL 1Q9OB 3DC0A 3FT2B 1IE5A 2VLRE 1RHFA 3O3BA 4JRYB 4XCYA 1K3ZA 3KE0A 3L6FA 3WXWH 5E8EB 3TH4T 4HJIA 3FCSA 5IY5B 3UTSD 1GHFL 4BKTC 4RNRA 3EJZC 1LP9F 4ZQKB 5IJKC 4I1RA 4QRFA 1KBBA 1MIML 1O6VA 3MBEC 1GS7A 3CDZA 4OD2B 5D96B 4JFOA 2CRYA 1YMMD 4U1MA 3PHQA 1DDHA 1YPZB 3I75B 3IE4A 3FB7A 3GSNA 2PTTA 4MAYA 1JRHH 5BOPA 2ICEA 1B4LA 2OYMA 3HC2A 1VGKA 2ZCZA 2EE9A 2CO6B 5KAQF 3G04A 4YL9A 3EG9B 3WFHB 4U0RB 4WFEE 1Z9OA 3WXWL 1HX0A 1BQLH 2GITB 1U8OB 1E28A 3LKQB 5HHNB 1NCWH 2X05A 3WJJC 4G80A 2BNQD 3LPPA 3PE9A 3QXTA 1BJ1J 1I82A 1AXSA 1RCYA 1HJCA 1ET8A 3DO3A 3HI5H 2XIDA 3P30H 5IJCC 2FL5B 2VITA 3SDDA 1RJYA 1IKOP 4YJZL 3IE9A 3NA9H 4R7DA 5EIIA 2WK2A 3UTOA 3M45A 2EP6A 4LNRB 5G5DA 3QZMA 1JRHL 3E80A 4LKCA 3INOA 4KKBD 1JV2B 3FN3A 3FOLB 3MV8B 4M5ZH 4RGMB 5CN1A 4YHLH 1YUHB 3MUHL 4LIQH 4J4PC 4NYLA 1IARB 1F42A 3GNMH 4BGDA 4U3XA 1BQLL 4XCNB 3EADA 5T1MA 5TDOB 1UT1A 1ZHKA 2ZNWA 1QPXA 5HYQA 3WNKA 4OD1H 3CSYA 2XZAH 3CNKA 1E3ZA 1F1AA 4ODUA 3CXHJ 2NY4B 4W4OA 5I82A 3KLQA 3WEAA 1JI2A 1U8MA 4TQEH 3HI5L 1FGNL 3P30L 5C0AE 3EJYC 1RZKH 5FCSH 3L9RA 4R5TA 4PWFA 3GXMA 4H0HB 4EVNB 3NFNA 3AT0A 3HAEB 2BHFA 1E27B 3FYEB 1KEGH 4UOW1 1R6VA 4YHLL 1TVHB 2IAMC 4M5ZL 4ZO8A 3MX0A 2HX7A 5B1KA 1R24B 4B60A 3IJEA 3OB8A 1T4KB 3GNML 2F7QA 3KGTA 2DQGL 2NTFB 4OD1L 3X14B 2NOYA 4OLUH 1FZJB 2XZAL 4RX4D 5DJ2A 5I0YA 3GZOA 4ZYKB 2HT2C 3KXFB 4TQEL 2DF3A 1EHAA 3ULVH 5IJVA 1REIA 3QDJA 1RZKL 4K71B 5CJQH 1JAEA 5E00A 2MPAH 4I1NB 3MKKA 1ZDSA 5J9PB 4X99B 3Q43A 3PGFH 4Y19B 4PRDA 1X9QA 3OMIB 1X5MA 3RY6C 5KG9B 4JFYB 2R69H 1O6SA 4PJAB 1FV1B 1DSWA 4EJ1C 4KMQA 1Q94B 1MFEH 4UNUA 1BM3H 4GRLB 1F90H 2EQDA 3VM5A 1EV2E 2EH7H 3N0AA 4OLUL 4Y1AD 5IMOB 4MZ2A 5C0CB 4BFEA 1WO2A 5F71A 1MDAA 2VNCA 2YEZB 1SJHA 4GBXA 5T1KA 1UJ3B 3PGCB 4N5UA 4ZFFA 1P69B 4QHNB 1J9TA 3ULVL 4MD4A 4PD4J 3IXTB 4MRBA 1AD0A 2BMKA 5ALBH 5CJQL 5I18H 4LZKA 1PL3A 2MPAL 5C07D 3FO2B 1U8HB 3HC3H 3GINA 3MV9E 2O93L 3N50A 1L9PA 4W9IC 4Y16D 4GSXA 3L5IA 1CDUA 2R69L 1NFIA 3MV11 1J0YA 4ZTOH 2YPLB 5KVFE 4Q9QH 3K6OA 1LMIA 2W60A 3DV6B 1MFEL 4P5MA 1SNRA 3PWNA 2ENQA 4GMSH 1BM3L 4MJ5A 4XXDA 4P2QB 1RJZB 1F90L 1D7DA 1SDYA 2LGNA 1S9XB 5KSBA 2EH7L 3TS8A 1MCQA 2BSRA 2P46B 1H8LA 2AW2A 3IN0A 1CYXA 4FXKB 3RWGB 4X5LA 5DJ8A 1ICTA 3VFRA 2OTPA 4OIBA 1RFDH 2CHXA 2DQCL 3V5DB 3FONA 4G7SB 4HIJB 5ALBL 5I18L 2K78A 3KPNB 3HC3L 3HZKA 5ICXA 3TT3H 4PS7A 3WU1A 1KSRA 2MEJB 3KYAA 2A6JB 1MFNA 5IQOA 4XZUA 3AITA 4ZTOL 1FL6A 2ZXEB 1FC1A 2WNXA 3TNNB 3WUWB 1JERA 1R3IL 4XMLL 3BE1H 4HUWB 3R18A 3ARRA 2ARJB 4KRPD 4L9DA 5I1AB 2G0KA 1X5LA 2C7UB 4J8RA 1E2VA 3GBDA 5JW5B 2YOCA 2B1AH 3P4MA 1AGDB 4A7TA 2FATH 3ECWA 1KG0A 4FCAA 1PCXA 4LHJB 1U91B 1RFDL 2D2OA 1EAOA 1PQZA 2X89A 5DFWH 2JIXD 5E5UB 2XICA 3VMPA 4LSSH 4ZMYA 3V0IA 4LVEA 5B7EA 2L0DA 4HIPA 3L4YA 1BD2D 4X6EA 3P9LA 1WWWX 3FT9A 3Q48A 3WNLA 4F2EA 3L7EA 4QTFA 2OJZH 3WFCH 3KHOA 2VTFA 3P1VA 4LLQA 4OF0A 2HFEB 1SJEB 1ZVYA 3BE1L 3HW7A 4HCRH 4PBDA 2GIYA 5BCAA 3BWAA 1FL5B 4QAMB 3EYQD 2B1AL 2HRHA 2V9TA 1KTLA 1WUNT 4K8RH 5HGBB 4ELMF 4KK6C 2IDUA 3A3YB 4LSSL 4N85A 1TKWB 1WA1X 3K6SB 5CCHE 4QHLA 4JFFD 1PPIA 4XP4H 1J1OH 3U1QA 1XF3B 4KDVA 2NLJA 5J1SC 3ARGD 5C97A 2OJZL 4J3OG 2OTUA 4XBGB 3WFCL 5EOCJ 2ADFH 3QIBC 1GKOA 5C7ZA 4WDIA 1FNHA 1P1ZA 4GG6B 2R0LL 1PKQE 4R9HA 2JCCB 5HYSA 1RP8A 2MQ3A 5EZIH 1UCTA 2PPDA 5JXAH 4I0PC 1X9RA 3GXTA 2GC4C 1YMHB 1R5IB 3S7GA 1F3DH 4K8RL 2OW7A 2WLMA 2RGSA 3NCXA 4D0BB 1XD1A 5T3ZD 3AQYA 2UUDK 4GW5A 1P6FA 2EEDA 4LLUA 4PJ7A 4XP4L 1J1OL 3HZMA 1NGWA 4O02B 3DX2A 4FA8A 5AYUL 3TP4A 1DR9A 2ADFL 2H8PA 2XZZA 4PJBF 4YAQB 4ZFQA 1IFRA 3SDXE 1NCDH 2OJEB 3FQNA 5ESQA 2WVUA 3CHXA 1ETJA 1YG9A 2Q76A 5SX4I 4MZRA 3UTTB 6PCYA 5CU5A 5EZIL 1FHGA 3INUH 2VLMD 5JXAL 1OTSD 4W81A 5AOMA 4MFHA 3I6SA 3MRLA 3EFDH 4PRBB 4FLRA 3MLZH 4PB9H 1HOEA 3ZTJH 3MVSA 3LN9A 4OB5H 3QUMH 3ZRSA 3F64A 2E7CA 2E27H 3S2CA 3W9EB 4J3VA 4UTAH 2XZCH 3M1BA 3O4LE 3VI4F 1S5HA 2G9KA 1MIEH 3VD2A 4JO8A 4X6DA 1WAAA 4HIIA 2LLLA 2WTRA 4HYTB 3ZBMA 1KLUB 3EH2A 1ERNA 3WNJA 5ACMA 4OAWB 3DHPA 2DIEA 2ESVD 1KLGB 1FN4A 3STZB 5FO8A 1BG9A 3B2MA 2QQKH 2K70A 4H1LA 3MRHB 2A1WH 4YGVA 1ADQH 1HE7A 4P8QA 2ATKA 3S3JA 3UO1H 4NKQB 1K6QH 3EFDL 4KO6A 4WWPA 1DVUA 3G6JA 5EULV 3HE6B 4PB9L 4OKVA 3WENA 4OB5L 3ULAB 1MFMA 3QUML 5IHZA 4B3EA 1TMQA 2E27L 2O5XL 4P9MH 4UTAL 1F4XH 4MDIA 4N3TA 3OX8B 5G4MA 1XXFC 5IEHA 4PW4A 1MIEL 4PVMA 3Q3GB 1XCWA 2IADA 3EDFA 4UT6H 1E8YA 4ZXBD 4U2ZA 4MXVF 2QQKL 3NIDE 3APFA 1B2YA 2A1WL 3SKNA 2FHFA 1ADQL 5IGXH 3SGEH 3KJ6H 5ITFB 1J10A 4N9OB 3UO1L 3IGFA 1K6QL 3EXJA 4YXKL 1YUKB 3MJ6A 4MRCA 1RZGB 1AQ8A 5C8JA 2ZOKB 2X7LB 2WZPA 1HKLH 3GD1C 3OKOB 2NUPB 4HT1H 5I6XB 5DK0B 5GRJH 1DQJB 2D7OA 4UIKH 4XI5D 1F4XL 1S7VB 1MNUH 2Y5QA 4PPTA 4Z7OE 4YK4C 5SWSD 1MCBA 3TA3C 4MDRA 2EICA 4RRPG 3K1KC 4ZMPA 4QWWD 1N59A 4UT6L 3QR1A 2AGJH 3PP3H 3K6NA 5JUEH 2HXAA 2A9NL 2RALA 5D7SH 3NIGE 5GS3A 1XAKA 4Y5YC 5HY9B 2BP0A 1XR9B 3L9YA 1QLEB 3RVUD 1W91A 4PREA 3APMA 2FWLB 3QO1A 5IGXL 4LDLB 1OAYH 3KJ6L 3QUXB 4K5LA 1XMEB 1CIDA 3VWJA 1WBZA 3MSPA 1AHWA 4NN7B 4ODWB 5G4OA 4E41D 5ADPL 1OT4A 1HKLL 1MW3A 3FTGA 5D7IE 4OCXH 4XCFH 3CZUB 5GRJL 3I6GA 2F54B 4ALAH 5B39G 2XWEA 2WXJA 3K0YA 3ZX1A 1BCIA 1MNUL 2DMKA 4U1SA 5D6DC 2YGVA 1WFNA 1NM4A 4P5TB 1TVDA 5HDBE 4PJ5B 1JP5A 2AGJL 5E2TH 1R3JA 5GSVA 5JUEL 5D7SL 3US1A 7CGTA 3D34A 2P8MA 3WHXA 5CNHA 1KXTA 3O2WL 4JJ5B 1E42A 1I31A 2ADJB 7FABH 1IL1A 5JXED 3P2DA 1OAYL 3QUZD 4GKNB 4B9IA 4BQ9A 2OMWA 5A2KH 6TAAA 3WJLA 3BVXA 2XACC 4JPSA 2ZSVB 1LDSA 1A9EB 2IDCA 5F1SA 1GS8A 1OF0A 4KKLD 4OCXL 4TNGA 1W72A 1VFBB 3CLFH 4XCFL 3W11D 1OE1A 1HSBB 1XCTB 5I1KH 1UD4A 5F7NC 4ALAL 3QORA 3EF7A 2W5PA 4NRYA 4C4BA 1FZOB 3JQOB 1FDLL 5EO0A 2G60H 4QXTB 1TLKA 3FHQA 3REWB 2YFOA 4UZSA 3MJ9L 4LLYB 2VMJA 4BFKA 1U8KB 2BWQA 2PF6A 4XPAL 4AQOA 3ARFD 1KENH 3T04D 5E2TL 2P8LB 1J1XH 4GAAA 3REVA 2VISB 3HNVH 3ILDA 1MCIA 5DK2B 5AZUA 5BS0D 4MJIB 1PD0A 3P69A 4HS3B 3GLZA 5FFLA 4X5PA 5JZ7D 4X8JB 5JIMA 1J48A 4KKAC 5IBLC 2G2PA 3CDCA 4YDMA 4N86A 3RJOA 1EZLA 1IE4A 4O9HL 5HD8D 1KIUA 4GAGH 8FABA 1OP9A 3C8KA 1EJFA 2IDSA 1QATA 5F88A 4XXWC 1RK7A 3WXVH 3OHXB 3CLFL 4APXB 3TN0C 3LKNB 3K46A 3B37A 5I1KL 2ZD0A 3HS8A 3RPIA 2E7DA 1OVZA 2CIIB 5DYOA 4J3BA 2HKHH 1GYCA 2G60L 2VRKA 3SDAB 1WFJA 1NTDA 2FZ3B 4AV0A 4WJ5A 4P46D 4ZPVB 1YC8A 4XN4A 1CPUA 1KENL 2CDEB 2GY7B 3RPBA 3HNVL 4IBLT 5EIIG 4F9PA 2OCCB 1P0SE 2FJGB 2Z7WA 5L2KA 1OCCB 1VKXB 3L1GA 1GS6X 2LAGB 3QXDA 3LS4H 4B9KC 4ZG1A 4AUYA 3T4YB 1IC1A 4JO2H 5FW7A 3T6WA 1ZJBA 2DDQL 4GAGL 4LRIA 1AG6A 4MNQE 5SWZA 1JWSB 4GEIA 1EGJH 1QVOB 3WXVL 5DD0H 5IG7A 1FC2D 4NO2B 3PFUA 1NL0L 2NYKA 4YFDB 2WVVA 1OAJA 1EZVX 1U8NB 2HKHL 5K9JH 2UV3A 5FECB 3ZSSA 5AB9A 1P5UC 4IRZH 1PAMA 3WE6B 3D30A 5C3IA 3P3UA 4MSWA 3SYOA 4APQA 4FQ2H 1M6OB 5E1IA 5AW8B 1OKEA 2DI9A 2DM3A 2FH6A 4JHBA 1TJGH 5C6PB 2PCFB 4YSTA 3IETA 2ZAIA 4EI5A 3RDJA 5BZDB 2FQGA 3LS4L 3AXLB 2EIEA 5T3XE 4JO2L 3V4PH 1CR9H 3MDJA 4U3SB 1DO6A 4Q9BA 1Z66A 1Q9LB 3MCKA 4Y2NA 3ECVA 5D7LB 3CZSA 5DD0L 3SBWC 2AXFA 4JFDD 4Z7QE 2JF1A 3DVIA 4ZTEA 1UCBL 3VQMA 4AC2A 2OXGA 1AMXA 5K9JL 3SPVB 3P4LA 4OM1H 1DN0A 5JORB 4IRZL 5FOBB 3IAPA 1CLOH 1J9RA 1JNLL 3QUYA 1LO5B 2F8XC 1BZQK 2A4ZA 4FQ2L 4LCIH 5HYFA 4B9YA 1E4KC 1ASPA 2E76C 2DY2A 4UNIA 1TJGL 1QSEB 4JFED 4RZCA 4MKMA 2H32A 2J1ZA 2X3CA 5FDWB 3BFWA 3BLPX 4UUJB 1PZCA 5F1IB 3SO3B 4TUOB 1MFVA 2V7HB 3TBSA 3T1WA 3V7MA 2CPUA 3HUJB 3V4PL 4I5BA 1CR9L 1XIWA 3MTRA 1E5UI 4PJCF 3RIAF 3CFNA 3CSPA 2KDYA 2XTJC 3GGWA 3Q2NA 4I89A 5J13C 1IIIA 3H9ZA 3RILA 3KVQA 1P5VB 3AWEA 4OM1L 4D94A 4PSRA 3BQVA 1CLOL 1YPZE 4LCIL 2YARA 1XX9C 5HDLA 4X2UA 3P9MA 2FO4B 3BN9D 4UIMA 5AAMA 1KYUA 4FD0A 5CMAB 3CG8A 1VACB 3FAXA 3IT8D 2GSIB 1JZ4A 3F7YA 4M6AA 1OOWA 4X8CA 1S7SA 4HPOH 3C5ZC 3H9SE 5JPNB 1IKFH 5FYKE 2FUQA 5B7FA 4TRPH 4P0DA 2CZNA 5E2JA 2CKBH 5HGAA 4AENA 2JKWA 3MRKB 3AS0A 3WD5H 4LCYA 3HG1A 4NI3A 4OJYA 3O2VH 4TYUA 1BGXH 4G9DA 3ISRA 1FO0H 4PJXA 4HUVA 4JO5A 1OM3H 2BY0A 2XTSA 5EZLB 1NMCB 5EBWB 5LBSA 4P9HH 4PM1A 2MOQA 3BUDA 2CGYA 5TE6L 3UYRH 2X0UA 3SKOB 3MV8E 1GCFA 4UANA 1A7PH 4E9SA 5DJYA 2VMFA 1GJUA 1MCWM 3IU4H 2DEYX 2HWZH 1IRAY 3FSAA 4JFTA 2H6OA 5E2UH 3D2UA 3B9KD 4HPOL 5JYLA 3V9CA 4I18B 1IKFL 2AZAA 4PJ8C 1WZ1H 2EDNA 5D2LE 1GGBL 1ND0A 4TRPL 1KCRH 4QRTB 1BX2A 2QVKA 1U3HC 3T4AB 1UYWH 3WFBH 3WD5L 4LLWB 1XGRA 4HJ1A 1AS6A 3O2VL 1F00I 2Z93A 2YAPA 3WLBB 1FO0L 1K8DA 4L37A 1TTAA 1OM3L 5J6GA 2GJ6D 5GRXG 2DM2A 4L1LA 1UB6A 3UYRL 3RVWD 5E8PA 2QGCA 4Z3TA 5IVZB 3UJIH 1PZ2A 1A7PL 1MUJA 1XEUA 3IU4L 2CIKA 2L7UA 4FMKA 4TL4A 3T3PE 4KC3B 2HWZL 2Q1EA 4F80A 5AAPA 1YSOA 2H0PA 5HHXL 1ZT1A 4KVPA 1EJ8A 2OW6A 2VC2B 1WZ1L 4BEIA 2XBDA 2VABB 5C0NC 1KCRL 4LCUA 4ZZKA 4URTB 5D1QD 2EVHA 1D5BB 2E6QA 1UYWL 1MZZA 5F3BA 1DQVA 2WQRA 3UJJL 4ADGA 2NX5A 2YD0A 2IWEA 4C54A 4NQDE 5T8IA 3IJHB 1IEBB 3JVGA 4EDXB 4Z7VF 4C55A 1DCEA 1UB5B 4Y19E 5AG9A 3N42F 4N0RA 2WIIA 3UJIL 4XMUA 4RMQA 5ICYA 3DXAD 5ESAB 2J8HA 1DBKH 3QJXA 1UH3A 1ZK5A 3MOQA 4JMNA 4Q6IB 2JE8A 2VM9A 3JWOH 3OAYH 2BX5A 1YEWA 5FO7A 2FCBA 3WIAA 5CFAA 5HYSG 1DZBA 1G0XA 1VADB 1WA2X 1X5JA 2ZJSH 1EAPA 4G42B 3QHTC 3QB7C 2XPYA 3OGCB 4N0FA 2BSCA 1Z32X 4QYOB 5E9DB 5A2LH 4B7IA 3ME0B 3UAJC 3IJSB 4AQAB 2KQMA 4TNVK 1A22B 2QDWA 2WKLA 5DEJA 5I74C 2IQAA 2A74C 2EADA 2IBGA 3LEVH 3WUZA 1QPKA 3GMRB 1O5DT 5DMJB 2FIKA 5D1ZA 3K2KA 4H0IA 1WIPA 2N1TE 3MJ7A 1C9SA 5EEUA 1DBKL 1ZLUH 2BNRE 2ZX6A 3POHA 4LQFL 4P2QE 3FO1A 1VERA 3MLTA 4HG4K 5EPMA 2VDMB 3JWOL 4H2AA 2WBJD 1UHVA 2Y1AA 4BFIA 1QKZH 4RFOL 1TTGA 3EYSL 4LPYA 4W9LC 1A3RH 1TTFA 3NA4A 2ZJSL 4HETA 3UAEA 3PWJB 4P04A 2I85A 4OFIA 3GWJA 2BM3A 4HZLB 4PWJA 5GGSB 5CN3A 1QR1A 1MFUA 4OIFA 1URLA 3RL2B 3DRTB 1A2YA 1ETB1 2QVFB 1W0WB 3FQ4A 3ARDA 2QMJA 5KS9F 1OAKH 3LEVL 1UFUA 1SYVA 1TITA 2K7QA 3SDCA 1JF1A 1I4FA 1L9OA 3JWNH 4I3RH 1GSMA 4JGJA 4X7SL 2QADB 4NAQA 3G9VA 3U82B 4GXVL 2W9EH 4F2MB 4AM0Q 4P4KD 2QZ5A 4BCZA 4RGNB 4LF3B 4WWKB 3TCTA 3PXHA 3E1F1 1QKZL 3DLQR 4NERA 3SE4A 3EO0A 4EZLA 4H1LG 4K9JA 5KSAD 4CKQA 1A3RL 3SCMD 2V5SA 2VR3A 3A4AA 4BDVB 1YNTB 2DOCA 3GRGA 5EEYA 2OTWA 5K33A 3VXSB 1HXYA 4HHAA 3SD5A 4NENA 4I85A 1SLVA 1WP6A 2CRIA 3II3A 1FYTA 2CDGB 1OAKL 2XLLA 2QGBA 3MRMA 3QWRA 3QNFA 1XSJA 4I3RL 4NKIH 2W07A 5AW4B 2P80D 5CEZE 4RRPM 3O11B 2D8KA 4V1DB 1VF5C 2W9EL 2ZG2A 4AQ8C 1YAIA 5EH1A 4HWBH 1D9KC 2MHAB 4MD5B 5I66B 3QQ3B 2RACA 2Z8RA 4FI7A 3RTLA 4CW1B 1BZ9B 5I1EL 3SE3C 1Y6MR 1HTYA 1WFIA 5IOPA 5HHOE 2KH2B 1AR1D 3UMNA 3D0AA 3NJNA 3RU8H 1M7XA 4ZMWA 1FNFA 2F53D 3SJVD 1I3RB 1S9WB 4XC3H 3VX0A 5IQLA 2VMEA 2A83A 4A2LA 1T2XA 4PY8I 2VW6A 5KN5A 2GSMB 5AL0A 4UT9L 3KS0J 1KYDA 4HWBL 3T0WA 4QHKJ 2C3XA 2G3NA 4HJ0D 2PETA 5IF0A 2A9CA 1N2RA 3QFJD 4HUNB 1J12A 1ZS2A 3C6LB 3I75A 2VLLA 1BYPA 1H3UA 3G5XB 4RBPH 3RU8L 1LK3H 2GHWB 4N8UA 3GHPA 1P7QB 4U6XB 4FFTA 1I3UA 3FB5A 4R84A 5FPIA 3CHRA 3NEOA 4XC3L 5B38B 2Y3NA 2CO6A 3H7BB 3RJDA 5L4IA 3WFHA 3ETSA 3S3DB 4YLBA 1U8OA 1NGQH 4HMDA 3LKQA 4KJWC 1WAPA 1TG8A 3PUCA 3IDYC 5GZNC 1DQLH 3CUPB 4XX1G 2ZXBA 2H6UA 1FLRH 1AQDB 2ZWSA 2QVIA 1VPOH 2ZE0A 3QXUA 3V4VB 1G6RH 4YHOH 2GT9B 2MNJB 4U1LA 3R8QA 4WTQA 4ZMNA 4NRZB 2OMYA 2Z31C 4L2LA 1AVAA 3VFOB 4LNRA 2AJZB 5DDHA 1LQBC 2R69A 8CGTA 1MELA 4KTEH 1JV2A 1OGAB 5AOZA 2QJDA 2NY1B 3MMEB 2FBJH 1ZV9A 5AB2A 2E5EA 1EO5A 3ZYOA 3HNSH 1HYSC 2FLMA 1NGQL 3GT6A 2GFBA 1T2JA 4LRNH 4L9LC 3QJHB 2OS7A 4F15B 4IGBD 3PF2A 2KMWA 1M4KA 1IVTA 5E0FA 1DQLL 3ILQD 3G6AA 5AVQB 4X4YB 3IWUA 5HGDB 1FLRL 4BE6A 2W0FB 3TFBA 1DFBH 2IANB 3EIFA 1VPOL 4LMQI 1N6VA 1G6RL 2G75A 4YHOL 5KYNA 4ZS7L 2DI7A 3F2LA 5DHMC 4CJ0A 4WFFE 4FQXC 2R4SH 2DAVA 2P5EA 4EVNA 2DKSA 4M62H 4KTEL 4JRXD 4NQTA 4EPSA 3U2SB 5F9OH 1S7XB 2WLYA 2DQUH 2Q9OA 1T4KA 3Q5OA 4WZ9A 4Q9RH 3HNSL 3N2JA 3L4XA 5C2BH 3IGKA 3DJ9A 4LRNL 2IMMA 3H0TB 3WTXA 3U7YH 1VEPA 3UBXA 3FFDB 5ICUA 4EZMA 3BKYH 3MCG1 3QQ4B 3WOVA 5GS0D 3JYBA 4ZYKA 2UXFA 1TJMA 3KXFA 3FF8A 5EOQH 1DFBL 1H5BA 2EE2A 1SN5A 2VUYA 5MENB 2Y2YA 1MCJA 4AEFA 4E2OA 3WO3B 1VZHA 1T1XB 4I2XB 3MV01 1NBZA 2X4OB 2R4SL 4FRWA 3VACA 1DTUA 1J5IA 5CLWA 2R2BB 3Q8FA 3H8NA 1QUNB 4M62L 4Q89A 4LOFA 1ZTXH 2ICWA 3DX7B 4QJ5B 1JUFB 5KG9A 5F9OL 2MNWA 2VR5A 4PJAA 2GK2A 4PUBH 4DZBB 4YDJB 5AUMB 4WU7B 2W81C 2DQUL 3CPUA 1QMUA 4Q9RL 1D5IL 5C2BL 2XA8H 3VXRB 3L3KA 5ES4B 4NUJA 3EH1A 4NUPA 4CRPA 1G9EA 3UL4A 3SY0B 3U7YL 2VUOA 1P4LA 4MMXC 3G08B 4UDTA 4XNQB 3BKYL 4JDTH 1UT2A 1BAWA 5C0JA 1Z0NA 5DRWB 5A40E 5EOQL 1OXYA 4QHNA 2G9HB 4M7ZB 3TJHC 4FI6A 1ZGLM 9CGTA 4FLOA 3FO2A 5INDA 4L29A 1JK9B 2H1LM 5EO9A 3QXAA 2AHIA 1XTLA 2Z3FA 5TGBA 4JM2C 3VU2A 4PTUA 1KJ2B 4HCRA 4PUBL 1JGDA 2YPLA 2N59A 1IQWH 3FSOA 3FFOA 4LNVA 1TO5A 2DLFH 1MJJA 2R1XB 2XA8L 4KUCD 1RJZA 1NUFA 1OF2B 1DVXA 1GW0A 3WY1A 3ZKQD 1QRND 4NJ9H 4PJ5E 5F1NB 4JDTL 1B3IA 4FXKA 3RWGA 1JV5A 4B50A 4GINA 1UJTA 3L54A 3L48A 3QI9C 4L4VA 3FN0H 3VGGA 1Z7JA 2PO6B 1NCCH 3V5DA 4DJMA 4HGKC 3GSUB 1XGQA 2LTQC 3BVNA 3OSV