5I1LB

Crystal structure of human germline antibody ighv5-51/igkv4-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB LIGHT CHAIN
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 213
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1lB01
1IGIH 3HFMH 1LK3H 3CMOH 3TJHD 4DUWA 3RGVD 1F4WH 1XF2A 3KS0J 1NJ9A 3DMMD 3HAEB 4XNQB 1NCTA 5J1SC 4JZOA 3WXWL 3DVGB 4RBPK 4G6AD 3ARQA 3C9NB 3SDXB 5B4MC 2P24A 3RVVC 3V4UH 3QFJB 3G6AB 4HDIB 1KULA 1B0RA 3RBGA 2YPVH 2DQIH 3V7MA 4F3FA 2ZOKA 2BJML 1AR2A 4NJAH 4D9LH 4BZ1H 2VDPH 4KJQD 5CJ5A 5MHSD 3S7GA 1RI8A 4YEEA 2VLKA 2ITDB 1QR1B 5DMGC 2MWCA 4JJHA 1S9XB 4Z7VF 1Z9LA 3DI2B 3WKMH 2DLHA 3ZHKA 1NQBA 4LK4A 4YAQA 4KJYA 2VR5A 5D7SL 1KB5B 4ZG1A 2HVJA 3CFBB 2BVOB 5IF0B 1I8KA 3D3VE 4PJHF 3ULVD 1G9MH 5HGHA 4ZFGL 1R5VB 3O3AB 1G7IA 5LGKA 4I18A 2VWEE 3O6KL 2FD6L 2HT2D 3VWKB 4CU8A 4EI5C 5GZNC 1QFWH 3VFWA 2JK5B 4V1DD 3QULB 3QEQB 4QNPE 3L5WA 1E6JL 1QSFE 3MV9B 4YDVB 1PEWA 5DD6B 2WUBL 3V5HA 3ULUH 2C1OA 3M8OH 5FECA 2EDHA 3IU4H 2AS5M 3TYFB 3CVIH 3BP4A 1P4BL 3L6FA 2GJ6E 3GSOB 5F88B 5D1QA 4IJ3C 3VU2A 3DTXA 2QHRL 1CICC 5JO5A 2XN9B 2AJZB 4G9DB 4QRPB 3WO4B 5CSZB 1M7DA 2BOBA 5CEZL 1SJEA 1I3RB 4ORGB 2Q8BL 2D7MA 5DURD 1N7ML 1D5ZB 4AH2A 4KMQA 2FHBA 2G60L 1R3LA 3I6GB 4ZTPH 4L4TB 3DX7B 1F4YL 1U8NA 1G7HA 1CLYH 2CLZA 2X9WA 3ZYOA 4JVUA 1F6AA 4F9PA 4JPIA 3GIZL 5EFIB 1EZVX 5C6WH 2CO6B 4PJEE 1DUZB 1I75A 5ALCH 2ICCA 1YYML 3D18B 1BFOA 2VIRB 1V05A 2ITCA 1AIFA 1LDSA 1ZGLB 2RR3A 1I9IH 2C7UA 4P57A 3UTQA 5AD0B 5DMYA 1I1AB 2QADD 4QRRB 5C2UB 1XGTB 2R1YB 4TUJA 2R39A 5I8KH 2WWKO 1RU9H 4GAYB 4HFUL 3MXWH 1G6RB 3DV6A 4CBPA 2X9XA 1KC5H 2X89A 5F89A 2FEDD 4KU1A 1T1XA 5C7XH 2Q7NA 1L4IA 5F7EL 3CLEH 3E0GA 4MJIA 3QUML 4CVXB 4PJ9A 3TBWA 5CD3A 1T7XA 5INCB 4QWWC 3LIZH 2GK2A 4QRQA 3RZWA 3I9GL 4W70A 3FOMB 1DL7H 4UINH 2O5YH 2I24N 5IMOB 3RTQC 1VKXA 2XA8H 1AY1L 2A77H 3WUWA 1UB5B 4WY7H 3O6FA 2J88H 3U0WH 3T65B 4H20L 3V8OA 1NC4A 2XWTA 3GI9H 4IDJH 5DQDL 4CMMB 3U2SB 2AV7B 3KPNB 2FHCA 2XKNB 3BW9B 4J1UB 4MAUL 1OT2A 4HC1L 3T2NL 4QXGH 1LD9A 5HTSA 3TJEH 3LKSA 4L8SA 4NT6B 4DOHB 1IMHC 1EEZB 4O00A 4PJDA 4OJFH 3VGGA 1JGEA 2HKHH 2VDLL 4QXUL 5E8EA 3HUJF 5E6YA 3MLZL 4XP9H 4HWEL 2W0KA 3QT2A 2X4UA 3I75B 4P4RB 4MCZA 2B5IC 2ZUYA 3O9WA 2VZ1A 2B20A 3RUGE 1PW3A 1QBLL 3D3VA 3SE3A 1HSBA 1FH5L 1YJDC 3GJFB 2ORBL 4U2ZA 1T1ZA 3GSUB 4KPHL 4Y1AA 3WFHA 3L7EB 1R3KA 3CUPB 2SEBA 5HJ3B 2GTZB 2E9BA 1LP9B 3NIDF 2IGFL 2XQBL 4OGYL 3QDJB 2MCG1 4JRYD 4PJ5B 1RURH 2GUOA 5DEGB 3EZ8A 3VXQB 4I1NB 4MJ2A 3P30L 2A83A 2ICEA 4ALAL 2DF3A 1OTTC 2J5LC 3OTTA 1OLLA 1MFEH 4X6FA 4YO0B 3RRQA 1FG9C 4KMLB 5BJTB 4AQOA 3TBSA 3W5NA 5EO9A 4UQ2B 3QWQB 5JZ7C 5GJTL 2ZUXA 5FAAA 3MMEA 2JB5L 2EDDA 2FL5A 3DUUB 4ODWB 1TZIA 4YBQD 1KXTB 1RSFA 2DQCH 3RNQA 2IQ9L 5DS8A 2HTLC 1I8MB 1SM3L 5ESAB 3N1QC 5L7XL 3U36A 4OI7A 4WIQA 4JFQA 2YD8A 1QRNB 2ICWB 2Q3AA 3WFDL 3SBWA 1MCNA 5EBWA 4RDQG 4HPYH 2Z31D 3IDNA 3ESUF 1J8HB 4GBXD 5GRVK 4M93B 4U0RC 1CE1H 3SKOB 5ECJE 1KGCE 1FO0A 4JG0L 3RU8H 4PBXA 1C08B 5BMFL 5C8JB 4PJEA 1M71B 5CP7B 1G7JB 3FHAA 1P7QD 4EDWH 2DBJA 2E6JA 4OD2B 3SN6N 4UDTA 1FVCB 1U58A 4WWKC 3QUXB 5IROC 2NTFB 3KYOB 5DQ9B 3UC0L 1S3KH 1OY3B 2EDYA 1HSAB 2BSTA 3O3DA 1CFNA 3HNVH 3TLRA 3L5XH 1EAJA 2WLZA 3KPRE 1FP5A 1X4ZA 5E8NB 5INDA 12E8H 4BH7A 1FC1A 1XIWD 4S1SL 3RHWK 1EX0A 4GRLC 5GS2H 2AXJA 4LVNB 2IJ0C 4H88L 1JPTL 5F1OB 5MEPA 3VXRE 1KIPA 1C1EH 3MGTB 5I1DA 5IHBA 4YHKH 1IC1A 2RFXA 2YD6A 5CINL 5FK9B 4FXKA 3I02B 2DL9A 2VABA 3VG9B 2CIKA 4LDEB 1U3HC 2BMKA 3V7AE 5FUCE 1BF8A 4UAOC 3EHBD 3CSGA 5HVHB 5HYEA 4DN3H 3LPGA 4PJXA 3UO1H 3EDFA 4YHYB 2D7TH 4NJ9L 2FX7L 3QAZC 1MY7A 2ZUQB 3QH3B 3TBYB 3UJIL 4KI5C 5DK2B 3VFUA 3VXSD 4Y4FC 5EU7E 4MS8D 5EIIB 5SX5K 1JPST 3M17A 5D2LE 4EN3C 43C9A 3LKOA 1A3RL 4F58L 4Q9BA 2Y07H 2OI9C 1NGPH 4DK3A 2CGRL 5TF0A 3TO2A 2WAHA 4QYOA 4NM4H 3JUZA 2X9YA 3HS0A 5FCSH 4NBYB 2Q7YA 3G04B 1JRHL 2B0SL 3EO0B 5GRWA 1TFHA 1WZLA 4NUJB 5SWZB 1DFBH 4JJ5A 4U1MA 4ELMA 4KJWC 3MRQB 4R2GB 3S36H 1HDMA 2J2ZA 3REVA 4G5ZL 4U1LB 1TXKA 4C56A 2APBA 2FB4H 1OL0A 1F3JA 1FL6A 1S7RB 3NZHL 5SWSA 3RUGA 2NMSA 5A2IH 2IAMA 5IBUB 1K4DB 2AQ2A 4PJAA 1DLFH 1ZGLP 2BSED 4NNXB 3QEGL 2QBWA 2R0WH 3HLAB 4TUOB 5DGRA 3IDXH 4LSPH 4NRZA 5M95B 2UUDK 1OP5K 4MJ6B 3U6RB 3BVNB 3FFCE 1QYGL 3KXFB 3P11L 3S96A 5GHWH 1N3NB 3HAEH 1CFTB 3SEPA 4N8VB 4LPTA 4YXHH 5FYKE 4D8PB 5J1TC 3RHWF 3TA3B 1BQLL 2PO6A 3FZUC 3VFPA 4Z95H 4FQLH 4XP5L 2IMMA 2OK0L 2YXMA 2PW2B 1VSCA 3FB8A 3E8UL 5JLZB 3FB7B 3OR6A 3O0RL 5D7IA 5DK0B 3BQUB 4AEFA 4XGZB 1MCHA 4X6DE 1ED3B 4P9HH 2EYTA 4NSKB 5DMIL 5HGBB 2NW2B 4EVNA 4WEBH 1A1MB 1M4KA 3EDEA 1C5DA 4QRSB 1PLGH 2E3VA 2F53B 4DZBA 2VXQH 3IFPB 1U0QA 4O4YL 2Q8AH 4JFFE 4XNUH 4N0YL 1ORQB 1Q0YL 1V8HA 1FVDB 5E9DA 5JXAH 1KB5H 2DQUH 4Z7VE 5D1XD 4NN5B 4HMDA 4QRTA 4RA3A 5J13C 1B9ZA 5F9WB 3GRWL 2B8OT 4RFOL 1MREL 5IVZA 1OF2A 4WUUB 3MACL 3FJTA 1DBKL 4HCRL 4KROB 2WIIA 4Y2DD 2E5EA 2W9DH 4YPJA 2M2DA 1TTUA 1UM4L 3SJVB 4O51B 1P2CA 4ONOA 3AXLB 4JAMA 1ZEAL 1CZ8L 2GCYB 3O8XD 5D7LE 3DARA 4QY8A 3OKKA 5GS1A 4L3AA 5DC0A 4F2MA 3QUMB 3RA7H 3EO9L 3L3DB 3OF6A 1QHPA 4B41A 4XRCB 7FABL 3BWUC 4LSDA 4OIAA 2YZ8A 1EGJA 3GHEL 1HI6A 1CGYA 3QIUC 3OHXA 1AFVH 1A0QH 4YWGL 4KDWA 4JGMA 1IGJA 1TVBA 5D7KD 3T8XB 5DZNA 2FO1A 4MAYD 1JNJA 4L4VA 5K33A 5HDOA 4Z7UA 4HUKB 5IB3B 5BZWA 2GSGB 4XX1G 2B1AL 4J4PD 1G9MC 1RIHH 2R69H 3F7PC 5KVGH 1KPVB 1F2QA 2D31B 2IH3A 4MNGE 1WCBA 3IFNH 4X99A 5JDSA 1QVOA 4ONGH 2YD1A 1P6FA 1RJCA 1T2QL 1XCQB 4AEHH 4ZDHB 2YA1A 4DUVA 1NGXB 2IALA 4LSVH 1T1WB 2M26A 4QCIA 5DUBB 2YKLL 3ULUC 3T0EB 1G6RH 5M94B 2VKWA 3M1BB 3AS1A 4K71C 1NUFA 4NKDA 2EKSA 1W0VB 3VXNB 1B4JH 3L7FB 3GM0A 32C2A 1AR1D 2H1PH 4LARH 4C58B 2QKIA 1OGAD 1LO4L 3PV6A 4PJGB 1R3HB 1HHGB 2YEZB 4HZLB 4TPRH 2AV1A 1UM6L 3MV8D 4I77H 3FO1B 1EXUB 5E1AA 3I50L 5I76A 2HWZH 1MJUL 5BOPA 4J3UA 2J7LA 4J3WA 3QHFL 1BQHB 3OGOE 3ULVF 3BHBB 3QQNA 3MNVA 4U6YB 1TQCC 1NEZB 2VLJD 5DMJB 5E4EC 4FG6D 1OP3H 3LEYH 2EE6A 4NBZB 1MAML 5B39G 3HMWL 4FQJH 2CDEA 4I5BA 1V7NH 4X4XA 4XPGL 4NZUH 1IAIL 3BKCL 1XF2B 4NYLA 2FHFA 1NJ9B 5ANME 2KQMA 4RCAA 1KCLA 4LCIH 4UU9A 5CJQL 4JZOB 4FFVD 4CKVX 3Q6GH 3THMH 3ZLQC 2F5AL 2OM5A 4AQ1B 1B88A 2DMKA 1R3IL 1LO2L 2P24B 5B3JF 5DUMH 4G8GD 4LLDB 1UQSA 3HUJE 4PGDA 5DI8A 4JN1L 4Z7VA 2ED8A 4F3FB 2CUIA 4NC1C 4PD4K 1J86A 2DLFL 3H9SE 4HWBH 2MHAA 1X5KA 3WO3B 4OIIL 4PJHA 1DSFL 2HH0H 4OKDA 4PLKC 4NQTA 1U93A 1ZHBA 4YAQB 4XP6H 2GSIA 3NIDE 5E6ZA 3WIIH 2HVJB 2GITA 1L9MA 1I8KB 4E9LA 5C92A 3BH8A 1TITA 5HGHB 3LOWA 3TBTA 2FBOJ 5IWLC 5D7LA 2B1HL 4DVRH 5DJAA 3BT2L 3VFWB 5I1KL 1JN6A 3IFLH 3F8UB 1ETZA 3STZA 3L5WB 2UZIH 5A3IC 1YEIL 5C08D 2XY1A 2CSPA 4I4WA 4BM7A 2C1OB 5GGVL 5FECB 2K7PA 4HBQA 3BP4B 5CZXD 5D1QB 3DTXB 5JO5B 3H7BA 4M9PA 4WJ5A 4XP4L 2BVTA 1M7DB 2VXUH 4DW2H 1SJEB 3K8KA 5B8CA 2Y25A 4MNHA 3MCLH 5EA0H 4JKPL 2BNQD 4AH2B 3OPZH 3CFKA 4DWHA 5BVPL 2DM3A 5IR1A 2NTSP 3QCUL 1R3LB 4C83A 3D85D 1F4XL 3NIFE 3BXNA 2BNRD 3KPMA 3GMMA 4RMSA 3SKNA 1U8NB 1G7HB 1RIVL 2CLZB 3B9KC 4JPIB 1YY9D 2V7NA 4PJ7E 2VZVA 1YEGL 3V6BR 1FGNH 3OJDA 3GO1L 5T1DH 5JW5A 2ZCKH 5DHVA 3TVMC 1IGTA 1BFOB 3MC0A 3GFUA 5FM5M 2ITCB 2DQJH 2CRYA 5IJKC 1AIFB 2JCCA 3ELAT 4GAJH 3HB3C 4LIQH 2C7UB 4P57B 3UTQB 5I9QC 3HC4H 1IGCH 1OWRM 4TUJB 2YD3A 3PP4L 5KOMC 3DV6B 2Q6WA 3KJ4B 5F89B 1A6VL 4HKJA 1T1XB 4DAGL 1YNKL 1FPTL 4MJIB 2GJZA 4MMZC 4JFDD 3KYNA 3TBWB 5CD3B 3FTGA 2EE9A 4H8WL 1RVFH 4QRQB 3WXWH 5F8QC 3CFJA 5HHQA 1IAIM 4P5TC 5F6HJ 5D7JC 4E0RA 4PRIA 2XWBA 1VKXB 1GOFA 4UTBL 3C60C 2HTKD 5T1KA 8FABA 2EDJA 3WUWB 2CKBA 4NP4L 2VISA 1DQJA 3O3EA 5T3XL 1S5IL 3O6FB 5FIEA 3HG1D 3GGWA 1YMMA 1D3CA 4UMGA 2Q3ZA 2XWTB 5ID0A 4U1GB 1U8LA 4YHOL 1G0YR 4KHTH 3SDDD 4GW1A 4QOKA 3VRLF 4DKDC 3SE4C 4WNQA 1LD9B 5D7SH 3HUJA 3LKSB 4L8SB 4NZDA 4F7MB 4OFYD 4ODUA 4PJDB 3H9SA 4XBGA 4MQXC 1N6VA 1RJLA 4MD0A 2AQ3A 5E8EB 3O6KH 1Q1JL 5D5MF 2FD6H 1FG2A 5E2WL 3SDCC 4KUZL 3VA2C 2EXYD 3P9WB 1CVSC 2X4UB 2OXHA 3L1OL 4WI4A 1OD9A 4MCZB 2ERJB 3GZKA 3O9WB 1E6JH 2WUBH 3D3VB 1HSBB 2MCPL 1T1ZB 1J1PL 4Y1AB 1KN2L 5J3HD 1S7QA 1R3KB 2SEBB 1P4BH 2YMXL 4U1SA 2JIXD 2QHRH 4LLQA 4OZHF 2DMCA 2ZWLT 3S88L 4HUXA 2DIJA 1YC8A 2GUOB 4UQ3A 5CEZH 2W0PA 4Y4KC 3MOBL 5CJXC 2DYPD 4LNVA 2Q8BH 1FC2D 2A83B 2ICEB 4FTVE 4RAHA 2P5ED 2Z8SA 3RZCA 1N7MH 4X6FB 4OF0A 5IIEA 2G60H 3P77B 4K2UL 5KANI 5F6IC 3UTTA 3TBSB 2WBJB 3SQBA 3QHTC 5EO9B 1WBZA 2HLAA 2LU4A 3MMEB 1F4YH 4L9DA 4ZOEA 2RGSA 5DHVB 1TZIB 3EYOA 4PRNB 3RNQB 4K7FA 3SO5A 5DS8B 2UZXB 4EUPA 4XVJL 3U36B 3GIZH 3PHQA 4LHUA 1EFXA 4JFQB 2FR4A 2P5WE 3OAZH 4P2QA 1JI1A 2FGZA 1YYMH 1FYTA 5EBWB 3IDNB 1BVLB 3ME0A 3RJDA 3W9EA 3TH3T 3LRHA 3O4LA 4H5SA 1CN4A 3MV01 3UTSE 5JHDA 1F6FB 3LPFA 4HFUH 5D1ZC 1TJHL 3DETC 1WCQA 4PJEB 4MCYA 2XTJB 4OFIA 1BLNA 4UDTB 4M1CC 1U58B 1RJZB 1WWWX 3BRGC 3Q5OA 2QR0A 5F7EH 1P6AB 3I84A 1MNUL 4XMLL 2GHWB 3QUMH 1ZKAA 2BSTB 2EIZA 3O3DB 1CFNB 1F58L 4HKZA 3MXVL 2K1MA 2MQ3A 2YPLE 5IFAH 4WHDA 1P5VA 4PRHD 4P9HC 5INDB 4BH7B 2AJYL 1OWWA 1YNLL 1K8DA 1AGCB 4OV6F 3I9GH 3ZTJH 4BQ9A 4TSAL 3ZSTA 3C09B 1QBMH 1I1FA 1FFRA 1JVKA 2A74A 2X4TA 2ZOLA 3VWJC 1YUHA 4ELKA 5MEPB 1KIPB 2RFXB 4HZAA 2QQNL 1O0VA 3KHOA 4JHBA 1U3YA 3QDAA 4FXKB 2ZG2A 2VABB 1AY1H 2IANA 2VTFA 2CIKB 2BMKB 4FZEL 4FP8L 2IWGA 4X5XA 3AY4C 2NXYD 4UOW0 4PJXB 1JPGA 4HSQA 2AJUL 4H20H 4Y2OA 5DQDH 4AM0B 4OD3L 3QQ9D 3RY6C 4P48A 1TTGA 4MAUH 3H9YA 3T2NH 4HWZB 5GS3A 3VFUB 3ETBF 3RKPA 1DTUA 2JELL 3FB6A 2DLEA 4KK9C 4KKCC 3M17B 1Q94A 1ITCA 4QXUH 43C9B 3WLWD 3LKOB 3MLZH 4HWEH 1MY5A 4QKXB 1L6XA 4IDLA 2GEEA 3TO2B 4QYOB 3S3PA 3HS0B 3BZ4A 1QBLH 2Q7YB 1FH5H 5KW9L 5MHSE 2ORBH 3WDJA 4KPHH 4JJ5B 4U1MB 4ELMB 2NYYD 5E2UL 2IGFH 3QDGA 2XQBH 4OGYH 3REVB 4G6FB 5K9OA 3D25A 4C56B 5CUSL 1NBZA 3CDGA 1F3JB 1FL6B 4P46A 2COQA 3G08A 5JHLL 3T2OA 5SWSB 3U48A 4YXLL 4M9OA 4F57L 5I6XC 2WBWB 1EMTL 3ZYZA 3CFIC 2IAMB 4ALAH 3MROA 4PJAB 1J9CT 3D39A 3PDGA 3R8BB 1T80A 4JO2H 4B53A 5C0CA 1KUMA 3HN3A 3VXUE 2C4FT 4V1DE 4NRZB 5GJTH 1MJ7L 4F7EA 5DJ0A 2JB5H 4DN4L 3QUZD 1WT5A 1JL8A 2IQ9H 3S96B 6CGTA 1SM3H 2V6HA 5LGHL 4KKNA 4ZFOA 5L7XH 3S5LG 4YJZL 4FTVA 4Y19A 2AERT 2PO6B 3VFPB 3KAAA 3WFDH 2NNAA 1KCSH 4YZFE 3NFSL 2HN7A 2NZIA 4YNYA 3FB8B 3HAEG 4KTYA 1ZT1A 3DO7A 5D7IB 3WHXA 4JG0H 1FORL 2CKBL 3KYMA 3P40A 5B3JE 1A5FL 5BMFH 2X1WL 3RVTD 2P5WA 2EYTB 3JVGC 1NAKL 2DQDL 5F3BA 4NNYA 3MV7D 1CXFA 1PX3A 3UC0H 4DZBB 3MRRA 1FFNA 4PBWD 3CMGA 4Z7QF 3U46A 3UTSA 1BD2D 5E9DB 5JXEA 4QRTB 1R5WA 2A6JA 4BK4A 4MLSA 2QSVA 1MCWW 4S1SH 1GZPA 4M3KB 1OCWL 4K94L 5IVZB 5TE4L 4ZOBA 4H88H 1JPTH 1UCBL 2WIIB 4P2OC 3LKRA 3QIBD 4IRSD 4ZS6D 5CINH 1W72A 5DJ8B 1D5MA 1ZAGA 1P2CB 1XF1A 4HJJL 3RJQB 4RRPG 1QD0A 1I9RL 2VXSL 4PGJA 4JAMB 4FQQB 3SGEH 1HHJA 3Q1SL 3E6FA 4WU5A 4AY0A 4QY8B 4A2MA 3OKKB 4Z7NF 5GS1B 5C09A 2Y6SC 4F2MB 1OLZA 1I1YA 3VH8A 4NJ9H 4YDKL 3SDYL 2FX7H 1HZHL 4GW4A 3UJIH 1HI6B 1SY6A 5FGSA 2P8MA 3OHXB 4PP1C 2R0KL 2XA3A 3UZVB 3OSKA 3G6JF 4XPAL 1IGJB 4XHJC 1OAKL 3BGFB 5J4MA 1A3RH 4F58H 4MD4A 3VXMB 3PWLA 5IT2L 4L4VB 4Z7UB 3DMMA 2CGRH 5BZWB 4R96B 3MR9B 2X09A 3CU1A 1JRHH 3D9AL 2B0SH 4GG6F 2BY0A 3ZT5A 1WCBB 4X99B 1BFVL 5JDSB 1QVOB 1GCFA 1ZVYA 4PYGA 3IDMA 4G5ZH 4M48L 1GYAA 2IALB 3NZHH 4QCIB 1T20A 4GXUN 2D7NA 5AZ2H 5F3HB 5IVXF 1VDGA 2EKSB 1NUGA 3BYTA 4NKDB 3QEGH 32C2B 3DVFA 1OPGL 4N0RA 1QFUL 1VEMA 3PV6B 4M93C 4F9LA 2AV1B 4X6BA 5B4MD 1QYGH 3N9GL 2DLTA 2GAZA 4L1HA 4JB9L 3RVVD 5E1AB 3SDAD 5HYFA 5F7HA 1JZ8A 2EDQA 5I1GL 1BQLH 5I76B 2DQEL 3ARSA 3QUXC 1J18A 4U1IA 4R97C 4XP5H 4EZMA 4JRYE 4IRZL 3MNVB 3CH8A 5FYJL 1Q9LA 3E8UH 1LNUA 1U2CA 5KZCD 3TV3L 1AC6A 3O0RH 2CUHA 5DMGD 4X5WA 4J8RB 2M8XA 3FO2A 3TC9A 4GRWB 4KWUA 1CGSL 3MX0A 3TP4A 1DQDL 5LAXB 5DMIH 4LVNC 2CDEB 4I5BB 1UWEL 4X4XB 4CN4A 5EO0A 3DI3B 3F6LA 1CDHA 1IILE 4HIXL 4I48B 4O4YH 3VG9C 1S9VA 4NYLB 3WV0A 4N0YH 1Q0YH 5GZND 1CXIA 4EI5D 4ZNCD 15C8L 5HVHC 5T1LD 3QXUA 4UU9B 5FOJA 2Q1EA 3VRLE 3GRWH 4YHYC 5F97E 1AGDA 2YPKA 1HWGB 2AABL 3MACH 4HCRH 5JDJA 4QO1A 3SCMA 2AJXH 1DLHA 1UM4H 2ZUQC 4G6JL 4DGIL 1GGYA 2GW5A 3H3PL 1UQSB 4NQDA 5D5ME 4PGDB 5DI8B 1U8MA 4Z7VB 4CDGC 1CICD 4AYFA 4WV1A 3ULSA 1PKQB 2MHAB 2OXGA 2ZG3A 4JO3L 1ZEAH 5I30L 1CZ8H 2D7OA 4NBXB 1JZ2A 3DXAD 1UKQA 4PJHB 1YQ2A 4YX2L 3S37L 3EO9H 4TOYL 3C6SB 3HE7A 1U93B 1ZHBB 5BW7C 2D0FA 2GSIB 2GITB 4LF3A 1K85A 3GHEH 4JDTL 4FQXC 4OZHE 1IZKA 3BH8B 3TBTB 2W59A 4H1LA 4YWGH 5KG9A 1PG7L 4R2GC 4Z8FL 3EJYD 1UXWA 3GNML 5DJAB 3VFOB 1JN6B 1JGLL 1ETZB 5TE6L 3MLSL 3STZB 3IJYA 2FX9L 1ZHLA 3C2AL 2WW8A 1H8OA 1JYXA 3E3QC 2P1YA 5LGJA 1T2XA 2B1AH 4ZFOL 4I4WB 1JZ3A 2DQHL 1L0XA 1P7KA 1JGVL 4KDTA 3BRFA 5GGSA 2I9LA 2KUTA 5H94A 4M6OL 2VE6B 2FJGA 2ZG1A 3H7BB 2HLFC 1T2QH 2DB8A 3MV11 4WJ5B 3B43A 4AENA 5B8CB 4OLXL 3K2UL 4MNHB 4F8TA 1IAOA 4K7PY 3TA3C 1UXSA 3CFKB 1MIML 5IR1B 5DRWB 4C83B 1KN4L 1BZQK 1AE6L 4QWWD 4MXVF 3BXNB 3ARRA 1AD0A 3GMMB 3SKNB 1LO4H 2DJUA 3MRNA 4Z7OF 4OF6A 4ODTL 1EBPA 3BQUC 4EIZC 3S6CA 5B38G 1UM6H 3ARGD 2V7NB 3PP3H 3RTQD 3QUYC 1RD6A 3OJDB 3I50H 3UBXG 5JW5B 5JMOC 1IGTB 1MJUH 4OGZA 3QHFH 1XT5A 2JCCB 4DKAA 3MTRA 3FQTA 3IU3A 4CN6A 1FZKA 5A2FA 3JWOL 3ARBC 5T3ZD 4OT1L 2GYSA 4NC2B 4NN5C 5KBNC 3S9DB 3DUHA 2Q6WB 4KKAC 4HKJB 1MAMH 3HMWH 1FNFA 3LCYA 1OP9A 4XPGH 2GJZB 1IAIH 1CBVL 3BKCH 4FFWC 1T66C 3VE0A 3KYNB 3GMOA 1WZKA 1KXQE 3PWNA 3CZFA 5GIRA 3FTGB 3UEZA 2YD9A 2DIBA 3D5OF 4BA8A 1SY6L 5CJQH 3CFJB 5HHQB 3MJ7A 5E03A 2F5AH 4S1DC 4OCXL 4XVSL 4E0RB 1R3IH 1LO2H 4PRIB 1A7RL 2XWBB 3EYQC 2UWEA 5CGMA 4JVPA 1PGRB 5LBSL 3EIFA 2BX5A 4K9EL 1OW0A 5T1KB 4NFBA 8FABB 3STLA 4E41D 2YXFA 4JN1H 2CKBB 4LCYB 3O2VL 2VISB 1DQJB 5FHAL 3O3EB 2DLFH 1DEDA 1ITBB 3GGWB 1YMMB 1Z0NA 2IPUG 3N50A 1ZHNA 5HPMA 2Z31A 1NCBL 1U8LB 4OIIH 1OTTD 3MO1A 3VMPA 1DSFH 4GW1B 4QOKB 1IC4L 4XP1L 3JXAA 4WNQB 4UUJA 4DGYL 1ZS8A 3HUJB 2GFBA 4QHMA 1G7MA 1JGUL 5JZ7D 1C16A 4IRJA 4XBGB 5T3XE 1RJLB 2HTLD 2B1HH 3FT4A 4MJ5B 1FG2B 2IC2A 1EO7A 3BT2H 4ZFFA 5FB8A 5I1KH 1AXIB 1FIGL 1YEIH 4ODVL 3T0EC 3ULVL 4OZHA 1XIWA 2Q76A 3GSNA 5GGVH 1VFBA 5TDOA 5I73B 4K3GA 5BS0A 3CVHA 3GSVA 5FXCH 2WZPD 4U1SB 1XFPA 4LLQB 4LNRA 4XP4H 3SKMA 4UQ3B 4U7MA 4WWKD 5I71B 3TNMA 1WFUA 1RIUL 4JKPH 1I85C 3M45A 4XTRC 5BVPH 3W0WE 5IIEB 3QCUH 5D7KE 1RMFL 5I1AA 3UTTB 4U6VL 1F4XH 4X8JA 1WBZB 5LVEA 2AK4D 1RIVH 4JG1L 3VXSA 5KSBE 3EYOB 2X70A 3RVWC 2OL3L 2X4OB 4K7FB 4GRLD 1VADA 4EUPB 3MRIA 1O7SA 3PHQB 4LHUB 2F8XC 4OFVA 3SGDH 1YEGH 4PGCA 1EFXB 1EHLH 2FR4B 2N1KA 3GO1H 4P2QB 3RIFK 4QXTA 5MEQA 3CDCA 5KS9A 5DVKA 1FYTB 3NN8A 1U3HD 3P3YA 4R7NA 3EOBA 2BVUA 2E27L 3W9EB 1P9MC 4LMQI 3T1FA 3O4LB 4OCRL 4H5SB 2R9HC 5GZOC 1UH2A 4L9LA 5JHDB 3UROR 2RIKA 3PP4H 5ETUA 4P3WA 2W9LA 3C87A 4MCYB 4TQEL 1PQZA 1A6VH 1J05A 2VZOA 4KI5D 4DAGH 1YNKH 1GGTA 2QR0B 4Y4FD 3WXVL 5DHYA 1OGAE 1FPTH 2VR9A 2BY2A 1RZJL 4LDLB 4M7KL 1EEYB 2EIZB 4EN3D 4HKZB 3MV8E 4Z7NE 4RFNC 4H8WH 5JIHA 1V3MA 3HR6A 4WW2A 1JK8A 3EOYG 4PRPD 1K8DB 3AS2A 1T21A 1I9EA 3ZKXB 2H8PA 1I1FB 2X4TB 2ZOLB 5DC4B 2G5RA 4FS0A 5IESL 1YUHB 3AGVA 3T2QA 2OTPA 4KJPC 3WJLC 4ELKB 1NAML 3T4YA 4MNQB 5D8JL 4UTBH 2IANB 4KJWD 1T89C 2BCKA 3I6LD 1INQA 4GMSL 4NP4H 4X5XB 1OTSC 5T3XH 1S5IH 3F5WA 5HYJB 4EQ3A 1ONQA 1P84J 1EUTA 1JPGB 2VLRD 3DX9A 4YHOH 3EYSL 4GG6E 4LGSB 3KHQA 3V4PL 3WFCL 5DDHA 2MSPA 4Q6IA 3CC5A 4N0FA 4XBPA 1QNZL 2PYFA 3BP6A 5K59F 3JWNC 1X5IA 3FB6B 4HUWA 3UZEA 2NY0C 4PLJC 1Q94B 3L3IA 2YD5A 2ED9A 4OLWL 1TZHA 4CL7A 2J3SA 2ADJA 1Q1JH 5E2WH 1PSKL 4G8GE 4KUZH 5C0AD 5IVXE 2B7DT 3L1OH 3N06B 3FZUD 3CSBA 4P2RA 1FGVL 3SKJL 3WNMA 5F1IA 3BX7C 3BZ4B 4AIZA 2MCPH 3IRPX 1J1PH 3BPCA 1S5HA 3B4NA 1KN2H 3RIFF 3LRSA 5EZLA 4XB7A 3NABL 4Y2DA 1XGPA 4TVPD 5I1HL 5DRXA 2YMXH 1DVFA 3QDGB 5K9OB 3S88H 3D25B 3MOAL 1NBZB 3CDGB 4NQEE 3G9AB 3G08B 3MOBH 1NBVL 4MYWB 4DQOL 5HHPA 2VB5A 3MUY1 3F6IA 4JHAL 3MROB 3O8XA 3HRZA 4GRWH 3D39B 5H35A 4NNPL 1BQHG 4FXLA 5C0CB 4K2UH 5FV2A 3V6OA 5HHVL 5CP3H 4MMXC 4F7EB 3JZ7A 5DJ0B 3TEUA 4I9WD 1QLRA 5C08E 3PHSA 4XVJH 2CK0L 4ZFOB 4FTVB 3BMVA 3KJ4C 3RWJA 2OR9L 4Y19B 3NZ8A 1L7IL 1RHHB 4JPKL 2W0LA 4LEOB 1H5BA 1TVDA 2NNAB 1RZ7L 4MAYA 2HN7B 4YNYB 4G6KL 2D9QB 1QPXA 3BN9C 1ZT1B 3DO7B 4K55A 5C86A 3OKOA 5FM5O 3WHXB 2BNQE 3KYMB 2NX5D 3T0DA 1TJHH 3AU1A 2X5PA 1P7HL 5J9PA 2P5WB 1Z9SA 3K4AA 4NNYB 5A1AA 3HZVA 2BNRE 1JHTA 4XMLH 3STBA 3V5DA 3MRRB 1FFNB 5C07D 3U46B 1F58H 1MHPL 3MXVH 5L2KD 3KPSA 1FCCA 1LVEA 1WAAE 1R5WB 2A6JB 3O6FC 5CIPA 2AJYH 3MGAA 1YNLH 5DVOA 4TSAH 4U05A 1GZPB 3NTCL 3B9VA 4U1GC 1P1ZB 1QFOA 4BK5A 1OGAA 2BXZA 1FL5A 3GSWA 3LKRB 2EEDA 2QQNH 3O3UN 1W72B 1QSZA 4L8SC 3PWUA 3QJFA 4MDJA 4FZEH 3O2DL 2E7MA 4OCMC 4FP8H 5HVFB 5D2NE 3GSNL 1LILA 5MP6L 4OCYL 2AJUH 4WU5B 1QLEL 3E6FB 3CVHL 4PV9A 3ULUD 4OD3H 5C09B 4RZCA 4KK5C 4LMQE 1I1YB 2VLJA 2P49B 1TCMA 2PYEA 5IFHL 2E7HA 2ERJC 4GW4B 3G6JA 3O9WC 2DLIA 4JQIL 1V7ML 3T3PF 5GXBB 3D0LA 2FLBT 3SE3C 2JELH 4XXCC 2P8MB 5FGBA 1NFKA 3QIWC 4YFDB 2DWEA 3V2AR 5CGYC 3QO1A 5J12B 4MD4B 1HHIA 2IBZY 2YSSA 5DMKA 3VDAA 2IFGA 5C9JA 4J23A 1NGZA 3B9DA 2NY2D 4MXVE 1EIBA 1INEL 4U1KA 1EA9C 3HG1E 2MPAL 3MLUL 5KW9H 4Z7OE 1N6QL 4XCEA 4TULL 2BNUA 2OZ4A 4JFEE 5E2UH 2WBJC 3D69A 2ESVD 4G8GA 3BI9X 3IDMB 5CUSH 2UYLA 4OLYL 5JHLH 1RUML 4YXLH 4F57H 1EMTH 3ARED 3BPNC 2NY4B 1CGXA 4B7IA 1MAJA 2X7LA 1MCJA 5E5UB 1Q8MA 4HS3A 4P2CG 3C5JA 1UM5L 1MJ7H 4DN4H 5HD8C 1G7QA 3NCFB 4X6BB 4RGMC 1IL1A 2GAZB 1KJMB 5LGHH 4LPUA 1F42A 5I66A 5TE7L 4WHYH 5K9QI 2PXYA 4X0KA 4LLUA 5HI4C 2AKRA 4Z77A 4U1IB 4JLRB 3NFSH 2E9JA 1SMOA 4UIKH 2ATPA 4OFDA 1LNUB 4JDVA 1QO3A 5EOQL 3V6ZB 1IEHA 3UPCA 2P5EE 4X5WB 1P4IL 2W91A 1FORH 2CKBH 3BDXA 1A5FH 3FO2B 4PLKD 3OXSB 5F9JA 3C09C 1NAKH 3HI6L 2DQDH 2VITA 5EO0B 3V8CA 1EEUA 2A9ML 2YD4A 3LVEA 3WUWG 2PW1A 1S9VB 3OAUL 5FYJE 1T5WA 4KTEL 1YPZB 3P4MA 3EDDA 5HHOA 5A3ID 1HXYA 1OCWH 4K94H 5TE4H 1IM3A 1AGDB 2YPKB 3IGAA 1JE6A 1WTLA 1UCBH 4S0TD 3SCMB 1DLHB 2GJ6D 1U3ZA 3MRKA 2VZ3A 4LVHB 4NQDB 2L0DA 5DGQA 4HJJH 1IT9L 1U8MB 1I9RH 3HZMA 2VXSH 3ULSB 4E42A 3WNLA 2LAAA 4CUCA 3TZVB 3Q1SH 2R2HB 3L3OA 4YFLF 5SX4I 2LTQB 5SV4A 4YDKH 3N0PB 1HZHH 3HE7B 4WFED 5JA8B 4PRHE 4LF3B 3W9DA 3TT3L 4ZD3L 4BSVA 1LMKA 4H1LB 5KG9B 2R0KH 3FAWA 3B9KD 3RWIA 4PFEA 4XPAH 1OAKH 1UXWB 4JFDA 5IT2H 2Z91A 1OB1B 4PLOB 3IJYB 1ZHLB 4R9HA 4EUPH 5LGJB 1SEBA 2V5YA 3HB3D 1P7KB 3D9AH 2P47B 5GGSB 4P3DA 4NDMA 1NUDA 1CLOL 1NFDF 2I9LB 5H94B 1BFVH 4W6WB 2FJGB 4Y5VB 4XVUC 3LRGA 1DQML 3LQMA 4M48H 5FYLE 4JVWA 4M4PA 2XG4A 4S10A 3QUKA 3HG1A 2EC9U 1IAOB 5JQHC 1UXSB 2R1WA 3OR7A 5L2JA 1FL3A 2PETA 4I3RL 3SDDA 5IG7A 1OPGH 2L7UA 1AD0B 3IDYB 3PQYA 3MRNB 4UOW1 4P5TD 5DVMA 3VMOA 1A22B 1Z0MA 5D7JD 3N9GH 1FFPA 4OFYA 1CU4L 4JB9H 4YE4L 5MEND 5E5MA 1G9NL 5I1GH 3C60D 2DQEH 1E4KA 4RSVA 5TF1L 1XEDA 4IRZH 2H2SC 5KJRL 3FQTB 3IU3B 5FYJH 3D0VB 5GS2D 3TV3H 2NLJA 4HH8A 1I8LA 1IKNA 3HZKA 2VXVL 4GLRH 1FNSH 4HAFA 2Q86B 1CGSH 1KJ2L 4YR6A 3ARFD 1UGNA 5EU4A 1UWEH 4GFTB 2BP3A 4MQXD 4HIXH 4NQCA 4NHCL 1TETL 3VE0B 3GMOB 5GIRB 3PWNB 2NZ9C 3CZFB 5C0BD 5FF6A 2FIKA 3Q48A 1ZT4A 1OQOA 3SDCD 5IKCA 15C8H 4HHAA 3VD4A 1H3TA 2FDBP 4J3OC 4LVOB 3MJ7B 4ZFZA 5GS1C 1SEQL 2AABH 1SJXA 2UWEB 4DGIH 4G6JH 5DVLA 1IKFL 3H3PH 4H8WC 3QEHB 3STLB 3AS3A 3AAZA 1N0LA 1WF5A 4JO3H 5I30H 3K74B 1ZHNB 3IDUA 5HPMB 4LCWB 1IAKA 1II4E 2Z31B 3BGFC 3MV7E 4Y4KD 3GMNA 3UYOD 3UBXI 3TIEB 1D5BA 1HH6A 5TDPA 3MO1B 2DTSA 2H2PC 1U95A 3S37H 1PZ5B 4YX2H 4U6HA 4TOYH 3PDOA 4UUJB 1ZV5A 1BD2E 3FCTB 1MHCA 3RX5A 1ZS8B 5IB5A 2GFBB 4Y16D 4QHMB 4JDTH 1G7MB 1C16B 4IRJB 3SPVA 1RK1A 4N0UE 3RWFA 1X9QA 4LFHG 1PG7H 1LE5A 4Z8FH 2RCSL 2P48B 3GNMH 4ZFFB 4XC3L 5FB8B 5IW1A 2J6EL 1JGLH 4KI5F 5TE6H 3MLSH 4ZUUA 2FX9H 3C2AH 3MUGA 1TCRA 3IDGA 4PRHA 1BF2A 4OZHB 1XIWB 3F12A 2YUVA 1H8NA 1RUQL 2Q76B 2DQHH 3GSNB 1CQKA 1VFBB 5TDOB 4MA3A 1JGVH 4QEGA 4RAVA 5BS0B 4HGKC 3CVHB 3GSVB 3PL6D 4UOJA 3OBAA 5D1ZD 4M6OH 3DETD 4YGVA 1DBML 4LNRB 2OJZL 4HAGA 5DEFB 3SKMB 5T5NF 4M1CD 4N1HB 3MLRL 4N0CC 5DZOA 4OLXH 3K2UH 1UEYA 4YFLI 3TNMB 3QFJD 4L8BA 2APTA 5I17A 4HX1A 1MIMH 1EHXA 1M6OA 5I1AB 2GJJA 1CGTA 4LCCA 1VGKA 1KN4H 4JDZA 2H6PA 4X8JB 5DD1L 4YGAB 1NDMA 2ID5A 2VN7A 1U91B 5GRXG 3VXSB 2X70B 4ODTH 3VWJD 1VADB 1AQKL 4JPVL 3MRIB 1EAPA 4JANA 4PGCB 4HIJA 4NPYA 4OAWA 3FN3A 4QXTB 2YC1A 5MEQB 3LDBB 5KS9B 4YIQB 3NN8B 2LABA 1CDGA 2FH8A 4R7NB 3EOBB 4IHOA 3WSQL 1JPFA 4JFHD 1A6TA 3ARYA 4XZUA 3JWOH 3QPXL 4L9LB 3C5SA 4OT1H 1HWHB 4R0LB 1MRCL 1PQZB 1J05B 5DC9B 3MV9D 3ARDA 3P2TA 4NCC1 5E7FA 5DHYB 4NO0D 3RQ3A 2QSCL 3RKDC 4KK9D 4KKCD 1EO8L 2L7JA 1CBVH 3HMXA 3TCLA 1EO5A 5TH2A 1ES0B 1ZLUH 5DEZA 1KB9K 3DGGA 3T3MF 1WBYA 4WW2B 4QRPD 3RX7A 1K9TA 1SY6H 1JK8B 4R6UA 1OP5H 5DD3L 1T21B 5BQ7A 3UJTL 2EH7L 3PXJA 2CD0A 2H8PB 4OCXH 4XVSH 1A7RH 3T4YB 1C8PA 2L4OA 2I27N 2UV3A 5LBSH 1GSMA 3V7AG 2EDFA 4K9EH 3RX8A 3U30B 4LAJH 1E4WL 2BCKB 4LOUD 3TNNA 1INQB 3HC3H 5AG9A 3O2VH 2Y06L 5FHAH 3F5WB 1ZLWH 4W68A 3VD7A 1ONQB 1VFOA 2ZSWA 1BOYA 2V2XB 3NCMA 2H3NA 3QWRD 2P4AB 4G9FE 1CFSA 3DX9B 1IC4H 2I26N 4XP1H 5DDHB 2DMBA 2DM7A 4Q6IB 3CC5B 5EUOA 4N0FB 4WENB 4XBPB 4DGYH 1BREA 2PYFB 3BP6B 3FFCD 5HY9A 1JGUH 1XH3A 4HUWB 4QRRD 4D0CA 2BHYA 1TZHB 3MV7A 2ADJB 2ZKHL 3WN5A 5IJVA 3ZDXE 5DK3A 3MRDA 4KRMB 3ESVF 1Q0XL 1BD2A 3PABA 4P2RB 1FIGH 4MJ4A 4ODVH 3K8MA 5F1IB 3ULVH 4AIZB 5BOZG 3LKPA 3BPCB 1S5HB 4YDLB 3P9MA 3LRSB 5EZLB 3DXAE 2A1WL 4Y2DB 1XGPB 5HYQB 5FGCB 3AMLA 4NUGL 1DVFB 1BOGA 1FCGA 3OKEA 3RDTC 2O5ZL 2IADB 2H32A 4KAQL 4X7TA 4JFFD 5HHPB 1RIUH 3U7WL 3LEXA 5H35B 3HRZB 3O8XB 4X6EA 1H3VA 4U6VH 1MI5D 3LS4L 2CRMA 4JG1H 5ABDE 2OL3H 4FMKA 3ALXA 3ULUF 3RWGA 4G7VL 2C3GA 2EECA 4P2OD 1L6ZA 4CVWA 2FZ3A 3NZ8B 4YLQT 2F54A 3PG2A 3K1DA 1JMZA 5TQ2L 5J6GA 1H5BB 4NCDA 4S1RL 4WHTA 2WUCL 1KLFA 4MAYB 2E27H 1ZWIA 4OCRH 4AMKL 3OKOB 5HI5C 2Y6SD 5ACLA 3EYVA 4TQEH 4PY7A 3VI3F 3AC0A 3L3KA 3CAFA 5AYUL 3HZVB 2VDKL 4X7EC 1MWAA 3WXVH 1JHTB 1RZJH 1I3VA 3V5DB 4PP1D 1UG9A 4HS8L 4M7KH 4ACPA 5GS0L 1SYSA 2CMRL 3KPSB 1OSPL 4XHJD 1I3UA 5EU3A 1EEQA 4WHCA 3TH2T 1AKJD 5CIPB 4BSJA 1RULL 1D7FA 4TTDC 5D72L 1D5IL 5DJCB 5IESH 5KSAA 3U1SL 2ARJQ 1NAMH 1FL5B 3GSWB 4RISL 4Q9RL 3V5KA 5J57B 4MXWL 5D8JH 1D6EA 2KQNA 5T3ZE 5IK3A 5D71L 5CILL 3PWUB 3SDAA 3QJFB 4MDJB 3OZ9L 3PE9A 4GMSH 2Y5EA 4JE4B 1QOKA 4ZXBB 4Z76A 3BFOA 1K5NA 4K94C 1WWCA 3RAJL 5ESQA 4PV9B 5TGBA 4ZO9A 1I3GL 4RZCB 4Q58C 3EYSH 3BEVA 2VLJB 4WI9A 3LHPL 2PYEB 3MRLA 3V4PH 3WFZA 3G6JB 2LVEA 3EO1A 3U4AA 3PGCA 1T7YA 1QNZH 3D0LB 2NY3C 2V9QA 1MAKA 4I13B 1GHFL 4JQVC 4OLWH 1GIGL 4Z7WF 2DWEB 5DJDA 1BFSA 3CDYA 3QO1B 1PSKH 3QDHA 1FAKT 4OF5A 5C0FA 1HHIB 1IAMA 2AQ1A 3OKLA 5IMMA 5DMKB 4EBQL 1NGZB 2CPCA 1FGVH 3SKJH 5T1LA 1A7QL 1IGML 3LQZA 4U1KB 3UP1A 4GUPA 2BNUB 1CGWA 3TN0C 4OSUL 3V0VA 4AJ0A 3NABH 5I1HH 3D69B 5IM7A 1KB9J 4CU6A 4G8GB 4K8RL 1TNMA 2UYLB 3OAYH 5CBAA 1PG7W 5I1EL 2NQCA 2FO4A 4PJ8C 1CICA 4PJCE 1NBVH 4DQOH 3ZHDA 1CYGA 2E9WA 2CDFA 4JHAH 1GOHA 4NNPH 3H9HA 3DXAA 2X7LB 5DSCA 5CAYB 3BIKA 4PJIF 3HPJA 5HHVH 3H3KA 3C5JB 2RB8A 4M8QA 3HMXL 1WZMA 4P4KA 1G7QB 2IFFH 3U82B 1IL1B 3AVEA 2HMIC 2CK0H 4OQTL 5I66B 4F37K 5B38A 1SBBA 2OR9H 1OTUD 2PXYB 1L7IH 2HA1A 4JPKH 4X0KB 4LLUB 2AKRB 4DVBB 4Z77B 2J8UF 3MA9L 1RZ7H 2OSLB 3GMRA 4X7SL 3JV4B 1NBQA 3BD4A 1N5AA 4Z78A 3IKKA 4G6KH 4PBVC 4JDVB 1XGYL 1QO3B 5AAWA 2EDXA 1QTYT 1Z9MA 4HUVA 1KPUA 4OQ1A 4P49A 3ZKXC 5F9JB 4M00A 5HGAA 1LDPL 2CIIA 2VITB 4FQXD 1KCRL 4Y7MA 4HK0B 2AK4E 4QT5B 5LJYH 3WIFA 3FO0L 4LSTL 2XZCL 2PW1B 4RIRA 3EKCA 1MHPH 2ZP0T 4L29A 4R2GD 4JY5L 4GKNA 5HHMB 1T5WB 3R0NA 1U36A 3P4MB 5HHOB 4DJMA 2X1PA 1HXYB 2DJ4A 3NTCH 1IM3B 3O6ML 3IGAB 4HXAL 4RMWA 3MRKB 4RX4D 3ARGA 2R2BB 4WUKL 2YUZA 1GGBH 3TYGL 2CR3A 1ZSDA 3FOLB 3HZMB 3O2DH 3EYUH 2HLFD 2I9TA 1ZMYA 4E42B 3GSNH 5MP6H 4KI5E 4OZIB 3LD8B 1V3KA 3KXFD 4OCYH 4NZRL 2V9RA 1QLEH 5F44A 4UBDC 2WV3A 4IMKC 4F7CA 2KL6A 3CVHH 3L3OB 4GAGL 5ITFA 3BP5A 1NL0L 1HEZB 3NFPA 3TA3D 2JTDA 1DBJL 5IFHH 3FAXA 4D0BA 4JQIH 1I9JL 2VERN 4FQIL 1V7MH 5ADPL 1TNNA 3W9DB 4BSVB 5ACZB 4X9BA 2FATL 2OLDA 5ESVA 3D1MC 5CEZD 2QEJA 1KBGL 3BQUD 1INDL 2AEWA 3MSPA 3RWIB 4XX1E 5DLML 2HJKA 2AJVL 3KYKH 3QUYD 4JFDB 2R4RL 5C0NC 1GXEA 2Z91B 3I6LE 3VMNA 3T1WA 1NFDA 3WS6C 3VGDA 4IS6A 1SEBB 1INEH 3NVQA 4Q0XL 3OG6B 4F37F 2MPAH 3MLUH 2DL2A 4IIQA 3CXHJ 1N6QH 3WS3A 4P3DB 4NDMB 2VLRE 3ARBD 3BUYA 4TULH 3SHSA 3TWCL 4PRBA 3ZKMD 3DROA 4PREA 4KKAD 1WT5C 1JJUA 4WUUD 4OLYH 5JIPA 4E41A 4LHUG 1RUMH 4IBLT 3UDWA 1X5FA 3QUKB 4PJFA 4JO1L 2FGWL 4M1GL 3BOVA 1JNHA 4FFWD 1T66D 3DGCR 2R1WB 2QJDA 3ROLA 3O11A 3B3IA 1PFCA 3OR7B 5L2JB 2FBJL 4KV5F 5C0AE 3SDDB 5IG7B 1MWAL 1FFQA 1UM5H 3PQYB 1ERNA 4S1DD 4U7KA 1HHKA 2HRLA 1FFPB 3EYQD 5FO9A 5GGTH 5CCKL 3DVNA 4NWTL 4H0IA 5TE7H 3X11B 3C5ZA 5E5MB 4LGRB 4U1NA 2IEPA 1RUAL 4KRPC 1B6DA 4YH6A 1MSPA 1QR4A 4U3CA 1DBAL 3EOTL 2NLJB 3HCVA 5EOQH 5JXEC 5ADOL 4C4KT 1P4IH 5C0IA 1FZOA 2G5BA 3HZKB 5FO8A 3EUUA 3SO3B 4HIIA 4YC2B 3H6JA 4O02L 5ITBL 4YR6B 1FJ1A 2VL5A 3HI6H 2X4RA 1LQSR 4ORZC 5EU4B 3UXFA 5E8OB 2VO5A 3K80A 1V3LA 2A9MH 1BQSA 3JWOC 3IS1X 4NQCB 5EO1B 2H9GA 2VKXA 5FF6B 5IROA 5MERA 2FIKB 1UZ6F 1ZT4B 3JSSA 3VRJB 5IKCB 2IG2L 4HHAB 4GS7B 1EHNA 4YBLB 4GRMB 3LH2L 4KTEH 1U41A 3QXVA 2HYMA 5JW3L 1YN7A 3R1GL 4ZFZB 3Q5YA 5J06A 2YWYA 3TO4B 5EU6A 4WFFE 4GRLA 1QP1A 2NX5E 3FQWA 3QPQC 1XR8A 1IT9H 1U92B 5D9SA 5FKAA 3AAZB 3VD5A 2AGJL 3DV4A 4RQQA 1NFIA 1U3HA 1IAKB 3GMNB 4O2FA 5J12C 1D5BB 1HH6B 1WFTA 4OFPA 2DWDA 5C07E 5C6PB 1MF2L 4U6HB 3PDOB 4LPWA 4K9EC 4XTRD 5L2KE 1MCDA 4EDXA 1MHCB 5IB5B 3VFNA 1KYOJ 1WJ3A 1IM9D 4ZD3H 3SPVB 1RK1B 4ZPVA 3X12A 2AI0L 4I2XA 3RVWD 2VDRL 4XWGL 5DO2C 1CGVA 4Y4FA 3RWFB 1IC5L 1LE5B 4I0KA 5C3TA 3O3BA 3T0WA 3VXPA 1NCCL 5A2KH 1NLBL 3QEUA 3JUYA 1ZA6A 3KR3L 2ENSA 4ZUUB 3MUGB 3OMZA 1KIRB 1TCRB 3IDGB 3OKNA 4PRHB 4UIMA 3N1GC 2VDML 4PRPA 3F12B 4KJQC 2NY4C 4FN0A 4MA3B 4RAVB 4HLJA 3LB6C 2R9HD 5GZOD 1ZGLM 2IQAA 5IQ9A 1J5OL 1CLOH 3O6LL 1JYNA 3HA0A 4YGVB 1H3XA 5BRZB 1A7OL 1H15A 2XY2A 4F9LC 3WLBA 4LSSL 1DQMH 1PY9A 2VAAA 3QXDA 1TLKA 5TQ0H 3ULVC 2QLVB 2FJHA 2YPLD 2P8PA 4L8BB 2VDNL 5I17B 4HX1B 2VLRA 2HT2C 1UVQA 1M6OB 2BC4A 2DBLL 4LCCB 1VGKB 4ODSL 3W39A 4JDZB 4I3RH 2H6PB 5C0DA 5KVEL 5IOPA 4ZUTA 1NDMB 3VI3E 2FWOA 3J7HA 4KJPD 5IGXL 1EAPB 1U8KA 5SWQA 4JANB 1CU4H 3HPLA 4YE4H 4HIJB 4NPYB 5CIPH 4OAWB 1VENA 1G9NH 2YC1B 3S5LB 3QR2A 2PKDA 1HE7A 1DANT 2ESVE 3LQAL 3U0TA 4IHOB 1CDCA 2PTUA 5TF1H 1OTSD 4UT9L 1JPFB 5KJRH 3PGFL 3VGHA 1ZVSA 1A6TB 4XZUB 5BV7B 3MPCA 4F7TA 5EZJA 1OQXA 3C5SB 3RL1A 1UCTA 1JTOA 5HHNA 1CFQB 2VXVH 2H41A 2OQJA 3GSQA 1JZ7A 1KJ2H 3QQ3A 2F9BT 3ARDB 1VEPA 4POZC 3SCMC 4OTXL 2NY0D 4PLJD 4FMFA 2BFVL 4LVHC 1TETH 1LO0L 2AP2A 4NHCH 4X6DF 5TH2B 3TCLB 5BVJA 4IOIB 3DGGB 5ISZA 1WBYB 1YNTA 2PCPA 4NM8L 5GGRA 3FQUA 1UH4A 5B22A 2X6MA 3TZVC 5BQ7B 1EK3A 4LQ1A 3VH8G 3GJEA 4NC1E 1SEQH 1RZJC 1F3RB 3VGEA 1BM3L 2DAVA 3HE7C 1IKFH 4Z7WE 4HPOL 1J88A 5GJSL 3TNNB 3VI4F 1RV6X 1CF8L 2VDOL 2ZSWB 1NC2A 2QHLA 4LBEA 3G5YA 1CFSB 1QZ1A 3VXUD 1A1OB 2LVCA 4HT1L 4PLNC 3DIFA 4NN6B 3WIHL 5EUOB 2NX5A 3U9PL 3QDMA 3ARTA 4ZTOL 5HY9B 1XH3B 4KDTC 4N9GA 4PRDA 4D0CB 3L5IA 4GW5A 4J3VA 5AWNL 2Z93A 1MLCA 1CE6A 2BSSA 4CADA 3EYFA 3V4VL 2RCSH 3WN5B 5IJVB 3MRDB 4R8WH 4Y5VC 4FFYL 2DRUA 4XC3H 2J6EH 4S11A 3KGRA 4QGYA 1BD2B 1X5HA 3PABB 5GQBA 4PJIE 1A2YA 4JO4L 4MJID 5KVDL 3LKPB 1RUQH 3BN9D 5C0JB 1VHPA 1RJYA 5E2TL 5CJOL 2EC8A 4XCNB 1S7VA 4DCQA 2FSEA 1DBMH 4WFEE 1MFDL 3IDYC 4M6NH 1BOGB 2OJZH 2X4NA 2J8UE 3CFDA 3OKEB 4JRXA 3MLRH 3P9LA 2XPGA 2H32B 4X7TB 3OJMB 1LWRA 3LEXB 3SKUD 1YN6A 2R1XA 4X6EB 3B6SA 1KT2B 2Y5TA 3O6FD 5E2JA 5DD1H 2J12B 5D96C 3VDCA 2XZAL 3D2UA 43CAA 4RA0C 3RWGB 1AQKH 4JPVH 3BZEA 2JJUA 3TGXA 2HT4C 2F54B 5J6GB 5K9JL 5F7KC 3IDIA 4WHTB 4XNXL 3QRFM 1ACZA 1C12A 3WSQH 1ZWIB 3PXHA 2VL4A 2P43B 3QPXH 3F7YA 4PTUA 5GRYA 3KDMA 1URLA 4DFHA 1IBGL 4KK5D 4XWOC 4BQBA 3EYVB 2FYYA 1CL7I 5JNYA 2DQFA 3BO8A 1MRCH 4PY7B 3O9WD 3L3KB 4LEXL 2KDGA 1MWAB 1CCZA 4LPCA 1UADC 4P5KA 2QSCH 4Y1AD 4NO5A 1FLRL 1E4XI 4Y5XA 1EO8H 1SYSB 1OW0C 5C0GA 5JA9A 3QIWD 3I3EA 5CGYD 3AREA 5EPMA 3RVXC 4N1CA 4DZ8A 5MENE 3EGSA 5EU3B 2RAMA 4R4NC 4HK3J 1MRFL 1KFAL 1NCWL 5DD3H 5KANG 3UJTH 2EH7H 4EKXA 1YYLL 4P3CL 2DN7A 4HWUA 3WHE1 5KSAB 1IE5A 1T1YA 2YR3A 5IHLB 5C3LD 1IGFL 3V5KB 1EDQA 1D6EB 5IK3B 2BRRL 4BYHA 5D70L 5C1MB 2WBJD 3IF1A 1E4WH 3R4DA 3SDAB 4JQXA 4IRJC 4H1LG 4NKIL 2Y06H 3I2CL 4Z76B 3ECBA 1WFNA 4RGNB 3O4OC 2AJ3B 2CKNA 5ESQB 5TGBB 3T77A 5E7BA 3BEVB 5C0BE 3MRLB 4S2SA 2PN5A 4Z7WA 1OVZA 1YA5A 1ORSA 3EO1B 3DUSB 3PGCB 1XIWC 1BJ8A 3OAZK 2XV6B 5HD8D 1S9YA 5HHXL 5DJDB 4HH9A 3P4NB 3F58L 2ZKHH 5C0FB 5IWLA 3BN3B 3OKLB 5IMMB 1Q0XH 5HI4D 4KV5E 5T1LB 3VRIA 1QSFA 3LQZB 4PP2A 1NGQL 2NY1B 4GUPB 3S35L 2R56L 4XHQA 3OB0H 4S1QL 1F97A 5J8OA 2E6PA 4KK6C 3V6FA 3V0VB 4L3ED 2CDGA 2GJ6A 4NUGH 1BJMA 5IM7B 4HULB 4F80A 4DK6A 3B8SA 5EC1A 5F7YC 5DD0L 1U8HA 4IJ3B 2ICWJ 2O5ZH 2FO4B 4KAQH 5D6DC 1O7VA 2ZCHL 3V79C 1G6VK 1R5IB 4NKMB 5CSGA 3U7WH 2CDFB 1UEMA 4PG2C 4OCNC 3H9HB 4TRPL 4FOMA 2WNGA 5DSCB 1XGQA 3BIKB 1CTOA 4ZYKA 3K4DA 2Z35A 1UJ3A 2EDLA 1FQ9C 3LS4H 4M8QB 4L9LC 2BOCA 4P4KB 3AFLA 4U33A 1WBXA 4G7VH 3U7YL 4NGHL 5FYJU 2X1OA 2FEEI 4R0LC 3NIFF 1MCCA 5B38B 4AEIL 3B9KA 5TQ2H 5IHZA 1UZ6E 2A73A 3MBEB 2HT3C 3VGAC 3BPLB 4S1RH 3SGKA 3UBXB 3QRGL 3GMRB 4TSBL 4JHWL 1N5AB 4Z78B 4QTHA 4TVSa 4NOFA 4R7DA 3SDXE 4PJ7F 4AMKH 1HHHA 3FHQA 3ZE1F 3GMLA 3QFJE 2MQCA 1LE9A 4WW2C 4K07A 4HUVB 1SBSL 1KPUB 2D03L 3HRPA 4U0QB 5HGAB 4MA7H 2CIIB 5AYUH 2VDKH 5CBEA 5I0DA 1FN4A 3WIFB 3E1F1 2J8OA 4HS8H 4BFEA 5DA0B 1FLTX 5GS0H 2CMRH 4RIRB 2Y36L 3QNXA 4L29B 1OSPH 3VJ6A 4GKNB 1RZ8A 1FIEA 4C56D 3GUTA 1RULH 3BWAA 1DN2A 5SWSD 3KG5A 3SQOL 5D72H 4JFHE 4BZ1L 3U1SH 4JFXA 4RISH 5J0BA 4L5FL 4Q9RH 1F13A 4P5TA 4MXWH 4NZJA 3SGJC 4Q6IC 4XNZB 4BSWA 5D71H 2BVPB 3ARGB 5CILH 2E7BA 1D9KA 3QEQE 1ZSDB 3OZ9H 3QI9A 2I9TB 2O93L 4XVUD 4OCSL 1FZMA 3C60A 3MV9E 4H26A 4N8CL 4U7SA 4F7CB 3RAJH 1T7VA 2PTTB 4C59B 3K2MC 5ITFB 4YDIL 1I3GH 3BP5B 3NCBB 4PTTB 2W1NA 1XGUA 3LHPH 3PWPD 3F7VA 4D0BB 4RAUA 2XN9E 1BJ1H 4QRPE 2CRIA 4UNUA 3W81A 3PHOA 3SE4A 4YDLC 4XBEL 1MCOL 5ESVB 1GHFH 3ARFA 1GIGH 2OX5A 2LAGB 5HI3C 5HDBF 2EDTA 1CLCA 1W2KT 4LRNL 3JTTA 1DVFC 1TDQA 2HJKB 2FLRT 3AM8C 5C0BA 4F7PA 4L4TE 1DZBA 5GGQL 4K3JL 5IW6B 4EBQH 5K93A 4DEPB 1NFDB 4IS6B 1A7QH 1QBAA 1IGMH 4Y88A 4ESKA 2H2SD 3K3QA 3UTZA 1IEBA 4IIQB 5ICXA 2B5IB 4J3TA 3WS3B 1BP3B 1QRKA 3BUYB 5TPWL 1GVIA 4PRBB 1T83C 4HJ0C 4OSUH 3V6OC 3DROB 2NY6C 4PREB 1OOAA 4K8RH 1H3WM 3NH7L 5F72S 4QHLA 4E41B 1UKTA 2ATKA 5I1EH 4QRRE 4PJFB 4OUUA 2N7BA 3TBVA 1JNHB 4H25A 5ILTL 1G7PA 3MRHA 4U6TA 4Y4KA 3ROLB 1H5BC 2OR8A 4M7ZC 2NZ9D 4JFPA 3O11B 3QZWA 1WUNT 3B3IB 4JFYA 5CJXA 2J5LB 4MAYC 4PJGF 1ND0B 3FT2B 1N26A 3HMXH 1AXSA 4Y16A 4GG8A 4APQC 2DTML 1CT8A 1T0NA 4OQTH 5FO9B 4ODHL 3OF6D 2K9UA 1MH5A 2HFGL 3C5ZB 3DSFL 4U1NB 1AGEA 5IB4B 3PWVA 3MA9H 4M4RA 3RP1A 1CI5A 4X7SH 2EZ0C 1KJVA 1WICA 1BQUA 4X4YA 3HCVB 1XGYH 3OJVC 4Y4HB 1MCLA 5C0IB 1FZOB 2G5BB 2H2PD 3VXMD 5FO8B 5FDYA 1G9NC 1T5XA 3PL6A 3AB0B 3LY6A 2VL5B 2X4RB 1MCRA 5D1ZA 1LDPH 1MI5E 3VI4E 5T3XD 1KCRH 2IH1A 3KPPA 3H3BC 3FO0H 3FMGL 5EZIL 2H9GB 4LSTH 4LLVA 4RMRA 2XZCH 4ZAKC 5MERB 4JY5H 3KPRA 3MRJA 4HDIA 4ZXBC 4UILL 4OGAC 2HFFB 5FUOL 4DOHE 4WY7L 1YN7B 3O45B 3ZTNL 3O6MH 1QPPA 2J88L 2QSTA 1H3PL 4HXAH 3VXRA 5EU6B 5FM4A 1DQLL 4GRLB 3VWJA 3ABZA 3OL2A 4WUKH 3FQWB 1XR8B 1OAUL 3TYGH 2KZWA 3LSOA 5D9SB 5FKAB 2W65A 2EIDA 3DV4B 4RQQB 4ENEC 3CFBA 1NFIB 5IF0A 5IVNA 5LXGH 4N0CD 4NZRH 2N56A 5FA3A 1QBBA 4UAOB 4O2FB 3W0WD 2ZUTA 3O3AA 4GAGH 2DWDB 1G7LA 2V9TA 1NL0H 4WGVB 1DBJH 1LP9E 4EDXB 1K3ZA 3QDJE 4FFZL 3VFNB 5BCAA 1I9JH 4FQIH 1F02I 4PJ5E 5ADPH 2C1PB 4ZPVB 3EJZC 2FATH 4FQPA 3X12B 3MV9A 4I2XB 4G8EA 1KBGH 5D2LA 4PGEA 4Y4FB 4NO0A 1INDH 1S7UA 5DLMH 5DF0A 3O3BB 2AJVH 3VXPB 2R4RH 3QEUB 5GISL 1ZA6B 2VR4A 4UIMB 3OKNB 2AJZA 1UKSA 1FO0L 4PRPB 2XI9A 4I0PD 5CSZA 3R8QA 4Q0XH 2IQAB 5IQ9B 4EEEA 3VA6A 3TWCH 4MA8L 4N90E 3X14B 3C8KA 5SX4H 1H15B 1WISA 3WLBB 2F19L 3DX7A 3KLSA 2VAAB 3QXDB 4KGLA 1J8HE 1I4FA 2FECI 2FJHB 2F8VA 3RKDD 2P8PB 2PXYC 4JO1H 2FGWH 4HG4K 3QHZL 4M1GH 4MVBD 3EDJA 2VLRB 4WI8A 5FKPA 1JTTA 2BC4B 2FBJH 1MHEA 5HSFA 1DUZA 3W39B 5C0DB 1YEKL 3NGBB 1MWAH 1T6WA 5IOPB 1JF5A 2KKQA 4ZUTB 1KLGB 1SMAA 3MJ9A 2FWOB 1JYVA 3FFCA 1U8KB 5SWQB 4QRRA 4YBHA 3HPLB 5CCKH 4NWTH 2R1YA 1CTNA 1RUAH 1RK0B 5DYOA 3U0TB 3GBML 5F96L 4OBSA 1ZVSB 1AP2A 5E4IA 5EZJB 1DBAH 3EOTH 4Y5YC 4LIQE 5ADOH 1D6VL 5DRZA 5HHNB 2VJXA 2XKUA 4YZFF 2OQJB 1T3FA 3QB7C 4X6DA 3GSQB 5C6TL 4O02H 3QQ3B 5ITBH 4OCWL 1GPOL 1HINL 4GQPH 4K3EL 3LN5A 4GXVL 4Y8DC 5EOCH 1AHWC 5BVJB 2ENYA 4JFFA 4YHKL 1B0RB 4OZFG 1A9BA 4OI9A 1NCNA 3OWEA 1CVRA 5ISZB 1YNTB 1S8DA 2IG2H 1FYHB 3QWOA 2ZOKB 5GGRB 3FQUB 3LH2H 3LD8C 3GJFH 3KPQA 5JW3H 1W8OA 2YN3A 3R1GH 1J8KA 3GJEB 5DD5L 1MI5A 2VLKB 2V5SA 5J13B 3ARXA 1N6UA 5DRNA 3KPNA 3BZFA 3DURA 4KJYB 1QQDA 1F90L 4P2OA 4NQED 2A38A 4FQ1L 1WIPA 2LV4A 2AGJH 1G7IB 1NC2B 3RDTD 4I18B 1EEZA 5J1AA 4QHNA 3ZT7A 1QKZL 3G5YB 1BZ9A 5SWZE 3NCYP 2YK1L 3GSXA 4TNWK 5I1IL 1MF2H 4B0MM 5IBTL 3U0PA 3BAEL 4WO4D 3PP3K 4YEFA 2DOCA 2F58L 3QDMB 1U8PA 3V5HB 4ZUSA 1U8OA 4N9GB 4PRDB 4GW5B 2AEQL 2Z93B 1MLCB 1KENL 3BUTA 3E3QE 4OIBA 3R06A 2VDRH 1CE6B 4XWGH 5L6YL 2BSSB 1IC5H 1AI1L 1H0DA 4NFDA 3L6FB 3EYFB 1GZQA 1NCCH 1NLBH 3K81A 3KR3H 4RMUA 4NC0B 2BOBB 1A2YB 4AT6A 1AKJA 2VDMH 5KN5A 5HVGB 3KXFE 1T4KA 5JOFA 5DJXA 4R4FL 4W6XB 1J5OH 5HI5D 3SDDC 1RJYB 4YPGA 4MNGA 3O6LH 4DCQB 1S7VB 4V2BA 1JNNL 2FSEB 1A7OH 2X4NB 1EJ6A 4LSSH 1J87A 3CFDB 1KTDA 4JRXB 3P9LB 1NCDL 2XPGB 4PRID 4OGXL 1F6AB 1K8IA 1J0IA 1EPFA 5CEZE 1IQDA 2BVQA 2VDNH 1YN6B 2WWMC 3ZE1E 3HR5A 5I8OL 1E4KC 2DBLH 4ODSH 5KVEH 2Y5TB 4K71B 5K9KA 4PIRF 3D2UB 4JM2D 4ZO7A 43CAB 4EOWL 1I8LC 3MRBA 4QHKJ 1TJGL 3BZEB 1IKNC 3I3BA 5IGXH 4QOKD 3SO3C 3S34L 4XPTH 2BRQA 1EHAA 3IDIB 2E7CA 4YQXL 4TSCL 3LQAH 5CP7A 2VLLA 3JBG7 4OD2A 1C12B 4UT9H 1Q9OA 4WUUE 3PGFH 5BO1L 4OFKA 4PJ9B 2NY2B 3F7YB 4PTUB 2BZDA 3JWDL 4GS7C 2A2QT 4YBLC 1EGJL 2FYYB 3F7RA 2DQFB 3BO8B 2VSDA 2GT9A 1A6ZA 4PS4L 2NY3D 5KAQF 4OTXH 4P5KB 4TNWF 4NO5B 3TO4C 4Y5XB 4M8VA 2BFVH 5C0GB 5I75B 1LO0H 2DKUA 5CEYA 5LXGL 2V5RA 5IB1A 1JHKL 5EPMB 3AREB 4C57C 4DZ8B 3EGSB 5ANMA 4AL8L 4NM8H 4HXBL 2ZUSA 4UDUA 2BJMH 2VQ1A 2J8HA 3IRZA 1QG3A 1NC4B 1P5UA 5GRUL 5IBLC 5DJZA 2EH8L 8CGTA 1T1YB 5ICZA 4JFED 5H37G 1BM3H 4V2CB 5GS0C 4YFEA 5HDBE 3TN0D 1EJOL 4HG4J 3IF1B 4HPOH 3FONA 5GJSH 1CF8H 4PJXF 1HNGA 5CLWA 1CL7L 2VXTL 2XWJA 4XPHL 4ZMAT 1NDGA 2VDOH 3ECBB 4JEGB 4ZFGH 4JREB 1JGEB 4NRYA 5MI0B 4PJ8D 3WD5L 3CX5K 3T77B 5IB2A 3INUL 1E4XL 4QHKI 5DJ2A 3WNOA 4S2SB 1MCPL 4NN7B 4Z7WB 1FYTD 3E2HC 4XCYA 3WIHH 3IB4A 2Y7QA 2UVEA 2DM4A 1FVEA 1OM3L 3U9PH 3O4LD 4ZTOH 3A0OA 2N4IA 5AWNH 5L88L 3WFHB 1BIIA 1S9YB 3T0EE 5JHDD 4FQXA 2HMID 4HH9B 1BBJA 3V4VH 1E6OL 4FFYH 3MNWA 1A6PA 3U9UA 3MJ9L 2VOTA 1EFQA 4PJGE 3L3GA 1QSFB 3NPSC 5KVDH 4PP2B 3QCTL 1S7RA 5F6HI 1PZUB 7CGTA 2OJEA 5E6IC 4DKEL 2C3XA 5FYKL 2P45B 4L3CA 4KVNL 1HYSD 3V6FB 4LCCC 5E2TH 2CDGB 5CJOH 2GJ6B 3MBXL 1MFDH 3KLHC 3CNKA 5EC1B 5KVFL 2FL5B 2C26A 1U8HB 4PD4J 1XCTA 3BDYL 4MJ6A 4MNQD 1F3DJ 5FYJD 1JMXA 4PGBA 3ALWA 4HLZH 3WLWC 2IAND 2DQTL 2R4SL 3MRGA 1XGQB 2XKSA 4ZYKB 5HYJD 4K8RC 1DEEA 2Z35B 1UJ3B 3MODL 2VZSA 3FO9A 2BOCB 3P0YL 2XZAH 1WBXB 1JUFA 5ICYA 1FO0B 1KNOA 1ZT7A 4D9QE 4W4OC 4O2CA 4PJ7A 3EFFA 5I74B 5I1JL 3C6LA 5IHZB 5K9JH 3ARDC 1TPXB 2A73B 4R3SA 3QUYA 4XNXH 4NSKA 1RFDL 2P44B 4QTHB 3QXAA 4R7DB 4W4NA 5D7IF 1HHHB 3HE6A 4UBDD 1PKOA 3GMLB 1MCSA 4NRXA 1IBGH 2A6IA 1CXHA 1RZGA 3ARBA 2B4CL 1ZLVH 5LG1A 2JJSC 4LEXH 5CBEB 1B90A 2DI8A 1Z6JT 5T1MA 1FLRH 1XZ0A 5I1DB 2X42A 4XCCL 3QNXB 1T7WA 3ZMRA 3VJ6B 1RZ8B 2FEEL 5C0ND 4OLEA 1MRFH 1KFAH 1EH9A 3GUTB 4KQ4L 1NCWH 5LWYL 3BWAB 3IAPA 2WLYA 1YYLH 4P3CH 4ETYA 3O2WL 3VWKC 3PUCA 2EYRA 4JFXB 1CR9L 2GCYA 3MQIA 4ZS7L 2R2EA 1IGFH 3D39D 4GT7A 4P5TB 2DD8L 4NN6C 2BRRH 4HC1H 4A2LA 5D70H 5DT1L 4JFZL 5JQ6L 1D9KB 5FYLD 4KFZC 2JE8A 1KIQA 3QI9B 4NKIH 3I2CH 4QTIL 1N59A 1FZMB 3C60B 4H26B 5JW4M 4X6CF 2VDLH 2OR7A 3MYJA 3WN5C 5L9DL 2JB6A 4M5ZL 3IFOA 4Y19D 1XGUB 3Q3GA 3WO4C 3VGFA 4FQ2L 4LAQL 3F7VB 3BRDA 4RAUB 1DE4A 3PV7A 1ZHKA 3KVQA 3PHOB 4LU5L 1J0ZA 4JKKA 3ARFB 4O5LL 1X44A 5HHXH 2VZTA 5EBMA 3JTTB 3F58H 3JV5A 1HDMB 4MXQC 1KPVA 4KVCL 5C0BB 4F7PB 4EIGB 4FQCL 4KRPD 5C0RL 4K23L 4LKXA 3RUGB 1BWMA 3BYYA 5C2BL 3P30H 1NGQH 3UTZB 1AXTL 3S35H 1IEBB 3UYPA 2R56H 5ICXB 1HQ4A 4X8XA 5F1SA 1J0HA 1HCFX 4S1QH 1I7UA 4UV4L 5JXED 1WIUA 3K0WA 2RJMA 1Z9OA 2HRPL 1S78C 3VXNA 2D7QA 4M7JL 4RMTA 2WK2A 3RIAK 1I1AC 1OAYL 5DD0H 4M1DL 1Z5LA 3LN4A 4QHLB 2ATKB 1IAII 2ZCHH 1O5DT 3IAGC 3VW3L 4P23A 4K3HA 4OUUB 3TBVB 4H25B 1G7PB 1MRDL 3MRHB 4Y4KB 4JZJA 2E7LC 4JFPB 4JFYB 3DYMA 3FO1A 4TRPH 1EXUA 2UVFA 3UTPD 5ALBL 1VACA 2VC2L 1UA6L 5F6IB 1AXSB 4Y16B 4MJIE 1LGVA 3IAQA 3OR6B 1IM9A 1WFOA 4TTGA 1T0NB 4HKBA 5AYQA 3U7YH 3EW3B 4NGHH 2D0GA 5DZLA 4X83A 1MH5B 3KLDA 3CX5J 4AEIH 4LSQL 3K1KC 3ZL4L 1XGRA 5HYIA 1FDLL 5KSBF 1AGEB 3QPQD 3PWVB 5ID1A 3QRGH 4EVNB 2ICES 2XACC 1C5DB 1KJVB 2I25N 4JHWH 1CXKA 5F70A 4X4YB 4XMPL 1BGXL 4YDJA 1P9MA 4GRWF 3LV3A 1JGDA 1SBSH 2D03H 1T5XB 3PL6B 5CD5C 1RVFL 6FABL 5D1ZB 3B5GA 1OF2B 5KSAC 2D7PA 2IF7A 2IH1B 1FNAA 3KPPB 2C4FU 1WZ1L 3ZHLA 4U2YA 5DO2D 4LLVB 2Y36H 3SDAC 2YPLA 3PF2A 4JGJA 3KPRB 1OAXL 1HN1A 3MRJB 4LLDA 3IVKA 1BMGA 5EBLA 4RGNC 2Z92A 2R0ZL 1PYWA 4PJDE 4P5MA 3SQOH 2VYRE 2NY4D 4L5FH 3VXRB 3LB6D 4WFGE 4PB9L 1GOGA 3VWJB 2KZ1B 3UMTA 3WJLA 3DRQA 4KHTL 5B3NA 5K9QG 4P0DA 1FNEA 3ILQC 3LSOB 4XT1C 3ET9F 2W65B 4OCSH 3P73A 1T89A 2YOCA 3TM6A 4N8CH 4FABL 1VFUA 4XAKD 5FA3B 1EV2E 4Y1AE 1TVBB 4X7FC 2QV2A 4YDIH 2YUXA 3RGVA 1G7LB 1JP5A 3RIAF 5I8EA 2DDQL 2OCFD 4D0DA 2ARWA 2NY1C 2APFA 4XBEH 1MCOH 2UY6A 4G8EB 5D2LB 4PGEB 3SGDI 5L8JB 3F65A 4HEME 4NO0B 1S7UB 2IH3B 3QNYA 4LRNH 4NZTL 1M1SA 4FHBD 4OF8A 3LKNA 1P53A 4OV5A 3T0AA 1YMHA 5GGQH 4K3JH 3U4BL 3MFFA 2A6DA 4LRIA 1CD9B 4UNVA 4MQ7A 5CGTA 5TPWH 1J0KA 5L8LB 5FM8A 3BSZL 5E08L 2JF1A 1MCEA 3C8KB 5BZDA 2QKIB 4P4KC 3NH7H 4NO3A 1H3GA 1I4FB 3P11H 4POZD 4KXZI 3SCMD 1UJTA 4KKBC 4U1HA 5ILTH 3EJYC 3MBEC 2Y1VA 4NQDD 5I6XB 3BPLC 3MUZ1 5FKPB 2A0LC 1MHEB 2XTJE 1QFHA 3VXUA 4V1DA 2OK0H 5GGVY 4PJBF 3TZVD 4YHLL 3QP3A 3FFCB 2DTMH 4GSDL 4ODHH 3HE7D 2HFGH 3DSFH 4L3EE 4JRWA 5DYOB 2JCCF 4JCLA 2F15A 1NGWA 2Z4QA 4WW1A 4G9FD 5F7LB 1MCWM 1AP2B 2FECL 4ZOCA 1LO5A 5DRZB 2EIEA 3CPLA 1MUJA 4BQ8A 4WI6A 3BJ91 1T3FB 1UFUA 4OLVL 4X6DB 5IFAL 2APXA 3FN0L 5CKGA 3LQAC 5ENWA 4RFOH 1MREH 4PJXE 1DBKH 1QBML 3LN5B 2Y72A 1Z3GL 3FMGH 3G5XA 4XNZC 5EZIH 3ARGC 4JFFB 1A9BB 1CWVA 1S8DB 3QWOB 5GRVL 4PGZA 4UILH 3KPQB 5FUOH 3RI5K 5I0ZA 1MOEA 5E5RB 1I8IA 3ZTNH 1MI5B 4P99A 2I07A 1WAAF 1H3PH 4LCUA 5DRNB 1DQLH 3BZFB 3EZJB 3DURB 7FABH 4N9OB 1QQDB 4CAGA 4P2OB 1OAUH 4K3DL 1A7NL 3CZJA 4JR9L 4JM2F 4I3SL 4F7MA 5J1AB 1FAIL 2EIBA 5D7LB 4QHNB 3BKJL 1MFAL 5J11B 1BZ9B 3GRWA 3GSXB 4ELME 4HUUA 3B2UC 4LPXA 4HCRA 3U0PB 4DEPC 5DHVH 4FFZH 3S8WA 5IFJA 4C56E 1E27A 3ARPA 4ZUSB 4Z18A 1U8PB 3VXOA 4IIQC 1U8OB 5JW4Q 3CX2A 5SWSE 2EDBA 3FT3A 3R06B 5I16A 4XXCA 1H0DB 4PJAE 4G8FA 1GZQB 1MCQA 2HT4D 3QIWA 4WTZA 3MFGB 5GISH 5I18L 1NKOA 3W5MA 3UDWC 4AT6B 1AKJB 1FO0H 1N4XL 2YKLH 5KN5B 4EXKA 3GSRA 1T4KB 5JOFB 4Q2ZA 5DJXB 1T0MA 4MA8H 3PGDA 4YPGB 1WLHA 4MNGB 4XWOD 2XRAL 2D9CA 2VLMD 3KPMB 3P77A 3PWPE 4JO2L 5IEKA 2F19H 4F8QA 2WBJA 1KTDB 3FB5A 2QQKL 1U8QA 2ZJSL 4ETQA 2OTUA 1K8IB 1F5WA 3MLXL 2M1KA 3MLVL 4PRNA 4KTDL 1IQDB 2HJFA 2BVQB 2X2YA 3C5ZC 3QHZH 5D7IE 4MD5A 3HR5B 3BESR 4GQ9L 3RVXD 1YEKH 4R4ND 4BFIA 1KCVL 1LO3L 4XC1L 1KCSL 4LCWD 3OJ2C 5K9KB 3B5TA 3NPZB 1BVLA 1CIUA 3L95A 4Y4HC 3MRBB 1W72L 1NBYA 3SY0A 4Z0BL 1ACYL 5DQJA 3WJJA 4D3CL 1UWXH 5F9WC 5E9DE 1GJIA 3AB0C 3RI5F 2OBGA 2VLLB 4JGUA 4KROC 3GBMH 4IRJD 5TJWK 4JRYA 1Q9OB 5F96H 1RJZA 4X4ME 1JV5A 4Z5RA 1KSRA 3CD4A 4R97B 4MB3A 1D6VH 4EXPX 4NIKB 1Z2KA 3HNSL 4MQSB 5C6TH 1CDBA 2GT9B 4L3EA 1A6ZB 4OCWH 1AGCA 1GPOH 3VD3A 1HINH 1IQWL 4K3EH 5BS0D 4GXVH 4X6CE 5CEYB 1FRGL 4RFEA 5IB1B 3EFDL 5KTEL 4RWYL 5ANMB 4BFBD 4UDUB 2VQ1B 1A64A 5F9OL 5DD5H 5DJZB 5ID0B 1PEZA 3W11C 4GBXA 5ICZB 3MLTA 1ZVHA 4AM0A 2C5DC 2P7TA 5IMLA 4KK6D 1F90H 3VXME 3C8DA 3FONB 4L4VE 4FRWA 5D5MA 3I6KA 4Z7UE 4FQ1H 2MMXA 2XWJB 4HWZA 1P7QA 1NDGB 2ADIA 5E1HB 4ODUB 3B9EA 3H9SB 4F15B 4WI7A 4NRYB 4XMKL 2R29L 5JR1L 1HIML 4MD0B 4R26L 5DR5L 1QKZH 3MA7A 2YK1H 5IB2B 5HVWA 2EEBA 2WQRA 5I1IH 5DJ2B 1A6WL 3ZKSD 1NMBL 5IBTH 1UWGL 3BAEH 4XCYB 2Y7QB 2XG5A 1FVEB 3IYLW 4YK4B 2F58H 1EVTC 2AEQH 1KENH 1S7QB 1BIIB 5L6YH 4FQXB 1S7TA 1AI1H 1BBJB 1R24A 4I3GA 3MNWB 4LLYA 5D93B 1Q72L 4HUXB 3ZO0A 2HFEA 3U9UB 4P9ML 2HT3D 1DUYA 3GKWL 4WCYL 3L3GB 4KGJA 4ZSOE 1JNLL 2F74A 3RZCB 2OJEB 2WQ8A 4R4FH 5AZ2L 4BELD 4L3CB 2PNDA 3NGBC 2FJFA 1I7TA 2IPTL 1AC0A 1JNNH 3NCJL 1L0QA 2HLAB 3G9VA 1ZLUK 1A02N 2VQUA 1A4JA 3ZE0F 1XCTB 1NCDH 4OGXH 1REIA 4PGBB 4N5EC 2C4XA 5FEBA 1LHZA 4WGWB 3TH4T 5I8OH 3MRGB 1KOAA 1OD7A 4GRWE 5GSRA 5DFWH 1DEEB 2APVA 3PWPA 3KS0H 4M62L 2KPNA 3FO9B 4EOWH 1JUFB 1TJGH 1X4XA 1ZLWK 5ICYB 1KNOB 1ZT7B 4HLZG 3I3DA 3V0WL 4O2CB 4PJ7B 3EFFB 1N5YL 3S34H 3C6LB 1E28A 4U49A 1BLNB 4R3SB 3QUYB 4TSCH 4YQXH 3RFZC 1NEUA 2NY5L 3ES6A 3QXAB 4WEUD 5BO1H 3HE6B 4QF1A 3AS0A 4OZ4A 2JJTA 4WI2A 1WEJL 4LPVA 4NRXB 3ALPA 2A6IB 3JWDH 1RZGB