1D6VH

Conformation effects in biological catalysis introduced by oxy-cope antibody maturation
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
221
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARGHSYYFYDGDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CHIMERIC GERMLINE PRECURSOR OF OXY-COPE CATALYTIC ANTIBODY A
publication title Conformational effects in biological catalysis: an antibody-catalyzed oxy-cope rearrangement.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 1999-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6vH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1d6vH02
2WBJC 3RWIA 4G9FA 4M5ZL 3FRPA 4JFDD 5D1QA 3K8MA 4JM2C 2GSGA 3BESR 1IGCL 3B9KB 4UTAH 2OI9B 2VYRE 2QQQA 2WMPA 1WBXA 5IGXL 1MCOL 1DEDA 3Q6FB 3VMNA 4F3FA 1A7NL 1FL5B 4CMHC 5C6TH 1OPGH 2WWKO 5K93A 1N5AA 5KBNC 5D7LA 1W72L 4LEOB 5GS0H 1NANH 4KJPC 4RGOH 3JTSB 3OGOE 3GNML 5DTFB 2D7TL 32C2A 3BDYL 4PG2A 3PQYE 1T2JA 4BQ9A 3MYJB 1QKZH 3QG7H 1MAJA 4KDVA 2ICWI 2W38A 4KTYA 4YDJB 2DTML 1BFVL 2EDKA 2Y06L 1NCNA 2R2BB 3QDGE 1U42A 2HTKD 4XNQB 3CK0L 4EUPG 2A0LD 3BH8B 2VC2L 2IG2H 2UYLA 1MCHA 4Z0XA 4Z7NF 5ESAB 1A1OB 3QBTB 5DEFB 5MI0B 1SM3H 4HIEB 2P7TB 2RFXB 4Q9QH 2XTLA 3W9EA 5IKCB 3O6ML 4MQTB 5GZOC 2E7BA 3S37H 4HUVB 3D48R 4N1CA 3FB7A 4UU9B 2BC4B 3LN4B 5C09A 3MRCA 1NANI 1KB5A 3QNXA 2PYFB 1S7VB 3P30L 4V1DB 1P9MC 1ZS8B 3FO9B 1TIUA 3GSNL 1EGJL 4IMKA 1IC5L 3JUYA 4XBEL 1UKSA 4HC1L 1ZSDB 2GTWA 3C9NB 3WHXB 5FUZH 2CO7B 1MIMH 3GBNL 5DHVB 4LDOB 1BBJB 1E28A 1HWGB 1RUKL 3OAYK 4ODXB 1H5BA 1WC7A 3UTSA 4OZGB 5A2JH 3TVMC 4PJ8A 5F7EH 4DTGL 43C9B 3V6BR 1M6OB 3QFJD 1S8DB 4XPTH 1PQZB 3DVNB 1L0QA 2OR7A 3L3IB 4MAYB 4JY6B 5FGBA 1TITA 4U6VL 1LHZA 5D5ME 3BDXA 2MCPL 4ZTPH 4HUUA 3FHQA 5IHLB 1OAXH 4BH8A 3SOBL 1FL3B 1NLBH 3DX6B 2F54B 15C8H 1T0PB 3ECBA 1BWWA 4PRNB 1CK0L 1VFAA 3UBXI 1TZHB 4RMWA 1AGEA 4LSPL 4Y19E 3HMXA 5D2NA 4K55A 5DMGC 1FNLA 1GGUA 1YEIH 1EJ6A 1T6VN 4ZOBA 1NJ9B 2UZYB 4JFXB 4NRYB 4GG8B 1TJGH 1VFBB 3L3JB 4XBGB 1EFXB 5TDPA 3G6JB 3ILPB 3EYOA 1ZVSA 5GGRA 1QBLH 4QXWA 3QUKA 5EZJB 1BD2E 5C07E 5CBEA 1XMWA 1IAIM 4JHAL 2IF7A 5SWZA 2IANA 3KDMB 4P5TD 1CBVH 1U95B 2VXTL 3L5IA 5B8CC 1RUPL 2X4OB 2O93L 1IGTA 5FYJD 4UDUB 1OB1B 4EI5B 5EZLB 1A22B 4U1KB 3SHSA 3BT2L 1DL7H 4Z8FH 2ADIA 2P5WB 5FF6A 3D3VA 3W0WA 1S7XA 2N56A 4OZHF 5HYEA 1UA6H 4TUKL 4KZDL 3L3DB 3O2DH 4F9PC 4QRSB 4JZNA 3DARA 3GMMA 4JY5L 5TF1L 4JRYB 2WBJB 1MJ7H 2P5EE 2ERJC 3HAEG 3L3GA 3FT3A 4WRLA 3LPWA 1FFNA 3OKLA 4MSWA 1EO8L 2P43B 1DN2A 4HIJB 3T0XA 3PWJB 3VGHA 4L5FL 3GDBA 3RAJL 4M03A 1W0YT 1GIGH 1FNEB 1G7JB 1JF5A 1T2QL 2FLBT 3DMMB 5I1JL 1HXMB 2MCG1 1JUFA 4QRQB 1CQYA 5CGMA 5D1ZC 3IGAB 2ARJA 4IIQB 4PLNC 1RPQA 2MTPA 4P3DB 1XF5B 3LS4H 5LCVL 3H0TB 5EU6D 3BD5A 2X89A 4MQ7B 3M07A 1U58B 1I1YB 4JGMA 1JYXA 1N6UA 1KLFA 3FQRB 5C0DA 2Z31C 1YMME 5HGBA 2BNQA 1NQBA 1MVFA 1T03H 4H20L 2WQ8A 3GMPB 1XR8B 1ETZB 4BSVA 4G9DB 1TVBA 4IRSB 4PJXE 1P7QB 5I8CB 4UMGA 1QSFB 3QDJD 2MQ3A 5L7XL 2M1KA 3ARDB 3T2PA 2BOBA 4HS3B 3L5XL 1RZIA 1FAIL 3LQAL 4WWKA 3LKPB 4PB0H 4XXDB 1VADB 4DN3H 3SE9H 1QSVA 3G5XA 3TIDA 2BY3A 2R0KH 3LDBC 3Q6GH 1XGRA 2D31A 5B21A 2ADGA 4HKBB 5FKAB 3VXMD 1NDGA 3O9WD 1OM3L 4PGJA 2V2TB 1EJOL 3TH3T 3VRLE 5IVXB 1FG2B 2AJXH 1FCGA 4OD3L 3VE0A 4EOWL 4TVPH 4C56D 1ZHLA 4ZS7L 4F80A 4U1SA 2WUBL 5A16A 5DK0B 2GAZB 1SEBA 2N7BA 2X4NA 3LS5L 5HJ3B 4RGMB 3V6OC 3H8NA 3I9GL 1DLHA 3PWVB 5E24E 3B8YA 3PWUB 5TQ2L 3FT2A 3GHEH 1JGLL 3KR3L 4GMSH 1T1ZA 4Q58C 4XNYH 3DETD 4QGYA 2GIYA 4JO2L 2JCCB 2H26A 3AU1B 2QR0A 5I1HL 5GGSA 4WW2C 4U0RC 5C7XH 5HPMB 1R0AL 3U82B 1E4KC 3BVNA 1DBMH 5EPMB 5BVPH 4YPGA 1C5DA 1CD8A 2A74B 3MBED 3WYRA 4JDZA 1A6TA 4FQLH 4M61A 4LEXH 3CH1B 5C3LD 1BQUA 3NH7L 5CEXB 4JREB 4OZIA 3QDGA 2ZG3A 3LEXA 3WIIH 1H0DB 1CD1B 3BKCH 1BZ7B 3CFKA 3TT3H 2RR3A 3UTQA 1I1FA 5J4MA 3KYAA 5KS9B 1FBIL 4OZIF 3LPFA 5MENB 1YNKL 1N2RA 3ELAT 3LZFL 4XPBL 1AHWA 4GG6E 3C5JA 3QEHB 2IGFL 1QR1B 3BIBX 5KSBE 1HH9B 4GAFB 3ARFB 1W8OA 2R1WB 1NLDH 2VDKH 1DUYA 5EZOH 3C2AL 4PRPE 1YQVL 2DJ4A 3C87A 3TYGL 4N0YL 2FO4A 4M6MH 2ATPB 2Q20A 3RWCA 2C3VB 3ULUF 5F1NB 4PG2C 1UC6A 2R1XB 5T3XL 5IHUL 2VDML 5F70A 1CVRA 2AGJH 5I71C 4ETQB 4D8PA 5EUKA 1NFDE 1HHHA 2GHWB 5TGBB 2EDDA 1FYHB 5HI4D 4L9LC 3GIZH 4YHZL 1NAKH 1YNTB 2FZ3A 3T3PE 3EDKA 2HT4D 3RGVD 4WGVB 4DGVH 4GKSA 3D0LA 3PGCB 3MLWL 2C3HA 1TQCB 3WO3B 4K3JH 4K9EH 4Z77B 4C4KT 1UCTA 5ERWB 1YQ2A 4AG4L 1WZMA 2NY7H 3JV6A 4HS6B 4I3GA 1F4XH 3B2UC 4Y5XA 3S6CA 2XZCL 3BZFA 4QHKI 3PABB 2F8OA 2LABA 5D71L 5DJXB 1GAFL 3BZ4B 3VG9C 2OTWA 2CKBH 4B7IA 1F4YL 5C08E 1JV5A 3VRJA 1YEJL 3PJSB 4WHYH 1CICD 3BGMA 4IMKC 4LLUA 3R06A 2YS4A 5L0QB 3QCTH 3PV6A 3LRHA 2P45B 3RTQD 5JXEC 4PIRF 1WCBA 2EYRB 2F53B 1OQOA 1R5WB 1BPVA 1IBGH 1YJDC 4X9FA 5LBSH 1YPZB 1YC7A 3GB7B 5GQBA 2E7MA 4PJ8C 2GEEA 1NEUA 3U30C 5F6IB 1BD2A 4F7PB 3C6SB 1Z9LA 3DUSA 4WU7A 3OKMB 3NOIA 4Y4FA 1FDLL 3VXSE 7FABH 2DL9A 2QBWA 4PRIE 5C0AB 5FGBC 1RFDL 5JORA 5BRZB 5C0FB 2MMXA 3DRQA 4LKXB 2R4RH 5DFVD 5B39G 1UZ8A 4FXKA 2NXYB 5SX4H 5CJOL 4PS4H 4YHMH 5K9OB 3KYMA 4XP9L 4HGKC 3T0ED 1S9YA 2VLKE 2NY4B 3G08A 5D2NC 2P42B 3O6FC 1B4JL 4NJAL 3TPUA 3TO4A 5DEZA 3NZHL 1MJJA 3MRIA 5T1KB 3IVKA 2JJWA 3OKNA 1UWGL 1LP9E 3SE8H 3OBAA 2I60L 5FM8A 2PCPA 4R97C 5L2KA 1RUML 3AUVA 5C8JB 3QAZC 4CJ1A 4WI8A 4J12A 4PJGB 5IF0A 2N4IA 4NNYB 1A6ZA 2XKNB 1N0XH 1XH3B 2VRAA 2NW2B 1A9BA 1F3DJ 1RHHA 2AP2A 5HVHC 5IB4B 3JWDL 2DWDA 3QNZA 4NFDA 1MI5D 2X70A 3VW3L 1NGZA 1BHGA 2VLRD 1VB9A 3BUYA 4MDIA 4IOSD 3MV9B 1A3QA 5IMMA 2FH8A 4PJDE 3T0BA 3W9DB 1U91A 3CPLA 3HNTH 4ZUSB 5KSAA 4O02L 4LVNB 4MX7A 4EVNA 3SO3C 5IFJB 1KEGL 1OAQH 3R0MA 2R56H 5CEZE 2WWMC 1F11A 2X9WA 3WNMA 2CJUH 5DJCA 4EUPA 5D1QB 3JV4A 3KYNB 5M95B 1PW3A 4TNVK 4ZQKA 1PX3A 1GGIH 3WE6A 1ZT7A 1DBJL 2Q8BL 3LKRA 1BBDL 3ZHLA 4RISL 2JJUA 3ROOA 2J5LC 4F3FB 1FE8H 1QACA 1RQ5A 4Q6IB 2OJEB 4L8DB 3GBML 3FB8A 4BUGA 5M7QA 3IXTB 5D7LB 2DQIL 3NCYS 2VZ3A 1CFTB 2B1HH 2BVYA 3DOSA 3AS3A 3QIBB 4XWGH 1VACA 5IOPB 4P59H 5HHOD 3O2VH 3SPVA 3F65A 3VGAC 4FQPA 5EZIH 4MAYD 3G9VA 1CE1H 3U7YH 4LDEB 3TBVA 4FABL 2JB6A 5IQ9A 3O41B 2Y23A 1LWRA 4XP6H 3TESA 3WKML 2GJZA 4NSKB 4K2UL 4HT1H 2F54D 2NLJA 4Z0XB 1CGXA 4WWKC 2XZAL 1JPST 4ZYKB 4QOKE 4KK5D 1CIUA 1RJZA 2AXFA 2XT1B 3ALWA 5ID1A 4O2EA 2COQA 1CFQA 5CSGA 1G9ML 1WK0A 1JWSA 3UBXG 4YE4L 3ZKXC 3JXAA 4L1DA 3GMLB 3V6ZA 5EU4A 3UPCA 4CDHA 2YSSB 2IAMA 3VWJB 1EXUA 4KRLB 1WITA 2WAHA 1OVZA 1N59A 3FKUS 3X17A 1U8QA 3ORJA 2EDYA 4YBQC 3MRCB 2F5AL 4BFEA 5FB8B 4LSRH 2C4FT 3T0VA 3MLSL 4IOIB 3W2DL 3GM0A 5KSVA 4PJAE 3C6LC 4TNWF 1EUTA 2C4FU 4GG6A 2GTWB 2W59A 5KSBA 5BZWA 3QUZA 4OJFH 3BFOA 3PL6C 5F9JB 2NX5B 4WNQB 3OMZA 1H5BB 1RJYA 3UTSB 1CGWA 1MH5A 4LCUA 4X7CC 8FABB 1RJCA 3H9YA 2P5WD 2R0WL 4MVBC 4XCCL 4LSUH 4UDTA 3THMH 3P9MA 1AO7E 3STLB 4NCC1 4CAGA 5TDOA 4OLXH 4HKXA 2WZPD 4XP5L 3OAUH 3CFJB 3QPQC 4G7YL 4LCIL 1E27A 4PFEA 2X05A 5I1KH 5H35A 3D25B 4JR9H 4NWTH 4XNUL 1T4KB 1TJIH 2WBJD 5AZEH 3CGTA 3MUHL 3ECBB 2DQUH 4JPWL 4WTZA 2W9EL 4JM2D 5ITBH 1AGEB 5ITFA 2HLAB 4NOBA 3LV3A 5HHMB 1DDHB 1QG3A 5F3HA 4OCMC 4JO3H 2LE9A 1AHWC 2J8UE 1L6XA 4IJ3C 3CH8A 4M1GH 4Z78B 3BXNB 1ZTXH 3ZKMC 2D7MA 1DP0A 1OSPL 3HAEA 2AVGA 1ZVSB 1PGRB 2NZIA 4P57B 2VIRB 1XF3A 3ARXA 4IEFB 3VH8A 1JFQH 1UB6A 2P47B 1OTSC 5F7MC 5ALBL 2IANB 1U8HA 2E9JA 5C08A 1FH5H 1ITBB 1P7QD 2XXCB 3UO1H 3EYQC 1U93A 3W82A 5T3ZE 5ISZB 4NRZB 1NCWH 4OZHB 1DBBL 1UM5H 5EH1A 5IMOA 2BSSB 4LPYA 1P84J 2VAAA 4MA3A 4NNXB 5LAXA 5KVMC 1JBJA 2Q76A 3DVFA 3D3VB 1S7XB 3AVEA 5AYUH 3M17A 1X6LA 3AM8A 1MOEA 3HS0A 3RWGA 2ZOLA 3QULA 1AKJD 2D03H 1Z2KA 5GZOD 2EO1A 4JZNB 5F96L 3VXSA 4I4WA 3O0RH 4PRIA 3SDXB 5IT2H 2PTVA 4JRXD 3FT3B 5ESQA 3QQNA 1UACL 2AW2A 3OKLB 4ORGA 2B0SL 4J23A 4OF0A 2VDPL 4G7VH 5LVEA 4R3SB 4LF3A 5EOQL 5F9OL 1KPVA 2VLKA 3S88H 4P3WA 1JUFB 4WHDA 4RQQB 1MHHA 3BP5A 4PJCF 5ILTL 4KDWA 1EHLL 2HJKB 3EYSH 4JB9H 3SGDH 1T21A 2VQ1B 3TVMD 1HK6A 1KJMB 1ZA3A 4OI7A 3HKFA 4PJ7E 4QCIA 4F8QA 3EAKA 4AYFA 4M3JA 3TBWA 4MNQE 1QHOA 5C0DB 2YRLA 1IC7L 2BNQB 3K4AA 1VERA 5E1AA 4JDVB 3MZTA 2VLLB 5FO7B 3RWEA 1QFUL 2BNUA 3RVXD 3FT4B 5DYOA 4Y1AE 4Y4FC 1J05B 3GI8H 4RFEA 1YJDL 2BOBB 3FB5A 2UY6A 1RZIB 4QXGL 5DD5L 5BO1H 1MFCH 1RUAH 4MZ3A 4OCRL 4UBDD 5DMGD 5DJ8A 1XZ0A 3NCJL 3TZVB 3IDYB 4XCEB 3LAFA 2VOTA 3BPOB 3MCLH 4JO4H 1B6UA 5MEND 3DWTA 1S7UB 4S1QL 4B50A 3K2MC 1C1EL 3HZYB 3RIFF 4JZJC 3TO4C 2XY1A 4G6ML 1ZHLB 1TQBB 5MERB 4QXUH 2X4NB 3SGDI 3UZVB 3QDME 3HE6A 5DD0H 1DLHB 4YBLC 1BJ1J 5GGVL 3ARGA 2D7OA 4P2RA 3PHQB 4NCDA 5BS0B 2OR9H 1D6VL 5C9KA 3CDGA 3ARBA 4TVSa 3K8KA 1T1ZB 1VEOA 1TMCB 1OT2A 1BP3B 1RZJL 2DJUA 2DM2A 3BYYA 1J8HD 1HZHH 1A14L 1K8IA 1YY9C 3RZWA 5DVOA 4OUOA 2AXGA 3CXDH 3C60C 4LPXA 4ZUUB 4JDZB 4O58L 1EZVX 5DK3A 4M61B 2VXUL 5D7IF 1QP1A 1X5LA 3UJTH 3QWRD 3MXWL 4D9RD 5E1HB 3QWOA 2CXKA 4L4TD 3CFKB 4UV7L 1I1FB 4IS6B 1BVZA 4R90H 4KVCH 1KJ2B 5LXGH 4QOKA 2GKIA 3PWPD 1N2RB 4HKZB 3QYCA 4YIQB 3MCG1 5T1LD 4ZTOL 1NGPH 3NCMA 1M1SA 5EIVA 1DUYB 5I15H 1T83A 1U6AL 3MLXL 4PV9A 2EC8A 2AAVA 2QSQA 4PLOB 2Z31D 4KZEH 2FX9H 3HR5B 1J9CT 4JY4B 4K23L 1ADQL 1CLYL 5C0BB 4AEFA 3IDIB 4YDKH 2H6PB 4NQED 4PJAA 4XPHH 4GMTL 2UV3A 1S7RB 3JVGA 4ERSL 5E08L 3FFCD 1RAMA 5BRZD 5EUKB 4E0RA 4PJEF 3C09B 2VLME 4N0UA 4W4OA 4FQIL 2VABA 5DRZA 4PP2A 1MFAH 4TSCH 2NXYD 4P0DA 2FZ3B 1FSKC 2NY4D 1MFEL 4TTGA 3D0LB 4JQVA 4WI7A 4YHOH 5IESL 3Q48A 1B9ZA 5E6YA 1OT1A 2HT2C 4BZ1H 2W1NA 2IAMC 2V2WB 4WHYG 4Y5XB 1KIQA 2E9IA 4ODUA 3IFOB 2FJHB 3LD8B 4NN6B 3WDIA 4NQSA 5J6GA 5CEZH 4UILL 4N1HB 1QFWM 2LU7A 4H1LH 2F19H 3ZZ1A 1X5HA 3CXHK 4NO2A 1UXSB 1JV5B 4WUUB 3R06B 4F7TB 2J8UA 1U8JB 2H32B 3MO1B 3GJEA 4F7MA 1CFVL 1OGAD 3QUZC 3Q1SL 3IAPA 1C7TA 3MV9D 2J8UF 4WI4A 3Q3GB 4UZGA 1BOYA 2YD1A 4QRPB 2RJMA 4HS8H 2VDRL 1Q94A 5T1MA 3MV11 4BZ2H 2E7LA 2LVEA 3DUSB 1BOGA 2B5IB 4WGWB 4WU7B 4XBPB 2DRUA 5E5UB 3I6KA 1Z3GH 3ZDXE 5J13B 4U1HB 3KPTA 1R3HB 1QFPA 2ZOKB 1I7ZA 1IAOA 4OD2B 3DRQB 1A47A 1YN7A 1HILB 3ZDYF 3O81A 2YN5A 3F58H 1J5OH 2W65B 4K8RC 4FXKB 5DA0B 4G9FD 2ICEB 1F90H 4G5ZH 3SBWA 2QQKL 2WBWB 1SJHB 3KYMB 3MROA 5D1QD 1UENA 1CDIA 1G9EA 3CUPA 2YD2A 3G08B 5ETUB 3TPUB 3GK8L 3SKOB 2CDEA 4HQQH 3X14B 3O45B 5A2KH 4KMTH 2PCPB 1WEJH 5DVKA 1G0DA 4XC1L 5D7LD 1KJ2L 1HSAA 1QHPA 5I74C 5B3JE 3HC4H 4X9HA 3UTPD 3WIHH 1FL6B 1KLGA 1RI8A 5DR5L 4IRZH 5IF0B 4OQ1A 3FN0H 4OT1H 4N5UA 2IC2A 1A6VH 1JPGB 2Z35A 1DEEA 4RMRA 5CINH 1A9BB 3DBXA 4Y5VA 4KK6C 3P73A 5CP3A 5FYKL 2PTTB 4HJGA 4AEEA 1JNHA 2DWDB 2X70B 4QY8A 3ULUL 1I8LA 1MCEA 1MCPH 2D9QB 1G9NC 2VUOA 4OLUH 4WCYH 5IROA 3MJ8B 3QH3B 4PJ7A 4Q9RH 4N8VA 1DBAH 2VITA 3U9PL 1K9TA 1AD0A 5KSAB 4DVBA 4ESKA 4MX7B 5E99L 4PJ7F 1S9XA 3AM8C 4XRCA 4ZUVB 3U4EA 3B2UD 5K9KA 4Y1AA 2Z93A 4CU7A 1XR9B 4EUPB 4DVRL 2GK2A 5C09D 4WFFE 3E6HA 1OCWH 3WE6B 3BN9C 3LEVH 1ZT7B 3CSYA 3OQ3B 3LKRB 1EEZB 4LAQL 4Y5YB 5F97E 3CXHJ 2DYPA 2RCSH 4RFOH 5E2TH 1CGSL 4ALAL 1Z5LA 1GL4B 4D0CA 4HD9A 1F5WA 2BRQA 2FIRT 3UTSD 2DQFA 5D7KD 4YXKL 4PJ8D 3IETA 2D0HA 2ZSVA 4LLWB 4X5LA 5CP7B 3SPVB 2YK1L 4FZ8L 4ZUWA 4ZFZB 3H3PL 1NL0H 4LSVH 1BIHA 5FO8B 4NJ9H 2ZPKL 1ZT1A 5EFIB 3CAFA 4P9HH 3OR6A 2JB6B 1RU9L 4U2YA 1CG9B 4MNHA 5IB3B 3QI9C 1JPTL 2PNDA 5T3ZH 3GRWA 4RGNB 1A7OL 2QEJA 3LH2L 4K3EH 1KPUA 1UVQA 1NCBL 1RJZB 2AXFB 1MVUA 1CFQB 4DZ8A 4LMQE 1A7QL 5TFSL 3V4PL 1JPFB 1MCJA 4KHXL 5EU4B 4AEIH 2EDWA 1KTLB 1X6NA 3QQ4B 1EXUB 4APQA 1JF1A 4NC2B 3B9EA 2MFNA 2PW1A 3D18A 3BI9X 1E4XH 3WL9B 1QSEB 2ENYA 3KNBB 4YX2L 1MLBA 3BPCB 5BXFB 5IB2A 5F7DB 2EYTB 1HIMH 2JB5H 4JKPL 3DVGB 3ARGC 5SWZD 2IAND 1UH4A 4FQJL 1AQKH 4R6UA 1J87A 3ARBC 3K4ZA 1OF2A 5ALCL 5CP3H 1A5FH 4BFBD 1MCKA 4XCYB 35C8H 3CDFA 1RJYB 3DYOA 1O7SA 2BMKA 3X3FH 4KROB 1MH5B 4K3DH 1CDJA 1N4XH 1NAMB 3UCRA 4RBPH 1RZKC 1X4YA 5GRJL 3D3VD 4JE4B 4XNMA 3W0WD 1WWAX 3QWQB 4FTVB 3JBG7 4XZUB 3WUWG 1EEYA 4DCQB 2WWMD 5GSVA 3PG2A 2AQ3A 5DUML 2VUYA 2R4SL 1E4XI 5IBTL 1T7WA 4X7SL 2OXHA 1S7QB 3SJVE 1CF8H 3HZMA 5E8NA 2R0ZL 3DSNA 2QQNL 3MBXH 2J8HA 4U7SA 1NCDL 5F3HB 3P4LA 4QYOA 3DV6A 4FG6C 2OX5A 5JW5B 4JGJA 1R24B 1BECA 1T83C 2X89D 3HAEB 3RFZC 1RVFH 4PJ9B 2ZG1A 1IL1A 2BNQD 3GSXA 1OTTC 3KPRA 4HX1A 3EFFA 4M4RA 2NZ9C 2YPLE 2OBGA 4YQXL 1AR2A 3WO4C 4DFIA 1SVCP 3D39E 1U93B 3JVGC 1A6WH 4XMPH 4HJJH 2C3GA 6CGTA 1V3LA 4GW1A 4WWKD 3HUJF 3L7FB 3NCBB 1URLA 4HXAL 2D9CA 2Q76B 4W4OC 4ZG1A 1QSZA 3VFNB 5E8EA 4DKFH 2E3VA 3U0TB 3SEPA 5L88L 3ARUA 3M17B 3HS0B 4PJHB 4LNVA 3QRGL 2ZZUT 1L9MA 1Q9WA 3FFDB 4JQVC 4HWNA 3KYKL 5JDSB 2FX7L 4HV8A 3ZE1E 3PWNB 4P3CL 3T4AA 4YBQD 1OD9A 4ORGB 3MLVL 4P2OA 5IVOA 1SY6A 2O5XH 4YZFF 4YR6A 3ILQD 3BQUA 3JSSA 1CXEA 4JKKA 4PJCB 5J06A 5DQJA 2FYYB 4LF3B 3RDTA 4NCC2 1NUFA 5BW7C 2BY0A 3HFML 2D3VA 1WTGT 3BIKA 4Z7UE 2R23A 1MHHB 3WD5L 1N5YH 1QRNB 5F93C 5D72H 3TCLA 4U3XA 1RJLA 2APTA 4DQOL 5D2LE 1KJ3H 4Q0XH 5BV7H 1QFOA 4MVBD 4K7PL 3NTCL 2RBLA 4I0PB 4XNXL 2AJ3A 5IBLC 3RZCB 5J8OA 4GXVL 4NFBA 2BNUB 4PRBB 3AB0C 4R2GC 1KN2H 5JNYA 1UZ6F 3OX8A 2QADC 3EIFA 4HKJA 4RFEB 3NA9H 4K7PX 4P9HC 1OW0A 2EO9A 3FB5B 1TZGL 4GH7B 3QDGD 4FQCH 3EOAA 5AWNH 1NAML 4CDGC 3N0PB 1UWEL 1I9JL 5I18L 5CEYB 5IHZB 1GYAA 1FZJA 2A6DA 4Z7VB 4DOHB 1XZ0B 4URTB 4EXPX 5E4EC 3SBWC 5FA4A 3TFKC 1QLFA 3KPLA 3V2AR 2HFGL 4ZFOB 3CFEB 1MRDL 3ZKMD 4NZRL 4XPGL 5FYKD 3ZYJA 5LWYL 2XA8L 1L6ZA 5ANME 3O4OC 1ZAGA 5IVZB 1H3UA 4D2NA 4ONHA 3HE6B 3VD3A 3BZEA 4Q2ZA 2ZNXA 5F88A 2OTUB 3DUUB 1OTSD 3T3MF 5HGHB 4L3CA 4JGUA 5DVNA 3WS3B 1K3IA 1WJ3A 4OFIA 2G9HA 4NQXA 2XN9E 3ARBB 3CDGB 4LU5L 3EYQD 3RY5A 3S5LG 3BKYH 2DIAA 1JWMA 2VB5A 4Y5VC 3O3BA 4P48A 2W0KA 4EJ1C 2ITDB 4NPYA 2EDNA 3KHQA 4MA7L 1T1XB 3JZ7A 2XIDA 1I8LC 2GJ6E 3E8UH 5FK9B 5IROC 4RCAA 5D7IB 3EO1A 4G42A 2YMXL 5HDLA 1VCAA 5MHSD 3MODL 4U1MB 3S35L 1G9NL 4CVZA 1WLHA 4BSWA 3CLEH 3ARZA 3FAWA 4YHYB 1WWBX 3B8SA 3MGOB 1BJ8A 5FXCH 3EGSA 3QWOB 1RURL 2VKWA 1NSNL 1F6AA 4NO0B 4NQDE 3V52L 2R0LL 5IMLB 5JW4R 3I6LE 3S35X 4GBXA 2GUOA 1YEEH 1WV7T 2A1WL 5ICXA 5FGSA 3UTTA 1T3FA 4HAFA 2BOCB 4GUPA 3VRIA 5J0BA 3SGEH 1N7MH 1R5VB 2F5BL 3SDCC 4JG1L 2VDOL 1MJUL 4LPVA 3PIQB 3VGDA 2X4QA 2APBA 4QF1A 1MFDL 4D0BA 1BD2D 1PBYA 4PJEB 1XCTB 5EBWA 4Y4FD 5GS2H 2AK4E 3ZE2E 1NMAL 4HEPG 3ZHKA 3NFSH 4S1SL 5JW4Q 3KJ4B 5T5FL 1BVKB 1W0WA 3UYRH 3DRTB 4HCRL 3IU4L 5JUEL 3HNVL 5DRZB 4PP2B 3V4VH 2DI7A 4Z7OF 4ELKA 1X5AA 4PJ5A 4TOYL 2JF1A 4R7NB 5JHLL 4BKLA 3ME0A 1DQML 5FA3A 1KLUA 1U2CA 3QZWG 5TE4L 4U1JA 1OP3K 3MJ7A 3TO4D 3RNQA 5C86A 1QFWH 1PDKA 3GFUA 2EH8H 6FABH 4NOFA 2NY5L 2XFXB 4QRRE 3SGEI 4APQC 2DB8A 2FATH 1NUGA 4PJBA 4BFIB 3R8QA 3U1SL 3DTXA 4NQSB 4R96A 5IWLA 5L2KD 5SWSE 1V7NH 3U0WH 3SJVA 3IKKA 5B39B 3WDJA 5I76A 1S9VB 4PJBF 3MLRH 1TNNA 2K7QA 1HHJB 1RZ7H 1I9RH 1ES0A 4ZFOL 4AH2B 4A6YA 1ONQA 1QNZH 1G7PA 3I6GB 1GZPB 4GQPH 3BPNB 4LSTH 1YY9D 3SCMA 1U8IA 4OGYH 4CL7A 1R3IL 5IEHB 3RY6C 3KPOB 1Q0YH 4TNWK 1TJHL 5I8EA 4YFDB 1P4BL 5KSAD 3O6LL 4ZOAA 5D6CB 2OP4H 3I6KB 3H42L 5HHVL 1YEGH 2YPLA 2R2EB 2NY0C 3HR6A 5GSRA 5DQDH 1MPAL 2YD8A 5I75C 1QFWI 2AI0H 3D39A 4WHCA 3RWJA 1LEKA 3BH9A 2ICWB 3QEGL 4U1IB 2DLEA 3ZMRA 4LARH 3MROB 3I85A 1G7IA 1RZFL 5D8JH 3LRSA 1PSKH 2UUDK 1JZ3A 3IFNH 2EICA 1A3RH 1PAMA 2VZVA 1IGML 4XT1C 5IG7A 4WU5B 5AD0B 3VXRE 4YXHH 5D7SL 2EDXA 3WLBB 3OKYA 2Y36H 5HGAB 3WN5B 3MRHA 1CLOH 3DO3A 4Z95L 1HSAB 3H3KA 3K7UA 3IFLL 4XPAL 3NPSC 2LVCA 3ZE1F 4AENB 5I30H 1OAZH 1MCWM 3ZDZF 4I77L 3DBXB 5EO1B 3HZVB 3BO8A 1LEGA 1S9WB 4XP4H 5L2JA 2MSPA 1MFNA 4M48L 4QY8B 1P2CB 5EO9A 3LKOA 2ZUYA 4JFFB 5ICYA 4RGND 1GRWA 1CGVA 2VITB 3RIAF 5ADPH 3TC9A 5TE6L 4DVBB 4YHIA 1M7IB 3QHZL 4J8RA 5FECA 2MPAL 2WUCL 4L4VE 4LMQI 1BEYL 1Q8MA 2HT2D 4KI1A 2IAMD 3VFPB 4TSAH 4WDIA 4X8JA 2HWZL 4JFYA 4ZODA 3AGVA 4ISVB 4NWUH 1HQ4A 4AIOA 3HI1B 1AGCA 3MV8E 1FIGL 1UCBH 2ICES 4GW4A 1GC1H 4PV8A 1CDUA 4WENB 5FHBL 5FUCE 3HRZA 3QUXA 4P2OC 4ZSOA 4XCNB 1UM6H 1AXTH 2DBLL 3GJFH 3NAAH 3BQUC 4NZJA 4AK1A 2QJDA 4XVSL 5J1AB 2DYPB 3RDTC 1TVHA 1JK8B 3UBXB 3STZA 3QUZD 3LOWA 4Y4HB 4NUGH 5AG9A 1CLZL 4O2CA 4PGCB 1I7TA 4BJLA 1CCZA 1X5FA 3WNPA 4X6DE 1CL7H 5M94B 1IKFH 2ZSVB 2C7UB 4WWID 4QHMB 4PBVC 3EOTL 4OQTL 1K4DA 1YDPA 3H2WA 2Y07L 4QO1A 2XN9A 4XNZC 5AZ2H 4JPIA 3REWA 2J6EL 3OR6B 1MLCB 1VENA 4WO4C 5I1CH 2G5BA 1OAKL 4LCWB 2WP3O 4K8RD 3BDBA 4QXTB 5B38A 1OW0C 1AY1H 1AD9A 5E9DA 4AJ0A 5IUSA 4F15C 1EO7A 2GJ6A 1JWUB 3KWWB 3TA3A 4HK3N 3MNWA 1H3GA 4JLRA 1MELA 2QHLA 4EDXA 1FRGH 3P9LB 5ADOL 4WW1A 3PP4H 4LRIA 1JF1B 1A7PL 2EYSB 2M8XA 3D18B 1UWXH 4X6BA 3P4OB 5GIRB 1RIUH 4NM4H 1C16A 3UC0H 5IB2B 1IQWH 4NQDA 1QA9A 3AAZB 1CL7I 2IFFL 4LDLB 4O00A 4HG4K 4QWWC 3MUJA 4TUOB 3RIFK 2O61A 5KVEH 4Z9KB 1B0RA 4M7ZC 4NBXB 4KK6D 5C08D 2DQTH 4C83B 3MSPA 1OF2B 4NZUH 4UTAL 3L3KB 4X7DC 3CVHB 5B4MC 1BM3H 1XGUB 1L0XA 3ARTA 5C6TL 4JZOB 4L3AA 1FFPA 2FGZA 3OPZH 4XNMB 4YNYA 1IMHC 1CXFA 4WI2A 1I8MB 3QFJE 1V7MH 4RGOL 4YBHA 3SDDA 1IGJB 2IBZX 3VXSD 5GSVB 3VWKB 4PRID 1VKXA 2YR3A 3O2WL 5H2BB 1GPOH 3WEXB 1KOAA 4H5SA 3LEYH 4RRPG 4MA1B 3MA7B 1IGFL 3BN9D 4HWBH 3HG1A 4HPYH 5CZKA 1LO5B 2VLKD 3WJLA 3ARSA 2AKRA 4GBXC 3ULVH 1ZGLA 4JANB 1XFPA 4P2QB 3OKDA 4GKZA 3BSZH 1D3CA 2Q6WA 3MRRA 4Q9QL 5F72S 1N6QL 4PRAB 4HUMB 1LE5A 2Q1EA 4PJFE 3WFBH 1S7SA 2UZIH 5HY9A 4R0LC 3QIWB 4L4JA 3FQXA 3EFFB 1FZKA 4YGAB 4U31A 4KGJA 4XMLH 3HUJB 1JNLH 2D4FA 3WSQL 4JVWA 4EN3A 3P3YA 3EYFB 3OAZK 1E4WH 2VLJE 3V5HB 4LQ1A 3PUCA 5FUZL 5FYJE 1MIML 2QHRL 2I27N 3SQOH 1CFSB 4X7FC 3CZFB 1Z0MA 4OFKA 4F7CB 2APWA 3MOBH 4MQSB 4WVRA 2HYMA 5EBLB 3Q5OA 4PRDA 3IJHA 5F7EL 4P99A 3HC3H 1D5MA 1XIWB 2XACC 4NUJA 4HV8B 4S2SB 3GRWL 4LHUA 4OCSH 1EHAA 4KJQD 1GC1C 3FAXA 4LKCB 2DI9A 4ONFH 3HE6D 3VI3E 5IWLC 2DLTA 4GRLA 4POUB 3ARGD 5CJXA 4NYLA 4XC3H 4P2RD 1NLBL 3BUTA 4MD5B 1T04A 5EO0A 3RDTB 4HG4J 15C8L 4YWGH 3BIKB 2HKFH 2C5DC 4MNGA 3ARBD 2KBGA 3VXRA 1RJLB 1JYWA 2IALB 4N68A 1FZMA 4RX4A 5I1IH 4PTUA 4YAQA 1TJGL 4B7LA 3B2VH 4GRWE 2QSVA 4MD0A 3SCMC 1I9IH 1CGUA 4M5YH 2CR6A 1IEAA 4RAUA 4F2MA 3OX8B 1IC4H 4HKJB 3CVHL 2ORBH 2J12B 1PKQE 2X1OA 5BJTB 3EOAB 1RUQH 1CBVL 4IDJL 5EIIA 3BP7B 4MJ6B 2AJSH 5I1GH 3DGGB 5FA4B 3NZ8B 4QOKD 2IQAA 1T0NA 2AJUH 3FQUA 3GHBH 4FP8H 3RBSA 4FG6D 2E6QA 3FN3A 3KPLB 1I8IB 4L4VA 4IRJB 4OZ4B 3MA9H 3TT1H 1UA6L 4HDIB 3V9FA 4JFPA 4Y16B 3O2DL 4GSDH 5E5RB 3MV8A 2O26U 1QEWA 1MJ7L 1OTTD 3V5DA 5HYQB 4L3CB 2NZ9D 4M62H 5K9JL 4NQXB 4YDLB 1XGQB 1KGCE 4X99B 2FJFA 4X6FA 4O9HL 2HP4A 1GIGL 5EU5A 5IR1B 1SVZA 2G75A 4L8SA 4ZNEA 2ZUQB 3C08H 1G7LA 2X4UA 2AK1H 1U8NA 4OM1H 1U2HA 3C5SA 4NPYB 3TNMB 5FYLL 5KZCD 2L0DA 5C2UB 4X80L 1SJVA 4ORZC 3IRPX 3EO1B 1OY3B 2G2RB 5TPWH 1I4FA 4CBPA 2DMKA 3G5YA 3B5TA 3OR7B 3W11C 4ZMAT 5KAQG 2HRLA 1MUJB 1INEH 3KPNA 5JOEA 3W81A 2NPLX 4HIIA 5DJ0A 3E3QE 1LO0H 1F6AB 1MY7A 5GHWH 4UINL 5D96C 5C6WH 1H3TA 1Z9MA 3T2NL 2HFEB 4X4YB 3QUXC 2NXZB 2PR4L 4FQXA 1FJ1A 4X0KA 3T77A 3PDGA 12E8H 1DR9A 4DN3L 1CE6A 3SE9L 4MD4B 4R4BA 4W6WB 1BLNA 1T3FB 2GK0A 4GUPB 3ARYA 25C8H 5HYSA 2R0KL 2DJSA 3FQNB 4RWYH 1ZA6A 3Q6GL 2CKBB 5MEOA 1SY6L 2I5YH 5SV4A 3CFCH 4TVPL 3EDDA 2X4QB 1HYSD 5IBLD 5DRNB 5F1IA 1KF9B 4R2GD 4D0BB 5FKPB 4Y4KB 5EBWB 4OTXH 4HBCH 2A83A 1S5HB 3GHEL 3OJDA 5DLMH 2LTQC 2GFBB 5KW9H 4L29A 1T7YA 4GMSL 1GGBH 1KIUA 1HHIA 3N9GH 3BISA 4XNYL 4BYHA 2NCMA 2Q87A 3PQYB 5DHYB 4ELKB 2OZ4H 3U9UB 1ZOXA 4PGBA 3TFKD 2DMCA 4RIRA 5FA3B 3MJ7B 5JOPE 1G7QA 5DJ2A 5E2WH 1U3HA 3WJJA 5ACZA 4GS7C 4XHJC 4DZBB 4LRIC 4FZEH 1G6RA 4DEPC 4PJBB 2FBJL 3PDOA 4FQLL 4LEXL 1AJ7H 1Y6NR 1FN4A 1RK1B 2ICWJ 3WIIL 1UXWB 1VEPA 1JHTA 3BKCL 1FPTH 3NN8A 1K8DB 1ZANH 5HHPA 4A6YB 2W0FB 1JGUH 2C3XA 2CDGA 3BMVA 3EDJA 2YXFA 3IS0X 4J3OC 3VG0H 1U8IB 5I17A 5EC2A 5IMKA 1T20B 4X9IA 3D0VA 2VDKL 4P5KA 1KUMA 4HUKB 1D5XA 3MQIA 4G8GE 4OCYH 1AGFA 3DGCR 2ESVE 4OLYH 5I8EB 1MEXH 2DIJA 1KTDB 2EDOA 5J6HB 3Q0HA 1K5NA 1MREH 1HKFA 4M6ML 1V5JA 2P8LB 2RB8A 2YZ1A 1NGXA 4ZPTB 1LDSA 4Y1AD 3SDDC 2E8ZA 3AREB 1KT2A 3OKEA 3RWJB 2J2ZA 1LEKB 2IBGA 3BH9B 3BP6B 1QVOA 4JHWH 1FLTX 2VLJA 3KYOB 5GJSL 1G7IB 4OLWL 5C0GA 1RIHH 2AV7A 4LBEA 2EC9T 4GT7A 4YDVA 1MHEA 1IJ9A 5D1XA 4ONGH 3GIZL 2DYPD 2EC9U 3WJLC 4XGZB 4DGVL 3PE9A 1SQ2N 3F62A 4PGDA 1DLFH 2EDTA 2WW8A 3DJ9A 1JPSH 3L7EA 4K3JL 4K9EL 1X44A 1K4CA 1YC8A 3ZYZA 2ENSA 3FOMA 2NY7L 5TJWK 2B7DT 3VFOA 2NY1B 3IFPB 4N9OB 3RQ3A 3NCCB 4I48A 2CKBL 3MNVB 1KFAL 5DUPH 4JQXA 2FNBA 1TETH 3BO8B 5KVDH 3V5KB 1I3UA 3TIEA 3MACL 5EN2B 3OWEA 4CNIB 5A3IC 4XPFH 4OD1H 4ZFFA 3EDEA 5GGRY 3S8WA 1NMCB 3MRFA 3QCTL 2PN5A 4ZPVB 3EYUH 4JCLA 5D9SA 4HWEH 4ZD3H 1IBGL 4HULB 5T5NG 3TJHC 5GJTH 5EDXA 3MV7B 3T1WA 4QT5B 3U36A 3LKSB 3IU3A 4APQD 4JFYB 2DWEA 1HQ4B 1PKQA 2BY2A 4U1LB 2C1PA 4KTDH 7FABL 1PY4A 3N1FC 4HEME 3DO7B 4NZTL 2R4RL 5JPNB 3Q2CA 4GRLC 5CJXC 3C5ZB 4XX1E 1C5CL 2R8SL 2DMBA 4HHAB 3GSOA 3STZB 3RVVC 1JI1A 2X1WL 1UQSA 4Z0BL 1KIRB 4BQ8A 3ULSB 1EFQA 3SE8L 1X5YA 3T08A 3E6FB 3U46B 4ODHH 4K94H 3LY6A 1I7RB 3K1DA 4OZGE 1YDPB 4A6YL 2A9MH 3UDWA 2ATKA 3AROA 2C4XA 3LKQB 1B0GB 4ZFGL 3RKPA 1FVEB 4YLQT 3RJQB 5B38B 1YMMB 1AD9B 3MLZH 2VLMD 4RNRA 2RQ8A 1ROWA 3L95B 3KHOA 4RFNC 4N0FA 5KJRL 5FYJH 3TA3B 1KENL 2F54E 4PYHA 4HPOL 1T80A 3MNWB 4MZ2A 1WFTA 1DZBA 3WUWB 5HHNB 4OLVH 4PGEA 1U8KA 3GSVA 2XNAA 3U2SB 3NFPA 4LPWA 3FN9A 3G6JE 2H9GB 1JTOA 3QIUA 4XH2A 5FYLD 4JFZH 4RRPA 3F7VB 4HH9B 1ZHNA 2CDFB 3EUUA 4KH2A 5FUCC 5J7CC 5FUOL 3KPRD 1FYTA 2CJUL 3NCEB 5C1MB 1JMZA 2DQDH 1EEUA 1DUZB 4JPKH 3P4NB 4O4YH 3R4DA 2M2DA 1W72A 4EXKA 1GGIL 4FFWD 3VFUA 4PJIA 4C54A 5BCAA 3GGWA 1DN0B 4YHKL 5TH2A 3MOAH 4PJIF 3TJEL 4RZCA 5GS1C 2P5WE 1NGWA 1FFRA 2ZCHH 3O11A 4NDMA 3SDAB 3ZTJH 5HDQL 1LE9B 2NNAA 4CU8A 3O2VL 4G8EA 3VFSA 5EZIL 4X5XA 5J57B 1CE1L 4QRUA 3U7YL 5A1AA 4P2OD 4JRYE 1RY7B 5DWUH 1WTLA 3HG1B 3BQUD 3LHPH 2XTJB 1HHKB 2YWYA 3RDTD 4HT1L 4LLMB 2HTKC 4QHUA 1T66C 4OBSA 2AKRB 1F58H 4ZS6C 4FQXC 1A2YB 3OKDB 4M1DH 3MC0A 2XWJA 2Q6WB 1PZUB 1BVLA 5EG6C 5EUOE 5C0IA 4AIZA 5CZXC 4X6CF 1S7SB 3D85A 4M9PA 5T1DH 5T3XE 4HC1A 3WV0A 4JJ5B 2PYEB 4LLVB 5DUBA 1CZ8H 2DLFH 5EIQA 1FZKB 2DAVA 4YPJA 5KG9B 1A0QL 1RZ8A 4KUZH 1EIBA 4PY7A 2V7HA 2PXYA 1YN6B 4LSRL 3MLUH 4NO5B 1JNNH 5FM4A 4EN3B 3IXAA 3OB0H 1FVCA 3HE7B 4KXZH 1LEIA 1ZE3C 2VNCA 1QSFE 1FORL 3MRLA 1YEDA 2ITCA 2I07B 4F37F 3CJJA 5JW3L 3C2SA 4G8GA 3TBYA 5CCKL 2ESVA 3X13A 5HYJA 3DXAB 5I8KL 2Y5TB 1CU4H 3CX5K 4F57L 1D5MB 5GGTH 4P46B 2EDLA 4G8FA 4M5ZH 4NUJB 4OGZA 3SE4C 1RSFA 4OLXL 2LFGA 5I1DB 3OAUL 4PYGA 2VISA 3WJJC 1QUNA 1U3HC 5I1KL 4MCYB 5IVXE 2A6IA 4JR9L 4NWTL 2NY2B 1TJIL 3EO0A 4QWWD 3O3DB 5AZEL 3WIFB 5IGXH 3I50H 4NYLB 1ZVHA 3QUMA 2RGSA 3WMSA 1IFHH 2DQUL 3CU7A 5LGHL 1F13A 4MNGB 2R39A 2D4DA 2FR4A 3B9KA 1FZMB 5B4MD 2DN7A 4PTUB 4KXZI 3WNNA 3Q6FA 1HH6B 2D7TH 2JCCE 3QXUA 1QTYT 1KXQE 4M1GL 4LPTA 4QGTA 1NBQA 3GKWL 3HI5H 2A77H 1ZTXL 1IAIL 4HXBL 3D6GA 5GZNC 4TSBL 3DX8B 4K94C 4HUXA 2F15A 1HXYB 4PRHB 1ZHBB 4LEOA 1P7KB 3SGJC 4RAUB 4F2MB 3JTSA 4UNVA 3MRNB 5DTFA 2KDGA 3LQMA 4QHKJ 3VI4F 5J11C 3MYJA 3S5LB 5JZ7C 1FO0B 3UO1L 4GAGH 2R2BA 1N3NB 4XNQA 3IJSB 3BH8A 3HC0B 1T0NB 1UM5L 4GBXD 4DAGH 3MRPA 2PETA 2YXMA 3TEUA 1EV2E 2B4CC 5LGJA 3UTTD 5ESAA 1A1OA 5KS9E 5MENE 5AYUL 3E1F1 2P7TA 2RFXA 1FGVL 2NTSP 2D03L 1S78D 2VERN 5IKCA 2ARWA 1QEWB 3GSNH 3O0RL 3RWHB 1EGJH 4LP5A 5CS7A 1IC5H 4HUVA 4XBEH 5KAQF 1MAML 4NN7B 4UU9A 1BF2A 3LN4A 4X6FB 2PYFA 1RUKH 1S7VA 1A6AA 4UAOC 4L8SB 4V1DA 1M05B 5C2BL 1ZS8A 3FO9A 1MSPA 1HKLH 2Y5EA 1WFNA 1G7LB 2X4UB 4PBXA 1ZSDA 4FHBD 1JMXA 3GSRB 3WHXA 4P23B 3BPLC 3EYSL 4PJ5D 1LO4H 4ODXA 3L5HA 4P4KB 1JZ6A 4TQEL 1KIPB 43C9A 1CFBA 1M6OA 3SOBH 5CILL 1NGYB 3CX5J 3TN0B 3DVNA 3G5VA 2IH3A 5JTWA 3RIAK 3HRPA 4M00A 4JY6A 2DKSA 4OGAC 3SJVD 1DE4B 4L4TE 1OWRM 2DBJA 1MFCL 1FJ1B 4X0KB 2GY7B 3DX6A 4YUEH 3H9HB 1FLRH 4RA3A 4PUBH 4PRNA 2GK0B 2VR9A 5HYSB 2DICA 1R3JB 4ZUTA 1NJ9A 3SCMD 1L7IH 4GG8A 3VCLB 4OI9A 3TV3L 1VFBA 1JL8A 3L3JA 4G6FD 4XBGA 3KLAA 5F1IB 1EFXA 2CR3A 3G6JA 3BYTA 3ILPA 3PHSA 3KPSB 5HHQA 3QCUL 2F53E 1RUPH 3U48A 3EFDH 4F9LA 1DANT 4R7DB 1YPZE 4P4RB 2YPLD 3D9AL 3PF2A 3UDWC 2OR9L 5EZJA 2HFFB 4V2CB 1DANU 3D39D 4MXWL 5DF0A 1U95A 4RMUA 3BGAA 5CSBA 5BRZE 3G6AB 4TUKH 3DETC 4RIRB 1OB1A 1HZHL 3VD7A 4EI5A 5C6PB 1GXEA 4U1KA 4W81A 5EU3B 5TF1H 4JY5H 2IFGA 2CK2A 1U41A 4B53A 3CXDL 1H8OA 2A2QT 4X9BA 5DJ2B 2A73A 1MQKH 4N9GB 1AI1H 1FO0L 2W0LA 4OZFG 1W8NA 3L3DA 3PDOB 5EA0H 3RAJH 4TNVF 3MBEC 1EBAA 4QRSA 4JRYA 1FN4B 5JMOC 1BX2B 3UJTL 3E3QC 5H94A 2NTFB 4CADB 4LVHB 3K2UH 5HHPB 4R90L 4KVCL 5LCVH 4Z5RB 2CDGB 3PWJA 4PJGE 3DMMA 1FNEA 1G7JA 1VSCA 1NBZB 1HXMA 3QO0B 5I17B 3VDBA 4GW5A 4QRQA 5IMKB 4H20H 3V0WH 3D0VB 5C0CB 1NGPL 4MJ5A 3IGAA 4RMSA 4FQHB 1D5XB 4IIQA 5I15L 1AGFB 4P3DA 1XF5A 5SX5H 1UJTA 3QHFL 4UNUA 2HN7B 3H0TA 1LDPH 5DHVH 1MQ8A 3MV9E 4MQ7A 4FQ1H 1U58A 1I1YA 4NP4L 3W11D 5L7XH 2XRAH 3FQRA 2OK0L 3LQAH 1V3JA 4X6EA 3GMPA 1XR8A 1ETZA 5DJ6B 2Q3ZA 4IRSA 1J0YA 1KCLA 4NKOB 3UZEA 5J12C 4PREB 5I8CA 1QSFA 1O7VA 3MUY1 5C0GB 3QUXD 3ARDA 4Y89A 2P49B 4U6YA 3F12B 1EJOH 2C9AA 4OD3H 3SKUD 1CLCA 4XXDA 1V3MA 5D1XB 1VADA 4ZS7H 4DUWA 1NDMB 3MCKB 4FFZL 3S3PA 2JTDA 1N64H 3O8XB 1S5IL 4I18B 2YD6A 4PGDB 4YHOL 4HKBA 2MOVA 2IEPA 3L7EB 5FKAA 4RDQG 5TQ2H 2V2TA 5IVXA 4YK4B 3KR3H 4BZ1L 3P9WB 5CLTA 3TNNA 3NA4A 2GAZA 4U7MA 1MCNA 5D7LE 3FRUB 5C0NC 4JO2H 1NPUA 5HJ3A 3ARWA 1FNSH 1R6VA 3IDXL 3UTPE 5I1HH 1OAUH 2XN9D 5F7WC 5DJYB 3PWVA 2F19L 1DQDH 3QXDB 2PXYC 1R0AH 2MWCA 1OSZB 1IARB 2F74A 2BRRH 4Z7NE 2CRYA 5E9DD 1G7MB 4BUHA 2GJ6D 3AU1A 3WLWC 2Y6SC 3TA3D 3HCVA 4MJIB 1YYLL 5HPMA 3RTQC 2AJZB 4NN5C 4XHJD 3CC5B 5EPMA 2DWEB 1PEZA 1Z6JT 2A74A 5F9WC 2PUQT 2C1PB 1YNKH 3DI2B 5JHDB 3LZFH 4XPBH 4HGMA 4NQDD 4UOJA 3FTGA 5CEXA 5I0ZA 2BSRB 1J5OL 1H0DA 1RULH 1F90L 4G5ZL 3C2AH 4LIQL 5KS9A 5C0JA 3TYGH 2V5TA 4R4NC 3H7LA 3B9KC 2OI9C 3ZL4H 3O3UN 3S96A 5KS9F 3ARFA 3C8KB 2R1WA 2V7NB 1MCRA 2NX5E 1BFOB 2ZKHL 3UTSE 2XXMB 1WEJL 2VDMH 5GISL 3U7AA 2ATKB 2O5ZH 3HC4L 3SDDD 1MCFA 3WIHL 3LMJH 3NIFE 4IRZL 5TQ0L 3FN0L 3U0PB 4YHZH 1T22B 4AL8L 2C3VA 1A6VL 3UJJL 2X4RB 5F1NA 5INCB 1I3RB 2R1XA 5CIPH 3HG1D 4ETQA 1MCPL 1YEHL 2XTJD 1ZWIA 4Q9RL 5J3HC 1YNTA 5F89B 5HHME 1JF6A 3I3BA 3KLDA 1ACYH 5MI0C 5D71H 2MHAA 3PGCA 2VL5A 5DGRA 2XNAB 4Z77A 2YHGA 3DYPA 3NABH 5IW3A 1F4YH 4KRPB 3MOQA 4XH2B 3QIUB 5ERWA 1ZHNB 4HS6A 4MDJB 4EQ2A 1LQSR 4H26B 3ULVF 3UROR 5DJXA 2GW5A 1OTUD 3BZ4A 5A3ID 3LEVL 4OFDA 4EN3D 5SWZE 1V3KA 2IANE 3PJSA 5JO5B 3RJDA 1OLLA 5ISZE 1F6LL 4OZHE 4Q7DA 5GRUL 1FDLH 4RZCB 1CTNA 3NVQA 1EMTL 2EYRA 1RFDH 2F53A 1R5WA 1NGWB 3UX9B 4NDMB 3D3VE 3ZHDA 2J8OA 1YPZA 4G8EB 3GB7A 4HWUA 3VFSB 1PEWA 3SKNB 4NKDA 1DQLL 5CJOH 4F7PA 2ZJSH 3OKMA 4LHUD 4XP9H 1NL0L 4X5XB 4NJ9L 4QRUB 3PGDB 2H2PC 2NY2D 4OM0L 3MXVH 1X4XA 2EEAA 4MAYC 5GGTL 5C0AA 3SDXE 1GH7A 4KPHL 4RAHA 4NJAH 5C0FA 4GRLD 1MWAH 1PY9A 1ZHKB 2JK5A 1A7RH 4K3EL 1BJ1H 3G5ZA 4ODWB 4X6CB 1EH9A 3RVVD 2HVKB 3VXRD 3ZTNL 2XWJB 1RUMH 3IF1B 5BZDA 1C5BL 1BVLB 3IS1X 4RX4D 2BVOB 4X8XA 1LMKA 5IM7B 1K3ZA 4KDTC 4AEIL 4AIZB 3MJ9H 3ZT6A 4Y2DB 5T1KA 5FM5M 1T7ZA 1OAYH 5DUBB 1G0YR 5TE7H 5BV7B 2Q86B 1WVZA 5C8JA 4PY7B 5C92A 2V7HB 3VW3H 2BNQE 3BWAB 3GSWB 1HIML 2JB5L 3GSUA 4F9LC 4X9GA 4PJGA 5E8DH 4EI6B 4NNYA 4ONOA 2XG4A 2XKNA 5D7JA 1XH3A 3UYPA 1AQKL 2NW2A 2P1YA 4PJGF 1GGTA 1YEFH 1A5FL 4U3CA 5IB4A 2AJYH 3WFEL 3TBYB 5HYJB 1WBZA 3RL1A 3X3FL 2XQBL 3MX0A 4EI5C 2CLVB 2KQMA 4GQ9L 2WQRA 1IT9L 3DECA 3W9DA 4L4VD 1P7HL 3VXTB 2A6IB 1P4IL 5IFJA 3MV8D 1RK0B 3EO0B 2R9HC 4WV1B 4RISH 3P77B 2W9LA 3QUMB 5DURB 5F6HJ 3VA2C 3BX7C 4XWOC 1IAMA 5BS0E 3KYNA 3MBXL 2FR4B 5I1LB 2WANA 4RSVA 3DMMC 1ZKAA 1XF2A 5I9QB 1NFIA 2XWBB 4Z7QF 5KVFH 3QEQB 5I73B 1JGDB 5IBUG 4MYWB 4Q6IA 1NGQL 2OJEA 4L8DA 4IIQC 2OS7A 4HUXB 3IXTA 1RVFL 4LFHD 4KKLC 1CFTA 3NACH 3QIBA 3WKMH 5IQ7H 1I1AA 1SMOA 4C58B 5IOPA 2FIKA 4K2UH 1EO5A 4PR5A 3FO2B 2XPGB 4GRMA 3ZKNC 3WXVL 1G9MH 4KJYB 4IRSC 2XOTA 3AMLA 3U4BL 3R1GL 3MJGX 3FO1B 4OZIE 3O41A 4E42B 1A6WL 4XMPL 4HJJL 1T66D 4HK0A 4ZS6D 3MRPB 4FQXD 3ARDC 3T4YB 4NSKA 4KHTH 1JZ4A 5LGJB 1MAKA 5GGQH 2BNRB 4ZYKA 4ZDHA 1C7SA 5I2IA 1NCUA 2HH0L 4OAWB 1JZ2A 1H9VA 5CZXD 1T5XA 1WISA 3GMLA 5I1EL 5DRWB 2YSSA 3VWJA 5FHAH 5FYKE 1YUHA 3DYMA 2VXQL 1RD6A 2YKLH 3F8UB 3QG6A 1XAUA 3ULUE 2HAZA 1L7TL 2WLZA 5HYIA 3I3DA 1A6AB 3Q5TA 5FB8A 1KCSL 2BX5A 2EE6A 2OLDA 4RGMC 4IOIA 2D7PA 4MLSA 3VXOB 4XCCH 4LHJB 1E6JL 3SE3A 5D72L 4U6XB 5IB5A 3NFNB 1CVSC 4CN6A 1KJ3L 4XP5H 4G7YH 4LCIH 5F9JA 3LKNB 5BV7L 3NCFB 2NX5A 4OIIL 4WNQA 4NO3B 5F7YC 8FABA 4N0CD 3B83A 1Y18A 4LASL 3JV5A 4OF8A 3STLA 4J7RA 1U3HD 5MHSE 4JPWH 1MHCB 3G5VB 2IH3B 1KN2L 1MCLA 3CFJA 2V5YA 5E70A 4MHHG 1WZ1H 3D25A 3RVXC 2VXVL 1T2XA 1YYMH 4GFTB 1VA9A 4HUWB 1T4KA 3NIFF 4G3YL 3HB3C 4FQCL 5AWNL 1UM4H 1RMFL 4JREC 3UZQA 1VFOA 4WFGE 2VE6B 4JHZA 2HLAA 3UTZB 4UBDC 5DMIL 1DDHA 4ZUTB 5DMKA 4WUUE 2GCYA 1J0IA 2DQJH 4OZFA 3KLAB 3QUML 3VXPB 5GZND 4Z78A 3ARFC 3BXNA 5HHQB 3EJYD 2VWEE 3JWDC 3OKKB 4HAGA 1VPOL 4P57A 4QRPE 4D0DB 2VIRA 4YO0A 5JZ7D 2XWTA 4UT7L 3UAJC 2VLJD 3U6RB 3F5WB 5ISZA 1BFTA 4NRZA 2KZ1B 4OZHA 5F96H 3CDCA 2PW2B 2BSSA 3E8UL 5D1XD 4NNXA 1GZQB 4OF3A 3NIGF 2ZUVA 5J89A 5GRWA 3V0AC 2A73B 3F6LA 3E0GA 2YD7A 4RBPK 2B0SH 4UI2A 1FG9C 2P46B 3RBGA 3MJ6A 2VDPH 5F9OH 2B20A 3CLEL 3GMRB 5DK2B 1TQCC 3SDXA 3DVIA 3ZT5A 5H94B 1D5IH 5AUMA 3VJ6A 5L2KE 2YD5A 1EHLH 3IDJB 3SDXF 1D5ZA 1UEMA 1KB5H 4R3SA 3WNKA 4GW5B 4RQQA 4C4KO 2HKHH 1ADQA 1JGVH 5MEPB 4MJ5B 3M1BB 1QFUH 2HJKA 3KXFB 4MA8H 4D9QE 2CK0H 1N7ML 1IEBB 2E9WA 2KKQA 5L0QC 2VQ1A 4V2BA 1KJMA 5DJAB 1P53A 2GY5A 5D93B 1YJDH 2VZTA 4GJTB 4RDQF 1HEZB 2DM4A 3BE1H 4X6EB 4JDVA 4OSUL 4OCRH 2VLLA 5FO7A 5CLWA 3ALXA 2H3NB 5F6IC 4JQIH 5C9JB 4YEEA 3NCJH 2OM5A 4OGAD 3FT4A 1TTUA 3LSOB 3NFSL 1G9MC 2CLRB 1J05A 4S1RH 3UYRL 4U6YB 2OTPA 3V4VL 5F7NC 1TCRA 1KELL 3TBSA 4Z7WA 5A43C 2X4PB 3QA3B 2E6PA 1IZKA 2NXYC 3IRZA 3TZVA 5BMFH 4XCEA 3HMXH 1S7UA 5GGVH 1C8PA 3EW3B 2NY4C 2FL5B 4Z7WF 1ORSB 4E5XB 3HZYA 3T04D 1T0MB 1T5WB 1D6VH 1S3KH 1QFWL 2EH8L 1INQB 1LK2B 2EKSB 3TNNB 2NY6B 4MWFA 4Y7MA 5MERA 3X3GH 2H1PL 3FB6A 1RZJH 1V7NL 3U0WL 3ETBF 4F7EA 4QNPF 1KGCD 1OOAA 3ZSTA 1A14H 1KC5H 4YHPA 2CIKB 3PHQA 4YHLL 5BS0A 2PTUA 1RZ7L 2CGRH 1I9RL 3O3AB 4DGIH 2F74B 1VFUA 4ZNCD 5E6IA 3LN5B 3TM6A 4DN4L 1PZ5B 5AEAA 2YA1A 1G7HB 4JO1H 4O58H 4OGYL 2VXUH 3HCVB 4RGNE 4LLQA 4NKQB 3MXWH 1NEZG 4JHBA 1I7UB 1JZ5A 2OMBA 2YC1A 3OTTA 2OP4L 4ZUUA 4F37K 1X5JA 1YEGL 2GSIB 4LCYB 1NUNB 4LVNC 3L6FA 4KV5F 3S36L 1CR9L 2AI0L 3NPZB 3TWCH 1TDQA 3FTGB 3QIUD 2A6JB 1QSEE 1AXIB 1CXLA 1M71B 4NKIH 3GBLA 2VN7A 1FYTD 3QNYB 4P2CG 3CVIL 4IS6A 1DBKH 5BOZG 1KJ2A 1PSKL 5D1QC 3IFNL 3FOLA 3S36X 3WNLA 5C0JB 1A3RL 4D3CH 4HKZA 3A6BL 4YIQA 3S96B 1MCDA 1CLYH 4U4BA 1KEML 2EEBA 2FEDC 5IK3A 1T1YB 5E56A 3AY4A 1ZGLP 4GMTH 4Q6IC 4KAQH 2MJWA 3JUZA 3HR5A 3I75B 1ORQA 5F1KC 3VXUB 2HG5B 3OL2A 3T8XB 1J0HA 4JY4A 3K3QA 3EZJB 3QIBC 1BQLH 1OAZL 3EZ8A 5AAMA 1RHFA 3D69B 4X83A 5C0BA 3PGFH 3IDIA 3OF6A 2H6PA 1IE5A 3QUYA 1S7RA 4K7FB 2CIIA 4XP4L 3SDYL 3GEWB 4X5WB 5IESH 1QLRB 4ODVH 1ZWIB 3W5MA 2QTEA 5ADPL 1M4KA 4OCXH 1X5KA 2AJVH 5JOPD 4PLKC 4M6OL 3PNWB 4X7TA 2UY7A 4UILH 5DI8A 5F21B 2MHAB 2VL5B 3FL7A 4L9DA 3D85D 4LVOB 2IPUG 1CS6A 2ZUWA 4NWUL 4QTHB 5C0ND 2V2WA 1R3KB 3VWJC 1UCBL 3IFOA 2FJHA 5A2LH 1CFVH 2PXYD 1FV1B 2JJSA 3KG5A 1UM6L 5DD3L 1AXTL 2NW3B 1KCUL 3QSKB 4DW2H 5BQ7B 1TCMA 1UXSA 1QRKA 2EDFA 2XV6B 4WUUA 2VDRH 3WLWD 4F7TA 2Y6SD 2PF6A 1U8JA 2H32A 3MO1A 4NUGL 3SE3C 2APXA 5I66A 4G8GD 1BJMA 2ESVD 1S7WB 5HYJD 4UNTA 1CL7L 3V6FB 4LLAA 1H5BC 3VDCA 3Q3GA 1UJ3B 3D2UB 4WHTB 3WFHB 4QRPA 3WBDA 2D2OA 4NKDB 4XBPA 2EXWD 1SJEB 1YA5A 4U1HA 4MB3A 1R3HA 2ZOKA 3ROLB 3GK8H 4OD2A 1F45A 1JZ7A 4G6KH 2JK5B 1HILA 1I75A 5DURD 2W65A 5J1TC 1SYSB 2HT3C 2ICEA 3G5ZB 1SJHA 4GXUM 4PJCE 2W60B 4R4ND 3I2CH 3QJHB 3ZSSA 5BZDB 4X4ME 3B9KD 5ETUA 5ESVA 2DL2A 4YHNB 1FRGL 1QRNE 2HJFB 4FMKA 3PP4L 1H3WM 3SKOA 5DSCA 3TGXA 4TRPH 1J11A 4R26L 5EBMB 3X14A 3LN9A 5JA8B 3O45A 5FYKH 4NM4L 1HQRB 3UC0L 1RZJC 4LSSL 4W6XB 3GSUB 1FL6A 1WT5A 3U9PH 3KJ6L 3TLRA 5D7JB 2DQTL 4HIHB 1JPGA 3MFFB 2PTTA 4J3VA 5E99H 2HJLB 1DFBL 1WBZB 3RL1B 4WUKL 5J3HD 4IHOA 3MJ8A 1Q9OA 2DF3A 3QH3A 4Z7VE 5SX4I 5FGCB 3OPZL 1TLKA 3MLTA 4L3EB 4DVRH 5CJ8A 1NC4B 3MRBB 3FJTA 4OLZH 4MJ4A 5E94B 4ZUVA 4LAQH 2Z91B 1AIFB 1FC2D 4U1GB 1ITCA 1GPOL 3LEYL 1XR9A 1IGIH 4HWZB 4ALAH 4R8WL 1UG9A 5IP4A 1KBGL 4G6AC 4P2RE 4HPYL 5ACMA 4LLDB 1P6FA 4V1DD 3REVB 4YXKH 5SWSB 1EEZA 4Y5YA 3P11L 3ULVL 1INDL 4XB8A 1XF2B 1NFIB 1LNUB 3BKJH 3WCYA 3IDMB 3CSPA 3H9SA 2BJML 4POZD 3BSZL 4FZ8H 3H3PH 2LAGB 3FMGH 1H3PH 1D7FA 4M7LL 1NKRA 1I1RA 4XMKH 3OJMB 4Q9CA 1Z9OA 3CMOH 3OSKA 2BERA 5FFLA 1WFOA 1JPTH 5D7IE 4TYUA 1I1AB 4LLWA 2FIKB 5CP7A 3F7YB 4PR5B 3LH2H 1QOKA 2H2PD 4GRMB 4ZFZA 3PP3K 4RMVA 4DKEL 1JNLL 5FO8A 5TFSH 3G9AB 4M7JH 3BWUC 3RY4A 5EFIA 2Y7QB 1CG9A 2QSCH 4KHXH 1GHFL 4HK0B 5IB3A 3EJZC 5KSUA 5FDWB 4G80A 3CCHA 4ZDHB 4KY1H 5I2IB 4G43A 4KK8C 3TZVC 1JPFA 3IDYC 3BKMH 1T5XB 3BPOC 4JKPH 1KTLA 3QQ4A 3JWOL 2YBRA 1YUHB 2FECI 1DVFB 1P5UA 3FQTA 4J3TA 4OCSL 1EFXD 3F6IA 4CMMB 2PKDA 3QG6B 2DS4A 3WL9A 1TQBC 4L8CB 1QSEA 1VDGA 3KNBA 3BPCA 5BXFA 5F7DA 1AFVL 2EYTA 5IFAL 4XC3L 2FEEL 4DUXA 3ILQC 3DVGA 4PJEE 4KKAC 2HKFL 4J2XA 3GJFK 5CZVL 5IB5B 4O51B 1A6UH 1PG7L 2APFA 5L8KB 4G8IB 5I1IL 2X6MA 4N0UE 4EI5D 4UQ3B 4XCYA 3B2VL 3F7QA 3RX8A 5DUMH 2HTLC 1NAMA 1I9IL 5IIEA 2W91A 2GITB 5IBTH 1Y18B 3DSFL 1PG7X 4S0SD 4ELMF 2O5YL 2QLVB 2R9HD 4FTVA 2JLLA 1NBYA 2R0ZH 2QQNH 1IC4L 4XZUA 2ORBL 4DCQA 4JRYD 1OP9A 4NM8H 2P44B 5DJDB 3WXWH 1RUQL 1QBML 1VGKB 5HPOA 1S7QA 5FAAA 4XWOD 4M8QA 3EOBB 4EUPH 5T33H 2AJUL 3DMMD 3QCVH 2X4TB 3GHBL 4FP8L 5DMKB 2X44D 4M8VA 3RX5A 1CFNA 2GCYB 4OZFB 2WK2A 2CLZB 3MA9L 4JFDB 3TT1L 1FNHA 4KKBD 5JW5A 3B3IB 4QHNB 4YQXH 5CD3B 5T3XD 1R24A 4K07A 4KKLD 3O6KL 5F44A 1O0VA 3AY4C 3MNZB 4PJ9A 4LAJH 3ULUC 4YO0B 4M62L 3ZKND 4X6DB 2XWTB 3IJYB 3ZDYE 4TUJB 4IRSD 5L88H 2FH6A 5DFTA 1QSFD 3QRGH 5FYJU 3ARDD 4CU6A 2AK1L 5DQ9B 3BN3B 3L7FA 3RVTC 3C09C 3IB4A 3BP4B 2G60L 3VFNA 3U0TA 2JIXA 5TPWL 1E0OB 1XF1A 4PJHA 5HDOA 2IH1B 3FFDA 2VZUA 3RWDB 3HFMH 5JDSA 4LOUD 4NC0B 4PJHF 3PWNA 5AUMB 3VJ6B 4M6AA 4Y5XC 3HMWL 3L5WB 3LD8C 4NN6C 1D5ZB 4P49A 3N1PC 3RA7H 4PJCA 5E8PB 3X12B 2FYYA 4OCWL 4K7PH 4ZAKA 2ZG2A 1ZK9A 2JJSC 2N7AA 4X4MA 5L9DH 5DVMA 3RHWF 4XNXH 1QRNA 4B0MM 3RUGF 2DD8H 4GXVH 1MNUH 1HINH 2KQNA 1GJIA 4NBYB 2FRGP 43CAB 3VFGH 4A2LA 4JFFE 3CFCL 4W68A 4HCRA 4O5LH 1NAMH 4I0PA 3RZCA 1I9JH 2VWEC 5ABDE 4PRBA 4Y8DC 4OTXL 2QV2A 4FNLH 2B5IC 1XF4B 5DLML 1R5IA 3HB3D 5J13C 2H8PB 1TCRB 4FQ2H 4K8RH 3KS0J 5ICZB 3TBSB 4NZRH 3LRGA 5CEYA 4Z7WB 2OZ4L 2M26A 5IHZA 5LWYH 4Z7VA 2XA8H 1YECH 1BZ9A 1EERB 1U0QA 4FXGB 2BVEA 3W5NA 4LRNL 3KPPB 2V2XB 4Z7VF 3VFVB 3SKMA 5E2WL 3ARFD 4ZFOA 4KKNA 1LILA 4KC3B 4KGLA 4YH6A 4M6NH 1TPXB 4MWFB 3CFEA 4LU5H 2EEDA 2GT9B 4FZEL 2QL1A 3RL2B 3FB6B 5IVZA 4F7EB 1KACB 3HAEH 3OJVC 2OTUA 1MFBH 3DUUA 4YHPB 5HGHA 4MA7H 5CHNA 3WS3A 5IJVB 4UOW0 3UAJD 5DMYA 1CD9B 1JJUA 1ZANL 1AR1C 4OKVB 4HFUH 4JPVL 1WT5C 5E6IB 3VXQA 5IHBA 1H8NA 3MODH 4HUNB 4HZLB 3VG0L 1G9NH 3T1FB 3OGCA 2I24N 2ITDA 4LLQB 4Z76B 3LIZH 1T1XA 4OCYL 5E95B 4ZOEA 4P5TB 5FK9A 3ZYIA 5EWIH 3N1GC 5D7IA 1NSNH 2YC1B 3V52H 2R0LH 4JG0H 5KSAC 5LQBH 4U1MA 5BOPA 3L6FB 2A1WH 3TCXA 3FONA 3MGOA 1JRHH 4NO0A 3B9DA 4XAWH 1XGTB 1AGBB 5IMLA 1RIHL 5DD1H 1JGEA 3AXLB 4JFEA 3FOLB 2VDOH 4EKXA 4HMCA 4MGXA 4Y5YC 2BOCA 1MFDH 2I25N 5IK3B 1EAJA 2Y25A 3L1OL 1BAFH 2BXZA 4NGHL 1JPSL 1R5VA 4MXVF 4S1SH 4GAJH 2F53D 3F7PC 3PIQA 1ORQB 4AM0A 2WINB 3GIVB 3MLYL 3ESVF 1G84A 3ABZA 4PJEA 5EU6B 1ED3B 1XCTA 4OB5L 4MCZB 1DQMH 3QUYB 5DUPL 1TETL 2CIIB 5C0AD 4XPFL 4F58H 1BVKA 3DRTA 3NCYP 1JRHI 4N5EC 5FV2A 2NY5H 1LK3H 4RGNC 1A3LL 4R7NA 3MREB 1J1XL 3QDJB 4I1NB 4X7TB 5DI8B 3RNKA 2VR5A 2DOCA 3QHTC 2DDQH 3TYFB 2KH2B 2ADJB 4R4FH 4OBRA 5T1KD 2C3WA 2XFXA 3ET9F 5E2VH 4KTDL 5FOBB 1WIPA 4BFIA 1AE6L 1A1MB 4KVNL 5FYLE 3VXMB 1M7XA 3O9WB 5B39A 1L9NA 1R3IH 3KPRE 1S9VA 4C56B 4NQVA 3NGBB 2WIIB 1HHJA 4OQTA 3HUJE 4AH2A 1TJHH 5D7JD 5E0QA 2KPNA 1P4BH 3MRJB 3H7BB 3I6GA 1GZPA 1GCFA 3H42H 2J6EA 5I66B 1LO2L 4NKMB 1MPAH 4WEBL 5IEHA 3KPOA 1H15B 1S7TB 1RZKH 4BM7A 4KROC 4ODHL 4Z18A 3GI9L 5D6CA 5FDYA 3DI3B 4PG9B 4PB9L 2R2EA 4P5MB 4YZFE 5EB9A 1PJ9A 4KRMB 1DQJA 1IGMH 4WJ5B 4I9WD 1WFUA 4PBWD 3SQBA 1MCBA 5D7SH 5AAWA 2ICWA 4U1IA 3S9DB 2YPVH 4KQ4L 4TVPE 9CGTA 3HNSH 4J3UA 5ESVB 3IFLH 4XPAH 4WU5A 1MF2H 1QFHA 5HSFA 5AD0A 2FEDD 1DQTA 1I3GH 3VA6A 2J4WH 5TDNB 5DSCB 4XVTH 3OZ9L 3WLBA 2IJ0C 4OLVL 3P0VH 5L8LB 1I8KB 5HGAA 1WAAA 3SKJL 3WN5A 1YNLH 5J56B 5D1ZA 3BHBB 3KPMB 2ADFL 4JFZL 1UZ6E 1F00I 3QIBD 1I1AD 1JHKH 4PJ9C 2AV1A 5HVWA 4AENA 3M8OL 1A21A 1WAAF 1Q9KB 1CGYA 1TZIB 1WUNT 4QTIL 1F6FB 5EO1A 2MPAH 3HZVA 1S9WA 4K3HA 1U8OB 2VDQL 5GRVL 1P2CA 1BEYH 5IBUB 3GSQA 4IHOB 4JFFA 5CWSB 2HWZH 3I02B 1Q9OB 3IDGB 3MLPA 4PLKD 5DD6A 1W0VA 2B1AH 1ZLWH 3MOAL 3MLTB 4DUVA 1JYNA 5FHBH 1M7IA 4N8CH 2FD6H 1Q1JL 2NR6D 3VFTB 3PXJA 1F4WH 3VFPA 4XVSH 2Z4QB 3VWJD 3T65B 3T3ME 1KV3A 4ISVA 3PHOB 3RGVB 5DO2C 2Z8VC 1JZ8A 3HI1A 5DDHB 1QLEL 2X40A 5F8RC 1FVDB 5DWUL 1MIEH 3S34H 4CW1B 1CLZH 5I8OH 3LHPL 4LGSB 4XCNA 1K6QH 5JXAL 2BCKB 4J3XA 4X4XB 4ODSL 1F58L 1NCTA 5J1AA 4FFVC 1JK8A 4HMEA 3H9SB 3V6OA 3VFMB 3UBXA 2Q7YA 4M1DL 4OQTH 3UJIH 4CVXA 4S10A 2ZSWB 1XT5A 4D9LH 4Y4HA 2CPCA 5K59F 2NX5D 2J6EH 4IOFC 2EIDA 4PGCA 3MRQB 1J18A 4YDIL 4UIMA 1CICB 5EOCH 2IADB 2C7UA 1CZ8L 2DLFL 2XI9A 3ARPA 5I19H 4QHMA 1LO3L 2Y72A 4I0PC 4KUZL 3RZCC 3MLUL 1F8TL 1PYWB 4N90D 1PD6A 1HDMB 1ZEAH 4R9HA 5MEQB 1MLCA 4WW2F 4LCWA 5ADOH 4QXTA 2HT3D 5KSUB 1JNJA 3MRMB 4G80B 5IB1A 3CCHB 3CMGA 2NY5C 3ALPA 3NIDF 1JWUA 2CMRH 3KWWA 2FGWH 5HHMD 4G43B 1JN6B 1IZJA 3UTTE 2EH7H 4JCMA 3P9LA 1G1CA 1HE7A 2DQCL 2YBRB 5TF0A 5CFHA 3FQTB 2EYSA 3T0EB 5F7FA 3J8F7 4KTEH 3P4OA 4WY7L 5GIRA 2X10A 4WI5A 4KJQC 1FNAA 2MKLC 3AAZA 3I50L 4TUOA 3W39B 2Y9RT 3HE6C 2YUXA 4FFYH 1IFHL 2UWEA 2Z8WC 2CQVA 4Z7OE 4C83A 2AEPL 5HXMA 2FWOA 3L3KA 1TFHA 2UWEF 3HZKB 5ISZD 3CVHA 1FAKT 4ELMB 1XGUA 4PJ5E 1RV6X 3O2WH 4JFHD 4KU1A 2DKUA 5IIEB 2HRPH 3HI5L 3P40A 2A77L 4JZOA 2OL3B 1MRFH 3IDNB 1IGFH 1MI5B 2APVA 2VLRB 1I8MA 1SEQL 1NBYB 4L9LA 2V9TA 1IGJA 3F7RA 3VWKA 3FCTA 3T09A 4FOMA 1RIVL 4PJBE 1HHGA 1CYGA 4YHYC 5H2BA 3WEXA 4G6AD 4GAGL 1KNOB 3O2DA 4M8QB 2P8PB 3MA7A 3O4LA 1N6QH 3MUGB 4H8WC 1AC0A 1CWVA 4DAGL 3I3EA 4E41A 4DGYL 1LO5A 2A6KB 4J4PA 1Y0LB 4QKXB 2CSPA 4L8BA 1CFNB 4JANA 4UT6H 4P2QA 1Q72L 4NQCA 3FZUC 4N8PA 4PRAA 4JM4H 1M7DB 3WSQH 3VMOA 2DQGH 2GYSA 1JYVA 3QIWA 4M43L 5JXEA 2QHRH 3V4UH 1ZLVH 5DC0A 2L7JA 3HUJA 1XGPA 3EJZD 1HKLL 4YC2B 3EYFA 5HHOB 4GAYB 2V17H 3KJ4C 3V5HA 3BAEH 5GRVK 3GRWH 1ZVYA 1FNGA 3STBA 1FGNH 1CFSA 1LO4L 4KK8D 2JIXB 3CZFA 3TZVD 4PLJC 4F7CA 5C0RL 5EBLA 1DQQA 1KYOK 2YUWA 4JDTH 1XIWA 1OP5K 1T1WB 4S2SA 4NRXA 5EORH 4J1UB 3O6FA 4CJ0A 1YEKL 4LKCA 3ZDZE 3ZKQD 3DX9B 4I2XB 1QQDB 3K46A 4QHLA 2VR4A 3RUGB 4KKAD 4MD5A 3ZE0F 5BS0D 4YUEL 4ZAKB 2R29L 1FLRL 4PUBL 1LVEA 1QPXA 1ULVA 3TBTB 2X4SA 4HK3J 5E6ID 1WIUA 2K9UA 2IALA 5SWQB 4FQQB 5ACLA 5I6XB 3BPNC 1L7IL 3X11A 2HTLD 2B2XH 3CVHH 1CXKA 4MS8D 5FCUH 1A7BA 3KPQA 2CRMA 4IDJH 1HYSC 4L1HA 3PWLA 4KQ3H 1H3VA 3CFBB 3E2HB 3EFDL 2E7LC 3DV4B 4UV4H 4WTZG 3MV7E 1IKNA 2BSTB 1R5IB 2CUMA 2IWGA 4NHCH 4G6JH 4KI5F 1WZKA 5BJTA 1P6AB 3OB0K 3EYVB 3QEUB 2OL3L 4ZSOE 3BP7A 4MJ6A 5DT1H 3DGGA 1BZ9B 3NZ8A 4AQ1B 1NEZB 1P1ZB 3B5GA 3GZKA 4HF5L 4B41A 1PKOA 3SKMB 1I8IA 5K9JH 4IRJA 2WWKT 1MQKL 4OZ4A 3VH8G 4JM2B 1AI1L 3EHBC 4HDIA 4Y16A 5HHXL 5EA0L 4O9HH 1EEQA 1B2WH 5GRXG 3ULUD 1ZGLM 3WN5C 5EUOB 5K9QI 4CMHB 5FYLH 5HYQA 3WFDH 5CHNB 3K2UL 4X80H 1XGQA 3DURB 5C0BD 4X99A 3OF6D 2E7HA 3S3SA 3VXQB 2F58H 4HIXL 3QUYD 5IR1A 3SO5A 5GS0C 3QQ3B 4M7KL 3RVTD 3OGCB 3V0WL 5E9DE 3TNMA 3BRFA 3IKCA 5CIPB 4ODTL 1BFSA 1LDPL 4LCCA 4C55A 1HOCA 1PFCA 2G2RA 4FQ1L 4DK3A 2XRAL 4UINH 3VFWB 5LJYH 3T2NH 3OR7A 1OHQA 1KYOJ 1TTGA 2PR4H 1MUJA 2X41A 5MP6H 4OGXH 1F3JB 3FONB 4M7LT 3QXAB 5HDBF 1AQDA 2MQCA 4YGVB 1AKJB 3ARRA 3MV01 1JGEB 1SY6H 4WFGD 1J1PL 4JFEB 2BY1A 3N85H 2HFEA 4X4YA 4JRXB 2XZQL 4MD4A 3HA0A 4LPCA 1N8ZA 4TPRL 4WUUD 4JFQB 1N64L 1Z0NA 3FQNA 2CKBA 1OLZA 3MGTA 4Y4HC 3C6LA 1KPRA 4XCFH 1I3VA 5K33A 2EIZB 3DIFB 1J1OH 1KCRL 3FQWB 4F33B 5DRNA 4AM0B 4QRPD 3PL6A 4YJZL 2P8MA 5FKPA 1FNSL 1IGYB 5LG1A 4Y4KA 1OAUL 3TVMB 3RU8L 1DQDL 3TO2A 2I9TB 1BIIB 4I3RL 3OHXB 1S5HA 2GFBA 5DZNA 5D6DA 2IPKB 2R1YB 2BRRL 5EOTB 4DFHA 3T2OA 2MQ0A 3PQYA 5DHYA 3HG1E 3V95A 3U9UA 2XTJE 1BREA 2FBJH 5AG8A 1MWAB 2N1KA 4UQ2B 2QQLH 3RNKB 2Q8AL 1D9KA 4H1LG 1X4ZA 1WQVT 3A6CH 3OJ2C 4EDWH 4JKWA 1IVLA 4YFEA 4DZBA 2Z9TA 4AT6B 4J6RH 3KAAA 1SYVB 4IM8A 2PYEE 1RK1A 1FZOB 1AR1D 1RULL 1UXWA 4LSQL 4NQVB 2BFVL 1UH2A 3WFCH 2WNGA 1K8DA 5BVJA 3G6DL 2W0FA 5L6YH 2XG5A 2BVPA 4U1NA 5JR1L 1YMHB 2A9NL 5GGUB 5JPMA 3L5JA 4D9QD 3ZL4L 1T20A 1CGTA 4OV5B 5B8CB 1TVDA 5GJSH 3DXAE 5CGTA 1ZLUK 1KTDA 3DROA 1DSFL 4OLWH 2ZUSA 1J8HB 5J6HA 2O5ZL 5ID0B 3LMJL 2P8LA 4ZPTA 1DQJB 2PO6A 2VDLH 4EBQL 5E5MB 3AREA 3P0YH 1A9EA 3BP6A 3VWKC 4NHUB 4ZXBA 1QO3B 3KYOA 4UUJA 1Q0XL 4P9MH 2I9LB 5CMAB 4KMLB 1NMBL 4MA1C 2ERJB 2DQEH 5E8OB 4LNRA 1ZT4A 4MNGE 5D5MA 4L4TB 3CFDA 2FBOJ 3VU2A 1VGEL 3H9SD 4J4PC 4XGZA 1EAPB 1ACYL 4W4NA 4UIKH 4H8WL 5D5MF 4Y19A 3PWPB 1KFAH 3NABL 5D1ZB 3MACH 2BHYA 2AXJA 2VH5H 5T1LB 2AV1B 4PRHE 5FO9A 2VSDA 3IFPA 3QIWC 1N6VA 1UYWL 1WWCA 3T0AA 3MNVA 5HGDA 2Z31B 2K7PA 3V5KA 2VQTA 4CNIA 5EN2A 3QO1B 4U3HA 4N5ED 4FFWC 3GSQB 3WKNA 4I5BB 5C07A 2LU3A 2YUVA 4XVJH 3RPIA 4NQEB 5DD6B 1W0VB 3G04B 4ZPVA 1MJ8L 3INUL 3Q5YA 5DVLA 3BEWB 3GMQB 3FFCB 4HLJA 2OMNA 4RAVB 2L7UA 3P4MB 5SX5K 1ND0B 4NZTH 2NYYC 5J9PB 1UH3A 5CKAA 3MV7A 4QT5A 3LKSA 1KTKE 2R2CA 2ZJSL 1C5CH 1FC1A 1XIWC 1AP2A 3LDBB 2R8SH 4U1LA 4PTTB