3U1PA

Crystal structure of m. tuberculosis ld-transpeptidase type 2 with modified catalytic cysteine (c354)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
285
structure length
265
Chain Sequence
RYTLNATAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mycobacteria Tuberculosis LD-transpeptidase type 2
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
total genus 63
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3u1pA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u1pA01
4QRBA 5E51A 5LBGA 4QRAA 5E1IA 5LB1A 4A1IA 5DUJA 3U1QA 1Y7MA 4GSRA 4JMNA 4GSQA 3ZQDA 4QR7A 4XVOA 5DC2A 4LZHA 4LPQA 4ZFQA 2HKLA 4K73A 4A1JA 1ZATA 4GSUA 2MTZA 4A52A 5DZPA 3VAEA 5DZJA 3ZG4A 4A1KA 3TX4A 4HUCA 4QTFA 5DVPA 4HU2A 3VYNA 4Z7AA 3VYOA 5E5LA 5K69A 5DCCA 4JMXA 3TURA 5D7HA 3VYPA 3U1PA 3ZGPA 5DU7A 5E1GA
chains in the Genus database with same CATH superfamily
1HINH 4R83A 2BFVH 3B3IA 3AAZB 3JXAA 1LTXA 3GWJA 4H5SB 1EH9A 4XNQB 4NQEB 5D7SL 1KBWA 3L45A 5AL8A 3U4KA 1U3HC 2AKRB 2OMTA 4KVNH 4LLDB 5JYMA 5E2TH 3V55A 1LP9F 3FT3B 1MKFA 2P5WE 1BQUA 2OI9C 4PJAB 2H7WA 2EXWD 3U4EB 3L4TA 2R56H 3O0LA 4LSVL 4B5ZA 3P02A 5AWNL 4EUPB 1BXAA 2A6IA 1D2PA 1MY5A 4BKSC 5BQ7A 5KSUB 3VM5A 1NFKA 3ZDXB 2ZCZA 4JG9A 3L3HB 3LZFL 2GT9B 1PX8A 1DQMH 2VE6A 3PL6C 2BXZA 5TK4A 4TOYL 3SDAB 1NCTA 2P5WD 3UYPB 2GHWB 4U1NB 3KPNB 1PY9A 3QRFM 2PYEE 1HOEA 3POHA 5F7DA 1FORL 3TGXA 2DQEL 5C6PB 1MCBA 3ZTNL 5I82A 4GBXB 2ZJSL 3MV7E 1Z6JT 4MBOA 4E9TA 2EDBA 1NBCA 4YDNA 2CIKB 3NJVA 3BH8A 4IIQA 3Q2CA 4Z7QB 3GZPA 5EWIH 3BQUB 3MUGA 4BWWA 1OB1B 2X2UA 3IDXL 4YUEL 5H37G 2EDNA 2PYED 1OGTB 2UY6B 2D3JA 4P3DB 5KW9L 1NFDB 1IARB 1YEDA 2ZX8A 4Y4FA 3TT1L 3UTTE 4TVSa 1R3JB 4PRAB 3VFSB 1PGRB 4N68A 3D9AH 3M6DA 4PV1C 4YC2C 4L48A 5TTRA 1I7RB 2Z1KA 4X98A 5EA0L 1A6WH 3MREA 3QJXA 2XACC 2WLNA 1M53A 5F3HB 4BBWA 3B3BA 4FCHA 1PD1A 1CCZA 4YDIL 4Y5YB 3E3QE 4LBEB 3UTTD 1AO7A 1CGXA 1CK0L 1OARH 3BE1L 4X4XA 2F53B 4OCWH 1BVKB 3ZRFC 4S1RH 3F8UB 4WUUE 3OKDB 5IW1A 5EOCJ 1JHKH 4WI7A 1KCBA 1RZIB 3FTGB 3GSQA 5DEZA 4AIOA 1LNUA 4IEFA 5IFAL 4IS6A 4AQ1B 5I1CH 3OKNB 5F1NA 4P46C 2C9RA 2Z35B 1IBBA 1QTYT 3SBWC 2WN2A 4HHGA 4TUKH 1SDDA 2OSLA 2GJZA 3LKNA 5D7JB 3W82A 4B9CA 4UOW0 1NGYA 1NDMB 2V7HA 3K6FA 1XGPB 3S98A 3WDIA 1MHPH 1MCNA 2X4TA 2ITDB 3A67L 2A9DA 2F08A 3GSWA 4NM4H 4UCFA 4WUUD 1A21A 2WQXA 1CG9A 4X5XB 3BJLA 3N3EA 5LLIC 1X5KA 1Z9LA 3UAEA 3ZGIA 4WW2C 1J1OH 1J7VR 5HI5D 4ALAL 2VXQL 2KQMA 2NR6A 1H8LA 3O9WB 4UM9D 3SPGA 3TEXA 4H8PA 1FCCA 1ZT7B 2HWZL 3BAKA 3H3PH 1C8QA 3VFTA 5DHVA 5BNXD 2WLIB 3EOYG 4N2FA 3HAEB 1EMTH 5HYSG 4FQ2H 8FABA 5GGSA 5F0JB 3OAZK 2VDRB 2VDPH 4YR6B 4R97B 3D85D 3TBWA 3IAQA 4H88L 4I4WA 1HEZA 3BH9B 2E5EA 5ITBL 1WQVT 3OGCA 2YPKB 4BQBA 4JRYA 4PCKA 3UTQA 2J8UE 4ZOBA 1DJSA 4V1DE 4HSAC 1QRNB 2IANA 1AGEA 3SCMA 4A39A 3GKZA 2PXYA 3QQDA 1U30A 4POZD 3VG0L 1A7QL 1Q9WA 3HZ3A 3II2A 2OYMA 1XGYH 3L4CA 2QV2A 3APNA 2X4OA 4LASL 4OGAC 5D71L 3T0AA 1FG9C 4LARL 4DKTA 3NIDE 3WXVL 5C0GA 3GUTB 3MLXH 3WG7B 4YDVB 1DQTA 3HI5H 4Z7VE 3SIKA 4NC1C 3GB7B 4PJIB 3LEXB 4V1DD 1MCWM 5HYEA 3LNGA 4NZDA 1LO5A 2HCZX 4KUCF 4K55A 5I1HL 4OZGA 2XQ0A 2Z93A 1TF4A 2GC4C 3GGWB 4GRWB 1IILE 2KLRA 1LO2L 3SSGA 2H26A 1RXLA 1XXDC 2YWZA 3T0WA 5DHDA 4B60A 4M5ZH 1NGWB 4LVOC 2A6KB 4Y88A 4Y16D 2OMXA 2J4WH 4ISVA 2DIJA 5GSRA 3IU3A 4KTDH 1HKLL 2XV2A 3ZDZE 5K39A 4FXKB 5H94A 4HIEB 1TQVA 4DIXA 1HSBA 4NQSA 3QAQA 2BM3A 5K33A 1RK7A 3OKEB 2OAAA 2YQBA 2C3VA 2IPUG 2QQQA 3DV4B 1DSWA 5LBSH 4DETA 3VGEA 5HHQB 4N5UA 4L37B 4I18A 3NCFB 3VYNA 4JRXE 3P73B 3IETA 2YC1B 2VC2B 3WMPA 5C0DA 1E28A 1MEXL 1G7HA 1UZ8B 3RBGA 3UABA 2VRAA 4HCRA 4BZ2H 5IJVB 1JYNA 4U1MA 2NX5B 5FFOA 3O3BA 2E27H 3THML 2W0FB 4PJ7B 4CMHC 3X1NA 2Y3AA 2FE0A 5L6YH 1QSFB 1K6QL 5B21A 5MENA 1N4XL 3KYOA 1GAFL 1FV1A 4QTIH 4YHKL 4JRXD 5B39B 3EYOB 3QFGA 2C1PB 3M8OL 1GA2A 1IGJA 2C9XA 3HNVH 1U3HA 1JTTA 7PCYA 4XN1A 4GO8A 4YDJA 1SMOA 1JGDA 2CDGB 3V4PB 1ZV2A 2YKLL 3CFBB 3ATEA 1OSPH 4IYKA 1DQLH 5EORL 3FQYA 2HLEB 2ARJB 3SDAC 1NFAA 3C5XA 4AY0A 4HZLA 4M7LH 1U3NA 1KACB 3N50A 1BVNT 2K78A 1KPVB 4LHUA 5EEYA 3C08H 3IDMB 4KY1H 3T4AB 3PL6A 3OQRA 3HZMB 2Z9TA 4WWKB 4GBXC 2E4FA 5K1JA 4M4RA 3L5XH 3K91A 3MV8A 4NPYA 4BQ9A 3OLIA 1K4DB 4FFVD 4Z7AA 3MRNB 1G7JA 5FX3A 5B7FA 3ARBD 4E42A 1E0OB 3DECA 3N43F 4IW4C 2OSYA 4CADA 4ZQTA 2DRUA 2KI6A 3CFCL 1RUAH 3DA0A 1P5UC 4WTWA 3B83A 3ZT6A 3H9SB 1RU9H 2BINA 4JQIA 1E9QB 2WO2B 5EZLA 3IWUA 1MFDL 2XG4B 3ESMA 1GPOL 3GEFA 3RGHA 2OTPA 4KRMB 4JO2H 4DHLA 1OTUC 4XPAH 1S7RB 1WBXA 3D3VA 5J9PA 5B1AB 2GK0B 5F9WB 5I6XB 1UVQA 3IFOA 3KGSA 4ETQA 5JXAH 2EXSA 4WW2F 4X7DC 4QHKI 3AG3B 2VDRL 4FMKA 4RBPH 1CDBA 3JV4B 6PCYA 3UGUA 3GBML 3WDJA 1V7NL 4A7GF 3HR6A 4AQ8C 2AJYH 1AP2B 1XWVA 5K9JL 2P5WA 1P2CB 3SGKC 2XWCA 2QKSA 1J0YA 2RB8A 1DE4B 2DI8A 1J5DA 3UBXI 1MI5E 5DD0L 4GXVL 3VD2A 3B2VL 2XZCH 4I1PA 5ACZA 5F88B 3O45B 5GPRA 1I7UB 2NLJB 1MIML 1N8ZA 2IH3B 3UFIA 3DX4A 3TN0C 2GTZA 3T77A 5EU5B 5FECA 5D7JC 2AEPL 5T8IA 1OV8A 1ZSDB 1ZWIA 1EFXD 1WAEA 3BN3B 3NFSL 4LESA 2VXTL 4JLRB 4AENA 1YUHA 1KIUB 3WU1A 2PYEA 1QLRB 5GGRA 4X8GA 2YUZA 4TNVK 3SBWA 3EYVA 1FZJB 3EJQA 3QCVH 3IDGB 5IQMA 3L5IA 4KXAA 3MV7A 4RDQF 3O9WC 3WHE1 1F97A 4HKJB 5AW9B 3OPZH 4ZO6A 1S9YB 2B9AA 2YD9A 4NO0D 4DN4H 4WW2A 1UWXK 3BVVA 2VLJE 3LS5L 4X7SH 3LKPA 2OK0L 3SKUD 3EOTH 4XMWA 1A6ZB 4YSCA 2MCAA 4A7GA 3DI3B 4NIYE 1M3IA 4Y2DB 3L7FB 4JO1L 4Y5VA 1X5AA 2IV8A 4R97C 4XO9A 4E5XG 2F7RA 3P4MA 3UTTA 3TESA 4RA3A 1P4LB 1Z1WA 1D6VL 4E9VA 1QKZH 3L6FB 2HRLA 1ZS8A 1VCAA 5D55A 4S1DC 3GJFH 3DTXB 5FO2A 4FNPA 1ETA1 2DQTL 2VLJD 3QB7C 4XVSL 3U9PH 4HUVA 3BKYH 4P2OD 1J12A 5EUKB 3O3AA 3BIAX 4JGUA 3BHBA 1KLUB 5K93A 4FEIA 5D2NB 4G7VH 4UTAH 2Y4SA 2JCWA 5I8KH 3IXAB 3D33A 3MRBB 1R75A 4G6KL 1BLIA 4TLKA 2UZYA 3KE0A 3EDEA 2JJUA 4MA8H 4EVNA 5ADOH 1A0QL 4X9IA 2J1YA 3DX7B 1CT8A 1KN4L 3MJ9L 4WUUA 1JNLH 2J8UF 3O41B 1LEGA 3BWZA 3QNFA 3QEQE 4QYOB 4F7TB 5JR1L 4I85A 4BK5C 2Y72A 3QDAA 4WKZA 1NGXB 2ZCKL 3HS0A 2EDHA 1XSOA 4UM9A 1W8NA 5GXBB 3A6OA 2C5DC 4PGBA 1UYWL 2Y3NA 2Y7LA 3FCSB 3X12B 4HISA 1T1YA 4OW6A 3V4PL 2DJ4A 2F5BH 2X4QB 1AR1C 2HH0L 2ALWA 2VXQA 3BH4A 3QEQD 5AG9A 4WK0B 5DJZB 3QUMH 4A2FA 1GCFA 1GZPA 3S5LG 3D85A 2BLFA 1Q8MA 2BRQA 5FS5A 3S0PA 1W9XA 4JMNA 3Q8FA 2BY2A 3QYCA 4RWYH 4M62L 2FIKA 2V2WA 1V8HA 1A2YB 1B0IA 1DUZA 2WZ6A 1OK8A 1G7MA 2Z7UA 4TTDD 4TV3A 3H1ZA 2BHFA 4IU2B 4UINH 1ZTXL 5ID0B 4KX8A 3LEYL 5IHUL 1YY9C 4G7YL 4DQAA 4UMSA 1I9IL 3HCVA 5T5FA 5E2JA 3RDTD 3BD5A 5AALA 4EXPX 1WJ3A 5L0QB 2HZHA 4KKPA 1GHFH 2J8UA 2UZXA 1NCBH 1UZ6E 3QXWA 4NZRH 5FUCE 4KXZI 5KVEE 3TJPA 1WFOA 4Z7QF 1NMBH 5HGGS 3RL2B 4MX7B 2COQA 5I1DB 7TAAA 5F72S 4POUB 5GGSY 1NFDF 4XNQA 3ATBA 4P57A 3UJJL 3BVTA 1I4FB 2AKRA 3ZYZA 2ED6A 2MNUA 1Q9LA 4G8EB 4LLDA 1L5GB 1N5YH 1P4BL 3FT3A 4WFEE 4PU2A 1ZVNA 3VH8B 1UCBH 1DVSA 4JRFA 4WTQA 4FULA 4GKNA 3MRJB 4P9MH 2P4AB 4MD0B 5DEFB 1MCSA 3LYRA 1BAGA 2AEIT 4W4OC 3LHPL 4R26H 4C83A 2XTJE 4P3CH 1T66D 4PY7A 4HBQA 3H85A 4MHHI 1FL5B 5I5MA 4N0UA 4YSTA 4S0TD 4WFED 4MLSA 3UYPA 1HSAA 1GYCA 5EIIB 5AKSA 3FN9A 1J5IA 3QWQB 2TRYA 5IB5A 1HZLA 3GRWL 1OWWA 3B2PA 1ET5A 1T7ZA 3ILQD 1GKOA 4F5CE 4O5LL 1D5BA 4G3YH 3FQ2A 4KI5F 2XTJD 5JDJA 1CICC 4FQXD 4R5VA 1UOWA 1AG6A 2BY1A 1XGQA 2YAFA 2YRLA 4OZHB 4XP9L 1IX2A 2MCMA 1J9TA 1NMCB 4OJAA 2XPGA 2Y7QA 5F2FA 1P5UA 1YNTA 5AVUB 1QACA 4AQZA 3CDZB 5B38B 2AEOA 5FKAB 4GT7A 4B53A 4ZD3H 1ETZB 3O2WL 5CN1A 4TLUA 3V6OE 5F9WC 1NFDA 5I6XC 2IAMB 3ARDD 3D18A 1K4CA 3PWLB 3P9LB 3U0PA 2HAZA 3WAJA 5A1AA 2XTLA 4XMLL 5ISZE 1EIBA 2PP9A 4UIKH 1TJHH 4C57C 2CKNA 4KQ3H 2QDWA 5KYYA 2WTRA 2Z1PA 3OC5A 3UG5A 2NY2B 2Z31B 1O6SB 4JFDE 4NC2B 2N1TE 1ACYH 3B9KD 1HT6A 3S3BB 2XWZA 1MCKA 1TNNA 3EJRA 1ZHKA 2B59B 3RFRA 3Q0HA 4AQ8A 4CC4C 5D2LE 5D96C 5LGJA 1IC4H 1SYVB 1ITBB 5I0ZA 4RISL 3AG2B 3ILQC 1R47A 4KH9A 2YGVA 2WKOF 5ISZD 4HOMA 5EBWA 3W57A 3H42L 4LCYA 1P9MC 2XN9E 3ML8A 1XCTB 5GS0H 3AT8A 2VMCA 2YN3A 3WE1A 1BA9A 4JFDD 3GTTA 4XWOD 1TOXA 3GXIA 4KU1A 3JSSA 1TZIB 3ELAT 3V4LA 1PG7L 1T1ZB 3IPBA 3EIFA 3L3OB 4YHNA 3TN0A 3UERA 5DRXA 5GGTH 1WFTA 2QL1A 3QO0A 4ZUSB 1AQKH 4P2RB 3INOA 4J23A 1MCCA 3GI9L 4KTYA 3PHOB 2XN9D 3ZG4A 3CXHJ 3DYMA 3WN6A 4M43L 4W6WB 3QFJB 4GQZA 4MCZB 4XBEH 4IRSC 1JZ7A 3ARTA 1UOVA 4U2ZA 2EDYA 3DIVA 3APMA 3V6OC 4JEGB 2BVPA 1SXCA 1CS6A 2MOGA 5ABDE 5CLWA 4GRWF 1J8RA 4RMQA 2K45A 1E4XL 4D7PA 2JLLA 4PGEA 4A7SA 3P4NB 4JPVH 4JZNB 2F5AH 1BJ8A 4ZFZA 2G9HA 4XGZB 5F0MB 5HHOB 3TEZA 3BOVA 2GIYA 4LK4A 1NFIB 2MQCA 4FXTA 4A63A 2WKOA 4K71B 5DEGA 2EDFA 2OR9L 5D2NC 3RKPA 3V5KB 3A23A 3QHTC 4ODSL 4GRLB 2CLVB 2M1KA 3BUTA 4MJIB 3U25A 1EFXA 1ZT1A 3GM0A 2VUYA 3GXDA 3OR7B 2P43B 5CZVL 3EBIA 1UOKA 2OMNA 3CWGA 3FN3A 1MI5A 4EZLA 3PGFL 1A4KB 1JZ5A 4MGXA 1OQOA 1W91A 1DDHB 3KHOA 1C5CH 4PCYA 2VH5H 4PJ7F 5EZPA 3BEVA 1TVHB 4HUWA 2DWDA 5DDHB 4P4KB 1CFQA 3L5WB 3KLAA 4DF9A 1CE1L 4LPVA 2FO8A 1ETJA 3T0XA 1LWJA 3ATFA 4BUQA 3OD3A 2ICEC 4QRPE 4WI0A 4CILA 1QVOB 4PJCB 4U0RC 1NSNL 2N0MA 4H1LA 3NG5A 4JM4H 1IEAA 4UQEA 5FXCH 3VRJA 4PI0A 3QHFH 4IBTA 2W91A 4AKPA 1CD9B 3SKNA 5F70A 2BMKB 5JQ6L 4NM8L 4QMEA 5IK3A 1YYLH 4QR7A 1F42A 3BZ4A 4G6MH 5JHMA 4UAOB 4AV0A 3QQ3B 4X4KA 2XU9A 3CIQA 2YPLE 3BZFB 4KV5E 4P2OA 4QRPD 4Q4IA 1MCIA 4QXGL 4KPHH 1QA9B 2XG5A 3STLA 1A3RL 1I3VA 3ZT5A 1U41A 4MKTA 4N1CA 5D70L 2KS0A 5EDSA 1G9EA 4J12A 3CGTA 1M2OA 5GGRY 1QPKA 2ZYRA 3LQMA 5L0QC 5INDA 5IFHH 4RFOH 5MEQB 2NUPB 1FPTL 3HE6D 4ZXBD 2B1OA 2KUTA 2HRPL 2YPLD 4LE8A 3LMJH 1S7VB 4OLWH 1UZGA 2VDOB 5BXFB 5AUMA 3MJ9A 2B77A 5GGVL 1CFNA 3V0AC 2EO9A 2VZTA 2ZUQB 3PIQA 4FD0A 3DRTA 3K6DA 2MMXA 2YD2A 4CVXA 5DD6B 1AH1A 4RGNB 5KTEL 3FSAA 3QEQA 4L3CA 2JVUA 5ADPH 4OCRL 5HYJB 3TFKC 3T8XA 1FL6A 3MRLB 2CDGA 2QFRA 2VKXA 3NIGB 4WU7B 2WXOA 5D4IA 3ZR6A 1E4KA 4LFHD 3IKCA 1WEJL 1A4CA 3SJVE 5E8OA 2E7DA 1DJZA 1N18A 5CJQH 2ARJA 2XXFA 3ES6B 1SBBA 3UJIH 4PTTA 3IF1A 3U82B 1V3KA 2AGJH 4KNSA 5D7IE 4HPOH 1F86A 4LCWB 2G3MA 1YO4A 4HYTB 1QG3A 2LVEA 4N28A 4K9EH 5KJRH 2YRPA 1ASOA 1AQDB 4IGBB 3SJVD 1ROWA 4YZFE 1PEZA 4BZ1L 4LPTA 5IW6A 4JDTH 4FQIL 5JIIA 2J6EH 3UBXG 4KXZH 3PF2A 3W39A 4MFHA 2Q7YB 5I9QC 5KVDE 1D5ZA 1CICA 2TSBA 1I82A 3HUJE 1MNUH 2XG4A 5LKNA 4X0KA 2YRBA 5E6ID 5F3BB 2ENQA 2JJVA 4XTRC 3AG1B 3LTVA 3QORC 4HIIA 4PWIA 4XCNB 1FH2A 3NABL 2ZWYA 5DMJB 3BRFA 4N2GA 3S4SG 2OMVA 2NY2C 3UPRB 4NO2B 4PJXB 5DT1L 4QJ4B 4G42B 3V95A 3ET9F 5JA8B 2JTYA 1PU0A 3VW3H 1HWGB 2OZ4L 3IFPA 1URLA 2WBWB 2F58H 4X6FB 2K6WA 1WLHA 4OAWA 5E1AA 4ONHA 5C7ZA 4NBZB 4LDLB 2DV6A 1TFPA 2AZUA 1P2CA 3VSVA 3W81A 2X87A 1BEYL 4CC4A 4LSDA 1D5MB 3ARYA 4PB9L 3CN0A 5IFJB 4KUZL 1YEHL 3VXQA 2ZCLH 3L3OC 4UI2A 4PV9B 2YMTA 3L1OL 1FFQA 4DGUA 5DJYB 1K3ZA 4OLZL 3EO9L 1U6AH 1EZVY 2R2HA 4R7XA 1BECA 2P24A 3CMGA 4RETB 3F2LA 2CHZA 1CTMA 4HV8A 4A7VA 1XAKA 2MQ0A 5JDSA 2GCYA 4RBPK 3RHWF 3VI3E 2ZNWA 4JB9H 4L8DB 3NACL 3GPEA 4DKAA 3T1WA 3K5RA 4XMPL 4LGSB 1PNCA 2NY5H 4F5CA 2W0LA 3TYFB 2BOCA 3DETD 1M42A 5TH2A 1WA2X 4HOZA 2NSQA 4WGKA 5HTSA 5A2CA 3BVNA 1JFHA 2GJPA 2V2XB 4DW2L 5ANMB 3NESA 4N2OA 4IRSA 3L3GB 4A2DA 2BSTA 3BAIA 5C0RL 3B9KA 3EBGA 2AVGA 2H1LM 3V6OA 3BP6A 3L4XA 1B4JH 3HI6L 3FMGL 5GHWL 5AVRB 4ONGH 2W8CA 2QGCA 4LL4A 1YNKH 3I6LE 3F7LA 4K94H 4K71C 5ISZA 3HNSL 2EYSB 2IWFA 4OCLC 4UV7H 3VQ2C 1P6WA 3B7SA 2EIEA 2UXVA 3LNFA 1FN4A 4X80L 3VDAA 4HSQA 4GRLC 5FF6A 2YFNA 4YVUA 1EJFA 3KGTA 2PCXA 4QRTA 1C5BL 5BPPA 2EIJB 4M1DL 1BVLA 4ZOCA 3WUZA 1MJ8H 1IMHC 1M7IB 5D7LB 3QQ4B 3I6LD 2VDQH 4MD5B 1KBGH 3MRQB 3C5SB 4JPIB 4UANA 3Q44A 4G1MB 1MRDL 3ZKND 1DYZA 1QI4A 5L4FA 4MXQD 3FUNA 4BH8A 2IWKA 2Q9OA 1F11B 4IOSD 3PWVB 4O58L 4KDTC 4K2UL 3X14B 2DBLH 1A6AB 2PO6B 3FJTA 3QRGH 1GZQA 4RIRB 3AG4B 3FO1A 3W9DA 2CA4A 3SD5A 5I66B 4M61B 4Z1PA 3GJFK 4GOSA 4LSTL 3IJYB 3LZQA 3P30H 3EGDB 5KANG 1UGKA 2ICEA 3EYUH 3ZRSA 1DVUA 2MKLC 1P7QD 1UEMA 2X44D 4H8QA 1MVFA 1QW8A 3BISA 3WFBL 4AZ8B 2IALA 4JFQB 4J3TA 2E6JA 4J6RL 2H41A 2VN3A 4UMGA 6FABH 1ZVYA 1QRKA 2EQDA 4P2AA 2X6BA 4M02A 3A6CL 1Y0LA 2WWOA 3ROLA 1PZAA 4QRUB 4HWBH 2YMXH 4QT5A 1M71B 3OKOB 4IBZA 3AQDA 4N8CH 5MERB 2YD7A 5I8OL 1JDDA 4YPGA 3RY6A 3HJEA 3LIZL 1OL0A 5DJAA 1HILB 4MXQC 1RFDL 5DSCA 5KSAB 1YEKH 1XAUA 1PFOA 1VGEL 5DUMH 5HDQH 4B41A 4JVWA 2DQDH 4XN2A 3P0YL 2CLRB 4ZX5A 1JFQH 4OZHF 3ESVF 1JV5A 1RZGA 1JZEA 4X9FA 5EN2B 1NPJA 3NCCB 1IC7H 4YXKL 1TVBA 1OK0A 1JGIA 4UQ3A 3IMSA 1JK8A 3ROOA 1DQKA 1NEUA 2AQ3A 1OW0C 3MLYL 2NY7H 1SEQH 5IIEB 1RHFA 1TETL 3K6SB 3UTSB 1AXSB 1CIDA 2XYBA 3H9ZA 3F7RA 3JV5A 3QH3B 5IT2H 2YOCA 4GEIA 3FPYA 4WZ9A 2E56A 3RE0A 4ZFOL 1KJVA 3VH8A 5J3HD 2TRHA 3PGCB 2XKNB 3KM1A 1AKJB 4HKZB 1RI8A 3OXSB 1G1CA 4QRPA 3UMTA 1JXFA 4M3KB 4IOFC 2WLKA 1FFNA 4YFDB 2LU7A 1IGIL 4NT6A 3RTLA 1FO0L 2ZOLB 2EKSB 3HZVA 3IJ7A 3QQ9D 1IAIL 2CO1A 1XMWA 3FNKA 4IGBC 3B2DC 2F61A 2W0PA 1ILSA 4NNYB 1FF5A 2XIDA 2FHFA 1IUZA 4XXDB 4N6RB 2YPLA 4X6EB 4TPRL 5ESVA 5I1JH 1EZSA 4MDJA 4QXTA 4BM7A 5D7IF 4FLOA 3TCLB 2O5ZH 5F7KC 5KYUA 3WIIH 4AGQA 1JSYA 1HQ4A 1DBJH 3BPCA 4LPCA 4W9HC 3HC3L 3MU3A 1ACZA 5DRWB 5EU3A 2E7CA 4ZJ9A 2W94A 3UG4A 1BXVA 1ZLDA 4HWZA 3QDJE 3PP4L 1U2YA 1XH0A 4OZ4B 3MAWA 2NYKA 4YDZA 1LQSR 4PHZA 2AJXL 1XSKA 3QORA 3UZVA 3GEWB 1F6FB 3GSUA 2BP0A 1YEGL 2OZNA 5MEOA 4S10A 3EJCA 1KB5H 3TP4A 5I19L 4NDMB 1SJXA 2IPKB 3UDWC 1NKGA 2YEQA 3WGUB 3QDJD 3DUUA 4G5AA 4E9LA 2IH9A 1MFBH 1MAML 3CNKA 1TEFA 5CUSL 3SY0B 1YQVH 1AGDB 5DGQA 1WGVA 3SJVA 2AK4E 3I74A 1T6WA 3KYNB 1Q9OB 2BERA 2FX9L 2ZYHA 3I9AA 5IGXH 3ZQWA 5IREA 4R7VA 4HH8A 3WI9A 5FYLH 3T65A 2A4EA 4AGMA 3N0PB 5EEWA 1KG0A 5E08H 3DO4A 1IM3D 1XR9B 1B4RA 5D7IA 4A1JA 4OCSH 1HJBC 3OAUH 3NZHH 3KYMB 1TTUA 2KDYA 3M86A 4XPGL 3RNQB 3TA3B 4M6AA 3GS7A 1CDCA 4BZ1A 4F7PA 3OVUB 2QPFA 2I9TB 3GYRA 2XXGA 2BIQA 3SOBL 1OPOA 2A6DB 4LOUC 3HG1A 5CIPB 1GCYA 2KDGA 3QP3A 4GSDH 4QF1A 2FECL 1PZCA 5CEXB 4PJCF 3NSCA 3GDBA 4PJDE 5JZ7C 3D4GA 3HUJA 5DFVC 5AZUA 2Q7AA 3VI3F 3K7UA 1IFGA 3C5JA 3IGAA 1TR7A 2PABA 3FUKA 1FZKB 2W65A 4XN9A 5KUMA 3SDYL 5JPNB 2ZSWA 3FB6A 3MXWH 3FB5A 2DMCA 1NMAH 1NIBA 4GP8B 4NQXB 4TUJB 1BF2A 4ZUWA 2XYCA 1VSCA 3KXFB 3F5WB 5T1LA 1HDMA 3JWOL 2OZ4A 5EF3A 1FI8C 4ELMB 2BNRB 2AXGA 5DHMC 1VRSA 1HYRC 1QEXA 2LFGA 1L9NA 2PF6A 2XZQH 2XN1A 4JG1H 4J8QA 3WNIA 3STBA 4X5WB 2OQJB 3VFVB 2YS4A 2E9JA 3Q43A 4HAKA 3KAAA 3FU6A 1PD0A 3NEXA 4PRID 4HPYL 3WS6C 3CVIL 1KCVL 2FZ3A 2JB5H 3ATAA 1W0WB 1MFEL 5FOBA 1KIRB 4M1CC 4Q9CA 2D7QA 4KO6A 4XMTA 5KBLA 2XA8L 4U3SB 3TO2A 1G6RH 4YDKL 1J0HA 4DVRH 3PHQA 3M1OA 1FNHA 1S9VB 2X89A 4PWFA 2O93L 1TTBA 2BIHA 3X13A 2HG5B 2XFXA 4KVCH 3SE8L 5FO9B 3QJRB 5HHPB 2AV1A 4DO6A 2YGOA 4KDTA 4WFHE 4AL8L 3R0MA 4EQ3A 1R17A 4HH9B 1W0VB 5FYJL 3VI3A 1OCWL 4JFFE 1DLHB 1MCQA 3STZB 4MNGB 4E41A 3FSWA 1QFPA 3NIGF 4RMVA 2H3KA 1AMXA 4AMKL 2NY6D 1UJ3B 4K5PA 5BS0B 3OKLA 1VADB 1DVFB 3JWOC 1MCOL 3MYJA 4BKTC 2XY1A 3AS3A 1BIHA 4LEEA 1D9KD 4NQCB 3MHZA 4WFHD 1AOZA 3X11A 5T1MA 4UT9H 1Z7JA 3VXOA 4JFFD 3W1ZA 4U4IA 2ITCB 3PY9A 1TQCB 1RP9A 4QKTA 1Q1JL 3U6XS 3S6CA 3PCYA 3L1EA 1DVZA 3IN0A 1G4MA 5FWRA 3PG2A 4GQ9H 3FSOA 1IKNC 3RIFK 1EO8L 3L4WA 1TO4A 3WL9B 3QWRA 3Q2VA 4IOSA 2FD6L 5F9DC 2GSGB 3NPSB 1GC1H 1EHLH 2ZXCA 1CUOA 1M6OA 4HS3A 5E9DB 4Z3GA 1Q9KB 1VERA 4YVNA 1DQIA 4P05A 1T89A 1I7ZA 1JZIA 1RJLB 5CJXA 3HB3B 5C0EB 2MCPH 1NIAA 2HG0A 2GUOA 2WY3B 4JREC 3U30B 4JZOA 4A68A 2X41A 3GXUB 4EI6A 2VERN 3GO1L 4HX1B 1OW0A 3OTTA 5CBEA 2VXVH 4IKJA 4AL8C 4PS8A 5ACLA 3DOSA 2F7PA 1LEKB 3IYLW 4ZI8A 1BZ8A 5I0XA 2JKIS 3FQWB 1MHCB 4K3DL 5FGRA 1DBKL 3HKFA 1S7SB 1FJ1B 4CN6A 1SJMA 4DKFL 5BOJA 4HJGB 1R3IH 2JJSC 4QCIB 4X4ZA 1MQKH 5CMAB 3PAUA 1JIBA 4V1DB 3KH3A 3P3SA 5EZOH 3PJLA 3VXUE 2F19H 1GGCL 3O2VH 12E8H 5C71A 3DV6B 3KDPB 1XB3A 4WTZA 4QKXB 5AZEL 4DN3H 4X99B 2CIIA 2AABL 3BKJH 1P7HL 3UXFA 2IFFH 3ZE1E 3K3QA 2P7TA 5FB8B 4TQ8A 5C2UB 5FK9A 3RX7A 3V6ZA 1Z3GL 4Z7VB 3LIZA 4Y16B 3RRQA 2R1XB 4M6ML 2D7PA 2WYTA 4PJGB 3DGGB 3ZL2A 1N0LB 5DRZB 5JHDB 5C86A 1YA5A 4IHBA 3EYFB 2O6CA 3OXRA 1QUPA 4ODWB 4I3SH 5LAXB 2QLVB 4ODVL 1BQHG 4FMVA 4YO0A 1AFVH 3NFPA 2E86A 5KG9B 3WUWA 5DTFB 2RHEA 2FTAA 4NN7C 3X3FL 1A7NL 1H3PL 4HFUL 4NWUH 4OJFH 3DJSA 5DMGC 1HCYA 1U8NB 3CHSA 4JL2A 2BX5A 1SJHB 3GINA 3D7PA 1AHWB 4KHTL 4LVHB 3RGVB 3GMNB 2FX8H 5DS1A 4ZFOA 4AUJA 3PV6B 4AVIA 1CZ8L 5B3JF 3QC5X 1LMKA 1JVKA 1NEPA 3MROB 2VITB 3HMXA 4JCMA 3T2OA 5HYQB 2X70B 4HT1H 3FF8A 3KPPB 1T21B 3WHE0 1BLNA 2WJ7A 3LQAH 3NK4A 3SKMA 5FPIA 1V7MH 1NIEA 2GC7C 1UB6A 2Q86B 3VFNB 1KNOA 5C8JA 4JRXB 5AAWA 4ZX6A 3S88H 5TPWH 4G8GD 1FO0A 5DMYA 2FL5A 2LW3A 1S46A 2X9ZA 3MA7A 3UO1H 4PV9A 4OUOA 2X7LA 3CVHB 5D9SB 4PJBE 1L9MA 3WY3A 5CD5D 3BLPX 1QBLH 4MZRA 4NXKA 3ABMB 2J55A 1H0DA 4M3JA 1KWKA 4U1KA 4O02L 5F6HI 1U8OB 5GZOC 3LZRA 1YECL 2WLLB 2ZWKA 4JVUA 1P69B 2KKQA 1JGLH 3A5VA 4P4RB 5I1KH 3BDBA 1CBVH 1RUKH 2QADC 3FN0L 3MRDA 4X6DE 2J44A 5JPNC 3LS4H 4BYHA 2R59A 1SF5A 4LRNH 2Z8WC 1IGFH 3MLWH 2R1YB 3RY4A 5FHAL 4DP4X 1RIVL 4Q6IC 1DVTA 3ARBB 3HNTH 4TSCH 5CD3A 1LO3L 5DZAA 3QDJA 4CU6A 1J1PH 2XTSA 4K4KA 3UC0L 4F2ME 5IQ9A 1WBYA 1UM5H 3JTTA 4OZFH 4XVJH 5CILH 5D1ZC 2GJJA 3QXVA 3VTTA 3EGXB 3RWCB 3MKKA 2VR4A 3RB5A 4O2EA 4H2CA 3MODH 3ILPA 4OB5L 4DVBA 1NUGA 4MD4A 1MFCH 1V3JA 1SOSA 3HVNA 1HVXA 3ARED 3FO0H 4MMYA 1JVOA 2CDFA 5FGSA 4NKMB 2XY2A 3ARGD 3AQZA 3NYKA 4JCLA 4NKDA 3CFEA 2PWDA 3MLVL 5F7EL 2VCOA 3GHEL 2WBJC 1U42A 3AWEA 5FUOL 1DFXA 4LLMB 1TU2A 4RFNC 1JPTH 5GGVY 4YPJA 3WJLC 4DPBX 2OXGB 2CKBB 2AK4A 2XI9A 4F8NA 2D3LA 1UJTA 2VAAB 4JFOB 5KZCD 4WU5B 1NEZB 5GJSH 3TPKA 2CR6A 2G0KA 1YDPB 2WVVA 1MJ7H 5L9DL 3BUYA 3O8XB 4LSPL 1HZHH 4LKCA 2YLHA 3CFQA 4G6JL 4JKNA 2B39A 4D0CB 3WLWD 1UM6L 3BN9D 1V10A 4RIRA 1TQSA 4EI5C 1QQDA 2A5UA 3MLTA 4P5KA 4WSKA 1EAPA 2J3SA 1IE4A 2Y1ZA 2EH8H 1T5WB 2F15A 5GRZA 3VGAB 5CHNB 5FDWB 4M7LT 1UJ3C 4LRIC 2R69L 3LRSB 1NICA 1DVFC 2ATPA 2A73B 3VFGL 2UVFA 2IG2L 4ACPA 4PJDA 5DD5L 2KH2B 4FFWD 3RVUD 4KMQA 1M7DB 2WQRA 5DUBB 1G9NH 1TYRA 1KB9K 2DD8H 3WFCH 2WLZA 3GSVA 4OY9A 1JGEA 4L0ZA 4JFVA 4NO0B 1YAZA 4FQ1H 3C6EA 1K8DA 4MQXC 4R90H 4MXWH 3FBQA 5JLZA 1MJUH 2EE6A 1FFPB 1ZTMA 4G71B 4BH7B 5E8NA 4OIIH 3CXDH 2W60A 2YHGA 2FWOB 4PLNC 4F7MA 4DK3A 3TT3H 5DCCA 3WLWC 1IKNA 1HHKB 3HB3C 4ZMNA 3SDXE 3JV6B 5DQ9B 2N59A 2D7MA 2CUHA 4HSCX 4YSQA 2FVNA 4CJ1A 4ODTL 4GAGL 3IFNL 1CGUA 1KLFA 1U8IA 4GQQA 2DLEA 2K4WA 1AXTH 2LLLA 2VRKA 3O6FD 4HMDA 3U36A 3AC0A 4A7TA 4WV1C 1KTBA 3KBHE 3EJSA 4PTUA 2ZUUA 1BVOA 1SVBA 4JUTA 2R0KL 1ZHBA 4L1DA 5SX5H 3Q2NA 3RVUC 5FCUH 3W2DL 1WCBB 1BQLH 4QWWD 3AJ7A 3GIZL 4DCQA 1U58A 5C0BD 5FW7A 2R8SL 4IQHA 4HK0B 2R23A 1D9KA 4RX4A 5CSZA 5E8PA 1U91A 3ZZLA 3MCYA 2HVJB 3O4OB 3FRPA 4JKWA 4ZSOB 5FW8A 1X5HA 4N85A 1Z5LA 4PMEA 2BHZA 4AW4A 4LQ1A 1HHIA 2JJSA 3IKKA 1AZRA 3IN2A 3AFLA 1BOYA 1T0MB 2ZOLA 3D6GA 3QZWB 2VN6A 2EKSA 4F33A 3I50H 5C92A 2A6JB 3FUDA 4QNPF 5IMKA 5JW4Q 4JM2C 5F9AC 1CFTA 2WHVA 4JNXA 2IDQA 4XMZA 4PRHE 4YQXH 2J1WA 5E8EB 2YXWA 4TSAH 2P52A 3CLWA 5EO0A 4OZFG 4IKLA 5L88H 1CFMA 3P40A 4W93A 3GHBL 5CN2A 4YGVB 1ZHLB 3HBGA 1OGSA 1ORSA 4FYQA 3D2UD 4B7LA 5DFTA 5DGRA 2YD4A 3CFMA 4H26A 4EEEA 4JG0H 5E24E 3CU7A 2VSMB 2PPCA 2WBXA 1FVEB 2E6QA 4Q8BA 3OKKA 1PKQE 4JPWL 4PRHD 2XXCB 1H19A 1WZ1H 4OKVB 5AOKA 5TF1L 2WBKA 2DL2A 1ADQL 5E2TL 1IU1A 2HLAB 2EDLA 4WY7H 4FLHA 3RGVC 3SKOB 2VL5A 3RDTB 2R56L 1TKWB 3CZGA 2GJRA 5I8EB 3DRQA 3TNMB 3G6DH 1U8HB 3T08A 4PJ5E 4N2IA 5SWQA 4NZTH 5FO8A 1G9MH 4PJFE 3G9AB 4PJ8B 1G94A 1NOFA 1KBVA 3TPUB 3DGCR 1QLEH 1DJGA 3BGFB 4YE4H 4ELMF 4Y1AE 3INUL 4KRPD 3P9MB 1CDUA 2FEEL 1XGZA 5ID1A 5EFIB 5JIDA 1EXHA 4AIEA 3NBNA 4PYHA 4X6BA 4AITA 3AB0B 2HKHH 2R39A 1PYWB 1THCA 4NQVB 4PJ5D 1RURH 3EJZC 1JERA 1CFSA 5BMFH 5IOPB 3VXUA 5L2KE 2HX9A 3VFWB 5HVHB 3H7BB 2CK0H 3FOLA 3KJ6L 3REVB 2MPAH 1MJJA 3EF4A 3GMQA 5DA0B 3S36H 3LKOB 4ZFGL 5EWIL 1F6LL 4XN8A 3HFML 1GIGH 5SWSE 1RZFH 2KQNA 3P2TA 2IADB 5GZOA 2Q2LA 4AXWB 4P3WA 2KYIA 4PVNA 3C5ZD 5K9KA 4I48B 4WI8A 3BD3A 5AYTA 4CDGC 4HCRH 3HOGA 4V33A 5L2KD 2CM6A 2GI7A 2OMZA 3D9AL 3HC0A 1ZIAA 3WLBB 2CALA 3EO0A 4NHUA 4NRXA 1WDAA 3TF7C 2D31B 2QEJA 4QTFA 3PDOA 1I3RA 5I6LA 3FB8B 1FZKA 2GAZA 5CEZL 1BBJA 2RCSL 3QZMA 4W9CC 1XGUA 4FQXB 1CQYA 5C0CE 1VFOA 4Q6IA 3MGAA 5SWSD 2VJXA 3L54A 3FU7A 3R7RA 2J1XA 3AT0A 3PWJA 1RUPH 3ULUD 5D1ZA 4IJTA 5F7UA 4OCWL 4K7FA 5D6CA 2ADFH 5ITFB 5H2BB 3ERXA 1HXKA 3RU8H 2FWSA 2B2XL 3ARDB 2BC4A 4OCXH 4E9YA 3FFCE 1XF4B 2PP7A 2XJKA 5I1CL 4LCCA 5C0CD 5LHDA 1T7WA 3PRZA 5G4NA 2AAAA 3K8MA 4L4VE 1ACXA 4KZEH 3JWNH 4OZIF 4FG6D 5LGHH 5F7HA 4JKPL 3V0DA 4HCFA 2WBJA 3O8XC 3QDHA 5E5UB 1EDHA 1N3NB 4HJ0C 3WKQA 3RFZA 3WJLA 2HKFL 5ERWB 3RI5F 3UZEC 1ZGLM 4FYTA 1IQDA 2ED8A 1DBML 1XMEB 3CFIC 3FFCD 3OKYA 4Z3EA 1JK9A 4O02A 4PJBA 2L7EA 5I16B 1AY1H 4GMTL 4PRBB 4RWHA 1N10A 5FO9A 2WINA 2Z3FA 3K81A 4XO8A 4S1QH 2E8YA 3BVWA 1J18A 4ZS6D 3H3PL 3ZE2E 4JFDB 2BDNL 5I5RA 4OV5B 1BFVH 4BQCA 2G2NA 2VR5A 3D50A 4EI5A 2BWIA 5IEKB 1H3WM 2VABA 1VKXB 1EMTL 3I6GA 3KL3A 4FQ2L 4H8WL 4LU5H 4N4YB 4UV4H 5FA4A 1FLTX 3S3CB 3C2AL 4FQQA 2FR4B 4PG2C 5D2LB 1YPZB 2VDPL 4X6DA 2QPDB 5BS0A 4LRIA 3CV5A 1WHPA 5D7SH 2ADJA 4CA4A 3CG8A 3VXTA 2XN9B 2ZYIA 4JFYA 1N5AB 5ETUB 5LNGA 4WAFA 3TIDB 1AGCA 4PD4J 3QUXB 3BXNB 4QO1A 3HLKA 4DEWA 4LSVH 2DLFH 5AWNH 1RK1B 3GSNH 1XGYL 2X4RB 1WF5A 4JM2F 2ZIDA 5INCA 3KWWA 1R24A 3K4ZA 4OZIA 2WO4A 3MNZB 3NFNB 4H40A 2RA1A 4M56A 3LZFH 4Q2ZB 1KXHA 4PJGF 1SMAA 2CUAA 4J4PC 1UC6A 1R3LB 1EEZB 2IGLA 3N44B 1JN6A 5HD8C 4JHZA 5C07E 3G9VA 4J27A 1RJZB 5J12C 5BVPL 4R4ND 3FONA 5HDBB 2MWCA 3ZTNH 4NN5B 1E9OA 5I6KA 3SDXF 3I3BA 4WV1A 4M5ZL 2NNAA 1BEXA 4K5MA 2DAVA 4H8WC 4BDVA 2DMBA 3MRIA 1Z9MA 3FCTB 3QWOB 3ARFD 3ALPA 4JQVC 3GZQA 3MRRB 5C07D 2V2TA 3GPSA 5KW9H 3IWVA 4WO0A 1WWAX 3TT1H 2DJSA 4DUWA 4BCYA 2BSDA 1MHHA 2OCFD 4S2SA 1YJDL 4DQOL 1VFUA 4KK5D 4UILL 1P1VA 2C7FA 4HAFA 2CNZA 4M8UA 4JM2A 3HI1B 2WMPA 5IBUB 5H37A 4EPSA 3FUJA 1QYGH 4BZ2L 1C08A 4EIZC 1PLCA 2FJFA 2DMHA 2NYYD 2OL3L 3D05A 4FNTA 4PJ9D 4YDIH 4IHOB 1A66A 2G0LA 4IK6A 4R4NC 5D1QD 5DRZA 4EDXB 3VFPB 5L6YL 5LAXA 1DBBH 3EJTA 4MVBD 4WLCA 4ELKB 3BAEL 3MUY1 3IS0X 3IDNB 3IJHA 3MNWA 5JHAA 1MREH 2HT2C 3DHUA 5HYFA 5CCHE 1CB4A 1CDJA 3JWNG 1TFHA 2JE8A 1AZBA 1D5IH 3ARFC 1E27B 2VDNB 1MFMA 3SDXA 3DVNA 3D69A 4OH2A 2C4FU 2PPDA 1WA0X 2HFTA 2MKWA 3HE6B 4J8RB 2F7OA 4ZXBB 1OSPL 3RGVA 4JHBA 2ATKB 4H25A 4G59C 1S7QA 3A67H 4NZJA 5CSGA 5JYLA 3MZGB 3MROA 2DQFA 1TUPA 1UH3A 2I7OA 1YVLA 1ED3A 4M7LL 1JPGA 2Z6FA 2XHNA 3OJMB 2ORBH 1L3NA 2H6PB 3EH2A 5GQBA 1WD8A 4U6HB 1BPVA 4XHQA 3T0DA 3UX9B 4PJ9C 1YJDC 4NUPA 3OMAB 4KJWD 4QLRA 1PNDA 3FU5A 2DYPD 4TUOB 2D9CA 4HOXA 3O2DL 2ODHA 3GM8A 3E7JA 5HVHC 4X7TB 1CMOA 4ADIA 5FHBH 4U1JB 1SDAB 1FYTD 3FQRB 3IMBA 1N8OE 5A3ID 2ENJA 1RU9L 2PCFA 3QJFB 1BX2B 1KLGB 4QXWA 2Y1YA 2EXYD 2PNDA 3CX2A 4H88H 3Q5TA 4PRHA 5BVJB 5ITBH 4Q9QH 2DKSA 4PR5A 1ZT4A 3BW9B 4PJHE 3W0WA 1Y1UA 3ZBMA 4WDIB 4PLJD 4XPAL 3CZJA 2CO3A 1IAOA 3TBVA 4BK8A 5HYSA 4EE2A 5DS8B 1JG9A 2YJQA 1CXFA 1XH3A 1FWXA 2NNCA 1A7QH 5E2WL 4ADJA 5JXAL 1FNEA 4LASH 2E9BA 4MA3A 3ZHDA 3IDJB 1P4IH 2LE9A 3L16A 5JNYA 3WXVH 1PKQA 1C1EL 2MCG1 3AS1A 1S7WA 1F6AA 4UUJB 4KRLB 4HD5A 4MB3A 1CR9H 1MG3C 4ZTOL 5IVZB 5CCKH 4JN2A 1D2OA 3WIHL 4HLJA 2EO1A 5E6IB 1O9WA 1X7TA 5I1HH 3TXAA 1VESA 3RWFA 3QIBD 4Z7NF 3DSFH 3M17B 1P1ZA 3QFDB 2XZCL 3E9TA 5FEBA 5FAAA 4EUPH 5I0YA 5GRVL 1LO2H 1HWWA 3O3EB 4XNUH 2ZKWA 3PUCA 5DHEA 2HA1A 4FL4B 4PJFA 1MH5B 4LKXB 2EXYC 3O3UN 4JCWA 4YBQC 4AYDC 3SGDH 3G6JB 1PZ5A 2DBJA 1I9JL 4JZJA 4Y1AA 1IEBB 2O6DA 5TFSL 5CR8A 1KGWA 1FNFA 2VUKA 43C9B 1B4LA 3AITA 3L81A 2W80C 2A9NL 3QXDB 3DX0A 2VSCA 3D2TA 4ZNEE 2ESVB 3L9EA 2PWGA 5FDYA 3QCVL 2I9LA 5IV2A 2X3AA 2K9UA 4XNZB 2Y0SA 3ZSTA 1CGTA 3LVEA 3Q2WA 5IR1A 1U8MA 3QUKA 2YBRB 3UZEA 3UACA 3OPZL 3FO9A 3EZ8A 5I6MA 1BWWA 3MJWA 2AJ3A 3VGFA 3KVDD 4BRVA 1P53A 4LDCA 4DP7X 4X7SL 2ZG2A 2ZX6A 4G80B 3SDCB 3RZCD 5SWSA 2O6FA 2Z7ZA 5CHNA 1OCZB 3P3YA 3QIBC 3TL5A 3THMH 4N6QA 2VB5A 1S8DB 1U8PA 3OWRA 2PW1B 4XB3A 4PG2A 3ZE2F 4GUPB 4W4NA 4PLKD 4OLEA 1GAFH 3UGEA 5CJ8A 3GTNA 5T1KD 3BKYL 3IXTA 4BHUA 3V2AR 3IGLA 2LAAA 3WN5B 4RDQG 4CW1B 2WXKA 4MKMA 1TDQA 5I8KL 3C6SA 5DYOB 4G8FA 2EDJA 4ZUVA 1UXLA 3ZGHA 2YKLH 5G5DA 2YMOA 2W92A 1LO0H 4PCSA 1DVQA 3QNZB 1JNHA 2WOYA 5FYJU 3VO0A 1S9KC 2Y1VA 2ZX5A 4F92B 1AD9A 3GT6A 3UG3A 3WTUA 5F9JB 3FFCA 1WAAE 2VTFA 1QX1A 3HZYB 2AVFA 2AQRA 4R4BA 4C55A 3UTPE 1KIPB 2X38A 3QDGB 2W9EH 1SOKA 4PJEE 4I77H 2W07A 3K6IA 2EDMA 2ADGB 1Z0NA 3GJEA 4J4PA 2IC2A 3IFLH 4L4VA 1NCJA 4PSRA 3DX9B 4PGDB 2WD0A 3NGBB 4P5TD 3CK0H 4FXGB 1SRDA 3J27A 1EJOH 1P7KB 2OMUB 3EFFA 3M7FB 1MLBB 3CFCH 5ENWA 1F4WL 1UXSA 2JELL 2RR3A 3P4LA 3UTPD 4Z7WE 1WC7A 1E5YA 1XF3A 3QULA 3OG4B 3UTZB 4ENED 3EFOA 3WOVA 1YN7A 3MBWA 5EOQL 1WG3A 3GIVA 5JORA 4IOIA 4UQ9A 3VI4B 2ENYA 5BZDA 1OF2A 3HAEH 4Y5XB 1IJ9A 4UINL 1EBAA 1IC5L 3V7AG 4AGPA 5JW3H 1G43A 2APTA 2MNJB 3FU0A 4NNXB 3W56A 1I8MA 1S7UB 4OFYD 4QRSB 2VDRH 3GBNL 4PV8B 5F8QC 3GBMH 1UA7A 1V7NH 1ZDQA 3ECUA 1E4XI 4MJ6B 3RA7L 3W38A 1P7QB 5A2BA 4XXWC 1HXMA 3ILEA 4FOMA 4NZRL 4H13C 5K9JH 4R3SA 2AMGA 3V0VB 4QRRA 1H3GA 1SEBB 2CJUH 4OBSA 1VFBA 4EUPG 2X6UA 3D39E 2IJ0C 2PN5A 5T3XL 5DD0H 3PDGA 5D5MB 3ZUNC 2DDQH 4FERA 2Q6WB 2WAQA 4C56D 3CQPA 1MIMH 3ZKSD 2DQ6A 1ZA3B 2YUWA 1I8LC 1N5YL 4NO5A 4K3EL 2JFCA 3MRKA 2AEPH 5E4OA 3RVTC 4U6YA 4L8CA 4Y9EA 3NFSH 2A4ZA 4FEMA 2VXTH 1BZ7A 4P9ML 3ARFA 3N40P 5J1AB 3D39D 3PWNB 5C07A 1HHGA 3RPBA 1FNGA 4AYSA 3OJDB 1ESOA 3GLDA 1CD0A 4R26L 3ARZA 1WD9A 1URIA 4CVZB 1EXUB 5HGHB 4YZWA 5J89A 1I9RL 2BWDA 2HTLC 3A0OA 4GRWH 4CSPA 1NC4D 2XC8A 4KJYA 4PMFA 2EIZB 4ZX3A 5AD0B 2HVKB 2BVTA 3V5HA 4QTHB 3BZEB 1XZ0B 4ZAKC 3RDJA 5KS9E 3QEHB 4PJ9A 2VKWA 1HX0A 5KEZA 2EE0A 5LBSA 4FQJH 4JO1H 4EF3A 1SOQA 2Y6SD 2V7NB 4NENB 4PW3A 3VFWA 1EAOA 3PREA 1HI6B 2FNBA 3QUYB 1VFAB 1D6VH 5IMLB 3U46A 1TZHB 3SE4C 3WY1A 5L7XL 4AOFA 3UEQA 4BZ2A 1MW0A 1UD5A 2OL3A 1XCXA 5DXWA 4P9HL 4XVSH 1EJ8A 4ZD3L 4NKQB 1JI1A 3BWAA 1VIWA 4GO6B 4G6KH 3DHMA 1F4AA 4E5XA 3NH7L 4AZUA 2WLYA 5T3ZD 4B95C 3FH8A 3B56A 5TJWK 1B9ZA 5L4IA 2OJEA 3MJ9H 1KN4H 3MBED 4IRJB 4MJ2A 2Y2WA 4DP5X 3EHBD 4D8OA 1SBSL 5GIRA 2I07B 1ACYL 1WZKA 3KYKH 3MKGA 2YEZB 2E7LC 4IKNA 1RIUH 4LOFA 2ZCKH 1Z9NA 3GSOB 4JANA 1FQ9C 1YPZF 3MJ7A 3FPXA 1IC4L 2Q8AL 2DQIL 4F58L 6CGTA 1KTDA 1E5AA 4KXDA 2VN5A 3BESR 5HGAB 5F1SA 1QSVA 1M9WA 3V4PH 3V9FA 1NINA 3KPLB 1ZGLB 3H55A 4X9BA 3E1F1 1IV8A 5FGBA 5FM5O 4F8QA 7CGTA 1Y18A 2GTWB 4NBXB 2B3IA 2IH1A 6TAAA 5EEUA 2R1WB 3LAFA 4BJLA 3EJUA 5GS0D 1RZJL 3MLRL 4M8QB 1AQKL 4XNZC 3HAEG 4PBVC 3R4DA 4M62H 3V0GA 1R5IA 1SY6L 3OC8A 4XBPB 2JJTC 1TQBC 4P9HC 3N44F 2J21A 4MQ7B 3MBEC 5FW6A 3FRUA 4XBEL 1ZTXH 2AJZA 2ADIA 3G5VA 3E1ZA 3LEYH 5IHUH 5I2IA 1RPUA 1CXLA 3SDCC 3S5LA 1I9IH 2YAOA 1UB5B 1IGTA 5C08E 3JTSA 4G6AC 2G75B 1USZA 2PETA 2YXVA 4GG6F 2QR0B 1IM3B 1RVFH 1JPFB 1ZV5A 5IHBA 1A1OA 4ADGA 1OEZW 3QIBA 3VXME 1H6FA 3JYCA 1FZMA 3V4VL 4Z76A 4XODA 4ZMXA 2NXYD 2NZ9D 4ZO9A 1PQZA 4I5BA 3WN5C 5K9QI 2BHYA 4I0PB 5C08D 1RK0B 1JNNH 1ONQA 2FT8A 3WIHA 1P4BH 2HFGH 3CCHA 4N3TA 1IB5A 3GSRA 3PJSB 2DM7A 3KBFA 1YG9A 3DBXA 2FO4A 1DEEA 1F45A 2CXGA 3GS4A 4YSSA 2AQ2A 5LG6A 4HHAA 3K74B 4IMLB 1AD0B 1N59B 3MGTB 1AZZC 3VXMD 1T2JA 1D5XA 3LKQB 3LHPH 1U2HA 4LSQL 2A83B 4Z77B 1RZJC 2JI1A 2VH5L 3NJLA 4XWGH 1U33A 1MHEA 1XCQB 3UP1A 5EUOE 4JO3H 5TDNA 1ZLWH 4AEFA 4JRLA 2QGDA 4OM1H 3WD5L 3G08B 3NGBC 3JVFC 4XNDA 3QJVB 4FXGC 2NZ1A 3RZCA 4EZKA 3GRWH 4JM4L 1R3KA 1AYOA 4JFEB 4ZNEA 5IB4B 2P5EB 4DK6A 1WAAF 4O5LH 2BNQB 4OFKA 3D25A 3L7EA 4GG6A 4PRIB 4M6NH 3VFOA 2OXHA 3BSGA 3K2KA 3V0HA 4ELDA 1W6WA 1L6ZA 1YYLL 4Y8AA 1DDTA 3T4YA 4GKLA 2Y5TB 3LN5A 1PSKL 4BKLA 1OAKL 4GI6A 4F1ZA 1AKPA 5T1KA 4Y5XC 2V3EA 4KPHL 4RFEA 1JDAA 2OSXA 3PP3H 1FVDA 3QNXB 3WIFA 4HPHA 4JFPB 2CRMA 4N8VB 1YEIL 2P8MB 4U1IB 4XMLH 3WKML 2I27N 5J11C 1QBML 2ZOTA 3P77A 2DIAA 4FI7A 3GJFA 1KYAA 1XBDA 4BA8A 1X7SA 3RTQB 4RFOL 3VGBA 4NIKB 5B39G 3CSBA 4UTAA 4TLSA 3UIYA 2WWMC 3BIBX 3L1GA 2V0AA 1KPRA 3VSTA 4UOQA 2NY6B 2F54E 4XXWA 4E9WA 4D0BB 5HSFA 5E94A 3FL7A 1EGJL 1T1WA 4PRDA 1PFCA 4OD3L 5BCAA 5MEPB 3CZSA 3H42H 4ZPTA 1U3ZA 4UIMA 1WAPA 5GRJL 4ZS7H 1ASPA 3PNRB 4WHYH 3U2IA 1C12A 1WAAA 2JIXD 1KY7A 3DX8A 5ADPL 1PG7H 1T1XB 1I8LA 1AR2A 3ISYA 2F54D 5DMKB 3C8HA 2N01B 2ZKYA 3MRCA 1ZA6B 2EE9A 2CU9A 3ZOAA 2IWEA 3GI9H 4UTCA 2ZUSA 1KT2B 5TGBB 4Y4HD 1QHQA 1MVYA 5CJQL 5ICXA 3T3PE 2Z65C 4HDIA 3VG9B 4KX9A 4TNGA 3UJIL 3HLAB 1EX0A 4RZKA 1XF2B 5DS2A 5CBAB 4QRQB 3OWEA 4Z7WA 1E7UA 2R2CA 3BO8B 4XBGA 1MVUB 1NCNA 4HUXB 1NAMB 1UA6L 2OW7A 1HH9A 4K9EL 5AYUH 5KJRL 1CGVA 1FFOA 2CLZB 2PW2B 3C60B 3SPVB 1E4XH 2FQEA 4ZAKA 4LLQA 1FNSH 3G6JF 5DJ8A 2J6EL 1SVCP 5JIKA 2VLLA 1CE6B 1BV8A 2C7UA 2GSIA 1L3WA 4HWNA 4WNJA 2NYZA 1IBGH 3WCYA 3T3ME 5B1BB 5A2JH 3VWJD 3ZTCC 1PLAA 3SE4A 2A0LD 1QSEA 4NOFA 5EU7E 2D73A 3T9WA 3VFRA 4ODSH 1TJMA 3D52A 2D4DA 4NAQA 4D0DA 3R06B 1GTNA 4IRJC 3QRBA 4FE9A 4X5LA 2PP8A 5CZVH 2B7DT 3DIFB 4WI2A 1HESA 4GAJH 4BFGA 1HC1A 3RBSA 1X5ZA 1E5BA 3VW3L 3MUJA 3TH3T 4JQXA 1Q72L 4ZTPH 4JKMA 2QZ5A 4PWKA 1CE1H 1K3IA 4ZPVB 4YFEA 3LN4B 2H0PA 4K7PL 3Q2LA 4KFZC 2VERA 2XZZA 5F7FA 1NBYB 3RWIB 4XX1G 1GMIA 4PB0H 3O3EA 4MMXC 5K59F 5D8JL 1SZNA 1GW6A 1HXYB 5M7QA 3M07A 3R1GH 4XMKH 2ZCLL 4K9EC 5EBMB 3RVVD 4KK8C 2H8PA 2DPKA 4R8WL 1G0YR 5F6IB 4ORGB 1RUMH 3G6JA 4KKAC 4WHTB 2NY1B 1INQA 4MWFB 4PYGA 4WEBL 4G43A 1M7UA 3DDFA 4XNYL 3KNBB 1CBJA 5DJCB 1S9XB 2H2PD 5B7EA 3VFMA 5CKAA 2UYLA 5J13B 3QUZD 3RLSA 1XF5A 3U0TA 3VX1A 1SHXA 2GJ6B 4L8SB 3U1SH 1IAII 2CJTA 3NUKA 3SO5A 1QOKA 2JJTA 1UXMA 1R5WA 2JQMA 2B15A 3MBEA 4NN6B 5EU4B 4K5NA 4G8GB 1FPTH 3VNZA 4ERSH 3EAKA 4I2XE 4FNRA 2EDRA 2HRPH 2UZIH 5I71C 2D2OA 3WIAA 4X8JA 5HJ3A 4EXKA 1B4JL 2JKXA 4GRMB 5F96H 5F97E 1LK2B 3ETBJ 3H53A 4ONGL 2DIBA 4DZ8A 2H9GA 5D93B 1HKFA 5IVXF 3C12A 1JZ8A 4CSTA 1BQRA 1R0AH 3BQVA 1G84A 4WHYG 3NIFB 5DJXA 4I0PC 2R2EB 4G70B 5T33L 1C16A 4EN3D 3TO4C 4LCUB 2JLPA 5IHWA 1JD9A 4Q0XL 2LTQB 2VLKB 3VI4F 3BEWA 4GXUM 1OAUH 4G72B 5E5MA 4Q58C 2BP8B 5DC9B 1V05A 4WGWB 3KWTA 4ZW8A 4ZT1A 1DQJB 3T1FB 1LYQA 1X9QA 5ICZA 3SBRA 1UQSB 1WEJH 3L3IA 4O2FB 1NGZA 3BC9A 1TTFA 2VDQL 3FCUB 5HI3C 1KBGL 4KOBA 5KBKA 4ZQKB 1N7ML 1AGFB 3GI8L 4L18A 3ZRCC 3O4LA 1TCMA 3AXLB 4CKVX 5A7BA 4HS6A 2O1AA 5AZ2L 1I9EA 3SODB 5SV4A 2NQCA 2YD6A 1OAQL 5D5MF 3A4AA 1J9QA 1PY0A 3AREB 5C1MB 5AVYB 1XFPA 5B1JC 4HFWB 3T2PA 1MLCA 4HKXB 3ARGB 1WBZB 4F2MB 1NAKH 1OGAB 5EUOF 3B1TA 3OQ3B 3CSGA 5IVXA 3ETSA 1IFHL 1LM8V 1UWGH 3R18A 3ZMNA 3MFGB 2JWYA 6FABL 2P8PA 5AKTA 4ZMPA 5TDPA 3WO3B 2HT4D 5C08A 2IQAB 5KYNA 5EO1B 3O11B 2O61B 4HWBL 2YMXL 3NABH 5F1KC 3VI4A 4GKSB 2FECI 5GGUB 3KLSA 2EILB 2BP3A 2NXZB 3RTQC 3V4VA 1QNIA 2VOTA 1F02I 1JYXA 3UBXA 3BVUA 5E1IA 2IDTA 3VXMA 4BXVA 2HN7A 1N2RB 4YAQA 5EN3A 1KXTA 5HHVL 1YEKL 3QHZL 2ZD0A 3ARUA 3MV01 4O4YL 5DUML 5GRYA 3RJOA 3IMTA 1QUNA 3AM8C 1INDL 4JY4A 4HW6A 3V0VA 2C9AA 2VIRA 2JKNA 3EG9A 3ABKB 1KGCE 2LABA 3S4SA 1NBQA 3T0EB 5IB2A 3LB6D 1U95A 4Y7OC 1CO1A 1V5JA 4ANUA 2NY7L 4HAGA 4KUZH 1YEHH 2BNUA 5IESL 4LIQL 5IBLD 4YBLC 5C97A 5IT2L 2YUXA 3GMOB 1YY8B 2GITA 2X9WA 1TPXC 4OLZH 4AT6A 3EO9H 3LCYA 3ZHKA 1AOHA 5EUOA 1S7TA 3OAYH 5EIIG 3MX0A 2KHAA 1RPKA 3KJ4C 2PCYA 4R5XA 3ULSA 4KQ4H 4P23B 3FB7A 1BJ1H 4ZMYA 1KGCD 2AXFA 3BP5B 1G4RA 5ABZA 1V54B 5I1LB 5BUAA 3NACH 3SYCA 4TNFA 5DK2B 3GMRA 2X4NB 4B9JA 2D0HA 3IBEA 1HQRA 2N56A 3LPWA 4MMZC 1HL8A 5TDOA 4W9KC 3UCRA 5A7EA 5KSBB 4P06A 4ZDHA 1R1CA 2J8OA 4XCEA 3NCMA 3P0VL 2WKGA 1ORQA 4BEIA 2V5TA 4DW2H 5B38G 3FQNB 4XNMB 3TU6A 5IB3B 4Q9RL 2OX5A 3O6FB 1L9TA 2ID5A 3DVGA 4I13B 3GXMA 2Q0ZX 5C0RH 3H4HA 2BCMA 1T7XA 3PWUB 4W9DC 5E23A 1WWBX 1JXJA 7FABL 5GHWH 1EEYB 4KNQA 4FLSA 1BD2D 2FEJA 4AIZB 1HI6A 2EEXA 3SPHA 3ZKMC 5C0BB 2FB4L 4L1LA 4N5ED 3HNSH 4UNTA 5FFLA 4X80H 1LE9B 2J73A 4R7DB 3ATDA 5I1AA 2X4PB 1O7VA 5DI8A 3VE0B 5EU6B 2YAMA 3ZE0B 1WUNT 3SO3B 3RX9A 1ZLVH 2JIXA 3GDCA 4M8VA 1C5BH 2DL9A 2UWEE 1LEIB 2X0UA 4M1DH 2WQ8A 3OJ2C 4J28A 2AXHA 2F54A 2G5UA 4JFZH 1OPGH 2VDOH 3C75A 4GPVA 4IRJA 4QOKD 5D1XB 3BP7A 4Y4HA 4E9QA 4OGZA 3KPSE 2VR3A 1KB5L 1MRDH 3SQOH 3IJEA 3D2UB 4IBYA 1VACA 2HP4A 3Q05A 1YEJL 2AERT 5HI4D 3T0VA 2HX7A 1MFBL 1F4YH 2WN3A 4K2UH 1IGCL 4NRYA 4U31A 4APXB 5IHZB 3PAVA 2QPSA 1T03L 3ZSSA 5GSVA 4LSTH 5IQ7L 2AAVA 4MNHB 1CLYL 4X4YA 1BVZA 4MZIA 4ABQA 3VFUB 3ZDYB 1PLGH 2NY1C 4XVUD 3KPSD 4DK5A 4XC1L 4XE5B 2GUYA 1AGBA 4JS7A 5EZJA 2WAHA 1F56A 3BLBA 4MMXA 3WFBH 5E08L 4HUNB 5IB1A 2R1WA 4P5SA 2X53A 5AVQB 4J6RH 3BPLB 4OVVA 3NZHL 5K9QG 4GW4B 3VWJA 2FQFA 2ZWLT 1FNAA 1QEWA 3IEAA 5BV7L 4PP2B 4B3VA 5GISH 1EO7A 2JB6A 3T5WA 3BPNB 5JW5B 1KV7A 3RPIB 2BSRB 5FYLD 3PNWA 2J6EA 3CFNA 2H32B 3OX8B 2JCCE 3RNKB 5FKPB 1JZ4A 2VWEE 4MQ7A 3FT2A 4NAMA 4KRPB 3ENEA 5I8OH 4G8IB 4NN6C 1OLLA 1VEMA 3LIZH 4GSDL 1FE8L 1GGTA 1UXWB 3D08A 3ME0A 2H1XA 4JFWA 3WDHA 1UB5A 3CLFH 5C9KA 4UQ2B 1VGEH 4PJ5B 4ESKA 4WJ5A 5D93C 4F7EA 3P0YH 2F74B 1PX3A 1HAWA 3GMLA 1KIQB 1VZHA 1BVNP 1A7BA 1H6EA 1DZBA 1I8UA 2BVEA 2DWEB 1HTYA 3KG5A 4AWJC 1CIUA 4OTXH 3UJTH 3MLYH 35C8H 1S5HB 1TETH 2YLKA 4I0PA 1F2XK 2QGEA 3U2SA 3TO4A 1FC2D 5MHSE 3FTZA 4GEJA 5L2KB 2EH7H 5FGCE 1X5LA 3ML9A 1OIOA 2H6OA 1J8HE 5IHHA 5EEXA 4PVLA 3VXPB 2OJZH 3FUEA 4HC1L 4URTB 2MSPA 1NC2B 5DZVA 3T6WA 5D1ZI 1FGNL 1BIIA 1T2QL 5BV7C 4DVRL 1IGIH 3QIUB 3KDMB 1CF8L 3TURA 4ODUA 1DN0A 5LO7A 3TZVB 5MHSD 2ZXAA 1M3JA 3A47A 1IAIH 1FFRA 4R4FH 3QQNA 4ECNA 3HZKB 1J8HD 4F2FA 3P1VA 4HKBB 1E4JA 5KJ4A 4TN9A 5C0IA 1XGRA 4AYMC 3CTTA 4TPRH 5JIHA 2QVFB 3NZUA 2NTSP 5IB4A 3SDDD 2XICA 2EEDA 5C0CB 3B8SA 2YWYA 1RIHL 3KLKA 4Z8FL 3LEVL 5HPMA 1AHKA 5BRZE 4LBAA 5BZXA 1OGPA 4EN3A 1D6EB 1UFUA 1QABA 3HC3H 4N90E 4NUMA 3VACA 1FVCB 1WICA 3PP4H 2NXZC 4N0YH 4U1SA 1HNYA 2Y7SA 2AJXH 2LHAA 2BJMH 3OF6A 3M1BA 5IEHA 3ABZA 1ZLWK 2AJSL 2XWRA 3MRPB 3L3KB 2XDHA 1JF1A 1YEGH 3QIWD 4G2AA 4MCYA 4HF5L 5BRZD 3LKSA 4L8BA 2VJ0A 4N90D 5J0BA 5I19H 3PWPB 1DR9A 1DVXA 1HHHB 3K72A 2Y5EA 1KCKA 3CZNA 1J8KA 3DUSB 2YIHA 3NT0A 3WS3A 2OTWA 3T0EC 1EHLL 3DXAE 3HMWL 1MUJB 3MLSL 1BG9A 4Y2OB 4D0BA 3TVMC 4MJ4A 4HEPG 4BRJA 1F90L 3EH5B 1IFRA 5I6OA 4G9FE 5FO7A 2PUQT 4MXVE 2VLRE 2GSMB 2FX9H 4OFVA 1W15A 1G7LB 3TTYA 3TWYA 4KKCD 3CHOA 3PP3K 2JXMB 3WE6B 4FQCL 3B4NA 1WVZA 3NMEA 4F8TA 4P23C 1A3LL 4ZW7A 2CO6B 3M1CA 3FZUD 3ZVVA 3DXAD 8PAZA 4L3FA 3Q9QA 3UBFA 4XH2A 4P59H 4TQHA 4B27A 3OLDA 4XCYB 2V3FA 3BWSA 1R3IL 3MCG1 2J5LB 2Z4QB 4G9FD 5TE6L 4NQDE 4NUJB 2VLRD 3SOBH 5CGYC 4DOHE 1VZGA 5BO0D 2JV6A 4MMZA 2EDDA 4N25A 2GEEA 3P2DA 3WFHB 3Q3GA 2ERJB 4HWBA 5E03A 4DN3L 2BOLA 1DUYA 3NEEA 5CJ5A 1EHAA 3SDYH 2VQUA 2E0PA 3MNVA 3IVKA 2JMRA 4R7NA 4WFGE 1J05A 5CJOH 4TF4A 3P0GB 1JPSL 3NSXA 3VXSE 1A6TA 1I1AB 1FGVL 2X1QA 3RHWK 4KZCA 3RL1B 2AC0A 4O51A 4FG2A 3JWOH 1G7IB 3F7YB 4J2XA 1H3TA 2P46B 5F1OB 4X9HA 3EH3B 1JHLL 3B6SB 4K23L 5HDWA 3KLHC 3F05A 4J3OG 1O6TA 4YOKA 1ZLUK 5DRNA 4GI9A 2ITEA 3RWDA 5HJBA 4FN0A 2AHIA 1B2WL 5KSVA 1MAJA 4QHLA 4FP8L 5D1XC 4HPYH 4L05A 5DLMH 1MFEH 1PCXA 4OUUA 1KPUB 4RSVA 4S1SL 4WW1B 3O3DA 5E9NA 3V5DB 5AOJA 3AGVA 2RMNA 3KPTA 5D1QB 2YBGA 4I7ZC 4LMQI 2E74C 2QMJA 2EO7A 4PGCB 3GMPB 3B34A 3NIFF 1RAMA 4BFOA 5G55A 3D07A 3LQAL 4LPXA 2ZQKA 1N19A 1V7ML 1B9KA 4EIGB 2IDCA 2ZAGA 5FYJH 4FQLH 5LAPA 5TPWL 3PHSA 1NBZB 1G7QA 4WKXA 4AW7A 2OPCA 2R9HC 4NQQA 3C9NB 3A21A 3BSZL 3MCLL 2EYTB 5H35A 5BZWA 4QHKJ 2EUZA 4AMKH 1TO5A 2H3NA 2XWJB 4XX5A 3DPBA 2BS9A 3C8KB 4BFJA 3QJTB 5ESQA 3VMPA 1RJYB 3LXUX 5JUEH 3U9UA 2WSKA 3LD8B 3N1QC 5EC1B 2JK5A 2A9BA 1X6LA 2UXTA 4UM8B 3QYMA 4U05A 4B0MM 1U8CA 2I7SA 2GJ6A 4TNVF 2O5YL 1SM3H 4X0NA 5I1KL 4GUQA 4GW1A 3ZYJA 1CBVL 1Q1JH 2EYRB 4X6CE 5C0ND 4WFFE 2DYPB 3OBAA 1WGOA 4XPHL 1IGFL 3HE7D 3MLWL 2HTKD 4E9XA 5AAMA 4P5RA 4F8LA 1EO8H 1OOAA 4M03A 4TSCL 4HUMB 2FD6H 2I25N 1I3GL 1J1PL 1FYTB 1A1MA 3LIUA 2UWEA 3EW3B 4NCC1 5EBGA 4Z3TA 3AY2A 4W68A 3IE9A 1KB5A 2ZSVA 2DH3A 3TBYB 3S8FB 5ESAB 5KVGH 2C3GA 1OCCB 2R83A 1F3JB 2W1NA 2WTPA 4WFFD 2ZP9A 3LQAC 3GO1H 2NY3D 3FO0L 3MRFA 5KUKA 1SJEB 4XNXL 3VRIB 1NJ9B 5D4JA 3CPLB 1DCEA 2BP8A 2Y6TE 4ZFQA 4K3DH 2ICCA 3QXAA 4PAZA 1DBKH 4F57L 4FHBD 4Z0BL 3F7VA 1T20A 5DJ6A 2RJMA 2ZOKA 4LVNB 1U8KB 4J39A 1BAFH 5DJ2B 3QIUC 4JFUA 3CFDA 3ARVA 1X5IA 4FFTA 4PGZA 1E8WA 2WVTA 4MQSB 3AY4A 3S5YA 4TTGA 2WWKO 1IKOP 1MJ7L 1DBAL 1IGYB 1GGCH 2FEEI 3H6AA 2MOQA 2WP3O 3KYAA 3QR2A 2L0DA 1M1XB 4PS4L 1RSYA 5AZEH 1A8ZA 3R7QA 3FC8A 4Z7OF 4Z6AT 2Q76B 1X3DA 2VGLM 1TTAA 3CC5B 4YIQA 5K9OB 1Z3GH 2E75C 4XZ4A 1AZCA 2Q1EA 3P4OA 3OKMB 4M6MH 4MNQA 1OGAA 1LP9E 2RFXA 5CIPH 5C0JB 1U93B 4ODVH 1UT1A 1A3QA 2R2BB 4R2GD 2GEQA 3D5OF 1IQWL 3MOBH 1X4YA 3L95A 1MCFA 4AYBA 2C1OA 5KSBF 2ZXGA 4C59B 1G9NL 3T2LA 1A7NH 1H3PH 3US9A 4HFUH 3WFCL 4NXSA 4Y4FD 4HGWB 2HX8A 4AVHA 3WNPA 3WFEH 1AIFB 1AO7E 2CGRH 2D0FA 4XAKE 1FBIL 3ZKXB 2CUMA 4ANVA 3L3JA 4KHTH 4MXWL 4FAAB 1MJUL 1E7VA 3CFKA 3HG4A 3VJ6B 1BQHA 1CZ8H 1SYSB 2IEPA 2XJLA 1BZ9A 3IJ8A 3LY6A 3TT3L 1ITCA 1YMMB 4N8UA 4FTVE 1B3IA 2NW2A 4HC1A 2PTUA 1C5DB 4P99A 4QRBA 3BUPA 1J8HA 3EKCA 2VZ1A 1AO7D 3V6FA 4XAKD 3ZE0F 4F3FA 5EZIH 3TVMA 1UD2A 1XXFC 2EZ0C 3SDDA 2Z0BA 4BSVA 5GS1B 3MO1B 1N64L 4ERSL 3VVWA 3NJFA 1Q4NX 4G9DA 2DQMA 3CFJA 5IJKC 4A1RA 4WGVB 1N70A 4FTVD 1UCTA 4XCFH 4OI8A 3FHEA 1KYOK 4F7CA 3ECBA 4UU9B 1K8IB 3MJGX 1NM9A 3EDDA 2BOBA 2JKWA 3FU3A 3Q6FB 2WIIB 4N0CC 2GBUA 4NRZB 5IROD 2HRGA 2NZIA 4UDUB 5DVOA 1YZZA 5I6PA 2ZUTA 3FN0H 1BOGA 2PCPA 3FSZA 3GMMA 3QIWA 2YGQA 5BRZA 4ODXA 5IMOB 2O5XH 3WKYA 4CDHA 4P5TB 4AEEA 4FHKA 1RIVH 3K71B 4FNSA 2DH2A 3KS0H 1A1NA 4O2CB 4KKZA 1I1AC 5ICYB 4NLHA 3G5XB 2XN2A 3D0LA 2P8LB 4PJEB 1RJCA 1FL3A 3OAYK 4OB5H 4JG0L 2NY4D 1A8JH 1PG7W 4TVPL 4EJ1C 3DMMC 1KJ3L 4LLUA 1LXMA 3LKRB 3LZLA 2H47C 3KCPA 4RAVA 2ZP0T 1WZ1L 3QUMB 4I88A 4PREB 2W88A 1J10A 5DMIH 3IDIA 4YHZH 2IAND 3HBPA 3SCMD 4DGVL 5JW4N 2SEBA 2FJGB 3GHEH 3U7WH 2CM5A 3E6HA 5FUOH 3NCYP 4A04A 4L9LB 2X1PA 1XSIA 3E8UH 3G6DL 4U7MA 4G9FA 1XR8B 2VLRA 2NY0C 4NJAL 2BCKA 3EOAA 4UOJA 3I6SA 3N1GC 3LX9A 4APQC 2X09A 1BFSA 4YNYA 5L9DH 4CKQA 1JWMA 1T5XB 3I75B 3FQUA 4G6JH 2MQGA 3D4YA 2GFBA 3FF7A 1KEML 4UT7L 1UM6H 4YE4L 2FEDD 3MGOA 2XNAB 1IC1A 4Z3FA 3DROA 1S5IH 1BFOA 4C56B 2UY7B 4KDVA 5KJ7E 2HKHL 3NJHA 2FJHA 1I1FA 1I8IB 4GB9A 4NQDA 3S3DB 3HIZA 1W72L 5DJDA 1RL1A 5BMFL 1JXKA 2QSCL 3N9GH 2R69H 1ZD6A 5I17B 2H0EA 2Z92A 3VFGH 2MPAL 4LEOA 3D39B 3RGBA 2IG2H 4QHNA 5DD5H 4UF7C 4R96B 3S48A 1AXIB 1KYDA 1NCDL 4AVKA 3OX8A 1RZFL 5AVXB 4IBUA 1NC4B 3FT4A 5J57B 4DZBB 1S9WA 4I9XA 5L2JB 4DP8X 5H37H 3EXJA 3ZQDA 5TE4L 3BLKA 4WWID 3VXSA 4AM0A 2FGWL 5HHNA 5J6GB 1UXWA 4JN1L 4XRCB 4Y4KD 3BGAA 3UZQA 1ES0A 4PSPA 5MENE 1N6VA 2A9CA 5FR3A 3SQBB 2YN5A 1I1YB 4D3CH 3FT0A 1UWEH 2FEDC 4P48A 4OQ1A 1K5NA 4LXFA 3VYPA 4ZOEA 3QG6A 4X6CF 3B8YA 4MAUL 5B22A 3DO7A 4ODTH 4YLQT 3ZO9A 4GAGH 5KVFL 1G6VK 4NSKB 4CSSA 1KB9J 4KUCD 4JHWL 3W9EA 3D34A 5KS9B 5MEND 4XOAA 3NAAH 1P5VA 2KERA 3K4DA 5EULV 3BWUC 1F3DH 5FFGA 2R0KH 3JWNE 5CFAA 2VXUH 1S6NA 3QNYA 3W2DH 3FTSA 4LVNC 5F7YC 1CLZL 1U3HD 2RACA 3CN3A 1U8LB 3GIZH 3KPQA 4EBQL 5E5LA 2V17L 4F15B 4JFXA 2H1PL 3MV8E 4MA7L 2LV4A 5LGHL 1GGIH 2WXNA 4NO3B 3QJOA 4UDTA 1JF6A 1OSZA 3CZFA 5JXEC 3F83A 1MXGA 3X17A 3D0VB 4LHUD 4PRPE 3RY5A 3CVHH 3JWDL 4GW5A 1B0GB 4CUCA 1JWSA 4OF8A 5DJ0B 4S1QL 1KTRL 2F18A 3I02B 1QO3B 3MV8D 4ZBJA 1BFVL 4L3EB 5EHFA 5CS7A 5BJTB 4GYBA 3KPOB 3S34H 4WO4B 3I3EA 4OVUA 1JGUH 1GYVA 4UV4L 2XN0A 2M8XA 4X6CA 3H54A 2QT6A 4ILDA 4PRPD 4BE5A 4JPWH 2WXQA 1OVZA 4ICXA 4OZFA 1HCZA 5TF1H 2VO5A 1XIWB 4LSRL 1ADQH 1WFNA 3KZ8A 2ETWA 5ICUA 1GSKA 3D3VD 4K0OA 4A6YB 4OJYA 4CBZA 3N1MC 4FNLH 4KROC 4L29B 2DLFL 3NCJL 4YDLB 3JQOB 1WTLA 3F12B 5AW4B 3GSNL 4P2QB 2BS8A 4J3WA 4D8PA 5EOTB 2PYFA 2BVOB 4LLWA 1CD1B 1HEJC 2PMZA 3JWNC 4UZGA 1B90A 2F6AA 3MQIA 3L9RA 5DUJA 3INUH 4GG8B 5H8DA 3WTVA 1QPPA 1H5BC 2NXYB 1SPDA 3UPCA 5CXPA 5BQDA 3U4AA 1R34A 2Q3AA 4DT2A 1I7TB 4G6FD 5B1CA 2HJLB 2GIMA 4AG4H 3JWDC 3LZOA 2XLLA 2BVQA 1H9VA 1MCPL 3CX5K 2K6YA 2XA3A 4BSWB 4J7RA 4L4TA 4KZ0A 3KJ6H 1UUNA 3REWB 3DOIA 4FABL 2M26A 4UBDC 4ZFGH 4J1UA 2IWGA 5EBLA 4QIRA 3LRLA 4XHJC 5IJKA 2NSMA 1NCOA 4P46D 3HFMH 3TTSA 1EANA 1J0ZA 1X7QB 4FQPA 3SKJL 5IF0B 3RWJA 4XOCA 4PG9B 5TQ0L 3MV7D 1LP9A 5AVWB 3UIZA 2Y23A 3WFHA 1N67A 4WCYH 4N9GA 3TASA 1MCWW 4LF3B 5CEZH 2RCSH 5IM7B 4ENZA 2X6AA 2YR3A 1HH6B 3QA3A 1QYGL 3RKDC 1ZK9A 4CMMB 4QHUB 1CF1A 3DURA 3QZOA 2B5IC 4QPEA 1I1AA 5F89A 2NUTB 2FSEB 3OAWA 4YSDA 4J3SA 1Y7MA 1DBBL 3L5JA 1E90A 4AIXA 1N26A 4NX0A 2B2XH 4W9IC 2ZAHA 1O9ZA 3DMMA 5JPMB 2V8LA 3C6LC 1HL5A 1MREL 2YSSB 1AI1L 4RNRA 3K6OA 2DWXA 4FTVA 5CGMA 1D5IL 4L2YA 4NC1E 3ZL4H 2XWXA 3D0AA 1UEYA 3QEUA 5F8RC 5EO9B 1QWHA 1KELL 4JKPH 2QQLH 3KPMB 4BFIA 1ZK5A 2QQNL 3MCKB 2B8OT 1NZRA 1W16A 5DO8A 4ANXA 5IROA 5E00A 4DGIL 2HKFH 3KR3H 4OGAD 2CO7A 2Q7NA 1DBMH 3JUYA 4XXCA 3ULVF 1F0LA 4P2CG 4L1SA 2ORBL 4XP5L 4GMTH 1PBYA 5HHMB 3UBHA 3N2JA 3UAFA 4APQA 1E5CA 4DP6X 4HZ1A 5HDOA 4KOCA 4CNIB 3I9PA 3F64A 2P80A 2Z0UA 3IJSA 2BDNH 3QCTL 5CF3A 2M2DA 1HOCA 4H8WH 3WJJC 1HZKA 1OXYA 1XGTB 2OP4L 4GJTB 5FHBL 3C2AH 3S5ZA 3BWUF 5EIQA 1FRGL 3SYAA 3L13A 3BCFA 5J5EA 3FXIC 4JJ5A 2CRIA 5E51A 4BQ6A 1KTCA 2OTUB 3QR0A 3CVCA 1LO4L 1S2EA 4Q9QL 2P5PA 1VENA 4KX7A 5HGBB 5D6DC 1CJYA 4AYFA 2B16A 3DLQR 2P42B 3HRZC 4YEFA 3H56A 4LLVA 4MQTB 3DX6B 1IAKA 2ZUYA 3NN8B 3V7AE 4H20L 3RWHA 1JV2A 5LGYA 4MDRA 1PJ9A 1CGYA 2HB0A 1FSKB 4DO4A 4NQEE 1P4IL 3FAWA 1WIPA 1PDKB 2WM0A 4JFHE 2DZEA 2FHCA 1T22A 4TUUA 5C09B 2R0ZL 1CR9L 1R3HB 4PJAE 4JRWA 2APBA 5CCKL 2KZBA 4GSQA 3C2SA 2YXFA 2VW7A 1FZOA 2K7PA 4GQPH 4A6YL 2KLSA 4YHIB 5BVPH 4KJQD 2IOIA 2J20A 3DSFL 2WGNB 5IJCC 1NEZG 2AQNA 4YMPA 3B43A 4A1KA