1WTLA

Comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light chain dimers
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
108
structure length
108
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCRASQDITNYVNWFQQRPGQAPKVLIYGASILETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDTLPLTFGGGTKVDIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BENCE-JONES PROTEIN MCG (LIGHT CHAIN)
publication title Comparison of crystal structures of two homologous proteins: structural origin of altered domain interactions in immunoglobulin light-chain dimers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 25
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1wtlA00
1OD7A 4MQ7A 4Y4FD 4OQTH 2Z9TA 2RIKA 1FNEA 4XCNA 3KXFB 1EEQA 2CMRH 2I25N 4EXPX 5DI8B 2EDEA 5EU6B 3DX6B 5HGAA 5IKCB 4MZ3A 4LSSH 1F4XL 1TQCC 1DQTA 2H26B 3FONB 5CKGA 2VLKD 5D5MA 1MOEA 1FL5B 4NPYA 3NCEB 4UQ3B 1EJOH 3BKJH 3D69A 3TT3L 3U4BL 1ZLUH 5CGYD 4RQQA 2O26U 2F54A 1YPZE 5D9SB 1NDGB 4WHCA 3S98A 3PWNA 4MMZC 4M7LH 1NCTA 5SWZB 1BREA 5DVNA 4LSTH 1WBZA 3B2VH 5ERWB 4NZTH 1QFWL 3CIQA 1I7ZB 5IFJB 3O8XB 4C55A 3MCG1 2FO1A 1UB5B 3NABH 1XCTA 2A74B 5BRZD 1TNMA 3K2UH 2FR4A 3GIVA 1J05B 5LJYH 2GSGB 4P46C 2KDGA 4HV8A 3E8UH 5D96B 1N6VA 5SWQB 3BZFA 3TVMD 1IC4L 3NACH 4HXBL 3SQOH 1OSZB 3DVIA 3O3AA 1MHCA 3GMQB 4K71B 4X4YA 3HI5L 4PYHA 1MSPA 4X9FA 3O2DL 4LF3A 1NGPL 3LKNA 1F97A 5EUOB 4HG4K 4LIQL 4UTBL 5E1AB 1BBDL 1TTFA 2MCG1 1CK0L 4P5TC 4CU6A 3HKFA 5GRVK 3ARUA 3CFJA 4GAGH 4GXVH 3CFEB 1SJHB 3UMTA 4K3DL 1SJEB 4WUUB 5FGRA 4YHYB 1MWAA 3I3DA 2XKNB 1Z2KA 1OW0C 2R2BA 4MJ2A 2Q20A 3NA4A 1L4IA 1G6RA 4LLQA 2B5IC 2GY7B 4W70A 1X5GA 3NZHH 5IP4A 2E9IA 3HPJA 4IRZL 1IGCL 2Z92A 3WBDA 5AAWA 1JNLH 1SBSH 4NO0D 1W8NA 1LP9A 2D31A 5JQHC 1UWEH 1T4KB 4G8FA 2ORBL 1KT2A 2DQGH 3UC0L 3KPOB 2X4UB 3BQUC 4NNXB 5D6CB 5I76B 1UQSA 3C5SA 3FO1A 3C6SA 4Y5VA 3W2DL 3FZUC 4JDVB 5BVJA 4UDUA 3VXQB 2W9DH 1AGBA 1GGIH 2XWTB 5F8QC 1T5WA 2WLZA 4QRPA 3BMWA 1GZQB 5T1LA 3KGRA 3VE0A 1DBAL 3LKQB 5IG7A 1PZ5A 1G9NH 4YDLC 1YC8A 4GW5A 4I18B 3BI9X 3CSGA 1KJ2H 5D72H 5FOBB 3PL6B 4K94C 4FQXC 1X6NA 2KPNA 5E2TL 2NY5C 4ZSOB 3NVQA 3TWCL 4OM1L 2BSSB 5DDHA 1X3DA 1K2DA 1DL7H 4TPRH 4P59H 4JQIH 3RUGF 1YUHA 4JFDD 4LEOA 1FORH 4Y4FB 2YS4A 2EDQA 5C0CA 2AJ3B 3E1F1 4KKCC 5L8LB 5GGSY 1UZ6E 3L5XH 4K8RL 4PJDF 3KS0J 3UYRH 3NCFB 2O5ZH 1I7UB 4A6YB 2HMIC 2VE6A 1U95A 4U0QB 3QXTA 4KWUA 3X13A 1R3LB 1KB5B 2VLKB 3GSQA 3I6LE 2V5SA 5F7WC 3SO3B 5F1SA 5ALCH 3VRJB 1KCVL 5GGUB 4DGYH 1Q0YH 5FDWB 3F65A 4HJ0D 5BO1H 2ZG1A 4PRHD 5FM8A 2NY5L 1N5AB 4H1LG 1MCRA 1F3JA 1WLHA 4H20H 4AL8L 1KB9J 2XICA 1EERB 2FLRT 1RSFA 4ZAKD 3IKCB 4O2CB 2VWEE 4Y1AE 1OPGH 1U8HA 1A6VL 4UAOC 5ANMB 3SGKA 4NM4H 1HNFA 3P0YH 3U1SH 2M2DA 1C5BH 1QBLH 2AEPL 1L0YA 1P5UA 3MV9D 5GS1A 3X11A 1NBVH 2F19H 1JPTH 3UAJD 1VESA 1QO3B 5BRZB 1RVFH 2VKWA 3UO1H 3Q1SL 3IFLL 4XVSL 3TVMB 3MRMB 1P9MA 1HSBB 3OPZL 5FGBC 1UH4A 5EU4B 3RVTC 5HHXL 1NUGA 2BHUA 4K3GA 2FYYA 2PR4L 3QHFL 3WJLA 4NQEA 3T1WA 3TJHC 2BVPA 4HIHA 4XPGL 1Q94B 4ZUSB 4P3DB 2EEBA 4U6HA 5DUMH 5C0BE 2DL9A 3D85D 4AEIH 1OAZL 3QI9D 3SE4C 3Q3GB 1RZKL 5FUCC 3C5JB 2X05A 1A1NA 3OKMA 4LPUA 5DYOA 3SE8H 4PJHF 4KQ3H 1F4YH 6FABH 5DEZA 1OP3H 5F9DC 4EI6A 4L3AA 1KTDB 2KZ1B 2RCSL 3TZVC 1AHWC 5E2UH 2XACC 2YPLD 5DFVC 1RPQA 4NO0B 2D7TL 4DN3L 2DI9A 1Q0XH 2PTTA 5HYIA 3H9SE 5EA0H 4HKBA 4PJCE 3R06B 1NMCC 1QNZL 1I3GL 1T22B 1N0XL 5H94B 2EH8L 2A6JA 4F15C 2XI9A 4L1DA 4PLOB 2ZUSA 4Q9QL 4N8CL 1J8KA 5HYSB 4HFWB 5JUEL 4X0KB 5I8EB 2YK1H 3T3PE 5KS9B 2FX7L 1O7SA 2D4DA 1A7RL 2V2WA 4UNVA 1CFQB 3S37X 3PE9A 1T3FB 1P1ZA 1MEXH 4ETYA 3C60C 3UPCA 2J8UF 3NFNA 3QO0A 4RFNC 4JFDB 5I1GH 4JZJC 4OT1L 4XAKE 3LV3A 1MJUL 5EOQH 1WITA 1ZLVH 4YHIB 3VMNA 2ZUQB 5E5UB 5IT2L 1S5HB 4Z7VF 1FZOA 3BT2L 1EMTH 4NQSA 4RWYH 4GKSB 2APFA 5C0AB 3ARRA 3FT3B 3L3HB 1I7TB 4HCRL 4F9LA 5CP7B 1RUQL 3CSBA 1XGTB 4U1LA 2YBRB 1KC5L 4HUMB 3RKPA 5HD8D 4ERSH 3LSOB 2LAAA 3ZKSD 3FT4A 4PRHB 4TSBL 3QXVA 3V9FA 3T2NL 1VFBB 4XBGA 2C4XA 4XXCC 5D2LA 2DWEB 3VFUA 1JHKL 4Y5XA 4ZAKB 2W65B 4H25B 4XP4L 3PWUB 3DX9A 4LCWA 5IEHB 2VXQH 3U9PL 4A2MA 4I4WA 3OKOB 5EO1A 1DLHB 3BIBX 4XRCB 4YFEA 4W4OC 3GMPA 4HEPG 4WFED 1LEKA 1AQDB 3MV9B 5TDPB 4HPOL 4UT7L 5HHPB 2PXYC 1JHTB 3TBSA 4C59B 2F74A 3W5NA 3QNYA 4PY7A 3L3GB 1X5YA 5IOPA 2CKBA 4BSJA 1HNGA 2VC2H 3BPLC 5B4MC 4LLUB 2HFFB 5TF1L 4ACPA 2DM7A 4I3RL 3VRLE 3MUZ1 2JJUA 1INQB 4G6JL 1I1AC 4NNPL 3QAZC 2NY2C 3RGVC 3P30H 5T5NG 4BFEA 3NCYS 5I9QC 4ELKA 4NO2A 1S8DA 4ISVA 3GJEA 4U1JA 3D85B 3GMLA 4UDTA 3QI9B 3O6MH 4FQLH 1WFUA 5ESVA 3O9WC 4A2LA 2YPVL 4V1DD 4XWOD 3WHE0 5JHDE 4N5UA 4HFUH 3QUXC 4OV6F 4Z95L 3K2MC 4DKEH 1NANI 4OZFA 4JVWA 2WWMC 4R90H 3RKDC 3VI4E 4LSUH 1A6UL 1NPUA 2YPLB 3TH3T 3ZDYE 2ARJB 2QQLH 3WNLA 3F7YA 5T5FH 2IH3B 2F53A 3EYFB 5F6IB 4LSPL 5I75C 5HI4C 1QYGH 5FYKL 2D2OA 3CMGA 5ESQB 4XNMB 2LVEA 3PF2A 4CL7A 4GLRI 4MA3A 1AIFB 1CXHA 2W9EL 2W9LA 3O0RH 2AXGA 4HS6B 3VXTB 4ZNCD 3TO4C 1LMKA 3U48A 3QHTC 1QTYT 4KVCL 3D18B 3ZHKA 4ONGL 1OQOA 4XPBL 1K5NA 4NKIL 2OR8A 4ZFGL 1UM4H 4O9HH 1NH6A 1KCLA 4JDZB 1J1OH 1FLRL 1NGYB 2X4SA 5AWNH 4HWBL 3C08L 5FGCB 5AYQA 4LVEA 4LPXA 2IBZX 1QACA 4XNUL 2Z91A 4K3JL 4PUBL 2ZCLH 9CGTA 4HH9B 4NCC2 4PGBB 4WEBH 3PHQA 4LNVA 2WW8A 3NIFE 1I85A 2WANA 4R8WL 1T5XA 4IHOA 4HF5H 3DBXA 2IPUG 5C0EA 4M1DL 5IMMB 1CLOL 4E5XA 5DT1L 1PDKA 2H32H 1BD2D 2WP3T 3DECA 1FCCA 2G5RA 4PJFF 3OKEA 4UILL 1LO4H 3FAXA 4M5ZL 5BW7A 4Z7UE 4C57C 1U6AL 2C3GA 1DQMH 1TENA 2MJWA 4P46D 2PYEA 3VFWB 4M02A 1NGXB 3UZEA 4Q6IA 2O5XL 1OAUL 1GAFH 3P4OA 1R5IA 2P5ED 4TULL 3UCRA 1EHLL 4N68A 1T20B 3MBEA 4HXAL 4F2MB 2XN9A 5DHXB 3F5WA 5ACMA 2F5BL 4P5TD 5ITBH 2Z8VC 5L2KD 1ZEAL 3OWEA 1WAAF 4O5LH 3OKLA 3B9EA 3VFNB 1X5XA 2V7NB 1V7NH 1CR9L 1UWGL 4JPKH 5D1QA 1FYTD 3FHAA 3W0WD 5KSAA 4MQSB 4RX4A 4JE4B 3C5ZA 3HUJB 4KDWA 3VH8A 1I3RB 4QOKD 3OAZH 2DYPD 3NTCL 4S0SD 1EJ6A 5E9DA 5JDJA 2XQYK 4Q0XL 2IAMA 1GIGH 5DZNA 3BDYH 4QRQB 3KPRE 4HJJH 3VFGL 4KUZH 3BQUD 4HLZG 3KVQA 3FZUD 4QRRD 1C16B 4X6DE 4KTEH 4ZDHA 1E28A 4JO3L 3MGTA 5K9QI 1NC2A 4V1DB 2MCPH 2FDBP 4LKCA 5CSZA 1E27A 4IRSA 4WI6A 1ZAGA 2ZSWB 5JW4Q 1R0AL 1HCFX 4HIIA 2OTWB 3RHWK 1NUFA 3TH4T 2HP4A 1MQ8A 4HK0A 4WWKC 5IFAL 3ORJA 4OCYL 5HXMA 1K8DB 4PRIE 4UV7L 1CFVL 1NBYB 4NJ9L 3SDXF 1DQDL 4MSWB 4XB7A 5T1DL 2QLVB 5F9JA 2Y36L 2DQCL 3CVHL 4KK9C 5HYSG 4KKCD 2Z35A 3RJDA 5HTSA 1X5JA 2HMID 2AXHA 4H8WC 1RIVL 3RX7A 3T65B 1S9KC 4OLVL 3LRGA 1ZOXA 3LMJH 4OLZL 2G60H 5EIVA 4L4TE 1SMAA 3VFVA 4ZFFA 3DUSB 4EOWH 4ZOCA 4AIOA 1CBVL 1PG7H 5IIEA 5DQJA 1NGWB 4JFPA 4NQCA 4GKOA 2EDHA 4LLWB 3G6DH 1G7HA 4X9GA 4MNHA 1NMBH 1HHJA 1S78C 1E4JA 4PRNA 4PGJA 4PJGE 3OMZA 4U2ZA 3O3BB 2MQ3A 3V4PL 4ZG1A 1D5BB 4X6BA 1XF4B 2B1AL 1BD2B 3SGDH 1J9CT 1P4BL 5DD1L 5F7DA 4BSWB 3MLSH 2R1YB 5H2BA 4RFEB 4YDIH 3BDXA 4P46B 3EYVB 5HJ3B 1GGCH 3VXSE 1KGCE 2YD2A 5K33A 1X5FA 4OCRL 2K7PA 4WJ5B 4BK4A 1WIPA 3MRCA 1B2WH 5J6GA 3RVTD 1BPVA 1CYGA 4OF3A 4PJ7B 2X4TA 2F9BT 4AENA 1NKOA 4KI5F 4YHLH 1AY1H 3TJHD 5JMRA 2FZ3B 4OD2A 1DFBL 4I48B 4IOSD 4MXQC 3WO4B 4P5TB 1TZGH 2NW2A 1C5CL 2VLJE 5J0BA 2WIIB 4NQXA 5L2KB 4G5ZL 5IVXE 4ZUWA 3ILPB 3DOSA 5IR1A 5FOJA 3GSRB 4L1HA 4AG4L 2B5IB 3UTOA 3PDOB 1FYTB 1HWHB 3W0WB 3DXAA 1P7QA 1I8LC 4UZGA 25C8H 1ZA3B 3S6CA 5I1CH 1MFBH 3TZVD 2IAND 4QOKB 2DYPB 2GT9B 4CKVX 4WV1C 3C2AL 3FFCA 5DFVD 4PJ8C 1XF3A 1BJ1H 4ZYKB 5JR1L 3T3MF 4Q9RH 3BQUB 3WD5H 2GUOB 1QBMH 3CLFL 1JNJA 2ZOKA 4QRRB 3EGSB 1ZHBB 1EAPA 2B1HL 4MA8L 4JR9H 4MJ5A 3WDJA 4QCIB 3SPVB 3ZTNH 3SDYH 3DVNB 4OLXH 1KLGA 4IRJC 5EC2B 1FNGB 2Y1VA 5GJTH 3V52H 4YDLB 1WFOA 3D25B 1W72L 3WFCH 5HVFB 3MRRB 1E4XI 4L9LC 4JDTH 5C7XH 1WGOA 5I1AA 5IF0B 3C60D 3ULUL 4R7DB 4OCLC 3HG1A 5ADPH 1JYWA 5I1LB 4MAUH 2JCCE 4AMKL 1VACB 5EOTA 1A1OA 2P49B 1ZANH 2VDNH 1U42A 1CVRA 4YGVB 1TXKA 1KPRB 4X4XB 3FRUA 3ZYJA 5DUBB 2A6DB 1I9RL 1XZ0A 2MPAH 4P4KA 1BAFH 1ZHKB 4ZOAA 1J1PH 2R0WL 5FK9A 4GRLA 4X8JB 3BWAB 4NOBA 3FQTB 2HJKA 1DQJB 3V5HB 2AV7B 3S5LB 3A6BL 3L3DA 5JORA 3WUWA 1J8HE 1D3CA 1VGEH 3BEWA 4K7FA 3B5TA 3MA9L 4G7VH 2H3NA 2YN5A 2WBKA 3EYSL 2P43B 1WBYB 5CJXC 5HHOE 4NFDA 5D7IF 3FB7B 4MMXC 3T4YB 4L3CA 4UAOB 3OKDB 1DANT 2ZZUT 3CPLB 3D3VA 3ES6A 4HUVB 5A1AA 3SDAC 1YMMD 1VPOL 4GRWF 4YHMH 3MYJA 3OG6B 1NFIB 3U7YH 5MENA 3S88L 2NW3B 3C9NA 2PXYD 1UJ3A 4XNXL 3O41A 3UTTD 3B83A 2YN3A 1EO8H 2Y07L 2WUBH 4KI5C 4ESKA 3QDJD 4Y2OA 4JKPH 3V5KB 1GCFA 5B4MD 3EAKA 1CF8L 4OLEA 4S1SL 4TNVF 5IBTL 2FGWH 1YY9C 1F6AA 1I1AD 2NXYC 2NY2D 3RGVD 1OF2B 1FNSH 4GQ9H 3BPCA 3MRLA 3QIUC 1TMCB 5DVOA 1A1MA 1A6ZA 5JPNB 5T1KD 1YEGL 2JK5B 4XCEB 5GRZA 4W68A 3TJEH 1QQDB 5ECJE 4Z78B 3O9WD 3VWKA 4F57L 3IDJB 2CUHA 3HRZB 3S4SA 3QUXD 2YRLA 4AT6B 1A14L 3TZVB 3I50L 2IANB 2WWMD 3B2UC 5DRNA 3RKDD 1OT2A 1AHWB 1E6OH 1U92B 1AGCB 2YEZB 3QQ4A 1CDGA 1U8IB 5CFHA 1MNUL 1OTUC 5IWLA 5HI4D 2FHBA 4Y2DA 1DLFH 1T1ZA 1N2RA 1NMCB 2OZ4L 5I0DA 4MJIA 4OD3L 1NLBL 1KFAL 5IJKA 1FFPB 3LKPA 1UKTA 4F15B 1BX2B 2A9MH 5JDSB 5C6TH 1CZ8H 3L1OH 3HTLX 3TO4D 5TFSL 2IFFH 3VW3H 3MOAH 2I27N 4YXKH 4J3WA 4YFLI 2EDKA 3CDGA 5F44A 3TYGH 4DEPC 1CG9A 5GRUL 3I3BA 5GGRB 4NCDA 3RUGB 1JZ5A 4PG2C 1MIMH 4WHYG 1I75A 3C60B 3BZEA 3NFPA 3CCHB 4RFNB 1U8QA 4JZJB 3NCJH 2F58L 1F8TL 1U9KA 4PJDB 4KJYA 3EO1A 3MA7A 3RQ3A 2BJML 2VISB 5T3XL 3HPLB 1F4XH 1JYVA 4E41A 1GC1C 4B41A 3VJ6B 5J89A 1ZV5A 4ZFOA 1W0VA 4X9IA 4XI5C 3TT3H 3VA2C 3FN0L 3FN3A 4Y4HD 3DLQR 5ISZA 5JA8B 3IDXL 5I8OL 1D9KA 3ILQC 3S36X 5IFHL 4ZQKB 2HJFA 2E8ZA 2Q87A 2VXTL 5D7SL 3W9DA 5D7KD 4U2YA 3VXPB 1QFWH 3MLVH 1A9EB 5GSVA 3BP5B 1N59A 4J1UB 1PZUB 5EU3B 3OAUL 4N1EA 5J6HB 1QFPA 5I71C 4PB0L 4DK3A 3J8F7 3RL2A 1ED3A 1YMMB 4GS7C 4MDIA 1XGPA 4FQHA 2PXYB 4RZCB 4IJ3C 1GC1L 3UTTB 1IM3A 4BYHA 3WS3A 1ZWIA 1IC4H 1GRWA 4HXBH 3DURB 2NTFB 1LILA 4F7TB 4D9RE 1A7PL 1BGXL 1R5VB 3HI5H 3QDJB 2ZNXA 3KAAA 3GGWB 4NYLA 3O2DH 4LRIA 3GRWA 3BPLB 1NGPH 4OCXL 3GM8A 4TUKL 4GAYB 5ACZA 2XQBL 1GGUA 4D3CL 5F7LB 3TBVA 4LIQH 3FL7A 4UTBH 2KUTA 1Q9LA 4WI4A 4L3EA 5IW1B 3IETB 3R1GL 1CK0H 1I1AB 2OL3B 3JTTB 2NY2B 3RGVB 2AJZA 4NKMB 3WFDL 1C1EL 4O00A 1NCUA 3ME0A 4O2FA 5HYJD 4IM8A 5T1KB 4PJHB 4PRBB 4JZOA 1N4XL 5ILTL 2RFXA 4JRWA 1FV1A 3RZCC 5C0FA 3O9WB 4AH2B 4N0UE 4NO3B 3S37L 3D39A 4IRZH 3QUXB 2IWGA 4V2CB 1IGCH 1JZ3A 5E8DL 4OF6A 4M03A 2KQMA 3HNVH 1KIQB 2V6HA 4WWKD 4JM2A 4ZTPL 1FZMA 1DVFA 2CIKB 5JLZA 3C09C 3UC0H 4S1DC 4HX1A 5JIIA 4FOMA 4JHAL 1Z9LA 2P8LB 3X14A 3W2DH 2VLRA 4UMGA 3U4AA 4ORGB 1WICA 3QEQE 3OR6B 1IGML 4HKZB 5GS0D 1YPZF 1TZHB 1P7KB 1DBAH 1FO0A 3CH1A 4KK9D 5DC9B 3TO4B 2Q7NA 1MH5B 1UFUA 3JV0A 2L7UA 1I1YA 2J2ZA 3MNZA 5FYLD 5E2TH 3SE3A 1T0MB 1INDL 3TWCH 4OM1H 1L9NA 4LGRB 4NO5A 2J8UB 4PP2A 3BKYL 3SGEI 1LP9F 2FH6A 4FXGA 3BH8A 2GIYA 4J8RA 1KPVA 3UYOD 4Z7VB 2XXCB 1U93B 4PJIA 1S7XA 2EDFA 2WINA 4K8RH 1UVQA 4APQC 2P4AB 2LFGA 1AGEB 3WHXA 2DBLL 1HN1A 5TJWK 4LSDA 5JOPE 2VAAB 2EYSA 4ZS7L 1KCVH 5CWSB 3S5LG 4Y4HB 2VSDA 3QHZL 4QEGA 1QUNA 2B39A 3EYUH 1CTNA 3O6FA 4PG9B 3MV8D 4AL8H 4KK6C 3U36A 3EOAA 5C3TA 3WEXA 4JFFD 3UBXA 3G5VB 4LLMA 5EU6E 1GXEA 1A6VH 2LVCA 3BXNB 4M7KL 3U0TA 3IJSA 2AEQL 3GIZL 1T1WB 2E7LA 2AEPH 1RUML 3TV3L 3QNZB 2C3VA 4XNZC 3ZE1F 5FO8B 3V2AR 3SKOB 4QNPE 4MXQD 1S7UB 4XB8A 1J7VR 4HDIA 4NP4H 4XVSH 2NX5D 5DJZA 3IYLW 3OPZH 4R9HA 5HHXH 1SVCP 5SWZE 1QHOA 1S7RA 2PR4H 3QHFH 3CLEL 3M17B 4EI5A 2ICWJ 3WNOA 3NIGF 2HFEA 1FFOA 1VHPA 5K9JH 3L5JA 3N85L 4XPGH 1QEWB 4QT5B 4F3FA 4MX7B 3BKCL 1IT9L 4PJ8D 1A7NL 4UIMB 2FBJL 5BOZG 5DSCB 4PV8A 1BZ7B 3SJVE 5HYJB 1OAZH 5CIPB 3C2SA 1RZKH 3VXMA 4D9QD 5I73C 2VDLH 1XH3B 1MCFA 5ENWB 4WDIA 4OZGA 1ZT7A 3X12B 4OCNC 4QF1A 3RTQA 3IFNL 1MI5D 4IRJD 1VERA 5IMOB 5I1DA 5LCVL 2RCSH 4K7PH 1UZ6F 4HGWB 1NFDA 5EUOE 3U1SL 3N1PC 4DN3H 4WWKB 4NDMA 1IMHC 1WK0A 1QNZH 4GKNB 1I3GH 2IG2L 1N0XH 3ARGC 1C5DB 2EH8H 3HR6A 5F7MC 5GGSA 4JN2A 4NQDA 4YEEA 2HRLA 1UM6L 2E3VA 5JOFB 2GHWB 3RWFA 4N8CH 4IDLA 3IDMA 4MNQD 4GKZB 4P23C 1JJUA 2HTKC 1KNOA 4G43B 3ARDA 1J1XL 1IEAA 3IF1B 2FX7H 3IRZA 4Q97A 1A7RH 5A16B 2QSCL 3B8SA 1QR1B 4P2QA 1TCRB 5DJ6B 3MJGX 5C0DA 1TTGA 4Y5VC 3KYAA 3PDDA 1EXUA 4OT1H 4HAFA 1A6PA 3BP4A 5IT2H 1JGEB 1KCRL 3BT2H 1NUNB 4D2NA 2KKQA 5C9JB 4ODHH 1ZHNA 4GMTL 3T77B 4CAGA 4LLAA 3BP6B 1PSKL 2G2RA 4BKLA 1RUQH 3LQZB 4PJFB 1G6RL 1KC5H 3E6HA 5C2BH 3MRKA 3CFBA 3SDAD 5KANI 3EJYC 4Y19D 4TSBH 1Z0MA 3T2NH 4ZXBA 2CRIA 1H3PH 3PIQB 3MV8B 3WV0A 2Z0BA 4HMDA 1JHKH 5D7LD 5DUPL 2YMXH 3GSNA 4XP4H 4KI5D 4JFFB 1LE9A 3U9PH 5DMJB 5EIIB 1F42A 1XEDA 3OJVC 4BFBD 3GB7B 3SQBA 3JUZA 2VLKE 1FQ9C 3HR5A 2YRPA 4E0RA 3OB0H 4HPOH 3MROA 4UT7H 1IM9D 1YY9D 2NXYD 2DKUA 1FGVL 5D71L 3QIUD 2G9HB 3RDTA 2BK8A 3SGJC 1NAMA 1BQUA 2HKFL 2NX5B 3OL2A 4PJCF 5AYUL 3W9EB 1SYSA 3GMMB 2GI7A 3QXDA 2R4RL 1GYAA 1YJDC 1ZT1A 2BSTB 2VL5A 4YGAB 3QQ3A 3SKUD 5TF1H 1JV5B 1E6JL 5IM7A 2H32A 4I3RH 4YAQA 2R8SL 4WFFD 3SGKC 2IMMA 1RIHH 5IB4A 4G6JH 3B2UD 4NNPH 1CICA 5GGTA 4WV1B 1QRND 5GS1C 4N8VB 2CDFA 1XGUB 4PJ8B 2D7PA 5HI5C 1OTUD 5BRZE 3C8KA 4C56D 1ACZA 3H9YA 5FF6A 4YDKL 2YPVH 1P9MC 4XNQB 3LRHA 1JF5A 2AK4D 1MI5B 4IRJB 3MLUH 4ODSH 2C4FU 3W81A 3WJLC 4JFXA 3RI5F 1KJMA 1DE4A 1IEHA 3MRIB 3OB8A 3P11L 1AP2B 4R6UA 1YJDL 1EEZB 2XYCA 3MRFA 3A67L 5FYKH 2R2HA 4NOFA 3SDXB 3EJJX 2SEBA 1EEYB 3D5OF 3HZVB 1RZGA 5EB9A 3RL1A 3RVXD 5BOPA 2VN7A 1NEZA 4J3XA 3RPIB 2NYYC 5EC1B 2K9UA 4HBCL 4MNQB 3H8NA 3W82A 3DV6B 4KVCH 1M7IB 3OXSA 1S5IH 4G42B 3B9DA 4XPBH 3LKRA 4HZLA 4NKIH 4LMQE 1R3HA 3DVFA 5J13C 3JTSA 3P4NB 5FA3B 2VXUL 4CGTA 1FLRH 4XI5D 4HWBH 3C08H 2YPKA 3RWDA 4XNUH 5ADOH 5FECB 1LO2H 2CRMA 4F9PA 3ILQD 4PUBH 4FQJL 2VQTA 1HOCA 3JV5A 5IROC 2CRZA 4R8WH 5DS8A 4QO1A 1EIBA 4M1DH 5MEQA 3GJFA 7CGTA 4MHHI 5KS9E 1NBZB 2AJSL 2O93L 1CLOH 4CW1B 3RX5A 5DT1H 1IAIM 4EXKA 3G6AA 5I74C 3VRLF 4HK3J 1A7OL 4UILH 3SDAB 3MUGB 4M5ZH 5D4QA 4Y19B 2R9HC 1U6AH 4PIRF 5DTFA 1WIOA 4BUHA 3MRDB 5C0GA 5D2NA 2FX8L 3Q6FB 5D7LB 4YHKH 5F1NA 3IDYC 3HI1B 3QDMA 2O5XH 3TNMA 4K9EL 1OAUH 3U9UB 4LASL 4MLSA 5JPMA 4TULH 1JE6A 1EHLH 3ARFA 4L29B 4NT6A 4ODUB 4JRYA 4HS3A 4UQ2A 5IW6A 3CUPA 4HXAH 2GSIB 3VI4F 5EFIB 4POZD 2HN7B 5BZDA 1IM9B 2FECI 3ZDYF 5C0IB 2F5BH 2NXYB 1A4KA 4B53A 3CSPA 1ZEAH 3LS5L 3N9GL 3QIUB 4PRHE 4M7JL 2X7LA 4I2XE 1AD0A 2OJEB 4KKAC 3U2SA 3G5XB 1T1YA 1CR9H 1UWGH 4Y5XC 2W60A 3QG6A 2ZKHH 5MHSE 3RZCD 5IVNA 4N0FB 3T8XA 4HQQL 1HHIA 3JV6B 1JPGB 1URLA 1CD1A 3PJSA 4LP4A 2NZ9C 5A40E 1QRNB 3MV9E 3V95A 5CEYA 4EN3A 1G9EA 3JUYA 1NANH 3VFGH 4S1DD 4ETQA 1V3JA 4C56B 2EO1A 3LEVL 5MERA 3MRPB 4LLVB 2NNAB 3TLRA 4JO3H 4R2GC 2XZCL 1J0YA 3U79A 1LDSA 1CFTB 2AK4B 5INCA 4X7TB 2FSEA 3WL9A 1BM3L 5E00A 1R0AH 2UZIL 1ORSA 5CJ8A 2PCPA 4I0CC 4GLRH 3IU3B 3NIFF 5DMYA 4OCYH 3B5GA 2XA8H 1TVHB 4DEPB 2JJTA 3CX2A 4P3CL 5EO9A 4R7NB 3KYNB 3MREB 3PGDA 3QA3A 4NJ9H 1BIIB 1DQDH 3TPUB 3DIFA 1NBQA 5T1DH 3PWPE 1KIPA 2CLRB 2Y36H 2EIZB 4Z7UF 5TF0A 2DQCH 3CVHH 5TH2B 1VDGA 2ICWB 1QRKA 4PRDB 1Q9KB 4GG6A 4APQD 2EKSB 1S7SB 4OLVH 3A6CL 3ZT7A 4HULB 1HSAA 1KTLA 4WW2F 4OLZH 4L8DB 1CE6B 2FIKA 2AKRB 1JGUL 2YSSA 4F33A 1CBVH 3QZWA 1IFHH 3MV01 1NCAL 5BS0D 4WU5A 1RZJH 1OP5K 4QWWC 4KK6D 1GGTA 2O61A 3ECBB 5L88L 1NKRA 1LEGB 1UXWA 3QUMA 1RJZA 4R97C 1H0DB 5DK0A 2P5WA 3V4PH 1CGYA 4XMPH 2B1AH 4X4ME 4GRWB 4CADB 1HILB 3V8CA 5EBLB 1P4BH 4GS7B 5DD1H 3V6FA 5ETUB 1ZA6B 2GJ6A 5FYKU 4IJ3B 1OAXL 2F54D 1AGFB 4OLUL 5FM4A 1EEUA 8CGTA 1HYRC 4JRXE 2FECL 1JN6B 4OCRH 2GTWB 1NCWL 4X6DF 1I85C 2DQDL 4LLYB 4QXUL 1JWMB 2I07A 1R5WA 4P49A 4Y88A 1FN4B 5JHLL 1C7SA 1D5XA 3RWCB 2QSTA 2BNRE 3G5ZA 2PYFA 3H9ZA 4DFHA 3PGCB 1DFBH 3F7VA 1N3NB 1C5CH 3CJJA 5FA4A 2FEEL 3CMOL 4G5ZH 5BW7C 3G08B 3QCTH 4P9HC 1QLRB 4AG4H 4KKBC 4P2RA 3RZCB 2HFTA 3PXJA 3KYMA 1BVKB 2ITDA 3C2AH 3JWOL 4N8VG 1YQ2A 2FJGB 4DGIH 3FO9B 5EZOL 4UNUA 2EDTA 1FZJA 1IEBB 3H2WA 3LRSA 5JR1H 3CAFA 4O58L 2VR9A 4TRPL 3C09B 4HBQA 4MWFB 5FO7B 3T4AB 5SX4I 5JW3H 1UGNA 3CLFH 1G7JA 3ULVL 3ARGD 4MA8H 4Z0XA 5EU7C 2CDEA 4WNQA 2HJLA 3LPFA 2C7UB 4FFWC 3H6JA 4P2YA 5C07A 4P23D 1CIUA 2R29L 3C5ZC 1TPXC 4LHUD 4P9HL 1W72H 1WC7A 3AMLA 4PJGF 3K1DA 3S36L 1P5VA 1U8PA 4ZO7A 1RK0A 1A6WL 3KLAA 4AY0A 3ULUH 1H3XA 4XBEL 3STLB 3IAGC 1MCIA 4AMKH 3QFDB 1HINL 4MDJB 3RRQA 2I60L 2W0LA 3QFJA 2R1WA 1DCLA 5DXWA 5INDA 2GJJA 1M6OA 4QRPD 1OGAA 1G7LB 4WW2C 4APQB 1I9RH 3VWJA 1NL0L 2X4PB 3QYCA 1B6UA 3KG5A 2R0WH 3QWOB 4P3WA 3FFDA 4X6FA 2CPCA 4JHWL 3RZWA 1BOGA 5KN5A 1IL1B 3EJYD 3A6BH 4JFEA 5CBAA 5BS0B 3FQWA 5TGBA 3I9GL 4Z77B 1MCCA 1EO7A 4MQ7B 5IUSA 3IFPB 5IMKB 2V7HA 2VN4A 3MPCA 2DQFA 2Q76A 3KNBA 3MA9H 5IVXF 3EYSH 3KPMA 3DMMC 2JTDA 3ALWA 4ELMA 1T7XA 2I9TA 2MFNA 2ZUXA 3F62A 3LIZH 3G6JA 1WT5A 2NQCA 3RNKA 1VPOH 4ZOEA 1U91A 2A2QT 2GAZB 4F7MA 3S88H 3HLAB 4HWEL 4XNXH 3DX7A 2A83B 1GZPA 4WU7B 2F54B 5KSUA 3RAJL 2Y07H 4H26B 5B38B 3IVKA 3PWNB 2EXWC 3P9MB 4LIQE 4PTTA 1ZLUK 3GSWA 3BISA 1GSMA 3ET9F 2UWEA 2FATL 5GSRB 4S1SH 5IBLC 1L6ZA 5IBTH 2BNQA 1AO7A 1BF8A 5JXAL 1QPPA 1X5AA 4JZNA 4QKXB 1FFNB 4DOHB 5HI5D 1XCTB 5TE7L 4PJ5A 1YEGH 1KIRA 3TYFA 3EO9L 4DZBB 1N8ZB 3OAYH 4L8BA 2ATPB 2JCCF 2N56A 3FQUA 4AZ8A 4X4YB 3T0AA 5AG8A 1A14H 2P5EE 4HS8L 4FQ2L 1BMGA 1MNUH 3I6LD 1HQ4A 1MVFA 3RWHA 4S10A 3VU2A 1T03H 1WVZA 2AGJL 5EBWA 3GEWB 7FABL 1WBXB 3GBNL 4OD3H 3OKKA 2X1OA 3ARGB 1KFAH 1X9QA 1YPZB 1MWAB 5DHVB 2Z8SA 3G9AB 4XZUA 1YEFL 3DGGA 2NYYD 4JG0L 1HHHA 2G5BB 1G6RB 2I9LA 5L2JB 4P23B 3W0WE 5TFSH 3FMGL 4LHUB 4Y1AD 3QRGH 2Z92B 1A2YA 4QOKE 1IKNA 5DD6A 5GRUH 4DZ8B 2XWBA 1LP9B 2D31B 5DMIL 1M71B 2VERN 3KPPA 5TDNA 3C87A 1KTKE 1MCHA 3C6SB 4Y5VB 2F58H 3MV7A 1F8TH 4XX1G 2DLIA 2YD6A 5F7YC 5FV1L 1BQLL 2PO6A 5KVDL 4EIGB 4YZFE 3GUTB 1FNHA 1EH9A 4QRPB 2BJMH 4MD5B 1BVLA 3I75B 2BNUA 5T3XH 3OBAA 5JMOC 1Q38A 4FQQB 5I19H 2VKXA 1H8NA 1ORQA 1LO0L 2YD9A 5DLMH 4R96A 4W6WB 3FN0H 1B88A 1K2DB 2W0FB 3IDXH 5DJ0B 5I8OH 5FCUL 3PNWB 5IFHH 1VENA 5C0BD 2HWZL 1NDMA 2R9HD 5EWIL 3P0VL 3MRBA 4EVNB 3RWIB 2VXTH 2R1XA 5D7SH 3MZGB 3SCMB 2RHEA 3HZMB 2CO7B 1B0WA 1SMOA 4JFHE 1U8KB 1ADQA 2VQ1B 1XFPA 3OAUH 3PABB 1IKFL 1H3UA 4PB0H 3N1GC 3ALPA 2VZUA 2MOVA 3O6LL 1UACL 3HMWL 3H9SD 2X10A 5HDBF 1FL3A 1UZ8A 5DC4B 4CN1A 4LARL 4OJFL 4YR6A 1KULA 3D48R 2DIJA 4CU7A 1F3JB 1HEZA 4ODWA 4B50A 4KKAD 3QUYA 1A7PH 4OCXH 4TUKH 1PKOA 2XQBH 4LCWD 4D3CH 1MCJA 1I1FA 3BRDA 3CSYB 5IHBA 3D2UD 2NZ9D 3R1GH 5E5RB 1GGBL 5GS1B 3MUJA 3WFDH 1C1EH 2FD6L 4U1MB 5TPWL 2BY0A 2DMKA 3Q2CA 2DB8A 2CH8A 1YQVL 4JFQA 2ARWA 2APWA 1N4XH 1RJYA 5ILTH 3Q6GL 4XAKD 1KG0B 5KSVA 2QR0B 1RUAL 3S37H 4U7SA 5EH1A 3BGFC 3R0NA 2HT3C 5E8DH 1I8IB 4HIJA 2EYRB 2X09A 1LK2B 2QHRL 4ZTPH 4X5XB 2A6IB 4JY4A 3IB4A 1DN2A 5FKAB 5C08E 3WMSA 4L4VA 4GRMB 4JHAH 4NSKB 1CLZH 1S3KL 1EZVY 2VXVL 1IGMH 5E6IC 4QHMA 2QJDA 1W8OA 3OKMB 3BD4A 4CRPA 2JB6B 2BOCA 3MJ9A 5KSBA 1KCUH 2A9NH 4YO0B 4Y1AB 1CT8B 1YECL 1T6WA 1INDH 3CDYA 2XTJE 4EJ1C 5LXGL 1OP3K 4LSSL 4ZUTA 3B9VA 5J13B 3SDCC 2F53D 3AS1A 3BKYH 1CGSL 5IWLC 4LQFL 2LU3A 3BKJL 3QIWA 4IOIB 4UTAL 5IJKC 3IXAA 4U6VL 4QWWD 32C2A 4FZEH 2NY4C 2DBLH 4R0LA 4YXHL 2DQIH 5GGVY 2E9BA 4CN4A 4U1KA 4PLKC 4R3SA 1MLCB 2V2WB 5IK3B 4UNTA 1BZ9B 2GFBA 5I74B 1P1ZB 3QHZH 2CR3A 4RRPG 4HUWA 5C0BB 3H7BB 3WLBA 3LV3B 5H8DA 1BLNA 1T83A 3IDYB 3MGOB 3KWWB 3KDMB 4UINL 3DYOA 3NACL 1M05A 2X2YA 4NQSB 4AEHL 3J7HA 5JHDD 5FYJL 2AEQH 3GIZH 3GMRB 3FCTA 1RJCA 1RUMH 3D9AL 3TV3H 2CDGB 4X98B 4HWUA 1LNUB 1FHGA 3H9SB 5HHME 1IAKA 4JEGB 4I0KA 4MCYA 3ESVF 2DAVA 2MQ0A 4PJCB 1M7DA 1FRGL 1IAOA 5B38G 4M43L 1G9NC 5CLTA 1XGQA 1BFOB 1YEDA 4KKBD 1B0RA 4DFIA 1G7QA 4Y5XB 1IGJA 4P0DA 1P69B 4LCWB 4D0DB 3N85H 4QXTA 5EO1B 4YNYA 3D2UB 3BKCH 1JNLL 3DSFL 4NRYA 5HDLA 1IT9H 5D7JA 5F3BA 5H35A 3P4MB 2FBJH 3UPRB 3U82B 4TN9A 3CC5A 1QHPA 3TESA 1RU9L 1FVCA 1XIWA 1DUZA 4X5WA 4QRSA 5C09A 4ZFOL 2ZG3A 3AY4A 3RWGB 1OAQL 1GGIL 2CKBB 3IFNH 4PJBE 3QDJE 5LCVH 3STZB 1HXMB 4FFWD 1D6EB 4QY8A 4P5KA 4RNRA 4RX4D 4FN0A 4LKXA 4IMLB 5FYKE 2R23A 3SHSA 4PJEA 4OD1L 5A2KH 1KEGL 2EDJA 5E9DD 3U46B 4CVZA 3ARBA 4ELKB 2IG2H 1U41A 1S8DB 1M7XA 3GMLB 3GKZA 4JQIL 3KR3L 2YUZA 1UM6H 4HWZB 3WCYA 3SGEH 4KVNL 4OUUA 3UBXI 4LHUG 3L5XL 4OZGF 3TBYB 1J1XH 2BVOA 3O45A 3OJDB 3X3GH 4OIIH 3VD4A 1WZLA 2QSCH 1FBIL 3WDHA 4PR5A 1JF1B 3V6OA 1MCWW 2WNGA 3F7YB 2F53B 3GRWL 2Q7YB 5EZIH 3E2HC 5ALCL 2VL4A 5D1ZA 1OVZA 1Q0YL 2DL2A 5BO1L 3VXRA 1JBJA 3MX0A 1KCRH 3AB0C 4Z7NE 3L5HA 2XPGB 2ED7A 4Y4KC 4NBYB 4S1RL 1GVIA 1RIUL 4GSDH 4XXDB 4XBPA 3DMMD 1WWBX 3HC3L 1PSKH 2YHGA 4R97B 3T1FA 4BH8A 1YN6B 1G6RH 1I8KA 2V2XB 4J2XA 2ICCA 2J8UE 2EDDA 5GGRY 4HMCA 1BFVL 4U6XA 3PWVB 2FIRT 2X4SB 1D6VL 4H1LA 5E94A 4NC2B 2XKUA 4NQCD 4HPYH 2VR5A 5DUPH 4NKDA 4KMTL 3KPNA 1UWXH 3PHQB 2OMBA 2EXWD 3PHOB 3H9HB 4LBEA 5JHDB 4F7EA 3FT2B 3PXHA 2FL5A 4J7RA 3F58L 5HHQA 5J3HC 3ARWA 1CD0A 5IBLD 1LD9A 4HWBA 3ARTA 3CZFA 3AAZB 4N5EC 1FO0L 4X80L 5E5MB 2LABA 4TYUA 2AXFA 2BOBA 1FGVH 5D71H 4PRID 3GHEL 2YWYA 2HKFH 2NCMA 4U1HB 4DTGL 5AYUH 5T5NF 1JWUA 4R4FL 3QDAA 5H37H 2R4RH 5DRXA 5L6YL 1A6TA 1A6AB 3QULA 4GG8B 4JKKA 1F4YL 3EJZC 3D0VA 4LDEB 5DHYA 1U8NA 1E6JH 1XF5B 4YPGB 2R8SH 5CP3A 2FJHB 3S96A 1QR4A 5ICZA 1FPTL 4MXVE 4G8IB 3EDEA 2E7LC 1P6AB 4NUGL 4LCCA 5IB3B 1A9BB 4HHAA 4MVBC 1CFBA 5EN2A 5GS3A 5I0ZA 5CILL 4YH6A 3FOMA 5I2IA 1I8MB 4U1IA 2WUCL 4L4TD 5EA0L 3NCMA 4F7CB 4YDKH 2RGSA 4NQUA 3OKLB 1UH3A 3V6ZB 2XZZA 3KHQA 2JF1A 2H6PA 2HG5B 1ZLWK 4EI5C 1TFHA 3P11H 1TPXB 1IC1A 3L5WA 3VH8B 3ETBF 3FRPG 1P84K 4Z5RA 5IV2B 4Y16C 3VXOA 3A67H 1S7VB 5E9DB 1HHKA 1DQLL 5HYJE 4X6CA 4LCYA 1JTOA 4Z7UB 1S9YA 3FB6A 4KHXH 5TDOA 3RIFK 1E28B 4HBCH 3VXSD 1KGCD 5DWUH 4JQXC 1E27B 4PV9A 4WW2B 2OCFD 5C86A 2V5RA 1Z5LA 3O4LE 4P5MB 3MO1A 3MUY1 2XXMB 4NJAL 4O2EB 4HK0B 4Z7WA 3MRGA 4KU1A 1KLUA 3GSOA 1UXSB 2VLJD 3SKNA 1OGTB 4RGNE 5J7CC 3HE6A 3KXFA 4DAGL 2BHZA 4FQJH 1LE5B 2BVTA 5DI8A 1EBAA 3DX6A 3MR9A 2AEWA 3DMMB 3ZZ1A 3CK0L 1WUNT 2AJSH 1UJTA 3WFBL 5FYLE 2XG4A 1FL5A 5BZWA 2VXQL 4UQ3A 4KRNA 1A0QL 1A7OH 4KJQC 3MLXL 5D9SA 5IB5B 4LLDB 4N8PA 4BH7B 5DQJB 2FX8H 4E9LA 4NQCB 2A73B 3CX5K 1G7HB 4K9EH 4MNHB 4P99A 4LASH 3UZVB 3LY6A 4GT7A 2ADIA 4FG6C 1I7ZA 5CD5C 2VAJA 5IFJA 3O8XA 4PP1C 4G8EB 4U7MA 5T1MB 1FL6B 1E4KC 1I1RA 1UB5A 3BUYA 1YA5A 1OB1A 3O81A 4PBXA 4X6BB 5JIPA 1D5MB 1QP1A 1XF2B 1J05A 3LS5H 1LWRA 2GSGA 3N9GH 4PRIB 5MEND 4M7JH 5SWQA 3P4LA 1CS6A 1OSZA 3MV8E 3DO3A 2YZ8A 3GMQA 3K8KA 4FQLL 1JZ7A 3QQ9C 4HQQH 1RV6X 4MA7L 4JFFE 3MRCB 3SBWA 2VZ1A 2X4TB 2HT3D 4ZUUA 3WSQL 5E1AA 3WS6A 3R4DA 5SX5K 4G9FE 4MCZB 3N50A 4FNLL 5FHBL 1SJVA 4WTZA 2X44D 4L4TB 1SJEA 1QYGL 2NW2B 3AC0A 3LEVH 4WUUA 3RDTC 1JYNA 5D6DC 4NQXB 2DQEL 2W59A 3UP1A 2NX5E 2XZCH 4WY7L 2XRAL 5E6ID 5IR1B 1BM3H 2UZIH 5KOVC 1V3KA 2UVEA 4PJGB 5HHOD 3ULUE 4GAFB 2YC1B 1T4KA 3GSNL 4J3UA 1QSEA 2X4UA 4NNXA 4P3CH 5D6CA 2EIBA 1UM4L 3SDCD 4O9HL 1D5ZA 1ZK9A 4JDVA 3TA3C 4EUPB 5CD3B 3F7QA 4KAQL 3VXQA 5E8EA 2XWTA 3R0MA 1CFSB 4MJID 4RA0C 1JPFB 3LQAL 2ZJSL 1GZQA 3VXSB 3LKQA 1F02I 1KLGB 3H0TB 1F00I 1NAML 4J4PC 3A6CH 2NY4D 3PL6A 5D93B 1IE5A 4HF5L 4ZSOA 1VSCA 3CXDL 4PLKD 5CEXB 3BP7A 1JGUH 1MFNA 3CFDA 2KQNA 4Y4FA 2VLJB 1EUTA 1NCAH 2NY3C 5GGTL 5IVXB 1BQSA 2AJ3A 5KJRL 1AJ7L 1SYVB 4A6YA 4MNQE 4D9LL 5SWSE 5DD0H 1KB5A 1XZ0B 2VLKA 1H8SA 3VRJA 4E41D 5F93C 4FTVE 5GGUA 1OY3B 5FK9B 4OZFH 2EIDA 2GEEA 4MB4A 3NMEA 1ZVSA 3LKSB 5ISZD 1OAXH 4J6RL 4OLUH 4F9PC 1I9JL 5E7BA 1D5IL 3V0AC 3L3DB 3IKCA 3WIHA 4O2CA 3WUWB 4DGVL 5GRXG 1NCWH 2DQDH 4WFHD 5IJVB 5ANMA 1OAYH 5BJTA 1ZVYA 5JHLH 2G75A 2J88L 4JPKL 1TDQA 1AH1A 3GKWL 1IBGL 1MCPL 2OSLA 1A7QH 4RIRB 5GQBA 1QO3A 3EFDL 2EE6A 4BSVB 4W6YB 1QSFE 1DN0B 5MENB 3TVMA 4P2OC 3MRMA 1E0OB 2AJVL 2OM5A 2JCCB 5EU4A 1DZBA 5D2NC 5HVGB 1RMFL 4NQVB 4KTEL 4ZFZB 5C8JB 1HH6A 3L3OA 3T04D 1N26A 2MCPL 5DD3L 3BGFB 5DFWH 2BRRL 4HUKB 2W92A 3MRNA 4G80A 3BZ4B 3JWOH 1CD8A 1Q94A 4ZUSA 4P3DA 1N6UA 5EZOH 4L3ED 1OL0A 4O58H 2L7JA 3Q3GA 3LKOB 3BPCB 2QQQA 3C5JA 3S35X 5CAYB 3ULVH 1C08B 1GPOL 5E6IB 4OCSL 4PJAE 1KTDA 3ZMRA 2VZOA 3MJ7B 1B4RA 1UENA 2R29H 4NKOA 3EOYG 3S4SB 2DIBA 2ESVE 5HHOB 3VH8G 4WFFE 4NO0A 4ALAL 5I30L 3BUTA 3LQMA 4TTDC 5DRNB 3S36H 4JHBA 1RZFL 1A6WH 3T3ME 3QQ4B 4PRPA 3SDCB 4XBEH 3R06A 1T22A 1N6QL 5BQ7A 5HGHB 1A4JA 2Y23A 4X7CC 3LB6C 3HZYB 2I60H 5T3XE 1J18A 2VZSA 2EDRA 1EFXD 5F96L 4OZIA 5HYSA 4HFWA 4Y4KD 4X0KA 5ACLA 5I8EA 1NL0H 4X99B 1PG7W 2NY4B 2FX9L 4F37F 1CFQA 4GJTB 3L95B 5F7KC 1T3FA 3AU1A 4M9OA 2JJTC 3BSZL 2NPLX 2XV6B 1NCCL 4JHWH 3BIKA 4JFDA 4P57B 2GTZB 3ZDZF 3O2WL 2DQUL 3NFPB 3I9GH 4ZS6C 1S5HA 4YDIL 2GJZB 3I6KB 2P8PA 1ITBB 4WI8A 5E2WH 5C0AA 4HIEA 3FT3A 3L3HA 3HI6L 2MWCA 5J3HD 4E41B 4YHLL 1A3RL 1AQKH 1XGTA 2R0KH 2YBRA 1KB9K 4IOFC 1ZGLB 3LSOA 4N5ED 5DK2A 2ZCKH 2EE2A 1LK3L 5J9PB 4B7LA 3BH9B 4HWEH 1VFBA 5ISZB 4PTUB 4K23L 1IGIL 3RAJH 3VD7A 2DWEA 2FRGP 3QEQD 4ZAKA 4H25A 4TSAL 3PWUA 1KJ2B 1XR9B 1HQRB 5BV7H 5IEHA 3EJZD 4HWNA 2P46B 1DLHA 1AQDA 3MV9A 2ZCHL 5TDPA 4ELMF 3K7UA 5I1CL 1B0GA 4GRWE 5HHPA 1FIGL 4MVBD 2X89A 3T0VA 3L7FB 1ED3B 3G6JF 5TE7H 4MDIB 4NBZB 2J6EA 3S34L 3WD5L 2H8PA 1QBML 2Z93A 2QSQA 3B8YA 3QJFB 3QXAB 1P84J 3GSUB 2HFFA 2ILLA 4JR9L 4XH2A 5SX4H 3WFZA 3SDYL 4DJMA 3K4AA 4NYLB 3O3EB 4HS8H 4EI5D 1JZ2A 1INQA 3T0EA 4FQ2H 2WV3A 5JOPD 2BVQB 3MC0A 4XPFL 4AQOA 1Q9LB 3JV4B 4L3EB 4MS8C 4Y16D 5J1SC 4NHUB 3DRQB 3D85A 2AGJH 4FMKA 4OKVB 3QUML 4YK4C 3QI9A 7FABH 4DCQB 3GBNH 5FO9B 2IPTL 1QPXA 4JZOB 1YEFH 3RWEB 2RFXB 4JG0H 2KH2B 2VDNL 4CDHA 3BVNA 3JZ7A 1ZGLM 5B21A 3FMGH 1ES0B 1I1CA 4KKLC 2YPLA 1DANU 2GCYB 4KH2A 3UEZA 1MCNA 5DMIH 12E8L 1FZMB 5DJ2B 3TO2A 5ESQA 2ATKB 2EDLA 1VKXB 4EUPG 3E2HB 3X14B 5F3HA 1AIFA 2DWDB 1LEIB 1CXIA 5IQ9B 1BQLH 4XGZB 5KVDH 2Y4SA 4HS6A 3VXTA 1EFXB 3AB0B 4NQDD 4NZRL 3QEGL 1W0YT 1BECA 4Y4KB 3D18A 4JJ5B 3K74B 5C92A 3MNZB 4MZ2A 2BSRB 3QXUA 1LO0H 1KLFA 4JDZA 1KOAA 1I4FB 3QDGE 4U49A 1NGYA 3ALXA 4JPIB 2MQCA 4PP2B 5FCUH 4KJQD 1F11B 4YHML 4QYOA 3SJVD 1NGQL 2HWZH 3BH8B 4FXGB 4HUXA 5EWIH 1EO5A 3P0VH 4HH9A 3QEUA 3JVGA 4YJZL 2WLYA 1ONQA 1S7XB 3QJHA 1C12A 1G9MH 4FXKB 2OXGA 4N0UB 3VWJC 2X70B 3QCVL 3RNQB 1YN7B 1IKFH 4JKPL 5IMMA 4FG6D 4PRAA 1MHEB 5CD5D 4XMKH 4PP1D 2WQRA 3O6LH 2BXYA 1UACH 3HMWH 4OZHA 3VFPB 3FJTA 3E0GA 3MMEB 4JQVA 3A6OA 4OFYD 1FNSL 4M8VA 1NGXA 5I17B 1KPUB 3QEQB 3WUWG 4FA8A 1L0QA 1J0IA 1FDLL 4UUJB 3TJEL 1I9EA 3QQ9D 4O02L 4IMKC 4YBQC 3S9DB 1Z0NA 4G8GA 3CFKB 5CJ5A 1T20A 3TIEA 3NPZB 5I16B 1QFUL 1WT5C 1GGBH 4G7YL 1EX0A 2C3VB 5D5ME 2XY2A 1AE6L 5GISL 5IHLB 5TPWH 2FD6H 1YQVH 5TE4H 1KXVC 2EH7H 1L7TH 5HVWA 3Q6GH 2F54E 4PJXA 3VFNA 1R3KA 4CVXB 2V7NA 4EKXA 4L8CB 3OF6D 5CSGA 2ED8A 3HUJA 2A9ML 3DI3B 1I3RA 2F8OA 4EI5B 1EK3A 2QHRH 2HFEB 1FFOB 4PGEB 3VW3L 1T04B 4BELD 4QRQA 4OUOA 2C3HA 4Y16B 1BJ1J 1NCNA 1S3KH 4OIAA 4C4KT 5KG9B 4I3GA 3TA3D 1MIML 1IGTA 1C16A 2VXVH 4LEXL 1U8MA 4DWHA 3K8MA 3JXAA 4V1DA 4U0RC 3NCJL 1QVOB 4OZGB 1ZT7B 2ZSWA 5I1KL 4QF1B 2CIIB 3S4SG 2OTWA 4OLWL 3WIFB 5I1DB 3BAEL 4J4PD 4F80A 4X83A 1YECH 5LXGH 3HC4L 1FG9C 4HAGA 1CDUA 1CGSH 1FGNL 4LQFH 1F4WL 4S1QL 4AIZA 4ODXB 5E7FA 4UTAH 1Y18B 2E7CA 3QCUL 4NRZA 2NY3D 1WCBB 1IGYB 4U6VH 4NQDB 1DBJL 3IDMB 2EDBA 4YXHH 5K9KB 1CU4L 2ICEA 3UTQA 2B2XL 3MLVL 1YMHB 2VMFA 4UIKL 4G6ML 3AGVA 2HH0H 4DVRL 1LP9E 1JPST 3DUSA 3MODL 4RMVA 1NGWA 3SJVB 4LCUA 2QKIB 4BJLA 5CJQL 4LLWA 2Z8WC 4XVUC 1HHGB 4UINH 4QRPE 4WRLA 1YNLL 4AEHH 5FYJH 5JO5B 1S7WB 3O3BA 1ZHNB 3LD8C 1RUKL 3O2VL 1TVBB 5E6ZA 1D5BA 4QHNB 4J23A 3D9AH 1XF4A 5ID0B 1MFCL 1BD2A 2G2RB 4BKLB 1KELL 1RHHB 3KJ4C 3VFTB 1RULL 3NPSC 4BSWA 4CMMB 2ERJB 2R1YA 2P8MA 3MRKB 4RFEA 1PD6A 1IC5L 3MJ8B 1FRGH 3EYVA 2JE8A 4M43H 1KENL 4P2OD 4NN7C 4WJ5A 3V8OA 5C0CE 5KW9L 5MEOA 5CJBA 4PJ7A 4RAUB 1MJJA 5HDOA 4BQ9A 1LE9B 4DUWA 3ZE1E 3BKML 5FM5M 5JNYA 3DSFH 3W11C 3DO7B 4I48A 4MJ6A 1HK6A 3QUKB 3HNVL 4E0RB 4P5TA 2QQNL 4MD4B 2DTSA 2WIIA 5L2KA 1N0LA 3LH2L 3NZ8B 1RU9H 4K8RC 4LPCA 3OB0K 1SYSB 5TQ2L 3TIDA 1OAQH 3KLHC 4HIXL 4OAWB 3PDOA 1FYTA 3NIGE 1ZA3A 3EO0B 1W0WB 2GT9A 3HHRB 4HSQA 2H32B 4YAQB 1WZ1L 2OX5A 4TTDD 4OD1H 1KEGH 3GI8L 1FNFA 3MOBL 4NFBA 1ADQL 4UT6L 1QA9B 3RWJB 3FHQA 3LDBC 3TA3B 4QRRA 3EGSA 4U1NB 4QCIA 3SPVA 3KR3H 5HGBB 1PYWB 3LB6D 4KVNH 4U3CA 1U0QA 5EBGA 1F58H 5EC2A 1FNGA 5C70A 2C1OB 3FQRB 3VA6A 3W39A 1F90L 3D25A 1I3UA 3MRRA 4NQEE 1X7QB 1PEWA 1FBIH 3S3JA 2OTUB 3GRWH 2BHYA 5IF0A 4QHLA 2R2HB 3KPSA 4TOYH 5C0NC 4RCAA 1VACA 1FJ1A 5IQ7L 3RL1B 4H88L 3HAEH 2NY3B 3WYRA 3EYUL 4ZS6D 3BGMA 4YGVA 1S7TB 4S1RH 1XF1A 1KPRA 4X4XA 1RIUH 5GJSL 3UZQA 5DUBA 3ELAT 5TQ0L 3L3KB 2A6DA 2OP4L 4MAYC 5MHSD 3AREA 3HC3H 2MNUA 1HIML 1ZHKA 4TQEL 3WNMA 5C2UB 4NZDA 1R3HB 3QWRD 4X8JA 3BWAA 43CAB 3FQTA 1DQJA 1RZKC 4M61A 2AV7A 3VGAC 1YEIL 4I3SL 4IOFD 1BFVH 3S5LA 3ZL4L 2E27L 3G04B 1D6VH 4U6YB 3QIWC 2NR6C 1SM3L 3PV6B 4I5BB 4KRLB 1PKQA 4NP4L 3QUZC 5EOCL 3B3IA 3N0PB 4KMTH 1U8JA 1DBKL 1WBYA 3BDBA 5DS8B 3T4YA 3F58H 4R0LC 1JGVL 3OKDA 2ADJB 4LHJB 1FC2D 3CPLA 4PJBF 3S7GA 4HUVA 4NRXB 1RUPL 3R8QA 4X80H 1FO0H 5K9JL 1I7RA 1NFIA 3MJ9L 3OV6A 2YOCA 2NW3A 1RK1B 3GHEH 1NCDL 4WI9A 4WGVB 4DTGH 4YE4L 5AUMB 4R4FH 1RZ8A 5DTFB 4P2OB 4Z76B 5L6YH 1TIUA 2VDLL 3PWPD 5D2NB 5IMLA 3V5KA 5F1NB 3O3DB 5EU5B 2OBGA 5DQDH 5HI3C 1IQWL 2C5DC 1FPTH 1SEBB 4KQ4H 5JPMB 4K7PL 4NUGH 3NOIA 2XTJC 3VGHA 1OF2A 5CILH 1ZTXL 4JO2H 2X6MA 4UQ2B 3IKKA 2D9CA 4MS8D 2WUCH 3CZJA 5JPNA 5DK3A 4Q6YA 4HUUB 2NMSA 4XCEA 4BA8A 1QQDA 2JIXA 1AD0B 2VZTA 4F58L 1FZKB 5D2LE 3HRZA 3SOBL 2W60B 3AS3A 3QG6B 4B5EA 4Z7NF 4AT6A 1HHIB 3FO0L 3MXWL 2IANA 3TZVA 5DVMA 4LCWE 4KKLD 1U92A 1AGCA 2YEZA 1T0NA 5KVEL 5FYJU 2WWKO 3VD3A 2HVKA 1RZ7L 1DQLH 4ETQB 5CMAB 3AVEA 1G7MB 1FFPA 3FQNA 5LAXA 2V5MA 3AY4C 1NAKL 5JDSA 4WI7A 1MFEL 3RGHA 4JRXD 1T2QL 2X4NA 1EV2E 2DQTL 2FSEB 4TVPL 1ORSB 5J1AB 4ODHL 3HS0B 4NJAH 5GGRA 4M8QB 3RUGA 2BNRD 3WFHB 1FVDB 5FEBA 4KZDL 1PJ9A 4BQ6A 2R4SL 1DTUA 3CCHA 5C2BL 1IQDB 4JZJA 1XR8A 2F15A 1AR1C 4PJDA 4PY8J 4DAGH 5HVHC 3L6FA 4I2XB 1H3PL 4X6CF 3QFJD 1OTTC 3MFGB 4X7FC 3VMPA 1OGAD 3CK0H 2YMXL 1MAJA 4OFDA 4JY5L 3VWJD 1OWWA 3WFBH 5F88B 5GS2H 4UT9L 1A0QH 1MLBB 3V6OC 5E8OB 1N64L 1VEMA 2D9QB 3QQNA 4KK5D 4MXVF 2F53E 1XT5A 4PYGA 5DR5L 3MLXH 4PS4L 5D1ZC 5I66B 4Z7WF 5EG6C 3UYPA 2YD4A 4ZQKA 2QADC 2DN7A 1G84A 3H42L 1HWGB 4RAHA 4WIQA 3DSNA 1AXSB 3VXPA 1CXLA 3BP5A 3IS0X 5EU3A 2O61B 4YBQD 1PFCA 5J6HA 1CXEA 4W4OA 2P7TB 1YMMA 1MHHA 1RIHL 4PJ9C 2DQJL 2PXYA 1NJ9B 4RZCA 4HC1A 2HT4C 3UTTA 3V6FB 3TP4A 2MKWA 1X5IA 3DURA 2M1KA 3PWPB 4K55A 1KJ3L 2C3XA 4XC1H 4YHOL 4MA7H 1UC6A 1AGDA 2YD5A 4GAYA 3BRGC 1YY8B 2DOCA 3QNXB 3WSQH 3ZHDA 3MLUL 1IARB 4ODSL 1RHFA 4MD0B 1D5XB 5IW1A 3IETA 5CEZL 5DZLA 2OL3A 5T3ZL 4FNLH 3RGVA 5FHBH 3ULVE 5JA9A 4ODBD 4XT1C 4NKMA 5T1KA 4NGHL 4PJHA 4PRBA 4YK4B 1JGDB 4W6XB 2DQEH 4PJ5D 5GIRB 1JFQL 4WY7H 2XRAH 3O9WA 5FHAH 2RB8A 3CDCA 4S2SB 2PYEE 4NO3A 2MSPA 1AI1L 2D03L 5EO0A 1YYLL 4ZPTA 4FABL 3PDGA 3KYMB 3EDKA 1Y6KR 43C9B 1S9XB 1KIQA 1ZVHA 1S5IL 1F5WA 2LU4A 2CIKA 3GSNH 4UOW1 3OX8A 5B39B 2Z4QA 4K2UH 3NIDF 1MCQA 2P8LA 2XN9E 5K9OA 3LRSB 3BW9A 4KAQH 4ORGA 1U3HC 1JNHB 3OR6A 3LQAH 2ZJSH 2ADFH 2BFVL 5ADOL 5BXFB 1LO2L 1KN2L 4WNQB 5EU7E 4JRXB 3TO4A 1MH5A 2BCKB 1FLTX 1NAMH 4ONHB 1CGWA 5KVMC 2OJZL 3B6SB 3EOTH 1OAKH 4LAQL 3CXDH 3ZYZA 3SDDA 2BNRB 4CN6A 4PLNC 1U8PB 5E9DE 4OSUL 4XP5L 4DVBA 4Z7VA 3MLRL 1FAIL 4OI9A 5GGTH 1U93A 5DGQA 5EZLB 5KJRH 1A3QA 1AJ7H 4KFZC 1FC1A 3JWNC 4OZ4B 5JXEC 3QFJB 5GRYA 5INDB 4XP1L 4XVUD 3K1KC 4D9LH 1OGAB 4YHKL 3VWJB 2VAAA 1HXYA 3HCVB 1F4HA 1B3JA 3Q5TA 3BPNC 4Y4HA 5L0QC 3MNWA 2XG5A 3CFIC 4J6RH 4PG9A 1I9JH 3U0PB 1K8IA 1XGRB 1D5IH 2EYTB 1DDHB 3HE6C 1JUFB 5TGBB 4DGVH 2CSPA 3ULSB 4POUB 1ND0B 3G5VA 2DQFB 4NNYA 2P47B 4OFVA 3KPMB 3BXNA 5D1XC 3MNVB 2ZKHL 3FKUS 2A6KB 2D0FA 1ZKAA 2J88H 3IXTB 3K4DA 4ELMB 5I6XC 5ICYB 5JZ7C 5LWYL 4MJ4A 3GKWH 3H3PH 3QNZA 1IBGH 1EZVX 5IVZB 1MCPH 3G6JB 3SKOA 3W11D 5GXBB 3NCBB 3EUUA 3EFDH 3ULUF 4Z6AT 1S7UA 3SKJL 5HGDB 4C54A 5C0JB 5EDXA 1UCBL 3BWUC 1LDPL 3P9LB 3DX7B 1CDBA 3L3IB 2AJVH 4K8RD 1DEDA 3PWJB 1RMFH 5DJYA 4NQCE 2OQJA 3IVKB 1ETZB 3U83A 3KLHD 1JCKA 5DD3H 2PUQT 4Z8FL 2BRRH 2P1YA 1MF2L 4HUNB 1QEWA 2AV1B 4QTHB 4E42B 4MX7A 4OGYL 1TTUA 1NUDA 4UIMA 1T1XB 5DSCA 3P77A 4FQXD 4OFKA 1HKLH 1V5JA 3IFOB 1TJHH 2XA8L 3GJFH 5CIPA 3GFUA 1RZJC 2C26A 1XH3A 3MZTA 3DGCR 3CH8A 2PW1B 4PJ5B 5ENWA 3WUZA 1GPOH 4RGNC 3TYFB 3L3JA 4OCSH 4U0RB 2MHAB 5IMOA 1LVEA 2PTVA 4ZNEA 4ENEC 4DQOL 3BO8A 4JFHD 5I30H 1X6LA 4ALAH 3V4VL 4WWKA 3OAYK 1OTSC 1RZFH 1B6DA 4RISL 1TQCB 5EBMB 5DVKA 1P4LB 4GKNA 2Z8RA 1N6QH 4L4VD 3OKNA 1C5DA 3VGEA 5F89B 5C0ND 2X4RB 3BPOC 3OKKB 2HTLC 1IFHL 5JOFA 4N9GB 5F96H 2R56L 3MCLL 3VDCA 4GKZA 1RZJL 1CXFA 4G43A 1HHHB 3ROLB 3TBWB 1BWWA 3IF1A 2FX9H 5J4MA 4MAYD 5FAAA 3DXAE 5A16A 1A64A 1CDJA 2CRYA 3IDGB 1CLYL 1ZE3C 4GAJL 1A2YB 1DEEB 1PY9A 1TCRA 5DJ6A 3BSZH 4XMPL 3FFCE 1NCCH 1LGVA 3BD5A 5JW4N 3KJ6L 3MOQA 3O2WH 2DQUH 4QXGL 3QIWD 2NR6D 1H15B 3GSVB 4LSQL 2HLAB 3QUZD 5C9JA 2VNCA 3T77A 4GO6B 2P44B 1RZIB 2Q6WB 3BP6A 4OZIF 3HI6H 2OYPA 2JJWA 3LD8B 3LQZA 4PJFA 4Q9BA 1A3RH 2P5EB 1AXTL 1P4IH 4KDTC 2E7HA 3VXUA 4YIQB 2M26A 1LK3H 3KJ4B 3NPSB 1QFWM 5C08D 5E8NB 3PIQA 4NUJB 4K23H 3OQ3B 1FG2A 1IGIH 3HG1E 3MRJB 3QCTL 4TSAH 5DA0B 2VUYA 4NN7B 1AFVH 4JO4H 3CU1A 5EIIA 5IHUL 5HHVH 1ZT4A 3GB7A 4PJAF 5HI3D 3VRIA 2ZCHH 2ZG2A 5IGXL 4MB3A 3ULUC 3MBXL 1FIGH 1S7QB 4GUPB 2XTJD 1WAAA 4YC2C 3MCKB 1PQZB 4DGIL 2G9HA 1FL3B 1QSVA 1UZ8B 2VLLB 3S34H 3W9EA 4XCCL 5JW3L 5IEKA 3G5YB 2BSTA 2FB4L 2VDQL 3HMXA 1JV5A 4ODWB 2XZQL 3IDIB 3G9VA 1I8LA 3SGDI 1QZ1A 4M6OL 2DM2A 2YA2A 4N8VA 4M1GL 1XGUA 4XPFH 4PJ8A 1MCLA 4A6YL 2IADB 3D3VE 4FQXB 2FJFA 3CXHK 4YHNA 3QUMH 2AERT 4X8XA 4WEUD 5CJOL 1KB5L 5MENE 3K0WA 3NFSL 3LDBB 2IPTH 5LVEA 2BDNL 4NWTL 1T66C 4AM0B 1RJYB 4XNQA 5DFTA 5C09D 4R4BB 1MI5A 2DDQL 3LEYL 5DJ8A 2Z31A 4S0TD 5DJXB 3MRIA 4EQ2A 4UU9B 4RSVA 1AP2A 2NY0C 4HIJB 5B39G 3WIHL 2BSED 2DS4A 3MFFB 3GBML 2D0GA 12E8H 4JY4B 3SDXA 1EEYA 4PREB 1T0PB 4L4VB 4YBLC 5HHMD 1YNKL 4OF8A 3U6RA 3RPIA 1IZKA 1NGZB 5EZJA 3VFOB 5EC1A 2UY6A 1AR1D 4NZRH 1MFDL 2QTEA 4TNVK 3QEGH 3DV6A 4G42A 3FO2A 1OTTD 15C8L 2VITA 2AJXL 3PQYA 4MAYB 5ALBL 3P4NA 5FA3A 3VMOA 3MLYH 1CCZA 4HKJB 4EDXB 4ZUTB 3LIZL 1UM5L 3EDFA 3NGBC 3VGAB 3PGFL 2Y06L 3GMOB 1NGQH 5D1ZD 3QIWB 3OGCA 2D7MA 1T89C 2R69L 1OSPL 5FYJE 4MJIE 3VXRD 2VRAA 3QUZB 3IXAB 2OK0L 4C83B 3QCVH 4QRTB 32C2B 2BX5A 4R0LB 2ZSVA 1JPSL 5FYKD 1NFKA 4DUXA 2DLGA 3BE1L 4KHTL 3SDAA 5FB8B 2BVYA 1G7IB 4Y19A 4PJ9D 2OS7A 4HMEA 5C08B 4YFLF 3WNNA 2HT4D 1KJVB 2IGFL 3MRDA 1IGFL 5D7LA 4LNRA 3QP3A 1FDLH 3HI1A 2IQAB 2B0SL 2AW2A 3FB8B 4O02H 3GZKA 1BLNB 4JCLA 3GMNB 4KPHL 1M05B 4FXLA 1MY5A 4I0PA 1MREL 4L29A 3VCLB 2GSIA 5EFIA 3FCTB 2HN7A 1QFUH 4MQXC 4E41E 4G7YH 5GISH 5HDBE 1AE6H 2XTJB 1BBJB 1F13A 3QIUA 2PW2A 1KTRL 1T03L 2CLVB 3DRTA 2J4WL 5ISZE 4OZHF 3TC9A 2OJEA 1E4XL 1IAOB 4J3OC 4ZAKC 1XGQB 4N0FA 5IHZB 3JV6A 3EZ8A 1B0RB 1JPGA 3VFRB 2Q3AA 3L7EB 4WFHE 5L9DL 4IIQA 4KRMB 1TZIB 1XMWA 2GK2A 4XVTL 1QRNA 4WHTB 3QRGL 4BQBA 4NRYB 3DTXA 5H35B 4RGMC 5EUKB 4C56A 2X1WL 3MRPA 1K3ZA 2NNAA 4LEXH 3CC5B 1U3HD 4ZOBA 5F9OL 3IJHB 5AD0B 1CFTA 4M6ML 4X5WB 5C09B 2AK4A 4X7TA 4IBLT 5I1KH 1Q9WA 4PJXF 1CWVA 4OLWH 3BAEH 1H5BC 4QY8B 4P5KB 5A2IH 1BEYL 4Y5YC 3T0EC 3HC4H 1TVHA 5I19L 1HYSC 1Q9OB 3BHBB 4R7NA 1FGNH 3KYNA 4L3EE 4PG2A 1B4JL 1BIIA 1F4WH 4S1QH 5DLML 3P73A 5HHMB 3WE6B 3I02B 3QCUH 2CLRA 2EIZA 2AJUL 5HVHB 2ICWA 4PRDA 4U1SB 4YEFA 1JP5A 3KYOB 1DBJH 5ITFB 5JXED 2EKSA 2DJUA 1S7SA 4L8SC 1CU4H 2J6EL 2VXSL 3V5DA 1V3LA 2B2XH 3D39E 2Q8AL 1PX3A 4L8DA 1CE6A 1U36A 4UIKH 4G6MH 3WFEH 4BZYA 4DVRH 2AKRA 1EVTC 3MODH 5DA4A 3QWQB 3ROOB 2P24B 5D5MF 3UJJL 5D1ZB 4N0RA 4ZTOL 5CJQH 2I5YL 4JY6B 35C8L 3VXRB 3HE6D 1X5KA 3WXWL 1QLFB 1AKJA 4WTWA 5D7IA 3ECBA 2WBWB 1YNLH 1QSZA 1LEGA 2COQA 4PJBB 1RUKH 1H0DA 3O2VH 5D1XD 1LO5B 3QDHA 1MFCH 2WK2A 5JZ7D 4CADA 1QBBA 1HILA 2WWKT 1KELH 2IALB 1TNNA 5EBLA 1RULH 2YKLL 3HAEA 5ETUA 1ZA6A 2XWJB 4PJ9B 3QAZB 2EICA 1IC5H 4U6XB 5I9QB 1AGFA 5F97E 1KENH 2QL1A 1JN6A 3SE9L 2GTWA 1WZKA 5KW9H 3JVGC 1OCWL 1H9VA 5I8KL 4LLYA 4PJIE 1JWMA 3KPNB 5CHNB 2R2EB 4JAMB 5E56A 3TN0A 3RWCA 2NLJB 3BKMH 3WNKA 3QH3A 3ZLQC 5IB2B 3PGCA 3O4LD 1AC6A 1UWXK 3CZFB 1N3NA 4FFZL 3UTSA 2QQNH 3LS4L 2FCBA 4LDLB 3LH2H 5KVGL 3G08A 5I75B 5HY9A 3GDBA 4MNGA 1QLRA 2JJSC 4NC0B 1OT1A 1VFMA 1CLZL 3K46A 3RY6C 5TQ2H 2X9YA 4RGND 3RZCA 4HIXH 1A6TB 4OLYL 4OF5A 5FUZL 2HT2C 3HA0A 1WF5A 3LHPL 5HGGS 5DHYB 4ENED 1U8NB 2PTUA 4X6EB 4JPVL 1WIUA 3S96B 1KCUL 2FJGA 1WZ1H 2A9NL 2OMNA 4QRUB 1BQHA 3GI8H 1OTSD 3MOBH 4HHAB 4K3EL 5FO7A 3T4AA 1ADQH 4UT6H 1CL7I 2H9GB 3D1MC 2IF7A 4O51B 4KRPC 4GW1B 1U3HB 3QEHA 2HTLD 4MQTB 1KCSL 1U58A 3M1BA 1CQKA 4H5SB 1F90H 3LN5A 3IT8D 4M1CC 1S78D 1MRDL 2DMBA 4FZEL 4HZAA 2DQIL 4JLRB 5A2FA 4MYWB 1SY6A 1QSED 3STLA 2HVJB 1RQ5A 1T21B 4GFTB 4RBPK 1HHKB 2XTLA 3QFDA 5IQ7H 4MDJA 2EC9T 4BZ1L 4YLQT 5FV2A 4H88H 4X6CB 3VXME 1KUMA 3FB6B 1HDMB 3E6FB 3MRHB 5GJSH 1G7LA 5TQ0H 4APQA 4OZGE 2OP4H 2X4PA 1HIMH 4TQEH 5FCSH 4F7PB 2DKSA 1EGJA 4XAWL 1NFDE 3TBTA 5KOMC 1YEIH 1TJGL 4I3SH 4G9FD 4Z7WB 4EDWL 3MRGB 3ZL4H 2E27H 3NAAH 1IL1A 5L0QB 4RRPA 5AEAA 1SM3H 5BS0A 1J0KA 5JTWA 4Z77A 3IFPA 3SKNB 5IMKA 5EOCH 1S9VB 3DROB 3HE6B 3F12A 1DBKH 5DJCB 1Z3GL 5CS7A 1OQXA 4NQDE 2H41A 4LP5A 4JREC 1EFQA 4QTIL 3MR9B 1R24B 1V05A 1JGVH 4RFOL 1K4DB 5D1XB 4ONOA 5I6XB 3QPXL 4HJGB 1RUPH 2D7QA 2GY5A 4PY8I 3ULUD 5BZWB 3DX8B 2GAZA 3MJ9H 3HLAA 4QLRA 4P2QE 3L9RA 3GBLA 1NCDH 2Q8BH 5HDQL 2A83A 4WU7A 2ZUVA 4YE4H 1HI6A 3CVHB 4H26A 4HKXB 5B38A 4Q9CA 3ZTJH 5E70A 4AQ1B 3P9MA 2EO9A 3A0OA 2E5EA 3CXHJ 1IQWH 5GSRA 4DK6A 2ADIB 1NQBA 2N4IA 2YR3A 3O4LB 1ZTXH 1FFNA 3E3QE 3BUYB 1OB1B 3OHXA 5DMGC 4ODTL 4DZBA 5F1IA 1N8ZA 1S9WB 1T66D 4RGNB 2ATPA 3FB5B 4F58H 2HKHL 1CL7L 1CGXA 5CZXC 2A77L 4M4RA 3SOBH 1BHGA 3FAWA 3RA7L 3FO0H 3MXWH 1HCVA 4C58B 2X4QB 5KVEH 1G7PA 1JVKA 4ZUUB 5SWSD 1FYHB 2NY0D 4M6AA 3X3GL 1RZ7H 4OIIL 3WO4C 4FTVD 3LN4B 4LGSB 5IB1B 1WBXA 3ARGA 5EZIL 4ZO8A 1YPZA 5DHVA 3BPOB 4BFIA 1NAKH 5E95B 1MFEH 1VB9A 2G5BA 1T2QH 4XCYB 4P23A 2DQTH 5L2JA 3EYOA 3PV7A 4LHUA 1ITCA 4TVPH 3TCLB 4OF7A 2OR9L 4GSDL 2CXGA 4DZ8A 2VB5A 5FKPB 5KTEL 1JWSB 4YFDB 5DRWB 1M71A 4KZDH 3I2CH 1QSEB 2R4SH 4PRPD 3DNKA 4CNIB 2EC8A 4CVUA 1D5ZB 1DSFL 1QSFD 5E8EB 4NZUL 5DZOA 3GUTA 4FQIL 4XNYL 4MD5A 2W0PA 5D8JL 3I75A 4RMWA 1R3JB 4HPYL 4FQQA 5T33L 4JY5H 3F6IA 3REWB 2JB5L 4U4BA 2XT1B 4UT9H 4PGCB 1CDCA 5DJAA 1N64H 4D8PA 4FQCL 4G9FB 4RAVB 1F3DH 4BQCA 5DR5H 2W0FA 3BP7B 5DJ0A 5MEPB 4PS4H 3PNWA 2YXFA 4P4RB 3CFDB 3RI5K 2WZPD 4EVNA 3H42H 3PWLB 4JGUA 3RWIA 5F7UA 5L7XL 3SCMA 3OKYA 4QHUB 3HZMA 5DJDB 5B8CA 1U8KA 5CINL 1W72B 2VQ1A 3AREC 1Z9MA 2VH5L 3PABA 5D2LF 5C0AD 2ESVD 2V17H 5A2LH 3S35H 5A43C 1P2CB 2UUDK 1UT9A 4MQXD 5GGVL 1R3IL 2DQJH 4BQ8A 1H3WM 1IILE 1G0YR 1YNTB 1YEEH 2GK0B 4YC2B 3IGAB 1OHQA 4K94L 3SGJA 1BWMA 3TT1L 1XCQB 1ZVSB 1BFSA 5ID1B 1JYXA 3D87B 3EZJB 1KJ3H 5T3XD 4YHOH 3GI9L 2E8YA 1X5ZA 4LVOC 5BJTB 3CSYA 2G75B 4W4NA 3DUUB 5CEZH 2BC4B 5T3ZH 3H3BC 4Z9KB 3X3FL 3THML 4U1MA 2OSLB 4L9LB 2X89D 3BYYA 4NGHH 2YXMA 3IDNB 2V5TA 2RJMA 4IS6A 2DRUA 5HBBA 1JFQH 3VXNA 1BFTA 1KG0A 4XVJL 2QR0A 2ED9A 1AI1H 4KHXL 2D03H 5D2NE 1YYLH 3HZKA 4FABH 1H3TA 5LBSL 5D70L 1HH6B 1I8IA 3QDME 3L3OB 2EYRA 4H1LH 5DWUL 1LK2A 4X5XA 5SWSB 2A6IA 2NY0B 3MRNB 4G80B 5E08L 3UTPE 3FRPA 3T0ED 3BN3B 5FKAA 1HYSD 4FTVB 4GMSL 2XZAL 4JRYE 4GRMA 5JOEA 4X7EC 1NC4D 4F8TA 4N90E 1A47A 1IZJA 4NSKA 5K59E 4YBLB 4K9EC 4RMSA 5HYQB 2BFVH 1KN2H 2UYLB 2JB6A 1ACYH 3MGAA 4YO0A 4Y1AA 3ZT6A 4UB0L 1CT8A 4URTB 2OJZH 4NKOB 3LEXB 5ESAB 4LAQH 1RURL 2LU7A 3FOLA 5J1TC 2BERA 4OSUH 2B4CC 5CP3H 4XP5H 3NGBB 4PRPB 4I13B 4WENB 3MLRH 4IOIA 1FAIH 5BQ7B 1AD9A 1A4JB 1QSFB 3ZO0A 5JIHA 1CGVA 1CFNB 3LCYA 4XP1H 5IROA 3KPQB 4OZIB 3MQIA 1X44A 3K3QA 3OR7B 3EW3B 3DYMA 4OI8A 3M8OL 5IK3A 1MLCA 3T2QA 2VLME 5JW5B 1MAMH 5CBEB 1BZ9A 4F9LC 1HE7A 4TUJB 3AU1B 3WO3B 3QIBA 5ICXB 4NWUL 2ADGB 1AXIB 3ULVF 5C0BA 3BIKB 3F7RA 3H7BA 1X4XA 1RJLA 4YXLL 2B4CL 4BM7A 3MGOA 3KWWA 3KDMA 1V3MA 2CLZB 2EDOA 4PJAB 4YDJB 5LWYH 2P8PB 4AEEA 3GMRA 4GG6E 3OSKA 2CDGA 4HIEB 1EUUA 2ESVB 4X98A 5GRVL 3AM8A 1LNUA 2ZPKH 1Y6NR 3H9SA 2CGRL 1JNNL 5DK2B 4JANA 4ZUVB 4PJCA 3SKJH 2XFXB 3UDWA 1UCBH 2VO5A 3DPBA 1LDPH 1QLEL 3T09A 3VGFA 5B3NA 1YYML 1BFOA 4FMFA 3F7PC 2GITB 4Z8FH 1KACB 5LGJB 4D0DA 2HT2D 1MF2H 4G8GD 5JQ6L 1L7IL 3D2UA 4OGYH 5DRZB 2P5WE 3IRPX 1GL4B 3P4MA 2IJ0C 4PGDA 1ZXQA 2K7QA 3UPRA 3BJ91 1B0GB 1VFOA 5GZNC 3FTGB 1Z6JT 2YD7A 3QDGD 3RX8A 4RGMB 1VFUA 1MCSA 4TUOA 2GJ6E 4KRPD 3LVEA 3RWGA 3ZYOA 2H8PB 2J5LC 2Z93B 3STZA 4M3JA 1HXMA 1D6EA 4XH2B 4DQOH 4M5YH 4IMLA 2CKNA 5GGQL 3V4VH 3VD5A 4M1CD 1H5BB 4Y5YB 3T0EB 4RISH 3HC0B 3U46A 3X17A 2APXA 5JIKA 4JFOB 1NC4B 4WTZG 3B9KA 3JWDH 3TEUA 5CZKA 4HWZA 4LRNL 2R56H 3NBNA 3MCLH 1MUJB 4UV4L 4P2RE 4HC1L 2R2CA 3TBYA 1J87A 3BVNB 3OJDA 4L8SB 1EA9C 3TCXA 5IESL 1CLYH 4GAJH 1JF1A 5DD0L 2Q7YA 1Y0LA 1NCBL 3KJ6H 5I71B 1J0HA 4M93C 3TO2B 4WW1A 5GRJL 1F45A 4Y7MA 1ZS8B 4WI2A 4QXGH 2OL3L 4LSQH 5F3HB 2XPGA 1PX4A 2X4OA 8FABB 4FP8L 4XXDA 5K9QG 3JWOC 2V9TA 5I1EL 1FVEB 5C07E 4KMQA 1DBML 1YN6A 1OAYL 4YWGL 1AXTH 2V2XA 4YX2L 3SDDC 2JELL 3HE7A 3ULVC 1MELA 3V4UL 4PLJC 5I8CB 3BJLA 2E6PA 3PWVA 4YDVB 3T0XA 5DEFB 2Y7QA 3ZDZE 3OJMB 1A7QL 2FBOJ 4U31A 5DQ9B 1YC7A 4QYOB 3WIIL 2AP2A 2I24N 4HUXB 5F72S 3EOBB 3DV4B 3QEUB 3QFJE 4LGPB 3PHOA 3DARA 3H9HA 3MXVL 1VADB 5JHDA 1ONQB 3QJHB 3FT2A 1IJ9A 1C12B 4Q6IC 5IHUH 1OGAE 3O11A 5C3LD 4JFYA 2ZOLB 2AS5M 4CVWA 5IGXH 4XWGL 4PRAB 5GHWH 3AAZA 5E5MA 1TCMA 3GSXA 3MBXH 5CZVL 1CDIA 4OQ1A 5I15L 4Y4HC 3MBEC 4OV5B 3DVGB 4OZHB 5DMGD 3FQXA 4U1HA 4XCCH 1HH9B 5AZEL 5JW4R 1P7HL 3IJYB 5FFLA 1II4E 4JFEE 4D0CB 1DQQB 1A6AA 4HG4J 2FB4H 2VDQH 4OI7A 4GG8A 2XZQH 4YPGA 1XF5A 4TSCL 5CZXD 4OM0L 2C1PA 2FJHA 2IFGA 3VG9C 4G8IA 3EFFB