5I1LB

Crystal structure of human germline antibody ighv5-51/igkv4-1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARYDGIYGELDFWGQGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity in a human antibody germline library.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords FAB LIGHT CHAIN
total genus 41
structure length 213
sequence length 219
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i1lB01
4D0DA 4YHZL 1RQ5A 2OSLB 3DSFH 3PHSA 1V8HA 1KEGL 2NY2C 3LS4L 4N68A 4HWBA 3SJVD 1UM5L 2Z35A 4BSWB 3VWJD 5I1LA 5IVZA 4M4RA 5D8JH 5I73B 5DJYA 1P7KB 3ARFD 3F8UB 4PY7A 4CVZA 5L0QC 3CVHH 2EC9U 3TJHC 1FO0B 3MNVA 2LTQB 1KGCD 5J12B 5F72S 2B1HH 5F7HA 5CLWA 1NGXA 4NQSB 3G04A 4XMKH 5SWSB 1RIVH 4W4NA 5EPMA 4Y4KB 3WO3B 2FZ3B 5EO1B 2Z91B 4KV5E 1QSEE 2VXUL 1P4IH 3V4VH 4Z0XB 1RD6A 1TZHA 2DIBA 4PJIF 4Z7VF 2NX5B 1AE6H 1I7RA 4MXVE 2W59A 3ROLB 3TVMD 1FZKB 4O4YL 2RAMA 2QQQA 1JZ6A 2NY2B 1MCOH 1MCJA 2CDEB 3QQNA 1IQDB 4P9ML 5IHZA 3QIWD 1T1WB 5LG1A 4P99A 4FXGB 2PW2B 4UQ3A 5CMAA 2XKNB 3LZFL 3BGMB 3V7AG 1HOCA 4XXDA 1OTTD 4O5LH 5JDSB 2IQ9L 3IJSB 2MNUA 5IBUB 5IKCB 1KFAL 2XY2A 4FQIL 2AJZA 1S7UA 2VQUA 4EDWL 1J0JA 4R7NB 1KCSH 1ITBB 1XGRA 4CN1A 2QQLL 4M8QA 1IAMA 4M8VA 4GW5B 3WBDA 1CL7H 3KG5A 2R0LL 2YHGA 4JQVC 5C0BD 3RL1A 4MAYC 1CVRA 1U42A 4NKDA 3W0WE 4PJEE 2NY4B 2XQBL 1JNHA 1R3KB 4JM4L 3LN4A 2O61B 3CFEA 5EDXA 1SM3H 4MA1B 5IESL 5IGXL 2X1PA 2IAMB 4NFCA 3SEPA 2CRYA 3AUVA 4ZD3L 1MJ8H 4KPHL 4QRSB 3RWIA 5BJTB 4MJ5A 2FATL 3VXPA 1L9NA 4KQ3L 5I1EH 1NEUA 4L3ED 1AR1C 3Q5YA 1DLFH 4GJTB 4R26L 1RUPL 4JQVA 3SKNA 2QSCL 3IVKB 4K2UL 5HYJA 2L7JA 4U1SB 1E4WH 3VFNA 3JWNC 4OD2A 2AEWA 1U41A 3GSNA 3LRSA 4XNZB 4UBDD 4U1NA 1RUML 1FVCA 4R90L 4K3GA 3O41A 3ALPA 3GMRA 3RVUD 2VLJA 5I8KL 1NBQA 3CZJA 2XN9A 5CSGA 4UU9A 1FYTE 5D5ME 5B4MC 2JIXD 1TPXB 1J1XH 2LV4A 4OD3H 5IW3A 2VISB 2WINA 3NA9L 4PP2A 5FCUL 1HYSD 1AGFA 4HC1L 3WFDL 3WIFA 1N26A 1MSPA 5J6HA 1CK0H 5HYJB 2CLVA 3GKZA 1NLDL 4YE4H 1T1YA 2FGWH 2Q8AH 2ZG3A 1AGDA 3BAEL 1VB9A 4CJ1A 3BDYH 3WMSA 3CXHK 5EZLB 1U3JA 4N8PA 1HSBB 3MOBH 1YEEH 4WTZA 3VXOA 1WTLA 3BGFC 3DBXA 4EJ1C 5DUMH 2XTJD 4U6YA 4NRXA 4MHHG 1S7XB 1XF3B 4GMTH 1FV1B 2XWJB 2J88L 4JRXA 4Y1AA 3TN0C 1FO0H 1A6PA 4LLWA 5E1HB 3BH9A 1D5XB 3PHOA 5CD5D 1MY5A 5F8RC 3IJSA 5FF6A 5J6HB 1KEML 5BOPA 1S78C 2W9EH 3PGFL 3QEQB 3ZE0E 4IRSC 1I9JH 1A6AB 5D1XA 3F62A 2CRMA 3KS0H 1ERNA 3SKOA 4M6OL 4PJ7B 5INDB 1QOKA 2PF6A 4BZ2L 5DHXB 2J3SA 2EE3A 2YN3A 4Y4HB 5FUCC 3UJJH 3CDGA 1U8IA 5L2JB 1R5IA 5LJYH 3MGAA 5DFWH 5JHDB 5FECB 1AGEB 4KY1L 2O5ZL 1MEXH 1QPPA 5E7FA 2M26A 4APQC 1JGVL 1BEYL 5CGMA 5FF6B 4X6EA 3IJYA 4GMSL 4PTTB 5EBLA 3ZE1F 1NPUA 3RVVC 3ULUL 2YMXL 4Q6IA 4HMDA 1EHLL 4GKSB 3DGCR 5F6HJ 2G2RA 5CS7A 5J89A 3S4SA 3JUYA 3UC0L 1X7QB 1MIMH 2VZOA 5E2VH 1VHPA 2P5WE 1WUNT 4RA0C 4BFBD 5FYKL 1NGWB 5HI5C 2PYEE 2JJSA 4TRPL 4CMMB 2A1WH 1IEAB 1PQZA 3QDGD 3BKCL 2HMIC 4WFGD 5T3ZD 3MRLA 1BFOB 1CQYA 3KPSE 1JNLH 2GK2A 3IFNH 2NY3B 4YHOL 3UEZA 3VFNB 3PIQB 3PNWA 1A22B 1PJ9A 1U58B 3T3PE 5CBAA 3IJYB 1SJXA 3O4OC 1EK3A 4XRCB 3GJFK 1N6UA 3W9EB 2OP4H 3TIDA 4HQQL 1IL1A 1LO0L 1Z5LA 2OMBA 4P0DA 1N2RB 3LN9A 4FQXA 1IQWH 3WNNA 1S5HA 4XXCC 1G6VK 4OZIA 3VRIA 3MV8A 1F3JA 3D0LA 3VXRA 5J0BA 2FO4B 4HIIA 3JBG7 2J88H 3RTQD 4ZUTA 1T6WA 3P4LA 3VXTB 2R0WH 2HKHH 4CDHA 3T2NH 5J12C 4P23C 4K07A 4A6YL 1NLBH 1CIUA 4Y5YB 3UJIL 5FM5O 4PFEA 4WO4C 3IDXH 2VRAA 4OTXL 4EN3B 4WUUB 1N8ZA 5HHME 4P59L 5T3XL 1KPVB 4WEUD 2BY1A 3HPJB 4NWTH 1CTNA 4XPTL 3QULA 5DEGA 4MNGA 4HF5H 3OWEA 5C0GA 5E94B 3FRUA 3TZVC 1S5IL 3INUL 1NDGA 4P5KA 4MD0B 4Q58C 4Y4FD 3MRRA 2WUCH 3EFDH 1KXTB 1BQHB 1RHHA 5E8DL 3FO0H 1INQB 1INDH 1FVDA 3RU8H 3WXVL 2UZYB 1OAYL 4C54A 3ZSTA 2QSTA 4GAFB 5JLZA 3MXVH 2OZ4A 4HK3N 4R0LB 3TO4A 3C2AH 4Z7WF 5A2IH 3L3JB 2VQTA 4L3EA 1FNSH 3HR5A 3PWUB 3OXRB 1I1CA 3QI9C 5F89B 5C9JB 5ADOH 4TULL 5SWZA 4F7EB 4QT5B 2OI9C 2LU3A 4OZFH 4JFFA 1XF4B 4RWYH 1RUMH 1QLFB 3T3MF 2IQAA 4IOFD 5D96C 2AEPL 3QNXA 5EZIL 3CVHL 2JTDA 2ZCHL 3N1QC 4RMSA 3V4UH 4X83A 4KQ4H 5HHOB 2CJUL 3DX9A 3QJFA 5CSZA 5C0BA 2EIBA 1D6VL 1VGKB 1CF8L 3ILPB 4MAYD 4Y16B 3FFDA 3MV11 4PJDE 4G5ZL 5C3LD 3O4LB 3K2UH 3QIWC 3ES6A 2DRUA 2IANB 1HXMB 4G8GB 1CFQB 3RZCD 5KW9L 5DQDH 2IH1B 4HGWA 1WIPA 4FQHB 4P46D 4DZ8A 5C2BL 4JPVH 4LLDA 2AV7B 4I9WD 2FO4A 2DM3A 5EU4A 1DQQA 2NTFA 4PJ9D 2VZTA 3L3DB 1GZQB 3CC5B 5GISL 2CIIA 1W72L 1EO8H 4PJFF 1VEPA 5IMMA 1BBDL 3L3GA 2E7CA 3MACL 1MLBA 1H3XA 3VXUB 4F15C 5E95B 4BSJA 3BE1L 3OB8A 5C0DA 4OFIA 5JORA 3TIEA 3LB6C 4KXZH 1VACA 1QFHA 4RAHA 4X6FB 3VFTA 4Y2DC 1EHNA 3KJ6L 3N1GC 1IT9L 4RRPA 4IOSD 1NBZA 1AI1H 4JFFD 1AHWA 4UNTA 4CMHC 4K71B 2OQJA 1QLEH 3G5VA 3C6LB 3WLBA 5BRZD 4Q0XH 4PD4J 3MGOA 4DGYH 2JCCE 2DWDA 1IM9B 1UZ6E 4DN3H 4KY1H 1QFWL 2YSSA 4MNQA 4OM1L 5HHVH 3MV01 4YDKH 3IAPA 3EOBA 5DD5L 1J18A 4MZ2A 3WXWL 1J7VR 3WYRA 4ELKA 2XN9E 1AIFB 2RIKA 2VLJE 3RNKA 1RZIA 1WAAE 4UAOC 3QR2A 2AQ2A 1CFNB 2DDQH 4YZFF 1DEEB 2AJXH 3O8XD 3PWVA 4JPWL 4B7LA 1JNNH 1VGEH 2D0GA 5L6YH 3KNBB 1SMAA 3QUZD 3ZE1E 3WFBL 3R06A 3WXWH 5DGQA 4ODWB 1A9BB 5LVEA 1AO7D 4K8RC 4I3SL 4OZHA 3DETC 3MXWL 1T7YA 4XCCH 3KS0J 3WFZA 3VGFA 5KSAC 2VUYA 5M7QA 3ARPA 2QV2A 4TNVK 1BBJB 1IC4L 1QSFA 3UTSE 4ZUSA 1GOGA 1TZHB 3CFBB 4LLUA 3GIVB 4ODBD 3ES6B 4JM2F 2CLZB 2AXGB 1YEGL 3WEXA 1U36A 4KJYA 2BNRD 2UYLB 5GGUA 1NSNL 2OMNA 4FQCL 2IFFH 3SBWC 4KRMB 4FQXD 3ULVD 3WJJA 3QUZA 4RGNB 2NY3C 3PWLB 5INCB 4JQXA 4QO1A 5GRWA 5E56A 4XWGH 5F7DB 1YY9C 5L8LB 3BUTA 4S1DC 4APQB 4LLYB 1UWEH 5L0QB 3MLZH 3H9HA 3QNZA 3OG6B 5F7NC 3S8WA 4RFOH 1KJ2L 2SEBB 1P1ZA 1B0RA 4I3GA 4FXLA 4KZDH 4QHKI 3V4PH 3WHE1 2OK0H 4P46A 2HRLA 2NY6D 4JHZA 1I7TB 4K3EH 4QRPB 2DM4A 5IB4A 1Q72L 3KXFD 3OKEA 4MNQD 5INCA 5MENB 4LPWA 3Q6GH 4ZXBD 4XX1E 1PKQE 1MVUB 1BFVH 5DK0B 3RZCB 1K2DA 4K55A 1YMHB 1N3NB 3ULVF 1L9MA 3MJGX 5CZXD 1W8OA 5C0AE 3HG1D 4PR5B 2E6PA 1FYHB 4YNYB 4YPJA 5IWLA 4L8SA 4Z7QF 1NBYB 4CADB 1AKJD 4N0FB 4CUCA 1FNHA 1T4KB 4JM2C 5KAQG 1AP2A 1N6VA 4DFIA 3T65A 1EO5A 4I2XE 5FO9B 3VG9C 1RZFL 1XF5A 3W39B 1S5IH 1C1EL 3CK0H 4QF1A 1F6AB 3BHBA 5HTSA 4PJAB 4UINH 4C56E 5JMRA 1GGTA 1L7IH 2O5XH 2V9TA 4NGHH 4P46C 4HKJA 4O58H 3RU8L 4AH2B 1XCQA 2BOBA 1FYTA 2D9CA 2ZUVA 1X5GA 1JJUA 1KJ3H 4P2QB 1T22B 4M5YH 1F2QA 4U7SA 2R0ZH 4Y4HA 1FFPA 2X4PB 4ONGH 5E4EB 4EUPH 3QHFH 3GNMH 4W6XB 4JDVA 5I30L 1AE6L 2RFXA 3IDIB 1A7QL 2C4FT 3C5SB 1FC2D 3MYZA 4PY8J 1PZUB 4XPHL 2MTPA 3QIBB 4ELME 2CDGB 3KLAB 1J11A 5D7JD 5GS1C 3V4PL 3RBGA 1NAML 3FT3B 1WBZB 4XNMA 3OZ9H 3VRLF 5F93C 4WTZG 1I75A 1NGWA 2C3HA 3VXME 4WFEE 1KXVC 4NRXB 2KBGA 2CO6B 3HZKB 2VDOH 1CGVA 3VXQB 2IADB 3BO8B 1ACYL 4KQ4L 3QBTB 4LCIH 4PBWD 3S9DB 4J4PA 1KENH 4Z7QE 2F58H 3UPRA 3QCUL 4DCQA 4NSKA 1FLTX 3H9SD 2XA8L 3RX7A 2V9QA 3LCYA 1BFSA 1LO4L 5HVHC 4N8VG 3L5XL 4KKCC 4X99B 2VLLA 4XHJD 2V5TA 4KRPC 1RIUL 3RFZC 5FYJD 2ZOLA 4ZO8A 1LK3H 2APXA 1VADB 4U6HB 1SJEA 2WBJA 4X9BA 3F7RA 3T0ED 4UT6H 1BECA 3QXAB 1VCAA 3IJHA 1RSFA 1XH3B 1WZKA 2J8UA 4N0UE 3T1FB 3EO1B 2PTTB 1MHHB 1OW0C 1VEOA 2C1PB 5IVXF 5I19L 3BKJL 1YC7A 3RGVB 3SN6N 1JGEB 4NC0B 4M7LT 1GRWA 5D1ZD 2Z8WC 5C07D 1R5IB 3SY0A 3H9YA 3T65B 2P42B 4GG6F 1CDGA 1JF1B 3MO1A 3FMGH 4RFNC 3CDYA 4P5TD 5JPMA 1SHMA 5H37H 1S7VA 4OIIL 1RMFH 4U1HA 3LQAH 5ANMB 1WK0A 1DEDA 3U0TB 5FA4B 3TN0D 1X5LA 4R3SB 2HT4C 4JFZL 4L4TE 2BVYA 1MY7A 1MAKA 3CFKB 1QR1A 1N59A 1MVFA 3RPIB 4KUZH 1FL5A 4PGBB 5D1ZC 2Q86B 4ONFL 1MREH 3SE9L 4BM7A 3EJJX 1RY7B 4V1DD 4HMEA 4QRUA 2H2SC 1IC7L 1U8PA 2XRAL 3O6FC 4NQDE 3P0VL 2EKJA 4FQJH 4BFEA 4X6CE 5HD8C 5T3ZL 5DEFA 1HZHH 4PGCA 1P4LA 1JV5B 1I1AB 3U0TA 1A3RH 4WUKL 3WE6B 4JFZH 4P5TA 5FUOH 4HLZG 3FTGA 3GSVA 5IB3B 2FX7H 4FNLL 2EO1A 3QIBD 4IEFB 5I1JH 3WFDH 1XR8B 4PJDF 3P9WB 3MBEA 1DANT 3BDXA 5DEGB 1UB5A 3OJDB 4RNRA 3FT2B 3QT2A 4I18A 2A6IB 4XXCA 3NIFF 4QCIA 1KF9B 3RKDC 4GBXA 4QRRB 3UTTE 3L6FA 1LK2A 3KYOA 5MEND 4FZEL 1CWVA 4GKOA 5C9KA 5E1AA 3VFPA 3MX0A 4YFLF 3WUZA 2WBKA 1CDHA 3KPMA 3H0TB 4U6VH 2IFGA 4HXBL 1JNJA 4L4VB 4NCC2 3X14A 1RULH 2I60L 1F6LL 4R2GC 4LRNL 4LU5H 3GRWL 5B21A 4HLJA 1DQQB 5IBTH 3ZE2F 1MRFH 1QO3A 1S7SB 1A6WH 1IGJA 2BNQB 3BPCB 4C55A 1R5WA 3MLUL 3BP6A 2XXMB 4D0DB 5DRZA 2H3NA 2DQEL 4PJXE 4P48A 3UYRL 1K4DB 2R8SH 5DJCB 5E1AB 3VFPB 3TZVA 5DURB 4WJ5B 2VDKH 3CNKA 2XWJA 4GKZA 4OLXL 3DUUB 4X5WB 3KWWB 5FIEA 2D03H 3QDJA 4L9DA 2H2PC 4LPXA 3FFCB 4H25A 4YX2H 2VXVH 3UC0H 1J8HE 1K3ZA 3E3QC 4Y88A 3PE9A 4OZ4A 5E2UL 4RWHA 3DMMA 3EYOB 5DRXB 4HG4J 4K71C 4B50A 4JFXA 3FOMB 4XCFL 3MJ7A 3S88H 1G7HB 3LD8B 3O3DB 2DQFB 4PG9B 1QHOA 3B9KD 3TV3H 4I9WE 1DBAL 1XCTA 3O0RL 2E9BA 4L4JA 5L2KB 2I07B 3KPLA 4LLVB 1MQKH 5GPRA 5JHDA 3KYKL 3PP4H 4OFYA 5GZNC 1NUDA 2IPUK 5EU4B 4TQEL 1YMME 1QG3A 5LKNA 5FYLL 4UINL 3KHQA 3OXSB 5IJKA 4QXWA 5A3IC 5IG7A 4WI2A 2QHLA 5H35B 1SVZA 2G2RB 4D3CL 4RFOL 3L3GB 4M5YL 1RK1B 2NR6C 4MXQC 4ZXBC 3WDIA 4CMHB 2VC2L 4KJWD 1NCDL 5FYKD 2X10A 3K8KA 1LNUA 1LEKA 3QFJA 3C60C 5J1AA 3FRPA 3SOBL 2FR4A 4OTXH 3QQ4B 3WN5B 3CZFB 2D0FA 4GFTB 3LMJL 1UQSB 2G5BB 3WFBH 2VH5L 4LLMB 4E5XB 5C0CB 1MJUL 1ZKAA 5BVJB 2GTWA 3CSGA 1BFVL 2FJGB 2OCFD 2OSLA 3ILQC 1HQRB 1P6AB 2ITCA 4CVXB 4JFFB 4D9QD 4BELD 4F8TA 2ILLA 1DE4A 3MCLL 4LCYA 3U83A 3ZE0F 1XGUB 1G0YR 1YYLH 3TWCL 3MJ8A 1LD9B 5JR1L 1BX2B 3HFMH 2UWEA 2XTJE 1R3JA 4KJWC 1ZLUK 1QO3B 4M4PA 1N4XH 3KPRE 5D71H 3AY4A 5BMFH 1CGWA 1JHLH 1SJHA 2R56L 4E5XA 1ZT1B 4YK4C 5FFLA 5DJDB 4GXUM 4ZPVB 1KENL 4URTB 4TN9A 1I85A 2QADD 5EBWB 1HXMA 5TDOA 3MJ9H 5ENWA 3TZVB 2DKSA 4NNYB 3TJHD 2GFBB 4RMWA 3HLAA 3T3PF 5E6ZA 3VJ6A 3O9WC 4X6DE 3KJ6H 2JF1A 4U1GC 4OI8A 3LQZB 4XBEL 2WWKT 3QYCA 2FZ3A 2RBLA 4HGKC 5JOFB 4O51B 4JFEE 1FNEB 4OGYL 4CVWA 4B41A 1IGIH 2HA1A 3O4LD 5JTWA 3VWKD 4MAYB 5F96L 2V5SA 3CCHB 3CSBA 4KK5D 4TUJB 1VSCA 3TYGL 1EFXA 5DD5H 2VNCA 4LF3B 1EMTH 4H20L 1UH4A 3MRHB 5DJXA 4PYHA 3QHFL 2V2XA 2NY4C 3WD5L 3B3IA 3L5HA 4HJGA 3GIZL 3RWHA 2X4TB 2QQNH 3GJFH 3AXLA 3H9ZA 3HHRB 2HJKB 1GVIA 4L4TD 2FB4H 3SDXE 2DQHL 4DAGH 5GRZA 1PFCA 1L7IL 4W68A 1Q1JH 2UZIH 3G08A 4ZUVA 3ZDYE 5T1DL 1QFOA 2VDRH 3QI9D 1G9EA 4GW4A 1VDGA 2IPTL 2HJFA 3I6LD 5HHNA 1BZ7A 3IETA 3A6OA 2R0KL 4YHIB 3SDCD 4RQQB 2C4FU 4MWFB 1CDIA 3BVNB 3QCTL 4X9GA 1BREA 3NCCB 1A1NB 3K1DA 4GAJH 1EBPA 2W0KA 4JCMA 3PGCB 5T1KB 3KPNA 4ESKA 4O58L 1T7XA 2MHAB 3LHPH 5CINL 1FE8H 1EUTA 2HH0L 4LSTL 1R3LB 1GAFL 1U3YA 2FJHB 1T66D 3ZKMD 1GZPA 5C08D 5DD6A 2FHFA 2KQNA 2CXKA 3GKWH 4C83A 4NHUB 1L4IA 1YEIL 4G6FD 1MCWW 2GSGA 3HR6A 1OSZB 4GSDH 4MB5A 3OJMB 3ARYA 4OCXL 4OZIE 2HG5B 5I2IA 5F6IC 2APBA 4BJLA 2VLKB 1Z0NA 3SBWA 5DTFA 5ID1B 1S7TB 1OPGH 3MRFA 5I18L 3A6CH 1ULVA 3KPNB 3L5XH 4XNYL 3HS0B 3QWRA 4JRYB 1MCWM 5CZVH 4WI3A 5T5FH 3RWEB 1QP1A 4DTGL 2VYRE 1FVCB 2GITB 4PRDA 1HNFA 1WLHA 3BQUC 5FCSH 1Z9OA 3F7PC 3UBXI 1L0XA 1P6FA 1RU9L 1I8KA 3QB7C 4IDJL 3EJZD 4XCEB 4QHKJ 5F7MC 1J8HA 1IGFL 2ICCA 1A6WL 5DJYB 1YJDL 3GI9H 1NMBH 5DD1L 5EC2B 4U6HA 4Z7WB 3O11B 5IEKA 3X11B 5C8JA 1YJDC 1IZKA 2DLGA 2IF7A 5DHVH 4PRHA 1S7UB 4ODTH 4G6MH 1EX0A 3UZEA 4WWKA 3TIDB 4ORGB 1RZIB 1HHHA 2H9GA 1UB6B 2BMKB 1RZKL 4ZFFB 4JHAL 3D48R 4YX2L 2ADIB 3T09A 1J1PL 1W72B 3OKMB 2NXYB 2VLRA 4M5ZL 3ZYJA 2ZSVB 3GI9L 5CILL 1CD0A 2RFXB 1NMAL 3IDIA 1MNUL 4MD5A 5MEQB 5JPMB 4HKZB 2PO6C 4HHAB 1UCBL 1H9VA 3ILQD 4MNHB 5F1OB 4BK5A 1JWSA 5EOCH 4YAQB 1J1OL 4ODWA 3C87A 1IM3B 5GGVY 4ZS7H 2DMCA 1JE6A 2Y72A 5IBTL 2B20A 1NCNA 3N9GH 3AU1A 5ALBH 3V8OA 3GMLB 1NDMB 1IC7H 2GJ6A 2XRAH 5I1KH 4LRNH 4WY7L 1CBVH 4LCWE 1AGEA 3IRZA 4EUPG 4I3SH 5M95B 1P7QB 1W0VA 4NQXA 4NN7B 2MHAA 3S35X 5HD8D 1A2YB 4WU5B 3VCLA 1KT2B 2Q76B 4XBPA 1HHIB 4PJGE 4PLJC 1AXSA 2R2EB 4WNQA 2FBJH 1CDUA 2RCSH 4X99A 5DK3A 1QLRB 1I7ZB 3PUCA 1UKSA 3P4OA 1ED3A 1OSZA 1YNTA 1CXEA 3FONA 5KS9F 1E4XH 2BX5A 3MV9A 1OP9A 2WINB 3AB0C 4JRXB 3CU1A 3MRLB 4X4ZA 5HSFA 4LLYA 4GRMA 1A3RL 4KVCL 5KSBB 4MSWA 4S1DD 5I76B 1IL1B 2CKNA 3EYUL 3HC4L 5L9DL 2EC9T 3BKYL 1JPTH 5C7XH 4S1SH 3CSPA 4MXWH 5TE4L 2XKUA 3REWB 5A2LH 2A6JA 1MRCH 1K4CB 2ADFL 4R2GD 4OGAC 3KYAA 4QNPF 1LE9A 1OAZL 3MV7A 3ULUH 2GJJA 4I0PA 5E0QA 3WFEL 1CICB 4WI4A 4J23A 4F57L 2H1PH 3SO3B 4EIZC 1MH5B 3GMPB 3U7WH 5EUKA 5HXMA 4PRHB 3F12A 3KPQB 4ZUWB 1HXYB 5IROC 2ZG1A 4P57B 5J6GA 4R0LC 1KN2H 1J8KA 5LWYH 3O41B 4U1LA 4MJIE 4LPVA 3V6OC 3HPLA 1JZ3A 4FABH 3NCJH 3QUKA 2RGSA 3HC0B 1I9JL 2DQJL 4M6MH 4HULB 2E6QA 4QWWC 4ZAKD 1N5AA 4PP2B 1KGCE 3CVIL 4U0RC 1MWAB 1WTGT 3WFCL 1T7WA 3AREA 4FQQA 4H8WH 2ARJB 2WP3T 4AL8L 2Q6WA 3ZMRA 4HSQA 3BKJH 1LO3H 1S8DB 1JHKL 2DQTH 4O2FA 4WEBL 4YXHH 2I9TA 1XGPB 2RCSL 1TFHA 3T0EA 3SJVE 4JM2B 3GSVB 5IB3A 1DVFB 1FQ9C 4NO3B 4L9LB 4KXZI 1LK3L 5DHYA 5CD3B 1V7NH 1AQDA 2E8ZA 5BMFL 4NKDB 1JHLL 4JFEA 4G9DA 1UXSB 3HMWL 5K59F 3BEWB 5HGAB 1B2WH 2R2HA 4JKMA 1HI6B 2P48B 4H26B 4V1DB 1BP3B 4G3YH 3NIDF 3WIHH 2XV6B 4F9PC 1A2YA 1AC0A 1YN6A 3MLTB 1S7SA 5HYQA 3FN0L 4U7KA 1NFDE 3IDJA 1ZS8B 2HTKD 2D31A 5F7LB 4NM8L 4FQ1L 4JRYD 1K8IA 1AIFA 1DBBH 3BH8A 3EOAB 4TQEH 2W9DL 1YN7A 1V7MH 5HPOA 1WWCA 4QHUA 1LNUB 3U6RA 2VXTH 2ADJB 1MJUH 5D1QA 5C71A 1F13A 4LCCB 3MNWA 4Y5YA 3KYMA 1EIBA 4FG6D 4HUWB 1NAMH 4X6CF 4WHDA 1KELL 2BNQA 3BPCA 3EYVB 2ORBL 3MJ9L 5KS9B 1UZ6F 2OTUB 2NY4D 1SJVA 4ZDHB 2X4OB 3X3GL 5EU3B 5I76A 1NCDH 2R69H 5DUBA 3V8CA 5IQ9A 5CEZD 2EDYA 2HT2C 3IDJB 5DA0B 4LSSH 2H8PB 1X7QA 2Y06H 4FQHA 5GJSH 1ZLUH 2DF3A 4EBQL 4DKEH 5FYJU 5SWSE 5J4MA 1XGUA 4GW1A 5SWSD 1A6ZB 4KKCD 3KLDA 5DJAA 3KPLB 3ESVF 5GS0H 2WUBH 2YUZA 1X5AA 4JY6A 4NUJA 2CUIA 2Q8AL 4S0SD 3KPPB 2BOCB 1U2HA 1XMWA 3IFLL 5TE6L 2COQA 4UILH 2J5LB 3RVWD 1IFHL 3B6SA 2NXZC 2OL3A 3VXNB 1U8KB 4LHUB 3IDGA 2X89D 5DVOA 4OSUH 1WFOA 1N2RA 4YK4B 1FN4B 3F5WA 3CMOL 4YBLB 2DIAA 1UZ8B 3OPZL 4BH8B 1T83A 5GGUB 3LZFH 3U4EB 4ZS6C 1Q9OA 3HNSL 3T2OA 3MLXH 3GRWH 3DWTA 4PRIB 5CWSB 1PKOA 3MRMB 1XIWB 3SHSA 3LHPL 5CINH 1OAYH 2P4AB 2C26A 4DZBA 2CRIA 1FNGA 3NAAL 2YRPA 4P2OB 1MCBA 1G6RH 1T2QH 1OAXL 3GK8H 1IKNC 4HLZH 4BQ8A 2FECI 3VXNA 3RNQB 2E5EA 5MEPB 5D7JB 1FVEB 3C9NA 2IH1A 3I3DA 1EVTC 4UB0H 1JCKA 4ODHL 1H8NA 3OHXA 4HJGB 3KYKH 4NDMB 1YEHH 2QQLH 1NMAH 1Q8MA 2VLME 4YIQB 3QDGE 1YEDB 1VGKA 3BIKB 1KELH 2PYED 1I8IA 4EXPX 3L3DA 3WNOA 1J0HA 2E8YA 1SYSB 2DKMA 2YKLH 3BP5B 4KTYA 2D31B 4OQTA 2VTFA 2QQNL 3RY5A 4LSSL 1TNNA 2V6HA 5C0DB 4XP9H 3TO4C 2E7BA 3ORJA 2GSIA 3QI9A 3NCMA 2Z92B 5FUZL 2CIIB 1AQKL 1FFOA 1S7WA 3OXRA 3KLSA 2X1WL 3WN5C 2BNRA 1H3GA 3WLBB 3DRQA 4GBXB 1NJ9A 4RX4A 2DQEH 1E28A 1KJVB 5FGRA 4MVBC 4WUKH 5FYJE 3T04D 5DSCB 3OV6A 5CJ8A 4JHWL 1RJLB 3OJ2C 4OD3L 4NZTL 4X6FA 2X1XR 3ARFC 3VFTB 5IVXB 1MFBL 1W72H 4DK6A 3C5JA 1FYTB 5HDBF 3UYPA 1EEZA 3LKQA 3P4MA 2FIKA 3C6SB 3QUYA 3HE6A 2PETA 5D6CA 2QJDA 2XZQH 2R56H 3F7VB 4ZOEA 3OR6A 4KZEL 3I2CH 4XP6H 3FFDB 4XZUA 3IRPX 4GG6B 1NFIB 1A14L 4OZHF 1UCTA 4WFED 4KUCF 4WV1A 1RFDL 1HKFA 3UTTD 2H32H 3HUJE 3WSQH 3ZTJH 3I6GA 3V0VA 1LO3L 4WEBH 4YXHL 4R96A 2AJUH 5L88L 1JPTL 2CKBL 3UJTL 4JVUA 3P73B 1Q94A 5GGVH 3GSOA 1N5YL 4LASL 3FO2A 1KEGH 1N4XL 1WBXA 1F4XH 1KIQA 4JKPL 4P5KB 2HTLC 2HLFC 3OAYH 2E27H 4XC1L 2IPKA 4JDZA 5EORH 4JCLA 1G7LA 2LVEA 4U4BA 3QUYD 5GZOC 3D2UB 1I4FB 1NMCC 3EYSL 4UQ2B 5GGTL 4J3UA 2ATPA 3B5GA 3LDBB 5F8QC 1C5DB 4QHMA 4XWOD 3BEVA 4OKDA 3EW3B 2P5EA 1D5MA 3Q0HA 3DO7A 3QXTA 4L3AA 1JWMB 1GIGL 4KWUA 1BJ1H 2C7UA 3S36H 5B39B 3B9KC 1KOAA 3DSFL 3NFPA 1NKOA 4JDTH 4S10A 4Y0GA 2IC2A 4Y4KC 2W9LA 4X7EC 3NCYP 1OF2A 2AK1H 4I3RH 1NFDA 1NC2B 1HHJA 5ACZA 3G9VA 1KG0B 1EFXB 1RUAH 3H7BB 1GGYA 4U3XA 4LAQH 3QXUA 4LNRA 1B0WA 2Z31C 4N0UA 4D0CB 3OKOA 5E00A 1AFVH 1HSBA 2XZAL 4L8BB 3AAZB 1CL7I 4IHOB 3DX6A 4O9HL 4DKEL 1ZOXA 3KGRA 2EIZB 3B9DA 1LO2L 4M62H 4O2CB 3QAZC 4TNWK 5C3TA 1SBSL 4PJ8C 1F58H 3AS3A 5D1XC 2WMPA 1CL7L 5T1MB 3BH9B 1MVUA 4MNQE 3C5SA 1K2DB 1KLGA 5I66A 4M9OA 1BLNB 4M93B 2F53B 4XVTL 5SWSA 4WW2A 3AVEA 1PBYA 5K9JH 4PB9H 4CN4A 1G0DA 1DBKH 4QRPA 2DKUA 4A6YH 5I15H 4X8XA 1UENA 4U1IB 5FDWA 1W72A 3O6FD 2FL5B 1C16B 4LP5A 3C6LC 4EUPB 5E8NA 1E27A 2PTVA 3V0WH 3ULVE 5FGCE 3D3VD 1FDLL 5T1LA 1AR2A 4WW2B 4HF5L 4AEEA 2EXYD 3K2UL 2EC8A 3V6OE 1RZ7L 2DLFL 1T22A 5TQ0L 3FB7A 4ODXB 1QEWA 1KB5H 5T5NG 5CBEA 2DOCA 3MXVL 1QBML 1LDPL 3HC3H 3L7FA 1FJ1B 3DI3B 3LN5A 2WIMA 4QF1B 5IMKB 3JWOC 2PTTA 4I18B 2HVJB 2B1HL 3V0WL 4KKLC 3STZB 1V7ML 1U91B 1NGXB 2JK5B 4DVRL 1IZJA 4M6NH 4PYGA 1RIHL 3RWIB 4TVPH 5FB8A 1B88A 5ICZB 1YDPA 1WBZA 3UTPE 1NAMB 1WCQA 4YR6B 3ULSB 1A3LH 4XCEA 3UMTA 2D0HA 4JO2L 1JZ4A 1AD0A 3W82A 4TSCH 1JF5A 4MHHI 2O61A 3NZHL 4HPOH 2VXQH 1UYWL 4UIMA 3W2DL 1SQ2N 4NQVB 4N1CA 4HXAH 4NQUA 1I1AD 4Z7UA 3BP7A 5ESQB 1FGNH 5DJ8B 2HRPL 4C56D 4MSWB 1HILB 3RUGF 2JK5A 4OZFB 2MQCA 1LMKA 1KEMH 1QBLH 3ARGD 4MZ3A 4WUUD 3MUHL 3EHBC 2P47B 1A1NA 2ADGB 4XNZC 4JFQB 2DQGH 2XIDA 3C5ZD 4YO0A 2Q8BH 3LOWA 5HHOE 3GSXA 4XXDB 4LSPL 3UTZA 3GIVA 3RA7H 4OT1H 5F1NA 3VGAB 4KTEH 4LEOB 4P4KA 3O4LE 4YHKH 1Z6JT 3DMMB 4FQCH 2A0LD 2XFXB 4I18C 4PJDA 5JQ6H 1WZ1L 4GKNA 4Q9BA 3HI5H 4R4BA 4CW1B 3VXOB 1OM3H 1EERB 1JNNL 2IWGA 2EIDA 1Q9LB 1PG7X 3B8SA 5ADPL 5I8OH 1S78D 5L88H 2Q3AA 3LEYL 3THML 3VFSB 3T0XA 3MRCB 3VMNA 3MNWB 5DHVB 4A6YA 3ZKQD 3WO4B 4ZPTB 2BSED 5IT2H 5E2VL 4MB3A 4KROD 1ZT7B 2VIRA 4BFIB 4MXVF 2YZ8A 1A9EB 1HH9A 4G6KH 4MXQD 5FV1L 5E2WL 3MUGB 3KPRA 5F9DC 3MR9B 2C5DC 2GITA 1MCEA 2K7QA 4D9LL 4ZFGL 4OUUB 4HH8A 5BJTA 3IDUA 5MERB 5JOPE 2AJYH 3BDYL 5DUML 1P84J 1MFBH 1QFPA 4RRPG 2BXZA 3TLRA 3MOBL 5BZWB 3W0WA 3O3BA 3BGAA 4OLWL 3TBYA 4G9DB 4PRNB 4MA7H 5I1IH 1FNLA 3EFFA 1T0NA 1IKFL 3S37H 1LGVA 1TLKA 1PKQA 2YUXA 1IVLA 4WVRA 3DIFA 1JGDA 1Q0YH 3UO1H 1T04A 1NCCH 3QUML 1KTLB 1OWRM 3KLHD 2XN9B 3O3AB 4Y5XC 2VWEC 2ADFH 3U46A 2HVKB 1A47A 1U0QA 3JV4B 3U2SA 3AGVA 5C0FA 5D6DA 5D2LB 4K9EH 1RUKH 1FZMB 1CICA 4DKFH 5DYOA 4YWGL 2ESVB 4MD0A 3VFOA 8FABA 3JZ7A 5LQBL 3SGKA 5A3ID 2LU7A 4AQ1B 3MREB 5F1IA 2BFVH 1OHQA 5C70A 4CU8A 5IW6A 3WS3A 3FQUA 5JPNA 4LVHB 1JFQL 1MI5A 4KMLB 3L3OA 4Y19B 1ZHNA 3KYMB 4PJCE 1DDHA 4HK3J 5EC1A 2MMXA 1ADQL 4KJPC 5KTEL 3TA3B 3G6JF 2VLJD 4Z7UE 5C9JA 5F3HA 1TJHH 1IM9A 4FTVA 5AG8A 2W60B 4POZC 3CCHA 5ISZE 3EBAA 4HUXA 4LF3A 3P0GB 4RBPH 1F3JB 3D0LB 5IF0B 3VXRB 1J5OL 4LSDA 1CT8A 1IAKA 4LGRB 4HDIB 4YEEA 4NQED 5I8EB 1CZ8L 2DLFH 3KPPA 3GHBL 1AXTL 4ETQA 5TFSL 4ELMF 3S5LB 2LTQC 1CFSA 1NL0H 2YRLA 1KCLA 3Q6GL 3CLEH 5DEFB 2AW2A 2DM2A 1JZ2A 2VITB 3N0PB 4Y5VA 5TE7H 2ZUTA 1M7DA 2WQRA 3CVIH 3DOSA 2EYSB 3RNQA 4AIZB 5I16B 1I1FB 3TH3T 3DMMC 2VKXA 2Y07L 4W6WB 1NKRA 5FDYA 3B83A 5HYSA 2AK4E 4UAOB 4W4OA 3MRJA 5IW1B 1OGAD 4QRPD 4WI5A 4TSBH 4H1LB 1EJ6A 1MFDH 5C2BH 4NZUL 1HINL 3EO9L 5JXEC 1PKQB 2EE6A 1TTFA 3NCBB 4XRCA 4WFGE 1HCVA 3FOMA 4ZUSB 3TH4T 3MJ7B 1LK2B 3KYOB 2JIXB 4JO1L 3VE0B 5C6WH 3WUWG 5MEPA 1GOFA 3MBXL 2X7LB 5E7BA 3T0DA 1FVEA 3I6GB 4RMTA 3TBWB 3V0VB 2BNUA 5TQ0H 3U4BL 4LMQE 1TIUA 4R0LA 1KYOK 3QDHA 2X6MA 2DL2A 3WIIL 1RIVL 2EH8H 5J1AB 4O51A 5J57B 3WN5A 3AREB 4PLNC 4GQ9L 3RY4A 2Z92A 2P8LB 4PBXA 1UFUA 5FOBA 4HJJL 4I2XA 4LOUC 5ESAB 4PJAE 3VD3A 5F88B 1JWUB 3D39A 15C8L 6FABH 1A4KB 3F5WB 3FZUD 3G04B 4G8FA 3BEVB 4HK0A 5BRZB 3DVFA 2AV7A 4IRJA 4EOWH 1YQVH 4BKLB 1D5ZB 1IEHA 4UV7H 3MLRH 2F74A 5T5FL 1IGTA 2BVTA 4KI5E 3CXDL 3ARDB 4ONHA 5CP7A 1DUZA 5E08L 5J11B 3QQ3B 3CU7A 3S4SG 3SDDD 2HFFB 3GSNL 3MRRB 3OJVC 3VI4E 5KVMC 4E41A 5B8CA 1I1AA 4JFXB 1T03H 4K8RL 2AVGA 4GH7B 4ZODA 1KC5L 2F5BL 3ARBB 5HYJE 1OAUH 5DVMA 3OKOB 2GUOB 2OTWA 5C07E 4XNUH 1QVOB 5DUPL 5L6YL 1I85C 5IJVA 5IB1B 2UWEB 4WHTB 3MRIB 2VAJA 4HV8A 3EO0B 2QSVA 1YNKH 4S1QL 4UMGA 3OR7A 2J8UE 1XGQA 1ZLSL 5EUOB 4JO4H 3T0EE 5SWZB 1FGVH 4TSAH 3NACH 1QSVA 3TNMB 1F6AA 3BHBB 3ZKND 3BISA 1ONQA 2Q1EA 1OB1A 2ERJB 3ULVC 2WM0A 5E4EC 1II4E 3U9PH 4QHMB 4ZNEA 4LCWD 3HE6D 3BQUD 3MA7B 1A7BA 2VOTA 4Y1AE 5FYKU 1EEYA 4OB5H 5TDPB 1FFPB 1GCFA 2VABA 2DJ4A 1F97A 2YKLL 4LP4A 3CFEB 1M7XA 2AKRA 4PV8B 4MMXC 2FYYA 4JJ5A 2C3GA 1BJMA 5EOTB 5E2TH 4PD4K 1U8QA 2FX7L 3BQUB 2M2DA 1RK0A 1T2JA 1IC1A 3LRHA 2R2EA 4JB9H 4Y4KA 4MJ5B 3FCTB 5EIQA 1IE5A 4EDXA 1KBGH 3BZ4B 1BVLA 4NYLA 3SPVB 5IB4B 5T3ZE 3DYOA 4YHMH 5JOPD 4PRBA 1J1XL 2IBGA 1I9IH 2I25N 1MCPH 3ZDXE 1OF2B 3PQYD 4J6RH 1NC2A 3UTPD 1SVCP 1RUQL 5F6IB 4FXKA 2R1XB 2X4NA 1MHCB 5FO8A 1T03L 4PJ9A 3RIAK 4NSKB 2HJFB 4ORGA 4XX1G 2NY1B 3NFNA 4XPGL 2X41A 4PJFA 4IHOA 3QH3A 1UM4L 3QA3A 4JZOB 1OVZA 4NYLB 4JLRB 1OY3B 4JGMA 1CXLA 3TCLA 1R3IH 3BWAA 2A1WL 2ZSVA 2WIIA 1X3DA 4UB0L 1UACL 4IDLA 2IPKB 1C16A 4JDZB 4E41B 1WZ1H 1AC6A 1RFDH 3FQWB 1IAIH 2W0FB 1HH6A 5MHSD 3QNZB 4TVPL 4X6CB 5FO8B 2XWTB 1MRFL 2GI7A 4YAQA 2D3VA 1IM3A 4LPCA 4HWEL 3CMGA 4PRDB 1FHGA 2XTJC 2FX8L 5KVGL 1PSKL 1L0QA 4WUUE 3WJLC 2XTLA 4I77L 1G7PA 5MHSE 3DROB 2VLKA 5DTFB 4NFBA 4LKXB 5FO7A 3PJSA 3AS1A 1N5AB 1KCVH 2Z93B 4X4XA 1PD6A 2JJVA 4MQXC 5DO2C 3V52H 5C08E 1C8PA 1IEBA 5E8PB 3FQWA 1A7PL 1YA5A 1QRNB 4CKVX 3U1SL 4KPHH 4WWKB 4NP4H 1MCIA 3ZDXF 1QLRA 3SO3C 5IFHH 2HP4A 1EEYB 2OR9L 1LP9E 5MENA 5C09A 1OARH 1G9NL 3MLUH 1WZLA 3RL2A 5EC2A 5HYFA 2X44D 4DWHA 2EH8L 1EHXA 3RDTC 4PY8I 1YEJH 5T1MA 4YWGH 4OD2B 3JV5A 3D6GA 3QUXD 3CFJA 4PR5A 1VESA 4JE4B 5BOZG 2FIRT 5C0CD 3U1SH 4JN2B 4M1DL 2BFVL 4LARH 4YDLB 1YDPB 4U2ZA 2C4XA 2DQCH 2C3XA 3H2WA 1B90A 4AMKH 4NZUH 3EO9H 1CGUA 2BSRB 2HKHL 4PTUB 4J8RA 4RMVA 1KULA 1T1YB 4EUPA 3OKKA 5EBMA 3HE7D 4YFLI 2W65A 4NQEB 1KN4L 3QG6B 2I9LA 5DRNB 5DJXB 4KU1A 3ALXA 3VMPA 1JPFB 4PLKD 4Q9RL 4LGSB 5JNYA 2E9IA 5BS0A 4JFED 3U46B 3W0WD 3OKEB 5D8JL 4MJIA 4WHYH 3RQ3A 2NY5L 1QBMH 4TOYH 3GJEB 3HZKA 5L2KD 3OKNA 1KYOJ 3QNYB 4L4VD 4NO0B 3EUUA 3O11A 3BKCH 4F37F 2VDRL 1V3MA 3A67L 1DLHB 4LVNB 5IMKA 3VGAC 3UTQA 1KCRH 2XWTA 3GSNB 3CUPB 3LRSB 1J5OH 4Z0BL 2HLAA 4HIHA 4M7LL 3BIAX 2PO6B 3NCYS 2PW1A 3ZLQC 2HTKC 5GGRA 5JXED 5CSBA 4DKFL 1IQWL 2R1WB 3VXUE 5AYUL 3B2UC 4AG4H 2IAMC 5KN5A 2YPLB 5BXFA 1LDSA 5C0EB 3FQXB 5E5UB 1G84A 3CD4A 1JFQH 1PY9A 4IMLA 1KCUL 3G5YB 4RBPK 3TT3H 1S9XB 1BQHA 5B39G 2J4WH 3V0AC 4QTIL 1URLA 4NHUA 3C5ZC 5F9OL 2H32A 3Q3GB 1DFBH 4OM0L 1EGJL 1AGBA 4KDTC 3T0VA 3TC9A 1OAKL 4NQCB 4XAWL 2R39A 1S7TA 2R1YA 2EYTB 3EDKA 4HUWA 3JTTA 1M6OA 5C7XL 2WWMD 3GMQB 1YNKL 3G5XB 3DIFB 1I8IB 2IAMA 1ZEAL 1MWAH 4H8WC 1S9XA 2AJSH 2A9NL 1GPOH 4QT5A 7FABL 2JJSC 4JANA 1IGMH 2YN5A 4U1MA 1V05A 3HNVH 1BVKB 3IFOA 3P4OB 2HVKA 4TPRH 1IKNA 4NO0D 5A1AA 2B7DT 3RI5K 4F58H 4Q97A 2PCPB 5GGQH 1KIRB 3SE3C 1VERA 5C92A 2R2BA 4UZGA 5I6XC 1CLOL 3RA7L 4L3CB 4F7CB 3IKKA 3V6ZA 5GISH 4ZO6A 1OGAE 2A2QT 4IMKA 2DQUL 4CVUA 3QG6A 4Q6IB 4YHNB 5BS0D 4R3SA 3WUWA 4EOWL 4Q6YA 1LE5B 1P4LB 4UIKL 3TPUB 2A74B 4RMUA 4LSPH 4LNVA 3WFCH 2EZ0D 4KKLD 3BE1H 1RIUH 2Q8BL 4J6RL 3L1OH 3RKPA 4HJJH 2A9ML 1VADA 2QSCH 2X70A 3P30L 4QXGL 1SY6H 1SM3L 3MRBA 4HKZA 4TUKL 3RWCA 2GAZA 1BF2A 5DO2D 3QG7H 2A6DB 1D6VH 2B4CC 1Z2KA 1A7OL 3SGEH 5IMMB 5ESAA 2N7BA 5DMGC 4HCRA 5LCVL 2X4UA 5I1GH 4PG9A 3BH8B 1ZK9A 3R8QA 3MOQA 4I4WA 2J1KA 4NJ9H 3JV4A 5KVFH 1UM4H 3L3JA 4ZUTB 3SQOL 5I6XB 5HHQA 5ICXB 1E4WL 3GBNH 2BOCA 4JFYA 5EN2A 3BOVA 3D85D 1F5WA 1LP9A 2JB6B 2HAZA 5MENE 1X4ZA 5ID0B 5FA4A 4M7KL 1RK1A 4X80L 4BZYA 4P4KC 1DVFA 1MUJB 5D9SB 3PQYB 4KI5D 4M02A 3MRJB 5IB1A 2L7UA 5HHMD 1H15B 3DX7A 1H8OA 1RU9H 1KTKE 1HCFX 1PW3A 2G5BA 1DBAH 3SE4C 2R15A 2PR4L 4QRTA 4F3FB 4N8VA 1UVQB 2VLKD 3MUGA 2Q87A 4P4RA 2YD9A 3VE0A 5ACZB 3SE8H 4I2XB 1HQ4B 4QY8B 1R3HB 4X0KA 5LAXA 1A5FH 1QKZH 3MRGB 4IOIA 4YHLH 5FYKE 3REWA 1G7MA 1U93A 1XF2B 1K8IB 3K0WA 4MQSB 1B6UA 3VFMB 4WU7A 5FGBC 4HH9B 1TJIH 4PJ8D 1F11B 3TO4B 1F2XK 1TQBC 3NGBB 3DX7B 1FORL 35C8H 4HBCL 5EZJB 2WNGA 4X5XA 1S9WB 3IXAA 3EYVA 1IGFH 3MYJA 5DZNA 3WLWD 3HG1B 5J8OA 3T2NL 4UDUA 4WRLA 1EAPB 4CGTA 5EOTA 4LCWA 5C0RL 5D1QC 5I1CH 1MCCA 3CX2A 3SDCC 3BYTA 4LHJB 5JIHA 1ORSA 5C0FB 1VFMA 2P5WD 3RUGB 3F58L 2QADB 3CX5K 4WHTA 1FPTH 1WISA 4J7RA 1U8NB 5HVGB 4G42B 2V2TA 1BVZA 2O26U 2UUDK 4MJID 4GXVH 4ALAL 2ID5A 5DJCA 5SWQA 1FIGL 3U7WL 4RAUB 3SJVA 2GT9A 3VXSB 4QTHB 3U4EA 4FMFA 4JHBA 1Z3GH 4F57H 2C7UB 5HHXL 2NW3B 4X9IA 1TQBB 1ES0B 1G0XA 4JLRA 2GHWB 3QEQE 1OQOA 2WW8A 4KDVA 3VU2A 1NCUA 4RGOH 1WC7B 4NO2A 4EI5D 4ZOAA 1VGEL 2X5PA 2P8PB 3BUYA 1U8OB 1CD1A 4O9HH 3OG4B 2G60H 1NFIA 3MLVL 4HIJB 4PJGB 4NKOA 5E5MA 2EE2A 4XCNB 1U6AL 4G8IA 3CJJA 1A7RL 1X5YA 2VQ1B 3T4YA 2CMRH 3VFWB 1KJ3L 4GG8A 4KKBD 5CUSL 2Y4SA 2APFA 4X5LA 3DROA 3BMWA 5TPWH 1UWGH 3JWOH 4YXKL 4MQXD 1FGVL 4C58B 4TUOB 1IGYB 5IMOA 2CUMA 1MQ8A 5HDQH 4UT6L 4UOW0 1FCGA 5EU6A 4AL8H 4S2SB 4YDIL 4C83B 4XCNA 4KZEH 4G7YH 2F9BT 3FN0H 3EYFB 3IDMB 3RJQB 4Z5RA 3P73A 3CX5J 4UIKH 2Z31B 3BP4B 2JE8A 5DZOA 3MGTB 5KSAD 1C08A 4WWKC 4ZMAT 2XG5A 4Z8FL 4NUGH 5IWLC 1S9WA 4R9HA 1Y0LA 4NQDD 3VXSD 1E6JH 3FOLB 3GMNA 4N0RA 1J87A 1AJ7H 1EZVY 1UA6H 4UT9H 2CKBH 3I9GH 1EXUB 1RJCA 3FAWA 1P1ZB 1OB1B 3DVIA 3LRGA 4TPRL 5DUPH 4S2SA 3ZO0A 4EI5B 2OJZL 3ETBF 3ZZ1A 2AI0H 3QJHA 3NFPB 4KVNL 3TCLB 3QFJD 4X6BA 3MTRA 3HRZB 1KIUA 3QDMD 2ZWLT 5HBBA 3GSNH 2OX5A 5D7IB 2LAGB 3S35L 5KJRH 1U9KA 2BC4B 4GRMB 3VXUD 2X89A 1A7QH 3JV0A 1A3LL 1HH9B 1TITA 2J7LA 3BQUA 2ZUYA 5C0IB 3VXSA 1BZ9A 1V5JA 5F9OH 3N1MC 4ZNCD 3DHMA 3QPQD 2F74B 5I1LB 2EDNA 5I73C 2WP3O 1WT5A 3EYQD 4PRBB 5DQ9A 3PJSB 3GJEA 4Y4FA 1Z9LA 4NO2B 1WWAX 4L4VE 3SCMD 1OAZH 4C4KT 1M71B 1QR4A 4K2UH 3LAFA 5DK2A 4MD5B 3PL6D 4M1GH 5MI0B 2BC4A 3O3EB 1UADC 3FQNA 5J1SC 5CGYD 1C1EH 3LH2H 5EU5A 3QG7L 5HI5D 5H8DA 1C5CL 1EVUA 3A6CL 4OLZL 2KQMA 3QZWA 2GSGB 4XNYH 2CSPA 1BZ9B 1D7FA 3PWPB 1PSKH 4OFVA 1TDQA 2R4SH 3DTXB 5EO1A 1ZLVH 4JG1H 3BJLA 3MA9L 2YBRA 4JDVB 4JKWA 4YZFE 3MRFB 4JM4H 5GRJL 3HS0A 4JRYA 3BPOB 2E7MA 4TULH 3DUSA 5DK2B 2BNRE 1YEHL 5IEKB 1IAIL 1UKQA 1IAII 3RGVC 5DMKB 3OGCB 3VRLE 3BPLC 3UBXB 1QSED 3KLAA 3MRQB 2ZUUA 1N64H 1MNUH 2N7AA 1D5BB 2XQYG 3RX5A 3V6FB 3DVNB 1TZIB 1SY6L 2H9GB 5KG9A 4P9HH 2NNAB 4YR6A 2HWZH 3WO4C 1VFBB 3GSWA 1BBJA 4ZFGH 1AO7E 4NHCH 3PGCA 5T1KA 5E8DH 4DUVA 1KB5B 1U95B 2GK0A 5A40E 5MEQA 2ATKB 5HYQB 1BD2A 2F8VA 4GKSA 1GL4B 4MDJA 2VERN 5C6PB 4UDTB 4KMQA 4ZTOH 3TF7C 3WE6A 1T5WA 5DR5H 4NM8H 3GB7B 3N06B 4IBLT 1JIBA 3MRPB 3BD4A 3DV4A 2VISA 3UO1L 4HDIA 3RL2B 1YMMA 3MQIA 1TVBB 2OK0L 4LVNC 1JNLL 3HUJF 1NUFA 1TQCC 1XIWD 2EDEA 5E6IB 3OMZA 3KPQA 1ZA3A 3CVHA 4KI5C 3D3VE 4XNXH 2MPAH 3FB8B 1ZT4B 3BD3A 1TPXC 5T3ZH 3GMOB 2FH8A 3TBTA 1GIGH 2ZOKA 1DQTA 1OGTA 3LV3B 4QXTB 3LPGA 4KC3B 3PV7A 3QUKB 2Z91A 1B4JL 4JFFE 2QKIB 2AK1L 3HE7C 5D2LA 4FFWC 5C0AD 4HIXL 2FH6A 1TTGA 1T80A 4Z7OF 1RUQH 1JZ8A 5BXFB 2IBZY 4PRPE 5KBNC 5C8JB 3BKMH 4XMLL 5FXCH 3RVTC 1FFQA 4TVPD 5E2JA 3V7AE 1YPZB 4CU6A 1G6RB 3KPRB 3KXFE 4KK8D 3UJTH 4WUUA 5EUOF 3OKDA 3TH2T 1VKXB 4PJEF 3IDNB 4LQ1A 5TDNA 2XKSA 4U1MB 1UB6A 2BMKA 4BYHA 5K9OB 5HYEA 3RDTA 2G9HB 5IQ7H 5D72H 4WW1A 4AG4L 3KPRD 4PGEA 4RISH 1FLRL 3EJYD 3ZDZF 2Z4QA 4YHKL 1AD0B 2KUTA 2CR6A 2X9WA 5I8CA 5FO9A 1PQZB 3O2WL 1M6OB 2ZJSL 4RMRA 4QRUB 1N7MH 3X12A 1N5YH 4HUNB 3MLTA 5DMJB 4M7LH 5ELIA 3WFEH 4LCCC 3DMMD 1H3UA 1T1XA 4FP8H 1FVDB 1SEBA 1T04B 1QACA 3QPXL 1KB9J 4P2QD 5L2KA 2G9HA 3AU1B 3BZFB 2FDBP 1QSEB 1A7RH 3JV6A 2YD5A 4LLWB 1I3RB 1QYGL 2X70B 1U95A 2VSDA 3ULVH 1N0XL 1CICD 4Y1AD 2X4OA 1R5VB 2AJSL 4XNXL 1I8MB 1ITCA 2NR6D 1KN2L 4RGNE 3M17B 3S5LG 1N8ZB 4XP1L 3FT3A 2H32B 1BQUA 4LBEA 2R0ZL 1HYRC 2WWMC 3P0YL 4NWTL 3WSQL 2R4RH 4IMKC 4PUBL 1FZMA 5M94B 3MLWL 4PB9L 4KTDL 2D7OA 4OAWA 3QJFB 5J9PA 2GAZB 3FO9B 5F71A 1X5IA 5E6IA 4ZAKB 1FIGH 3CVHB 2WV3A 3SE3A 3IDXL 1WCBB 5HYIA 1CLZL 1INDL 4OIAA 4WTXA 5L9DH 3MODL 1CFQA 2O93L 2C9AA 2BRQA 3HUJA 3W5MA 2GKIA 3ZT6A 1DUYA 1FPTL 2E7HA 5EZIH 2EDTA 1YN7B 1I1AC 4LDOB 4RISL 3GNML 4QHUB 3U6RB 1J8HD 1EO7A 2IG2L 3NACL 2IBZX 5BZWA 3S3PA 2PXYD 3W0WB 2WWKO 3O3BB 4HXAL 3R0MA 5TE7L 2VDQL 1H5BC 3FT2A 2F58L 5BV7B 4CU7A 5ADOL 3REVA 2WQ8A 1D9KA 5IB5B 5A2FA 2E7LA 5J1TC 1RJYA 4JRYE 1OT2A 1RK0B 2YD4A 3H0TA 1HINH 1TVDA 4XVTH 5F7YC 3HC0A 2UUDH 3TYFA 4PGJA 3IKCB 2NW2A 5BQ7B 5JDJA 1LVEA 4L3EB 2APTA 2ZCLH 4U3HA 1KJ2A 5AUMA 3DX9B 5DDHA 4LIQH 1HN1A 3LVEA 5IG7B 3JWDC 2P8PA 3BUYB 3BP5A 3SGEI 5DWUL 3B6SB 3QSKB 4Y2OA 5BO1L 2Z8RA 1TVHA 3LH2L 1Y18B 1I4FA 4UQ2A 5IW6B 2F53E 4Y2DB 2VL5A 1G7MB 1U93B 4KHXH 1XF2A 2Y06L 1EHAA 4NJ9L 3DPBA 3FB6B 2VSCA 3G9AB 3LKNA 2VDOL 3KXFA 3HI6L 4OCNC 4U49A 5IM7B 4A6YB 4H1LA 1IMHC 5C0BB 4K3DL 2IGFL 3JTTB 4NWUH 3GSRA 3QWOB 3PG2A 5BVJA 1R5VA 3O2VL 3GGWB 4XPHH 4C4KO 2F8XC 1PYWA 4GXUN 4DOHE 2KPNA 5F1SA 3EAKA 3D25A 1ZS8A 2YD8A 3HE7B 1B0GA 2XNAA 2X7LA 4GOSA 2EDXA 3P30H 3NH7L 1I1YA 4HUXB 4ODTL 4G6ML 4FQ1H 4WFFE 3CMOH 3BN3B 4OQ1A 1ORSB 3PABA 1MCHA 3B5HA 5KZCD 3MXWH 1J88A 3BYYA 5SX5K 4WO4A 3WCYA 4GRLD 4HCRL 3TVMA 1F4YH 4HKBB 1BFOA 2B1AL 4K3DH 3LKPA 3HR5B 2FB4L 5HHPB 4LKXA 5FO7B 1WCBA 3HAEH 4WFHE 1IAIM 4Z77B 3K4ZA 2Q20A 4ODSH 2CUHA 5J56B 3TJEH 4HKXA 4IRJC 4NT6B 4DJMA 5CKGA 4Y5VB 5I74B 3TIEB 2DLIA 2Z31D 4HIEA 4FA8A 5IHLB 4GO6B 3LKOB 3VWKA 4ZUUA 1TJGH 3L3KA 5GS1B 4IJ3C 3C60B 5K59E 2NY6C 4ONHB 4RX4D 3ZDZE 1CVSC 1W0YT 1J0IA 3EO0A 1F4AA 1EGJA 1S9YB 4WDIA 3ZSSA 1M7IA 1C5CH 4Q74A 5L8JB 3TBSB 4HS3A 1H3PL 4FZEH 1LO5B 2AI0L 1FRGH 3FL7A 4GRLA 4XNQB 3QUXA 1NGZB 3GFUA 5F9JA 1F4XL 5FOJA 5HYSG 3CXDH 4RCAA 1KPVA 2P5WB 1DANU 4X7SH 5GSVB 4HFUL 3SDXF 3V79C 2PYEB 3E2HB 1NCCL 2OLDA 5FCUH 3MJ8B 5I1JL 3QI9B 4JPWH 5GGTH 2VUOA 3OKLB 4ODXA 4H5SA 2CO7B 1WJ3A 2F5AH 3KPSB 4XMLH 1FYTD 2DB8A 5BV7H 2ITDB 3C6LD 5L7XH 4PTUA 4ZUVB 3BT2H 2VXSL 4LVOC 3MLVH 5KSUB 2X40A 1H5BB 4HW6A 3IS0X 4GRLB 1ZHKB 2ED9A 4M1CD 4XNQA 5MEOB 1CR9L 4U1JB 3HA0A 4XI5C 3GJFB 4R97C 3M45A 1FO0L 3QRGL 1BMGA 1TXKA 1UGNA 1SBBA 2Z31A 3HC4H 4JY4A 5IT2L 3MGTA 3QDMA 4YPGB 4WHCA 3IGAB 3FN3A 4KUZL 2RB8A 5HVWA 2KDGA 2ADIA 3UCRA 3GSOB 2DWEA 4Z7UF 1UWGL 4O2CA 3PWUA 1ETZB 1A02N 4N8VB 4XP6L 1REIA 3O2WH 3W39A 2P8MB 2FEEI 32C2A 4M6OH 5EU7C 5H35A 1RUKL 4HWZB 4YBQC 3C60D 1DZBA 4HHAA 2XNAB 1UYWH 2EEBA 3W2DH 2VDLH 2EDFA 3QUXC 4KKBC 4TOYL 4XT1C 1OTSD 3AMKA 2BHYA 3RNKB 2YD7A 3NFNB 1HIML 3TT1L 3ET9F 3QFJB 3NIGE 4U3CA 5KG9B 2FSEA 4UT7L 3E3QE 3V5DA 3STLA 4QRRE 4OF8A 4NKQB 2VN7A 1MHPL 2MCPL 1B9ZA 2FJGA 4TUOA 1A21A 5L8KB 5JZ7C 3FQNB 3K7UA 2ATPB 3LB6D 3LKRA 2Q76A 3H7BA 1G7IA 4QRSA 4PJFB 2VDKL 1CZ8H 3EYUH 3L9RB 5CUSH 2P24A 5IK3A 4DK3A 5GS1A 3RRQA 1BPVA 3FONB 3VDCA 3HE6B 3STLB 4Z9KB 4UQ3B 5IHBA 3FZUC 4J8RB 1YEFH 3JSSA 4PRPA 3F58H 3NOIA 3ULUC 1GHFL 5I1CL 4X4YB 3LKRB 1BLNA 2CDEA 3AMLA 5CP3H 4UTBL 1VACB 2ZUQC 2LABA 3SGJA 1ZHLA 2AXFA 4XPBL 1PG7L 4Z7OE 2AQ1A 2CRZA 4X9FA 3VXMD 3PP4L 4NC1C 4G7VL 3DLQR 1FIEA 2VXUH 3U82B 3FO2B 4H5SB 3Q6FB 5I17A 2OZ4H 2P45B 1U3HD 5K9JL 5IVOA 1PGRB 4M1GL 2Z93A 1AGFB 4JO1H 4X4XB 1ZWIB 4LARL 1P69B 3QXAA 4F7CA 4NKMB 2FX8H 2V7HA 4MNHA 2A83B 4ZOBA 5MEOA 4HXBH 1SBSH 5ISZB 2GUOA 3GBLA 3QH3B 5I30H 2Y9RT 3INUH 5B38G 2YXFA 2Q7YA 2HT4D 4ONGL 5DA4A 4RGOL 5D7LE 5EO9B 4DKDC 2J8UF 2VWEE 3NABL 1O7SA 2HMID 2EDQA 1CXIA 2AEIT 1UKTA 4DVBA 2BVOA 3O6ML 2B1AH 1OCWH 1CE6A 4XBPB 1BQLH 4KAQL 3MPCA 4FG6C 5DT1L 4R4BB 1MLCA 1W2KT 3MLWH 1RZJH 4YDJA 5ETUA 3V95A 4OV5A 2OS7A 2D7PA 5E8OB 4XVSL 1CGSH 5KJRL 3FRPG 1G1YA 1A6UH 5DF0A 3EOTL 3QIBC 3VXRD 3MV8D 1P4BH 1QSFB 4KMTL 1PEWA 5HDLA 3I84A 4U2YA 1DBJH 4R4FL 4KVCH 2FJHA 1ADQH 1CXHA 3OGCA 4P5TC 3IT8D 4WO4D 1K5NA 3MV7D 4XVJL 3QIUC 1I8MA 3P40A 4X8JA 3U7YL 1Y6MR 2VLJB 1OP5K 5ALCH 3WJLA 5C0NC 4MA3A 3MROA 3SDAB 2FHCA 5JNYB 5FUOL 3ISWA 1UWXH 4EI6B 5I15L 2IPTH 4WIQA 2NNAA 2VDQH 5JW3H 5D1QB 5GRJH 3LS4H 1JNHB 1DSFH 4D9RE 3E0GA 4LFHD 1ND0A 3K2MC 3S3SA 1JN6A 3PDOA 5DLMH 2ZZUT 3R8BB 3H8NA 1PEZA 4DUWA 4PS4H 4LK4A 2K3TA 1ZANL 3HI1A 1HHIA 4NQSA 5FKAA 1R0AL 4FQ2H 5DJ2A 3IAGC 4NN7C 4H88H 1QRKA 3LQAC 5GSRB 3BIBX 3VGBA 2YZ1A 4L4VA 5KSBF 1K6QL 4WENB 3V2AR 5BRZE 5I1HL 4WU7B 2P43B 3BZFA 3CH1B 1T1ZB 5IVXE 4JY6B 2IBBA 4NUJB 4JB9L 3SKNB 5E6ID 1HYSC 1NUNB 3B2VL 3G5XA 4K7PY 4MJ6A 4WI9A 3DO3A 1S8DA 4O2FB 1T1XB 4BZ1H 1AD9A 3BD5A 2CDFB 4KDTA 3ZTNH 5C6TL 5D2NB 1XZ0A 4HCRH 5IBLC 4K8RH 4AEHL 5DMIH 3G6JA 1A6VL 2PO6D 1FFNB 5IEHA 3S37X 2DQIH 4X5WA 2H41A 1GOHA 1YY8A 2VLRB 1GGCH 4Q0XL 1LE9B 5BQ7A 3RIAF 4JFHD 1VPOH 3WIIH 4RZCA 2YK1L 4O2EA 1G7JA 1MAMH 5EC1B 3QXVA 1IEBB 1XF1A 4LSUL 4GAYB 2J8UB 3I6LE 4WY7H 1CBVL 2D4FA 2VLRD 5EUOE 4FOMA 5CAYB 4E0RA 1RUPH 4M8QB 5HVFB 5J6GB 4R6UA 4L8DB 2CDFA 1MFAL 2IH3A 4LPUA 2BP3A 3CFDA 5E03A 1QA9B 1X5KA 2AJUL 3GI8L 4WW1B 3X14B 2C1OA 1EO8L 3WHXA 4E42A 5IM7A 4GAGL 5F96H 3ARGB 4YIQA 1BD2E 4YHPA 2ZNXA 5FUZH 4DGIL 5AWNL 4OZGA 3E6HA 4Q6IC 5H94B 5JXAH 2DIJA 3UTOA 5IB5A 4KRPD 1XGPA 1IBGH 4M7ZC 3O3AA 3N1FC 4JY5L 4CW1A 2VC2H 1JVKA 4YBQD 4C59B 4OZIB 3VG0L 3HB3C 3Q3GA 4GSDL 5ALBL 4DN4L 1QLEL 4KGJA 3DV4B 5GIRB 5DFVC 3RTQA 3LEYH 2NY2D 2FR4B 2VQ1A 4KJQC 3JV6B 5HI4C 3VXMA 2GSIB 5HI3C 4KQ3H 5FYLH 1MCKA 4DCQB 3F65A 2W65B 4NOFA 3RP1A 1T21B 4J3TA 5DD3H 1PZ5B 4XTRC 4L29A 1FLRH 1NMCB 3UROR 3NA9H 1TJGL 1JTPA 1YUHA 3TBVB 5JPNB 3ZE2E 3HPJA 3MCLH 1P7HL 3C8HA 1J1PH 4WWKD 5B8CC 4MA8H 3CLEL 3DUUA 2ZOLB 4XP9L 2NY1D 3DXAE 1VFUA 3QDJB 5DRWA 1D9KC 4TTDD 2GYSA 2GCYB 5FKPB 3WFHA 5CKAA 3EFFB 4QNPE 3U4BH 5E8EB 2VH5H 2VLMD 3PNWB 43C9B 4ETQB 1AQKH 1U58A 4NQDA 4NGHL 3MUZ1 3OTTA 1Z3GL 4D9QE 3Q5OA 1QFWI 4P2YA 3ARFB 5ICYB 5HI3D 4CL7A 3FO1A 1OCWL 5DJ6B 1CE1L 1WWBX 1XZ0B 5D70H 1S7QA 5JLZB 3SDCA 3AB0B 1I1FA 5DQJA 3PQYA 5FGCB 1BOGA 4PGDA 3SY0B 5HVHB 5IJKC 5EU6D 1O5DT 2HJLB 2G5RA 4K9EL 4JG0H 5DFTA 4NN5B 4EKXA 3OKLA 1A1OB 3S5LA 1KIQB 4LFHG 4AJ0A 4N5UA 3CLFL 4HAGA 5ANMA 4MX7A 4L1HA 3K8MA 4L4TA 1IAOA 2GJ6D 3BESR 1J05A 4PBVC 1OTTC 4NT6A 1CE1H 1T7ZA 4IDJH 4U1JA 4WEMB 2ZSWA 1Q9WB 1S7QB 1JYWA 5A16B 1QVOA 4ODVL 3RWDB 4KK6D 3T4YB 2C3VA 3KPSD 2NZ9D 1HWGB 1NLBL 4HKBA 4H26A 1XIWA 2DLHA 3IB4A 4PJHA 1FFOB 1S7WB 3PL6B 4K3JH 4U0QB 4X6EB 5EBLB 4ZXBB 3DURA 4H8WL 5EU5B 4UI2A 5E9DA 1RJLA 1Q9WA 3BPNC 3ZKMC 2E9JA 4G8FB 5JR1H 1S7RA 4NIKB 3RWGB 4IJ3B 3DTXA 3I9GL 3M8OL 5JOFA 4P5MA 1N0XH 5DJ0A 4U05A 4HWNA 2H6PA 1L7TL 2XKNA 3DETD 3QQ3A 4PV8A 1CTOA 3BPNB 3R4DA 3BI9X 5CZXC 4HGMA 1C5BH 2AJVL 5TDOB 3WV0A 2DMBA 4OLUL 2P5WA 1ZHKA 2I24N 3LMJH 1JPSH 1P53A 5BRZA 4HAFA 1XGRB 1RJZA 5I0ZA 2Q3ZA 3FQTB 5ABDE 1ZVHA 4EDXB 3GIZH 4FTVE 4K3HA 3BZ4A 1PDKA 1FNEA 1J0YA 3KPSA 3VFWA 2R9HD 4HG4K 4IRJD 1EMTL 2YA1A 5E8EA 4JAMB 3AS2A 3U9PL 2HFFA 4NQDB 2QLVB 3MRDA 5I1DB 5CP3A 1EAPA 1C5BL 2AJVH 1C7TA 2VDPL 5FGBA 3BJ91 2YRZA 3V4VL 3IXTB 4QOKA 4I5BA 1EEUA 1RJZB 5IJVB 3HI6H 3PDGA 5GGTA 3VXPB 4OZHB 4GG8B 1I7TA 25C8H 5HGBA 1K6QH 5HGDB 1ZLWH 5DDHB 1FNGB 1F8TL 1B3JA 2P8LA 1EZVX 3TNMA 2ZUWA 4MLSA 4MQ7A 3VGGA 4KKNA 5LGJB 3UTTB 1RV6X 4QYOA 2FEDD 3NH7H 1GXEA 2CMRL 5CJ5A 1FZJA 2Y36H 2VAAB 5IIEB 4AENB 2NTSP 2VL5B 5TE4H 1CU4H 1CN4A 1NAKH 1RVFL 2J6EH 5AYQA 5AD0B 1H3TA 4XVSH 2HRPH 4MDIB 4R96B 3MA7A 4AEFA 3K81A 4TSAL 5J06A 4OZGE 3FCTA 4QTIH 5T33H 1CXKA 1H15A 25C8L 1NANH 5K93A 3ZYZA 4XCYB 4OIIH 4NQCE 2XPGA 4ZO9A 2AKRB 3ARXA 3WIFB 5TF1H 3I3EA 3Q2CA 3TEUA 3V4UL 5B8CB 4ZYKB 1EXUA 4PJAA 1HQ4A 3H9HB 1F4WH 3NPSC 3PWJB 5DD6B 4OT1L 1T20B 1KC5H 4HWUA 4PGZA 1R0AH 2E3VA 1CFTB 2YC1A 2Z35B 4BSWA 1BVLB 5GS0L 2LVCA 4DN3L 4JHAH 3DBXB 3OAZK 3UP1A 4OD1H 2X4PA 1I9IL 1J8HB 5JMOC 3THMH 4F80A 3LN4B 4K9EC 1KBGL 1OAQH 1XGQB 2DJUA 2R69L 5EOQL 5EUOA 4MYWB 3MZGB 1MPAL 2R29L 3O8XB 4Y19E 1OGAB 4GW4B 1GH7A 4HIEB 1B6DA 4MDJB 1NC4A 4QWWD 4ZAKC 5DS8A 2HT3D 4MA3B 4HEPG 4F7TB 5TQ2L 5DEZA 3T77B 5LCVH 1KNOB 3ZDYF 1A7PH 3VWJA 1BF8A 1YMMB 4Z78B 3F7VA 3T3ME 1S9YA 4WDIB 3OKMA 2DQGL 3MRNB 4JG0L 1I7RB 5DFVD 2MSPA 1HOCB 1EA9C 1IARB 1XGTA 5AZ2H 5JDSA 1ZT7A 2OR9H 2NLJB 4QXGH 1I9RL 2X9YA 4X6DA 5DC4B 3H9SE 5FK9A 3B5TA 3GMOA 3TBTB 1BIIA 3CPLB 5GSVA 1JWSB 3UBXA 4RGMC 3SQOH 4PJCF 1KPUB 1FL3B 4ZNEE 4JFDA 4GW5A 4UUJA 3OL2A 3SPVA 3TFKC 4G8EB 1HSAA 3OSKA 4X6BB 1LEGB 2OXGA 2PCPA 2HG5A 2IEPA 5DGRA 2YPVL 4OAWB 2AK4B 2A38A 5IOPA 3C2SA 4XP1H 2X4NB 2B4CL 3G6AB 1G9NH 5IFJB 4OLXH 2BSTA 4JG1L 2AJ3B 3ARDD 1BIHA 1D5MB 2WUBL 1ZHLB 2AXFB 4XB8A 1RUAL 4N8CL 1DEEA 3SDAA 1ZGLP 3NCJL 1B4RA 1DQLL 3QDGA 4N0YL 3VRIB 1P5UA 3GO1H 4OFDA 3GSWB 1I3GL 2F54A 4KDWA 3NZ8A 5GRVL 1OAQL 5EOQH 5I9QB 2AAVA 2O5ZH 4IMLB 5FYKH 4PLKC 3HNTH 1U3ZA 3VG0H 4KZDL 1X4YA 3S34L 3GSQB 1SEBB 2GY5A 1ZGLB 3S96B 1I7ZA 1N0LA 3EYSH 1H3VA 1GGBL 5FB8B 3NABH 5BS0B 1QR1B 3RZWA 3C8DA 4YBHA 1U2CA 1HWHB 1HIMH 2XICA 2VIRB 4ZFOL 2ED8A 2DTML 3PDOB 3QHZL 3SGJC 4NQVA 1J86A 4OLVH 4JHWH 4PJ8A 2BY0A 4POZD 1NL0L 4V2BA 4K7PH 1KTDA 3QO0A 3VGDA 2H26B 1VKXA 1QBBA 2BVUA 4F2MB 1V3JA 4ETYA 2UZXB 1IAKB 5D6DC 3T0AA 3L7EB 2EH7L 2YWYA 4E9LA 3RUGE 2A9NH 7FABH 3SDXB 5I2IB 3I2CL 5ITBH 3AREC 4FP8L 4KROC 5C07B 3LQMA 3U0PA 4KRNA 5I9QC 1NCBH 1E27B 1G7JB 4XTRD 1IRAY 2VB5A 3FKUS 1XGYL 3BZDA 4HIHB 2IMMA 4XAWH 3G5YA 4MNGE 1JGLL 5KVEH 3IYLW 2PN5A 4XMPH 3P3YA 3HFML 4ZQKB 3Q48A 3T0EB 4IRSA 2F5BH 3MV8B 4NZJA 3JVGC 1VFAB 3CFDB 4HIIB 2W91A 4O00A 1W8NA 1OSPL 2J4WL 3LIZL 4YDIH 4L5FL 4OZGF 4BQCA 4PJBB 1F11A 4Z7NE 5CJXA 2WBJD 2R2HB 4FFYL 43C9A 2DLEA 4PTTA 5IFJA 4Z8FH 3MFGB 2WLYA 3SKMA 3U7YH 1NFKA 5DRZB 5CD5C 4AIOA 4UDUB 2ZOKB 1F4YL 2BXYA 2Y6SD 3M17A 1N7ML 3HMXA 2BVPB 1SEQL 4F7PB 1NAMA 3ULSA 2NYYC 5K9QI 12E8L 1NC4D 3PGDB 3N85H 4AEIL 1U6AH 1F8TH 1FG9C 1FL5B 2F8OA 4PGBA 1OTUD 3IF1A 1I3RA 5HDQL 1E4JA 4F7MA 3VDAA 2Y7QA 1QBLL 2P46B 5F9WB 1TCRA 3TYGH 5J9PB 3RVXC 2MFNA 4CRPA 1AGDB 4BZ1L 1RHHB 5D93B 5IP4A 3SKMB 1QPXA 4ODVH 5D2LF 1CFBA 5ID0A 3L6FB 4YHNA 1D5BA 3OKDB 2IGFH 2DQFA 3NN8B 1AKJA 5E2TL 4YDVB 4YHZH 3HNVL 2H8PA 1AH1A 5D7JA 4KTEL 3KPOB 5C0JA 1JF6A 4RDQF 4U6YB 7CGTA 1E6OH 4HK0B 3T08A 2O5XL 3IS1X 2XA8H 3HCVB 1UB5B 2Y6SC 2YK1H 3OJDA 4RNRB 5HHVL 1DCLA 5I8CB 4X80H 3FO9A 5AZEL 1ZVYA 4OCSL 2AV1A 5D5MA 1F3DJ 3MBED 2H2SD 5J3HD 3QIBA 1LE5A 1CXFA 2YSSB 4Y4HD 1QQDB 1T89C 4ZSOE 4OV6F 3QDAA 2ZCLL 1YECL 4ELMA 3QIUD 1FN4A 3MLPA 3SE4A 3TFKD 4RSVA 2JJTA 1MI5B 3VXQA 3ESUF 1CFNA 1N64L 2OJZH 3PP3K 1S3KL 3NZHH 4HPOL 1PG7W 4X7FC 3PWNB 3FFCA 3JTSA 4H25B 4JKKA 4V1DA 3IFPA 1BAFL 1NC2D 4RIRA 1FNSL 4KHXL 4XWOC 4DZBB 5J13C 4V2CB 1D3CA 4OLYL 4OCWL 5F3HB 2X1OA 4N90D 3WS6A 2JB5H 1OGTB 3LV3A 4M6NL 4ZTPH 3C08L 3WL9A 1G7HA 3O3DA 1UZ8A 5I1AB 4QOKD 1BOGB 4PGDB 6CGTA 12E8H 1JRHI 5FYJH 2VR4A 5C0AA 1DSFL 3TVMC 5BW7C 4OLZH 1XR8A 1TZGH 3GMMB 3P9MA 3QHTC 4J4PD 3DYPA 4DGIH 1EFQA 2FNBA 1M7IB 1D6EB 1J1OH 4QHLA 3L3IB 1NCWH 4J2XA 3VD9A 4F7EA 5GHWL 2X2YA 4FRWA 2ZKHH 5TDNB 4QY8A 5JXEA 5D1ZA 2V17H 4Q9QH 4NPYA 3RWJB 3AM8A 3IFLH 4JFDD 4XP5H 4JQXC 4KI5F 3C5ZB 5LGKA 1U3HB 4P9HC 1QRND 1XAUA 2DN7A 3S97C 3A6BL 2VMFA 1OT1A 3MO1B 4TTGA 1AHWC 4HUVB 2XXCB 3LKPB 1EBAA 2BNRB 3DURB 3ARSA 3UTTA 5C09D 5LGHH 5FYLD 4ONFH 3SE9H 2IPUG 4LHQB 4NKOB 1A6VH 1UJ3A 3E6FA 1A7NL 3S36X 5H2BA 5IR1B 4NWUL 1Q9KA 4Y8AA 2GIYA 4M1DH 2X4QB 1NUGA 3MNZA 3RWGA 1JWMA 2CH8A 3ARDC 3GHEL 5I74C 1UJTA 1TMCB 5KSVB 5DQ9B 1EJOL 4NN6C 1AO7B 3CDFA 1XEDA 3AROA 2D9QB 4GG6A 3MRDB 5I1DA 2W0FA 2KZWA 2ZJSH 4X6CA 5T33L 1MLBB 1DE4B 4GRWB 2DI9A 3IETB 4H0IA 4UNUA 5TH2A 1GGIL 1F00I 4BKLA 2C3VB 4LASH 4PJXA 3EGSA 1AHWB 2R29H 4QXUL 2BERA 2NY7L 2N1KA 2ITDA 3WKNA 3VA6A 5CGYC 4LU5L 2UWEF 3O8XA 4JY5H 3LS5H 4GXVL 4QYOB 3H3PL 5TPWL 4KK9C 2ICEA 3SJVB 4HIXH 3MLYH 3MRHA 3P2TA 1BWMA 3HMXL 2W92A 1Q94B 3DO7B 2EECA 3P9MB 3MRIA 4HWBL 5C09B 4JKPH 4V1DE 4X5XB 5HHPA 4NZTH 4XB7A 4PRPB 4S1RL 4YGVB 1NFDB 5SX5H 1NCBL 1WITA 1MF2L 2IANA 4G8GA 2P44B 1J12A 1R6VA 2V2XB 3VWKB 4LLAA 4YBLC 5HHNB 4BH7B 3IGAA 4KTDH 5B39A 3AAZA 1VFOA 4JDTL 4LOUD 4CDGC 3WKML 4ZTOL 3QPXH 3AM8C 2VDNH 2ZUSA 1LO2H 4M62L 1G9NC 3AY4C 5SWZD 3TV3L 3ME0A 1DN0B 3VD7A 5EBGA 32C2B 4FZ8H 3EJZC 1M05B 5MP6H 4TSBL 5CJBA 1UM6H 4JJ5B 4M48H 1GJIA 4LDLB 5JW3L 3B4NA 1UJ3B 3E6FB 4U31A 3ULVL 2J8OA 4JN1L 4M7JH 4M93C 5GJTL 3D85B 2VZ3A 3VJ6B 2FJFB 4P3WA 4LCIL 3OHXB 4TVSa 5IHZB 5ICZA 1AP2B 2OQJB 5KSVA 4LSQH 4EQ2A 5JHDE 5KZCB 3X13A 2AEQH 4YC2B 4P2OD 1HDMB 3B9KA 2GY7B 4IM8A 4TNVF 5ID1A 1G7LB 1DL7L 4D8PA 4B7IA 1NCAL 5KSAB 5IKCA 2LFGA 1MJ7L 4QRQA 4FN0A 1ZLVK 1MI5D 1I7UB 1UG9A 5C0IA 4JY4B 1SYVB 2UV3A 3RWFA 4OV5B 5IVZB 3TGXA 1DP0A 4PRIE 2XT1B 3D0VA 3LSOA 1XF3A 4NZRL 5F7DA 5IQ7L 5D7IA 2PXYC 1JRHH 2X4SA 2XOTA 5TGBA 1A4JA 5B22A 4Z7WA 3IU4L 1E28B 4HJ0C 1FZKA 5ESVB 4GAYA 1N6QL 5FK9B 4N9GA 2EDWA 3H6JA 4K94C 4G43B 4JN2A 4F9LA 1T0MA 1BZ7B 4X9HA 5DWUH 2EO9A 2ZKHL 3FB5B 1VEMA 4QHNA 4Y4HC 4EI6A 4S0TD 2QR0A 2CK0L 2IJ0C 3PDDA 1LEGA 2YPKA 3HAEA 4G6AC 2VABB 4FXGA 4GQ9H 4NZRH 3QDGB 4OCYL 3SDXA 2IADA 3BO8A 3UTSA 5CCKL 1MRDL 1DBML 1JPGB 5DURD 2Q86A 4ISVB 5D2NC 5CZVL 3JWDH 4P9HL 3OB0H 3ROOA 4U1NB 4GBXD 1YYML 3O3UN 1CG9A 5IMLA 5LXGH 1RAMA 2OTPA 3HLAB 4LCUB 2VN4A 4GT7A 1KV3A 3PWPA 4FFWD 3ULUF 5JW5B 2PYEA 2UZIL 4AQOA 3C08H 1FBIH 4HUUA 4M9PA 4IIQC 2P24B 3MJ6A 3HZVB 4UILL 5HGDA 3O81A 5GIRA 3RTQB 4CMMA 5A2JH 1DN0A 5CLTA 3MA9H 1KIPB 3MBEB 5JW4N 3QO1A 4MAYA 3WD5H 1IKFH 1IGCL 1BFTA 3LPWA 4ZO7A 1DN2A 1RI8A 4WWID 4HFWA 2A73B 4MJ6B 3L95B 4ZFOA 3NTCH 1TCMA 4HKJB 1MCLA 3W9EA 3WHE0 3HG1E 4X98A 1KJ2H 3RIFF 1FFNA 4JGJA 2Y36L 1KXQE 4XCYA 3FB7B 5SV4A 4BUGA 4HWEH 3BWAB 2BSRA 2HFEA 1YEEL 5KN5B 2JCCA 3BWUC 4PJEA 5C0BE 1FC1A 3O6LL 1YEIH 3SDAC 4YHYC 4GG6E 3X12B 1JMZA 4U6TA 1OOAA 4N9OB 2FX9L 5JO5A 3PWJA 2NY7H 3GI8H 4DOHB 5ADPH 2UWEE 5BZDB 3QZWB 1T5WB 2JELH 3FFCD 1TQCB 4NO3A 3BRDA 3L3OB 4XPGH 2C1OB 4NN6B 4X7CC 4FTVD 4BFGA 5C07A 4JFPA 1M4KA 4PJBA 4D9LH 1A4JB 3RTQC 5IVNA 2B8OT 5HDOA 4LAJH 1ZVSA 1CE6B 3E6HB 5ESQA 1JGDB 2V5MA 1INQA 4AH2A 3ZHKA 3BKML 3ALWA 4P5TB 3V6FA 3IDNA 4UV7L 4EVNA 1FE8L 1K4CA 3QDJD 3MSPA 4LSUH 4U1IA 1CR9H 3UTSD 2OYPA 5DJZA 4F58L 4WW2F 4NM4L 2R2BB 3CH8A 1L0YA 5JQ6L 1RZJC 5DMYA 4FQLL 4B5EA 1JK8A 4UT7H 1P7QA 1W0VB 2GK0B 4NQXB 3SGDI 4OLVL 5D72L 1F45A 1HXYA 2OTUA 2ARJA 1U8HA 5GS2D 4EBQH 2F5AL 2V5YA 5I1HH 4P4KB