5I1LB

Crystal structure of human germline antibody ighv5-51/igkv4-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 213
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1lB01
3VGAC 5F88A 5D5MB 2VLKA 4PJAB 3QCTL 3ZDZE 4K9EH 1JWSA 4XBEL 5JPNA 3DETD 3D0VA 1T0MB 3R06B 2C1PB 3HI5H 4MWFA 2EE6A 1M1SA 4J3OC 3U82B 1WTGT 5E24E 2EC8A 4J3SA 3RY6A 1CI5A 2XTJD 4NO3A 4AT6B 4D8PB 4KI1A 1F4AA 1FVDA 2RAMA 2BSTB 4WHTA 4IRJD 3S3JA 4KJYA 1RUQH 1IBGL 3OB8A 2EC9T 2EYSA 4OV6F 4EN3C 2ZCKH 5EZOL 5FAAA 2OL3L 3RVVC 5HI3C 2YEZA 5DMKB 4HZLA 3VWKD 1B2WH 1XZ0B 3VGFA 4G5ZL 4MNHA 2BC4B 5B38A 4FS0A 4DAGH 3LKQB 1UXWA 1FCGA 4F7CB 3O3BA 1WWCA 3MREB 4Y89A 4YWGH 4Y4HC 1JNHB 3ZLQC 2BERA 4WV1B 1N0XH 2V2TB 1KULA 2BNRA 2OCFD 4GAYA 3QQ3B 3MZGB 4OJFL 2ZOKA 2AS5M 3WEXA 1AQDA 3QNYB 2BOCA 3QA3A 1MEXH 3G9VA 4XP6H 4Y2OA 4NRYA 1HKLL 2AJXH 5CJOH 3UTSE 1CQYA 3KHOA 3LVEA 4D9RE 2B1AH 1QSEE 4MZ3A 5IG7B 3LKNB 3TT1L 2O5XL 3DHJA 3BP6B 4PJHB 1GGCL 2WP3O 35C8H 4FZ8H 5CGYC 3E2HC 4XVJL 3TO4B 2GQHA 2OP4H 2AJUH 1S7QA 1MRDL 3DV6B 1NFIB 4NRZB 4KZEH 1UJ3B 2BHUA 3FQTB 1AO7A 3D87B 1JCKA 1NBVL 4NZRH 3QH3B 4YBLC 1CL7L 5HBBA 3E0GA 3MBEA 2W0FB 4RMUA 3RP1A 5MHSD 3OB0K 1LD9A 2AQ3A 1KELL 2N1KA 3SDAA 2VDNL 2ZUWA 4LRNL 5CP3H 4FQIL 4X5XB 1MWAL 1K9TA 1UM5H 4MJIA 4M8VA 1PEZA 5CEXB 4DOHE 1CICA 5E8NB 3BPCB 4J8RB 3KPNB 3FO0L 1ZTXL 1KIRA 1HYSC 3LB6D 5SWSA 1KJ2B 3I50H 3QQ4B 3TWCL 3DVGA 3BQUA 4G7YH 4OB5H 3U46B 3QXVA 4P23C 4UT9L 2GSIB 1BQHB 1IQDB 5DJCA 1CGWA 4DN3L 5T1LD 3G08B 4WO4D 1RZGB 2AJZA 3TN0B 4NQCD 2J12B 3MCLH 3D1MC 4ZFGL 1L7IH 2F54E 4UV7H 4WFFD 4NNPH 2V5SA 4MAYB 2F8XC 4AYFA 5K9OA 4HWUA 3SE3C 1BJMA 3BH9B 5CKAA 4W68A 3IJSA 4YIQB 1PYWA 1T2QL 2FCBA 2PN5A 3KPLA 3U7YL 1PX4A 4JZJC 4DUXA 5LGJB 5IQ7L 4I48A 3MXVH 1X44A 3FCTB 5F44A 4NN5C 2ZCLL 3I75B 5C3LD 3M8OL 1IKFH 3FT2B 4GUPB 5HYJE 1TLKA 4AZ8A 2NTFA 4ZDHA 3P9MB 4LHQB 1RUPL 1YEKL 4Y5XA 4NUGL 1B0GB 1S3KH 3D25B 1EBAA 4WI3A 5E8PA 4U1GB 2Z93A 2JCCE 3WL9A 2V6HA 4P4RB 4QXUL 2E7CA 4U1IB 5DD6A 1KOAA 2N7AA 4XNXL 2FGZA 1EH9A 3TNNB 1ZHKB 1TITA 4XRCB 4N68A 5D2LF 5IESL 2ADIB 4PBXA 3RY5A 1OCWH 1DUYB 3L3DA 3HLAA 1YQ2A 4PGEA 5F3HB 3Q6GH 2P5ED 2A6IA 4OLYH 3PGDB 5DUMH 1LP9B 1UCBH 4TSBH 3GSNL 4DKDC 3RWGA 3SPVA 3GI8L 4POYA 5DVLA 5GXBB 4JFFA 2DQIH 3QWRD 5JOEA 2ADJB 3CDGB 1J8HA 2X4UB 5DDHA 2VABB 3UEZA 1I85A 3O4LA 4OZIA 3MRCA 4PJ9A 1EFXA 4ZXBD 5BMFL 3V4UL 3RGVC 2GY7B 1U0QA 1INQB 2YPKB 2CLRA 4QT5B 1CGTA 1GIGL 1NH6A 3H9SE 1EEYA 4UIKH 3T0EA 4GRLA 2UUDK 2APXA 3LV3A 5EZLB 5HI5C 4KHTH 1RJYA 2X4QA 4OIIL 5T1MA 3ZT6A 1J0YA 1RU9L 1NCWL 4P5KB 5E00A 4MJ6B 1CFSA 1E4XL 4PJDF 5T33H 3C9NB 1I8LA 5EU5A 1OPGL 3SDDA 1GRWA 5DVOA 1XMWA 1DJSA 1FZJB 1ADQL 3FO1A 2VZ1A 3DRQA 4GAGH 4OLUL 5GS2D 3VXQA 4C56B 1OAZL 4BSWA 1NMBH 1L6ZA 4TUJA 4IOFC 5JORB 2P8MB 2IJ0C 4F7EA 1LDPH 5EWIH 1S7SA 1UM6L 3HZYA 2E6QA 1ERNA 3U83A 3FZUC 4ZD3L 4X4XB 4PTUA 4P2RA 1MFBH 4X99A 3CVIH 4LVHC 4JLRA 3CFKA 3ECBA 3AXLA 2BSED 5EDXA 3G5XB 4Q9CA 1VACA 4JM2F 3CX2A 4L9DA 3UZQA 2HRPH 1N5AB 5E5RB 5MP6L 1ZT1B 3TH4T 2KQMA 12E8H 3QXWA 2O5ZL 3LN4A 1BBJB 3HR6A 3VGHA 1C5BH 4FFZH 4G6JH 1B6DA 3AAZB 4PLOB 4JHWL 1FC2D 3RWEA 3ZE1F 2UZXB 1DQQA 5GZNC 4JFEE 5SWQB 3MBEC 1K3ZA 4LHUD 5KSUA 1NFKA 3K1DA 1OP3H 1QBLH 4O2FB 2A6JB 3SDAC 4B0MM 4Z7UA 5F9WB 1NEUA 4HFUH 4XWGL 3HCVB 4D9RD 3O6FA 2B5IC 2CR3A 3VD4A 1MNUL 2WWKO 3DMMA 4HIXL 1QSED 1SMAA 2DICA 3RVTD 3KAAA 2IFFL 4EXPX 3BQUC 1CVRA 4PJCF 4M6OL 2JIXB 1YEHL 3QUKB 4H1LH 2X7LA 5DJXB 5F9OH 4BQCA 2ERJC 4QXTB 4IOSD 1T83C 5CLWA 3CXDH 4YO0B 2ZCHL 2P5WD 1N2RB 3H3PL 3ARBA 4YHML 1KCRH 5GGTL 2BVQB 3BMVA 4IOIA 4L8DA 4M93C 4PGBB 1F6AB 4OCRL 1Y6NR 4MSWB 2AVGA 3UZEA 4U2ZA 2W91A 1L0XA 4K3EL 2DQFA 4N9GB 4LVNB 2ESVE 4QHUA 2NYYD 1MLBB 3FQXA 5J3HD 1KIPA 2PNDA 2DQEH 3GMLA 5I1HH 3NIGE 3UTTA 1L9MA 4H20L 3F58L 3RL1B 5GS0C 3PDDA 1L4IA 1YMME 3LKOB 4Z7VB 1WEJL 5D7LE 3GGWA 4MS8D 5FA4A 2Y07L 3BD5A 4X7EC 1QQDB 4M1DH 4MDIB 4Q6YA 4HF5H 3K4AA 3G6AA 3DJ9A 4GW4B 4HBQA 3RWCA 4PJ8B 5DJDB 4EDWH 1S7WB 2ADGB 4QGYA 2DWEB 5INCB 3PL6D 4WI5A 1UM4L 3FB6B 1L6XA 3EOTL 4DUVA 5CBEB 5C09A 3LS5L 1DUZB 4WCYH 3ALXA 1DQDL 4HH9A 1HHJA 3NA9L 4HKXB 4R2GC 1I85C 2HVJA 4PJ9C 1WFNA 3UBXA 5HYJD 3MRIB 3TBYB 1T66C 3FO9B 1BVLB 4JRYE 3OPZL 3T0EC 5F71A 4X9GA 2Z9TA 4MJ2A 4EDXA 2DB8A 3MV9A 1QNZH 4OLVH 1NC2D 1OAUH 4EOWL 4LLVB 4YXKH 1BQSA 5DTFB 1H15A 5L2KD 5LBSH 2ARJB 2R4RL 2PXYC 2YWYA 2D7TL 2RFXA 4U3CA 2X2YA 5ADOL 1PQZA 3WFHB 1T89A 3NPZB 3C6LA 3SDDC 5AD0B 3HFMH 4G43B 1DVFA 3W9EA 4LFHG 4KHXH 3H7LA 4NPYA 1RJLB 4C4KT 1JZ8A 2ENYA 3DXAA 3IDGB 1P6FA 3CZJA 1G6VK 2XZAL 1JGVH 3V6OA 1GHFL 3BUTA 4WI8A 3FN9A 4JREB 1OSPL 4OT1L 4U0RC 1W2KT 5KSAA 4TOYH 3AU1B 3OG6B 4KK5D 2YUWA 5H37G 4O58L 3CNKA 5FGBA 1BWWA 5AEAA 1RPQA 4X7SH 1KTRL 3QJFB 3HNSH 5FUCC 1OSZA 5F9JB 3KYOA 1KGCE 4LSTL 1RMFL 2NY3B 3BESR 5A43C 3N85L 2J2ZA 3KYAA 4TULL 5GS1A 1NFDA 1GGIH 4UQ3A 1A1NB 3O2WH 1IC4H 1PLGL 4RAVB 1ORQA 2GTZB 3HKFA 2YXFA 3QFJB 2VWEE 3VRIA 3VD9A 4RGND 1G6RB 4CNIB 4PJ5A 5IVXF 1NCAL 5KG9A 2CDFB 1JTOA 2R2CA 2R2EB 1DEEA 4MXVF 3Q2CA 2VLLB 3VD3A 3MJ9L 1NCDL 4JPIA 1PY9A 1LO5B 1A14L 4F15C 1J9CT 1T0NA 3DMMC 3K2UH 2OLDA 4ZPVA 3VXPA 3RZCD 4TPRH 2Y7QB 1ZS8B 4PRHA 2FHCA 2ZUVA 4PRBB 4DVBB 1UYWH 1X5JA 5CWSA 1OLZA 3V95A 2VRAA 4JN2B 3TBVB 2GSGB 1YJDL 2YUXA 1K3IA 3GIZL 1Q94B 2FEEL 2AJ3B 2NW3A 3RNQA 3GMPA 2D31B 4PJXB 2CRMA 2IBGA 2DQJH 5TDPA 4OUOA 5C9KA 4Z5RA 5TE6H 5E4EC 4YX2L 3ARBC 2YK1L 4LASH 5TFSH 1SVCP 4M8QA 3MRDB 3LN5B 2MMXA 4ZAKB 2L7JA 1A6VL 3VXRE 1F3DH 4GXVH 1I9RL 4FXKA 1YEIH 1ZLWK 1I3VA 2B0SL 5CD5C 1P5UA 1LGVA 2HT3D 5FYLH 3TYGH 2VKWA 1ES0A 5I2IA 1OAQL 3LQMA 3B2UC 4ZFFB 3SDXF 3BPLC 3GSNA 3QIBD 4X4YA 4RAUA 1T5WB 3ULVE 1RZIB 5F1SA 4RCAA 1Y18A 4OM0H 3UMTA 1QBBA 5K59F 1TJGH 2ZUQB 3VGEA 1QR1B 5IM7A 3CU1A 1NAKH 1HDMA 3L95A 1QRNB 2QHLA 2VUOA 4LLQA 1HILA 3T0AA 4P59H 1BFTA 1PGRB 1WIOA 2FEDC 1QSFB 3ZTJH 2XKSA 4G8IA 4M43H 1GZPB 4L4TB 3DLQR 3TFKD 1QKZH 4R0LA 5E5MB 5IROA 3RRQA 5FDWA 1JZ7A 3ULSA 4KUCD 4G8EB 3QCUH 1ADQA 1NAMH 1OD7A 1KB5A 1B9ZA 3DVFA 4NM8H 3QCVH 5D7LD 5I1LA 1WFUA 1X7QA 3C5ZB 1BIHA 4J2XA 1RZ8B 2EDTA 3QBTB 3L9RB 3QPQD 5EUOA 4DZBB 3RDTD 1K8IA 4EIGB 1BEYL 2WBWB 2YD9A 2VKXA 1X5IA 5JZ7C 5C8JB 5I30H 1FNHA 2AEQH 1MI5A 1NC4B 1TTGA 1HCFX 3DGCR 5I66A 2ADFL 5KVDL 3ZKXB 3TPKA 4W4OA 4ZO7A 1DVFC 4WWKC 3VXMB 2XWTA 5FM8A 2QQKH 1BQLH 3QIWD 1CD0A 4TSCL 5HDQL 1P7QD 1Y6KR 1NCCL 3V4VH 5KSAC 4JFDB 4UILH 5AUMA 1EERB 5FGBC 4OD1H 5T3ZD 2QSVA 4F33B 3SKNB 3SO5A 4LARH 1JF5A 1XEDA 4LLDA 4YXHH 3ARFB 5L8LB 1DSFL 1XCTA 2A1WH 1DBKH 1U41A 4LOUD 4I18B 3QG6B 3LRSA 4XC1H 4OZHA 3F5WA 3IU4L 4P5MB 4R7DA 1A7QL 3FT3B 1TTFA 5FKAB 3UJJL 3WMSA 1H8NA 4DQOH 3BUYB 1EMTL 2UVFA 1JNNL 2CXKA 2OBGA 4GW1A 1JP5A 2MCPH 1YECH 4H5SA 4M7KH 1UKQA 5D7KD 4OFVA 5TDNB 2XPGA 1NGQH 2EYRA 3VFTB 4QF1B 4QXGH 5F72S 1HEZA 1U58B 5GGTA 2BJML 3QXAB 4QRRD 3S88H 1QUNA 1W0YT 3B6SA 4UTBH 2EDKA 3WUWB 2R69H 3T2NL 1JTPA 5DI8A 1A6WL 5I16B 5IR1B 3OSKA 2NQCA 3EKCA 2GW5A 4TUOA 4XBPB 1U8JB 2ZKHL 2YKLH 4Q97A 3BI9X 4Y5VB 1YNKL 1XR9B 4NYLA 5ILTL 5CSGA 1LO3L 3P2TA 4LKXB 4G6FB 3KNBA 4K9EC 4XNQA 3VDBA 3HS0B 1M7IA 4LBEA 5EO0A 1XGUA 5F7DB 1AGCA 4XMLL 4GG8B 5JHDE 1RUKL 3GSUB 3KPOB 3PWPB 3VXUE 1VFMA 4L1DA 4NQDD 1BZ9B 1G84A 2H9GA 4U1NA 2OJZL 6FABH 2QSCL 4I0PD 3TBSA 2XN9E 2F74B 1TCRB 3P3YA 2BNQE 5I71B 2BCKA 4BYHA 3IS0X 3W11C 3DVIA 1NUNB 3H9SB 1IC5H 1RZKL 3O11B 2DMKA 4G9FD 3LMJL 4NJ9L 4UINH 3WHXA 3SDCB 1N26A 3SO3C 5C9JB 4PRNB 1WT5A 5J6HA 1B4JH 4X6DA 4IBLT 3N1MC 1XIWC 2BVOA 5T1KA 4XI5D 1KNOB 3MNVB 1CLOL 3K8KA 2F53A 4FTVA 4HXBH 4RNRA 3H9YA 2EH7L 1SYSA 3RKDD 2FBJH 4OZFA 2CK2A 3BT2H 4HWBH 3OKMB 4WUUE 3U7WL 4F8QA 3VXRD 3O6KL 4ODWA 4AMKH 4HKJA 3HG1A 5T1DH 4R0LC 2NR6D 5IROC 5D96C 4LAQH 3TA3D 3KYMB 2YD1A 4CADA 5IVNA 4NQUA 1FIEA 5JIIA 1I9JH 5DRXB 5HHOD 4P5TA 1LO4L 2YC1B 4CU8A 4HUMB 4WW2B 5AAMA 3WCYA 4OLXL 4TVPD 3ULVD 5D70H 3QAZC 1G1YA 3CH1B 4NZUH 5JW3L 1S7UA 5DD5H 4Z76A 1WVZA 1RJZA 5J11B 1E0OB 1RY7B 4LQFH 1PJ9A 4KXZI 1AXIB 2Z92B 4JZNB 5DYOA 4AH2A 1CFVL 3SY0B 3VFWA 4JG0H 4L8SB 4KK6D 3HMWH 2WLYA 4LCCA 2OZ4H 3N9GL 4WJ5A 2GT9B 2VLJE 5KVEH 2GYSA 4U33A 4FABL 2BRRL 3FRPG 1VGKA 1BD2A 1XGRB 2PYFB 2Z31D 2PO6D 1MCIA 1VGEL 3T4AA 2KQNA 5ANME 4DN4L 3Q6FB 3RHWF 2VO5A 2MHAA 4WHYH 4OGAC 1G7IA 3UO1H 1CFNB 3QEHB 5GGRB 3VXSB 5KW9H 5IFJA 3MJ9A 2V2XB 2R2BA 4JFZL 3T0VA 4P2QA 1SQ2N 1ZA3A 4PJGE 5J56B 3BKYH 3P11H 5CJQL 4P4KC 4XGZB 4Q7DA 5GZOC 4TSAH 1R3KB 1YEFH 4NBYB 4JPKL 5EOCH 3T77B 2R4SH 4LVOC 3MNZA 1G9MH 1FBIH 4ETQB 4NO0D 3OF6D 1BM3L 4HG4K 4U1HB 5FYJD 4Y4KA 1R5VA 4M1CD 5E2UH 5K9KA 4BZ1H 4O5LL 4OZGE 3OX8A 1FL5B 4WNQA 5D8JH 3OKYA 5KVFH 3IETB 3V5DB 3MLXL 2CRZA 1YEJH 5L9DH 2IH3A 5JOFA 1E4WL 1U8HA 2GCYB 3LY6A 5F7WC 1KJ2L 4R3SB 2IH1A 2VIRB 5CSBA 5K9QG 3WNKA 4M02A 5JW5B 1OD9A 1T21A 2YPLA 3QZWG 5IMLB 4PGDB 1PSKH 5DVNA 5HY9A 4K07A 2B20A 1KN4L 5DEFB 4C59B 4KI5F 1YEDA 4UUJA 4NHUA 1U8LB 1HKFA 4NZJA 4ZYKA 5EOTA 3S37H 2YD6A 1JN6B 4LL9A 1G7MB 2FX8H 1U93A 3UPRB 3RA7H 5HGDB 4LPCA 2IGFH 4J3TA 4PJEE 1L0YA 2J7LA 1SY6H 4FNLH 4PJFF 1NLDH 5IOPB 4FQQA 5MI0C 1IM9D 4LF3B 2VLME 3MJ8B 1HHKA 2FX9H 2WM0A 4PY8J 1NBYA 3RL2B 4M9PA 2C9AA 3T0BA 3VFPB 3DSFL 1FYHB 4P2OC 4JDTL 2HT2C 4NP4L 2OI9C 1AFVL 3WDJA 3BDXA 4AQOA 1AY1L 1MCFA 1ZHLA 2XACC 4FHBD 1IGIH 1IGML 1YPZA 2IPTH 2X9XA 4D0DB 1DL7L 3IDJA 3MCKA 2VL5A 1E28B 3ROLB 1K2DB 5C07E 3OR7A 4BKLB 3D69B 1TVDA 4RMSA 1ACZA 3ZMRA 4JFQB 1F3DJ 4H8WC 1CDBA 3U4BL 1Z0NA 2K7QA 1TZGH 5JHDD 4PIRF 1KN2L 5GGSB 4KRMB 4NCDA 5JXEA 4KY1H 4HC1L 5GRVL 1KTDA 2XN9D 4Q0XL 4JQXC 5DD1L 3CX5J 4UV4L 5CHNB 1JWUB 3T09A 4HKZB 4AG4L 2WMPA 1MRCL 3QI9A 1A7RL 1DE4A 3F7VB 4Y4FA 4HT1L 2AQ1A 1IGJA 3GUTA 1HINH 5B39G 1MRFH 1JZ2A 2NY0C 1N7ML 1FVCA 3THMH 5JO5A 4E41A 2W0LA 4L8BA 3WIFA 4HWZB 3RKPA 1SJHB 2EDYA 3QJHB 5I1GL 3IDMA 4JVPA 4ZQKA 4GQPH 4IIQA 3B3IB 1HHGB 2OSLB 4PG9B 4XB8A 4CUCA 4YJZL 4E42A 1S9XB 4JJ5A 3G6JB 5ISZE 3EJZC 3OJDB 1WV7T 2AK4E 5EU4B 2A6KB 1A3RL 1HQ4A 2VDRH 4YHYB 3QPXL 3TO2A 5BXFB 1TVHB 3DARA 4KDWA 1CFQA 3R1GH 1FG9C 4U49A 2E8YA 2G9HA 1DCLA 2Q3AA 4N5EC 1RK1B 1F58L 2FIRT 2QADB 1XFPA 3FN0H 3V4PH 3WFEH 2J88H 5SWZE 1YYML 3QUZB 3UYRH 2VQUA 2DM4A 1NGYB 2V2WB 3L5XH 3TGXA 4EI5A 4J6RH 4GRWH 5DFTA 3UROR 5ABDE 3MBXL 4OAWB 5CJBA 5IF0B 4KJWD 3VWJC 3MRKB 1OAXL 1RUAL 1RVFL 5EOQH 1ETZA 4Q6IB 1CGXA 4E5XB 3QUYB 1RULH 4KDTA 1CLZH 1KPUA 3H42H 3CDFA 4KJPC 3PWUA 4NOFA 1EAPA 3N06B 1ZT7B 5IB5B 5DHVB 1M7XA 1DLFL 1JHTA 1TQCC 2DYPA 5D7SH 2CJUL 2FLBT 2FJHA 4PJ7B 1P2CB 3D39E 4CMHB 1NEZA 2V5RA 3CFBA 4LIQL 1CIUA 1F2XK 2BVPA 3NIDF 5I1IL 1OAKH 1UA6H 1XT5A 4GG6E 4YXLH 3KLDA 5FFLA 2VLKE 3I84A 3BKCH 5CBAA 1A7PL 4OM1H 1NGWB 1FZKB 1JI2A 2BSRB 3KDMB 1TFHA 2XZCH 4U1SA 4YC2C 5EORH 3H7BB 5IUSA 4XPBH 3SKOA 5BS0B 5I1CH 2H2SC 5EZJB 4RFOL 1C5DB 3OKKB 2JELL 1UB6B 3C60A 5FKPA 4XMPH 3BAEL 5DUBB 4Y2DA 1JF1A 4YGAB 2DLIA 4LSSL 5HYQB 3U4EB 1S5IH 3MPCA 1MHPL 2APTA 1TJIL 2VDOL 5D5MA 1Y6MR 1HXMB 4KMLB 4PJAA 1GJIA 1A1MB 3V52L 1CCZA 1U9KA 3F6IA 1FORL 5GS2H 4DK6A 3MV01 5FUOL 1T0MA 2EXWD 3R06A 4KV5E 2MFNA 3EO9H 1C5CL 3IDUA 3GRWL 2C1PA 4OBRA 3MRBB 5I8CA 4JJHA 3RHWK 4YGVB 3HZMB 2NY6D 4Y19B 2AJSL 4D8PA 4ODUB 2W60B 1W72L 2EXYD 4TRPL 4JR9L 1V7MH 2BSTA 1IGYB 5BRZB 1CU4L 4PP2B 2BNRE 4LU5H 1QPXA 2VDLL 4F58L 5DO2C 1YN7B 3OAYH 2NXZC 1WIPA 4PLKC 4U3HA 1HZHH 3SKJL 1J8KA 3V6ZB 1MFEL 5E8EB 3WLBB 3DX8A 1T7VA 5DMKA 1RZFH 4XC3L 2LV4A 1IAII 2ZG2A 2BC4A 4CMMB 2CIKB 4N8VB 4EEEA 4CVWA 2YXMA 3LKQA 5JXEC 4F7CA 2X1OA 1X5XA 2DLFH 5E56A 5BJTB 1JNHA 4NIKB 1V3LA 1EPFA 3SKMB 1INEL 3NTCL 2GTWB 1UACH 4J4PA 2V2TA 4R97B 3QQ3A 1J0IA 2VLMD 3A6BH 4TTGA 4AEFA 2BY1A 3QNYA 4Y0GA 3BIAX 1KBGL 3QI9C 3WNLA 2WNGA 3CD4A 3ELAT 4OD3L 4Y4HD 3PE9A 5F3BB 3A6CH 5E8DL 1I9IH 3L3OB 3MODL 5F96L 2IADB 4G8GB 4NKMB 5C7XH 2JTDA 3D85B 3DGGA 5IG7A 3C2AL 4CJ0A 3LKNA 5C07D 3TIDB 2NNAB 2WAHA 4QHKI 3BP6A 4PJHA 4MJIE 5D7IB 1JPST 4XMKL 2Z35B 3TO4A 5TDOB 5ITBH 3EYVB 5I8KH 1KCSL 3DV6A 3GMOA 1NFIA 4NRZA 4OIBA 3VRLE 1T04B 1KG0B 5FUZH 3FQTA 1RHHB 3WN5B 1YQVL 4YUEH 1YUHB 4EIZC 1GAFH 4X80H 4AL8H 1K8DB 5CGYD 3QH3A 4ALAH 1N3NB 4NHCH 2W0FA 2AGJH 5EH1A 1AQKH 2XXMB 5A2LH 5EC1B 3K7UA 2DM3A 4X5XA 5J4MA 2DQHH 1FRGH 3NABH 4PB0H 5E8NA 4LSQL 5AZ2L 2I26N 3BPCA 3OAUH 3WFCH 4J8RA 1IQWL 3VI4E 4U7KA 4XP1H 1MJUH 4JCMA 4KDTC 3SOBH 3QQ4A 2OR7A 3KGRA 3SGJC 4K23H 3UTQB 3K81A 3U46A 3KPRB 2GSIA 1BQHA 1IQDA 2EZ0C 1JFQL 3UPAA 4L4VB 5ISZD 4XNZB 2AK4D 1VADB 3G08A 2BNQB 1RZGA 3I6KB 1N64H 4S1DD 3TN0A 5IJVB 4JRXB 5CZKA 3QIUD 1HYSD 4GKNB 4PFEA 4UQ2B 1KTLB 4FQXC 1GGYA 5FM4A 4MAYA 1M71B 1CF8H 1CQKA 2D03H 4P23D 3HMXA 5D71H 3BH9A 1V8HA 1JMXA 1I7ZB 3Q3GB 5D1ZC 3RJDA 1VPOH 4YIQA 5SWZD 1WAAA 2ZNWA 4PLNC 3ULUL 2A77H 5LGJA 1JYXA 3HTLX 4HPOH 1PG7W 3FCTA 2D7PA 4YDJB 1AXTH 2ZCKL 1A21A 3QDMB 2A9ML 5EOCJ 4GUPA 3C60C 3K80A 3P9MA 1U91A 1B2WL 4Y2DC 2GFBB 4PGJA 3GNML 3MLRH 1B0GA 3D25A 4CBPA 2KPNA 4LPVA 4LLYB 4APQB 2AERT 4P4RA 4YWGL 3NCYS 4G8FB 3C5SB 4U1IA 1A7OH 1J8HE 2BRQA 3EDJA 3O4LE 4OZIE 3MV11 2DM7A 3ROOB 3E6FB 3TNNA 1ZHKA 3NCEB 4XRCA 2ADIA 3ILQC 4Z78B 4XP6L 1DUYA 3GSXB 4UNTA 1F97A 3FTGB 3VJ6B 5F3HA 4BQ8A 2VLKD 2ZPKH 5ADPH 2C3HA 4WGWB 2E7BA 4HC1A 1LP9A 1P4LB 3RUGB 4XNUH 1E27B 5EIVA 3MFFB 4PLJC 3GBMH 2B1AL 3WNOA 4FQHB 4BELD 1ZANL 2G2RA 3VMOA 5LWYH 3VRJB 3LQZA 1UWXK 2ADJA 2X4UA 4YR6B 2VABA 1F6LL 4CDGC 2YD3A 35C8L 4FZ8L 4JB9L 4IRSB 5GRVK 2VLJB 3QHZH 3P77B 3RIFF 1TXKA 1ZVYA 3B5HA 4O4YH 1INQA 2YPKA 2AJUL 4QT5A 2DOCA 3DBXB 3RAJH 1FZMB 5EZLA 1UH3A 2XG5A 2HG5B 4RIRB 3RVWC 3EFFB 5FYKL 1I1RA 2A74B 4P5KA 5I19H 2XTJB 4P2RE 1T6WA 3RGVD 1NCNA 1HXYB 4J4PC 1LK3H 1MIMH 3C9NA 25C8L 4K3HA 1FZJA 5HI5D 3ILPB 1NGPL 1ZOXA 3HNTH 2X1QA 5GRJH 4C56A 1D5MA 5TPWH 5CP7A 1FP5A 3DO7B 5I1KL 4F7MB 3X3FH 5JORA 2P8MA 4N90D 1GOHA 2NLJB 3I50L 1FN4B 3CC5B 4G7YL 3VWKB 4X4XA 5DD0H 4YHZH 4Z7UE 1NUGA 4PJIF 4CJ1A 2PYEB 1ZSDB 3MCLL 3V7AE 1J12A 3OJVC 3G5XA 5C3TA 4NNPL 1IM3B 1N5AA 3U48A 4FQPA 3FZUD 5IB3B 4M7LL 4OSUH 3PJSB 1BBJA 3HI6H 3MA9H 5EU6D 2R0KH 1CLYL 2P43B 1EEUA 5DJAB 5SWQA 2QQNH 2OTWB 4JFYB 1FG2B 3GM0A 1JK8B 5F89B 3QUXB 1CE6B 4O2FA 1YC7A 2A6JA 1AO7D 3HAEH 5C2BH 4XPAH 1UZ6E 4WI4A 3AREC 4KQ4H 3HCVA 4JO2H 4EUPG 4R90H 3V8OA 1MFCL 4NWUH 2H32H 3MBED 3SE9H 5GRWA 3T8XB 4AEHH 1ULVA 5I17A 3SDAD 5DQJB 3QUKA 4MJID 1MCHA 1I7UB 3BP7B 5DJXA 5L7XH 4XPHH 3U9PH 3UTTE 4RQQB 3UBXI 4FXGA 4KTYA 2DKSA 1OCWL 2FH6A 4YO0A 3REVB 5SWSD 1Q0YL 4X83A 1T1WB 1KCVL 1WZLA 5MEOB 3BQUD 4MAYC 1N2RA 5D7JB 5DUML 5DQ9B 1Z9MA 5JTWA 2R0LH 2C3VB 4TSBL 4ELMB 1F6AA 1RZ7H 5FCUH 2RIKA 3B2VH 4MSWA 1UWEH 2D7OA 3JWDL 1IEHA 3IF1B 2DQIL 1F4WL 4N9GA 1X5YA 4IDJH 3GRWA 1MLBA 1AP2B 2VR9A 4NWTH 3QEQE 2IMNA 4PBWD 3AY4A 3O6MH 2J6EH 2KZ1B 3RL1A 2X4OA 4KU1A 3LKOA 4GSDL 5HSFA 2RBLA 4Z7VA 3G6DL 4NCC2 2BSSB 2XKNA 3KPSB 1LE9B 5T1LB 4KHTL 1QQDA 4U1GC 3EDEA 4LCUB 1CL7I 4FQLH 4NQCB 3O8XB 5JXAH 4PG2A 4GW4A 4XPTL 3CFEB 5KBNC 5D2NC 1I1AC 5DWUH 1LQSR 4PJ8A 1L0QA 5DJDA 1XAUA 4CN1A 2Y06H 2OR8A 2ADGA 1EGJH 2DWEA 4GAGL 3S5LB 4G6MH 5INCA 3MV9E 1NMBL 2LQRA 2AQ2A 1NCTA 4CGTA 1YDPB 3SE8L 5T3ZH 4BQ9A 1ZGLP 2WUBL 5CBEA 4NQEB 1DUZA 1LDPL 2BOBB 2XI9A 2XRAL 2OTUB 4IS6B 3I6LD 1D5BA 4HKXA 2E9IA 3W2DL 1MFBL 3CVIL 2D9CA 2X4TB 3DXAE 3MRIA 3TBYA 3FO9A 5EUKB 3V6OE 2NY7H 1BVLA 3BPOC 1IZKA 4IMKA 3DIFB 3NCBB 4NDMB 2VDPL 4JFFD 4LSVL 1A6UL 4M62H 2XQBL 3I6GB 1GH7A 2CK0L 1JZ6A 4C83B 1J8HD 4LLVA 3X14B 4R2GD 2GITB 3O4LD 5GGSY 4PJ9D 1C5BL 1EFXD 4FFZL 4G6JL 4HZAA 2RHEA 3Q5YA 4FFVC 1T66D 3V6FB 4NO5A 2ZG3A 3SBWC 5IB1B 1HSBB 4DWHA 3T0ED 4GRLD 5AD0A 4OFPA 5IFAH 1QBLL 1U3HB 5D2LE 4G43A 1NFDE 3EYSH 2FD6H 3IDGA 4HFUL 5KSBF 1R0AH 5FB8B 5BZDB 3AS0A 3D48R 1M7DB 5JIHA 3S4SG 5C0FA 3ARRA 1N59B 3AU1A 2BXZA 3MRGA 4PV8B 3SDDD 2P4AB 4PJ5E 1D7FA 3AC0A 3LKPA 2VDQH 3PQYE 4X5WB 2UYLB 3T0XA 2ZSWB 2P7TA 3QJFA 3ZSSA 3HUJB 5F9JA 1VFAB 4HCRH 3CIQA 3SN6N 1MCLA 5HHQB 1OM3H 4LMQI 4HEPG 1MREH 3WSQH 3B9AA 3DETC 1J1PL 4HULB 3B9KB 3V79C 1LK2A 5JDJA 1A1NA 2W9EH 3D18B 2C26A 4PRHE 4RAVA 2APWA 4WEBL 2GTZA 4L1HA 3DSNA 2ICEB 4P2RD 2WBJB 4QRUB 2DL2A 3FQRB 4GXUM 3SCMB 4DW2H 4MQXC 3CXHJ 1G6RA 1URLA 2H6PB 4IRJC 4NFBA 2DQCH 2R2EA 3W0WB 5F9WC 8FABB 1LO5A 1IEBB 5H35B 2WIIB 4LVEA 4OCLC 5DMIH 3R0NA 4FFYL 4G80B 4LEOB 1ROWA 3CGTA 2ZNXA 4M1DL 2Y7QA 1TJHH 1ZS8A 4DVBA 1EO8H 5C08E 1ZEAL 5FHBH 4JN2A 3TBVA 2GSGA 3SHSA 3RIFK 2AJ3A 3EDFA 4LMQE 1U8IB 2AXGB 4WW2F 3O6FD 2D31A 4PJXA 5F93C 1Y0LB 2Y5TB 3DMMD 4OI7A 3AROA 1JPSH 4RFNC 4DFHA 4PGCB 4NKIH 1I3RB 4BFEA 2CIIB 1I8IB 4BUGA 1Z9OA 3U0PB 5J6GB 3MRDA 3LN5A 5I1JL 3ARYA 4ZAKA 2HKFL 4WCYL 5CAYB 1ED3B 3OJMB 4V1DB 3DVNB 1ZLUH 3NPSC 4LVNC 4PYHA 3ULVH 2WWMD 1C16B 4XXCA 3ARBD 5KAQF 5BV7H 1P1ZB 4KZDH 3K3QA 5K33A 3T2OA 5BOZG 4D9QD 4ZFFA 5DK0B 3PP4H 15C8H 1HE7A 1T5WA 1BFOB 1RZIA 1QNZL 5J13B 5D1QA 2PW1B 3CMOH 1Q0XH 5J1SC 3IDXH 5LBSL 1BLNB 4RRPA 3UTTD 2X9WA 3U36B 3B2UD 2ZUYA 3TCLB 4WY7H 5FK9B 4RX4A 1EVUA 1EUUA 1JNLL 4KHXL 1QRNA 1G0XA 5EUOE 1PW3A 1QSFA 1RFDL 3UTSA 4D9LH 5BVJB 2HFGH 3NMEA 4L4TA 5E5MA 4LLWB 1AXSB 3J7HA 1Z2KA 1JE6A 3OQ3B 3GHBH 4G8EA 4X7SL 5IKCB 3C8KB 3HNSL 2FEDD 2FO4B 3T1FB 1CXEA 3L6FB 4JO4L 5KVGH 3C5ZA 3BP5B 2JJVA 3LIZH 4WO4C 5C09D 4PJBB 1REIA 4IMKC 1RZ8A 3L9RA 3OGCB 3T3PF 3O2WL 1IC4L 4DZBA 1PAMA 3EZJB 4NNYB 4NCC1 5C8JA 5EN2B 5FYJH 4G7VH 4H88L 1NC4A 1S9YB 1R3JA 3KXFE 4DEPB 2KL6A 1XF2B 3WJLA 3MV9D 4DKAA 2X1WL 2JJUA 4F2MA 1WCBB 3GI9H 4PRIB 3CVHB 3X17A 1EHLH 4JREC 1LEIB 1XF1A 3K2UL 4JFDA 5L88H 3C6LD 2J8HA 1UYWL 1DVFD 1DEDA 1EO5A 5I1DB 3DXAD 1H0DA 4F33A 3SKNA 2NZ9D 1S9KC 1NC2B 5KS9B 3ARFA 2NY3C 4F9LC 1P6AB 2ZUXA 2DQJL 5L2KB 4NT6A 4TNVF 5KSAD 3S3SA 3ZDYE 4I18A 3QG6A 1QEWA 1BQUA 3CH8A 5JQHC 5I18H 1O7SA 5EBLB 1JYVA 1JZ5A 4P5MA 4IRZH 3MOAH 2VXVL 4LASL 2MSPA 4F80A 4D0CB 4R4ND 1P4IL 3GSRB 4BH8B 3FT3A 2L7UA 2UVEA 5FKAA 4KVCH 1WF5A 2BY0A 3BUYA 5I1EL 2YMXH 1F6FB 4GXVL 2EDHA 3ESVF 3VFVB 5TDNA 3VA2C 2CRIA 3D9AH 5HHNB 3VFTA 1B0WA 3PP3H 4QF1A 4ZXBC 4DGIL 1U58A 1CFTB 4RMQA 3KWWA 3HR5B 3QXAA 4I2XB 4PJ5D 4YHNB 1I1CA 3WUWA 2CSPA 3JWOH 5CJ8A 5I16A 5IR1A 1A0QH 4OM0L 1JZ3A 5IBLC 1V3JA 4XBPA 4JFHE 1U8JA 5JHLL 1OW0C 1KXTB 4Y5VA 5IHZA 1NAKL 1XR9A 5TE4H 3INUL 4P9ML 1G9NC 4RGNB 4LKXA 2X42A 4PRHD 2YD2A 3HC4H 4OKVB 3HS0A 2ICWI 3SGKA 1OF2B 1KCUH 4OFKA 1QKZL 4ZAKC 4UDTB 4GG8A 3GSUA 3KPOA 3PWPA 1JGEB 1BZ9A 3NVQA 4XXCC 2NXYC 2E7MA 2F74A 3P0VL 1B90A 1TCRA 4MXVE 4YAQB 3TC9A 3VI3F 4H1LG 3QCVL 3FB7B 4HK0A 1NMCC 1X4XA 3H9SA 3O11A 1U8OB 4ZUWB 2P45B 3HG1E 1CDJA 2DDQH 1XGQB 4CW1B 3GK8L 3SDCA 5C9JA 5D1QC 3VXOB 4PRNA 1PKQB 3R4DA 2XYCA 5IEHB 1FC1A 4HIEB 4YE4H 5JQ6H 5KAQG 2FBOJ 1A7NL 4Z18A 4Q9QL 3W11D 1KNOA 1I75A 3MNVA 2R29H 3PGCA 5EA0H 4LNVA 2JE8A 4XCCL 4M9OA 4HBCH 1S9VA 3ZE2F 1NANI 4GKSB 2QQKL 1BQLL 5FF6A 1I8KA 1RURH 4OGXL 4QRPD 2APVA 3QRFM 3ETBF 5DRWB 3OKMA 2LU4A 1BIIB 2VSDA 4Z7QF 4PY7B 5F21B 1OGAB 4NOBA 3AM8A 4UILL 2FEEI 5BO1H 5D72H 3KYMA 3RVTC 2YBRB 4W6XB 4BFIB 4CDHA 3QIBB 4UAOB 1U6AH 3W81A 4AY0A 4DJMA 1EJOH 5DRXA 1C12A 2A1WL 4V2BA 1BD2E 3BXNB 3C5ZC 5BCAA 3HE6A 4X6CF 5ACZB 1OP3K 1C7TA 3GBNH 4HGMA 2VLRE 5MENB 1FGVL 2AK1H 1MUJB 3CH1A 4HD9A 3WFBL 4N1CA 3NCFB 7CGTA 2Z92A 4DQOL 4HKBB 4JFEA 3EDKA 2XZQH 1YECL 3BP4B 3SY0A 4HGWB 4YDIH 4P2QE 4L8SA 1ITBB 4YHKH 3FONB 2B7DT 3UYPA 3HNVL 3AFLA 4P48A 5C1MB 2GT9A 3PV7A 2P8PB 1G1CA 1ZA6A 2JLLA 1ZT4B 2HVKA 1MI5D 1XGRA 3S88L 2PYFA 4O9HH 4C4KO 2R69L 3V0WH 3VFGH 4IHOB 3Q6FA 5DEZA 4MS8C 3UP1A 4XPGH 3VFUB 1IGFH 1BOGB 2X10A 4JDZB 3RBSA 3NN8B 1X5ZA 4N0YL 1Q9KB 1CFNA 2YKLL 3QEHA 5GGRA 3VXSA 2V2XA 3VDCA 1HIMH 5BOPA 4P3CH 2EDNA 4EJ1C 1AGBB 3L3JB 4GQ9H 1Z9LA 5JUEH 4I18C 4NQSB 4ZUSB 3D2UA 4U6HB 3L3IA 3E8UH 3SKUD 3MLVH 3RU8H 2XNAB 4XGZA 4B53A 5DMGD 2P44B 5CIPB 1R3KA 4QNPE 3SQOH 3TZVB 4PP1C 5IT2L 5LXGL 5HTSA 2OL3B 4ETQA 4GBXA 4GKZA 2ESVA 4DGVL 3P0YH 3CLEH 3O4OB 5GGUB 6FABL 4U1HA 3GFUA 2YPLE 5EZIL 5GZOD 2AEPL 3BD4A 4LGPB 1JGDB 3HC3L 3MYZA 4Z7WF 3D5OF 2C3GA 1YMMA 4OD2B 1FL5A 1A22B 3IETA 3V5DA 3P30H 2OJEB 3WIHA 3L5WB 1B4JL 2VXTH 4UOW1 1Z5LB 3ARGC 2GCYA 4X7DC 2FR4B 4RWYH 3MYJB 2AV7B 1SEQH 1WBXB 4LGSB 3WDIA 5E03A 5JW5A 3U9UB 5IMLA 3CMGA 3TJEH 1XGYL 3ZZ1A 1IMHC 4WRLA 5DEFA 2AAVA 3WO4C 2VXSH 4KJQD 5C0EB 1U8LA 5DA0B 1S5HB 3DRTB 5AWNH 1JN6A 2VQ1B 1G7MA 2RJMA 5HHMB 4LAQL 2LVCA 1NCBH 4QRRB 3UPRA 5HDBE 1U8MB 3GMNB 1I9JL 1VB9A 1ACYH 5ESVB 2MOVA 2Q8AH 5IOPA 1X5FA 1G7JA 2ED9A 4LF3A 3P73A 3MJ8A 2E9WA 3RL2A 3OKLB 5D70L 5JIPA 2CMRL 3VFPA 5DD5L 1FV1B 4JFHD 4EQ2A 3TVMB 4IDLA 1NL0H 2B4CH 4YHIB 4TNVK 1KJVB 3HMWL 3H2WA 4M1GH 4DVRL 2XFXB 1E28A 3ROLA 1K2DA 3I02A 4UT7L 1CK0H 2HT2D 1SEBB 4ZODA 3D69A 1FNFA 4BKLA 5HVHB 3OTTA 5E2VH 3LKSA 4JFQA 4OCYL 4NQDB 1FZOB 4GRMB 3RNKB 4E41E 5GGSA 1XGTB 2F53D 4FTVD 5E9DB 3RZCC 3CPLB 3UO1L 3X13B 5KTEL 5KW9L 4G9FB 1QYGL 5E2JA 5CHNA 1JWUA 5LG1A 4HKZA 5H8DA 1N4XL 5E8OB 5HGBA 3HE6C 3F7VA 2X44D 1KC5L 2UWEF 2VR4A 1CT8B 3BKYL 4HJJL 3B5TA 3P11L 2FGWL 3WIIL 5J11C 4QOKB 4P5TD 2VSCA 4JQVA 3IFOB 3ZTJG 1XR8B 2R4SL 6CGTA 3MROB 4HWZA 1SJHA 1FBIL 3QJHA 4JDVB 4PJDB 3B3IA 1HHGA 2OSLA 4PG9A 4Y5YB 1FDLH 2EEAA 1S9XA 3DX7A 4ZNEA 2P48B 2DM2A 3G6JA 5E2UL 3OJDA 3TA3B 2HT3C 3QHFH 5EU4A 2A6KA 2VOTA 5D1XB 3ZHKA 1QFUL 5KN5B 5KVFL 5HHOB 2VXQH 1MCPL 2RCSH 5HGGS 1YEJL 5B8CB 1XF4B 5BXFA 5L9DL 1TVHA 1RK1A 2QV2A 3EJZD 1LHZA 2YRPA 3GJFH 5BV7B 3MOQA 1BD2D 3WFZA 1TENA 3QUZA 5LGHH 4MXWH 3OKOA 1NGYA 2V2WA 2YHGA 3K74B 4Z8FL 1PSKL 1BREA 4JM2B 1FVEB 4OAWA 1BZ7B 4GS7B 5IF0A 3MV7D 1DN0B 2AI0H 3MRKA 5M95B 1D9KC 1FO0H 1D5IL 4Q6IA 1CS6A 4E5XA 2FATH 3CX5K 4EKXA 5DT1H 3UC0L 5C70A 4P2QD 3QEUB 4M61B 5E95B 3WV0A 2FX8L 5GHWH 4GBXC 1ZT7A 4TQEH 5IB5A 5DHVA 1SY6L 3VGBA 3CSPA 3OV6A 2QSQA 1PZ5B 2NY1B 3AUVA 4PJ7A 2FX9L 1LILA 4L9LA 3IVKB 2Q6WB 4KJPD 1KSRA 2DLTA 2ED8A 3AB0B 4U6XB 5D5ME 4PJAE 4PGZA 3RDTC 2M1KA 4PJCB 3ZL4H 1LDSA 1IGIL 1NGWA 3MRQB 1FZKA 4KKAC 4MDJB 3KDMA 2XWBB 2IPTL 3MRHB 4LDEB 3WS6A 5J06A 4F3FB 1KYOJ 3H7BA 3BH8B 5BS0A 4MHHI 3U1SL 3VG9C 5EZJA 5JLZB 1C5DA 4K7PL 3OKKA 4OI9A 2V17L 1OTSC 4OFIA 4FQCH 1UB6A 4BQBA 2VJXA 4P3WA 4AJ0A 5DUBA 4BZYA 1JHKH 3BIKB 5HYQA 4B5EA 3U4EA 1A3QA 4IM8A 3CAFA 2H2SD 3EOYG 3NCYP 3OGOE 4BH7B 5JA8B 2YPLD 4PB9L 2IAMB 2YSSB 1A1MA 1WZ1H 4L29B 1UXSB 3I9GL 3OKDB 1NMAH 4N8CL 4ERSH 3U7AA 4C58B 5CSZB 2VC2L 4YFDB 4I3RH 4LOUC 4R8WL 3CU7A 3HZMA 4Y19A 2PCPB 5EU3A 4ODUA 1RUMH 3THML 4XWOC 5BRZA 1IGYA 4PP2A 1WBZB 1J5OL 3KXFB 3ZT5A 5IHUH 1YN7A 3PWVB 2ATPB 3V6ZA 1G7QB 4KMTH 4BA8A 3NZHH 5E8EA 3WLBA 4MNGB 2DI8A 3JV6B 4KROB 1BFSA 5DMYA 4CMMA 2CIKA 4N8VA 5DO2D 1MHCB 1AHWC 3QEGH 2G5BB 2UY7A 4MD5B 3IRPX 2NXZD 4PLKD 5BJTA 2OM5A 4NKDB 5IBTH 3SKMA 5IV2B 1PVHA 3ZKNC 2GTWA 4PJHE 5E2TH 1CZ8H 3FN0L 1IAKB 3V4PL 4I13B 3UYRL 4AIZB 4UNUA 3S34L 4J6RL 1G0DA 5JXED 1MIEH 1INDH 4GO6B 5CILL 4QRQA 2GEEA 1JPTH 5CZVH 5GRUL 3RWIB 5F3BA 3BPNB 2BVTA 2EE9A 2VWEC 5BZWB 3L3OA 1RULL 1IILE 1LO0H 2IADA 3H42L 1OARH 4G8GA 4NKMA 3D85A 5A16A 4O2CB 4EBQH 4HUVB 3QI9D 1PEWA 4JM4H 3PHOB 1ZGLM 1RIUH 2HRLA 4Y4FD 3TIDA 2X05A 5D7SL 1MFDL 3EJJX 5D7IA 5TGBB 2Z35A 4M5ZL 5KJRH 4I0PC 4JKPH 5E6YA 5TDOA 3AMKA 1WQVT 3EYVA 3VXNB 3BKJH 1MJ8H 5MEPB 1R5IA 1XF3A 4YHYC 1KG0A 1RHHA 3LSOB 5TQ0L 3TLRA 1YUHA 2PR4H 3G04B 4ODTL 4YZFF 1MPAH 4LHJB 5IEKA 1N3NA 2AP2A 2DBJA 4ZS7H 5EORL 5GISH 4XPBL 2R56L 1SBSH 5I1CL 5EC1A 2Y5EA 4XP5L 3VA6A 1MCWM 4Z7NE 3KYKH 3OAZH 4YFLF 3QULB 3GKZA 3IAGC 3WYRA 1UADC 3M1BB 3U0WL 1S5IL 4M5YH 2NR6C 3L5HA 3QQNA 4EI5D 4GRWF 4HUUB 1AE6H 5IVXB 1EIBA 3KPRA 3MO1B 4KGLA 4L4VA 1P69B 1KFAH 4BZ2H 5I1AB 1VADA 2EKSB 1MVFA 2BNQA 2BMKB 3I6KA 4P0DA 4WHYG 2Q87A 1YY8B 3EO9L 4UI2A 5IJVA 1U95A 4JRXA 4CMHC 1A2YB 2DI9A 4L9LC 4GKNA 1MCSA 4UQ2A 1KTLA 2XZZA 1MCRA 1M71A 3LD8C 3KPQB 5GSRA 1EO7A 3ULVC 5HGAA 2HWZH 4LSDA 5LAXB 2EZ0D 5L0QB 2DYPD 1I7ZA 3Q3GA 5CEYA 1IT9H 5CINH 3HN3A 4HJGB 3L3HB 5BVPL 3DYMA 4LRIA 3C08H 4MA1C 1MH5B 4YDJA 3I2CH 3QDMA 4M00A 5GJSH 4AIOA 1JPFB 4HS8H 4HMDA 1XCQB 3JV4B 1P9MA 1LP9E 4WUUA 2J8UB 2GFBA 4GAJH 5FA3B 5C0BD 1FFNB 2SEBB 2PO6C 4MMZC 3QDJE 2NY5L 4LLYA 4APQA 4G8FA 3C5SA 3HUJF 2VISB 4TNWF 3STZB 2YD8A 3ZDZF 3E6FA 1TETH 3C60D 2VNCA 4Y2DD 4DTGH 4GKOA 2Q7YB 3MC0A 4PUBH 3FTGA 3VJ6A 2X4RB 2VLRB 3SDXB 1OAYL 3K4ZA 3UAJC 5E08H 1KENL 4GLRI 4I77H 3RUGA 1E27A 1U42A 3MFFA 4HX1B 5C7XL 4FQHA 3GO1H 3DX9B 2C3XA 3S7GA 3VRJA 2I9LB 3ZKSD 3OXSA 4YR6A 1YC8A 4IRSA 43C9B 2VLJA 4C56E 3WD5L 5ITBL 4JN1L 1I1YB 3DBXA 3NGBC 2J3SA 3FKUS 3MLZH 3QRGH 4MD4B 5FUZL 2HG5A 4YDVA 4RIRA 5DRZB 3EFFA 1D5ZA 1GAFL 1T7ZA 4AL8L 3OKNB 2A74A 5CUSL 1IRAY 1B88A 4RWHA 4JG1L 3VGAB 1QLRA 2NY4C 1HXYA 4NHCL 5LQBL 4KPHL 1QOKA 4R97C 5JNYA 5ID1B 5HGHB 1EEQA 3WKMH 1CDGA 3ILPA 1DDHB 2IG2H 4PJGA 4PB0L 1FRGL 3NABL 1DBMH 3DO7A 3WFCL 3DUUB 4K8RL 4F7MA 1TPXC 4J4PD 4XP1L 1NSNL 1FN4A 3H9HB 3A67L 4HUXA 3CC5A 5K9JL 2DKUA 1T2JA 5EB9A 3UJIL 4S0TD 4LIQE 3MLWL 3C09B 2ZUTA 1BF2A 4A6YB 1T22B 2HJKB 2PYEA 4EN3B 3ME0A 1ZSDA 3VFNB 1NDGB 2P1YA 1IM3A 2D03L 3CLFH 5I73C 5IB3A 5D71L 3PJSA 2VAAA 2AJVH 1LO2H 3EW3B 1U3ZA 3TO4D 5DJAA 3RI5F 4JKLA 3QCTH 2I60H 4QXWA 4JFYA 1FG2A 4HPOL 4XBEH 5F89A 3QUXA 4ZOBA 2IALB 1CE6A 1AXTL 2BDNL 2VL4A 3ESUF 3D3VE 1GGTA 2LU3A 4QHMA 3ARTA 3MLRL 4AENA 4WTZA 4QCIB 5DQJA 4LP5A 1I7UA 3BP7A 1IBGH 1JV5B 2H2PC 4RBPH 4XNZC 4OUUB 5DRNB 4EVNB 5EZOH 3REVA 4Z7VE 1DQTA 2FRGP 5MEOA 1T1WA 5DHYB 2ZPKL 3GDBA 2NX5D 3ARQA 5D7JA 5ADPL 1JGLL 1J1XL 3QZWB 3DOSA 5HHVL 2C3VA 1BX2A 4ELMA 4P9HL 4LCWB 1J0KA 1QFWM 5E0QA 2CR6A 3GBML 3TN0D 2EDOA 3MLSL 1QTYT 3GSQB 3IF1A 2FJFA 4KC3B 2F19L 4LRIC 2WINA 3MTRA 4LSPL 4MAYD 1AP2A 1MOEA 2D0GA 4RA3A 2R1XB 4O4YL 5SV3A 5EG6C 3RAJL 3MLTB 2BSSA 3RQ3A 3KPSA 3RX7A 1LE9A 5F7KC 1FSKB 4LCUA 4NQCA 4MJ4A 3O8XA 3ZHDA 2JCCF 3NIFE 4Y16B 3CFEA 1I7TB 4YQXL 1MIML 3TT1H 3S96B 4N0FB 1N6QL 3X3GH 2O5XH 1Q1JH 3EYFB 1I8MB 5HDOA 1CR9L 3HNTL 1LMKA 4O2EB 4XVJH 5GRJL 3S5LA 1NKRA 4HIHB 3KS0H 4DZ8B 1MRDH 2XTLA 5E5UB 2VITB 1YDPA 1CBVH 1QG3A 2IBZX 2I24N 2Z8RA 4KJWC 4NQEA 1MF2L 3BISA 1NBVH 4ONFL 3WLWC 3TV3L 1E4JA 2BOBA 5D93C 4L3CB 2OTUA 4IS6A 5IIEB 3C5JB 2CDEB 1CL7H 4OCSH 3STBA 5DD0L 3HRZB 4YHZL 2H8PB 1YA5A 3PDOB 4JZJB 1CXIA 2X4TA 3RVXC 3DTXB 5EUKA 4NN5B 4K7FB 2KUTA 4NDMA 4LRNH 3SDYH 3DIFA 4MVBC 2B8OT 4Q74A 3I6GA 3MGTB 3FMGH 1ZLSH 4C83A 1J1OL 2H26B 3PNWB 3X14A 2GITA 1ZTXH 1P5VA 1EEZB 2WV3A 3BGFC 4G42B 3HI6L 3MA9L 4YLQT 3V6FA 8CGTA 3TWCH 2A9NL 5B39B 5DQDL 3DI2B 2QQNL 5IB1A 1JPGB 1HSBA 1JWSB 3QXUA 1U3HA 2WIMA 3D0VB 4DN3H 1J0ZA 2O26U 4JVWA 3STLB 2YA0A 5BZDA 1T1YB 4FFVD 4R90L 1M7DA 4NWUL 3QFJE 5IGXH 2IBBA 3SE9L 5E70A 1N59A 2H1PL 4PV8A 3BEWB 4AEHL 4NKQB 2ZUUA 4X5WA 2UYLA 2PKDA 3RZWA 1CDUA 3ES6B 4WFED 5T5FL 4LHUG 2C3WA 4C56D 5F7HA 4XPHL 2VN4A 3HUJA 3U9PL 1VFAA 2Y9RT 3BZDA 3TBTB 1FJ1B 2WQRA 1UENA 5HHQA 2VZ3A 3IGAB 1X9QA 1YYLH 3MV8B 3B9KA 3M8OH 3RGVB 2YEZB 4LKCB 1FAKT 3D18A 3ULUE 3WHE0 4TNWK 1RUPH 1YEKH 1KXQE 2ICEA 2NY6C 4NUGH 2WBJA 4QRUA 3FQRA 3MJ7B 3SCMA 3BO8B 3S36H 1RZ7L 2EXYC 4QXUH 2H6PA 3O2VL 4PJXE 3ZO0A 3QUXC 2X09A 3FHAA 4OBSA 2Q86B 4NWTL 3DI3B 3W0WA 4HDIB 3ZYZA 3RTQA 8FABA 3O6ML 1IEBA 3SE4A 4MQXD 5H35A 2WIIA 3EOAB 2EKJA 1L7TL 1RIVL 1T6VN 4G80A 4LEOA 4X98B 2AEIT 4BK5A 3GSNH 4FQLL 3GI8H 2M2DA 3S36X 4MCYB 1U8IA 2AXGA 5DZOA 1DBBH 1AGEB 1Y0LA 2Y5TA 4QWWC 2Y06L 4NO2A 5EU6B 5BMFH 3V4UH 5IMKB 4PGCA 3JV0A 3OAYK 1I3RA 3MJ6A 5D7JC 1GIGH 4HWEH 1I8IA 5BQ7B 3U0PA 5J6GA 1JWMB 5T3ZL 4LAJH 1AO7B 3VFOB 1WWWX 1ED3A 1RU9H 3SGDI 4V1DA 3DVNA 4F7PB 1L9NA 4QHKJ 5GGVH 4KUCF 4WFGE 1QRNE 1OPGH 3NCMA 5ACMA 1LD9B 4N0CD 1P1ZA 1UEYA 1JIBA 1QSFE 1MCKA 3SDAB 1ADQH 1Q9OB 3G5YB 1EZVX 5DK0A 4ZFOL 1KB5H 2B4CC 5FYKE 3CXHK 4OLUH 4L4TE 1OAZH 4M62L 1BFOA 2DD8L 1MCDA 2B5IB 1J10A 2PW1A 4RSVA 3T65B 1BLNA 5SWSB 1UM6H 3DVGB 5T3XD 2DRUA 3TCLA 4M03A 1RHFA 5FK9A 4ZD3H 4YHOH 4IJ3C 5C0AD 4PJFB 1OT2A 1MY5A 1QLFB 2ERJB 2DQDH 2AJZB 5I9QC 3EYSL 4KKLC 5BVJA 1H5BA 1F13A 3U4AA 4PRPB 3WXWL 1F4XH 4U1LB 4JFXB 1A8JH 4PJ8D 3RI5K 4DKEH 2O5ZH 3GM8A 4LLWA 2VDQL 3CFCL 3MX0A 4M93B 5EIIA 5FHAL 4JHWH 3EYOB 3LPWA 2PUQT 5IKCA 3ARPA 1IFHH 1MAJA 4PS4H 3VXME 3T1FA 2EYTB 1EAJA 2CRYA 3L6FA 1MREL 3QUMB 3D6GA 3WSQL 1H3PH 3BP5A 4G3YL 5E7FA 5FV2A 4B41A 4PJBA 4S1DC 1A9BB 4XWGH 1QPPA 4JFDE 3OGCA 3S6CA 3QIUC 4HUKB 2W9EL 2NTFB 1RQ5A 1MNUH 3FB5B 4NNYA 1W8OA 4HIXH 2Z4QA 5EN2A 4Q9RL 1S9YA 3KJ4C 2IFFH 3LDBB 1DQMH 1YEHH 1XF2A 2DQGH 2Y6SD 1U3HC 4J12A 1N6VA 3FFDB 1P7HL 1WCBA 3UXFA 4KTEL 4PRIA 3L3DB 4NGHH 2ZCHH 3MOBL 4CAGA 3CVHA 5DMIL 5LGKA 1LEIA 1NGXB 3H3PH 4YHMH 2ORBL 5GGTH 1TJHL 2DIJA 5FHBL 3WE6B 4WENB 3O81A 4JFFB 4F57L 1TZIB 4K3EH 1C8PA 5KS9A 4E0RB 3FFCB 5DDHB 4R2GB 4YK4C 1GSMA 1RZJC 5IQ9B 1DBJL 1KEMH 1JPSL 2IQ9H 4H20H 3F58H 5EBLA 2CLRB 4X4MA 3O2DL 3IFLH 1EEYB 1WEJH 1ZK9A 3U30C 4D0CA 2JB6B 2Y07H 4BH8A 2WBJC 3OZ9H 1H8SA 2NY3D 2R9HC 3FO2B 4YHPB 3EOBB 1U8PA 4KVNH 1G7LB 1UGNA 4IEFB 5E00B 3HE7B 2PXYB 1MVUB 4BSVA 4TVPL 5C0JB 3HZVB 3RY6C 5BV7L 4KZDL 3B83A 3RTQC 3LQAC 3SE4C 1U8KB 1CFTA 1BF8A 15C8L 2QHRH 4I2XA 4YHNA 3TJHC 2Z8WC 3QDJB 4YPJA 3CMOL 1Q0XL 3U6RB 3PWPE 4U0RB 2VB5A 1E6JL 3CDCA 4FG6C 1BGXH 3LS5H 1M05A 2CKNA 4XB7A 1DQDH 3EYUL 4WY7L 3NA9H 1UZ8B 3H0TA 1JVKA 1H9VA 4RMRA 3ULUD 5IBLD 2HFGL 3HAEG 5FV1L 3AGVA 1OF2A 4OZFH 3P4NB 3DHMA 4H8WH 2OYPA 3GHBL 2R4RH 3TYFA 1JGEA 2VZVA 2D7TH 5ADOH 3DUHA 4JO1L 1F90L 4YAQA 4KTDL 4CN6A 3IRZA 5CMAB 2XA3A 4KRLB 5DJ2B 3L7EB 4ZAKD 5C0DB 1U8OA 4ZUWA 4JCLA 2XZAH 1XGQA 4F15B 4CW1A 2PTVA 3VXOA 1OSPH 3ULVF 5JPMA 1PKQA 2NXYD 4OFYD 2C7UB 4LEXL 3LH2L 3R8BB 5FYJL 4G7VL 1OB1B 5IEHA 4HIEA 1IL1B 4O58H 2UZYB 4Z7OE 2NPLX 1QACA 5TH2B 4OZ4B 4JQIH 4LSTH 5D1QD 4YNYA 5ITFA 4K94L 4GKSA 3N85H 4TULH 1CDHA 2BFVH 3KJ6L 3MRLB 1H5BC 5DRWA 1EHLL 5E4EB 1BIIA 3BEVA 4RX4D 5L88L 4LSUH 4PY7A 4HIIB 1OGAA 5MERB 5LCVH 3ZTNH 2YBRA 4WFGD 1QRND 4YEEA 4BFIA 2HYMA 5HYSG 3NFPA 4S1QL 1UJTA 1QSFD 1N6UA 3UTSD 1NCAH 4NRXB 3FQXB 1RD6A 1CICC 3BXNA 3MJ9H 5AG9A 1D5XB 5IW1B 5I18L 5ACZA 3PXHA 5MENA 1NANH 1A14H 1ZVSB 5J1AB 2EEDA 1MUJA 3MOAL 2XT1B 3UTZB 5CJ5A 4O02H 1MHEB 3VXSE 4KVCL 3C5ZD 1YJDH 3BP4A 3GIZH 3FONA 5GRYA 3KS0J 3D9AL 1A1OB 2ED7A 2P8PA 1ZT4A 3D3VB 1NC4D 2HH0H 2XXCB 4YX2H 1QR4A 2YK1H 4IHOA 4N0UB 3VFUA 5IMOA 5C09B 1BOGA 4JGJA 1J88A 3ORJA 2LTQC 3NN8A 4JDZA 7FABH 1Q9KA 4U7MA 5HHXL 4GJTB 3P4LA 4L3EB 1I9RH 4HH9B 1HHJB 1T3FB 2B0SH 1AGBA 3L3JA 1W72B 1II4E 2FX7H 1TNMA 4H0HB 4JFDD 3WXVL 2O93L 4NQSA 4ZUSA 4Y5XC 1OAQH 3MACH 5DD3L 2XNAA 4XHJC 5C6TH 4DKFH 5C0GB 4ETYA 5CIPA 3GSVB 3TZVA 3ARFD 4EUPB 2DQUH 2OL3A 2F54D 4U1JB 2WUCL 2NCMA 1FFPA 2IPUG 1QA9B 5GGUA 5FO8B 2RFXB 32C2B 1AD0B 1BMGA 5F6HJ 1WSST 3U2SB 3QEQA 1JGDA 3CDYA 4WWKB 4NPYB 1P4BH 4PP1D 4OD2A 2DDQL 4P9HC 4YDKL 5E99H 4F8TA 3RGHA 2OJEA 1A9EB 1KLFA 4JEGB 5KSAB 1Z5LA 4NFDA 3L1OH 4YE4L 4I0KA 2FYYB 4ONHB 3K8MA 2FR4A 5E1AB 4X9IA 3MYJA 4MAUH 2AV7A 1WBXA 4HBCL 2R8SH 1FGNL 3U9UA 4GRLC 2HTKC 3FAXA 3ARGD 1RURL 5B21A 3BRDA 2GJ6B 4UQ3B 2DMBA 5I6XC 1S5HA 4YPGA 3DRTA 1ORQB 3QISA 1ZLVH 2VQ1A 3RX8A 3MRRB 1I8LC 4ZOEA 5D72L 3VRIB 4ESKA 2EIZB 4QRRA 4ODSH 4G6FD 1U8MA 1LNUB 3GMNA 3P4MB 1WC7B 1GC1C 4ODVL 5E94A 5ESVA 1CLCA 4S1SH 1QFWI 4PTTB 5KVDH 1DEEB 2FHFA 1R3LB 3NCCB 4UB0H 3OKLA 3GBNL 3PWPD 5FOJA 2HMIC 4UZGA 1NCCH 1FV1A 4U0QB 3TVMA 4JO3L 4L4JA 3V5KB 4FZEH 4ACPA 5TQ2L 3IJHB 2XZQL 5C0CB 1MWAA 2P46B 4YDLB 4YHIA 3H9SD 3LRHA 4YDIL 2IPUK 3O6LL 5D2LA 2XFXA 5FGCB 4WHCA 5HI4C 4HQQH 2XA8L 3QXDA 4M7ZB 1SEBA 4ZO6A 2FB4H 4XX1G 3ALWA 1JJUA 4ENEC 4GRMA 1G7HB 3IU4H 4J3WA 5F9DC 3RNKA 2KDGA 2CQVA 5FM5M 3V0WL 3VFGL 3B9DA 1XGTA 1R3IH 5E9DA 3PQYA 3UJJH 3X13A 4UAOC 1EMTH 3EGSB 1K6QH 4G9FA 3VXTB 3ZKMD 4ZNEE 3G6JE 2WANA 1HIML 2G75B 3O6FC 2HJLA 2MKWA 3E8UL 1CT8A 2BJMH 3RU8L 2WZPD 3KHQA 3T2NH 4QOKA 3SQOL 4NJAL 3IFOA 3I85A 1XR8A 1YEGL 1A6WH 2P49B 3PIQA 3MROA 3S4SB 4QRPB 3HC0B 4JDVA 4X9FA 1XIWB 3HE6D 2O5YH 4PJDA 1MAMH 4Y1AE 3P0YL 4HAFA 1Z6JT 3UZVB 4Y5YA 3ARDB 1YNKH 5IJKA 2WWMC 2J8UF 3O2DA 1WLHA 4LLQB 1KV3A 5D1XA 3ZSTA 4WEUD 5D4QA 3CK0L 4JFED 3RWHB 5KN5A 5B8CA 2F5AL 1F5WA 1XF4A 5E6IB 4Z7QE 4OQTL 5C08A 4R0LB 5D96B 4XMLH 1RUKH 4RFEB 4Q2ZB 4KRPB 2B39A 1AKJB 5CZXD 5ELIA 4OLWH 3K1KC 4PJ7E 2OJZH 4PREB 1SEQL 4X7TB 2QSCH 2K7PA 1HHIB 4Y8DC 4PJIB 3L3KA 1MFAH 1ZLUK 4A6YL 2E3VA 4S1RL 4JM2A 1FVEA 1BZ7A 1RZKH 2VXSL 1MCJA 5ID0B 1DN0A 4M7JH 3VXSD 5IVOA 3TZVC 5AWNL 4HS3B 3EO1B 3QEUA 4M61A 3FRUB 1MI5B 2ZZUT 1NCBL 1IAIM 3OG4B 5BS0E 3D2UD 5TF1H 4OFDA 1ACYL 1HN1A 2D7NA 1CLOH 1KLGB 1MCEA 2X5PA 1PZ5A 5EU7C 2Q8AL 1D9KD 2X4PB 2PF6A 3IVKA 2OK0L 3VFMB 2R0ZH 4XCEB 2DJUA 2OR9L 4OZGF 1K4CA 1JYNA 4GBXD 4OTXL 2ESVD 1EDQA 4XNYL 4H25B 5FIEA 3VDAA 2G60L 4PJCA 2I27N 1F8TL 3W9DB 3MRQA 4MDJA 1YMMD 2XWBA 3MRHA 2J4WH 4F3FA 3HPJB 3BH8A 3LAFA 5DC4B 3E1F1 1LO4H 4HH8A 5JLZA 3MA7B 1XCTB 2BNUB 4UTAH 4Y19E 4LNRB 3MR9B 5E2VL 3UCRA 3LRSB 4JFOB 4OZHB 2DAVA 4KKAD 5BRZE 3V9FA 3BDYL 3BIKA 4P4KB 5ESQB 5JW3H 4J23A 1T89C 3C6LC 4QO1A 4BH7A 2IAMA 2YSSA 1OTSD 4L29A 1CFVH 3QG7L 4PJEF 1UXSA 3QSKB 4HUNB 2NZ9C 3OKDA 1QBAA 3N9GH 3V6OC 5CSZA 2YRLA 1WISA 3V2AR 4FABH 2BRRH 4N1EA 5F7MC 2PCPA 4XP4L 4K71B 3LHPH 3UYOD 4XP9L 3TVMC 1KJ3L 3FQWA 1WBZA 4R4NC 4AEIH 3KXFA 3KLAA 4GMTH 4JRYD 4MLIA 5GS1C 1HWGB 1FDLL 3PWVA 4Q58C 2ATPA 4QTIH 1S7TB 4JFZH 4I0CC 1M4KA 3QHFL 2HTLD 4XWOD 4MNGA 3JV6A 2N7BA 3H8NA 4ZOCA 3M45A 5C0NC 1KJMB 1BZQK 2VXQL 3EYQC 4G8GE 1T20B 1MHCA 1Z0MA 1YNLH 1KYOK 1M7IB 2G5BA 4MD5A 3MRMA 3MXWL 4NKDA 2E9JA 3IXAB 3MRPA 5DEGB 5D7IE 1IAKA 3BIBX 4U1NB 1SHMA 4MXWL 4AIZA 5KANI 4HFWA 5MI0B 3Q1SH 1F45A 1UKTA 1F4YH 3ZKND 3PP3K 3RWIA 3VFRA 5IW6B 3MGAA 1FO0L 1KGCD 5BZWA 1TNNA 2FWOB 4P2OB 5DT1L 1WJ3A 4X6DB 1E4WH 2AJYL 2OI9B 4O2CA 4HUVA 4XPFL 3IDYC 4IMLA 5C0RL 3PHOA 4GOSA 4R4FL 4Y5YC 5KZCD 4U4BA 1VHPA 5TGBA 3FQUB 4P46A 2BP3A 3OMZA 5I8OH 4NM4L 3VXNA 5KSBB 3DUSB 1KN4H 5DJYB 3CSYB 5MEPA 5EO9B 4AIXA 2R1YB 2W9DH 3LSOA 5B8CC 5CEZL 4ODWB 1SYVB 3G04A 3KPRE 3HMXH 4ZUTB 3ZL4L 4L4VE 5ACLA 4MQTB 2EH8L 4CADB 2EDFA 4JRXE 4E9LA 1BECA 2ZWLT 2DLEA 3R8QA 1HK6A 1FYTB 1FH5H 1HQRB 4FQCL 1ZHNB 4RGMC 2JB5L 4JM2C 4JKKA 4S10A 4G9DB 3QULA 1FAIH 4NBZB 3M1BA 4JKWA 4NUJB 4JDTH 3QUZD 4NP4H 2NY0B 4KQ3H 5CCKH 1X4YA 5EBMB 1TZHB 4JPVL 1AY1H 4XVUC 4HUUA 5IVXA 1WZ1L 1IGMH 3QDME 3MO1A 1SM3H 1AC0A 5I1AA 4XCYA 2EKSA 3K46A 3L7FB 1DL7H 2BMKA 3BMWA 1YY8A 2NY1C 2B1HH 1A2YA 4MJ5B 5FOBA 4I3RL 3WJJA 2FO1A 3KPQA 4GG6F 5LAXA 3AB0C 3N1PC 4ZNCD 1KN2H 4PBVC 4UOJA 1KT2A 1BVKB 4HC1H 4HJGA 3L3HA 4HS6B 4HLZH 4Q0XH 3MV7B 4LPWA 4X5LA 5IHUL 4G6AC 3FOMB 1ZWIB 1MH5A 4JPWH 5DD1H 4UV4H 3TH2T 4KMTL 5F7LB 2LAAA 3U0TB 1JPFA 3LS4L 2ICWA 4AG4H 4OV5B 1XCQA 3JV4A 1A7RH 1NJ9B 3RUGE 2EIDA 2X89D 5HJ3A 4H1LB 1KCLA 5FA3A 5HDLA 3VWJB 2BK8A 1AI1H 3VH8G 3QEGL 5BS0D 1N7MH 2HLAB 2VISA 4W4OC 3STZA 3IFNL 2IQAB 1CZ8L 1NCUA 3HB3C 5E2TL 2LAGB 2Q7YA 1T80A 2P24B 4J7RA 2X4RA 2VLRA 3SDXA 3GKWH 1FFRA 3R0MA 4WI7A 5GJTL 3GMQB 1JPTL 4YHLH 1I4FB 4N1HB 1J0JA 3QPXH 4HX1A 2IH3B 2XTJE 5DMGC 3S8WA 1IEAA 4GAFB 1OARL 4JGMA 1U8HB 3DX9A 2I9LA 4Y19D 4ELKB 4YC2B 3UAJD 43C9A 4JKPL 1MELA 1T21B 5BRZD 1D6VH 4KROC 1I1YA 3BKJL 1WBYB 4UUJB 2IF7A 4MD4A 2Y23A 2F9BT 5I15H 4WU7B 1KLUB 1OAXH 1RUAH 1RVFH 3H9ZA 4MNQB 5DRZA 5DXWA 2FH8A 1OTTC 2MPAL 1AGFA 3REWB 4GLRH 3QO0B 5D9SA 5ID1A 2V9RA 2E27L 2PYEE 5GISL 1ZE3C 4LLUB 4GW5B 2JJSA 1AIFB 2X1PA 4H0IA 2MTPA 3QUML 3KYKL 1NBYB 4LIQH 4OQTA 2IANB 2NY4D 3TBWB 5GS0L 4KJQC 3FRPA 2F58H 4WDIA 4HEME 4HV8B 3H9HA 2I07B 2OQJA 1I3GL 2VYRE 3MCG1 4L5FH 4BZ2L 1KFAL 4LDOB 4A6YA 4J3VA 1T22A 2HJKA 3MCKB 4P46C 4EN3A 4RFOH 3VFNA 2FL5B 1NDGA 5TJWK 4G8GD 2JELH 3D85D 4CVZA 2V9TA 2NW2B 5LVEA 4LSSH 3S98A 5CINL 1TJIH 1T4KB 1HCVA 2DJ4A 3O3EB 1FHGA 3V52H 1IGTB 2IALA 2FJGA 5GJSL 3BYYA 1A6AB 3MLYL 3QI9B 2IBZY 1WT5C 1UQSB 4MLSA 4ELME 3S37X 2CGRL 5T3XH 4KKBC 3VI4F 1B0RB 2HFFB 4YFLI 4PRAB 5TE7L 4JR9H 2ZJSL 5DUPL 4L8BB 3BHBB 2Y1VA 1CU4H 4NC0B 4OLZH 1U92B 3BSZH 4Z95L 3ZDXF 1JV5A 4ZQKB 2VDLH 4OCWL 4OUUA 5DRNA 4EVNA 4WFHE 3SKJH 4NZDA 1MFEH 4HMCA 3KPSE 3SJVB 1F02I 5DHYA 3VXUD 1JI1A 4XC3H 4NQCE 3QZWA 3KPRD 4J3XA 5E08L 3D0LB 4I77L 5L0QC 1QLEH 2H2PD 4L4VD 4BM7A 4LCWA 2BNQD 2G9HB 2C1OB 1BWMA 3GSQA 4JRXD 4KK9C 4P5TC 4ZTOH 3NTCH 2Q3ZA 1SJEA 2ITDB 2CO6B 1J7VR 3MRFB 4WVRA 2R1XA 1KBGH 2DQTL 3V8CA 4JRWA 3MLTA 3LZFH 3MLZL 2OMNA 4NQEE 4C54A 1ZAGA 3J8F7 1RIHH 1NLBH 4Y16A 3CZFA 4LCCC 1I1FB 3C2AH 4OZIF 3MQIA 3NCJH 3S96A 4N0FA 4WUUD 4K2UL 3EYFA 2A6DB 3WKML 1I8MA 1JTTA 2IG2L 4XMKH 1FPTH 2F15A 2W1NA 4APQD 1HYRC 3EHBD 4HIHA 4NQVB 4DZ8A 1KCSH 5B3JE 4FQXB 2VITA 1KB9J 3SE3A 4EI6B 5A1AA 3NAAH 3TNMB 4UDUB 5D1ZB 4L3CA 1BVZA 5IIEA 1XF5B 3C5JA 5CBAB 2CDEA 5JDSB 1R3HB 4Y1AB 4UT6H 1XH3A 3HRZA 5AYQA 2H8PA 5C0BB 1DBAL 3UJTL 5B38G 1LEKB 2VDMH 1OP9A 3DTXA 3GJFK 3EFDL 3WLWD 4JY4B 5C86A 2EECA 1YJDC 2E7LA 3CLFL 3I3EA 3MGTA 4LSQH 5AZ2H 3MJGX 1MCOH 2H26A 1IQWH 3PNWA 3RWJB 3KR3H 1LO2L 3BZ4B 1ZV5A 1EEZA 4G42A 4IRSD 2VLJD 2NY2C 3RVXD 3HUJE 5B39A 4GXUN 4Y4KC 2I60L 4PRDB 2VZOA 4MVBD 1JPGA 1NBZB 1JFQH 1G6RH 5F7EL 2JJSC 2JK5B 3GHEL 5J12C 1KXVC 3STLA 4HXAL 1X5HA 5DJZB 5I8CB 4X6CB 1T1YA 3PG2A 1NAMB 3EBAA 3BEWA 3TT3L 1UCTA 1Z3GH 3ES6A 3EJYC 4YBHA 4M48H 3ULUH 3W0WE 3C09C 5H94B 3TBTA 1FJ1A 1EZVY 4Z7UF 1MSPA 2J5LC 5F8QC 3IGAA 1H3WM 2A9MH 2ZG1A 3MV8A 2E8ZA 3RGVA 3VMPA 3DX8B 1Q38A 1G9NH 4LKCA 2QLVB 3U79A 1LVEA 4U6YB 4MA7L 3GNMH 1GPOL 1VKXB 4UIMB 3MJ7A 1V7NL 3JBG7 3BO8A 3KYNB 1FE8L 2HN7B 3NACH 2PYED 3PWNB 4S0SD 2CLVB 5GGVY 4AM0B 3GSOB 4U6VH 4X7FC 2C4FU 4O00A 2Q86A 4HDIA 2GJZB 4AT6A 1UZ6F 2GIYA 3AS1A 3W82A 4Z9KB 1N5YL 3EOAA 1TQBC 4X98A 2Y25A 3QUXD 4V1DE 3VMNA 5F7NC 2CUMA 3QP3A 3DGGB 3WS3B 1ZANH 1CG9B 4MCYA 3HZKB 3F6LA 2V7NB 3X3GL 1Q1JL 1AGEA 4ZTPL 1UWGH 4JB9H 1CDYA 5EU6A 1XZ0A 4Z7WB 3EO0B 5IMKA 4X9BA 1A02N 5E2WH 5IP4A 1K4DB 3GMOB 3FL7A 5BQ7A 1IARB 3MREA 1R5WB 1JWMA 1CBVL 1YZZA 4WV1A 3VFOA 2WSKA 1ITCA 2P5WE 1BP3B 1YY9C 5FYKH 1A3LL 4QWWD 4CVUA 4F7PA 4QTHB 4OCSL 4LSRH 2I5YH 3OKEB 3W5NA 5D7JD 25C8H 2Q76B 3NH7H 4Y4FC 4DGYL 2HAZA 4X4ZA 1NGPH 1Q9OA 3G5YA 2YD4A 3SDYL 4JHAH 3UX9B 3AREB 4B7IA 4FMFA 1X6LA 1FSKC 4K3DH 5I1KH 3FMGL 1ZLSL 2DJSA 4Z6AT 3SGEI 1DR9A 1F00I 1A47A 4IIQC 3T65A 4KK8D 5GIRB 4Y16C 1CXKA 2QR0B 3O3AB 2NX5B 1B3JA 2GJJA 3PGFL 4WFHD 3SGDH 2DTML 1UVQB 4PJFA 3KPSD 1HSAB 4PJBE 2L4OA 3F12B 1QLFA 1T83A 3QDGB 3O8XD 1UJ3A 1YEEH 4HPYH 1RSFA 4PRPA 3O9WB 5IGXL 2CLZB 4U1LA 4JFXA 4NQXB 4M7LH 2EIBA 5EPMB 3VW3L 4QY8B 3EYOA 1CLYH 3V5HB 2M26A 1C1EH 4RISL 4KKLD 4EI5C 2EYTA 1PZUB 4RGOH 5CEXA 3QUMA 5IMMB 4PRIE 4ZFZB 3HI1B 1BBDL 4LPXA 1RV6X 4NQED 1CE1L 3KPNA 1YYLL 1A9BA 4XAWL 1IGCL 2E7LC 1KJ2A 1U91B 1MFCH 3FB5A 4R9HA 4K9EL 4FA8A 3FQNB 3OAZK 3S36L 5DJ8B 5KS9E 2W92A 5L2KE 1QFPA 3HI5L 5D2NB 4X6FB 1F3RB 1I1AB 2X4SB 3RY4A 5AYUH 1T5XB 1NFDF 3FN3A 3QYCA 5F1IB 3DX6B 4X4ME 3FFDA 4HLJA 3VGGA 1G9EA 1Q0YH 5IHLB 1KCVH 2UWEB 1NGXA 5IWLA 5FECB 3DECA 5DC9B 1A6TB 1RUQL 1U3HD 4ODHH 1UG9A 4CVXB 3WE6A 4YFEA 1TZIA 3JWDH 2G2RB 1RZKC 1F4WH 3I75A 1Q72H 1DBBL 3LQZB 4E0RA 3FFCA 1WZMA 3FT2A 4ONOA 5IQ9A 3WNNA 2EE3A 4I2XE 3IS1X 2R23B 3BPOB 1CD9B 4GSDH 4DAGL 4HWEL 3TIEB 2D3VA 3G6DH 3N50A 2JB6A 1I3UA 1RJCA 1N0XL 3FO2A 1YMHB 4YHPA 3EOBA 3FHQA 3D39D 1EVTC 1G7LA 5ERWB 4JVUA 3HE7A 1UFUA 2PXYA 1MVUA 1W8NA 3B9KD 4XPTH 1U36A 5C0JA 1MEXL 2W07A 4RGNE 3V7AG 5GGVL 1KEGH 3HZVA 1H3UA 2AJXL 4MB3A 5CJOL 1FNGB 5F1NB 4XXDB 2WBJD 3SCMD 3PGDA 1U8KA 3N1GC 1KB5L 2R9HD 2EDRA 3LKRB 5GGQH 1D5MB 5F70A 4S11A 5CP7B 2RQ8A 4DK3A 4OCXH 3PWLB 4F7TB 3QDJA 3SE8H 3U6RA 2WUBH 1QHOA 3CDGA 3W0WD 4GMSH 3RTQD 2XRAH 2CH8A 3BKMH 4YHOL 4LK4A 2OP4L 4ISVB 1UZ8A 3W2DH 2PTTB 1JRHI 3TJHD 2IWGA 4YBQD 2DQDL 4KZEL 5J7CC 1JGUH 4FG6D 4JFPB 2VDPH 1PKQE 4LSVH 1A6UH 4NZRL 2XQBH 3OBAA 1DLHB 1F4XL 2CK0H 5ALCH 4NC1E 4WV1C 3P4NA 4DKEL 4MJ6A 2ITCB 1IAOB 4LCIH 5FCSH 3HRPA 4D3CH 3P9LB 4U7SA 3QO1B 1AJ7H 1IFHL 4PS4L 1WIUA 3JUZA 4IRJB 5DLMH 1UM5L 2QBWA 5CMAA 1QVOB 5DJ2A 4OI8A 3L7EA 1H3PL 3ZYJA 1VEMA 1CTOA 1BAFH 2BNRD 4KI5C 5C0DA 2MQ3A 4V1DD 1OGAE 2HLFD 1HI6B 2X4NB 2C7UA 4KFZC 4OB5L 1OB1A 5CJXA 1IL1A 5SV4A 5I17B 1DQML 2HFTA 1QZ1A 3TO4C 4P2YA 2DQGL 4UMGA 5EC2B 5C6PB 1L7IL 3I3BA 4UV7L 4OZ4A 5TH2A 4FXGB 5MENE 4Z0BH 1ZT1A 1UJ3C 4PR5B 1J1PH 4HHAB 5EUOF 5IBUG 1X5AA 3IFPB 3MRLA 4NGHL 4RFNB 2QL1A 3AAZA 3GJEB 2JKXA 4HIIA 4WEBH 4XVTH 5MERA 3UBXG 3QFDB 1S7VB 3M17B 3MXVL 3QNZB 5A40E 3B9EA 5H2BB 3NPSB 5FYKU 1A4KB 4NRXA 2PTUA 2R39A 1IKFL 1KEML 1D5XA 2IQ9L 3NA4A 4PYGA 5IW1A 4ZUUB 4NC2B 1S3KL 2X4OB 1ZVSA 5J1AA 3IFLL 5C0AB 2XKNB 4FFYH 3UTZA 2JIXA 2YA2A 3OZ9L 2ICES 1MHEA 4HJ0D 4KUZH 3LDBC 1CICD 1ZEAH 4KVNL 5DGRA 1MCWW 4K8RD 4QXTA 3TN0C 3BJLA 2XWJB 1A1OA 3Q6GL 4ZS6C 4U31A 3WNMA 4OZHF 5I76B 1A64A 4OLYL 4FFWC 2IC2A 1PDKA 3D3VA 4RBPK 1UCBL 2BVQA 2QHRL 4K3JH 3KPPB 4PGBA 5IWLC 1DANU 4N0UA 5I1JH 1M6OB 1BGXL 1QHPA 2JF1A 5EBWB 3RPIB 2HKFH 3PUCA 5IHBA 5AG8A 3WIHH 2I9TB 4L3EA 4PRID 2AABH 1D5BB 5EU7E 1T3FA 2K1MA 5K93A 2A73B 4P99A 5DA4A 1KPRB 1W72A 3BWAB 4UIKL 3GZKA 5T3ZE 3ZDYF 4UBDD 4ONGH 3LRGA 1MCQA 4ZO8A 4WO4B 4MDIA 3MMEB 5C0GA 1BOYA 1GYAA 1A4JB 1XGPB 3GSVA 5DJ0B 3QWOB 4EUPA 5T33L 4H8WL 3MUZ1 2DTSA 4U1JA 3HE7C 1S7WA 3MRNB 5DC0A 1QA9A 4NO5B 1FL6B 5FO8A 32C2A <