1WTLA

Comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDITNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTLPLTFGGGTKVDIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords BENCE-JONES PROTEIN MCG (LIGHT CHAIN)
publication title Comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light-chain dimers.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wtlA00
1PVHA 5ILTH 1ZKAA 4KJPD 5EIIA 1CZ8L 1W72L 5DRZB 3MRDB 5IMMB 1D5ZA 2OBGA 4UBDD 3ZE2F 1SVCP 2A1WL 2F54A 1FVCB 3L1OH 3EZJB 3SQOH 4OTXH 4ETYA 3WJJC 5K9OB 4X4MA 1BZQK 2IALA 4U6TA 4G9FD 4RA3A 2HKHH 2XG5A 1VESA 1ED3B 5FCUH 1A3LL 4JRXD 1RJLA 1TZHA 3WN5A 3GRWH 4CVWA 4OV5A 4X4YA 3EJYD 3QQ4B 5ESVA 2HH0L 4EN3D 3OAZK 4QEGA 1A6TB 4E41D 3I6GB 3F7YB 4JFFA 2V5YA 1UCBH 4XBGB 5L8JB 1ZHKA 1JK8B 3MMEB 4F33B 1MRCH 5D7LA 1KTRL 4D3CH 4NKDB 3TBSB 3VU2A 3NA9L 4I48A 4O51A 4CMMB 2F53B 2VDML 3MV7B 5GRJH 5TDPA 4PY8J 4C56D 4JQXA 2XFXB 1O7VA 4I0PB 4PB0L 4O4YL 2DYPB 5C0RH 4XMLH 3BQUB 2JLLA 4O02L 2GJ6B 4Q58C 3V8OA 4OUUB 3VXUB 1RJYA 5F1NA 3SDCC 5GRXG 3T04D 4MNQE 3O6ML 3EOYG 4K8RL 1Q94A 2HFFB 4HS3B 4JY5H 4GAJL 2NY3B 3GSWA 3ZTNH 3N85H 4RGOH 1OP3K 4MS8C 2OJEA 1F4AA 1F4WL 4AIZA 2AV1B 2YWZA 1G7QB 2IWGA 5E8PB 3UTQA 4AYFA 1BQLH 4M1DH 3WKNA 3P77B 4YAQB 1RAMA 4P48A 2ENYA 4CBPA 5DD0H 3ZHDA 1FVDB 4NO2B 3GSRB 1U8JB 1ZSDB 6FABH 1YY8A 1L6ZA 5HYQB 1NCBL 4PRHB 4ELKB 3U4AA 5KVEH 1H15B 4EI5B 5FIEA 4HWZA 4GKZA 3ULVF 1SJEB 1UADC 3QXVA 1T66C 1UXSB 3C2AH 5BRZD 4PRPE 4DKFH 5EN2A 2LTQC 4L1HA 5AZEL 4LIQH 4P57A 5EBLA 3WXVH 4E5XB 1PLGL 2X42A 4FRWA 2OJZH 4CRPA 3TO4A 2GT9B 1CXFA 3O6FC 4FQJL 4YXKL 3REVA 3PGDB 4EBQH 4KROD 5JNYA 4Z7NE 1E4KA 4Q9RH 5DDHA 4M5ZH 2B0SL 5DRXA 5I66B 5ADOL 5DFVD 5KSBB 4HKJA 4LHQB 1TLKA 4X6DB 1ZTXH 4ZUWA 3BXNB 3B2UD 5FO9A 3E6FA 4MJIA 2IPUG 4DTGH 3RWIA 5IB1B 1IFHH 3GM0A 4POUB 4Z7WB 1QVOB 4QHLB 4U1JA 2QQLL 2CMRL 4XP1H 5I1GL 3WYRA 5C9JB 5CD3A 1MIMH 5HVHC 3FT4B 4JPVH 1D6EB 2VDKL 3L3JA 5I0ZA 2HA1A 3K46A 3M17A 2WINB 3HC3H 5TDNB 1MUJA 4IMKA 3HMWH 2NY1D 4P2RB 4OAWA 5ESQB 1ETZA 4AZ8A 4TN9A 3T4YB 3ZKSD 4JGJA 1C5DB 3F7PC 1OVZA 2E6JA 2DMKA 2RIKA 4NQVB 5AAMA 4JCMA 5F88B 5KN5A 1AHWA 3O3DA 3OHXB 2XQBH 4PREA 2V2TA 1V7NH 5C0CE 4LEOA 4HUWB 1IQDA 1T21B 2RCSL 4HF5H 4PY7A 1BGXH 5EA0L 1ROWA 3EYOB 5J3HD 4DKEH 2CDFB 1RI8A 3JWOH 4NRYB 1ES0A 2BVOA 4XTRD 4XI5C 5HVFB 2KBGA 4LSUL 5K9JH 3RY6C 1G1CA 4LVOC 3HNVH 4Q6IA 4UNUA 1B2WH 2ATPB 4NQSB 3DVIA 3B9VA 5LG1A 4JVUA 1QLEH 2XWBB 2DDQH 2COQA 3MRQB 4F7PA 4WUUD 1FZMB 4Y2OA 2LU4A 3ALXA 3K8KA 4KKAD 5I71B 4WFEE 5EH1A 3WKML 5JOPD 3C6LA 2VZTA 4MDIB 2EYTB 3OKOB 2XN9A 3HS0B 4CW1B 1UJ3A 1CLOL 3CPLA 3PABB 5DJCA 4IJ3B 1MCKA 1GGYA 4JQIH 3S3SA 3ARGD 4LQ1A 4AEIH 2KQMA 3PWNB 3BD3A 5EFIB 1BD2A 1Y6KR 3BKYL 3VXOB 4Y4FC 3WFBH 2EXYC 4UT7H 1BZ7B 2VTFA 1B6UA 2HVKB 1HH6B 4IRSD 1UA6L 4IOFC 3RWEB 3MO1B 4AEEA 3OF6D 1WBYB 2GCYB 5T1DL 5D93B 5T3ZL 4M43H 3FHQA 4TQEH 1YMME 5HHQA 3HI5H 1FFPB 4XNYH 1HI6B 2JCCE 3U7AA 3PF2A 4HZLA 4G42A 1IC7L 1G0XA 3MRCA 4OLWH 5FKPB 5TGBB 3SO5A 3U4EA 1QSEA 2CUHA 2EKSB 4KK5C 1CDCA 4M7JH 4WV1A 1ZMYA 4ZMAT 4RNRB 1J0JA 2EC9T 5EOCH 5JMOC 3DUUB 1LVEA 1U8LA 5I1IL 2LAAA 2XG4A 3QAZB 4LCUB 4ELMB 1YZZA 2BVPA 4UZGA 1NFDA 3TPUA 3UO1H 3CSYA 3OJDA 5DF0A 4YHIA 1N59B 4LSVH 4PP2B 2NXYB 1F8TL 1R3KA 4XCNB 3H42H 4Z7UF 1OAQH 2UWEE 2I9LB 4F15C 5IMOA 2GTWA 4PJFA 1TQCC 1XGQA 1DQTA 5EO1B 3EOBA 2Q7YA 1VGEH 4NQTA 1G7LA 2AQ3A 4RMUA 5FGBC 3PHQA 3WHXB 3TFKC 1I3RA 2FLRT 5C0JB 4PIRF 3QIWC 5K93A 3FONB 1FO0A 4LSTL 4CVZB 3FO9A 2VXTH 3VXMD 5FECA 2AEPH 3D69A 3LRSA 1GC1H 1TETL 1A6VH 4YEFA 4GAGH 4MNGB 4PS4H 1OWWA 3HI1B 1DSFL 3VFMA 5GGUA 3JV4B 2YRLA 5AZ2L 3TZVC 3PDGA 1NBZB 2NW2A 5KG9A 4NSKA 5BZDB 3V4VH 3KXFE 2DL9A 5J06A 2DQFA 5T1KB 1NCCL 5JQHC 4GBXD 3MLRL 2H2PC 5EC1B 5MEOA 4KMTL 5C0AD 5JO5A 1YPZA 3RVVC 1AGFA 4XMKH 1S7VA 2AKRB 3C09B 4XWGL 3TV3H 5IMLB 1Z0MA 3HN3A 4JFQB 5DMGC 3BW9A 4XPBH 1LP9F 2BXYA 1MQKH 5HHOA 1T0MB 3D3VD 5I9QC 1OCWL 3QUXB 4MAUL 1CE1H 2X4QB 1I7TB 1ZS8B 2VXQH 5IHZA 1YEFH 3NACH 1DVFC 1FDLL 5D9SB 3K3QA 2AJYL 3DURB 3RIAF 1F00I 3KPPA 1X7QB 3ULVE 5ABDE 2FIKB 1QBML 3QQ3B 1OSZB 2R8SL 2VL5B 3F5WB 2IFFH 1UCTA 1ZA6A 2RGSA 4X5XA 5FEBA 1IGYA 4WI5A 5GRJL 2VH5L 3ME0A 4TTDC 5DHYA 4ODWB 4WFHD 2R0WH 5DRWB 5I1JH 3GMNB 2GTZB 1CLZH 4HUXB 2XWTB 4R96A 4ZUVA 5FO8A 1J05B 2E7HA 4TOYH 2HFTA 4PV9B 4ZO7A 5J6HA 3DV6B 5GPRA 2AABL 3ARBB 3MFFB 1H3XA 4A6YA 3ZKQD 5BS0A 3GJEB 3BEWB 1LE5A 3MLSL 4DN4L 5LBSH 1EFXD 4K8RD 3VFOA 4XNQA 1DQDH 1S7RA 1NMBH 1E27B 1Z0NA 1Y0LB 1BQLL 1RVFH 5L0QC 5I1CH 1F45A 1TPXC 5FOBA 5GJTH 1WCBB 4FFWC 3H7BA 3O2DA 2R0ZH 4YBQD 3WIIH 4PTTB 4LCCC 5C08A 4XBEL 3K74B 1HOCA 2VAJA 3UMTA 4QHNB 1FZOA 1NFIB 1LO0L 1PSKH 3TBVB 4IOIA 2IJ0C 1HHJA 1UB6A 4KTEH 2XRAH 4JO4L 2AJXL 2Z92A 5IB3B 3ZO0A 5F3BB 3DX6A 2PYFB 3K4ZA 2AJVL 1GAFL 4LIQL 1Z9MA 4XZUA 2JELH 5FF6A 1K8IB 1S9WB 2QV2A 2BSTB 3DLQR 3O11B 4PJ7F 4ORGB 3L3KA 3L6FB 2NW3B 4R4FL 3QPXL 1D3CA 4HBQA 4GKSA 5E1AA 3MRKA 3TA3B 4LARL 5HHMD 5E6IA 1S7UB 2ZUXA 4NWTH 4KKBC 2JIXA 3Q3GA 2C9AA 4MVBC 2IGFH 5HYSB 3CSGA 1A7PH 5KVFH 2I5YL 1E6OL 4L4TE 3UJJH 2YS4A 4R4BB 1S5IL 3SO3C 3TNNB 3QULB 4N9GA 3SDAC 1NDGA 3ARUA 3IXTA 3CFBA 5C0IA 5DJXB 1WV7T 3LN5A 4P2YA 3UYPA 2B2XH 4RFEB 4LEXH 3GMQB 3C60B 3RVWD 1IEBB 4OT1L 2JJTC 1MIML 4QRTA 4Y5YA 5CJ5A 4NDMA 5BZWA 3QEQE 1LDPL 3OPZL 2WQ8A 3QIBB 2NY4C 3I2CH 4NP4H 1T20A 4ZS6D 4MAYC 4M6MH 4PBWD 1NGZA 5FGRA 1HDMA 3G04B 4PRBB 2VDQL 1EAJA 4L4VB 4O58L 1C5CL 1OD7A 1ZA3B 3IJYA 2VKWA 5FHAH 3I85A 1NAKH 1U8QB 5MEQB 1UVQA 2NY7H 3HG1B 1F58L 3NPZB 3QXAA 3CSPA 4U1SA 3O0RL 2FL5A 2HVJB 1ND0B 4ZPTA 2BRRH 4Z7OF 4X6BB 4OZHA 3LQAH 1K4CB 1AE6H 4LASH 2X4UA 2FX8H 1MCWM 3MODL 3UPRB 4PRIA 1F3JA 2IAMD 1QLFB 2YXMA 2JJWA 5IVXE 4KY1L 4JCLA 3REWA 5CS7A 5D7JB 3U0TB 2QSCL 2C3HA 1UB5A 3PHSA 4DOHB 3QQ9C 3MUY1 5IGXH 2XTJD 4XCYB 2YD3A 2Z93A 3BWUC 4LLWA 3QJHA 1TJHL 2VO5A 4OUOA 1QPPA 1I9IH 4I0PD 1DQJA 4JQIL 4LPXA 2DYPD 5IR1B 1HQRA 4HIIA 3HZVB 2CIKA 3BMWA 4YX2H 1XFPA 2ESVB 3G5XA 3QUZA 4LCYA 4Z7UE 4F9PC 1H3VA 1I85A 1MWAL 4JFZL 2AK1H 2NY3D 1J0KA 3TLRA 1ZT4B 3PGCA 2DI7A 4ONFL 1KN2H 5HSFA 1ZGLM 3UBXA 5L2KE 1XGUA 5FK9A 5J9PA 3QDGB 1JL8A 4MJ5B 4P2OB 1T6WA 4HFUH 4HJGB 2Y4SA 5E03A 3QUYC 5JOFB 3FT2B 5C09A 3WNMA 1H5BC 1D9KB 3GMRB 1H3GA 4PJ9D 3V6ZA 1OTSD 1NL0H 4PRHD 1FNLA 5ICXA 1HNGA 5FGCE 4QHKI 1KTDA 1ZGLP 1VB9A 4BK4A 4EI5D 2GSIA 2E9BA 3MRBA 1CGXA 1WBXB 3PL6B 2DD8L 2NNAB 1YUHA 1R3IL 4Z76B 3J8F7 2MHAB 1RZIB 1GGIL 1KTLB 4PLJD 2ORBH 3SGKA 4JPWH 2CRMA 3RZCC 1RIVH 1YNKL 2IPTH 1H8OA 2B4CC 3QXUA 1CFVL 5CZVH 4E0RA 2HN7B 3MSPA 1BFSA 2ITDA 3R06A 1N3NA 1NMCB 5I1DA 1CU4H 1N5AA 3DGGA 1MI5D 2GFBB 4KUZH 1Z2KA 1TZGH 3B9KC 2WSKA 3KPOB 4WU5B 5GGQL 5HI5C 5I1EH 2AK4A 2AJSL 5KSUA 4KMLB 3WIHL 3STBA 3U79A 1BBDL 4U1NA 1G7JA 5C0BE 3KVQA 5E8OA 4BJLA 4LHUD 2YSSB 1D5ZB 2R29H 1GVIA 3MX0A 2F54B 1J1XH 1M7XA 2VDLH 3FO1A 1EGJA 1RK0A 1MHPL 5D2NE 3VDCA 1VEPA 4K71B 2IALB 4P46D 3T0EC 2ZWLT 1VFAB 3RFZC 3QI9C 1RJLB 3S6CA 3UZQA 1TZHB 5I1KL 3WN5B 3GI9L 1DQLH 3UTTD 1NCDH 4QRUA 4OV5B 1MSPA 5ESVB 1QSVA 3QG6A 4YIQB 3RY5A 2ICWI 1BJ8A 1I7ZA 2FDBP 1G9NL 1IEHA 3D5OF 4JFFB 1DLFH 5IIEA 3R4DA 4P2RD 5E5MA 3N9GL 5IJKC 4QTIH 5EWIL 4YXLL 3GMLA 5D7LB 1JN6A 2X4TA 3MA9H 3TH3T 4I48B 4O51B 5TDPB 5E7BA 1I1RA 2EXWC 3NPSC 2O5XH 3IFOB 3UPAA 1CDYA 1IGJB 2DQUL 1MEXH 3HB3C 3OR6B 4ZO6A 5DR5H 1RJYB 5F1NB 5MEND 2I25N 4WI3A 3PWPA 4JRYD 4QRPA 5ACMA 1Q94B 3O9WA 4HMDA 3VD4A 1B4JL 4UTAL 1G0YR 5JDSA 1DBMH 3GSWB 4OI9A 1NANH 1WVZA 2DAVA 4X7EC 1NPUA 2OR9L 3DVFA 3GEWB 4G9FE 3NH7H 3TGXA 4AIZB 4K7PX 4IDJL 3E8UH 3UTQB 1OWRM 4GKOA 1SYVA 1I9RL 2XV6B 3G9VA 4MA1C 3UJIL 3HRPA 4PJ7E 4GRWH 1JZ2A 3WDJA 2EZ0C 2PYED 3MNVA 4DUXA 5EU6E 3MLYL 5CP7B 1UKSA 5DZOA 4P3WA 5A16A 1EXUB 3KPQA 3MBED 2LABA 5FFLA 2B1HL 1C7TA 1A7NL 4E41E 4HWZB 5D2NC 4GKZB 4PTUA 1TENA 4OF0A 3AREB 4ZQKA 4M6AA 4P23A 4RFOL 1BJ1J 5IB5B 5KVGL 3OB0H 3BGAA 2R4SL 1KLUA 3KNBA 5C2UB 2X7LA 5EN2B 1HYRC 5DXWA 2CR3A 1VFMA 1QOKA 1I4FA 1IBGL 4P57B 5EBLB 4C56E 1WIOA 1X5HA 3DV4A 1FE8H 4N5ED 5H2BA 5LCVL 1AR1C 2L0DA 1L7TL 3RNQA 3TO4B 5JNYB 2V7HA 1FFQA 3REVB 4MB5A 4IMLB 2YKLL 3LKRA 5T5NG 3T0WA 4LLDA 5FDWA 2OZ4L 4YWGH 5DDHB 3VI3F 4OF3A 3IXAA 5DRXB 4L8CA 3M45A 5HI4C 4PGEA 4IRJA 4HKJB 4OLYH 5E00B 3Q6FA 3ARXA 3I02A 1PAMA 3ARFD 1SYSA 2R4RL 2HMID 4ZUWB 2BMKA 5B38G 4KAQH 3ROLA 2X4SA 4QYOA 5FO9B 3E6FB 4MJIB 3DARA 4MNQA 3RWIB 1JGLL 4HS6A 1MJ8L 1FBIH 5GRUH 2Z31D 4DCQA 4U1JB 4ZG1A 1FO0H 1YEKL 1NC4A 5CD3B 1J0HA 1R5IA 5AWNL 2W0PA 3L3JB 5FA3A 4Z7OE 3M17B 3UJJL 2FO4A 1UFUA 3EKCA 1MUJB 4AQ1B 3OG6B 1G7PA 1OARL 4OAWB 4AG4H 1IEAA 1ETZB 4APQD 4FG6C 4JO1H 5JA8B 3B2VL 5CEZH 1JYXA 1OAKH 1NUNB 4LAJH 1RURL 1AHWB 5CCKL 3O3DB 1FNEA 4PREB 3P0GB 4Y2DD 2V2TB 2VABA 4LEOB 4OGYL 4PRAA 3MJ9A 1TTUA 2V5SA 1RUKH 3QFJA 4CNIA 4PY7B 1GGTA 1AD9A 3JVGC 1OGTA 2EDNA 1ES0B 2BDNL 2BVOB 2DBLL 3RY6A 4AQOA 1CGUA 3F12A 3I50H 4TRPL 5IROA 3EOAA 4Q6IB 4I77H 4R9HA 3BWAA 1BFOA 3WS6C 3HZMA 5HVGB 1ZEAL 4U1LA 2ZSVA 3UROR 3VGGA 1OGAE 1RZJH 1FZJA 1UZ6F 2NY7L 3GFUA 4OJFH 1PDKA 1X5KA 4P4KA 3BRFA 2NY0C 4M6OL 5T1KD 2KZWA 4F7PB 2IMNA 2VZUA 3X3GH 2CLZA 4MXQC 2P49B 3ILQD 4AMKL 5FO7A 2IQ9L 5AUMA 3GKWH 4DEPB 2VZOA 2R1WA 2XN9B 3VXQA 1UJ3B 4DZBA 3CPLB 4LVHC 2FEDD 2YN5A 5DJCB 4OGXH 3C8DA 3F6IA 4DFHA 5KJRH 4JG1H 4KVNL 1BD2B 4WRLA 1CI5A 4OD1H 1YECH 4U7KA 3RRQA 3NCJH 1TQBC 5D7IF 3NGBB 3U30B 4K3JH 1K8DA 3O4LD 3FN0H 2FSEB 3W82A 5T1LD 2QADC 1KPRA 5F6IC 2CPCA 1CDJA 3O2DH 5ECJE 5HHQB 2X1OA 5DVMA 4HZLB 4PJDF 4G42B 2MQCA 4YDKH 3W11D 4RMRA 2DI9A 1G6RL 4ZTOL 3MRCB 1UJTA 4RWYL 1YC7A 3U4EB 1QSEB 3ARDD 2EO9A 1A1MA 1KXTB 4WV1B 3O2VL 3G6JE 1CD8A 2W92A 2D0HA 4G3YH 4WUUE 4JPKH 4R8WH 4DGYL 3D25A 3N1FC 5JOPE 4PG2A 5CINL 5GS1C 1U8LB 5F1OB 4HSQA 4J6RH 4KVCL 4Z95L 2BVPB 1WK0A 3OKNA 3NOIA 1NFDB 3TPUB 3CSYB 3FKUS 3OJDB 3KR3L 4YHIB 4J12A 5FYKH 4NGHH 4FFVC 4UQ3A 5HYFA 3ZKXB 1Z3GH 5IMOB 2GTWB 3PIQA 4OCLC 2HLFD 4PJFB 4AH2A 1RZFL 1XGQB 3V0VA 3WFEL 3CZJA 2ORBL 2A83A 2Q7YB 4WHDA 4J7RA 4WTZA 2A6DB 1G7LB 1DBJL 1QZ1A 2P24A 1IMHC 3PHQB 1I3RB 2H2SD 1BEYL 4UNTA 1FO0B 3O6LH 3FO9B 5FECB 3D69B 2P4AB 3LRSB 4JZOA 4ZAKA 2AS5M 4MA8L 2VXVL 4PJBF 4MLIA 3AVEA 4ERSL 3ULUH 3AUVA 3VWJA 1QFWL 1BQSA 3RUGF 2PETA 4ONHA 2Y5EA 3GIZL 3VFMB 5GGUB 4F8TA 2UV3A 5JW5A 5IVOA 1YMMA 4U6VL 2NW2B 4KI5D 5E08L 5KG9B 5D1XC 4NSKB 4JFDD 5TF1H 1YEDA 4O9HL 4URTB 3BIKA 3C08L 1S9XA 5A2IH 3U83A 3NFSL 5MEOB 5JO5B 3KYKH 4DAGL 1AGFB 1S7VB 2YUWA 2Y07L 2R23A 2YXFA 3BW9B 5HHOB 4KKAC 3MCLH 5F97E 5J11C 2FEEL 3L3HA 1RFDL 3AY4C 4HAFA 3EYQC 2DJUA 3ZL4L 3QIBD 2ZG3A 3GJFA 4NC1E 1CWVA 3OQ3B 4UB0H 3AB0C 4YZFE 3RA7L 3KPPB 3L5IA 1DUZB 1Q72L 4ZFOA 1QYGL 1MCOL 1I1FA 1UM4H 1LO4L 1WLHA 1ZA6B 3ZSSA 3VXME 4OZIE 3HPLA 4X5XB 1IGYB 3W2DH 3HG1D 1B90A 5D4QA 5DHYB 2EC9U 2XPGA 3TWCH 1NLDL 2V5RA 1UWEH 3ULSA 4R96B 4UIMA 4K7PH 4ZUVB 3MJGX 5HDOA 5FO8B 5KTEH 4MJ6A 4X83A 2V17L 1E4XH 1KCSH 4BH7B 2IQAA 1I8IB 1KCVL 5B22A 3VI3E 5BS0B 4RGND 1QNZH 1KB9J 4JO2H 4D9RD 1LE5B 3GMPA 3HE7A 3P9MA 5FUZH 3VFOB 3MZGB 4YUEL 1DN0A 4XNQB 1S7RB 3MYZA 3GSNL 5C0AE 4NIKB 4FTVA 1QFWI 4BUHA 5MHSE 1FCGA 3M07A 3EO9L 5IF0B 5FOBB 5C2BL 2PO6A 3H7BB 5EDXA 3P9LA 3D3VE 3EFDH 4ZFFA 1KJ3L 5C08B 2B1AL 3KXFA 1HOCB 4HKBA 1FZOB 4G6JL 1KIQA 4IOIB 2MCPL 3FQTA 3RVUC 1HHJB 2LVEA 2PW2A 5C0DA 2J4WH 2Z92B 1J9CT 4MD4A 4HFWA 3H6JA 1JNNL 3DX6B 1BVZA 4N0FA 3RQ3A 4B41A 4XZUB 5I17A 3F58H 5GSRA 1TNNA 5D7KD 2A77H 5FF6B 4HCRL 4G6MH 2FEEI 2R0KH 5HYJD 3L3KB 4XWOC 3OG4B 3JTSA 2EIZB 3HLAA 2PXYA 2YEZA 4Q7DA 3FTGA 3TT1H 1RHHA 3T8XA 4GKSB 5E1AB 3MRKB 25C8L 2EDHA 5E6IB 2CO7B 4NN5B 2JIXB 3Q3GB 3LEXA 3PJSA 4WEUD 2NY2B 5SX4H 1CR9L 3T0VA 1GGBL 1C7SA 3FN9A 3B43A 1AJ7H 4OFDA 3SE3A 1MOEA 2K9UA 3H9HA 4OB5H 3LB6D 3U6RA 3MA7A 3CFBB 1PFCA 4FFYL 4I2XE 3VGEA 3BO8A 2Z91B 3ZZ1A 5C0IB 1I1AC 5B39G 5HHPA 1UZ6E 3LN5B 1GRWA 3IB4A 1N4XH 4PJHF 3B6SA 1EGJH 2HJLA 4YHNA 3RIFK 4GBXC 1WGOA 3MXWH 4QRTB 4Y5YB 4NDMB 5BZWB 3THMH 5DMIH 3TN0A 5IFAL 2VSDA 5MP6L 1T83C 1T20B 1NGZB 3AC0A 5DD1L 3RBGA 4BELD 5J8OA 1HDMB 2HRPH 1EVTC 1HSBA 3FHAA 5HHVH 3ZT6A 3IJYB 3P30H 1EBAA 5JIPA 3EDJA 1CVRA 3H8NA 1UVQB 2Z8VC 5KAQF 2CLVA 1I3VA 4HJJL 4U1SB 2FL5B 4ONGL 2J6EL 1DE4A 4ZPTB 4FFZH 4XCEB 4OZHB 4MA7L 3JWDH 5CJOL 2FX9L 2VR4A 4XP5L 2X4UB 1PBYA 4HKXA 2EEAA 2I24N 4WW1A 4R0LC 1X4YA 3MR9A 1U8NA 4PRIB 1F3JB 1MIEH 1J1OH 1RZJL 4M8VA 2YUZA 2VN4A 3LKQA 3REWB 3TBWA 3R1GL 4JFFD 1P1ZA 3CK0H 4LPYA 1UB5B 1NCAH 4I18A 4GSDH 3QO0A 1KFAH 3GKWL 4H1LA 5LGKA 4QKXB 2Z93B 4LLWB 3QJHB 4KC3B 1MFCL 3SDDA 2Z8RA 2H9GA 4OI7A 1A0QL 1DANT 4UQ2A 4OGXL 1DQJB 2VDOH 2C3VA 3GHBL 2GUOA 7FABL 3CVHL 1HQRB 4HIIB 1K9TA 2CIKB 1GSMA 4QNPF 3G5XB 3QUZB 2DWEA 4LCYB 4OLUH 3RTQC 4L8SA 1A9EA 1FC1A 2BJML 2X4NA 1HCFX 3QEQA 4JFYA 1JGUH 2OMNA 4ZUSA 4EOWH 3B8SA 3N1GC 5C6WH 3PGCB 3OGOE 5JR1H 4ODHH 3A6CL 3GO1L 3UBXB 4Y4HD 4PJIF 1XGUB 2APFA 2APTA 2XACC 5J9PB 2DQEL 1ZOXA 4I4WA 3MLVL 2J88H 2P5ED 5F7UA 1HINL 4MXWH 3HNSL 4C57C 5JZ7C 5C09B 2EE6A 1U0QA 1JHKL 1MELA 3KPRA 5HD8D 3X14A 1VADA 3V6ZB 1FIGL 4PJBE 5C3TA 1QR1A 1AGCA 5ICXB 1WFTA 3K80A 4LGRB 3V5KA 4MB3A 1KTDB 1WQVT 2GSIB 1T0PB 5E8EA 4KDVA 3WO3B 5CILL 3MRBB 5D70L 2CKNA 2PTTA 3ARED 1YUHB 2GJZA 4ZNEE 1DBKH 1PG7L 4AJ0A 4H8WL 3DOSA 5J12C 1HK6A 1PEZA 1IKFH 4QXGH 2XTJE 2WK2A 5E94A 4HPOL 3VG9B 5DMKA 4E0RB 5IVXA 4M61A 1R5VA 1YEHH 2ITDB 3R06B 3VXUE 1N3NB 5I1DB 1N5AB 3DGGB 3VGDA 3HPJA 1P7HL 2C3XA 3WO4B 2XQYG 4KKLD 3LD8C 2AK4B 4U33A 5KSUB 1IGIL 3MLZL 4U1NB 4OCWH 1G7JB 1KOAA 4MLSA 5EB9A 4JFHD 1VEMA 5E8OB 4CL7A 2RJMA 5SX5K 1EUTA 1F11A 4HWBL 4GXVH 4NN7B 1A7QL 4L29A 2NY6D 4WY7L 3FO1B 1KCLA 1T04A 4Z7UA 2YPVH 4FXGA 4MJ2A 5E2UH 5HDQL 1S8DA 2DTML 3MJ9H 4LBEA 4ZNCD 4PRHE 4TSCL 1IGCH 5GS0H 4QRUB 4PD4J 1XMWA 3KPSA 2R2EA 2R1YA 4L9LA 3RGVB 3QG6B 2RR3A 5L2JA 2ED7A 1I7ZB 3FFDA 4P3CH 3X13A 5L88H 1G7MA 5IIEB 5E5MB 4KZEH 2DM2A 3K4AA 2DQHL 4NZDA 3GMLB 5A3IC 1JN6B 2X4TB 1CDHA 4RSVA 5DLML 1MI5E 5MERA 4NZUH 4RAVA 4OCXL 3VG0H 2K1MA 4L5FH 5KSBE 3PWPB 5CD5D 2FO1A 4I0PC 4QRPB 3D18A 3O9WB 3TBYA 4NJAL 5JDSB 3BQUC 4U05A 2DRUA 3GBLA 3MYJB 5CP3A 4KRLB 1LP9A 2APBA 1HCVA 3DMMD 1RJCA 1W2KT 2E7MA 3TWCL 3FOMA 3QEHB 1F4YL 1SYVB 1KCRL 5C0BA 2NY3C 3B9DA 1KELH 4XVUD 3UTTE 4WWKD 3MNVB 5I8OH 4MYWB 4GG8A 4WFGD 2FX7H 4OSUL 2Q8AH 3L7FB 3KPQB 4R4NC 1QFUH 3RL2A 1JWSA 3LY6A 1LO2H 3LKPA 3OWEA 4J4PC 4ZS7H 4PTUB 5HDBF 3FB5A 1IGFH 4P2RE 1F97A 4JLRA 4ZQKB 4P23B 1U3HD 1BD2D 5CMAA 3KNBB 1KLFA 2J7LA 2X7LB 4EI5C 1I4FB 5JTWA 4K94H 1INDL 5C6TL 1JWUA 5F8RC 3DV4B 4TPRH 3LMJL 3LIZH 5H2BB 4BFEA 3RNQB 1P2CA 1IAOA 4ODSH 5IW1A 2V7HB 4PJHE 5MENE 2CDGA 3ARVA 4KI5F 3LKRB 3T0DA 2M8XA 4LLDB 1L9NA 5FDWB 1CD0A 4JRYE 3W9DA 1J8HD 3IXAB 3F6LA 1E4WL 3Q5OA 4PGEB 1SEQH 2VKXA 1QSED 4IRJB 2GK2A 3Q6FB 3I02B 1AI1H 2XA3A 1SYSB 1QBAA 4X98A 5IB2A 5C9KA 4P59L 2BMKB 3ROLB 1T2XA 2X4SB 1EVUA 2DLFH 1EEUA 4QYOB 3S3JA 4M48L 4MNQB 2PYEE 1IT9H 2X6MA 4HS6B 1TVHA 1X3DA 1C08A 3HUJF 3SGDH 5FYJL 2XZQH 4DCQB 4HH9A 2X9YA 1NC4B 1R5IB 3SE8H 4G9FA 4J3XA 3O8XD 1DUYA 3C9NA 5DEGA 3P4NA 5FA3B 3QCUL 3I3EA 1T1WB 2FO4B 5DD3H 2YMXL 4JRXA 5LGHH 4PJ7A 3LS5H 4WCYH 1G7PB 2H1PL 4TVPL 3BISA 2MWCA 3GK8H 1IEAB 5I8CA 2WW8A 4EN3A 2DN7A 1HYSD 2FYYA 4QOKA 1FGVH 3LEYH 2JB5L 4XNUH 1BF2A 4KKCD 4LSRH 4E41A 2HT2C 1FNEB 4QRQA 2VABB 4PRAB 4P3DA 5M95B 2Q86A 3QFJB 1ZT1B 5J1AA 3D1MC 4CNIB 5K9QI 1AD9B 3N0PB 5CIPA 1OGTB 5KW9H 3QCVH 1FYHB 2DF3A 5K9QG 4RISH 4C56A 1YNTA 4Q2ZB 2ZOKA 4HJ0D 3F12B 4N0YL 4M1GH 3EOAB 3BWAB 2UVEA 1BFOB 3C6SA 2Q8BH 2BK8A 4LIQE 4NKQB 3WSQL 4KHTH 4F37F 3HZMB 2P8PA 3GJFH 4U1LB 4QNPE 2ZSVB 3EZ8A 3MV01 1FZJB 1A6AA 1MCRA 4G5ZH 2O93L 4P4KB 4ELME 5FB8A 1TDQA 4DGIL 3DX8A 4ZYKA 1NLBH 1QHPA 2FJGA 2CLZB 5JW3H 2ZCHH 5FO7B 1FNHA 2V9RA 2ZP0T 4PJIE 5AUMB 3V4UH 1GPOH 2R1WB 5F7WC 3VXQB 4JO3H 5I71C 5HHOD 3P40A 4BM7A 2DQTH 1QBLH 1JTTA 4V1DA 4HIJA 2A9NH 2OTPA 5FYLL 3RU8L 5BV7H 4P49A 4PRDA 1DL7L 5I8EA 2VYRE 4IJ3C 4FP8H 4KXZH 3X3FL 1K8DB 5C6PB 5BRZA 3S35L 1YQVL 4JKLA 1KPRB 4J1UA 3FZUC 5CSBA 4UMGA 5HHXL 4RMVA 5ALCL 4PG9A 4WUKH 1JRHL 3V2AR 4D8PA 5D93C 2C3WA 4O5LH 1A1MB 3SE9H 3FO0L 3TO2A 5BS0D 2ZUSA 4HLZH 3CDGA 5L9DL 1P9MC 1NDMA 4K9EL 1OTTC 4KK6D 3D25B 4KGJA 1CL7H 3H0TA 3DO7A 3LRGA 1ZLVH 1Q9LB 3VGAB 3OKNB 3FMGH 4N0RA 4FQLL 2X70A 4OM0H 1U58A 3QAZC 3ULVH 5L8LB 5ICZA 1QHOA 4UQ3B 4MA3A 4HPYL 4JHAH 4P4RA 4P9MH 5DK0A 3PIQB 3RJQB 4GMSL 2DQCL 4AH2B 1BECA 5SWQA 4OCNC 2NX5D 2NXYC 4HS8L 3V0VB 1CLYL 2D31A 2A83B 3O4LE 4FMKA 1IKFL 5HBBA 4RRPA 2VXSH 3U7YH 2BXZA 2P24B 5F96H 3WFCL 4W6WB 1OW0A 4RCAA 5EBWA 4JR9H 1Z6JT 3QPQD 1RUML 4ENED 4AL8H 1PYWA 5KVDH 5ID1A 5IQ9A 3AROA 1YEJH 4JZOB 2CJUL 4N90D 4ZAKB 5AYUL 2K3TA 3ZTJH 5E6ID 3K8LA 5EZJA 3VWJB 3O6KL 1KCUH 2JIXD 4M6NL 3BSZL 4JB9H 5GHWH 3RWGA 4ONHB 1X5LA 3C5ZA 4GUPA 5JHLH 3VE0A 3DETD 2NY2D 5JW5B 4F80A 2F8OA 3CX5K 5DURB 1B9ZA 1YMMB 2DICA 4H20L 2VZ3A 2P48B 3RDTD 2WWMD 5JXED 3BIKB 1S9XB 3LN4A 1VFOA 3ARSA 2VLRD 4AEHH 2NCMA 1ZLWK 4I1NB 4J3SA 5I19L 2ZG1A 5IESH 4XVJL 2R23B 4L8DA 1VCAA 4L3EA 4WUUA 4FNLL 4ZFGL 5F9DC 3ILQC 4LAQH 1PGRB 3L3HB 3C09C 3U7WH 5GS2H 3LN9A 4WGVB 2HJKA 2AVGA 3U1SH 1SM3L 1NSNL 3GJFB 4Y8AA 2C4XA 1BJ1H 1QFHA 4KZEL 3ARGA 5HDBE 3AFLA 5D6DA 3QUXC 1QRKA 2NYYC 1I1FB 2Q76A 1HZHL 3P0VL 3HPLB 4ODTL 4LLVA 1V3MA 5C8JA 2XPGB 4W70A 3SDYH 2J8HA 4IRSA 2BRQA 4HK3J 1FV1B 3B5GA 5DD6A 3OF6A 4H1LH 3ULSB 4UIMB 4NNPH 4CGTA 1ZLSH 4MJ6B 1U8PA 1ONQA 4KI5E 4JGMA 4XH2A 1F3DJ 3EYSH 1AY1H 1TJGH 4JFDE 5BV7B 3W11C 3GMPB 3CLFL 3HE7B 3P9MB 4ISVA 5IMKA 1MRDL 5CSGA 4K3DH 4H0HB 1K2DA 5DGQA 4KRPD 4LSQH 4FTVB 3PV6A 3ARBC 3MRNB 5E2TL 2RHEA 1CF8H 2FGWL 4PUBH 2H32H 1KEGL 3VW3L 4JANA 3P9LB 3ES6A 5TPWL 1CBVL 4ZFFB 5HYIA 5CGMA 3OGCA 4M93B 4XPGL 3VRLF 4XCFL 1CXKA 3EDKA 3GSQA 3FQTB 4F3FB 1LEKA 2PW2B 5SV3A 5C0DB 2UUDH 3FO2A 2XXMB 2XZZA 3QHTC 1NCNA 1FL3A 1Q9KA 2GSGA 4HFWB 4JEGB 4MD4B 2FBJL 3MLXH 1XIWD 2QQNL 4N0FB 4X7SL 5GSRB 3HG1E 3MLWH 4NYLA 3OKDA 4W6XB 1F2XK 2ERJB 1MPAH 1AKJD 2DM3A 1JHLL 1JFQH 1I3GH 1JYWA 1RU9L 3JTSB 1QQDB 5GQBA 3ARZA 3HLAB 2PXYB 2YEZB 3N1QC 1HHKA 3FTGB 4OD3L 1RHHB 3T8XB 4FZEL 5HYSG 3D9AL 3PQYD 1X9QA 4ZXBD 3VXMA 1CS6A 4N1CA 4RGNE 3LEXB 3PJSB 4P2QD 4D9RE 4MMZC 5ID0A 4XVTL 3DJ9A 3TA3C 4Q9QL 3QHZL 3G6DH 5FYJU 4IEFB 1IAIH 4MQSB 4OLXL 4ZTPH 1HILA 1A14H 3VMOA 4HGMA 5D8JH 3U6RB 1LDSA 3MA7B 5IFHL 4U6HB 3BO8B 2R9HD 5LWYL 1W72A 4LDLB 5HHPB 2OLDA 1IC4L 2W1NA 3B6SB 2HJLB 3BJLA 4YHNB 4Z78A 1QKZH 3CFIC 4YC2C 1WZMA 4YDIH 5JQ6L 5E99L 3ROOB 3V79C 1I7RA 1A7OL 1DTUA 2P7TA 3TN0B 5B4MC 2D7QA 3HAEH 1GC1C 3C60C 3ESVF 3D3VA 1OAYH 3B5HA 4S10A 1S7WA 4C4KT 2BVTA 1P69B 5D7KE 5TFSL 2YPKA 3FRUA 1HSBB 1AR2A 4K3GA 1AGBA 4TVPD 5HYJE 1AXSA 3QIBC 1TZIA 2PKDA 5IJVA 1P7QD 1F6FB 1L9MA 2CLVB 1CTNA 5T1MA 4C58B 3LH2H 12E8H 1A6WH 2OL3L 3EOTH 1T0NA 2BCKB 4NO5B 2AQ2A 1W8NA 2VR5A 1DE4B 4WNQA 3QG7L 2IBGA 1N64H 4Q9CA 1EHNA 3IRZA 1KB5L 4JN1L 3RWFB 3T3MF 1JMZA 4HKXB 3VGBA 1T1ZA 3IDXL 4WW1B 5ISZB 4M03A 3RGVD 1U8NB 5GGRA 4B7LA 4GRWF 3RI5K 4OLZH 4KK9D 3LKQB 2VL4A 2GITA 3TBWB 1P1ZB 5CP3H 4XGZA 4FQ1L 1FGNL 3NFPB 2ZCHL 4I18B 3MJ7A 2VXUH 4L8BA 3QO0B 3B3IA 4M4RA 4H1LB 5D7JC 4ZFZA 4OCYL 4UOW1 4OCRL 3EFFA 4JO3L 3U4BL 4F9LC 4NJ9H 3SDDB 2H9GB 1MF2L 3AXLB 1UM6H 4UQ2B 3P9WB 4QHKJ 4OM1L 2GUOB 3TJEL 3TM6A 1INEH 1QD0A 4F7TA 5CJBA 5FA4A 2AJUH 4FN0A 4XAWH 4XNXL 2DWEB 4IIQB 3PWPD 4OQTH 3E2HB 4L8SB 4M7LH 4QRPD 1A9EB 2V6HA 2X4NB 4DN3L 4LCIL 5FYLD 3V52H 3QEQB 1SY6L 2UUDK 4JFYB 4ZUSB 4F58H 1OD9A 4X4ME 3VFSA 2AGJH 4M9OA 4UT6H 2H32B 3BP4A 4U6YA 5HY9B 4K07A 3BKMH 5F7HA 3I9GH 3O3AB 3OZ9L 2WLZA 4FABH 2Z4QA 2GY5A 2W9EL 4PYGA 3OL2A 3VFWA 5F7EH 3KPRB 3X14B 1VADB 1Z9OA 5D7IA 1QR1B 5FUOH 5E56A 3OXSA 5E5RB 4P2OC 3V5KB 4S1DC 1UWGH 3JBG7 2A74A 2YD8A 5CZXC 5E8EB 1D5XA 5FDYA 4JFFE 4NUJA 2PTTB 4K7PY 1D9KC 2GJZB 4P23D 5LQBL 1WWCA 1P84K 1WBZA 3OKYA 1MCPH 1YEEH 4PJDA 1GHFH 3PL6C 4M7KL 5E94B 1DEEA 1RZKH 3SCMD 3FFCD 4M61B 3ECBA 1HKLL 1R5VB 2EEDA 2J8UF 4O2CB 5DHVA 5L7XL 4GQ9L 4G9DA 2GKIA 2ICWJ 1ZT7A 3KYNA 3SY0A 3NAAL 1NMCC 2YD1A 5KANG 1QUNA 3VXSD 1CK0L 2IF7A 3QA3A 5DO2D 3TJHD 2PTUA 2ITCA 5IQ7H 3WS3A 1F11B 4P9HL 5DSCA 2VDNH 4LGSB 1QBBA 1XEDA 4XPAL 4L29B 5E8DH 2WP3T 2P5EE 2OCFD 3HR5A 5DRZA 1G9ML 1T04B 2Z0BA 3P0YH 4Z7UB 4FXGB 1U6AH 4WFFD 3U9PH 1A02N 2CH8A 1S8DB 4LBEB 2BY2A 1U8IA 3VDBA 1AFVL 3LS4H 3HAEB 1ACYL 3PWUA 5CIPH 4JDTH 3UC0L 4AM0B 2LV4A 4K71C 5J4MA 3KPSB 2R2EB 2R1YB 4L9LB 1DN2A 5L2JB 3L3OA 4O2FA 3IS1X 1DANU 2DQIL 4GG6F 3VXNA 3X13B 3FFDB 3WN5C 1IZJA 4TULL 4X7FC 3AS1A 2AQ1A 5H37H 3TT3L 1NBVL 2IAMA 4Q9BA 4BZ1H 4PJBA 5AEAA 1YJDH 1JGVH 2EEBA 3RUGA 1JCKA 5MERB 1IILE 5BO1L 4ZNEA 3RVTD 1UEYA 4RAVB 2EE9A 2ILLA 3MOQA 4M5YL 4CVUA 4LU5H 1FNSL 3EYVA 3P4OA 2E6QA 2EIDA 1QFOA 5JA9A 4JFHE 4JQXC 3G5VA 3LQAC 5J1TC 2Z35A 3D18B 4NNYA 3TBYB 5CJQH 1EHAA 3RIAK 3GMOA 5CUSL 4I3RH 4I3SH 1LP9B 3D87B 4N8PA 4L4JA 4NFCA 5F6HI 4NHUB 3JSSA 3FOMB 5K9KA 5HGAA 4N1EA 5C0BB 2N7AA 3O81A 4K23H 4BQ9A 2J8OA 5HGHA 1N7ML 1OQOA 4PGDA 4DVRL 1TJGL 3RL2B 1JWSB 3P77A 3LKPB 2CRYA 5FV2A 3KPMA 4OZGB 3BPOB 1FVDA 3FB5B 4JLRB 4PJ9A 5HD8C 3UTSA 4PRHA 4ELKA 2QHRH 5CMAB 3MOAH 4EI5A 3VXRD 3BKJL 2D9CA 3EJJX 5LXGL 1JWUB 5SWZA 4S0SD 1SBSL 1KXQE 1P2CB 3UYRL 3JUZA 1IAOB 5IW1B 2R15A 2W9DH 1G7HA 3L5HA 2CDGB 5D7SH 3Q2CA 3VWKD 1H3TA 1RUAH 3W9DB 2C1PB 4HWNA 4KRMB 3MFGB 3TO4C 3VRIA 1MI5A 4EXPX 5F1KC 2EH7H 4DQOH 1E4KC 2YA2A 4W68A 3MLWL 1MAML 5IB2B 4X98B 1JPSH 2Y9RT 5D6CA 3TF7C 5C0GA 5GISH 3MACH 6CGTA 3EYUL 1NAML 4Y16B 3ILPA 4LHUA 3B9EA 4NOBA 1TVHB 4WFGE 1C08B 3Q5YA 2Y6SD 4NM4H 4YFLI 4HH9B 1CDBA 4XXDA 4NUGH 1MREH 3S4SA 2Y23A 3IDIA 3WCYA 1EJOL 1DBBL 1ZANL 4TUOA 4P46A 4G9FB 2UZIL 1P4BH 3VA2C 1QVOA 1DUYB 3C9NB 5DEGB 3P4NB 1BD2E 4JRXB 4RDQF 4PJ7B 2CDEA 1JNHA 1OAUL 5EUOF 3UTTA 3T3ME 1GZQA 1Z5LA 1JPGA 3L5XH 1IJ9A 4P2CG 4EN3B 1WICA 4QOKB 2WINA 5TDNA 3WUWA 4GRWE 4IMKC 4E41B 5BVJA 4P2RA 3J7HA 4QRQB 1WWWX 4P3DB 5I8KL 4NZTH 2Q86B 4NQVA 5J1AB 1NGPH 1QACA 1J8HE 2PCPA 5CIPB 1INQA 2DOCA 4FQHA 1AHWC 4NWUL 4ZAKD 3MRPA 4LNVA 3HNTL 1YNTB 1QSEE 4KHXL 4D9LH 2DMCA 1T22A 2ZOKB 3E3QC 5T3XH 3V4PH 3F7RA 2MQ0A 4PJHA 5MENA 4CDGC 2P8PB 4KQ4L 4LPUA 4JRYA 3BAEH 4F57H 1A6AB 5F9AC 4NFDA 4Q6IC 2JK5A 5FB8B 2MFNA 3V7AG 5ITBL 3DX8B 1NFDE 4QTHA 3BUYA 4M3KB 1A6UH 2FJGB 5F7NC 5JIKA 3RVXC 3ARYA 5CBEA 5TQ0L 4ZO9A 2FB4H 4D0DB 3BPLB 2DKMA 1NANI 2HT4D 1U42A 2EDKA 2I07A 3X12A 2H8PA 3T2OA 3CXHJ 3HC4H 2PYEA 3C6LC 4MDIA 4NQEA 4XB7A 4FQIH 1A47A 1R5WA 5EBGA 4ALAH 4WTWA 4DEPC 3MBEA 4V1DB 4HIJB 1UJ3C 1U8OA 4G7VH 1GGCH 4PRDB 2D4DA 3QZWA 4QHUA 5I8EB 4HT1H 3P2TA 2PR4L 4J3VA 3D0VA 3GNML 5BRZB 1S9YA 2X4OA 2YC1A 3MUZ1 4OF5A 4J1UB 3LDBB 2XXCB 1MFDL 5DUMH 3NGBC 5TDOA 3U30C 2XT1B 4Y5VA 3MO1A 4PG9B 3SGEI 2OS7A 1INEL 4D8PB 3QR2A 4W6YB 4KROB 1S78D 4PB9L 1JNLH 2AEIT 2OQJA 2DWDA 1UKQA 2JF1A 4XHJC 3I6LD 3HE7D 1C5BH 3CDGB 1NDMB 1RUPH 1TCMA 4KZDH 3VRJA 2Q1EA 1DDHA 3V5HA 5D2LB 4FTVD 1RZGA 4UAOB 2A6IA 3P11H 3ARFA 3QEGH 3H0TB 3DO7B 2A6KA 4WV1C 4BKLA 1FC2D 1W0YT 2BVQA 4MHHI 1MCWW 5HHOE 5IBLD 1DFBL 2X70B 1U58B 4K3EH 1FFNA 4MHHG 2EDRA 3CDFA 3KPTA 3IDGA 1WZ1L 2CQVA 2Z31A 3BDYL 5ICZB 1KG0A 4MA3B 4OIIL 5DK0B 3CMOL 4A6YL 5SWQB 2KKQA 4JM4L 2VC2H 3VFUA 4PJIA 4HUMB 2D31B 4N8CL 4YHOL 4GG6E 4HW6A 5I18H 4HEME 5EBWB 2NY1B 3DHMA 2AXJA 4APQA 3PGFL 4RA0C 1CZ8H 1W72H 1PYWB 3W5MA 2C7UA 2ZNWA 5ID1B 5IQ9B 4K55A 3UAJC 4Y2DA 1U9KA 2A1WH 3BT2L 3JUYA 3WEXA 1N0XL 5EZJB 3SGJA 4EJ1C 3RWGB 4R6UA 1RMFL 5BS0E 3BZFB 3C5ZB 4GUPB 3FN3A 3QISA 2NY5L 2HTKD 2CGRL 2VE6A 3HI1A 1A3LH 2Y06L 2SEBA 2F8XC 3LN4B 1NMAL 3CU1A 2HH0H 1K3IA 1DLHA 9CGTA 3MRJA 4XX1G 3WJLA 5T1KA 5JW4Q 1HWHB 4L3EB 1NC2B 1CFSA 3BIBX 4HGWA 3PE9A 4YHLL 4YXHL 5CGTA 2EC8A 3QCTL 2NX5E 3NA9H 3AU1A 2VDMH 4H0IA 2HJKB 2X1XR 4H88L 4PB0H 1YY9D 3T3PF 4O4YH 3ARGB 2DQDL 4O02H 4FQXB 5F7DA 2Q76B 5LAXA 3W81A 3O6MH 5EU7C 3GSVA 4N90E 4K8RH 4LLVB 3S34L 5C8JB 3LRHA 2FIKA 4GAJH 4IRSB 3UTOA 3O4LA 4FOMA 5DD6B 1OT1A 5T1LA 4ZDHB 4FXKA 1IM3A 1OY3B 1J8KA 1F4WH 2D0FA 4ODWA 4FZ8L 3CUPA 1ONQB 5GS2D 4XH2B 3MV8A 4QT5A 2VMFA 1N5YL 4KQ3L 3D39D 4P5TA 5ISZD 5IUSA 2D7PA 4ISVB 5IMKB 4DW2L 3BE1L 4X8XA 2VLRE 3ARDA 4XCCL 1K2DB 1NCBH 4Z0XA 1MY5A 3QP3A 4UILL 4BZ2L 1KTKE 3PV6B 1T1YA 2YZ8A 4N1HB 3WLWD 1MWAA 4JANB 3ES6B 2G60L 3MLUL 3OGCB 5AZEH 3VD9A 4QWWC 3GSQB 4HK0A 2ICWA 1PLGH 3QXTA 3FO2B 5ERWA 1FL3B 1FRGL 1Q9KB 2GSGB 1R3HA 4LDOB 4YXKH 4FQJH 3F7VA 4G6KL 5EUOE 3SOBL 4NYLB 2B0SH 3OKDB 4HGKC 4PJAF 5ADOH 3WD5L 3SHSA 4PJ5D 3DXAD 2HG5A 3V6OE 1A6ZB 1HHKB 4OZHE 1X5JA 2BERA 3M8OL 1J0IA 2YUVA 1FH5L 4M7ZB 4ENEC 4OIAA 3VXMB 4GXUM 1V8HA 5DHVH 3KPRD 3EGSA 5ID0B 1FAKT 2QQLH 1GCFA 5E6IC 2CMRH 4NN5C 1AO7D 1CICA 3BX7C 5I1GH 1HILB 1L4IA 2E8YA 4EI6B 3T65A 3WIHA 2NY2C 1T2QL 1UH4A 2VDKH 4ODXA 3JV0A 3ZKMD 4YHKL 4OLEA 3MRMA 4Z7QE 1D7FA 1W72B 8FABA 4JFDA 4WEMB 4DUVA 3NTCL 1WTLA 4Z78B 5GGVL 2OXGA 2C3GA 3NZ8A 3IAGC 3BPCA 2J12B 1I7RB 1RJZA 1SQ2N 2HTLC 3N1MC 5KSAD 3DHJA 3A6BL 1T5WA 2DKUA 4BYHA 5J57B 4ZUUA 3D3VB 4XP4L 3ULUC 1S7WB 2RCSH 4LCWD 1OM3L 4XPFL 4Y5YC 5EA0H 1KSRA 2YPKB 3FRUB 3TCLB 4X6FA 3HUJA 4QRSA 3B9AA 1AGBB 1AXSB 1TZIB 5IJVB 4LSUH 1CGWA 4OD2A 3TESA 5IBTL 4E9LA 5T1MB 1FG9C 3PQYE 1T0NB 4OF7A 4RMWA 5JUEL 1JVKA 4Y0GA 4P2QE 1MJJA 4OF8A 4WNQB 3W5NA 2BY1A 4EDXA 4LK4A 5DQ9A 1AP2A 1T1ZB 3IFLL 1ADQL 3WKMH 3KPSD 4X6BA 5IOPA 2V2WA 4JM2F 1K4CA 5GGRB 5GRYA 1MHCA 1LO5A 3I75A 2VLMD 5EUKA 1CLOH 1KCKA 2GITB 1TJIL 2VZSA 2HKFL 1H3PL 4XGZB 1AQKL 3SDXF 1NGQL 1T5XA 5DQJA 3MJ7B 2XZCL 4L8BB 4PJEF 3BKYH 3B3IB 3DYPA 5D1QD 4ZFZB 3EFFB 3RY4A 1AH1A 2FLBT 5BJTA 1UA6H 3IDMA 1XZ0A 1V05A 1KYOJ 3BP7A 5T1DH 1EO8L 4F7TB 5T3ZH 4TVPE 5FA4B 3UBXI 2UYLA 4GRMA 1J87A 1AGEA 4EDWL 4XRCA 1J1PL 5IR1A 3UBXG 2MJWA 1NQBA 3QEUA 4JY6A 2JB6A 2OXHA 2CLRA 3HZVA 3VFVA 1IC7H 2R39A 1L7IL 4QGYA 4NM8L 3VFSB 3QUZC 5F71A 3BP4B 4U6YB 4NHCL 1I85C 4JG0L 4PLKD 5GZND 5HYJA 2Z4QB 1OQXA 3VFWB 2YPLD 4OBRA 5DT1L 5I1IH 1OF2A 5D7IB 4LLMA 5HHMB 3ARRA 3OXSB 4KRNA 3DSFL 3RBSA 3U0WL 2A74B 3BN3B 4ODUA 3RGHA 1D5XB 2D7NA 5DZNA 2OZ4A 2NZ9C 4WHTA 5HI3D 1F8TH 3TEUA 4DGVL 4WW2F 1WBZB 4J2XA 4PJDB 1VGKA 1FG2A 1S9VA 3DX9B 4ZOCA 4X9FA 3O41A 4I0KA 1NCTA 1FIEA 3WNOA 4MZ2A 3SGKC 1F13A 3BMVA 3SPVA 2R9HC 3ECBB 1QA9A 1NKOA 3BYTA 1IGML 3A6OA 1YYLL 5DHVB 2KDGA 5CKAA 4Y5XB 2XQYK 2A73A 2IPKA 3GB7A 3PWPE 4G9DB 3IU4H 3VG9C 1DR9A 1CT8B 4QRPE 1ZT7B 3KYNB 4LSTH 3SY0B 1B3JA 5FYLE 3FRPA 3OMZA 1KULA 1TETH 5DJAA 3MRHB 3QA3B 5FV1L 3WO4C 5GZOC 1JZ4A 3WS3B 5I18L 5DSCB 1DSFH 4HAGA 2UVFA 3PWJB 3O3BA 5AZ2H 4Y16D 3HR5B 2YSSA 2WM0A 4M1CD 5I75B 4KGLA 1CD1A 2X9WA 4NN7C 4LVNB 1U8IB 1O0VA 1NCCH 1CE6A 3MLRH 3PWUB 1YEIL 4KMTH 4GRLA 2YA0A 2BP3A 2A0LC 1BREA 3WLBA 1WFUA 1VFAA 2W65A 4XWGH 4IRZL 3L3OB 4MCYA 4O2FB 2DQJL 3VXNB 4LMQI 4Z6AT 2N1KA 5FYKU 1OCWH 4X5WA 2MQ3A 4YHZL 4YIQA 2IAMB 4MAUH 4QOKD 4PJBB 2YD4A 3TVMD 4Z7VF 5EZIL 5T33L 3VCLA 3RUGB 1FDLH 3SKNA 1R3LA 3ALPA 2AJYH 4HQQL 2FATL 3LKOA 3W9EB 1QBMH 2R8SH 3IDYB 2VLJB 2XTJB 1IAIM 3EYVB 3P4OB 2VH5H 3HI6L 3VXSE 4U1GB 1H0DA 1P4IL 3IFOA 3JWDC 3G5VB 4XMPL 1IGJA 2Z35B 4NNYB 3OR6A 3GMOB 2F74A 3GBML 5T5FL 1TVBA 1UWXH 3ZYZA 2AABH 1U93A 3O9WC 5ITFB 4NC0B 1IARB 5K9KB 3MLSH 2RBLA 5HGAB 4DN4H 4PJAE 4FQCL 1IKNA 1P6AB 4LRIA 3EJZD 2IH1A 1OP5H 4Y4HA 4MWFA 5HGHB 5J13B 5I9QB 4X5LA 4PGDB 2HFEA 4UU9A 4R2GD 2P5EA 3Q5TA 2V9TA 3NA4A 5FCSH 3KPMB 2XICA 5CP7A 5CZKA 4GMTL 4CADA 4XBEH 4PJ9B 1EXUA 3UTSB 4V1DD 1LO0H 1G6RA 2F8VA 2R56L 4G6FD 1X6LA 3RKDD 5M7QA 1LMKA 1HE7A 2AJXH 3AREA 2A38A 4JO4H 5IB5A 1C12A 4P23C 5SWZB 5E2JA 4RQQA 4BZYA 3QFJE 3IYLW 3ORJA 1OPGL 2AJVH 1GAFH 1G7HB 1QFPA 1SHMA 4X80L 5J7CC 3JV6A 5A2JH 4R4FH 3QPXH 2YRZA 3BH9A 1U3JA 4LRNL 3VRIB 1MI5B 3QIUD 4IMLA 5DFWH 1V3KA 1M4KA 4LARH 5KS9F 4NQXA 5D6CB 5C0GB 5B21A 4Z0BL 1VERA 2I5YH 3ILPB 1N8ZA 1E6OH 4IRJC 5E00A 5DO2C 4LHUB 3CFDA 3O3EB 1S5IH 4HUVA 1MHEA 3R0NA 4XXDB 3S4SB 1A3RL 3IDIB 2IG2L 3D85D 5F7YC 3HE6D 4L3CA 4OCMC 1ZHNB 4TUOB 4P46B 4RAHA 5B3JF 2ICCA 4PJ8D 5I0DA 5FUCE 4YK4B 1YN7A 5TE6L 2CDEB 1JNHB 3VXRE 3UTTB 4OT1H 1GZQB 2QR0A 1Z5LB 3DYOA 1JPGB 5CBAA 1LDPH 2ARWA 3OPZH 4P5KA 3PP4L 3DIFA 2O5ZL 3LPWA 3DVNA 3WUWB 1AD0A 3IAQA 5DJ0A 5BVJB 1F6AA 2VDQH 4UIKL 1EJ6A 1NBQA 3MRFA 2OR8A 4Z9KB 3SDXE 4O58H 4OZFA 5GGTL 1C5CH 2PCPB 1INQB 4FQHB 1WAAF 3MRPB 4YFLF 3PNWA 3CXDL 2FD6L 1F58H 1OSPL 1T22B 3O0RH 2Y1VA 3C5ZD 2CKBL 4PP1D 2H41A 3V0AC 5GS0C 4YHYB 4HIXL 4PJHB 4RIRA 5MENB 4WO4D 2XIDA 4JRYB 3S36L 4M7LT 5IROC 2HFGL 2JK5B 4XPHL 3MODH 4NKIL 4BSWA 2D7TL 3BUYB 4QTHB 3IGAA 4G80A 3DMMA 1R3JB 4XC3L 5CBEB 1UWXK 4KY1H 1VPOL 2QSCH 1Q1JH 2I07B 3BJ91 4P4KC 2H8PB 4L3ED 3X12B 1ODAA 1NC2D 4LDEB 2FIRT 3KPLA 2PYEB 4WWKA 4MQXD 5T3XD 4C4KO 4NQEB 1R5WB 1Q0XL 3MBEB 1TJHH 1U8OB 1I1YA 3L5WB 3QZWB 4QHUB 4KJWD 1SJHA 1HHIA 4JY4A 1JZ8A 1U3HA 3HCVA 4TUJA 5I6XB 1HXYB 4FQXD 3D0VB 1S9YB 2X4OB 2GI7A 2YC1B 3GSNA 4R26L 5LKNA 3I84A 2Y5TA 2FECL 2ZUTA 5TDOB 1MWAH 1YC8A 4JFZH 2G2RA 3IU3A 4Y5VB 5EG6C 2FSEA 1FLRL 2MSPA 4ONFH 1EX0A 3FQWA 5ANME 3DO3A 5F1SA 2OQJB 4LPWA 4OCSL 1LK3L 2DWDB 3BKCL 4BK5A 1J8HA 5D71L 4JFED 2EDEA 4WTXA 4N0CC 3QYCA 4ZFOL 3VRJB 1DDHB 3V5HB 5C0FA 1RZGB 2A6IB 4KJQC 3ARFB 2A6KB 4BKLB 4JVWA 2DD8H 1R3IH 1IC5L 2BVQB 4K94C 4HCRA 3MGOA 1GGIH 4PG2C 3VXTA 3ZE2E 2EIBA 1FFNB 2ZSWB 1YN6B 1YNKH 4BFIA 3IDGB 1DBAL 2Z31B 2MTPA 3VGAC 1KG0B 4WTZG 1CFVH 3SGDI 3SDCD 4QXTA 3O8XA 1GH7A 4HH8A 2R2HA 3VFUB 4PJIB 5C07D 3GHEL 4OV6F 5GGQH 2RB8A 2AJSH 3WIHH 4HXBL 4MS8D 4APQB 1J86A 1BBDH 3FT3A 3KWWA 2A6DA 4GAYA 5CFHA 2C7UB 4JHWL 4Z7VE 4Y2DB 2MKLC 1PW3A 3WEXB 3IU4L 4QXUL 1T03L 1MVFA 1MHPH 3C87A 3I6LE 5DQDL 1U8HB 4ZAKC 1U2HA 2FECI 2VE6B 3VWJC 4FTVE 2OI9B 1T66D 5I1KH 3GI9H 2SEBB 1K6QL 1Y18B 2F58L 2J8UA 4KU1A 3MCG1 3BGMA 1DLHB 3MRJB 1ORSA 2Z9TA 3L95A 4XP6L 1G9NH 2A2QT 1MCQA 1H3UA 3DRTA 2BOCA 3N9GH 5EWIH 1CFSB 4YXLH 3O6FD 4HGWB 35C8L 4JAMB 2Y72A 3CH1A 3VXPA 1HIML 2J6EA 1GL4B 3AU1B 5IWLA 2WUBL 1A4KA 3OKLA 2B5IB 1TTFA 1YYML 2ZOLA 2DQUH 5IG7A 1HQ4A 4MX7A 1OOAA 2WP3O 5F7DB 5LAXB 1A7BA 4G7YL 3GSVB 1A7RL 2HJFA 3NABL 1DUZA 1B4JH 4UTAH 2ZCKL 4PJGF 1Z9LA 3O4LB 1U8KA 4OZGF 5IW6B 2BOBA 3OKKA 5T1LB 4GG6A 4FXKB 3ZSTA 1IM3B 2OR9H 4GS7B 3GBNL 5AAWA 4IDJH 1U41A 3CUPB 1YNLL 4J8RA 1I9RH 3MV8B 4QT5B 3UJIH 4P5TB 1YEGL 3MLYH 2D03L 3S88L 3CVHA 1WFOA 3ARDB 4Z0XB 4BH7A 1I8IA 2B1HH 5KS9E 1A7NH 4CN1A 1EHLL 5BV7C 4TUKL 1T1YB 2VQTA 3GSXA 3HE7C 3HKFA 1UM5L 4RFOH 1MNUL 2ZCLL 1MWAB 5KVGH 1XGTA 5HGBA 2R4SH 3CMGA 4LOUC 3OJVC 4JDVA 1IQWL 2WQRA 5IF0A 4PR5A 4PRPD 4HLZG 1IBGH 1ITCA 2PO6C 4U3XA 5IBLC 4HK0B 3PUCA 2ICWB 4XI5D 3T4AB 2AEWA 3TH4T 3WFHA 5ERWB 5LCVH 5DTFA 2QQKL 1L7TH 2DB8A 3NCYP 1R3HB 4M93C 4Q0XL 2YKLH 3F7VB 1A9BA 2OZ4H 5A40E 4ORZC 1XR9A 3QUML 1JV5A 3BP5A 1K5NA 2Y7QA 2NX5A 2EH8L 1I9JL 1T6VN 2WIIA 3L7EA 5C0NC 2HG5B 2J1KA 32C2B 2R4RH 4GFTB 1VSCA 2ERJC 2EIZA 5FHBL 4HMEA 3ZE1F 1JGLH 1LEIA 2PXYC 5ISZE 1MJ8H 1RIUL 3QWRD 3EGSB 1WAAE 1REIA 3DI2B 5IT2L 5E9DD 3ULVC 1MJUL 1CICB 1YEKH 1UH3A 2YD9A 4ESKA 1DQML 1N0LA 1I75A 3UPCA 3T65B 5AWNH 4Y4FD 4ODXB 3OAYH 1TITA 4C59B 3ZTJG 2DLHA 3MRMB 1KENL 3MRIB 3BHBA 4JFDB 3RDTA 8FABB 3SE3C 4IOFD 5JXEA 1B4RA 1OARH 2Q7NA 4HWBA 2KL6A 1CYGA 3NZ8B 2PF6A 2VLRA 2Z91A 3B2VH 3UTPD 4WI6A 3BPCB 4DK3A 1OAXL 1RJZB 1RURH 1CFQA 5CCKH 3OBAA 3CCHA 3TYGL 1T5WB 1EERB 4OGYH 5JIHA 4ZUUB 2JJVA 1P5VA 1RZ8A 4X6FB 2EDXA 4KK5D 4TNWF 3TN0C 3HUJB 4QRSB 3B8YA 2BDNH 1B6DA 2DBLH 3DXAE 4OD2B 2N56A 4TRPH 2ARJQ 3EO0A 4OFKA 1VDGA 2B4CL 4DKDC 4YBLB 1YY9C 2XZAL 3KJ4B 2APWA 1ZEAH 1J5OL 3RWHA 1MJJB 5EUOA 3KPRE 3FB7B 2GYSA 3U2SA 4EDXB 3V0WL 4R90L 4PLNC 4M6OH 1KIUA 3FQUA 4Z8FL 5DQ9B 1AP2B 3V6OA 3RIFF 3QDJD 4AMKH 3MNWA 4XCEA 2IQ9H 5IOPB 2V2WB 4HXAL 1MHCB 1LO5B 3I75B 5EUKB 3D2UA 5HGDA 4H1LG 4RGNB 1Q9OA 4M3JA 4KJYA 3CDYA 4HBCL 3P4LA 1T5XB 4KVNH 3TFKD 1MH5A 5DQJB 1G6VK 2QJDA 4FQ2L 3QIWD 4JHBA 3B5TA 1O7SA 1GOHA 1Q1JL 2P5WB 1IVLA 1U95A 1E4JA 1UC6A 4I18C 5BJTB 5IHUL 5EO9A 4LCWE 3IDMB 1XZ0B 2VLJD 3BP7B 2ZJSL 3MBXL 1Q9WA 1EEZA 1RUQL 3PP3H 3EHBD 4XNZB 1KEML 2UYLB 3CLEL 4GRMB 1AGEB 5D2LF 3SDDC 2J5LB 4KDTA 3TZVD 1JPFA 4XRCB 3QEUB 4JY6B 4AT6A 2JB6B 3VFVB 2CLRB 4ZTOH 1G6RH 1RULL 4RWYH 5KSVA 5LVEA 1XIWA 4IIQC 1WCQA 2XA8L 2H2PD 1BM3L 3E2HC 4L8SC 1OTUC 2NTSP 3LAFA 5GGRY 3O2VH 4YQXL 1BWMA 2H45A 5HYJB 1AKJA 3T0BA 2CK0L 3DGCR 4DGYH 1C1EL 5I16A 5DMGD 2C4FU 2E9WA 5CINH 3KPSE 3S96A 4RFNC 1CFNA 1OF2B 4LLMB 1JJUA 2QSVA 5T3ZD 2VDRL 3FQRA 2VLME 3PQYA 4HEPG 4KVCH 4Z95H 4ODUB 4ZXBA 3KR3H 4P2QA 1DVFD 4WHTB 4XVSL 3UTSD 2GQHA 1PG7X 3TC9A 5D96B 1VGKB 1FG2B 1S9VB 3FAXA 4G6AC 1RZFH 1T2JA 3O41B 5SWZD 1I8LA 3WFEH 3VGFA 4JE4B 3FAWA 4I8DA 3SPVB 1W0VA 4L1DA 1QA9B 1DBJH 2ATKA 4KK8C 3IKKA 1BEYH 1FL6A 2A73B 2IPKB 3GB7B 5C7XL 1X5ZA 2EDFA 4LLYA 1NUGA 3CX2A 3H9SA 4TNVK 5IV2A 4MA8H 2VXVH 2YK1L 4TSBL 5DJAB 4ERSH 1MAJA 1UXWA 1LP9E 3B4NA 1UT9A 4EIGB 1QFWH 4PBVC 1HH9B 3UCRA 3GIZH 3S37L 3WXWH 1XCQA 2AW2A 3O3BB 1X5GA 4PRNA 5EU5A 3QDHA 3HAEG 3C8HA 4U6VH 4S1QL 3LPFA 4Z18A 1P7QA 1KJMA 5E08H 4Q6YA 3RHWF 4FFWD 2YPLE 2ZUVA 1CD1B 2AP2A 3GUTA 4O9HH 2UZYB 4OZFH 1F3RB 3C08H 1CE6B 4U1MA 3QUKB 3NFSH 3QHFL 4OZGE 1ULVA 1KN4L 4GRLB 3ZT7A 1WUNT 4DAGH 3WLBB 2I60L 2W65B 2Y07H 4DJMA 4MCYB 4HG4K 2KPNA 5F6HJ 1SMOA 1GOFA 2HP4A 4X5WB 4NZRL 1RFDH 4L9LC 3RGVA 5DK2A 3ZL4H 5A2FA 3SE4A 2PUQT 3ELAT 4GAFB 3VCLB 4NNXA 3SKNB 1R3LB 3WNPA 4U7SA 3O2WL 3RA7H 4LQFL 2R69L 1Q72H 2WIMA 1A5FL 3CVIL 3LKOB 4NQCD 1QYGH 1MCOH 1MFEL 1LO4H 4LP4A 2Q20A 2ZPKL 4X4XA 3ETBF 1EFQA 4GLRI 4F7CA 1H0DB 2PTVA 1CTOA 1NLDH 1SEBA 1FNGA 2F74B 3PP3K 1JTPA 2O5YL 1HXMA 5GRVK 2V17H 1TVBB 2CUIA 4WHYH 1KCVH 1NKRA 1WEJL 43C9A 1X5FA 1U93B 3VFGL 2VJXA 3MYJA 1C16A 4YUEH 5BMFH 2IH1B 2MPAL 3GSNH 5J1SC 4Y4HB 4MWFB 1UACL 5F7MC 3EO9H 1MCSA 3QEHA 2HFEB 4UU9B 4JRXE 4KTDL 2NR6C 2P5EB 4CU6A 5C2BH 2E7LA 2NY4D 4NQED 3ZE1E 1KJ3H 4CADB 2B1AH 3L7FA 1FHGA 3BPNB 4QOKE 4G6JH 3E1F1 4PLOB 1G6RB 2MCPH 1V3JA 3BPOC 2AJZA 5DYOB 1JWMA 1G9EA 1SBBA 1C12B 5HI3C 4RQQB 2VNCA 2WZPD 5FM4A 1WTGT 2CO6B 4I0CC 1JNNH 5CSZA 3ZMRA 2NXZB 4LFHG 4HCRH 3WFDL 2ZNXA 3SCMA 1KC5L 3FFCA 2L4OA 3JV6B 4POZC 4BSVA 5C71A 4HC1L 1UYWL 2F19L 3BH9B 1BLNA 1JPTH 4YFDB 1FPTL 1BBJB 5AG8A 4K2UL 2R0LL 2HT3C 4S1RL 4MNHA 2BNUA 4LSPL 1S7SA 1D6VL 25C8H 3I6KA 1F2QA 2X89A 4NQXB 3SKOB 5I15L 3PWLA 3VXSA 1CR9H 4YNYB 2OSLA 4NKOA 1N8ZB 1F90L 1GGBH 3CFDB 3GSOA 4ZD3L 3QQ9D 4PFEA 3BD5A 4HUVB 2NY6B 4JQVA 1D5IL 1MHEB 4KJPC 3JZ7A 1PY9A 1RZKC 4FFYH 4L3CB 2DTSA 1LQSR 4UBDC 4NBXB 5D72L 1YN7B 4V1DE 3KG5A 4PJAA 3NIDF 4FQQB 4BQBA 5C0EA 2QR0B 2ZKHL 1UENA 4OKVA 3WHE1 5CBAB 5IFAH 4P5KB 1T1WA 5BRZE 3DIFB 4NT6A 5MP6H 3DVNB 1AD0B 5DJ0B 1P7KA 1V7ML 2CXKA 15C8L 5DD1H 3RX5A 5A2LH 4YR6A 3G5YA 1F6AB 3EJYC 4K3HA 5TQ2L 2I9TA 5E2WL 1KF9B 4EN3C 1BHGA 3MRFB 4OZFB 1K3ZA 4CAGA 3PNWB 1V5JA 3QUYD 5A2KH 5EOQL 5H37G 4HJJH 1ZT1A 3H9ZA 2WV3A 4ONGH 2EDQA 2J6EH 4NCC1 1MY7A 1FFOA 2NTFA 4RIRB 4MA7H 4Q2ZA 4KFZC 5D2LE 4Y19A 1F4XH 5ACZA 3WIFB 5ICYA 5CJOH 2FX9H 4XP5H 3RZCD 4NBYB 1YMHA 4U0RB 3S3PA 4XXCA 4BSWB 1M71A 2C5DC 3IGAB 4G80B 3DMMB 3C5JB 3R1GH 1NCWL 4CJ1A 3B83A 5IEHA 1AGDA 3KPLB 4Z7NF 4WWKB 3B9KD 2W0KA 4WI7A 5HI5D 3QH3A 3BPLC 4UTBL 3Q1SL 2VUYA 4JKPL 1IGTA 1MFCH 1A0QH 1I1YB 3K7UA 3GHBH 5TE7L 2Q6WA 7FABH 1SJHB 1HHIB 3CVHH 4JY4B 1R0AL 1U3HB 3HCVB 4TUJB 1FCCA 4CMHB 3VXRA 2F5BL 5I2IB 4YE4L 3GSNB 3SBWA 3RKDC 2Y5TB 3P4MA 2BJMH 4DK6A 1HWGB 1XF2A 4WEBL 3T0ED 2G2RB 3IU3B 3OB0K 3STLA 5L6YL 4JM2A 4RMQA 2ADFL 3SKUD 4GRWB 3G6AA 5EORL 1RZ7L 2HWZL 2WBWB 1QRNB 3A6CH 3FQWB 3GO1H 3LDBC 3DX7A 1AXTL 2DQEH 3IFPA 3HFML 3VWKA 3MV8D 1KJ2L 3X11A 3MLVH 3SDXA 5GRWA 1HINH 5EZOL 3HNSH 1J8HB 1SJXA 4P5TD 4PJEA 3IDNA 5ALBL 3QRGL 1BP3B 1JHKH 4KROC 1BX2A 1FIGH 4O2EA 1MCBA 5C0FB 4G8GA 5CILH 5D70H 4N8VA 3OV6A 3KHOA 4L3EE 3Q48A 5DFVC 5EIVA 1PG7H 3MGOB 2P44B 4LKXA 4H8WH 4BH8B 4JZNA 4DKAA 5T3XE 3VXTB 5LJYH 4UAOC 4BFIB 1Q9LA 3K81A 1JGEA 2G9HB 4UDUA 1J12A 3B2UC 3SKMB 5TH2A 4BQCA 2DLGA 3HB3D 4RRPG 4HPOH 4WJ5A 2FHFA 4QXTB 1CDUA 4D0CA 1J0ZA 3WNLA 3O8XB 2R2HB 3CGTA 4HUKB 1QLRA 2E27L 1NEUA 4YBHA 1IGIH 3GSUA 3QRFM 4Y7MA 1I7UA 1HNFA 3MLZH 2ID5A 3FT3B 1N6QL 5BXFA 3KWWB 5F3HA 5CJXA 4GAYB 3U36A 3NCCB 4H0GA 3S5LA 2V5MA 5JPMA 1FSKB 4HWBH 1OW0C 4M62L 2EZ0D 1A7QH 2NY1C 3F65A 1ZVSA 3DUHA 4WY7H 2VR9A 5IK3A 4WW2A 2B7DT 3DTXA 4JFEE 2EDDA 4QRRD 2OTUA 5HDQH 2DTMH 4U2ZA 3OJMB 1FL5A 1WISA 4TSCH 1MVUA 1CICD 3T1WA 2VISA 3SJVD 3WXWL 3C5ZC 4K7FA 5J3HC 5ANMA 2J8UB 3LEVL 4XTRC 4JJ5A 2G5BA 4ZPVA 3BGMB 5IVZA 2AEQL 1ORSB 3L95B 3IAPA 1BFVL 3DRTB 2BOCB 2IH3A 1AR1D 5DFTA 1Q0YL 2DQHH 1PKQA 1S3KL 1XGYL 2OL3A 4JRWA 3CH1B 3ABZA 3VXPB 2JCCF 5DLMH 1IM9D 1HKFA 1A4KB 4CJ0A 3OKLB 1WT5A 4EZMA 1RPQA 2YN3A 4EVNA 3KJ6L 3OXRA 2ZOLB 1KB5A 4OCXH 4MCZA 2R1XB 3GI8L 1HQ4B 4MX7B 5IG7B 3UP1A 2W0FA 2VQ1A 4LSSL 5GXBB 4RMTA 3UDWA 4XPTL 1VACA 1NEZA 2HJFB 4KJWC 3SEPA 3ARGC 3O3UN 4NJAH 5D6DC 4FQXC 1U8KB 4NRXA 1G0DA 2BOBB 3OKKB 4GG6B 3UJTL 4OI8A 4J8RB 3IFNL 3CDCA 1F4YH 1KCRH 4IRSC 1FV1A 3L3GA 3JTTB 1LO3L 5JXAL 4JZJA 2UWEF 4Z7VA 3V8CA 1S9KC 4OSUH 3CVHB 3NBNA 3MXVL 1WC7A 5EU6D 2UY6A 3NCYS 4FG6D 4RZCA 1HEZA 2OTWA 3GSXB 3HMXH 5BMFL 3WNKA 1SY6A 1GXEA 1XGTB 3CFJA 5HGBB 1FAIL 4JDVB 4EIZC 3MRNA 4PR5B 2P5WD 2ARJA 2WBJA 2OP4L 1INDH 4C83A 5C6TH 5AD0A 1MCNA 3LMJH 3WFHB 5DTFB 4HIHB 2DQGL 4F3FA 1A9BB 3NIDE 2Q87A 1S7TA 1XR9B 1JV5B 3BP5B 3CU7A 1K5NB 2Y7QB 1KIPA 2NX5B 5K59F 1E4WH 4S1SL 2WIIB 3L7EB 2AI0L 2NY0D 5KZCD 5F9OL 3S8WA 4MXQD 4WFHE 4NO0A 4P59H 1WWBX 4UDTA 4JDZA 4XP9L 4F2MA 4PJXF 1QQDA 1JPTL 4M48H 4NC1C 1LEIB 5F70A 5L8KB 2VIRB 3JV5A 3RAJL 5FYJH 1E28A 4M7ZC 3U48A 2ADGB 4HULB 1PX3A 4XBPA 3QCUH 2YMXH 4G8IB 4A2LA 3BRDA 1CVSC 1BFTA 3BHBB 3RDTB 2VLKB 1EMTL 4TVPH 2H1PH 2D2OA 2QADD 4U6HA 2VLRB 3MLTA 3T2QA 2DIJA 2JB5H 4RBPH 5TE4H 1MCDA 5KS9A 1CFQB 5I1HL 3CCHB 4PPTA 3VA6A 1RIHL 2WAHA 3LZFL 4HHAA 3ROOA 3LKSA 4WVRA 1IE5A 1RZ8B 2IMMA 3BDBA 3RZWA 4N0YH 2OX5A 3EO0B 1MRFL 3K0WA 4JVPA 5ADPL 2O61A 2H26A 3RP1A 4U1KA 1JI2A 1CGSH 3WSQH 2X1WL 3W0WD 4YDJA 3RWHB 4KPHL 2DKSA 5EUOB 2BNRB 3U2SB 5D7IE 5HHME 3L9RA 1XF1A 5E9DE 1OGAD 4NO5A 2BCKA 2FJHA 3FQUB 4DGIH 4FFVD 4JJHA 4GRLD 5DUPL 3MNWB 2VN7A 3LHPL 2GHWB 1VFUA 2OK0L 1F4XL 3NZHL 3BUTA 5DD5L 3QT2A 3RWFA 3QO1A 3D2UB 1GGUA 4PJDE 5HGDB 3D39A 4CUCA 5ISZA 3PWVA 1Q9OB 4KJYB 1WAAA 2FHCA 3T2NL 3UX9B 3UTPE 1MH5B 4KRPB 3MUJA 4P5MA 4W81A 1I8KA 5FYLH 3RU8H 1WIUA 4H26A 1OLZA 3VH8A 1DL7H 4YPGA 4TTGA 4UV7L 3NFPA 4K8RC 3X3FH 1U95B 2WUCH 2P43B 1KGCD 1OAZL 3S35H 3EDEA 5EO9B 1YQVH 5DI8A 4R7DA 2VLLA 3RJDA 1Q9WB 1EEZB 4LLQA 1FYTB 3AXLA 5F1IA 1JPFB 5HHXH 4YBQC 1CGVA 5ALCH 2EIEA 4AT6B 1JRHH 3QDMD 3KYOA 5D1XD 3MV9B 2DLEA 3A67L 3VI4F 2G75A 5KSVB 4IIQA 2MCG1 1XIWB 4UI2A 1MFBL 5BQ7A 2X09A 5HJ3A 3RI5F 3FO0H 2X4RA 2M26A 1J0YA 5GGSA 4YHML 5L9DH 3HA0A 4K9EH 1AKJB 5IFJA 4R97B 3BIAX 4PJ5A 2H32A 3DXAA 5I16B 4NQDD 3QDJE 5HY9A 3S96B 1CFNB 3O3AA 2BC4A 3A0OA 3FQRB 3PQYB 3EYQD 2IADA 2A9ML 1VENA 1R6VA 4X4ZA 4ZXBB 4FQLH 4M9PA 4P2QB 3OAUL 5DWUL 4UV4L 1AO7A 4HPYH 2ED8A 3RUGE 1S7QA 4GMSH 2DQCH 3KYAA 1J11A 4HWUA 4HS8H 1CLYH 1FORL 4FHBD 2VITB 1NAMA 1W0VB 2VLJE 2MKWA 1NFKA 2NXZD 3CH8A 3WFCH 2EDLA 2ATKB 4Y4KA 1FL6B 1RUMH 4MQTB 4LP5A 4LLYB 4XC1L 4RBPK 3H9SB 4O2CA 5IV2B 1BQHA 4OKDA 5KSAA 2CJUH 5AYUH 4NC2B 5E2VL 4OLVL 4Y5XC 1UXWB 4QGTA 3RVWC 1E6JL 3FL7A 3O6KH 4M6NH 3Q6GL 3BSZH 2E9JA 4LCWA 5I30L 5IVXF 3OKMA 1XCQB 3N06B 1MJ7L 3QJFA 3X17A 4PRNB 5EU5B 1BAFL 2BNQB 1P7QB 4ZS6C 1KJMB 3OX8A 2FRGP 4H20H 4TSAL 3GUTB 3QB7C 5T3ZE 4LPCA 4U1MB 1X4ZA 2AXGA 3EUUA 1X5AA 4AEFA 2BFVL 5I75C 5I19H 2V7NA 3RVUD 4XVJH 3UTSE 4LVNC 2E6PA 5DJ6A 3HAEA 3MOBL 4FNLH 4ZFGH 3D0LA 4AM0A 5DC9B 2QEJA 2IANA 5SWZE 4HWEL 5DK2B 2F9BT 2F15A 3CAFA 1SM3H 1MFAL 1NSNH 1RQ5A 4NNXB 2BSED 1GIGL 4XWOD 5DA4A 2BY0A 4PJCF 4UINL 3SKJL 5JHDD 2IAMC 4HZAA 2UZXB 1HZHH 4X4XB 3P0VH 2Y36L 4ODTH 3K2UL 5D1QA 4F7CB 3H3PL 3ARQA 2VZ1A 4MB4A 1LK2A 2NQCA 2XY1A 3NCEB 1R24A 1SEBB 4GT7A 1D5BA 3IDYC 1KBGL 4NZJA 2XTJC 1FNGB 1CFTA 3VFTA 2RFXA 3EHBC 1HXMB 4U1GC 5ILTL 5DVLA 4Y1AD 1JNJA 43C9B 5DJYA 2IBZX 1JMXA 2ICEA 5K59E 1I1AD 3CLFH 1C16B 1MRDH 2XYCA 1A21A 3L1OL 5DJ2A 3SQOL 4OTXL 1TTGA 4NHUA 1K4DA 5FKAA 5IHBA 5E2TH 2FGWH 5DMYA 5MHSD 1BIIA 2HKHL 1KEGH 3VW3H 5FCUL 4PJXE 2Z8WC 5TPWH 1CBVH 1T89A 2YPLA 3GRWL 5J13C 4WI2A 4XPGH 4PJGA 4XCFH 3MJ8A 4OQTA 4OZGA 2NLJA 5A43C 2AJZB 3HMXL 1JWMB 4RAUA 4PJ9C 3H2WA 1OTSC 4NQCE 5AYQA 1UCBL 2FBJH 2BX5A 2FWOA 5GRZA 1ACZA 4U7MA 2QQNH 5CSZB 1MRCL 4KMQA 4X7SH 4D3CL 3SCMB 1ZE3C 3FFCB 4BSVB 3BD4A 4PLJC 1JHLH 1WZKA 4ZSOB 1RU9H 1BLNB 1QRND 4OD3H 5C0RL 4MNHB 4FZEH 4XMLL 2BNUB 1S7SB 5HVWA 4LHUG 3D9AH 3I6KB 4HUUA 2X5PA 2C1PA 2KZ1B 4NO3B 3PWLB 3S4SG 4XVTH 3VXSB 5E8NA 5D5MF 2OSLB 4JY5L 3ALWA 4NKOB 5B8CA 4Q9QH 3QHZH 3GSOB 3LQMA 1QSFD 3ZTNL 3N85L 4OLXH 4RGOL 1KT2A 4Y16A 2EDOA 5E24E 4ETQA 5IFHH 3BN9D 4M1DL 1M1SA 3MROA 4NQEE 4G8FA 5LWYH 4HDIA 1XGRA 4HKZA 1IC4H 5DD0L 4PJAB 2AJ3A 3WUWG 4YO0A 6FABL 3RX8A 5T5NF 5IEKA 5KVEL 5JQ6H 5C0EB 5E99H 4P46C 4MD5A 4OKVB 1A7OH 3RTQD 2H6PA 1PKOA 2GAZA 4YK4C 4NT6B 1P7KB 2DM4A 3NN8A 3C2AL 4MSWA 4H25A 4DKFL 4YR6B 2VERN 3G5YB 4GH7B 5TFSH 2I9TB 5H35A 2E7CA 2MMXA 2W60A 5TE4L 3TVMA 3WXVL 5I1LA 3P3YA 5JZ7D 2OJZL 4UT9H 1CXEA 3KPNA 4YPJA 2OL3H 4NPYA 4EBQL 3QNYB 2X44D 3KHQA 5DZLA 2Q3AA 4Q9RL 2YBRA