1D6VH

Conformation effects in biological catalysis introduced by oxy-cope antibody maturation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords CHIMERIC GERMLINE PRECURSOR OF OXY-COPE CATALYTIC ANTIBODY A
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6vH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6vH02
1C1EL 3PWLB 3ESUF 4FQXA 2BY2A 3H42L 2W0FB 4GH7B 4HUNB 4F58H 2MFNA 3IDGA 2AEIT 4H0GA 3BUYB 1N6UA 5T1KA 3F7VA 2PTVA 1D5MB 5KSAC 3K1KC 1A2YA 5B8CC 4ORGA 5DUPH 1ZHNB 5E6IB 2FX9H 3QEQB 1ZGLA 1D9KC 1G7HB 3P4NA 4UBDD 1FYTB 4OBRA 5L0QC 4QHUA 1ZHKB 3PV7A 3C60A 4WJ5B 1R24A 2L0DA 4IOSD 1J0ZA 2JELH 2NY4B 3O3UN 4M00A 3ZZ1A 2XG5A 4FTVB 3HR6A 4F7CB 4PJHE 2QKIB 5TE7L 4N9GA 2DM4A 1WF5A 5E8OB 3DV4A 5IOPB 1FNFA 3GGWB 4ZUUB 4DCQB 4QEGA 3I3DA 3LKQB 1ERNA 1Q8MA 1CICB 4GW4A 1AFVL 4JRYA 5DJAB 3SN6N 1CLCA 4FTVD 4XB8A 2XA8H 1D7FA 2VLJE 5GPRA 4KKNA 2AJXH 1F13A 5C71A 5C3LD 1A02N 3OJVC 1FYTD 2LU7A 4YXKL 1ZV5A 3KAAA 2HFFB 3RKDC 2DWDA 4ZS7L 1HDMA 4JREB 1W0WA 5C08B 1WTGT 4XWGL 3ARBD 2P8LB 5SWSE 1AI1L 4C4KO 5DD3L 1QSEE 4PJAA 2AV7B 1MHHB 4X6CB 4MZ2A 4ZD3L 3O3BB 5CMAA 2ZG3A 1DVFA 3ILQC 3DSNA 4XMPL 2JB5H 5IROA 5C1MB 1EEUA 2F58L 1T21A 4ODHL 1GZQA 1G1YA 1VFMA 3V8CA 2R1YB 1DDHB 5LAXA 5E5UB 4NKOA 4HZLA 4WFFD 1A7PL 4XPBL 1BJMA 1ZGLB 3QUKA 3RWGB 1KTKE 2AW2A 4Y5VB 1NGWB 3PABA 4R96B 3H9ZA 1KB9K 1QRND 2GIYA 2EO1A 5EUKA 4MQ7B 5CZVH 3MV01 2DBJA 4KZDL 3RDTB 3MFFB 3U7YL 5IG7A 5BO1L 4YPGB 4KMQA 2PF6A 2BOCA 4NBZB 3MRFA 1M71A 4GXVH 3AVEA 3QUXD 5J9PA 4QRTA 5IB5B 3D87B 3CGTA 1CXFA 5SWQA 2DI8A 3QSKB 1I7RB 1KGCD 5DK0A 4JPKH 3MRIB 3HCVA 3UTPD 1BVLA 4EBQH 4N1HB 1OP9A 1U95B 4XBEH 3QIBB 1J1OL 3VFMA 3VWJD 3MLTA 3QJFB 3JUYA 4ZQKB 3CH8A 1TJGH 1D9KB 4NC1C 5J6HA 3RWHA 4MWFA 1HWGB 1KLGA 3SCMD 1WAAA 2X09A 2ICEB 4NRXB 5CJOH 1QVOB 2XTJD 4R7NB 1Q94B 2FX7H 4W6YB 1T5XB 4XCEA 5KVDL 3Q1SL 3JWDC 2HT4C 4LOUC 3F12B 3BI9X 1F3RB 3WNKA 1QPXA 4G9FA 4OQ1A 1N0XL 2HT3D 1RZ8B 1E4JA 2GTWB 5C0JA 4HUKB 3R06B 3F5WA 4Y5XA 3KPMB 2YC1B 1KEML 4X8JA 4Z77B 3RGHA 3EOBA 1T3FB 4JFZL 1HCVA 3ET9F 1MI5D 5CJQL 1NMCB 1SY6L 1FE8H 2XG4A 4MDJA 4NOBA 2OL3H 4NQSB 2XKSA 3I75B 4MYWB 1ES0A 2X7LA 3X14B 5B8CA 3H7BA 3RWEB 2OCFD 2Z35B 4JREC 4TOYL 5DWUH 3CUPB 5D1ZA 4MLIA 5I1AB 1UYWH 3HI1A 2AI0L 1NGYA 1ORSA 1SBSH 1PEZA 2HMID 3QISA 5JPNB 4K7PY 1OAUL 2NY2B 4X0KA 1OAXH 1LEIB 3ULVF 1HEZB 5IVXB 3BKML 1MEXH 2NY0D 2JB6A 4JQIH 2BY3A 4O5LL 1OGAD 3U6RA 5MEOA 4U1JA 4LLDB 3ES6B 2R2CA 3UBXI 4M5YL 5I1CH 1KXQE 2XZQL 5DJXA 4G5ZL 1MCIA 4P46A 4MDJB 3PP4L 3O0RH 4PD4K 4QXWA 4ODTL 1QYGH 2GITB 3MZTA 3LS5H 3C6SA 2VE6B 4HWNA 5J12B 5EWIL 3BPCA 4M61B 5D5MF 4KI5D 2XN9D 4NBXB 2Q76A 2QADC 4R8WL 4JHWL 3VDBA 1GOFA 1RJYB 3ZDZF 2BC4B 2Q3AA 4OT1H 1MLCB 4LASL 2OP4H 1OAUH 3QUYD 1CXLA 4L4VE 3V5KA 4JRYB 5DO2C 3VGEA 1RK0A 4HS6A 1HQ4A 3GRWA 1T1XB 4XPGL 3WS6A 3FKUS 1E4XH 3RVVC 4HFUH 1JPGA 3NA4A 1W0VB 2WBWB 4MNQA 2Y5TA 3FT4B 3DARA 4N90E 3ARGA 4FMFA 3T1FB 4J2XA 1SEBB 1J1PL 1U6AH 1TTUA 2VLKA 4QRSB 3WSQL 4WW2C 5F96H 5I18H 3G04B 2JIXA 2XFXA 1B88A 2XWTB 3FONB 1Z0NA 3ABZA 4FXGA 4O5LH 4HKJB 2BJML 1A6TB 2YA0A 1B0RA 4TNVK 1DCLA 5JHDE 2YEZB 1A6AB 3OJ2C 3L7FA 1CTOA 1QFWM 1H5BC 3UAJD 3MOBL 5J4MA 2IH1B 5IESH 4UNTA 1DQJB 3DURA 3HZMA 1LK3L 3VWKD 3CDGA 3EO1B 2BNRA 3UYRH 4YXHL 4WRLA 2LABA 4XCNB 3A0OA 1I4FB 4M62H 4NQXA 3C5ZD 5JIHA 3ARFB 3ZLQC 1RZGB 3D9AL 2QJDA 4WU5A 2YA2A 1RHFA 3BQUC 1PLGH 1QO3A 4K8RD 5E0QA 5TDPA 1BPVA 3S34H 3MJ9H 2GQHA 1OOAA 4GBXC 4U0QB 5EBWA 1JPTH 5F70A 2R2BB 1JI2A 4UI2A 3GMOA 4G6JH 2Y7QA 3GJFK 1FFQA 2ESVE 3GSRA 1I8MB 1EX0A 1Y6KR 4NJ9H 2D7PA 5CJOL 1K8IB 2Z93B 4GSDL 1P2CB 4BQ9A 5C0EB 1I9RH 4FQXD 3UPRB 1LO2H 1FPTL 1AD0B 1J8HE 4WVRA 4Z7VE 4CDGC 3ULUE 2BX5A 3BRGC 3DUSB 3GHBH 3JV6A 2AXJA 3V4PH 4LVHB 1A7RL 4S1DD 1URLA 5DT1H 5HY9B 2FX8H 4KK8C 1ZLVH 1TIUA 4F37F 1J0HA 1ZSDA 4D0BA 2KL6A 4OF8A 1KCUL 4PJAF 3L7EA 4GW1B 1A3QA 1UZ6E 4Q9RL 1N5YH 3M8OH 3R1GL 3TA3C 1H15A 2C4FT 2XZCL 1FL6B 1EUTA 4FQQB 1FZJA 4OZFG 2WWKO 3MLYH 1ZAGA 5E5MB 3RA7H 1FVCA 3ZE0F 2WV3A 1KNOB 1YMME 4HGKC 5EO9B 2XXMB 3NIDE 3WNLA 2D31A 3IS1X 1L7TL 1KIRA 4M4PA 2NXYC 4ODXB 3VXNA 4PJDF 5J13B 2DI9A 4HG4J 4CGTA 2VXSH 3KYAA 1R3HB 5TF1L 4G7YL 4LLQB 4EI6B 4YC2B 4YHYB 12E8L 1RURL 1QFUH 1FCGA 1HYRC 5FO8B 2NXYD 4BUGA 1EO7A 3Q6GL 2FX8L 4HC1A 4UOJA 1A6ZB 1RPQA 1CZ8L 3VXMB 1OL0A 3JV5A 1T0PB 4O9HL 4Y1AD 5TGBA 4F9LA 4LPWA 4L8DA 4X8JB 1UG9A 4LCCA 5D7JB 5A3IC 1F97A 4QKXB 3SKUD 4Q6YA 4DK3A 2KKQA 1DBKH 3BO8B 3QFDB 5KAQF 4P2OA 4PJAE 4JRXB 3NIFE 2VLMD 4WENB 1L0QA 5I17B 3EDJA 1Y18A 2AQ2A 3D39E 4NQVB 3NIGF 1IM9B 1HQRB 3PHQB 4ZS6D 1JJUA 4ZFGL 3PGDA 4EOWH 3BKCH 4WO4B 3N1PC 5CCKL 4DOHE 5E99H 5TDPB 3MNZB 3AU1B 3U4EB 4KKBC 4PJEA 3NOIA 3N85H 3BRFA 5D7LA 5GGTH 3SKMA 3PHOA 4HWBH 4PJ7A 3PWPE 4WWKD 3LKNA 1IEAA 3MLXL 5CP7A 1LO3L 1C12A 4WI7A 4XTRC 2MQCA 1KLUB 3FN9A 1IGJA 1TJHH 5LBSH 3ZT6A 2FEEL 3G9AB 2ITCA 5I1IL 3W2DH 4J3XA 3NH7H 3SE9L 1BMGA 1NCDH 3VDAA 1DQJA 3UTZA 3SKOB 4LVOB 4QLRA 1OAYL 3JTTA 5DMKB 1RU9H 4DKFH 1NDGB 4DZBA 1NGWA 3PABB 4R96A 3F7QA 1RURH 4IJ3B 1FVEA 5TDNB 1E0OB 3MNVB 4G80A 4U1HA 1I4FA 2ADFH 5HHOE 1QPPA 4FZ8H 3MCKB 1TZIA 1WAAE 2FR4B 3LN4B 4M8QB 3VD3A 4P4KC 3FAWA 1CG9B 4X4YA 3BQUA 1C08B 3ARGD 5C08E 2QTEA 1LP9E 3N85L 1K9TA 1U42A 2DWEA 3VDCA 1U8MB 2HTKC 3GMPA 4MNGA 3CVHB 4PV9A 3H3PL 2NY5L 2YUXA 3L1OL 2P8LA 4NUGH 1Z3GH 5DRZB 1Z5LA 4HBCL 3ALPA 2PYFA 2H32H 3FONA 4HS6B 5EZIL 3DYPA 3T2OA 1AD0A 2WZPD 1DVFC 4TPRL 4CL7A 2Y06H 4LSVH 3O41B 3IDIA 4GRMA 3WJJA 3QNXB 3DSFL 1I1AA 1U92B 5IV2A 5FGCB 1CGSL 3L5IA 5KVMC 4K71B 4KK5D 1T7VA 4PB9H 1N5YL 2DB8A 4HJGA 5E1AA 5ADOH 1ROWA 2BVYA 3O8XB 1FJ1A 2JF1A 2W1NA 4WFGE 2RIKA 3JTSA 5GS3A 4U6XB 2VDQL 2BP3A 2G9HA 3OJDA 3TN0A 2NY5H 1KBGH 4GMTL 5E2VH 3WXWH 3CK0H 4H1LH 1JWMB 1IQWH 1MCNA 4JR9L 4YHOL 2R4SL 4H1LA 1P53A 4G9FD 3QUYB 3NZHL 1A0QH 2AEPL 5DRWA 3MRPA 4F7EA 1JV5A 3A67L 5JA9A 1IGIL 4NCDA 3KPOA 4DW2H 1INQB 3LKOA 1QBLL 2R56H 3S36H 1OW0A 3BPLC 2FSEA 3MA7A 4QTHA 5H2BB 4XCCL 3ZDXF 4RFOH 1NCCL 2IALB 1NCTA 5BXFA 2X89D 5HGHA 1YY9D 2PUQT 3VH8B 2VDPL 4DN3L 4HUUA 2L7UA 4JLRB 1LO0L 2QQNL 2NNAA 2IH1A 2NR6C 5F96L 35C8L 5C0GB 5I18L 2F58H 1CLZH 1MHCB 4AENA 3PG2A 3MRRB 4TUKH 4YBQD 1YEKH 4M6ML 3TVMA 4MHHG 1EFXD 4LU5L 5EU6B 1BJ1J 3MRJA 2BNUA 2X7LB 3OHXA 1FFOB 3X14A 1L7IH 4Y4KC 1AIFA 1BOGB 3TH2T 1EH9A 1T5XA 3GMNA 5GJTH 3RWIB 3SBWA 4JANA 4YO0B 3FB7B 3FTGA 4OIAA 3REWB 15C8L 1Q9KA 2WP3T 2YD9A 1J88A 4BFEA 2AV1B 3F5WB 1P7QB 5F6HJ 2GEEA 3MV8D 1SEQH 4FZEH 4FQHA 2X70A 4M7LT 2RAMA 4X6DA 1LD9A 3OAZH 5SX5K 3HZVB 2ERJC 3MLRH 3ROOA 4QOKE 1TJIH 5H37H 3ZSTA 4FZ8L 1KCRL 1BLNA 3F7YA 2WBJA 4P46C 4E41E 5EUKB 1XGTA 5DRWB 1A6VL 4YHLH 3D3VA 1KUMA 2A77L 2EH7H 5GGSA 1I1YB 4G8FB 3HI1B 4GAFB 2X1XR 3G6JB 4U6YB 1KPVB 2YUZA 5TQ2L 2V7NB 4F2MB 3V7AG 3QULA 1YA5A 4LSSH 4POZC 1MRCL 1LEGB 3S98A 5EO0B 1R3KA 1UH2A 5DJ8B 4ZNEA 4U49A 4JDZA 3KYNA 4P9HH 4IMLB 4JRXD 3I75A 1VA9A 4HJ0C 5ISZD 2XN9A 1YDPB 2H9GB 1NCWL 1OB1B 1TQBC 1KIQA 2EYRA 4PBVC 3VXRA 4WI5A 1I1AC 2CKBL 1KIPB 4LSQH 3QQ3B 3B6SB 4RWHA 4PJIE 1LDPH 4XP9L 3GB7B 1IAKB 3SY0B 2BNQA 1DQML 3H9SE 2YPVH 3B5GA 1U8PA 3GNML 5B4MD 1JBJA 3RWIA 3V0WL 4P59L 1A6VH 2X4SB 5C0JB 5BQ7A 4QHMA 5CMAB 4BSJA 5L7XH 5GGUA 4Y4FD 3CFKB 2F8OA 2PYEA 1OD7A 5I30H 2ZG2A 3VJ6A 4MQTB 3ME0A 2L4OA 4HXBH 3UJIL 4QRUA 4YX2H 5HI4C 3RTQB 2AKRB 5FYKE 5E9DA 1P6AB 2HJKB 4C56B 5IMLA 3LD8B 1VFAB 3QNYA 4MXQC 4Z7NF 3BZDA 4J8RA 3GI9L 4X7DC 2EE3A 1X5FA 3FCTA 1YYML 1IFHL 1FYTA 3ZE2E 5DURB 2ZUSA 5FEBA 4XHQA 5DI8A 5MHSE 4XC3H 4KUCD 1L0XA 1S7WA 2CRIA 5ISZE 1XGYL 1A21A 4HK0B 3FFCE 3B83A 2X1WL 3QXTA 2WUBL 4P0DA 2G5BB 2Q8AH 2ZNWA 4Z76A 4QHNB 5ANMA 1KPRB 1RIVL 2AP2A 4WI8A 2P24B 1WVZA 4FQXB 2EDLA 1MFEH 1G7QA 4GAGH 4JEGB 4LSQL 1B2WH 4NWUL 1U8KB 1AKJB 3NMEA 3HAEH 1QKZH 1OWWA 3GBMH 4JY4B 3WS3A 4PBXA 5L88L 4UT9H 3P4NB 4V2CB 3QH3B 5DFTA 2WAHA 2X4OA 1JTTA 1DANU 1IAOB 4XGZB 4E9LA 3FQXB 4GLRH 3S97C 5IEHA 4TQEL 5ICYB 1UWGL 1D5MA 1FL3B 1F6FB 3CMGA 2D7MA 4APQB 4FOMA 2YRPA 3ZKMD 3SO3C 2E9BA 3NCEB 4MA3A 4XI5D 4TN9A 2XWBB 2FLRT 4LKCA 1DBAL 5CWSB 4RAVA 3QUKB 3V4PL 1HDMB 3CJJA 2FECI 3CFCH 4OCLC 3PWLA 4Z7UE 4ZTPH 1D5ZB 3O6FD 4PJHF 2WM0A 2P43B 2Y5EA 5JA8B 3TO2B 4ZTOL 3UTQB 3BP5B 3O3BA 1QBML 3QWRA 3QHTC 4OFPA 5JORB 1U3HC 3HZKA 3FFCD 2Q8BH 2A73B 5JW4Q 1UJ3B 3X3FH 1U8LA 1ZTXL 5C09A 3I2CL 3RX8A 1K3IA 5DYOB 1N7ML 5TE4L 4EI6A 2XZQH 4CJ1A 4YDLB 4YHML 2W59A 4UAOC 1II4E 3S3SA 3T8XA 2VLLA 3JV4B 2PCPA 5E2TL 4DVBA 4P2QB 4M5ZH 3VFNB 1DLHB 1EERB 2A6KA 5I8CB 4K3EL 3PDGA 2UZIH 4G43A 4PGEB 1A7BA 3MACL 3UMTA 1P84J 1Q1JL 5DHVA 3UPCA 2D3VA 3DOSA 1SMOA 4NQUA 5D8JL 2ARWA 3SGKC 3BGAA 4FFYL 4D9LH 1IAMA 3HRZA 1O7VA 4U1SB 3F7RA 4WWKB 4TUOA 3JZ7A 4P2OC 4ZSOB 4K3GA 5IK3A 3VRIA 3BWAB 3UJJL 1YNLL 1LE5B 1YEEH 4OZHB 2QHRH 1FZKB 5CJXA 4ODXA 1KIRB 1IC1A 3DJ9A 2GTZB 4QRRE 1UXWB 4X6EA 3V5HB 3D85D 4WUKH 4PGCB 3F7PC 3JV6B 1DBBH 3MUGB 4R2GD 4UDUB 5FYKL 4PJXF 2ZWLT 4GG8B 1FZJB 1KN4H 4ZUTA 1KC5L 5JDSA 2X44D 4DVBB 1QFUL 1RK1A 4ZS6C 2CKNA 2XNAB 5KVFH 3MLWL 1KV3A 4QWWC 4DFIA 1TZGH 2GJZA 3J7HA 1RZJL 2X70B 4N8VG 2J8OA 3DUSA 3PXHA 4U6HA 2AJYL 4ZOCA 5FUZH 4WFHD 3NTCH 5JORA 2NY2D 4XT1C 4H5SA 4R4BA 4WU5B 4GW5B 3GSUB 4KROD 4K7PL 4XC1H 4N8CL 2CJUH 5GGRA 2JJSC 1HKFA 1XIWC 4Y16D 4KVNH 2MQ0A 2DQEL 3QAZB 1AHWB 1MCBA 3RL2A 2P24A 4GRWF 1X6NA 3FQUA 3RVVD 3FOLA 1NGZB 3U7WL 1SJHB 4P2OB 4FQIL 1T6WA 4S1RL 3LQZA 4XWOC 5BOZG 1GAFL 5D7SH 3DMMC 1JGDA 5I1LB 3DGGA 1A9EB 5C08D 1A6TA 4I0PB 2CLZB 4KQ3L 1QLFA 4WTZA 3WS3B 5DWUL 3HNSH 1KLFA 2C7UB 3EOTH 2GTZA 4NQCD 2ADIB 4R7DA 5CILL 1HINH 4NC1E 1B9ZA 4U05A 4C56A 5IMLB 4IDJL 2G5BA 3E6HB 3IDNA 4BZ1H 1UEMA 5GIRB 5DMYA 5EC1B 4X4XA 4XMPH 1X4XA 3AM8A 1CK0L 5JR1L 3PJSA 1KCUH 3MNWB 4OCXL 1MJ8H 3SE8H 3K46A 3VFSB 4G7VH 4PG2A 2JJTC 3EYVB 4TNVF 1CFSB 4JRXE 3HB3C 5AWNH 1I3RB 4HGMA 1S78C 3EBAA 4HD9A 2HJKA 1IL1B 3A6CL 4X6DE 5DURD 5D2LA 3HRPA 1YEFH 4M61A 1CD0A 2DBLH 5EUOA 3CVHL 3SE3A 2NW3B 2COQA 5IMMA 1FP5A 1FG2A 4I8DA 4G9DA 4U7MA 3WKML 5EPMA 3TBWB 4GRLC 4HUXB 4CMMA 3UTQA 2Z8WC 3D1MC 4FQIH 1KN2L 1CFNA 4ODSH 4HIEB 1JGUH 4DKEH 3O6KL 1UENA 3ZKXB 1S7QB 4X6CF 3BDYL 1KACB 2EDOA 4DN4H 1U3HD 2FJHB 3IU4L 1NBVH 3QWRD 4OLVH 1YUHA 1FV1B 5C0IB 2UUDH 3CZJA 4YXHH 5CBAB 3CSGA 2K7QA 2QQLL 3G5VA 2XY1A 3MC0A 3KDMA 1RZGA 4RFNB 4XHJC 2OK0H 2R0KL 4CDHA 3MV7E 5B38G 4JY4A 2IH3A 1H9VA 4UB0H 4P3CL 2BVEA 2GSIA 4M6OH 4KI5E 1G6RB 3QUMA 4NJAL 4KK6C 3KPNB 4LPVA 3U4AA 4PLNC 1O5DT 2NY7H 4NT6A 1DL7L 3ULUL 3IFPA 2RFXB 2V7HA 4IRZH 4KDTA 4I0PA 2WLYA 4LQFH 5F1NA 4G43B 1A6WL 4YR6A 1TFHA 4PP1C 3CLFH 5EU4B 4FFWD 4AJ0A 1W8NA 3DETC 4U1NA 3NN8A 2XIDA 4KPHL 4AEIL 4NQSA 3F12A 2KH2B 2QQLH 4G8IA 2EEAA 2R23B 1MCPL 3IAGC 2GJ6B 4LSTL 2MCPL 3B9KA 2IAMA 4TVPL 2WBJC 4TUJB 5HYQA 5JW4M 2ATPB 3HPLA 3BPCB 5L6YL 1VGKA 1N2RB 5ISZA 1NUDA 1TJHL 3AU1A 3U4EA 5JHDA 3BT2L 3WIHL 2NY0B 3GIVA 5F7WC 4ZG1A 3ULUH 2RJMA 3NIGE 4PGBB 5H94A 4P2OD 1JI1A 3QUMH 3GMMB 2BNQD 2YPLA 3DX9B 1QYGL 3GHBL 5GGVH 3G5XB 3JWDL 3BYTA 5JPMB 4A2MA 5MEOB 1ONQA 4CW1B 1BGXH 1L7TH 2VAAB 1NDMA 2HJFA 3JXAA 5EORH 4WHTA 5CAYB 4Y0GA 5CINL 5IEHB 3VFWB 4UMGA 3L95A 3CFDA 2DQCL 3MR9A 5I9QC 4PGZA 1NSNL 3C5JA 5F6HI 4C83A 5IIEA 5EZIH 4JHAL 4OTXH 2N1KA 5KSVA 3GHEL 3ULVC 2JJTA 2Z8VC 5D93C 5T1LB 4B0MM 5K9QI 4M43H 4HH8A 1IZJA 4OI9A 5F71A 1IGML 2C1OA 2DS4A 4JRYE 5D6CB 3ZE0E 2HTKD 3H3KA 5EIIA 1F58H 3LRSA 4PTUA 1P7KB 4YX2L 3OSKA 1I9EA 5D1ZB 1FG9C 1T21B 3VGDA 1DLHA 1WV7T 5I6XB 3DTXB 3GI8L 1C5BL 2R8SH 1VFUA 4G9FB 2F19H 2IQ9H 3UJTH 2BY1A 5CJ5A 1QBLH 3QIBD 2H26B 4P2RA 4ODHH 2QADB 5HVHC 4UU9B 3RJQB 2CUMA 3KPSB 5A40E 5CLTA 3G6AA 5DHVB 3B2UD 3QDJA 3RZCC 4P5MB 2FHFA 1YMMD 1HWHB 3GIZH 4UT6H 1P9MA 2DQIH 1S3KH 4U2ZA 3VGHA 2AJSL 1ZT1B 2J4WL 1BQSA 2Q86A 3TNMA 4PJ9D 3EFFB 2LTQB 1ZEAL 5C8JB 5SWQB 3L3IA 2X42A 3OR7A 5DJAA 1UKTA 1WCBB 4JN1H 1V3KA 4U1HB 3DUUB 2I9TA 1NSNH 2AXGB 4R0LA 4U0RB 1I9RL 2OQJA 4MWFB 3VFVB 5GIRA 4GSDH 3MOAH 4FP8H 3L3GA 4ONGL 1QO3B 3ARRA 5C6WH 2GSGA 3PWUB 4OLVL 3W0WB 4V1DD 2D4FA 3L3KB 1Q9LB 3T0EE 3VFTA 4RRPA 2OM5A 3MTRA 5HHNB 1G7JA 5KVEL 5FYKH 1M4KA 1TVHA 2CLZA 5ANMB 5DK3A 1G9ML 1WBYA 4BFIA 4JY5H 1ACZA 3ZTNH 1A1MB 1QLEH 2A0LC 2YMXH 1S9XA 5JQHC 3NFNB 5K59E 4JFDB 4Y5VA 4KDWA 3KYKL 4JO2H 4MJIA 3ZDYF 5BOPA 1KJMA 2VMFA 1C5CL 2DLFH 3HA0A 2EXYC 2XFXB 3RY6A 2HYMA 4Z7WF 5EZLB 1DFBL 2UWEF 1AKJD 2HTLC 4L8SC 4NSKA 3WIFB 3BAEL 5FF6B 3HI6H 5D96B 3KJ4B 2XTJC 4FN0A 4YK4B 3ILPB 5ICXA 4KPHH 5IGXL 2ZP0T 6FABH 2W0LA 3HHRB 3RTQA 2XPGA 2DQJL 5I76B 4PJDA 1XF2A 3MYJA 1M05A 1ONQB 1P4BL 3F62A 1UYWL 3QEHA 1U2CA 1KFAL 2DM3A 3HMWH 1F3DJ 2ICCA 1OTSC 4P5KB 3S6CA 4XH2B 5GS1C 5C07A 3D18A 2PR4H 3DV6B 5C86A 3EO9L 3C60B 1A4KA 2H2SC 4S1QH 4WHCA 2N4IA 2YSSB 5KVEH 2MMXA 3CFEA 4CVXA 5CIPH 3K3QA 3B9KB 5JZ7C 1FVDB 1XCQB 3HC4H 3THMH 7CGTA 1OB1A 1U8JB 1AH1A 5B4MC 1IAIH 2GSIB 2FBJH 4RGMC 5BV7C 1AGEA 3RHWK 5JDJA 1D3CA 3BRDA 2A9NL 4A6YA 2VZVA 3VWJA 5E1HB 5C92A 35C8H 1LP9F 4X9BA 2D9QB 1D6VL 1OSZB 4O2FB 5J13C 3P0YH 5FOBA 1SY6H 2CIIB 1HH9A 2WBJD 3VXRE 2HVJA 1FL5A 1ZHLA 2ZSVB 5KOMC 43C9B 4XMKH 3FQNB 4XNZC 1OW0C 4PP2A 2ZNXA 1NGPH 3H9SA 4RMVA 3PNWA 2V5RA 1NGYB 1ORSB 2JJSA 5JW3H 3UO1L 3PWJB 4GBXB 4OZGB 4M1DL 2HG5B 1YEJH 1DE4A 1AGCB 2C3HA 1LEKB 3UPAA 3GDBA 4HKZB 3C09C 3GSRB 1R5WA 3X11A 1FC2D 3MV9B 4GG6F 4YFEA 4BFBD 4GXVL 1K85A 2PYEE 1BFTA 5F9WB 4OCRL 1IKFL 2UVEA 4OFKA 5KSUA 1JVKA 1LE9B 4U3CA 2D0GA 4IRJB 5GJSH 5TFSH 5K9JH 1BWMA 5KVGL 1N8ZB 4XPFL 4YZFF 2X6MA 3ZT7A 4MD0B 2BXYA 4YEEA 3HE6A 5DD6B 1EZVX 4LHUA 2WIIA 2FH8A 3TVMC 4HK3N 1MFAL 1OTTD 4WUUD 1RFDH 2QSCH 2VABA 3MV7A 2JE8A 3SDYH 4YAQB 2QQQA 1T83C 3MROB 4Z78A 5H35A 2R0LH 1OTTC 4Y5YC 3ZHDA 1TETL 5JHDB 4LIQE 1TMCB 2YPKB 3VFPA 1Q9KB 5ILTH 5TQ2H 1XR8B 4HMEA 3EKCA 3MRLB 2XICA 1F4WH 2WSKA 3IDXL 3P0VH 3GUTA 2X4TA 2DDQH 4HKBB 4JZJB 2R23A 1CFSA 1TVBB 2FD6L 1CLOL 3EIFA 4XNZB 5KS9A 2BMKB 4UAOB 1NEUA 3NAAL 4U1NB 4J3VA 3ARFD 1MFNA 1JGVL 4UILL 1QFWI 1BREA 4I18C 1FVEB 1GGCH 5C7XH 3WYRA 2XXCB 3HAEA 4LKXB 1BD2A 4BH8A 1FGNL 3SDCA 2APVA 4EZMA 4KTEL 2ADGB 5TH2A 4H26B 4OZ4B 1UQSB 1SJHA 3TZVB 1R5VB 3FCTB 1F4YH 4PJXB 3O4LB 2ITCB 3MMEB 1GH7A 2PW2B 4WWKC 1MLCA 1FFNB 2WQ8A 3AXLB 2VQUA 5J11B 1A5FH 4XBGA 3MQIA 4KAQL 4QNPE 3MLVL 5FKPB 1IVLA 1JWMA 5E9DB 4Q9BA 2AKRA 2YPLD 1DUYA 1GHFH 3ARBA 3EDKA 1OAKH 4OZIF 2A83B 2ED9A 1L4IA 1MVUA 5GSVB 1Y0LA 3ETBF 1MAML 5JIIA 4BK4A 5C0IA 1MUJB 4DN4L 2XWJA 1ZWIA 5DO2D 2VLKD 4OF5A 5EUOB 1T03L 2SEBA 4CVZA 1OPGL 1U58A 1S8DB 4HMDA 2VLRA 4NQED 5FO9A 2LV4A 1AGCA 5T5NG 1KT2A 4R90L 4FQPA 4JFEA 2Y7QB 5IVNA 1CFNB 2DQIL 2JLLA 4LK4A 3P77B 4OT1L 4PJXA 1JNHA 4R2GC 5K33A 2GY7B 3GZKA 1IGYA 2Q20A 4JM2C 1FZOA 4RGNC 4WU7B 1NUNB 2F53B 2JJWA 5E24E 3HLAB 5DK2B 4LLDA 5F3HB 2AGJL 4OQTH 3QULB 4QWWD 5C2BL 3LH2H 4ZO8A 4K9EC 1DE4B 3QAZC 3ZKSD 2I27N 4GFTB 5E08L 4G5ZH 5IK3B 4RA0C 3WD5H 1A1NA 1KSRA 1NPUA 1PKQA 1YEHH 4MJ6A 4J1UA 3UTTA 4LCIH 2AXFB 1NAMA 3U0PB 3EOBB 4MB4A 5JZ7D 4P2RE 5MEPB 3S3PA 2A9ML 2GJ6E 4ONFL 4Z9KB 1CZ8H 4ENEC 3OKMA 1VACB 4I48A 4PRAA 4RGOL 2CDEA 4D8PB 3LQMA 4NZRH 5EBLB 3WLBA 1U93B 1MHEB 3HTLX 3MO1A 1F4XH 1WWCA 3AB0B 2V5MA 2VN7A 4XI5C 5DUPL 1N64L 1Q94A 4IRZL 3PQYD 4MNQB 5D7IE 2Q6WB 4KJYB 4H25A 4AM0B 2BVQB 2E8YA 4R4FH 3OXRA 5D72H 2YHGA 1MCOL 2EDJA 2YD6A 3UAJC 2UV3A 4EKXA 4CNIB 5F89A 3R06A 4L3EE 1P5VA 3HI5L 4ZMAT 3MJ9L 3NACH 1J1OH 4J4PD 4XXDB 4ODBD 3VFRB 3HKFA 1T2QL 5T3XE 1WWAX 4X6BB 1DN2A 2EECA 2BOCB 1BFSA 5KOVC 3EYQD 2B5IB 1RK1B 3KPQA 1T66C 1MREL 3KNBB 4PYGA 1DBJL 2Y07L 4P4KB 4PRDA 1U95A 1PYWB 3S37L 2DMKA 3T2NH 4IM8A 5ESAB 1LE9A 1SJEB 1OP3K 3ORJA 4X6EB 3C5ZA 3QO1A 3B43A 5FO8A 2X4QB 3FFDB 1KJMB 1Q9LA 4MJID 2MKLC 4WY7L 5FFLA 4KUCF 3FO9A 2HG5A 4K94C 2X10A 1SJVA 1S9YB 2H3NB 4RGOH 2VR5A 4WWKA 3GI9H 3FL7A 1WZMA 4ONOA 1DQTA 4BFIB 4EN3A 2PO6A 1TZHA 3P4OB 3NGBB 4YNYB 3SGKA 3DWTA 2HLAA 3IDJA 4Y2DD 4GLRI 4HUWB 4WI9A 4K94L 3BDYH 2R1YA 1BJ1H 3NIFF 4HX1A 1U8KA 3QIBC 1U36A 1RZKC 4BKLB 4JGMA 4DVRH 5C0NC 3QNYB 4Y2DC 4MB3A 4YHPA 2BSRA 3WIIL 4UT7H 2CK0H 3BESR 4UTBH 1CT8A 2ZUWA 3OL2A 4DTGH 2CUIA 1TZGL 4PUBH 4XVTH 1QSFD 1U3ZA 3TJEH 4UV7H 1N5AB 1W72L 1U8NB 3PE9A 2VKXA 4P5TB 5FDYA 1RZIA 1RIHH 4HIXH 3P9LB 5D96C 4ODVL 5TJWK 4OZHE 4JG1L 2ZCKH 4Z7UB 5MI0B 5F7MC 1K8IA 5E4EC 5I15H 4P5MA 1S5HB 3GMRA 1G7HA 1M7IB 1G6VK 1F58L 1NCCH 2R0KH 1MNUH 4N5EC 4QRRA 1KCLA 4XB7A 1BBJB 1JYVA 2FNBA 5GRVL 4LLWA 1FL3A 3IDGB 4X9IA 5LGHL 5B39G 2NLJA 4TNWK 4ZDHA 4N0YH 1UWEL 1LP9B 5KN5B 4N0UA 1CR9L 4A2LA 5J9PB 2QQKL 1JYWA 2VOTA 2FBOJ 2R4RL 4LQ1A 3L3KA 4P4KD 3T0VA 2ERJB 2YUVA 5FA3A 5LKNA 3CD4A 1MH5B 4M9PA 1FO0L 3VD9A 5LCVH 1NEZG 4UNUA 5ICYA 2D9CA 2R0ZL 1GC1H 2AK4D 4R97B 4BUHA 1QSFE 4DAGL 3GSVB 3LHPL 4MJ4A 4JFOA 5IQ9B 3QO1B 2RB8A 3C5ZB 3OB8A 5FKAA 3VXTB 3GBNH 5HYFA 2Q7YA 2C3XA 4U1IB 3WFHB 4QRQA 1MQKH 4UV7L 2Y1VA 3QCUL 3WN5B 1AGBB 5SWZB 1L7IL 1FSKB 1UT9A 2I60H 4WO4A 2FLBT 2ZCHH 1A9BB 4LHQB 3OAZK 5SX5H 3QQ9D 5JOEA 1UACL 3E3QC 4LSUL 1TQBB 1T0NB 1TXKA 4G6AC 3T0EB 4Y4HB 5B3NA 1ZA3B 4HH9A 1BIIB 4HV8B 1LD9B 4AT6A 3V5KB 5C0BA 2C3GA 2OX5A 1NBVL 2KPNA 1MCWW 2CMRL 4LDOB 4NFCA 3S35H 2HFGL 4U31A 4M6MH 1BOYA 1DN0A 3LKQA 5AD0A 4I3RL 2J88H 2CGRL 1WFTA 2DIBA 3BPOC 1MJJA 3KYOA 3B9DA 4MNHB 3UTTB 1BD2E 3HNVL 3MLPA 3DIFB 1REIA 3AREC 3D48R 3QUMB 5DK0B 2NY7L 3FT3A 2G75A 4H0HB 4TTDD 5CZVL 3BZ4B 5FM5M 4BSVB 5CIPA 4XNXL 2BDNH 4QHMB 4KWUA 1Q9WA 3X3GH 5BW7C 4ZNEE 4LCCC 2FATH 3C8DA 4NKDA 5IFHL 4PJ8B 1T66D 2I24N 2F53A 2E9JA 2E6QA 2NY3B 2H6PB 5GRVK 3TNNA 3AC0A 2F54E 5A1AA 3PWNB 5BS0B 4Z8FL 4P57B 3M1BB 5AEAA 3UZVB 5F9JB 1TITA 4GMSH 4ERSH 3VD5A 2VUOA 3E0GA 1G6RA 1KEMH 1VESA 1YDPA 5L2JA 1OGTB 2CIIA 3GK8H 3SO3B 1JPSH 3C2SA 3MXWL 3FOMB 2YD4A 1UCBH 4NHCH 1FAIL 4JAMA 1GIGH 4LHUD 4Z7WB 4NCC2 2VQ1B 2NW2A 2X4UA 5B22A 1FO0A 2DLTA 3L95B 1XEDA 4FHBD 3GMQB 3OX8A 4KI5C 4WUUA 5HGAA 5I75B 1DANT 2IPTL 1LNUA 1L6XA 4FNLH 4I9WE 3P77A 2FGWL 4E41D 1K6QL 4GUPB 3MUJA 3QDJE 2ZSWB 4YPJA 5HHXH 4LCIL 2LQRA 1BD2D 1HILB 1WWBX 1DBBL 4PJGF 1PAMA 1GRWA 4R4FL 3IDIB 4P5KA 4NM8H 4OSUL 4NO0B 4TYUA 2CK2A 2VXUH 1K2DA 4L9LB 1FG2B 3G5YA 2GYSA 2DQTL 3OGCB 2AV1A 3T77B 1NGQH 2ICEA 1IFHH 4JFXB 1VGKB 5T33H 4OZFA 4HWEH 1S9VA 4RFEB 2BCKB 3WD5L 3CC5B 4OZFH 4WEBL 2F15A 3GMNB 4CN4A 2AK4B 4JO1L 2OL3B 2WWKT 3LPFA 3QEUB 1UJ3C 2Z91B 1I7RA 3EO1A 1FO0H 1FNHA 1OM3L 4RGND 2AJVH 3MLZL 2C4FU 4MCYA 1HHHA 5CD5D 4OGXH 2JK5B 3ARBC 1ZXQA 1UB5B 3CCHB 1O7SA 3SCMB 4TTGA 3BEVB 4JM4L 3MROA 5H35B 3ARTA 2VDPH 4YBLC 4RMRA 1I1FB 1KB5H 5FYKD 4RBPH 2YRLA 2ZJSH 2Z92B 1X3DA 5LGJA 1JF1A 5LJYH 3HUJE 3SHSA 1L9NA 2BHYA 2KDGA 3LKNB 3OKEA 3VXUA 3BKJH 2DQEH 4YWGL 3SDXB 4I9WD 2G9HB 3OJDB 4XMLL 3QDJD 4IRJD 4M6OL 1AD9B 2BFVH 4FQ2H 3KPOB 1NLBL 5DC9B 2AJVL 1MQ8A 5CSGA 5DD0H 4JFED 2NW3A 1QRNB 4QRRB 1W2KT 2CK0L 4RSVA 2F8XC 3DUUA 4EUPH 2VABB 1SBBA 4KRPC 3RUGB 4PJGE 1AGDA 3KJ6H 4FFVD 4KJQC 2VLME 4RX4A 5FA4B 1JFQH 5C07E 2UY7A 3JWNC 5BZWB 4OFIA 2A38A 4OGYH 3KXFA 1BQHB 1KCVL 2NR6D 4LLWB 5FK9A 4PLKC 4WEUD 3SQBA 5E8NB 3UEZA 3RWDB 1JNNH 1JTOA 3ARBB 5D1XC 2P46B 4JY5L 3WIHA 3QXAB 4M93C 1YECH 1T5WA 2GJJA 1W72H 2B5IC 1S78D 2O5YL 3A67H 2VR4A 3AUVA 4EI5B 5JW5A 4R6UA 2DYPA 2H1PL 3S4SG 5HHMB 5F7DA 2BDNL 4MX7A 2CH8A 5FGSA 4LCYB 4C58B 5BS0E 4G80B 2EH8L 4H26A 2W9EL 1RY7B 1X4YA 1C5CH 1A6ZA 5CP3A 3V4UL 5I1AA 4DGVH 1UXWA 5IBTH 4MJ6B 2ZOLA 3DMMB 4D9QE 1HHJA 3V6ZB 5E8OA 3AMLA 3T04D 2GHWB 2DWEB 3Q5OA 3IFLH 2BVPB 4FTVA 3TWCH 5BO1H 1MHPH 1OP5H 4PRPD 5C09B 2MHAB 1DBMH 1MCHA 4WWID 1EEYA 4O4YL 4PYHA 2DQFA 2DQCH 2JCCE 3O45B 4I18B 4NPYB 3GNMH 3MNVA 4H88H 4LMQI 5ECJE 2PTUA 3ZDYE 2HMIC 3SOBH 4F15B 3OAUH 3WUWA 3OAYK 1CYGA 3MZGB 4LGPB 4W4OC 4PRDB 2JKXA 4HIIB 1ZS8A 5FYJU 2IANB 1J05B 2AJXL 3MNZA 3W5NA 2DJ4A 2ID5A 3KLSA 4J12A 1A7OH 3DRTA 5DQ9A 1HYSC 1K6QH 1ZHBA 2LU4A 3K8MA 3MJ7A 5F72S 5L0QB 4U1GC 5C07D 4YE4L 3FAXA 3WFEH 4UTAL 4H0IA 1VCAA 2VL5B 5ID0A 1C12B 2DMBA 4RMWA 2Y72A 1GGTA 3ZKXC 2XTJE 3V6FB 4IRSC 4K8RC 3EO0B 3H2WA 4O51B 4MQXD 2ITDA 3CXHK 4ZOEA 3V52H 2PO6C 3GSNA 4IS6A 4EI5C 2VDKH 3VRJA 1MRDH 4XWOD 4D0CB 1H3VA 3RGVC 4U33A 3QWOB 2CR3A 3RUGA 1CBVL 3O6FC 2D2OA 5J57B 4LSUH 4Y4KD 4F7PB 1D6EB 4F7TB 3D0VA 5SV4A 1S7UB 5EB9A 1F4HA 4UIKL 2K3TA 3PNWB 3KHQA 3SGDH 4OCYL 3KS0J 1VFOA 3QCTL 3D69B 1WZLA 2MCPH 4LSTH 4XAWL 2FJGB 3IF1A 1RVFH 1NKOA 5IMOB 5MENE 3OKEB 3VXUB 5J6GB 4F57H 2DM2A 2DICA 4FQJH 4FABL 3MA9H 5DDHB 4X7FC 5FCUH 5I8CA 1F4AA 3W9EB 1ITBB 4JZJA 3OKKA 3LQAH 1X4ZA 4WW1B 1CE1L 2PXYA 2VDQH 1A3LL 1E28A 5GGVY 1FIGH 2XRAH 3VG0H 5KVDH 4ZODA 2ARJB 2NY4C 5CD3B 4GRWH 5E8NA 4YLQT 2HFFA 1NMAL 4PLOB 3EDEA 4KMLB 4ZSOE 1V05A 1NUGA 3PL6A 4CADA 3LEYH 3O4OB 1H15B 2PW1A 2QEJA 3DO7B 1S7QA 2CDFB 1T5WB 3V52L 1N5AA 3D0LA 3KYKH 1Z9OA 3NBNA 5DS8B 2WP3O 1I8MA 1XIWD 1RUAL 1RQ5A 1AGFA 4GUPA 4EIZC 5IJVA 1RZ7H 4HS8H 1JPST 3MYJB 4S0SD 5FO7B 2VYRE 3SKJH 6CGTA 1S7XA 1NCDL 1I1AD 1FPTH 4W6WB 3HE6C 2VXUL 4I3SL 4JG1H 5KSAA 3FB5B 5HHOD 5ELIA 1GGCL 2NMSA 3PGCB 3MUZ1 4JQVA 3CDYA 3GSQB 4K7PH 1MIEL 3BSZH 8FABB 1PKQE 1T83A 3BN9C 1MWAL 4L3EB 3VWKC 5E6IA 4UB0L 4OFVA 3E6FA 4X9HA 3MMEA 1ZANL 3D3VB 1OAXL 1CL7I 3JWOC 2WWMC 2X41A 2DLEA 2NY2C 1KENL 1OM3H 4WUUE 4N0YL 5LGKA 5E2JA 1YY9C 1QSEA 3MRCA 4C4KT 1BWWA 2W0FA 5ABDE 1S7SB 4XGZA 1DUYB 2BRQA 1IEHA 1RHHB 1U3HA 4OM1L 3H7BB 3IDNB 1IC5H 4W4OA 3QCVH 2I07B 3GIZL 4UT6L 4KJQD 1LK3H 3LKSB 5CFHA 1Q0XL 3MV7D 3W39A 2R2HB 3AS2A 3CZFA 5GISH 4WHTB 1DN0B 5D2LF 1JZ8A 3TO4A 5I1GH 4UOW1 3D25B 3RVTC 3BIBX 1EXUA 5D5MB 1YEIL 3U36B 3KLHC 4MVBC 4Y5XB 3AAZA 2D7OA 1K4DB 1XR9A 2XWTA 2J3SA 1Z9LA 4FXGB 4HCRA 4X98A 5AYUL 3RGVD 1YPZE 2CGRH 4TULH 1PY9A 1MCJA 1XMWA 4IRSA 4MCYB 1XGRB 3BPNC 4OB5L 5ACZA 2P47B 3R0NA 5C6PB 4KK9C 3LKPB 5BW7A 2VDKL 5HGDA 5F7KC 3MGOB 1T0NA 3WFCH 1RJLB 3ARED 1F90L 4PRIA 3FT4A 3UO1H 1KTLB 3RGVA 4UQ2A 5C0AB 4JANB 4YO0A 2P5WD 5HHMD 3C6SB 3TFKD 5CJXC 3EJJX 3MPCA 2FEDC 4EOWL 4LCWE 1HSBA 1HXMA 4NM4L 1EHXA 1S7VA 3CMOL 4M1CC 5F8QC 3DTXA 4MA7H 3MRFB 5GGSY 4S1SL 2V7NA 4F2MA 1P4IL 3UTSE 1KJ2B 3MA7B 5H2BA 5DQDL 1LDPL 4XP9H 5FDWB 4ZFZA 1LEKA 1UACH 4MGXA 4L4TE 1I3UA 4RRPG 4NGHL 43CAA 3OTTA 1EGJL 3K74B 1KIQB 2EYRB 3MBEC 4JFYB 4LLYB 1XGTB 4XNXH 1OWRM 4Y4FA 4HJJL 4IRJA 4QGTA 5LAXB 4HG4K 4QCIB 5D4QA 1RUPH 2P5EA 2XRAL 4WFFE 3RAJH 2YRZA 4HBCH 2WLZA 2OR9L 3B9KD 3L3JB 3QXWA 1JNJA 4YHKH 5GRJL 1SYVA 3MRMB 2FSEB 4QTHB 1DP0A 1RSFA 3LY6A 4P3DA 1JMXA 4PJFE 3E8UH 4JZOB 4OUUA 1NBQA 1HSBB 4HJGB 4L1HA 5LXGL 4NHUA 4UUJA 2RBLA 4IIQB 5I2IB 4ODVH 1J10A 1UWEH 1NCUA 3MV9E 1VPOH 3Q0HA 1EEZA 2X2YA 2IFFH 4L4VD 1B6DA 4TOYH 1N64H 3QIUA 1XF5B 5F9DC 1JZ6A 3WNOA 1WICA 2QQKH 5JOPE 5FDWA 5DLML 2LFGA 3SKJL 5D7JC 3MBEB 2NLJB 1QZ1A 3PP4H 1EHNA 5DJ2B 1A14L 3SDAB 4ALAH 1RAMA 1FH5L 1BX2B 4KKCD 1JE6A 4RISH 4OLXH 4X4ZA 1MCDA 3O3AA 5T1KD 1MJJB 2X9XA 1GXEA 1JK8A 1KF9B 2YK1L 1CDUA 3ZYIA 5DS8A 2P7TB 4XP4H 3ZTJH 5GZOD 4JFFB 2X9YA 2GJ6A 4UZGA 5D70L 2BVUA 4JFDD 1BVLB 1AC0A 2BK8A 5IHZB 4URTB 2A6IA 3VH8A 3QQNA 1N3NA 4LBEA 1CQKA 1A7OL 5ACZB 2XACC 1R24B 4AIZB 4HH9B 3O4LE 1WK0A 4I0PD 4PG2C 2CQVA 3UBXG 4R7NA 2EZ0D 4DCQA 5MERA 4TRPL 1T2XA 4JJ5A 2XZAL 2W91A 3D25A 3GKWL 4ZYKA 1T1YA 3PF2A 1P4LA 4MQ7A 3BUYA 4N9GB 4DN3H 5T3XH 5LXGH 3VFOB 1HZHL 1WIPA 1RJCA 3MRKB 4JE4B 5JIKA 5FF6A 4ELMA 4WJ5A 4N0UB 1ZHKA 1EGJA 1G7QB 4KROB 1X5IA 1PG7H 4J3WA 4NJ9L 4EUPG 5INDA 4QHLA 3IVKB 4QHNA 2G2RA 3QUXC 5KBNC 1YNLH 2NTSP 1TCRB 3QWQB 4IEFB 3UDWA 1LO5B 2RR3A 4QTIH 3QO0A 2ATKA 5D71L 3WS6C 1WBYB 4OAWA 3LN9A 3WIIH 1M1SA 4M03A 4BH7B 1BBDL 1Q0YL 5C0BE 4XVUC 1F4WL 3A6BL 1AXIB 4I3RH 2WUBH 4G8GB 1F4YL 2F74B 1DVFB 1CL7H 4WW2A 1VFAA 5CHNB 1MPAH 3M8OL 4LAQH 3W9DB 3HPLB 5AWNL 2C3VB 3SGEI 3QJHA 4Q0XH 1AXTL 1JK8B 2F5BL 1JGUL 4XX1E 1YYMH 1NCBH 1VEPA 3IAQA 4CKVX 2KUTA 5IOPA 2UY6A 3MUHL 4J6RH 1M7IA 3GMPB 5D72L 4DGVL 3RHWF 2DF3A 2UZXB 4F7CA 3UCRA 4KDTC 4RGNB 4WTZG 3GMLA 2XZAH 3QUZD 5C0RL 3MBEA 5D71H 3FHAA 2NY1D 3W9EA 3VXNB 2FGWH 2FWOA 4POYA 2A9NH 1TZIB 3Q48A 4PIRF 4PRID 5EIIB 1RIVH 2FZ3A 2J12B 4I1NB 2F54A 1YEGH 5I1DA 3S3JA 4PGCA 3TFKC 3QQ3A 4JPWH 4WY7H 1F2XK 1I8KB 2VSCA 4WTXA 3CFBA 2A2QT 4Y5YB 3PDDA 1HIML 2CUHA 3GI8H 2OZ4H 4NIKB 3VFNA 3HAEG 4OGYL 4PJGB 3TZVC 4L9DA 4ZSOA 5D7SL 4NQCE 1I9IH 1GL4B 3PQYA 2ZOLB 3DMMA 1A64A 3FZUD 1U8HA 1BBDH 1Q0YH 1VFBA 4B5EA 2E7LC 5IVOA 2JCCF 3N0PB 1NEZB 3BEWB 4ETQA 4LGRB 2B1AL 5C07B 5IB2B 4EI5A 5JW5B 3WMSA 2FECL 3LV3B 4OGAD 3WO4B 1AGDB 2V2XB 1JZ3A 3H6JA 2IAND 4ONHB 4POZD 1PJ9A 3QDAA 2C26A 3K4ZA 1PVHA 1VADB 3QIWB 3IS0X 1KJ2L 4RIRA 1MCRA 4XP4L 1AHWA 3C8KB 1KCSL 2J88L 2W65B 5T3ZD 4IBLT 1IEAB 4P59H 3MR9B 1DFBH 3GSOB 4M02A 4LP4A 4APQA 3K7UA 4CVUA 1KB5L 1JZ2A 3P11H 1J1PH 1U6AL 5IW6A 3WHE0 5HD8C 4M1DH 4JFPA 1FH5H 1RULH 4R26H 3SDXA 4OLWL 3MACH 3QDHA 5HGGS 1R3IL 4K3EH 1I1CA 5GRWA 4LPUA 5ENWB 2UWEE 4HPYH 2BSTB 3NCYS 5HYJD 4DKAA 2DM7A 4KRPB 1G9MH 3P9MA 5I19H 2BNRB 3EYVA 4JPVH 3ZE1F 5E99L 1CLYL 4J7RA 4L5FL 1MFCL 4AEFA 2EDXA 4NO5B 2C5DC 3LV3A 3VA6A 2QHRL 4P46D 5SWSB 1CE1H 1ZS8B 5BVPH 2Q7NA 4PREA 4G42A 5L2KB 5DI8B 4DQOL 1N4XL 3TIDA 2NY0C 1KTDB 1YMHB 4KTEH 5CZKA 2IPTH 4LLMB 2FEEI 2YXFA 5FB8B 5C0CD 2ADIA 4R7DB 5HGHB 5LCVL 1G6RL 1XF3A 4CBPA 2EKSB 4JFHE 4ERSL 1DBAH 4NN7B 3RTQD 3STLA 2A74A 1OPGH 3RIAF 4I0KA 3KS0H 2ED7A 4KXZI 1HSAA 3GO1H 4YR6B 3HR5A 5I1DB 1ADQA 1INQA 3LKOB 3BKYH 4NJAH 1YUHB 1QBBA 1JGEA 4YHLL 4GRWE 4PJ9A 2H32A 4P2QA 5IP4A 2PCPB 3BP6B 2CD0A 3RDTC 4HGWA 1CF8L 4GW1A 1F8TH 3L7EB 2Y5TB 1RUKL 3P9WB 3QDJB 4GKZB 4V2BA 1CDCA 4WI2A 4O00A 4YIQA 3NZ8B 2PN5A 3UTSA 2QLVB 1FRGH 4LDLB 3CLFL 2R69L 1JZ7A 1LNUB 3ZYZA 3HMXA 4L4TA 1DEDA 4ZUWA 4N0CD 3V4VL 5FK9B 5D93B 1WT5C 4PY8J 1ZEAH 4UV4H 4NZTH 1HNGA 4RDQF 1GGBL 3RI5F 3O2VH 5HDLA 4JQXC 4LEOB 2Z93A 2ZKHH 3OV6A 4N0CC 5EC2A 4X80L 5DJZA 4YUEL 3DXAE 4P23B 4PRHE 5CSZB 5CZXD 3O41A 3B6SA 1I1YA 1J0KA 3F58H 2QL1A 3AXLA 3O8XC 2KQMA 1D5IH 3F6IA 2OJZL 5I9QB 4G6MH 1I1FA 3TBWA 5BS0A 4TTDC 2O5XH 5GGQL 4EDWH 1T0MA 4OLYH 1IC4H 1IE5A 1MJ7H 4JZOA 1SYSA 3TBYB 5FHAH 3IVKA 3VXRD 1OP5K 4WFED 3C5JB 1Q9WB 2A74B 3KLAB 5D2NA 4X5XB 2VXTL 4HXAL 4L4VA 3AMKA 5IM7A 4Y19E 3QUZC 3SE8L 4U7KA 4TUOB 2Y36L 3RWCA 5CBEB 5C6TL 2CDGB 4JO4L 3ZKNC 2A1WL 4LARL 4OB5H 3FO1A 3NFSL 2OL3L 3S96A 3PWNA 4ODSL 4YDVB 3IU3A 2P5WE 3U7AA 4OZ4A 1HH9B 1JPGB 5JW4N 1RUKH 2YSSA 3N50A 4GBXD 3HR5B 4PREB 4PGEA 2X4RB 1BVZA 1RUMH 3L3HA 2VLRD 1J1XL 1TTFA 2I25N 3NCJH 3OKDB 1EJOH 1GGIL 5L7XL 2VDNH 4OCRH 3FQWA 4APQC 3ARDB 1F3JB 3SKOA 1IILE 2KZWA 1Q0XH 4NO0A 2G75B 1CFTA 5I30L 1X5KA 3EGSA 5I66B 4Z7VF 5F7LB 2A6DB 1TQCB 2EDRA 3OWEA 5IEKB 1D5BA 4Y2DB 1KFAH 3HMWL 4MD0A 1AY1L 4RNRA 4NNYB 1RJLA 3AS0A 2FH6A 4XH2A 5SWSD 4JHAH 1Q9OA 3GSOA 4E5XB 2P5WB 3MSPA 2IG2H 1VKXB 3PGFH 4P9MH 4KH2A 3QIUD 2YN3A 1R5IB 4N8CH 1JP5A 4MJIB 1IKNA 4XXCA 2Q76B 4HAGA 5F1NB 2DTML 3I85A 3DRTB 3TO4B 2EDKA 1HCFX 4KGJA 4NM4H 1QUNA 4LASH 4LRIA 3MRNA 5JPNA 2Z8RA 4Q6IA 4X8XA 3KPNA 1HI6A 4U6HB 4MA7L 4KI5F 3TBTA 3CX5J 3Q6GH 2O93L 5D2NB 1Z3GL 3U79A 4JFOB 5D8JH 4Z7QF 2W9DH 2EDTA 5C0FA 5TDOB 3FOMA 2OZ4L 3LCYA 1C7SA 3VD4A 4N0FB 3O6LH 4AMKL 3P30H 4RDQG 3QT2A 1F02I 1TDQA 2ZCKL 3C60C 3EYFB 4UDUA 3NFPB 1WC7B 4I4WA 4YE4H 3RZCB 3WFEL 4Z6AT 4UTAH 3ECBB 1R3JA 1U8OA 3BD4A 4NYLB 1MCPH 1RZJC 4TVSa 2EDQA 1OHQA 4PJHB 4NKMA 3BD3A 3FB8A 4OGXL 1GZQB 1LGVA 3PQYB 1J87A 2E5EA 4MS8C 2B1AH 3PL6B 4F9PC 4NKQB 4WEMB 5LGHH 1AGEB 3FO0L 3KR3L 4U1SA 4HLJA 3HRZB 5CEZL 2BOBB 1IBGL 3CFBB 4JQXA 2NX5A 4XNMA 1WAAF 1M05B 4P2RB 4TNWF 1K8DB 2CO7B 1E4XI 5HHOB 1BX2A 3ARZA 3ARDC 4WTWA 3F65A 3T0BA 4Y88A 1V3LA 2W0KA 2P8MB 2R1XA 1WISA 4L8SA 4AMKH 4Z8FH 4GRMB 2OTUB 2RCSH 4GAJH 3ZKQD 1U8NA 1DSFH 3MCKA 1YEGL 4GJTB 1TPXC 3G6AB 4PUBL 3ILQD 3LVEA 4EN3B 5D2NC 3QXUA 3QUXA 4MA1B 3VXSA 4ZNCD 1KLGB 1Q72L 1OAQL 2O5YH 1WBXA 3F58L 3MREA 1U8MA 5L2KE 2VDLH 4D3CL 5TDOA 4QOKD 3KGRA 1WSST 5IBLC 2QBWA 3KPSD 4J4PC 4LVOC 3S37H 2DQDL 1B6UA 4I77L 4XCYA 2Y4SA 2HJLB 1LWRA 4PRBB 4U2YA 2GW5A 3UZQA 3CIQA 2CIKB 5IMOA 1W8OA 3QEQA 2BHUA 4Q58C 4R4ND 3P40A 1S3KL 1FYTE 4G42B 4X6FB 3EO0A 3O2DL 3VGAB 1CD1A 1B0GB 2CRZA 3DX6B 4NO3A 3OG6B 3NAAH 1OCWH 4G8EB 2NXZD 5JXED 3EAKA 4LCUB 5FA3B 1I1RA 3SKNA 5INDB 3P0YL 3VWJC 1T20A 4OD1H 1FQ9C 4JFHD 3DX9A 2YPLB 3QWOA 1C16A 3RBGA 5ENWA 4Y16A 1MREH 3C9NB 4LHUG 4PJBB 1N59B 3H8NA 1ACYH 5F3BB 1LMKA 5BRZE 4PRIE 4N9OB 3TP4A 4A6YH 2XKUA 3IFLL 2CLRA 3FB5A 4OCMC 5I1JH 2VDRL 4YHYC 4KK5C 1R6VA 1PD6A 3KNBA 2IQAB 1T1YB 3JVGA 4NQTA 3OGOE 1SVZA 2R4SH 3PIQA 3RAJL 3BOVA 2IAMB 1IQWL 1IKNC 2C1PB 3QQ4B 1EEQA 5KJRL 1VEMA 5CKAA 2AEWA 1A4JA 5T3ZH 1FNLA 4HAFA 3PL6C 3U9UB 3VFRA 4BQ6A 3LB6C 3O2WL 1C8PA 5C0ND 4Q6IC 5IHLB 4FQLH 3VGFA 4QT5B 5EU7E 4HUWA 2E7LA 2BNQB 4M93B 3C60D 2XKNA 4CN6A 2XYCA 3BAEH 2LU3A 4MX7B 1CDJA 2EDEA 4JLRA 5F6IB 4ZFGH 1JUFA 4OCNC 3LKSA 5T1KB 1FLRL 3AB0C 1I7UB 3DX7A 2VXVL 4JQVC 4ZO7A 3SDAD 2J6EH 1R3HA 4D0BB 2B1HH 2ZCLH 2X4SA 3MLWH 4Y5YA 4JQIL 5D1QA 1IGCL 4MJ5A 4IOIB 2DLFL 4LVNB 1J0JA 3FB8B 3TBTB 3W11C 2V9RA 1C5DA 1GZPB 2VXTH 4HXAH 1YMMA 5CEZE 2O26U 3SPVA 2W92A 4PLKD 5LWYH 3JWOH 4YBQC 3TEUA 3QUYA 3N1GC 5DMKA 4XP6H 1IC4L 5DJZB 3SDCD 4JPIA 5GJTL 4KRNA 5C7XL 3BIAX 1KEGH 4KZEH 3MV9D 5DEGB 3RWEA 5B8CB 3U48A 4HCRL 1EK3A 4KROC 1BVKB 1WJ3A 1MUJA 2LAAA 4WGVB 2J5LC 3WSQH 2DDQL 1KJVA 3DIFA 1BQHA 5HYJE 4OZIA 3WDHA 2VZOA 1V7NL 4FQLL 1OLLA 3WKNA 3ZSSA 3QA3B 4X5WA 1I9IL 2WBJB 4KKCC 3FTGB 2PNDA 2W9EH 3WHE1 2CXGA 2YC1A 4JO3L 4HIEA 5JUEH 2VISB 1B90A 2XI9A 5I17A 5FV2A 4OAWB 3IDUA 1EJOL 1GGIH 4ZUSA 3QG6B 3VE0A 3EZJB 1VENA 4O2EA 3BO8A 5TQ0H 1KOAA 3HNTH 4XCEB 4YDKH 3K2UL 3FQXA 1ND0A 3LZFH 1EXUB 3UC0H 3IAPA 1EUUA 5JXAH 4J3UA 1MF2L 5HGBA 5DHYA 4YGAB 1BFVH 3P4MA 5CZXC 1MY7A 1JHKH 5HHVL 1YQ2A 4PJ9C 2HRPL 1MLBA 3TLRA 5J11C 1TVDA 2XY2A 3LKPA 3GUTB 3QDMD 4WIQA 2YMXL 5JNYB 3VXUE 5JTWA 2AQ1A 3LS4H 1AXSA 1WITA 5IFJA 2AS5M 1XZ0B 1CXHA 5KZCB 2PYED 1JWUB 4YHNA 1MAKA 1OT2A 1YEJL 3HLAA 5DK2A 3AGVA 4FQCL 4JDVB 1ZGLM 5MP6L 4HKJA 5F44A 4KV5E 1HHHB 3STLB 3L5JA 1X44A 1IGYB 3E2HC 5CEXA 1JV5B 1CICC 4XNQA 4HT1H 5KVGH 5ID1B 1P5UA 3QFJB 4JRWA 4QOKA 4ZXBA 3DXAD 4K2UL 1F11A 2FX9L 5FO9B 3RNKA 4C56E 3PGCA 3RU8L 4DGYL 1JHKL 4LU5H 3TF7C 1MJ8L 3FN3A 5A16B 2X5PA 5AZEL 3V6FA 1SYSB 3INUH 2R0LL 4LLVA 5GSVA 5FO7A 1D5XB 4JCMA 3HNTL 5CLWA 1H3XA 3DECA 4Z7WA 3FQUB 3UTSB 5CEZH 3D3VD 4OLXL 5F97E 3P9MB 4FMKA 2YD1A 3TZVD 1QG3A 1YZZA 3S35L 3OKYA 4LEXH 1IEBA 3ROLB 3OKNA 2GCYB 1NBYB 5DD3H 4NO0D 2BVTA 3W11D 4LHJB 4TSBH 4C59B 3HI5H 1FL5B 1LVEA 4UUJB 1BQLH 1MFEL 4PJIA 2UVFA 3EYOB 3UJTL 3WV0A 1F4XL 1VFBB 3EHBC 4FXLA 5D9SA 1CT8B 1GHFL 3AM8C 4Y2OA 5D6DC 2GJZB 2Q3ZA 1WWWX 3CVHA 1EPFA 3L3JA 1XZ0A 4HKZA 4BSVA 3RVXD 1XF3B 3VRIB 5HI3D 5I74C 1G7PB 1KCVH 4Z0XB 4WCYL 3QUYC 3Q5TA 5F7FA 3T0DA 3O3EA 4N8VB 1J12A 3I6LE 3LN4A 4K23H 4M8QA 3HZMB 3S7GA 4ZAKC 2HLAB 1XR8A 3OQ3B 1ZVHA 3QG7H 3KPSE 4KKLD 4LPYA 3TV3H 4DGYH 1QR1B 4P3CH 5D1QB 1ZLVK 4J3OC 5ESVB 4X5LA 4MNGB 4KI1A 2DYPD 1UZ6F 5ACLA 3CDFA 3NPSC 2Q8BL 4X99A 1ZSDB 1HXMB 3RVUC 3SEPA 3D85B 2A77H 2CKBA 2IFFL 4PJ8D 1YMHA 4K3JH 3EJYC 1CS6A 1KYOK 3GM0A 3CLEL 2A6JA 4OQTL 1BM3H 1G7IB 1IGFL 1E27A 4YHMH 4P49A 4ZTPL 3GSNB 3QIBA 1IRAY 3VFMB 4JPVL 5JQ6H 3VG9C 2ICWI 2F74A 4X9GA 4HEME 2YZ1A 4DUWA 1V7MH 3LD8C 2AJ3B 2CKBH 3L6FB 5EU6A 1YNKH 5DSCA 2PO6D 4HWBL 2DQHH 4LKCB 1K5NB 1ZMYA 1MFAH 5E95B 1K4CA 2YD2A 1HE7A 3NFNA 1S9XB 5GZOC 5KW9H 4NO3B 3NCJL 4LSRH 1ZLWK 5D7LB 2E6JA 3RQ3A 5BV7L 2VZ1A 3W9DA 2VE6A 4K07A 4HIHA 2CO6B 2GK0B 4Y4HD 5GS1B 2E9WA 4PV8B 5GISL 4QYOA 3U83A 5FGCE 3C9NA 1RUQH 1DDHA 1N6QL 2UZIL 5E94A 2R2EA 2HFGH 3TT1L 1RHHA 2R29L 2Z92A 1T2JA 4Y19B 1JN6A 1EFQA 2EYTB 3CDGB 3HNVH 2JB6B 4JPIB 2Q87A 4PJAB 4NN6B 1F5WA 1JUFB 5D7IF 1J05A 4JM2D 3TCLA 4X6FA 4RAUA 4KVCL 3T1WA 4KY1L 1BHGA 2ZPKL 2GT9B 1U8HB 4PJFB 3DV6A 4LOUD 3IFNH 4TRPH 3D18B 5FCSH 5I74B 1LO2L 1J86A 3CVHH 5FYJH 4EXKA 4Y5XC 5CJBA 2FO4B 1A1NB 5K59F 2VDRH 4PJ5B 1QACA 4F7MB 5F9AC 2FBJL 4QY8A 2J2ZA 1S9VB 5E6ZA 4BSWB 4ZFFB 1H5BB 4X9FA 3T0EC 1KGCE 1U8JA 5ESQA 1NBZA 2C9AA 4NNXB 1UADC 1UJ3A 1CFQA 4BFGA 2DOCA 4BZ2L 1WBZB 5DFVC 1RK0B 2IQAA 5FYLE 4ENED 4YUEH 4TQEH 1JFQL 3HMXH 1UGNA 3QZWB 5KSBA 1PSKH 1FFPB 1NJ9B 1YN6A 1BF2A 1SY6A 5HXMA 1A3RL 4JFFA 3WIFA 1QOKA 2NY6C 3DGCR 1SQ2N 1A7RH 2I26N 3GB7A 3JV0A 5AAWA 3P4LA 4ZUUA 3Q3GB 3U4BL 5FM5O 4P5TD 5JLZA 1N0XH 2XPGB 1E6OH 3NZHH 4O2CA 3I50L 3CFKA 4JDZB 3TIEB 2F19L 4PJ5A 3W0WD 1M7DA 3BXNB 4YDKL 5F9OH 1OQXA 3RA7L 3U30C 2PXYD 4ZAKA 3WEXA 5C0EA 2R2EB 1P2CA 1IARB 4XCNA 4X4YB 4Y16B 1CDYA 1I3GH 5FKAB 4QHUB 2P1YA 3D69A 3WXVH 3M1BA 5F9JA 1RIHL 4HIXL 3C08H 1AR1C 5D7LE 3DROA 4OUUB 4HLZH 1YEDB 5ITFB 5HHPA 4KKBD 1KBGL 5GS0L 2EEBA 3GRWH 3CH1A 3BPNB 5FHBL 3BZFA 1X5HA 1YNTB 4OCYH 1H3WM 3CUPA 4F7PA 3SDXE 5FOJA 3BGFC 4X6BA 4TVPH 3HZVA 4BZ2H 1S7VB 1AI1H 2BRRH 1PKOA 1B4JH 5E94B 3MV11 5H94B 2BSSB 4B41A 4KUZL 2VB5A 4LL9A 2CLVB 3VFTB 3MOBH 1WGOA 2ZG1A 4M3KB 1AFVH 4IS6B 3DRQA 1IAII 1A7NH 1E4WL 2I5YH 3TIEA 3OXRB 4JRYD 5HHOA 4DOHB 5F1IA 1UCBL 4NHCL 4NQVA 1KELH 3IKCA 4R0LC 5C08A 3BH9B 4LNRB 3BISA 4Y4KA 2DTMH 3W0WE 1EDQA 2JIXB 2KZ1B 3VI4F 1ZHBB 3MJ7B 3O9WB 2QV2A 3IDMA 5T1LD 1GYAA 2A6IB 2AK1H 5J3HC 1P69B 3WKMH 1S7RB 1I8IB 4I5BA 1G9NC 5HHXL 5K93A 2P5ED 1CR9H 5IF0B 1I3GL 1CDBA 1KIPA 3FT2A 2NNAB 1CFQB 2NYYC 5T1LA 2UZYB 1WT5A 3ULUC 1P7QD 5I66A 3VXQB 3NH7L 1HHGB 1IGTB 1MAMH 2NPLX 4G3YH 3IU4H 3NN8B 4CUCA 3MGTB 3DI2B 5EG6C 1RU9L 5BZDB 1A22B 5EUOF 4LGSB 1NGQL 4FFZH 2X4RA 3CFCL 4K94H 5CJ8A 3CH1B 1A6WH 4GBXA 3QB7C 1G9EA 2HT2C 3H42H 3B8SA 4OSUH 1H3TA 4YQXL 5A2FA 1KG0B 4JKPL 1CVRA 1OD9A 3C2AL 3QHZH 8FABA 2A1WH 4LARH 1LHZA 2H1PH 4RA3A 4O58H 4MXVF 1KELL 2Z31A 3ARQA 3KPRB 4MVBD 2DRUA 3VI3F 1HIMH 3BP4B 4PR5A 3D6GA 1X9QA 2P5EB 4QCIA 2O61A 2X1OA 3V0VB 4APQD 1Q9OB 2RQ8A 2Y25A 2GJ6D 3KYMB 3IDYB 1RD6A 4NC2B 3FB6B 3MYZA 3SO5A 2K9UA 2HJFB 3HFMH 5SWZE 1GVIA 4NKDB 4HGWB 1U58B 1V3JA 4NFDA 1H3UA 1NAMH 3QEGL 1GJIA 5AYUH 4X6DB 5ERWB 1BZ9B 4OFYD 4QGYA 3SDDA 1GGBH 4JFQA 4GW4B 3VXQA 2A83A 4JDVA 5IJVB 3S5LA 3GGWA 3UTTD 2W0PA 4ZFFA 2IBZY 3ULVL 3DHJA 3S4SA 3O8XD 3JSSA 4LF3B 4ZFOL 5I16B 1R0AH 3QNXA 4ZXBC 4D0DA 4G8IB 4CADB 5KG9A 1MJ7L 1QFOA 1OGAE 1G9MC 1CFTB 2R15A 4KZDH 2NY6D 1JGEB 1JPTL 4XXCC 1R5VA 5I1GL 5DHYB 3QEQE 5DT1L 1OCWL 1C16B 1ZLUK 3HPJA 4PPTA 5IBLD 1VACA 4I48B 2B0SL 4PRAB 4RZCB 2A9MH 3LSOB 3GFUA 3DI3B 4YPGA 3TT3H 3UROR 5I1LA 5EDXA 3V7AE 4LSDA 2B2XL 5C0CE 2VKWA 2XQBL 5DD1L 2PXYB 3GSXA 1FNSH 5HDQL 3LN5A 4KDVA 4E42B 3NTCL 2AAVA 3TPKA 3P73B 4R3SA 3MRIA 3RWCB 2H8PA 1CN4A 4DKFL 1I9JL 3RX7A 4S11A 4PRNA 1BECA 4XCYB 5HGBB 1W0VA 3O6FB 1JYXA 2OK0L 4X7SL 5CEZD 5ESAA 2ADFL 1GOGA 4IHOB 2AEQL 1BFVL 4OF6A 5JOFA 3D3VE 3TH4T 1UZ8A 2XQYK 5D1ZC 5FAAA 2EYSB 4GKOA 4AZ8A 4KTDL 4BA8A 3FOLB 3MLVH 4CAGA 4GQ9L 1AGFB 1IGJB 1WIOA 3EUUA 1Q1JH 4S10A 5JO5A 4NRZA 4OKVA 4O9HH 1TENA 1YYLL 1G7LB 2AJ3A 3BZEA 2APFA 4MAUL 1CDIA 4NQDA 1UEYA 5HPOA 1SM3H 1J8KA 1EO5A 1AR2A 2ED8A 2M8XA 4MA8L 3VFSA 4S2SA 1ZGLP 3BWUC 1AR1D 5EU5B 5DJXB 2BVOB 3O45A 4I18A 4AEIH 3H7LA 1BVKA 4GXUM 2LTQC 4NUJA 4QXTB 3OB0K 2R29H 3MRHB 2YD7A 2OMNA 4F33A 2VL5A 3B2VL 3O81A 2DJUA 3T3MF 2B39A 3QEQD 4I2XE 2EDFA 1QBMH 5CEYB 4JM2B 1P7HL 3ULVE 1IM9D 3CPLA 5DD5L 3INUL 1VGEH 2EC9T 4XP6L 2ICWJ 4B7IA 2FRGP 3VXMA 1ZTXH 5I15L 2NYYD 4Y19D 4LCYA 4PJ8A 1DR9A 1OY3B 2MKWA 4R4NC 5I1CL 5FECA 3DV4B 2G5RA 5IW3A 4J4PA 4LLQA 4LSPL 3DX7B 2FIKA 2DMCA 4DK6A 4N1EA 3QBTB 2VLJA 4XAWH 4DW2L 1HHGA 4NWTH 1IC7H 5D7LD 2HN7B 3QQ4A 1RV6X 3I6GA 4C54A 1B2WL 4KKAC 1B4JL 5K9KA 5DA4A 5EO9A 5HYJA 3S88L 1QLFB 2PO6B 5J0BA 3U46A 4O51A 4FQQA 3IB4A 5BRZB 4S1RH 1FSKC 4JM2A 3IDMB 3WNNA 2UWEA 1TJGL 3WJLA 5BVJB 4YZFE 1UCTA 1ITCA 4Q9QH 1ZVSB 1IGMH 4NRZB 1WFNA 2VXQH 3PXJA 3OKOA 3QEHB 2VISA 4FQCH 3TV3L 4Y4FC 1OVZA 3U0WH 4MA3B 2XWJB 5F1IB 3QJHB 2DLGA 4HF5H 4RMTA 2B1HL 1IAIL 1S5IL 4PJEB 4L8DB 2WQRA 4MJIE 3EOAB 3IXAA 4FRWA 3LEXB 2CR6A 3O3DB 2DQFB 1OARL 1XT5A 1JF1B 4XC3L 4F8TA 5D1QD 5JO5B 3FRUB 3QPQC 3GMOB 4HWZB 1T04A 4L8CA 5HYSG 4Z76B 1MI5E 3STBA 1MHEA 3LN5B 3PWJA 4OZGA 5EU4A 1CD1B 1WBXB 2FIRT 3AROA 5BRZA 2AJSH 4GMTH 5E2VL 5C0RH 4WI3A 2P42B 5IB2A 1IMHC 2G2RB 4IDJH 4JHZA 2F5AL 1QR1A 1DBML 3ARUA 3C6LA 3PWVB 3TPUB 3CDCA 3TWCL 1G9NL 3IETA 3MUGA 4L1DA 5E5RB 2B0SH 4JHBA 2EIDA 1RMFH 4U6VL 1PX4A 5FOBB 4F37K 4S0TD 1FRGL 1J5OL 5IFAH 2HN7A 3D85A 4KV5F 5IHZA 3PWUA 3W0WA 5GZNC 4L8SB 2EC8A 3CC5A 3HC3L 1EFXB 3QNZA 1RUQL 4QRUB 3VFPB 5MERB 3IFNL 5LBSL 5EU5A 2C3VA 3K2MC 3EW3B 4HLZG 4ISVB 1MNUL 1BIHA 4ZUSB 1U8QA 4V1DA 2EIEA 3ZTNL 3LPGA 4C57C 4J8RB 1V3MA 3GEWB 5HI3C 3O2DH 4UDTB 2QSVA 3DVIA 5DUML 3DVFA 4RAHA 3SE3C 5MEQA 3QG7L 4U1LB 3ZE1E 4X5WB 2HAZA 3X3FL 1N6VA 3R0MA 4PBWD 5HHVH 1PEWA 2R9HC 4NQEE 4HFWB 1KJVB 2IMMA 1XF1A 4GRLA 4QRPA 2F53D 3DXAB 4U3HA 4PJIB 3VXOB 1T6VN 2NW2B 2X4UB 5T1DH 1HN1A 4KFZC 4F9LC 3UX9B 2R9HD 4YXKH 4UOW0 3LS5L 3X11B 3UPRA 4R97C 4HC1H 5FKPA 5CGYC 4PJ8C 1SBSL 3UC0L 1OTSD 2IADA 3PDOA 4GKNB 4HULB 1I3RA 4OCWH 2ZSWA 1FFNA 3M17B 5ID1A 3TCLB 1SEQL 4FZEL 4P99A 3MLRL 3GK8L 5GGRY 5D1ZD 2JB5L 4U4BA 2ZUQB 4HK0A 2VQ1A 4OZIE 5I73C 1JGVH 3HAEB 3BPOB 3OB0H 2YXMA 4HUVA 1WZ1H 2DAVA 1Z9MA 2O5ZL 4NGHH 2VRAA 3N1MC 1JF6A 5E9DD 4DUXA 5DVKA 4MSWA 3RWFB 4XX1G 5HSFA 4YBLB 2J8HA 3GKWH 3MXVH 4AEEA 5GHWH 1R0AL 1X5GA 5GGSB 5TF1H 2X4TB 4L4TD 1PYWA 2Q8AL 2GSGB 3PWPB 4Y1AB 1JRHL 2BCKA 4Z0BL 3GSXB 3BD5A 4IRJC 3TNNB 4PTTB 3KPQB 1NMBL 3NCFB 5HI4D 4M7LH 4RQQA 4OZHF 2NXYB 1XGQB 5EIVA 5IBUB 2AABH 1LK2A 1JHLL 3OR6B 1X7QB 1K2DB 5DTFB 3TBVA 5EU6E 1KXVC 4MNQE 3L5XL 4YAQA 1FFOA 4XXDA 3MJ6A 5JHLL 5FYJE 2J1KA 3OKDA 4WV1A 5L9DH 4LVEA 3KG5A 3ARGB 5ISZB 4MAYB 1EA9C 3GSNH 3OMZA 5M95B 3REWA 1I85C 3IKKA 3MRLA 5C0GA 3QA3A 4TVPE 3BGFB 2OR9H 4JG0H 5JIPA 1I8IA 2CKBB 1HQ4B 4NO2A 3SGDI 5HGDB 5C0CA 3UBXA 4D94A 2MPAH 4ZTOH 4G6KH 4KQ4H 3T0AA 3SJVB 3OHXB 1CLZL 1YQVL 3ZL4L 1MF2H 3OKMB 1X5LA 1FGVL 5EUOE 1EO8H 4JFDA 3Q6FB 1DQMH 1ETZB 4ZPVB 3TVMD 1IC5L 2C1OB 5ITBL 1INDH 3IRZA 5HD8D 2JIXD 3X12B 4G7VL 4GG8A 1YC7A 4ZUTB 1QNZL 1OAZL 4YBHA 4K9EH 2HWZL 4IIQA 1PKQB 5I2IA 2Y6SC 4HUUB 1QD0A 4NHUB 4DUVA 2E9IA 4BQBA 3DBXA 1JZ5A 1T22B 4IOIA 2OR8A 3ES6A 1ZT4B 2DBLL 3DUHA 1U0QA 1LEGA 5HPMB 3KPRE 3VWJB 5F3HA 1JHLH 1M7DB 3BXNA 4PJXE 1H8NA 4F8QA 2J4WH 4JY6A 3I50H 4AEHH 4NO2B 3T2QA 1J18A 2EDYA 4QF1B 3DSFH 1EJ6A 1IC7L 4Z7VA 1ZHLB 4O58L 4RWYL 3X3GL 2FJFB 1CGYA 2H6PA 3MLUL 4OQTA 4HZLB 3GSNL 5EU6D 2J6EA 5AZ2L 1OP3H 5MEQB 2W9DL 3F7YB 3FB7A 1H3GA 3BVNB 3T4YA 3GSQA 5MP6H 4MJ5B 5GS0D 2IAMD 1Y6MR 4K8RL 5I75C 4LSRL 1UB6B 4QTIL 2NTFB 3SGJC 3UTTE 3GMMA 1RI8A 4HJJH 3L3OA 1MHHA 3VXOA 2BNUB 3RI5K 1NANH 1P84K 3UDWC 1JNLL 5ALBH 4NZTL 4OCSL 3GIVB 1HZHH 4HW6A 3VXSE 1S9KC 3ZL4H 3QFJE 5A2KH 3MV8A 1KB9J 1AQKH 4RMSA 1UA6H 2I9LB 3T09A 5IR1B 4QY8B 2VO5A 4XNYH 4EEEA 4UQ3B 1PX3A 5CCKH 3FMGH 1J11A 3HG1D 2DQGL 1KENH 3BP7A 4JM2F 4K7PX 1C08A 3U9PL 4XCFL 4BQ8A 1INEH 1U8QB 4NKMB 3MRJB 1UWXH 2R0ZH 3IJSA 3GSWA 3P0GB 5CWSA 1NAKH 4KVNL 5HJ3A 5EOTB 1F6AA 4W4NA 5D5MA 4PJDB 1U41A 1MRCH 4M4RA 3DROB 5TE7H 1M6OA 2QQNH 5EORL 4NT6B 1NFDE 2PTTA 4HWUA 3MRGB 1F42A 2X4PB 4ZFOB 4QXUH 2HFEB 2V5YA 4HKBA 4RWYH 2VQTA 5CGYD 2IPKB 5IM7B 1H3PL 4YJZL 4FFYH 4D9LL 1BFOB 1HHIA 4XNYL 3VRJB 4FQJL 1CFBA 5SX4I 4KJPD 3BW9A 3PWVA 4FP8L 4HDIA 3TPUA 5T3XD 2V2TA 2OJEB 3VFOA 4LFHD 2X40A 3K0WA 1DBKL 3MFGB 4LPTA 4Y5VC 3MRQB 2NY4D 4MA8H 3PHQA 2ADJB 1B3JA 1G0XA 4AY0A 5IWLA 3EJYD 2MSPA 1S7WB 1VADA 3QIWA 1LDSA 2R1WA 2EKJA 3FRPA 1OGAB 5KJRH 2DN7A 4HS3B 4AQ1B 2PW1B 3DO7A 3QFDA 3QQ9C 3EFFA 5A2JH 4ZDHB 4P5TA 4L8BA 3CFIC 4KTDH 4X6DF 4IJ3C 1UH4A 4Q9RH 5I1KL 5AG8A 3CX2A 2J6EL 4OZGE 4ISVA 2BY0A 3RVTD 1D5BB 1MEXL 2FYYB 1YQVH 3FJTA 3B3IB 3IDYC 4X7CC 1INEL 2VTFA 1IM9A 1HQRA 5E8EB 4YGVB 3RU8H 4F15C 1YEFL 3ZYOA 4PJCE 5F7UA 3WUWG 1E28B 4A6YL 2HLFC 4KK9D 3U4BH 1NLDL 4XBPB 4OFDA 5GS0H 1UB6A 5J06A 1J7VR 3KPTA 4PJ9B 4KQ4L 4GS7C 2QSTA 4PB0L 4XAKD 1ADQL 2ZSVA 5TGBB 4PJHA 1YMMB 1QSVA 1CXEA 1EEZB 3U0PA 2VSDA 4HIJB 1RUAH 3G6DH 1YN7A 1EEYB 3GBML 1VEOA 2CSPA 1FNEB 2IMNA 3JTTB 1GGYA 4PV9B 1NUFA 2RHEA 1FIEA 3WXVL 3E6HA 4IMLA 4RBPK 3A6OA 1AE6L 2EYTA 3E2HB 4H20H 3QPXL 3P11L 2NZ9D 4EVNB 1DLFL 1CG9A 5C70A 3CXDL 3HNSL 1I8KA 4JFFE 3K1DA 3DBXB 2V6HA 4Y89A 3QI9A 4H8WL 5TDNA 1NAMB 3WBDA 4EQ3A 4TPRH 5SWSA 3NPZB 2WK2A 1UKSA 5I8EB 2DKUA 2V2WA 1NGXA 5DEZA 3NFSH 2B7DT 4M48H 1ZT7B 2CMRH 2OTWA 3BN3B 5IIEB 1WCQA 5JPMA 3QDGA 5D1XA 2XOTA 2YBRA 4RAVB 2VC2L 1FBIH 2ILLA 4PB9L 2O5ZH 3SJVA 2E27L 3VA2C 4P2QD 2UWEB 4OV5A 1WEJL 4PS4H 1LO5A 1Y0LB 4KRMB 1BZ7A 4H5SB 3H0TB 1A7QL 2VDOL 3EFDH 5J3HD 4IHOA 4Q97A 3ARFA 1YC8A 3EYSL 3T0WA 5IGXH 2WBKA 1BM3L 4YDIL 4XPAH 5D2LB 2IBZX 3FQRA 2QHLA 1XGYH 1TNNA 5E2UH 2VLRB 4XBGB 5JXAL 1OGAA 2R1WB 1YY8A 5DJDB 1FORL 3VCLB 1DUZA 3RBSA 3NVQA 3DURB 4PGBA 3MNWA 3LRHA 2XNAA 5EH1A 4P4RA 3O2VL 1K4DA 4PJDE 4UNVA 3U46B 5L9DL 1XF4B 4Q9QL 1HSAB 4F9PA 5KTEL 5IW1A 2D31B 1T4KB 1KCSH 4M5YH 1QSZA 4NQXB 3O6ML 1A47A 1QTYT 3HS0A 3L1OH 2HT2D 5D7IB 3C08L 5DJYA 1YPZB 4PLJC 4L4JA 3G5ZB 4D0DB 3IJHB 1KTDA 3P4MB 1GC1L 1CICD 1XH3A 2HVKB 2P8PB 5DR5H 2DQJH 3K4DA 5HDBF 4JDTH 3SDCC 1RZKL 2ADGA 1XGPB 2EDNA 3L3HB 2XTJB 3HE7A 3MUY1 5MEPA 4XPBH 3K4AA 4R8WH 2EXWD 4O2EB 4CU8A 2AJYH 5FUZL 5E5MA 3QUZA 3ZO0A 1PQZA 1UKQA 2XZCH 5EO1A 3QEUA 4Q7DA 5KTEH 4Z0XA 2HTLD 2F5AH 4B50A 1RUML