1D6VH

Conformation effects in biological catalysis introduced by oxy-cope antibody maturation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
b'QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHIMERIC GERMLINE PRECURSOR OF OXY-COPE CATALYTIC ANTIBODY A
publication title Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6vH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6vH02
1R3IL 3P30H 2R29L 3DTXA 3LHPL 3W5NA 1A9EA 4TTDC 1VADA 2P44B 3BP7A 3FQUB 3T0ED 2H1PL 4HUXB 4LGPB 4FFWD 4LDOB 3V2AR 3C9NB 2GSGA 4O5LH 1CR9H 2A9MH 2PR4H 3QJFA 3L3KA 1D5MB 2AEWA 3P73A 3FOMB 4ODTH 4PRID 2VZUA 3HZYB 5HY9A 1YEHL 4XNQB 3DX8A 1HHKB 1TZGL 4EIZC 4HW6A 4F7EB 4I48A 5FYJU 1IGTA 3BN9D 1RUML 3UAJD 3KPQA 4CBPA 3OG4B 2X4QA 2GTZB 1NC4B 4UQ2B 3LH2H 4EZMA 5CFHA 1HWHB 5E1AA 2X89A 1U8LB 2MCPH 3V5HA 3MRQA 2BNQD 3F6LA 2VOTA 4MA7L 4NZRL 4I0PA 3G9VA 1YDPA 3OHXB 2C1OA 3WHXB 3TNMA 4MHHG 2VLRA 3LRSA 4RNRB 2OTWA 3QDAA 4Y5XC 4K7PL 1KPVA 4QCIB 1U3HA 1U8IA 4R0LB 1XGPB 4O51B 3DXAB 4UILL 1EDQA 1EJOH 2LU4A 2YD8A 4HIJB 1NLBH 4OKVA 4LHUD 4MMZC 2AJZA 2IQ9L 1D6VL 5MI0C 3QI9D 3H9SB 3GSQB 2YRZA 1RUQH 4JFXB 1DFBH 4HK3J 5E2WL 4FZEL 4YE4L 3QNYB 1AFVH 1VESA 5DURD 3SOBH 4D0BB 2Q7YA 4MCZA 3SKJH 3O4OB 1ZMYA 2YXFA 3NA9L 4YK4C 3BAEH 3PWUB 1JNNL 4NC1E 4KK6C 2XN9E 2WBJD 4XP4L 2V5RA 2PUQT 4JB9L 4ZS6D 4Q9QH 1L0XA 3MYJA 5IQ7H 3MODH 4R7NB 5DK2B 4ODUA 2C9AA 2ED7A 2HH0H 1RZGB 2HTLD 4XRCA 3LB6D 4OD3H 1RPQA 5ADPH 1U92B 5F70A 2ICES 4DGIH 3KLHD 3KS0J 5GHWH 3PL6A 4ODHH 3IFPB 3VGAC 3K8LA 3NABH 3LRGA 1Z2KA 3WUWB 4EI6A 4ZUSB 3BGAA 2OMNA 1DDHA 4ZFGL 3INUL 3B2UD 1TETH 2GEEA 4PGDB 2VLME 3MQIA 3VH8A 2NZ9D 3HC3L 1QKZH 2Y7QA 3VG0H 1NAKH 5IM7A 1YMHB 4U0RC 1GGCH 4PR5B 5L2JA 2OL3A 1KFAH 1T1WA 4J4PA 3QULB 1A7QH 4LVNC 1JWUA 5GJTL 2P7TA 1R5IB 3AY4A 4QOKA 4HJGB 3BYYA 4BKLB 2Q1EA 1NMBL 3HCVA 5D2NB 2DQIH 3GIVA 2E9IA 2EDTA 2KQMA 3OF6D 2FECL 2FO4B 5I1KH 5J6GB 4M03A 4UNUA 2V2WB 1E4XI 2IFFH 3MPCA 3NCCB 3IDJA 2QSCH 1MCHA 1NBYB 3TP4A 2W9EH 3U46A 3WSQL 3BIKA 3WIIL 1ZT7B 2V2XB 3AREC 3QIBA 4NZTH 1CIUA 3RWEA 4JKPH 4ZPVB 3LOWA 4FXGB 1T66C 1MF2H 4QXWA 4XVJL 4Z7UA 3TIDB 1T4KA 5GRYA 4S1SH 2EECA 2SEBA 1O5DT 4YHLH 3OKYA 4YBQC 1BVKA 3RGVC 5EN2A 5HGHA 4OLYH 3MRBB 1VEMA 5FGCE 4EUPH 3QEQA 1EV2E 4UB0L 1FJ1B 3RY6A 2B5IB 1CD1A 1MRDH 4YO0B 1XEDA 1H5BB 1FFRA 2UWEE 4RWYH 1C7TA 3VWJA 5JNYA 4O2EA 3D9AL 1VEOA 1M7IA 1NEZG 1WF5A 4JN1H 3BISA 3HMWL 1FL5A 1G7LB 2BSTB 2I07B 2XTJD 4MDJA 2V2TB 1KACB 2AEPH 4DCQB 3BYTA 4X9FA 4GW4B 4WHYH 1FP5A 4MSWB 4PBWD 2YBRB 5IJKA 4QRPE 1ZHNB 5CP7B 1QEWA 5I17A 5FA3A 2J12B 3MUY1 2VR9A 3WYRA 4U49A 2ZUTA 5FKPB 4NQCA 4JFEA 3JVGC 1A3RL 1WIUA 3N1GC 4OV6F 1TZHA 1SJEA 1CLOL 4UDTA 2P24B 4PJCF 1YEEH 1ZVSB 2MHAB 5I6XB 5DQ9A 3HC0B 3MV8E 5ID0B 3DGGB 1NL0H 4ONFL 2UVEA 4TYUA 3KYOB 4Y4KC 2JJVA 2ZUVA 2X4NB 2XZAL 3H0TB 5D5MF 1PSKH 2CIKA 1L6ZA 4LLYA 4HX1A 4YHPA 1N6VA 4IRJD 2UY6A 3WJJA 1MAMH 2FZ3B 2HMIC 4D9LH 5ITFB 2Q20A 2GY5A 3MSPA 2AJYH 4E5XB 1HHIB 1CLZL 3PQYE 1LEKA 3GHBL 1ORQB 3HE7C 3VRIA 1A3LH 1OAKH 1XIWD 3O6FC 1F97A 1AKJA 3BP4B 1JGVL 1EHAA 3HLAA 4MA8L 2DLFL 3TNNA 1N4XH 4WWKD 1HQ4B 2YN3A 1U8PA 4D0CA 4R4FH 4XNXL 3O9WD 4DN3L 2ZP0T 4OLUL 1KEMH 3G6JB 3X3FL 1TVHB 2IALA 1UB6B 3F8UB 4JZJB 2A6DA 4I77H 1VFAA 5FCSH 1QFHA 3QO0B 3TESA 3IDNB 4XH2A 4X6CA 5B39A 5I18L 1CL7H 4H0GA 2H32B 5HVHB 3T4YA 4NWTH 1J11A 2I26N 4Y4FC 3O8XC 3U0WH 1KB9K 4PLJC 1M7XA 1B6UA 4JKWA 4NO2A 4F7CB 2IAMA 4G8EA 3Q0HA 5T3ZD 4PLOB 2ZUYA 4JG1H 4OUOA 1FSKB 2DQUH 4S1DC 4F7PA 3S35X 4KRPC 5CMAB 3DBXB 2ZNWA 1N2RA 1TNMA 3SDAC 1Q9LA 1EUUA 3EOAB 2EE9A 4Z0BL 1MCIA 4YHYC 4U3XA 5CZXD 2DQEH 1RUKL 4N9GB 1TITA 4JFFA 4KMTH 1N6UA 1NCDL 1Q38A 1ZA3A 3CD4A 1LO3H 5FUOL 2OK0H 3UJTL 1PBYA 4DTGL 4HHAA 5GISH 2VLKB 3IFOB 5SWQB 4KKBC 5CHNA 3VI3E 4KPHL 5L88H 2E7HA 5KVFL 1R3KA 4YHIA 2BDNH 4DAGH 5F88B 4OZFA 5I9QB 5LVEA 1A0QL 1IMHC 2V9RA 4YDKH 5K9QG 3BZFA 2Z35A 4KH2A 5C3TA 2HT4C 4R4BB 5H37G 2QQNL 4QXGL 3MUJA 3ARFA 2EXYD 5GXBB 1L4IA 3IXTA 2VDMH 3RGHA 4HWNA 3L3HB 4M8VA 5DJ2B 4JY4A 3X14B 4NNXB 2FWOB 4PD4K 3UCRA 5IHUH 5KG9A 1J1OL 2ITDB 1A22B 4NKIL 4PJ7A 5C0FB 1F4YL 4XX1E 2F5AH 1B0GA 3MJ9H 1VA9A 2AW2A 5TE4L 3NTCL 2OR9H 3ELAT 5A2JH 3ME0A 1NUDA 1IKNA 5ALBL 3PHQA 1W0YT 2V17H 3ZYOA 2J8HA 4GS7C 1FV1B 4XPTH 2ADJA 3D69A 1OP5K 1LEGA 2QKIA 3SJVB 5D7JB 4TUJB 2W60B 4OAWB 5L9DL 2G2RA 4CRPA 4OZGF 1H8NA 2X9XA 3SDCA 1DSFL 4B50A 4DKAA 4ELMB 4N5UA 4WFHD 5E6IA 1JGDA 5ALCL 2AK1H 5GQBA 4PRAB 3MV11 3FO9A 5GJSH 1KB5H 1NGQL 5I8CB 1K8DB 1F2XK 3MA7A 3OKKB 3SGKA 4Q97A 4CL7A 1IZJA 1QFUL 3VI4F 2YD4A 3D6GA 1YJDH 2Q86B 4CVZA 5IF0B 1AP2B 4XPAL 1YJDC 3T2PA 4L3CA 4NZUH 2VSCA 4V1DA 1AGDA 2PCPA 4GLRI 5JQHC 5EIIA 2Z31C 4FTVB 1G0XA 1NJ9A 2YXMA 5HHPB 1S7TB 5FECB 1I7ZA 1OGAA 3KPRB 3IETB 5E2UH 4GAGL 1VERA 5FAAA 2BVEA 4GUPB 2X4OB 2J5LC 1YNLL 5F72S 3MLZL 1F6AA 1RU9H 4PG9A 4MNGE 4ZO6A 5D7IA 3OAUL 2C7UA 1QLFB 3MRKA 3C8KA 5SX5K 1JL8A 4XAKE 2EDQA 2FL5B 3VXRD 1F13A 4F33B 3RWJA 3OXRB 5C0CE 2AVGA 1ETZB 3QDGB 4JFOB 2ZSVB 5FHAH 1KENL 4QXTA 4OI7A 4PJ9A 1JN6B 3VFVB 2Z4QA 1DLFL 1LD9B 3TCXA 3RL1A 4CGTA 1IAIM 1HYSD 4MXVE 1VEPA 4OCRL 1YEKL 2ZPKL 4FXKA 1YY8A 2P5EA 2AEIT 4M3JA 5BW7C 3WCYA 5ICYA 4YQXL 5CILH 2XY2A 5HHMD 1I9IL 5GS1B 5CCKH 1QRNE 4OT1L 1I8MA 5GSRB 1CDUA 3UTSA 3QDJE 3VXMD 3LPGA 2EDLA 3BEVB 1BZ7B 3D3VB 5BO1L 2W0LA 4MNQD 3MMEB 4JRYB 1LP9A 4OGYL 1B3JA 4Y2DA 1NFDB 3U6RB 1WQVT 3DTXB 3PDDA 1A9EB 3GIZH 1VADB 3BP7B 3TBVB 4BH8A 2VAAB 2GSGB 3GO1H 4ZOBA 1NDMA 1ADQH 3U2SA 3A6OA 1RZ8A 4Z7NE 3QJFB 4R0LC 3L3KB 3P73B 4XWOC 4D9QD 2OJZL 3RVTD 3VXSD 5HY9B 4IMKC 4XWGH 3CH1A 5DRZB 3DX8B 4QTHA 4GMTH 2O93L 2DOCA 5CLTA 4I48B 5F7EH 4DOHE 5TPWH 1IGTB 5HHOD 1DL7L 5FXCH 1VHPA 3FKUS 2X4QB 5SV4A 4HFWA 2C4XA 5JA8B 5FA4A 3N9GL 3OMZA 3RDTA 3GJEA 4QRRB 1I9RH 5E1AB 4HWZA 5K9JL 3NPSB 2JLLA 4KK9D 3E8UH 4PGBA 3V5HB 3WE6A 2VR5A 3MRQB 1OWWA 4ZSOA 4I0PB 1S9WA 1YDPB 3VFMA 2C1OB 3TNMB 2VLRB 3GMNA 1ED3A 3LRSB 1RK1A 2A6JA 3N50A 4OIIH 2OTWB 3S37X 1RZ7H 2P45B 1U3HB 1U8IB 4R8WH 3N0PB 3SGEI 5FOJA 5A16A 2NW2A 4KKAD 3QRFM 2MQ3A 4XVTL 3RQ3A 5FYKE 5D72H 5F3HA 2DKMA 4OKVB 1XF1A 1PEWA 1IE5A 1INEL 3VFTA 2AJZB 2HG5A 1RHFA 3BVNA 3U7WH 3FO1A 4Y1AE 2VSDA 5JW3H 5FO9A 3IFNL 3IDXL 4GO6B 2VR4A 1TNNA 3UTTA 3LN4A 2A0LD 4PREA 3BJLA 1EAJA 1I8IA 2O5YL 1G7IA 2Q7YB 5I1LA 5KZCD 4MCZB 5JORA 3QCVL 4ZO9A 4A6YL 4WY7L 3MGAA 3DYOA 4KKCD 3MCG1 1RI8A 3EO1A 3HN3A 3RVVC 3MYJB 4OSUH 5KS9A 1NPUA 1S9KC 1SBSL 1RZFL 5DVOA 4XRCB 4WO4B 4DKEL 4X5LA 5A1AA 2VUYA 5E8PA 5D2NC 1HKLL 3O6MH 3TYGL 4NRXA 3PL6B 5CGYD 3NZ8A 2L7JA 3SDXF 4YX2H 4OCNC 4PBXA 4EI6B 5L2KE 1DDHB 5GS0H 1FNSL 4KI5C 2X42A 3GM0A 5GS0C 3VH8B 3S98A 2Y7QB 2HT3D 4G9DA 3LRHA 1KUMA 5IM7B 5B8CA 5L2JB 4X98A 4MDIA 2OL3B 1FAKT 1T1WB 1RFDL 1JWUB 1XGRA 2P7TB 1A64A 4QOKB 4GRLA 3WKML 2HTKC 3LMJL 3HCVB 4QHNA 1QFPA 3GIVB 3QQ3A 3H3PH 4LNRB 1FAIL 3JV5A 3IDJB 2B5IC 2KKQA 4P46A 1H5BC 1OAYH 3T3PE 3U46B 2DTMH 2HN7A 5ERWA 3BIKB 3TCLA 2JCCE 3BPCA 1IAIH 2EZ0C 2JJSA 1DUYA 2VZSA 2FRGP 3QIBB 2CLVA 5FGBC 4PPTA 5AWNH 4P57A 4RMQA 4EJ1C 4LP4A 4J12A 4LNVA 5MEPA 4Z7UB 1IQDA 1T4KB 3K4AA 2SEBB 3QRGH 1NMCB 2J4WH 1JZ8A 3AS3A 1T5XA 4PJEF 5EN2B 5HGHB 1Q1JH 3ZHKA 3D18A 3CSYA 4DK3A 1GOFA 3QEQB 2VDKH 1UCBH 1CD1B 4J3VA 3FQNA 5IMLA 4KAQH 4OCSL 2DI9A 3VWJB 5JNYB 1BZ9A 4O2EB 1M7IB 1FZJA 4KK8C 5GGTA 1FL5B 5I6XC 2A2QT 4MDJB 3MLXL 5IB1B 5I2IA 3HHRB 2VLJE 5AYUL 3AMKA 5DUPH 1QEWB 1XGQA 5I17B 1VFBA 1OARH 2EDYA 5FA3B 3DURA 1GRWA 4ELKA 1MNUL 4JFEB 1EZVY 4NKOB 4XNMA 1TZHB 1KELL 3NCJH 1SJEB 4UDTB 4R9HA 2R0ZH 4U1KB 3NPZB 1ACZA 2DQFB 3ZDXE 5DQ9B 3RKDD 2BRQA 3FT2A 4KFZC 1MVFA 3VXUD 1BQSA 1G7MA 1IGCL 4Q2ZA 4AENA 4ZUUA 1A7RH 2FBJL 2CIKB 3RUGA 1TDQA 3WD5H 4LLYB 3F7RA 5E2TL 1KJ2L 1WCQA 4U1IA 5IWLC 2HLFD 1TCRA 3X13A 1LK2A 1ACYL 1BEYL 3OZ9H 4JO3H 4JZJC 4OUUB 4JZNA 4L1DA 1Q9OB 2FSEA 4P99A 4FQLL 2H32H 3IF1A 1LEKB 5HVHC 1K85A 1JYWA 4U2ZA 1K6QH 5IEKA 4IOIA 4H26A 1AKJB 4URTB 4KVNH 2K1MA 3HLAB 2VDOH 3TNNB 2AQ3A 4XTRC 1FFOB 2UZIL 3WEXA 4X4XA 4M9PA 5DFVC 1FSKC 2NNAA 1MCDA 2WBKA 2IALB 4G6AC 4R90H 4ZTOL 1AE6L 3B8YA 1YEIL 5IJVA 2EIZB 2A6DB 1VFAB 1AY1H 3H3KA 1R3LA 4OD2B 4XH2B 4X6CB 5C0AA 5B39B 4OCXL 25C8H 1LO4H 2I60L 5HD8D 4N1EA 5SWSD 2Q8BL 3T4YB 5JPMB 1BHGA 4PRIE 1TXKA 1CF8L 3C6SA 4QRPA 2GCYA 3RWIA 1P7KB 4NO2B 4P2OA 4YXKH 2IAMB 1HQRA 3RWFA 3P30L 3T04D 4NCC2 1AQKH 1LO2H 1R0AL 3QIWB 1GPOH 1MFBL 4F7PB 1DVFA 2X1XR 3QO1A 1CR9L 2D7QA 1N2RB 3CFIC 4EI5A 5I9QC 4ODTL 4EQ2A 4PJHE 1QLRA 3MV8A 1CIDA 1OTSC 1ZA3B 3LH2L 1JGEB 4XMPH 4HHAB 4XC3H 1DBBH 1MAJA 4GRWB 4OZHE 3UTPE 2P8PA 4LK4A 2EYRA 3O45A 2AKRA 4M4RA 2IANB 2HJFA 5KVMC 1TJHH 5CHNB 4Z8FH 3BUTA 5FYLH 5C71A 5DT1L 3C2SA 4YR6A 2F54A 1P7QA 4OF0A 4YHIB 5IESL 3CXDL 1FLTX 3CLEH 4LPWA 3DO3A 1EJOL 4XGZA 5C0EA 2JIXD 4GBXD 4YBLB 5J6HA 2Y9RT 4JM4H 3BZFB 3OXSA 2GJJA 2Z35B 1J12A 1CICD 3RJDA 1MHCA 4W70A 4BQCA 35C8H 1UM5L 4M02A 2UWEF 1AFVL 5CKAA 4JY4B 3DV6A 3QNZA 3DROA 5D7JC 2WIIA 3LKRA 3KPMA 3D87B 5KG9B 5IB3A 3MGOA 2YPLB 4H1LG 3SDYH 2I5YH 4PJ7B 1HI6A 4WI9A 4CN4A 1JTTA 2ZUXA 3WFEH 1UEMA 4Q9QL 1B0GB 1QG3A 3DVFA 5IQ7L 1IM9A 5GGVL 2F19H 4H8WH 3UJJH 1RVFH 4H8WC 4HGMA 4RRPA 3PHQB 1FNGA 3QPXH 4XHJC 4OD3L 2HT2C 4AIOA 5ADPL 1EBPA 4DGIL 4LPXA 3OJDA 4AEFA 2ZUSA 5BXFA 4JHZA 5GHWL 2KDGA 4ODHL 2ADJB 4G7YH 4G9FE 1ZLWK 5FF6A 2QBWA 1AGEB 4LSUH 2F58H 1TETL 1GOHA 1WAAA 1KCVH 3SDCB 5C92A 3JSSA 4M1CC 3P0YH 5E6IB 3VG0L 1JGDB 3CK0H 5GRJH 3NN8A 1C7SA 1GGCL 3GJFK 4LOUC 4O58L 4UT7L 5ICXA 3V8CA 1Z9MA 1KFAL 5I1EH 2W38A 2BNRB 3FO9B 1HWGB 1P2CA 4TQEH 4U7SA 3CDFA 2YK1H 3MA7B 4EVNA 1YYLH 3BH8A 4CVZB 2EDEA 2DQIL 4KUZH 3P4OA 4M1GH 4L3CB 4V1DB 1AGDB 5B38B 3L7FA 2PCPB 4YGAB 5GPRA 5EIIB 2L7UA 4YHNA 2ZCKH 1EBAA 3BQUA 3DUUB 4HBCH 1I7ZB 1KF9B 1OGAB 1ONQA 5I76A 1PEZA 2W9EL 4OIBA 4R2GD 2W07A 2VDLH 5IQ9A 1BFOA 2NY7H 4AH2A 3C6LD 1UKSA 4HV8B 5GS3A 4NZTL 1HZHH 4F9LC 4JKPL 4P3WA 1F6AB 2VDQH 1C5BH 4FQXA 3P4MB 4HCRA 3C60A 1KIUA 3F6IA 4PG9B 2NTFA 5GS1C 2PKDA 5D7IB 2C7UB 3MRKB 3C8KB 4S1SL 4GQ9L 5C9KA 4RWHA 2XTJE 3FAXA 1WVZA 5E8DH 3RWJB 3ILQD 4OLYL 1NCUA 3U7AA 2GK2A 5DFWH 4QXTB 1FNEA 3G5YB 4PJ9B 3K1DA 1MRDL 2Z4QB 4OV5A 3RL1B 3H7LA 4OI8A 2ESVA 4LLMA 4HFUL 3OKMA 5EH1A 4FXKB 2NCMA 5KW9H 1YY8B 5D71H 3T77A 2P5EB 1T7VA 4WEBH 4PG2A 5ICYB 5KVDH 2AEPL 3EHBC 2XG4A 5FO7A 5A3ID 1I8MB 4YXHL 3UTSB 4AQ1B 1ZT4B 4YWGH 5KSAA 3MNWB 3ZKQD 1LP9B 4Y2DB 4Q6IA 1MJ8H 3NPSC 3QDMD 5ETUA 1QFWI 4PB0L 4EXPX 1Q94A 4OIAA 4I0PC 4BH8B 5EWIH 3QHFH 2D7PA 1G7QB 3GBLA 3QQ9D 4K8RH 5JR1H 4NJAH 3C08H 1NDMB 4K8RC 3U2SB 1QBML 1RZ8B 1U3HC 3GSXA 2DQTH 4PJAE 5FKAA 1IGJB 4JY5L 3CH1B 5DJ6A 2RAMA 4QTHB 3NCFB 5IMKB 1NL0L 3GBNH 3FT3A 1MIMH 4G8IA 1J8HD 3GKWH 4AY0A 2J2ZA 3D2UD 4JREB 1PSKL 5DMJB 5EZLA 4LIQE 4HFWB 3EO9L 5T5FH 3QFJA 5FA4B 3RDTB 3A0OA 1KGCE 3GJEB 4GSDL 3WKNA 3MLYL 3SQOL 4QTIH 2QHLA 2QSQA 3WE6B 2XWJB 4KJQD 4ZSOB 1IC5H 1S9WB 3GMNB 1ED3B 2AJYL 1RK1B 3EFFA 3PHSA 1MHHA 1P84K 4EUPG 1A3LL 1OAKL 4MNGA 4L8BA 5DMIH 5A16B 2NW2B 1BJ1H 4X6DE 3QZWG 4P23D 1N4XL 1A8JH 2VXTL 5MEQB 4OQTL 3VFTB 5CSGA 2HG5B 4CUCA 3GSWA 3BVNB 3O0RH 3FO1B 3VFWB 3P9WB 1KEML 3VGEA 5FO9B 2Q6WA 1W72H 1A3QA 3PL6C 3Q2CA 4WHYG 2Q8AL 3UTTB 4PREB 3PDGA 3QT2A 1NCCL 1DANT 1I8IB 4ELMF 4I77L 1G7IB 5T3ZE 5J56B 5I1LB 1RZJH 5L7XH 1JI2A 2J8UE 5JORB 1RZJC 1CL7L 4PRPA 3WFHA 3MACH 2J1KA 4NWTL 1B0WA 4I9WD 3EO1B 2OL3H 1OB1A 3U0WL 1N5AA 3MROA 4RISH 4P5TA 2NY2B 4FP8H 2NY0B 4J4PC 4F7MB 4NQXA 3VXPA 2MPAH 1AJ7H 3CSBA 3AC0A 3AY4C 2P8MA 4LPYA 3QPQC 1KULA 1HXMA 2DQUL 5E8PB 3Q5TA 4V2BA 5ITBL 4NRXB 5H94A 1ZKAA 3NZ8B 3MV7D 1FLRH 5EUKA 3T2NH 1EHXA 3VFPA 4S1RH 3CSGA 1MCJA 1E4WL 3R8QA 4X0KA 4ZUWB 5DRNA 2DQEL 1EGJA 1ZGLP 1UGNA 2CXKA 4KMTL 5AZEH 2F8OA 4P2QD 1GL4B 4G9DB 5ECJE 3QIBC 5B8CB 4X98B 4MDIB 2F9BT 2OK0L 3OJVC 2NR6D 5TFSH 5ISZD 3AAZA 4DGYL 5B3NA 1NMCC 4QHNB 5I8KL 1UACL 2IH1A 3QQ3B 4WGWB 3H6JA 3MFGB 1AXTH 2BDNL 2F53B 3NFSL 4JDTL 3RY6C 2XRAH 3Q6GH 4YDKL 4P46B 2BY3A 3VWJC 3KJ6H 2HN7B 5ERWB 2ITCB 3TCLB 3BPCB 1DUYB 2CLVB 1FNLA 3PXHA 5BV7B 3O4LB 1I3RA 1EH9A 4PY8J 1HYRC 4UTAH 1N5YH 2VDML 1HINH 4Y1AA 5D1ZD 1OSPH 5MEPB 4MXVF 1IQDB 5EIVA 1MJUH 4Z7VE 5IJKC 5T1MA 4JQVA 5IHUL 2R9HD 1T5XB 5EBMB 3CSYB 2PTTA 5FOBA 2F5AL 3MLPA 2E7BA 3FQNB 1F45A 1BZ9B 4RZCA 3MZGB 2OR9L 1CLCA 1W0WA 2VAJA 3JWOH 1FZJB 1T21A 4WFHE 4YDIL 3JWOC 2P5WD 4OF7A 1CFNA 2OZ4L 4XPTL 1FCCA 3QWRA 3D85A 5I2IB 5JMRA 3QHZH 2DM4A 3GSUA 4JKMA 1UXWB 5B4MC 5I1JH 4DN4H 1XGQB 1VFBB 5F7LB 4G6KH 1NAMA 3DURB 2CUIA 4ELKB 3CC5A 4GW1A 2AK1L 3WJJC 1FL3A 5L8LB 3FQRA 5GJSL 2LU7A 3TZVA 2G5RA 5D1XD 1T2JA 4WWID 2WWMC 1M71A 4KY1L 3LS5H 4JQXA 4ORGA 3FT2B 3VFUA 1MI5A 1IAMA 1P4LA 4Q2ZB 4AENB 2X9WA 4ZUUB 4WHDA 4HJJH 1ZGLA 5CKGA 3VFOA 2AI0H 5E2UL 3RUGB 4XZUA 5KSUA 3HPLA 2CRIA 2R1XA 1LGVA 2FEDC 4KJWC 4U1IB 4JFYA 1LK2B 2IPTL 4K3EH 2JCCA 1FNAA 4PD4J 4Z9KB 3W2DH 4JZNB 3BPLB 3MJ8A 4B5EA 1M05A 1RU9L 3SDDA 4PLNC 1WFUA 2ZCLH 4H26B 4IOIB 3QUXA 3ARBA 1WJ3A 3B9EA 1TCMA 1PY9A 3CX5K 5FHAL 2IAMC 1F4XH 4NJ9L 1BQHA 4ZXBA 1JVKA 2BNUB 4LGRB 5LXGL 4X4XB 4U1SA 5TF1H 4MNQE 1I75A 2NNAB 4P2CG 3HNTL 1J1XH 1OWRM 1I1AA 3CFJA 4BZ2H 2PYEB 1I1CA 5IJVB 5J4MA 1KG0A 1R3LB 5GGQH 2R56L 5C0AB 2H2PD 1TTFA 5CCKL 3LPFA 3IAGC 4P49A 1FE8L 4PJ8A 4D9QE 4Y7MA 3VXSE 2VLJA 5AAWA 1N7MH 3C6SB 3FHQA 2B39A 2GCYB 4QRPB 3RWIB 3TJEL 1OVZA 3ZKXB 4P2OB 4IRSB 4GRWH 2B7DT 2CK2A 4M7JH 1HQRB 3RWFB 4PTTA 1FYTD 1WC7A 4C83A 4M5YH 4QXUH 4L8DA 2DI8A 3QO1B 2IMNA 1GGBH 4KWUA 3HMXA 1FPTH 4EI5B 5D2LA 4XWGL 4HXAL 5T5NF 4GMTL 4RAUA 3TA3A 1QLRB 5F7EL 4YBLC 4YHZH 2GUOA 5MEND 2GAZA 5TE7L 2RIKA 2VDNH 2RJMA 3ARFC 3MRGA 2AJUL 4KKLC 5DJAB 3MBED 4LU5L 3PWJA 3T3PF 4RQQA 2DQGH 2P8PB 3OBAA 2EYRB 3O45B 2AKRB 4UDUA 2HJFB 4OIIL 3AS1A 3EJYC 4WUKH 4YR6B 4JY6A 2F54B 1P7QB 4YGVA 2PO6D 4P48A 5KN5B 1UA6L 4XI5D 1CGWA 1FN4A 3LKQB 4JANA 1UADC 2XKNA 1A7PH 4XGZB 5C0EB 4ZO7A 4FABH 4PJFE 2R1WA 5J6HB 2YKLH 2J88H 4OFIA 1IKNC 5HYJD 1S5IH 3ZT5A 4NC2B 1QHPA 4R97B 4WFFD 5JW3L 5ADOH 1MHCB 1D7FA 5HI3C 3HG1D 2BVYA 3NCYP 3RVUC 3QNZB 3DROB 1BOGA 3LKRB 3KPMB 1QNZH 3KHOA 4N0CD 4KTEH 1MCFA 3HS0A 3T0EA 2HKHH 3ZLQC 3GFUA 5IB3B 1NCNA 3S5LA 3SDCC 5GRUH 5DQJB 3KYMA 5F7UA 2HLAB 5IFJA 5E6IC 4K3DH 5CEZH 1HI6B 1FC2D 3WN5A 3OAYH 4I1NB 4BM7A 4ZFFA 5E24E 4XCFH 4YHOH 4KXZI 3SGKC 1FNGB 5EUOF 1OW0A 3OJDB 1RQ5A 4MXQC 3LIZH 5BXFB 4ALAL 4CKVX 3F62A 3LEYH 4K9EH 1J18A 3MUZ1 5FF6B 1AGCA 1FG2A 4K9EC 4EBQH 4K7PY 2NQCA 3NGBB 2BNQA 4TVPH 1WGOA 1D5XA 4KVCL 1GSMA 1SY6A 2K7QA 2CKBA 1S7QA 3NN8B 1K2DB 2FJGA 5C1MB 3HUJB 3MCLH 3OR7A 1UJ3A 1P2CB 3A6CL 1H3PH 1GC1L 4UAOB 1KPRA 1QBLH 2QHRH 4EVNB 5LGKA 3BH8B 4MS8C 4LHUA 5EZIH 3FMGH 1TPXB 3P4OB 5AZ2H 1BM3H 3QI9A 3QUMA 3H3PL 4X9GA 3L7FB 1OSZB 4Q9RL 4YHNB 3BQUB 3EIFA 4PJ9C 1EERB 3GK8L 3TBSA 5F96L 1CGTA 1ONQB 5I76B 4PB9H 2M8XA 4KHTL 1OAYL 3UBXI 4PJXF 3MLRL 2WAHA 1BFOB 4X7CC 5IQ9B 5BRZB 4AH2B 1HSAA 3WUWG 2ZKHL 1BZQK 1K8IA 2DMBA 1FIGL 3HRPA 1JPSH 3C60B 2ZJSH 3MO1A 5J1SC 3ULVH 4ZNEA 1QR1A 3ULVC 3EJJX 5GZNC 3QRGL 1W0VA 2EIDA 1AR1C 2VL5A 1VB9A 4HIXH 5DEFA 1KBGH 4Y2DC 3VA6A 1Q1JL 4LHJB 1FNEB 1C5CH 2VDKL 3V6ZA 1UCBL 1WK0A 2A73A 4OV5B 4KAQL 3OPZH 5GGRY 4NN7C 2ESVB 4LLMB 2FNBA 3CVHA 1CXKA 2A77L 3S3JA 1MHEA 3T77B 4OQ1A 3BRDA 3VXQA 5C08D 2NXZD 3ECBB 4ETYA 3V7AE 2BRRH 1JMXA 5FO7B 4HS3A 2XZQH 3DPBA 4HKZA 1KTKE 3TN0D 4WCYH 4FRWA 5E5RB 3WDIA 3B3IA 4OCYH 5KSAB 3RDTC 5D4QA 1FL6A 2DDQH 3VXUE 3WS3A 1IEAA 1PY4A 4Q6IB 3OKEA 5ETUB 3OF6A 4PJHF 4UT6L 4QRTA 1Q94B 3DVNB 4OTXL 1WZ1H 5DXWA 2R0ZL 3F12A 4NQED 3FAWA 1MHPH 4OZIE 4OF3A 1INQA 3GSXB 2L0DA 4JO1H 4OZHF 4NHCH 5FKAB 1ERNA 3S36X 1F90L 5DJ6B 3ZE0F 1G7PA 4MJIA 2RQ8A 3FT3B 4G8IB 1NUGA 1N0XH 5EZLB 3QFJB 3STZA 3ZKMC 3REWB 2X6MA 3ZTNH 3R4DA 2HRLA 2X10A 4A2MA 4KK6D 1HSBA 2PF6A 5TJWK 4KJYB 1MHHB 4P9ML 4UINL 1H3TA 4MNGB 4GKNA 1K6QL 4ZQKA 4L8BB 4WW1A 2EKJA 1OT2A 4U6HB 3K74B 4KVNL 2X05A 1AGBA 4GAFB 2VDOL 5JDSA 2NY2C 2NY0C 4PY7A 3L5HA 4DZBA 5SWSE 2W91A 1A9BB 2B0SL 5CJOL 4RBPK 2DBLH 1FVEA 3GUTA 4N90D 3KDMB 2EXWC 5GS2H 4NP4H 4POYA 2Q6WB 1BIHA 2YMXH 4J3OC 4X9IA 1SEQH 3BW9A 4N8VG 5TF0A 2FEEL 3WFZA 2DLEA 4RGND 4PRPB 1LO4L 1FIEA 4L4VB 4ZODA 5K9OA 2CJUH 3VDCA 1OB1B 5B8CC 1N5AB 3MROB 4YXKL 3L9RA 4NQXB 3VXPB 1AQKL 1LO2L 2P8MB 4ISVA 4JFDD 5LJYH 4P3DA 3L3GA 2Z91B 1HXMB 1QSED 3BXNA 1JZ6A 3KPSD 1DE4A 4PGJA 2NZIA 4JPIA 1S5HA 1ROWA 4IRJA 1M7DB 3VFPB 4AMKL 3ARED 5C6PB 4BZ1L 4P46C 1G6RH 2QADD 4PJAA 4X0KB 5DRNB 1LO0H 4P0DA 4M5ZL 4YHKH 3CXHK 4NOFA 1OAXH 4RDQF 5HVGB 3AS2A 1T7WA 2GY7B 1T66D 3EYOA 15C8H 4GJTB 1H3GA 5E00A 2JJSC 5BV7H 4AL8H 4YFLI 2OTUA 4JO2H 2NY5H 5BV7C 1XIWA 4NSKA 4XMPL 1XCQB 1EHLH 3AAZB 4XC3L 1B9ZA 1VDGA 4MD4A 4WI2A 3GI8H 3IKKA 4WWKA 1I7RA 2KH2B 5E8NA 5F7HA 3WJLA 1FHGA 4HH8A 2Z92A 1C08A 3O3DA 2IH1B 4EDXA 1G9EA 3O9WA 5JZ7D 3S37L 2AK4E 1ODAA 5DHXB 1YY9D 2R1YA 1C16B 4NC1C 4I4WA 1JUFA 1DBKL 1ZT1A 2EICA 3RWHA 1JPST 2R0LH 3BKYH 3QCUH 5GGTH 3SE3A 5DVMA 1I3RB 4TPRL 3W0WD 4CN6A 5EU3A 4AZ8A 5DD0H 1BBDH 1CQYA 4F2MA 1J0KA 2DKSA 1J9CT 5T1MB 3W82A 5I1CH 1CBVH 3CMGA 3T3MF 4M93B 2XG5A 5DHVA 5GGUB 3T0XA 2BJMH 4LAQH 1K4DB 2VMFA 4AM0A 1CS6A 4OKDA 2PTTB 1N8ZA 1S7VA 4IDJH 2ICWA 4NZJA 2BOCA 2EO1A 3PP4H 3V5KA 4PJDA 2F19L 4H8WL 3L5XH 4RZCB 4NWUH 1T21B 5T33H 4OFYD 3QPXL 2V9QA 4IDLA 1XGTA 3MV9D 1CFNB 4G7YL 4GLRH 3D85B 2GQHA 4J3UA 1UENA 1N26A 3GSUB 4LSUL 4AG4L 1QYGL 1U8KA 2F58L 3KG5A 3L7EA 1CDHA 5C9JA 4FA8A 2HMID 5DQDH 1KCVL 1NDGB 5ID1A 1PG7X 1NAMB 3P0YL 2XI9A 3CC5B 3T1WA 4GW1B 4P9HH 1FL3B 3QUZD 5EPMA 3FQRB 5I1EL 5ESQA 2GI7A 4P9HC 3BPLC 4X80L 3TZVB 1TZIA 2YK1L 1ZANL 3WFCH 1YYLL 3TEUA 4DUWA 1M71B 4RSVA 1OTTC 4YH6A 2W0KA 2D0HA 3D39D 4M1GL 4YC2B 4ORGB 2FYYB 2W0FA 4BSWB 3VFUB 4U3CA 4HAFA 1J0IA 1MI5B 2ZCKL 4HBCL 1ZGLB 2A6KA 4WW2A 5SWZE 4G6MH 4XZUB 1IVLA 3HPLB 2R1XB 1KC5H 4X6DF 4Y4HD 3UBXA 2CRMA 4JFYB 3WFBH 1MLBA 2R15A 4KTDH 4PTUA 2GJ6D 1HZHL 2JCCB 3OKDA 2VDQL 3MJ8B 1D5BA 1M05B 4DFIA 4FZ8H 4HDIA 1D5IH 3VDAA 3MV01 3VA2C 2BC4B 3PP3K 3GMQA 3RWCA 4Z7VA 5E8DL 3QYCA 3QUXB 3JV6A 5I16A 3ARBB 4S1DD 3ZKXC 4P2OC 1AR2A 4TRPL 2J8UF 2AQ1A 1BQHB 3DSFH 4ZXBB 2QV2A 4U1SB 1G9NL 2D2OA 4JZOB 4LQ1A 5KW9L 1VENA 2JELH 5D71L 1I1AB 3CFJB 3S8WA 2IG2H 4HQQH 3QUYD 4EI5C 5DLMH 1HCFX 3B9KD 1KG0B 1ZWIA 5C09E 1P5VA 3EYVB 4KU1A 1SHMA 5C2BH 4PJ8B 4GG8A 2KZ1B 4YWGL 2VLJB 4PJBA 2HFGH 5CP3A 1J8HE 4PTTB 3HNSL 3HR5B 2VXVH 4JDVA 5EWIL 3QHFL 5HPOA 2E7MA 5JR1L 2QSVA 3C08L 1S9XA 3SGEH 2APWA 1Z0NA 5D2LB 4YPGA 3CAFA 3REVA 4RAUB 5IVXB 1MIML 3GKWL 4H0HB 5HJ3A 5IV2A 1S9YB 1KIQA 2GAZB 1UT9A 1P6FA 4GXUN 5DO2D 3SKMB 2RFXA 4WJ5A 5CWSA 4R97C 5JQ6H 5E4EB 3BH9A 3MRGB 3VXRA 5JTWA 3E3QE 1VSCA 5JIPA 4RMWA 4QTIL 1I3GH 1MY7A 1PKQE 4FQ1H 3PWJB 4J1UA 4WU7A 5FYJH 4L4TD 2Y6SC 3V52H 2RB8A 4UDUB 5FYKL 3K4DA 4DK6A 1G6VK 4JY6B 4YGVB 4BYHA 1S7UA 5DMIL 1FN4B 4JANB 2XKNB 2Y07L 3NCYS 3FQXA 2D03H 1C5DA 4I9WE 5EG6C 4JHBA 5F6HJ 3O0RL 4JRXD 3QP3A 4OJFL 3VXMA 5DD5H 4JG0H 4K3HA 5HDOA 1PFCA 4WTZA 4MNQA 1W72L 3EDDA 3VFGH 1JTOA 2V7NA 1NGYA 3MYZA 4MQSB 2WWKO 3NGBC 4B0MM 1P4BH 4K55A 2FECI 3SE8H 3HS0B 3T0EB 3VG9B 3CU7A 1ZHKA 1V05A 4Z95L 2PW2B 3LEVL 3S5LB 3MV7E 1I4FA 3KYMB 5IFJB 4QRQA 2MJWA 1ZA6A 5DYOA 3RTQB 1UZ6E 3ZO0A 2J7LA 2WBWB 3VXSA 3WN5B 4BSVB 5C0IA 3PV7A 2YUWA 3AS0A 4ZFFB 2VZOA 4NM8H 1PZ5A 4P2QE 2MPAL 4UAOC 5DS8A 1BVZA 2IBZX 5HHOA 1MLCB 4RIRA 3U9UA 1TPXC 1NSNH 4ZUVA 5IK3A 1AGCB 1FG2B 4HEPG 1LMKA 3BQUC 4S1RL 2BNQB 1UQSA 2Y06H 1D5XB 5HYQA 3OJ2C 5AZEL 5F1SA 5EU6B 2CKBB 5L8JB 5BMFH 4JPWL 1S7QB 1ZS8A 2FJGB 2P1YA 3NFPA 4HCRH 4M43H 3UYRH 3OR7B 5AAMA 1UJ3B 4J6RH 1OPGH 1U8OA 3C60C 4ODVH 5EDXA 5J3HC 1U8NA 1P84J 1KPRB 3IJHA 2YPVH 3W5MA 4LHUB 2KPNA 5LCVH 1XZ0A 4LSVH 1T89A 1L0QA 3QI9B 5T1KD 1KNOA 3BEWA 3EAKA 3TO4D 3TBSB 5DURB 1I7UA 4FNLH 4ESKA 2XRAL 3Q6GL 5E1HB 1Z3GL 3WNNA 2FATL 4LSDA 1F3DJ 3KJ6L 2NYYD 4U1LA 4LCCA 3FO0H 1E6OL 2FIRT 1GAFH 1OCWH 2XA3A 2AQ2A 5ICZA 1K8IB 4PG2C 1ZLSL 1N5YL 3VH8G 2VXUL 1A1MA 1HINL 1NC4D 3MO1B 5I19H 1OSPL 4PRBA 4CU8A 5LQBL 3EKCA 3PIQB 4QRUA 1QR1B 5IW1A 2P5WE 2Y72A 2VL5B 5KSAC 4UOJA 3ILPA 1WT5A 3B9DA 4XPGH 2AS5M 4Q6IC 3QCTH 4HKJB 4OLVH 3V6ZB 3B5GA 3X17A 4RCAA 4XWOD 3RAJH 3FZUD 4XCEA 2VWEE 3ULSB 2V5YA 3L6FA 3LQAH 5JOFA 1LK3H 7FABH 5E70A 3LQAC 4HWBA 3VXQB 4HBQA 4PJ5B 43C9A 1URLA 3CPLA 2XKSA 1A6TA 4HS3B 1KCRH 4HKZB 5DZLA 1E6JH 3QHZL 5DMGD 1A6VH 4Z7WA 2UY7A 4DN4L 3SCMB 3B3IB 3TJHD 1FL6B 1MJ7H 4G6KL 4MLSA 3WS3B 1IEAB 1MWAL 2EH7H 2GFBA 3OKEB 2J6EH 4MQXC 4N5ED 1DLHA 4C56D 4QRTB 1RIVL 3F12B 1QVOB 5JXAL 1Q0XL 5HDQH 1INQB 5DJZB 3BPNC 3OKNA 3PF2A 1ZGLM 3MA9L 5IUSA 1G7PB 1UB5A 4MJIB 1BJ8A 4RMVA 5FUCC 3NMEA 2BFVH 4J3XA 4HJJL 1EO7A 3STZB 2XN9D 4KGJA 4U31A 5GSVB 3K3QA 4DQOH 3MJGX 4X7SL 4N1HB 3K81A 4PJFF 2X09A 3QWQB 4K3EL 1DUZA 4FFVC 4S2SA 3QEUA 2WP3T 1HSBB 3VFNB 2B1HL 4GKNB 1YQVL 1FO0L 2OSLA 4WW1B 5JW4R 3B2VH 1AGBB 3FQWA 2XTJB 5JDSB 2DIAA 5IR1B 4PY7B 4I2XE 4EOWH 4CN1A 1FVEB 3RL2A 1Z5LA 3GUTB 2CKNA 1DQDH 3UC0L 2OCFD 4XPHH 4KI5D 1F11A 1I9EA 1FYTE 4BZ2L 1QTYT 1NCBH 4PY8I 3BW9B 5IBTH 4L3ED 4X99A 3EYFA 1EGJH 3RVXD 5GGQL 3HUJF 4LSTH 5H35A 3CZFA 2H2SD 5K9OB 3EGSA 4MWFA 3IJSA 3MRHA 1BAFL 1HHJB 3NIDE 1N7ML 4O9HH 2X70B 4WNQA 2MFNA 4NO0D 5FK9A 1J1PL 3L9RB 4LARL 5MENE 4QHKJ 3STBA 4M5YL 4HUUB 4GG6E 4ISVB 2K7PA 5E95B 4P3DB 4PV8A 2CLZA 3BXNB 4WHTA 1DE4B 3I3BA 1MCNA 1YMMA 1F02I 4JPIB 1GGBL 3HI5H 1S5HB 4RA3A 1FPTL 4IRJB 5CJQH 4OZIA 1IAII 4G8FA 3DMMB 2CH8A 4PJAB 4WFED 2XICA 2R69L 3SPVA 3JXAA 3PWNA 1MQ8A 5MEOA 2OTUB 2VDNL 4H5SA 2JKXA 5B39G 2EIBA 1T1ZA 4NSKB 4K3GA 2AXHA 4MD4B 1SM3H 1LEIA 1IGFL 2WUBL 5HYJE 4WWKB 4AQOA 1I7RB 1RIHL 5BZDA 5E8NB 1UWGL 4X7TA 4JQVC 2MQ0A 5F44A 4M93C 3PABA 2VN7A 2Z92B 3CX5J 1C08B 3O3DB 4R26L 4V2CB 4EDXB 4LPCA 3O9WB 1GZQA 3BE1H 4X9HA 2R1YB 3VFRA 1UH2A 1A7PL 4I4WB 1JUFB 3PWVA 1ZT1B 4FABL 1JJUA 2YKLL 3RWHB 2J88L 5F1NA 5I8OH 4MD0B 5GGRA 1MCBA 2AXGA 3JV4B 5ADOL 3R1GH 5FHBL 5EU3B 1FH5L 4F2MB 1JPTH 2E27H 2AP2A 1QNZL 4LMQI 1XMWA 4NIKB 4O4YL 1PD6A 3V4UL 1OD7A 5HYFA 3MTRA 5DHVB 3MNVA 4N0FA 4AM0B 1UYWH 3U0PA 4U6XA 5JW4N 4K3DL 3V6OA 1N8ZB 1S7VB 5CEZL 3JTTA 2BOCB 3V5KB 1DQQA 4PJDB 1A7BA 3TZVC 1FFPA 4XCFL 4FFZH 4JM2F 4OZFG 4B7IA 3LS4L 4WUUA 1XGTB 4W6XB 5JLZA 3LCYA 3LIZL 4YC2C 5E9DD 4JQXC 2XNAB 5IT2L 2E3VA 1E4XL 3S4SA 4TVPL 1U8KB 1QSFD 3L7EB 5H37H 1IC4H 5C9JB 2RBLA 4G7VL 5ID1B 5C2UB 4YEFA 1ZHBA 5EPMB 3MCLL 4XNUH 1CD8A 2OP4H 1CFBA 1TZIB 1H3PL 4OCWL 1YPZF 3BDYL 2QHRL 5KOMC 2JIXA 4GBXA 3M1BA 5HI5C 4LSQH 4F8TA 2HVJA 1CICA 1HE7A 2EDOA 4D3CH 3WXVL 5AZ2L 3QUXC 1BM3L 3ARBC 5DFVD 2W0FB 1KEGH 2BXYA 4ZXBC 2A6KB 4PB9L 1J10A 5D1QD 2APVA 3QNXB 1Y0LB 5HHQA 3UYPA 3UBXB 5GGVY 1MLBB 1I1AC 4PTUB 1SJXA 1ZV5A 3OKDB 1D5BB 5DVNA 1JPSL 2ZJSL 4PJCE 4Z6AT 5AG8A 1HDMA 1PGRB 3I75A 4PJ8C 4PRHA 5C08E 1AO7B 4H1LB 5KVEH 3GMQB 3RWCB 5I16B 4CW1A 3H7BA 4ODXA 2R8SH 3MRFA 3T1FB 3IJYA 4JFQA 1QFWH 3F58H 2GT9A 4ENEC 5I1DA 3IFLL 2Y25A 2E9JA 3PE9A 4DVRH 3ZL4H 4U2YA 3HMXH 4MVBD 2H45A 2AJVH 1RZIA 3EOTL 3KS0H 5DK3A 3IXAA 1OTSD 2BRRL 4IRZH 2AXFA 1ZWIB 4ZD3H 2ZNXA 2QSTA 2XZQL 5DI8B 2K3TA 4OBSA 5JIKA 3WNLA 1PYWB 4XCNA 4M7LH 1AD0A 2WK2A 2A74A 3SHSA 3E2HB 4OCYL 4PJBB 4UOW0 5TQ0H 4YAQA 5JUEH 3MOAH 2BVOA 3UTZB 1KTDA 3BKJH 2DKUA 2IH3A 6CGTA 4JDVB 5DWUH 1RURL 3HA0A 1WZ1L 1TTUA 1S9XB 2I27N 2GTWA 5MP6H 3C6LA 1T83A 3M07A 4FQHA 4YPGB 3T0AA 3MLSH 3REVB 4ZDHA 3DIFA 4D8PA 2H41A 5FM4A 5DD1H 5HJ3B 3Q5YA 5IV2B 3DHMA 3HRZA 1N0XL 1C1EH 2RFXB 4WJ5B 5CWSB 4TSBH 5B22A 5D7JD 1LDSA 5EOCJ 1MY5A 4LAJH 5C0DA 3VXRB 3P3YA 3RVWC 3KXFE 3GI9L 2OYPA 2R2EA 4J1UB 4WU7B 4N90E 3T0EC 3VG9C 4FFWC 4HPOH 2VIRA 1S7UB 4HEME 1NCWH 2IBGA 3RTQC 4F9PA 4MD5A 4EN3D 4RGNE 3WN5C 3FQXB 1C5DB 4M6MH 5HHMB 3ARYA 4IS6A 1UEYA 2DBLL 1GCFA 2H26A 3L5JA 2IGFL 3UAJC 1OW0C 4JFZL 3VXMB 1JIBA 3CLFH 2XIDA 4WRLA 3KPRD 4L8CA 2YMXL 4MXWL 1RAMA 1FCGA 4NUJA 1SEQL 1MH5A 2V7NB 1NGYB 2ZSWA 3QDMA 3LKSA 3TBTB 2WM0A 4LOUD 3DJ9A 4XVUD 1SY6H 1ZHKB 1UM6H 2CKBH 5IEHA 2C1PB 2CJUL 1ZTXH 3OGOE 1KTLA 2AJXL 4QRQB 2ILLA 4JVPA 1ZA6B 4Y19A 3ARRA 1CK0H 3IS0X 4TUOA 5C70A 5H2BA 5C0IB 3VXSB 1XAUA 1UJ3C 4LKCA 1H3UA 5D6DA 3MLVL 2EC9T 1PZ5B 1BBJA 4I0CC 1J8HA 1OAZL 3BPOB 3D2UA 5HHOB 1CXLA 2D0GA 4RIRB 3ARGD 4KUCF 3TGXA 3Q3GA 4ZUVB 3GDBA 5IK3B 3RNQA 3EYSH 3QI9C 1ZLVH 2B2XH 2GJZA 1CU4L 1UQSB 3FQTA 1G6RL 2RCSH 4XAKD 1LO0L 4YHKL 1IGIH 1JPGB 1RJLA 4NHUA 5BV7L 5C0CD 4AL8L 1ZS8B 4JO2L 3MJ6A 2NY5L 4X9BA 5D7KD 5IB4A 3N85H 3WNKA 1EHLL 2X4SA 1U8OB 2C3GA 4JRYD 1U8NB 1QQDA 3FO2A 4P23A 5TDPA 1MEXH 1XZ0B 2HTLC 5JOPD 3KLHC 3BEWB 4YZFE 3GMLA 3SGDI 2Q7NA 1E27A 1CXEA 1QRND 1I7UB 5IBLD 4HIHB 3QDJD 5KZCB 3EHBD 2R0LL 3BKYL 3B2UC 4U1LB 3QCUL 2ZOKA 5KSBB 3ZTJG 1I8LA 1WBXA 5ICZB 2NZ9C 1FQ9C 4BQBA 1E4KA 1A1MB 5DD0L 3FJTA 4PRBB 5DUBA 4QRRD 1A02N 4QRUB 5IW1B 1CE6B 1F8TH 3F7PC 5J0BA 3VI4E 3MV9E 2N1KA 3SCMC 2B4CL 1TVBA 4I0PD 3ILPB 4LAQL 1A6WH 3GSVA 4IDJL 1UXSA 3CX2A 1DEEA 3BKCH 4H88H 3DUSA 3L5XL 4XCEB 4NWUL 3L6FB 5JOFB 1D3CA 4X5XA 1XH3B 4M7LT 4P2QA 3BZDA 2CPCA 1AIFA 4MZ3A 3BESR 5H8DA 3MCKA 43C9B 1OTUD 3CPLB 4U1JA 4H20H 1A6TB 3CXHJ 3QIUD 2LTQB 1JRHI 1G1YA 1U2CA 5ISZA 1NUNB 4U6VL 5CBAA 2H3NA 4Z7WB 4KK5D 5I0ZA 5T3XH 2ADFL 3D39E 3MRNA 1O7VA 5DRXA 1QA9A 3TPKA 2GFBB 4E42A 1DBJH 2FGWL 1F00I 5FYKD 3S3SA 2W1NA 5HHVL 1M6OA 4LSPH 1QACA 1CZ8H 3EYUL 3WFCL 3ULUF 5L0QB 1BOYA 2GJ6E 3QAZB 2HFFA 3OKNB 4AEEA 4UV7H 3U4EA 3ROOA 3E6FA 1A6AA 1UB5B 2GHWB 4WO4D 1MAKA 1RJZA 2XTJC 4PV9A 1MREH 3ZDZF 5D1ZA 1MFDH 1UZ8A 3TT3H 2VDRL 1MSPA 5MHSD 4JPKL 5FCUH 3KJ4B 1I1RA 1DUZB 4S2SB 5C0GB 3QEUB 1FVDA 3WFDH 4DKDC 3DI2B 3NH7L 1EHNA 3BP5A 5EFIA 2OSLB 4OGAD 3ROLA 4Z7QE 4ERSH 2P5WA 3FQWB 1OL0A 5L2KD 3DVGA 3OAZK 3DSFL 1WEJH 2BSRA 1GGTA 1Z5LB 3ZDYF 3E1F1 5E2VL 5DMYA 1CGSL 3V5DA 2JELL 1F11B 2IG2L 2P42B 3DOSA 4IRJC 2XWBA 4KROD 5DLML 2CUHA 4DZ8B 4X99B 3RBSA 4I5BB 3EYFB 1M1SA 3V0VB 3DMMC 4FQCL 3V4PH 3CZFB 1OAUL 4MWFB 5D1XA 3IJSB 3MRHB 4AEHL 4NKQB 1XIWC 5EA0H 4WNQB 3SO3B 5FK9B 5IKCA 2JK5A 4RFNB 2VXVL 1H8SA 4WWKC 4PV8B 3QEQD 2CLZB 4WHTB 1YQ2A 2VXQH 4WI4A 3VCLA 3WJLC 4PJIE 2ORBL 1YMMB 3O9WC 3U4BH 3VWJD 1ZLUK 4LP5A 4YBHA 4OZIB 4L4TE 1LE5A 4MNHA 4G8FB 3LEXA 4HC1A 4ODSL 4A6YA 3S36L 5DJCA 3SPVB 1JYNA 4YXLH 3G6AA 3IU3A 3PWNB 4NQDE 3BWAA 4Z76A 5MEOB 2P47B 4XCCH 3SE3C 3GNMH 1WICA 5JQ6L 4H5SB 3TPUB 2XV6B 4Q9BA 4AIZA 3DRQA 3LN5B 1T1ZB 5K9KA 4ZMAT 4FQ1L 4QGTA 1LEIB 1CFTA 5FYJL 3K0WA 4WDIA 3V52L 4JRXE 5BZDB 2ZUQB 5T3ZH 4LLDA 3DYMA 4QRSA 5DHVH 3PABB 3K7UA 1AI1H 1FZMA 5GGSY 3MNZA 1RHHB 1N6QL 3OX8A 4PJGB 3SDXE 2XXMB 4WFGE 3CIQA 3VFRB 4L9DA 5F71A 4FQJL 4ZFZA 3PWVB 3QB7C 2CRYA 4IOSD 5F1NB 1Q0YH 5CZXC 4WI3A 5GGRB 1RULH 4KXZH 4Y8AA 3MXWH 4LVEA 5DD5L 5IBUG 2DQDH 4LBEB 1ZOXA 1WV7T 3SKOA 3VFGL 1WWCA 3Q5OA 4BK4A 3JWDL 3OKOA 7CGTA 1P4BL 1FYTA 4RA0C 1MUJA 4CADA 3MNVB 4N0FB 3IGAB 2WQRA 3U0PB 1UJTA 3NAAH 3GSNL 1IAOA 3QQNA 3JTTB 2QR0A 3W9EA 3O2VH 2WWMD 2EH8H 4MAYB 1DQQB 1HIMH 2NXYD 4GAJL 1Q9KA 3MOQA 1FFPB 2GSIA 4QEGA 1MFCH 2H8PA 3X11A 1CFQA 2JE8A 2UUDH 3HZVA 4WUUB 1G7JA 1BIIA 3NFNA 2D4DA 1N0LA 2HJKA 4XC1H 5JLZB 2E6JA 4N8PA 1XR9A 1CD9B 2FEDD 3MBEA 1CXHA 3S4SB 3B5TA 3VGBA 3KYKH 4KQ4H 1F4AA 4J23A 2NLJA 4P5KA 4XBEH 5CZVH 1ZHBB 2PO6A 3SO5A 3C5JA 3LZFH 4HCRL 4M43L 5M7QA 3UYRL 1XF2A 4J6RL 2VC2H 4ODVL 1KN4L 5F3BA 4P3CH 3MUGB 2JIXB 3M1BB 4GBXB 2HVJB 3FL7A 4H1LH 2YPVL 5DJ0A 5LCVL 5HYJA 1CICB 3A67H 3N06B 4LSVL 1PKOA 3LKPA 4HF5H 4I3SL 3QIWD 8FABA 4RRPG 3HG1A 3BZEA 4FNLL 1BWMA 3CNKA 2NY4B 3J8F7 5ESAA 1B0RB 1MQKH 2O26U 3PGFL 1KJ3L 5HHQB 4TSAH 2NPLX 2A38A 3FO0L 2CR6A 4L8SA 3S34H 1A2YA 3EOYG 4RAHA 2BSED 3DXAE 3GMMA 2O61A 1U0QA 3I75B 1CXFA 4PRHB 4W68A 3E2HC 2BZDA 1INDL 4PYGA 2W9DH 4CW1B 2IAND 3H7BB 1ORSA 4ODXB 3MFFA 4F58L 2FD6L 3QCTL 3MRFB 3AVEA 3IJYB 4JFQB 3BOVA 5A2LH 5I1DB 3FB5A 3UTOA 3M8OH 1KJ2A 2VH5H 4Z5RA 1CCZA 1JGLL 3NIDF 5F6HI 3LQAL 2BERA 4GKSA 2LE9A 1RZIB 4C56E 1KLGA 2YD1A 1QD0A 4LQFH 1MIEL 3IXAB 4KDTA 2Z0BA 3UTPD 4ODBD 1A7OH 4GG6F 3EW3B 3G04A 4RAVB 4HUKB 2AXFB 4CVXA 4G3YH 1KCRL 3KAAA 4K3JL 4XCNB 1AD0B 1A6VL 2A74B 3MRJA 1UKQA 4C4KT 4HUNB 2FX9H 3Q48A 1CDIA 4YAQB 1MJ7L 4ODWA 2EH7L 2BVOB 2J6EL 3GRWL 1PG7L 1KTDB 2YPLD 2ARJA 2IH3B 1CDCA 1VGEH 2GKIA 3RY4A 5I71B 1QFOA 3KWWB 2GTWB 3HE6D 4PGZA 5HDQL 1HYSC 4ZAKD 3C6LB 5AYQA 3UROR 2OX5A 1GIGL 4GMSH 1NGWA 2R2BA 4ZDHB 4D8PB 2BFVL 5HI3D 2YRPA 5CUSH 3HRZB 3WV0A 2GK0A 3AXLA 2W9LA 4I18B 1EVTC 1HEZA 5C0DB 4DQOL 5D2NE 2X4TA 1NBVL 1U8HA 4DGVL 4LLUA 4NT6A 3R0MA 4HIEA 3ES6A 2YEZA 4UUJB 2XTLA 2E8YA 3RZWA 5CEZD 4KI5E 1XGYH 2BNRD 1U6AL 3VGFA 4JJHA 4PJCA 4G9FD 4G5ZH 4L3EE 1YNTA 2F15A 4X4YA 1T1YA 3B2VL 2XT1B 4MD5B 5C08A 3U0TA 1JZ7A 2BCKA 3HKFA 4MXQD 1DP0A 2YS4A 4EOWL 4MJ5A 4IS6B 2H26B 3BPOC 3TN0A 5D5MA 3UEZA 2IADB 3MUHL 4L8CB 5DUMH 4TVPD 3QDHA 3U7YL 5I15L 1MH5B 3BHBA 3QDMB 4KK9C 5IBTL 3LKSB 4WV1A 5C6TL 5EOQH 3BO8A 5IEHB 4I8DA 4LSTL 1DQLH 4NQEA 1KTLB 4ZFOB 1FZOA 4Y19B 2UYLA 4MS8D 3RZCD 5H2BB 4WFEE 4LKCB 3NA4A 2WIMA 4QYOB 4KKAC 1BBJB 3WO3B 1PVHA 3D2UB 4JR9L 3CUPA 1MPAH 1ZK9A 4PJ9D 4HLZH 3KYAA 3Q3GB 1T89C 3RNQB 2E9WA 1LHZA 3HI5L 4DKFH 4X4MA 2GJZB 2DMCA 2DQCH 1D5ZA 2D7TL 5CJQL 2A0LC 1FDLH 4OFVA 5I74B 3TT1H 3FQTB 4ZYKA 4R3SA 1RJLB 3HZMB 2VE6A 1SYSA 4NHUB 4LHQB 2Y36L 5IB4B 5DSCA 3UTSD 4KKCC 1HXYA 1AR1D 1FGVL 2X4SB 3ZSTA 1A6UH 3G5ZA 5BOPA 1SM3L 1SJHB 1QQDB 4P23B 1MJJB 3ZE1E 5TDPB 1OF2A 4HK0A 4XP6H 4Y16B 2A9NH 1T2QH 1WT5C 4KMLB 1NCAH 1SEBA 4TOYL 43CAA 3VE0A 3GMLB 5DJ8A 5CGYC 1I3UA 3I9GH 3HNVH 5CAYB 1DBMH 3SN6N 4O2CB 1A7NH 1FNHA 3ARSA 1CTNA 2ZOKB 3IDIA 1J0ZA 3R1GL 3T0WA 2HT3C 5HGGS 4IOFC 5I1GH 4N8VB 4BFGA 1V8HA 2LTQC 5DUBB 2MCG1 3WIHH 1JPTL 4U7KA 2EEDA 5ANME 2OM5A 4DFHA 1TVBB 4FS0A 3STLA 4JFDA 1KCUL 2DQJL 1QSEA 5E9DE 2G5BA 1MFAH 1UYWL 3KPSA 5ILTL 4RMTA 3GSVB 4PP1D 4R7DA 1UXSB 1NUFA 1DEEB 2A1WH 1QSFE 4BQ9A 4M4PA 1NFKA 1TMCB 1X5IA 3DUSB 3EJZD 5AD0A 3AREA 5J13B 4U1NA 5F8RC 4HGKC 4X5XB 5L0QC 1KGCD 3UPAA 4G8GB 4P2QB 1OM3L 1AIFB 3ISWA 3QAZC 5CD3A 5JIIA 3TBYB 2FB4L 3ZKMD 1JF6A 5ISZB 1JPFA 5I66B 5CBAB 4YDVA 1FORL 2DBJA 3MRNB 1IC4L 1A21A 2Y5TA 1QA9B 5SX4I 2R29H 4WHCA 4TN9A 3LHPH 3GJFA 4E42B 4NNPL 2H1PH 2P48B 1MRCL 3KJ4C 5EO1A 2D7MA 1M6OB 2CLRB 4QHKI 4XNUL 2OP4L 3MRCA 1J86A 2NY2D 5F7WC 4D2NA 1YEHH 1YUHA 1TZGH 4D3CL 3U4EB 1U8JB 3ROOB 1A6AB 1RUMH 3LQMA 3W0WA 1RJZB 4PV9B 1KEGL 4C59B 5GS2D 1E28A 5D1ZB 3S3PA 3U83A 3NZHH 1CXIA 5C6WH 1ZSDA 1UZ8B 4Z77A 1BX2A 2VLKE 4QY8A 1CVSC 4NZRH 4I3RH 3HZKA 4OZGA 3ALPA 4KC3B 4K7PH 1FVDB 3L3JA 4PS4L 4KRLB 2BHYA 4JQIL 4QGYA 3CZJA 4LVHB 1YECH 4UILH 3RWGB 3BP5B 5EFIB 4OFYA 5KVEL 3ROLB 1CLYH 4MB5A 3MV9A 3VWKD 3SO3C 3DVGB 3FFCA 4L9LA 4YUEL 3RKDC 4RFNC 1D6VH 1QFWL 2BSRB 3F58L 2F53D 2C3XA 4FZEH 3ZL4L 4YE4H 3V5DB 4XBGA 5DEGA 2AJVL 3D5OF 2D9QB 3F7YA 2EYTA 3NA9H 4IRZL 3QUZA 1JNNH 3TF7C 3O4LD 3TH3T 4YFLF 5F6IB 4FG6D 4Z7OF 1WBYA 4M7LL 4X8JA 4PUBH 5D1XB 4JB9H 5IVZA 1H3XA 1B90A 2CIIA 5TQ0L 4LCUA 3T8XA 3MOAL 5IKCB 3GGWA 3BKJL 4OQTA 5IFHH 5EOTA 3SJVE 2ZUQC 1JP5A 3VCLB 1X7QB 2EC9U 4OGXH 1BQHG 2BX5A 4ZFGH 4BUGA 4Y4HA 5DC9B 4ELME 2ED9A 3ULUL 1LE5B 4MNHB 3LEXB 5EORL 5TE6H 2GJ6A 4FQIH 4A6YB 1J8KA 3HC3H 5DJCB 5D96B 2X4RA 3QFDA 4D9RD 2R39A 2JJWA 3IU3B 1MCWW 3V0WH 3BWAB 4Z76B 1RIUH 5HD8C 4OLXH 4TSBL 4YZFF 4QHLB 1ITBB 4JO4L 3DRQB 5K9KB 4LRNL 4LLVA 3DWTA 1CFTB 4OD1L 4WDIB 1KIPA 4LLDB 4QRSB 1A6PA 3WHE1 3KPRE 1V3KA 1FZMB 4X6FB 3MNZB 1S3KH 5EC2A 3OX8B 4ONGH 2X1QA 4HIIA 3V6OC 1V3LA 3QUYA 5EZJA 3WSQH 4MAYC 4H0IA 3B9KA 5CINH 5HHXL 3RPKA 1PW3A 4XP5H 1IC1A 4YNYA 4RGMB 3T0BA 5F7YC 5KTEH 4JHAH 5TDOA 3GKZA 3HFMH 3SKOB 4DUVA 4LEOA 5INCA 4XPFH 2AEQH 3OKOB 1FYTB 5LGJA 1S7WA 1MUJB 4CADB 1UM6L 4UB0H 3QXAA 1NC2D 2F5BL 1IAOB 2IPUK 2QR0B 3W9EB 3QH3A 1CK0L 1X5AA 3D9AH 5HGDB 2XPGA 5FEBA 1V7ML 2LAGB 1OTTD 1FRGH 1HH9A 3HMWH 1Q9KB 1T1XB 2ICWJ 3BJ91 4HXBL 3T65A 4BQ8A 1YYML 2GSIB 1HNFA 3O6LH 4GBXC 2H8PB 3HAEA 3WS6A 1E4JA 1CFQB 3X11B 3HZVB 3QEGH 1G7JB 1BIIB 3NFNB 5EU7C 1KCLA 5D7KE 2HYMA 2HJKB 2CUMA 1CICC 3D3VE 3IDGB 1QLEL 2DLHA 1JWMA 3EYSL 4K23H 4JRYE 2B2XL 1XR9B 1SVCP 1NFDE 3MBEB 1B6DA 3FOLB 3B9VA 2PYED 1YEFH 2RCSL 2NY4C 4P5KB 2NLJB 1IGIL 5JOPE 3QWOA 1A3RH 1BF8A 1MCQA 3N85L 1XF2B 2A83A 1GXEA 1X5XA 3S5LG 4MX7A 5F3BB 5IG7B 5C0BA 2E8ZA 4P2OD 4IRSD 2HWZL 5DJ0B 1J88A 2OZ4A 5GRVK 3LKPB 8FABB 3WNOA 3QXWA 4QRRE 1T22A 3HG1B 3T0DA 3BZEB 3SDXA 4KGLA 5ESAB 1TIUA 2VLRE 4L3AA 4MB3A 4Z7QF 5GIRA 2WV3A 3V6BR 4L8SB 2CMRH 1A2YB 5J12B 1YC8A 3AM8A 3KPQB 3GMMB 3UJIH 3NACH 1R5WA 4UTBL 2FJFA 4XP9H 1F8TL 4MA8H 1LO5A 2CDFA 5KJRH 1ORSB 3MFFB 1A6WL 1KN2L 4FXLA 2DS4A 5B3JF 4LF3A 2F54D 4LHUG 3U79A 4G80A 1KPVB 3LVEA 3TBWA 3FB5B 4DN3H 4H88L 4OLUH 4NQVA 5I71C 4LPUA 2NX5D 4Z5RB 5CEYA 4R2GC 4GKSB 2DM3A 2RR3A 3C6LC 3ARZA 1T83C 5I18H 5GRVL 3IRPX 3G04B 1MELA 4ZOCA 4CVXB 4Y2OA 3X3GL 3Q1SH 1IKFH 2HRPH 4PJIF 3MRJB 1FFNA 4I18C 5T3XL 5K33A 5C7XH 4M3KB 4ODWB 5FYJD 5F1IA 1DBJL 4KQ3H 4PJEA 1G7HA 3ILQC 4PLKD 2ARJB 5T1KA 4WTXA 1CFVH 4OLZL 3O2WL 3TO4A 4PJGF 3BKML 4GQPH 1N59A 1R5VA 4LSPL 1GGIL 5MHSE 2FBOJ 5DF0A 1D5MA 2E9BA 2FEEI 5FGSA 1KIRA 4ODUB 4F7EA 5GGSA 4UV7L 4J3TA 1RUKH 4F9PC 3KPOA 1NGWB 2R2BB 3VRLE 3O2DL 5HHNA 5A3IC 2GK0B 3D1MC 1MFDL 3UJTH 3TT3L 4HJ0C 4DTGH 2R2CA 1HEZB 1XFPA 2ZUUA 1TVDA 3OHXA 2AERT 2FGZA 1CDGA 4RNRA 2X4TB 1U8HB 4LLUB 2IWGA 3ES6B 3RP1A 5KVFH 4R0LA 1UH4A 1T7ZA 3H3BC 1A0QH 4NUGL 4NN6B 2OMBA 1T1YB 4ERSL 2MWCA 5C08B 2NXZB 4YEEA 2BCKB 5D6DC 3CFKA 5ACMA 4QXGH 4MZ2A 1MCPH 3MC0A 3TN0B 4Z7UE 5D5MB 3IDUA 4NC0B 5BRZD 1RUPH 2ATPA 3CFCL 1CGYA 1J1OH 3QEQE 4C56A 5I74C 3P40A 4WV1B 4KJQC 2CXGA 3BO8B 3RWEB 1F4YH 4U0QB 2DYPD 4NQEB 5J3HD 4QLRA 1FZOB 3VDBA 5M95B 4R7NA 5TE4H 2UYLB 3NTCH 4LCIH 5DD6A 5EA0L 2EEBA 4J8RA 1OQXA 1BVKB 1U92A 3E3QC 4P23C 5BVJA 1JE6A 2DF3A 3BWUC 3CUPB 2VXQL 4Y16C 1YNKL 4XBPA 4M1DL 2QEJA 2XN9A 3U4BL 4OCLC 4ZUSA 2B1AL 1AC6A 3S88L 2YD5A 1BD2D 1D5ZB 3F7VA 1HNGA 4PGDA 5L9DH 3V7MA 1JNJA 5CSZA 1EA9C 3OGCA 4U7MA 3B9AA 5C0JA 4ZYKB 4LDEB 4R3SB 2VE6B 4UV4H 1I8LC 4XCCL 1AXSA 2CQVA 1FZKA 5DSCB 1R5IA 4QWWD 4HJGA 5FV2A 3G5ZB 2HP4A 3SE4A 1YC7A 5EUOE 1OF2B 4M6NH 4HK0B 4XPAH 2FO4A 4NQCB 3LD8B 3MR9A 1IRAY 2V2WA 1SEBB 4XNYL 43CAB 3U9PH 3VE0B 5DJ8B 4UOW1 3RA7L 2ZOLA 2ADIA 3KR3L 2C3HA 1WLHA 3KLDA 4L3EA 5J13C 5CJBA 1Q0YL 4RGNB 1RULL 3IDIB 4JM2D 3MXWL 4NDMA 4OB5H 1OP5H 2DQDL 3OAUH 4NO0A 4HX1B 2NR6C 3DETD 4YHPB 5I30L 5J89A 2O5ZH 1P1ZA 4E41D 3MRBA 3ARXA 1ES0A 4JFDB 5CD5C 1QSEB 3P0VL 2EDHA 1FJ1A 2G5BB 3KPSB 2YUZA 1GZPA 3NAAL 4DW2L 2NY6D 3LV3A 4R7DB 2XA8L 2EH8L 1BQUA 5L6YH 3VRIB 1YEKH 1JF1A 2EO9A 1HIML 5I1HH 1TLKA 4PJXE 1LWRA 1G7LA 1TJGL 2QADB 3GEWB 4X6CE 4YQXH 1JHKL 2ZCHL 5DVLA 4XC1L 3I50H 1QP1A 1WFTA 5FM5O 1O7SA 1U8PB 4D0CB 4OT1H 1CD0A 1X4XA 2FHCA 2FX7L 1JPFB 5D1ZC 4YDVB 2UWEA 3TWCH 3JZ7A 3OSKA 3KYKL 4KQ4L 2Y5TB 5FKPA 4XNZB 2X4PA 5CZVL 2WANA 3GJFB 5HVWA 2OJEA 4PRPD 5EO1B 1GGYA 4L4VD 3LZFL 1JZ2A 3EUUA 2VC2L 2EDXA 2KL6A 3MRCB 4P3CL 4GAYA 5BZWA 4LVHC 3WNMA 2ED8A 5JW5A 4G8EB 1CQKA 3KYOA 4HPYH 3S96A 3GMRA 1CGUA 1DL7H 1LDPH 2ICEA 3W0WB 4GXUM 1H3VA 1HHHA 4ZNCD 3WXWH 1E28B 1JV5A 4W4OA 4O5LL 3N9GH 4KI5F 3SKUD 1ZSDB 2A9ML 1Q9LB 4F57H 2PR4L 5K9JH 4Z77B 1BX2B 5I0DA 4QY8B 2IANE 1KLFA 2QJDA 5C0RH 3KHQA 2KBGA 3HZKB 4OZGB 3U4AA 3QG7H 4JFFB 1HHIA 4R6UA 3IKCA 3RPIA 3F5WA 3L3JB 3S9DB 4YPJA 5F9WB 3KPLA 4HT1H 5F6IC 4KJPC 1FC1A 5D1XC 2MCPL 5ANMA 3ZE0E 3HPJA 1KJMA 1GOGA 2W9DL 3C5ZA 3MV9B 1EEQA 3FFCB 3BMVA 4L9LB 1P69B 5E9DA 3LKNA 3TVMD 5IWLA 1R3KB 1EFQA 2WNGA 1DJSA 2VH5L 3PQYA 4OZFB 1QSFA 2O5YH 4XBGB 5DEGB 1CGXA 2YPLE 3F7YB 4LPVA 2EYTB 4LQFL 1WIOA 1JYXA 5J11B 1NLBL 4HC1H 4R4ND 4PJ7E 4A6YH 4F7TA 4WY7H 3QUZB 4AT6A 4G3YL 3UBXG 5D96C 3UDWA 5C0NC 3ARFB 1RUQL 1WBYB 4X8JB 3BT2H 1DFBL 3IXTB 5IVZB 3FN3A 3SOBL 2FX9L 2AK4D 4LCUB 3T8XB 1RZFH 1BFVH 4TSCH 2F8VA 5DEZA 3SKJL 1W8OA 3GGWB 2LVCA 4OF8A 3IB4A 2CGRH 3BAEL 1HKLH 5FDYA 3WLBA 1U41A 1VGEL 5EOTB 1BECA 1X5GA 4PP2A 5CJ5A 1MOEA 5D1QA 3MODL 4Y4HB 4XPBH 5EZOH 2HH0L 1AGFA 3PNWA 4CVUA 3ZE1F 2GJ6B 4GMSL 4TUKH 5CEZE 1L9NA 2AJ3A 2BNRE 2X4RB 3QFDB 2H2PC 3QWRD 4EQ3A 4RGMC 3D69B 1LEGB 2QKIB 1RFDH 3NABL 4ZOAA 4LLVB 2AABH 4V1DE 3JBG7 2G2RB 5SWQA 1P9MA 4HG4K 2WLZA 1T3FA 1KIPB 1QKZL 2YD7A 3VU2A 1NAKL 1GYAA 3FB7A 2XKUA 1OGAE 1XGYL 1FAIH 4TVPE 1HKFA 4BFEA 5EC2B 3WDHA 2VJXA 1A7QL 4MLIA 3C2AH 4HIIB 4POZC 4G5ZL 3N1MC 3SY0A 3QUYB 4JCMA 3B9KB 4G42A 2VERN 2WINA 5K59E 2R23A 5I1KL 4YNYB 4DVBA 5D7IE 3G6JF 1DEDA 2IFFL 1NJ9B 4KUCD 3NIGF 2QSCL 4JGUA 3X14A 1UWEH 2HAZA 5TDOB 5GRZA 4LEOB 3GM8A 5INCB 3IAPA 3MBEC 1DBAH 5LGJB 4EEEA 1S7WB 1UVQA 3CMOH 4Q9CA 1DZBA 5C0FA 3V79C 3QXAB 2JF1A 3AB0B 1MF2L 3QH3B 3TM6A 2P5EE 3MRPA 4OCMC 2XPGB 4XI5C 4YHLL 5SWZD 1HH9B 3HAEB 1MPAL 2V7HA 3ULVE 3UTSE 2XQYG 2X9YA 2OI9B 4P59H 1MCKA 4ZO8A 3CFEA 1JWMB 2D0FA 1MVUA 4DKFL 3ZHLA 1LP9E 4M8QA 4RWYL 2DQCL 3DUHA 2NY1D 3SGDH 3U48A 1I1AD 4JN1L 1KTRL 3T3ME 4ELMA 4WTZG 4X5WA 4OZ4A 4FQ2H 3QWOB 5I8EA 4PRAA 3HB3D 1VFUA 4L8SC 5KAQG 5J12C 3EDFA 2HVKA 2A83B 4MX7B 4EN3A 4OF5A 5C0BB 5T1LD 1LILA 1RSFA 1G9MH 1NGPH 5HXMA 1DTUA 2A9NL 4Z0XA 1T2QL 4JAMA 1IGCH 1G9MC 1NCAL 1S7TA 1QPPA 3CCHA 1HH6A 1TFHA 4L5FH 4NN7B 3KLSA 5DJDA 3KPRA 5C09D 1T22B 1GGUA 1YEEL 3I9GL 5E2TH 2PXYA 3RWDA 1XGUA 4HUMB 4WI6A 2YD3A 4GUPA 4PRDA 3H2WA 5GIRB 1ACYH 3DNKA 3L3OA 2C4FU 2G75A 5IHZA 4KDTC 5I1GL 3JTSA 1QLFA 1BQLH 3WIHL 4TTGA 2XFXA 1R5WB 1JRHH 2FJFB 3KPTA 1JZ5A 4F33A 4HWZB 1J0JA 2IMMA 4PGBB 1LO5B 4JFOA 3G5VA 3KNBA 1MAML 4ZUTA 2CDFB 3VFMB 4D9LL 3ARGA 1JN6A 1MFAL 4Y5YA 2UZIH 2G60H 5F89A 5C8JA 2A6JB 4LF3B 2IFGA 3B6SA 1RMFH 4G80B 1ZAGA 3UTTE 3TBWB 1H0DA 3RFZC 1QHOA 4NQVB 4HLZG 5HSFA 1KYOK 5CEYB 4HD9A 1YEIH 1CDBA 3ULUD 4HZLA 1BGXH 5F3HB 5C0CA 4OCXH 2I60H 4BUHA 5GSRA 5DHYA 4R4FL 3BEVA 1O0VA 2E6QA 3Q6FA 3D0VA 3LN4B 5A2IH 2YD9A 4W4NA 1IEBA 3MLWH 5F1IB 4BZYA 4PJEB 1G7HB 3TBVA 1R0AH 2VAAA 1MFBH 5T1KB 4LCWD 4APQD 4UT9H 3TO4B 1MCWM 1G0DA 1XF3A 1N59B 4JDZA 1R5VB 3EO0A 1QRNA 5JDJA 3RTQD 3I6KA 3QDJA 5KS9B 5DRZA 1KIRB 5GGSB 4NN6C 3I84A 3LKOA 2YWYA 2CD0A 2Y23A 1A5FH 3KPOB 2NXZC 4JG1L 4MCYA 2Z9TA 3L3DA 2CDGA 3NZHL 5HHNB 4QRRA 3TN0C 2GYSA 4I3RL 3WLWD 1EJ6A 3MLUH 4U33A 1CE1H 5EU6D 5DT1H 2F53E 1NANI 4WV1C 3AGVA 4NFCA 3MX0A 1LO3L 1A4JA 5HDBE 3CU1A 2DL2A 4HS8H 4CAGA 1YECL 5IESH 3CXDH 3KLAA 5GISL 3I02A 1XGRB 1CLYL 4GRLB 5EU5A 2KUTA 2BY2A 4AIXA 3O4LE 1I7TA 4J3WA 3CFKB 5D7LD 5L88L 3QIUA 5LWYH 4K94H 4I0KA 1J0YA 4DAGL 4F3FA 3BX7C 1ZVYA 4K94C 1UM5H 1AQDA 2APTA 1L7IH 5E08H 2ATPB 4JPVH 4C56B 6FABH 4NBYB 5JW4M 5DVKA 4P57B 5JXED 3FONA 1NGXA 4PUBL 5HTSA 4LVOB 2QTEA 5GGVH 1NFDF 1I9JH 5DD6B 4WI7A 1KB9J 4D9RE 4J8RB 4WO4A 1CI5A 5IFHL 1SMAA 5BVJB 5FB8A 3D18B 1MFNA 1W2KT 4XBPB 2EKSA 3LD8C 1W72A 5IMLB 3R06A 4OGXL 2XN9B 3MJ9L 2MTPA 4FN0A 2DM2A 3F7VB 3PUCA 1IGMH 3NIFE 5TE6L 4FQIL 5CSZB 3OGCB 4PJ5D 2V17L 4HKBA 5C0JB 3V0WL 4O58H 4UT7H 4LRIA 4RGNC 3EZ8A 1HK6A 1RIUL 1AXSB 4OLXL 1FZKB 1X4ZA 3SCMD 3V7AG 3DV4A 3G9AB 1RK0A 5L2KA 2VKXA 4LNRA 1TJIH 3MR9B 2XZCH 1P4IH 1U3YA 1D9KA 3RUGE 1S3KL 4XNMB 1KB5L 2VKWA 4ONGL 3CFDA 5INDA 2ZOLB 2ADIB 4PGCA 5CINL 4L3EB 1YJDL 4XP5L 4MJID 2QADC 4NZUL 4P2RD 1NBZA 1F4HA 1Q9WA 4NDMB 3PDOA 1G7MB 1ZLWH 5KTEL 4JHAL 1J05A 3T2OA 5JHDD 3HFML 4NO0B 4GQ9H 4XPFL 5T3XD 2AV1A 5ESVA 4S11A 2AEQL 1QRKA 5B21A 4ACPA 5A2KH 1TCRB 4WVRA 1P1ZB 3X13B 5JHLH 4N68A 5E99H 2EDFA 1ES0B 3GJFH 4XNZC 1GZPB 2FSEB 3LV3B 5JZ7C 3IF1B 4HWEH 4HFUH 2PYEE 1YY9C 1JF1B 3BFOA 4GRMA 1FRGL 5IEKB 2Y5EA 3ARUA 3K46A 1OOAA 3O6LL 5C0AE 3QEGL 3V95A 5IB1A 1F3JA 3WEXB 5FGCB 4YXHH 4K23L 4IJ3B 4M6OH 1CTOA 4RX4D 1WITA 1EFXD 2UWEB 1YEFL 5CILL 2X4PB 4PB0H 3QXTA 4L29A 4NKOA 2OJEB 3OL2A 2NMSA 2WQ8A 3VRLF 1B4JH 4U1KA 1NBQA 1QBMH 1X5LA 2DQFA 5F9WC 4GAYB 5BZWB 4JY5H 5JW5B 3S96B 3GMRB 5EUOA 3ZT7A 3GIZL 2ICEB 3BIAX 4Y89A 2WUCH 4L9LC 1DVFB 4YLQT 1HHHB 3GO1L 2VQ1A 4PRNA 2DWEA 3EO9H 1JV5B 2FX8H 4GSDH 1ADQL 3MLYH 4OZFH 3ARTA 3SQOH 5BJTA 1MWAA 4PGEA 3DMMD 3JUYA 3S4SG 4OUUA 5IBUB 4GKZA 2F54E 2CMRL 1Q9OA 3MV8B 5TPWL 5J11C 4WGVB 3IKCB 2RHEA 3RPIB 1S78C 2NX5E 3F5WB 3QUZC 5HYSA 5AEAA 3UJIL 3NACL 4Z7UF 3KPLB 4XP9L 1I9RL 3PWPD 1CFSA 3E8UL 1JBJA 5DJYA 5ANMB 3HPJB 1FFOA 1KJMB 3GMPA 5KJRL 3C5ZB 2VXTH 1TENA 4OQTH 5E9DB 1J0HA 3QR2A 4E0RA 1RZ7L 3LKNB 1S9VA 5FO8A 4R8WL 1Y6MR 3QEHA 3FN0H 3PQYB 2Q8AH 1QSFB 4C54A 5FYJE 1NCCH 2EIZA 4F80A 4PJXA 1F6LL 5D72L 4Y4HC 4OD2A 5DTFA 3ZKND 3OXSB 1UCTA 4F7TB 1G1CA 4AT6B 3U7WL 3Q1SL 5JPMA 1IKFL 2HRPL 1FO0A 1P7KA 3ABZA 3DV6B 5C7XL 3RX7A 4WEMB 2WIIB 4YHMH 1V3MA 4KQ3L 2ZZUT 3TO2A 3QIWA 3MGOB 1CFVL 1HN1A 4JLRA 3WLBB 2ICWI 5ITBH 4PP2B 1ZEAH 4QNPE 5D1QB 4OSUL 1IM9B 1WAAE 4PRIA 4Y0GA 1E4WH 4EDWH 1JZ3A 1AGFB 3PNWB 3QUYC 2P49B 3B9KC 2AJ3B 3HUJE 3O6ML 4O2FA 2UVFA 1JGEA 4P2YA 4Z18A 2QQQA 1F3DH 4YX2L 4P4KD 4DGYH 5GS0L 5IW6A 2IANA 5I8KH 1JHLH 1T3FB 2IPKA 1UACH 4PJHA 2EDNA 2FCBA 2JB5H 1X9QA 3FB7B 5ICXB 4NOBA 4ZFOL 3NFSH 3ZZ1A 4JDTH 3AB0C 4NPYA 5BRZE 3SY0B 3VD4A 4G42B 4OZHA 1AHWA 1IC7H 5HGBA 3HAEH 2WINB 4FMFA 2R23B 1MCPL 1BVLA 3WS6C 32C2A 4RMRA 3RHWF 4DVBB 1U8QA 4UBDD 1P6AB 5DO2C 2OI9C 3ARDD 3FFDA 1EEZA 4HK3N 4X4ZA 2DTML 1RUPL 3FN9A 1T7YA 2YPLA 4X6CF 2D9CA 1IZKA 1IAIL 1SJVA 1UVQB 1K9TA 5AWNL 3BD4A 2WBJA 2ESVE 1ZXQA 4FQXB 2DQHH 1BD2E 2NTFB 5KANG 3HE6A 2BVPA 1IAKA 5E4IA 3MRPB 4ZAKA 4LCIL 1AO7D 1IARB 4P5MA 2J4WL 4YDJA 4YDIH 4TTDD 1RUAH 2OZ4H