3U1PA

Crystal structure of m. tuberculosis ld-transpeptidase type 2 with modified catalytic cysteine (c354)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
285
structure length
265
Chain Sequence
RYTLNATAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptidoglycan binding protein
molecule keywords Mycobacteria Tuberculosis LD-transpeptidase type 2
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 63
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3u1pA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u1pA01
5D7HA 1Y7MA 4Z7AA 5DCCA 3ZQDA 4A1KA 4JMXA 1ZATA 5E5LA 4JMNA 4GSUA 4GSRA 4XVOA 3TURA 5DVPA 3ZGPA 4A52A 4HUCA 2MTZA 3VAEA 4ZFQA 5DZPA 4A1IA 4QR7A 5E1GA 4GSQA 3VYPA 3VYNA 5E51A 3U1PA 3ZG4A 5DC2A 3TX4A 4K73A 2HKLA 3U1QA 4A1JA 4QRBA 4QTFA 5DUJA 4QRAA 5E1IA 5LBGA 5K69A 3VYOA 4LPQA 5DU7A 5LB1A 4HU2A 5DZJA 4LZHA
chains in the Genus database with same CATH superfamily
2HVJA 3GK8H 5AL0A 5SX4I 3UBXA 4I1RA 4ZODA 3AWEA 4HKJB 3W3BA 3O3DA 1E2VA 1JDCA 4ZOEA 1PQZA 1C08A 2Q0ZX 3MUJA 1NCNA 4OFYD 3PAVA 1KB5B 3DJ9A 5DYFA 3L5HA 5D7LE 2XN9E 1MLBA 2Q8AH 4ZNEA 3CU1A 3LZRA 4LEBA 1KC5L 4RSVA 4YXHH 4JQVA 3KVDD 4HLZG 4L1TA 3I6GA 4PJ9D 3KPMB 4XO8A 4JFFD 5EZIL 1NDGA 3C5ZA 4MAUH 4J3UA 3RWIB 2WXJA 4JR9H 5JZ7C 2EZ0C 2LU4A 3OJDB 1PSKH 5K59E 3VI4E 4IBWA 4AYGA 3PFQA 3O4LB 3G6DH 3F6LA 5FB8A 1Z66A 4TNVK 2PO6D 4OFIA 4GFXA 4BE5A 4F8LA 1BFSA 2LQRA 1LO2H 3UTTD 4DP2X 3TYFA 2WWMD 3Q3GB 4U4IA 2OXGA 4GRLA 4FGMA 2WWMC 4ZUSB 4K7PX 2VLJB 5AOLA 2WXFA 4KKPA 4QRRE 1R24B 1P5VA 3MJ8B 4I13B 5HDBB 4BKLB 2O93L 3T0BA 4YDLC 3NMEA 4U7KA 5JIDA 1MFAL 1QRNA 1MXDA 3PGDA 5DEZA 3UTSA 4JY4A 1J87A 1BZ7B 3NGBC 4JFYB 4KH2A 5HHME 3CFUA 1SMDA 4DKEL 2NW2B 3OXSA 3NZ8A 1R9FA 1XGUB 3MMEB 4QWWD 4UQ3A 1FIGL 4G7VL 1J18A 1T89A 1JHTB 1LK2A 2RACA 5DJAB 3WO4C 3HLAA 3NG5A 1XIWA 3NJXA 1UD3A 4K5LA 3QA3B 3FSZA 3FOLB 4GRWH 2C5DC 1BMZA 3DHUA 1EXUB 4P2QE 3SY6A 5E8NA 1EDHA 1MZZA 1YAZA 2OJEB 2F58H 4ZX6A 3BPLB 3TN0A 1A6UH 1BQLH 2IMNA 1O7DC 3B9KB 3DGGA 5B3SB 5JYLA 1QLEB 3LSOA 3SYQA 4OLEA 5DC4B 3WMSA 1L9TA 3E8UL 4UDUB 1HX0A 4S1RH 1BREA 4OGAD 3OB0H 1FL6A 1ZA6B 4LT7A 2PN5A 1X5LA 1DLHA 2OMTB 2R39A 1XSIA 5D1ZA 5CILH 2AQSA 4NJ9L 4XVSH 3AVEA 3O9WB 4L4VB 1WS8A 5BO1H 1J8SA 4RMWA 4NDMA 1LO5B 1RY7B 4MDRA 4RAUA 4YHIB 3HC4L 1COBA 2X9XA 2XNAB 3QQ4A 5B4MD 2VN7A 5B4MC 2MTPA 3DK2A 4YBLB 5D2LE 1IAOA 3QUXA 1OCCB 3MJ9A 2QKIB 4Z7QE 3CVDA 3GBNL 2QVTA 2DMHA 4YHLH 4WF7A 3C5XA 2FBRA 5IJKA 1XGTB 3ESUF 3ZQDA 2B4CL 4FXKA 4H13C 3CFEA 1S7SB 2K0RA 4WHDA 1RUAL 3HE6D 4TVPD 1FGNH 4X4KA 1TQCC 2ZZUT 4N2CA 4OF7A 4X42A 2JIXB 5JPNA 5EPMB 2VMFA 5HHOB 3ZL4H 1AOHA 1WUNT 1EIBA 1PEZA 4FI7A 1Q0YH 2F5BL 4JRWA 4YHPB 1NLDL 4OFQA 3QG6A 5KBDA 3LN4A 2IDCA 2OQJA 3ABKB 3CBRA 3IETB 1HXYA 4FA8A 4QKXB 4AYSA 4DN3L 1BFOA 2CXKA 5I1GL 1DO6A 2QEJA 4F27A 1ZVSA 4BFKA 5CD3B 1GC1C 3FHAA 2R27A 3MPCA 3MRMA 5FYJL 1J1OL 4AW7A 1J0YA 1X5IA 2GUOB 3WO3B 1F3DH 1EMTL 3ZLQC 2ID5A 3QEHA 4PJDB 3A0OA 2XY1A 4G6FB 4PTTA 2EKSA 1CICA 4NWUH 2ZKMX 4GKOA 2HUEA 1RFDH 4RFEA 2P8PB 3VB9A 1XHHA 1KLGB 3FO9A 2J2ZA 3GMOA 5IW6B 1JWUA 4CMHC 3CLFL 2ZXBA 1SUHA 2ZUYA 1OTSD 4X9HA 3TIDB 4BBWA 2DQTH 3JYCA 3H55A 3SHSA 4POYA 2UYLB 5ANME 2AJYL 2JTDA 3VWJA 3I9PA 3BDYL 3U0TB 5M95B 2EIMB 4UTAL 4HC1H 1HZLA 4UF7C 1IBFA 1D6VL 1KDJA 2BSSB 3CUPB 3KLAB 3SOBL 1OSEA 3P4OA 4N87A 3ZG4A 2P42B 5T5FH 2FHFA 2ZG1A 3WS6A 1VENA 4JRYE 4XMLL 5SV3A 1LL1A 3VU2A 2CUHA 2FHCA 2XZCL 3PHQA 4WO0A 2HTLD 1WFNA 5ITBH 2HTLC 3QDMB 2EIZB 4YDVB 4LVNC 3F05A 1EAPA 2QFPA 4LE8A 4M8VA 5MEQB 1IFHL 5AOJA 3SKJL 4UYPA 4H0LC 1MFNA 2GI7A 4U49A 4MMZB 4ATTA 3V8OA 1NFIA 5IBUG 4OF5A 2X4UA 2LE9A 1JPEA 3ECBB 4DTGL 3D3VA 1TTRA 4XHJD 4CVZA 4J2XA 4XHJC 2QQKH 4G6KH 3LVTA 4Z0XA 4MRBA 2K9FB 3P3UA 4L5FH 3S98A 2WLLB 2APSA 2XVBA 3CH1A 2O5XL 3BSHA 4A7QA 4OJCA 4DSYA 3B7YA 1G4MA 3KJ6L 4PRDA 1JXGA 2EDWA 1XCXA 4MA3B 1S8DA 4KZCA 3HMXL 3WHE1 4UM8B 4QHLB 5DRXB 5ANHA 3KPQB 1GIGH 4P07A 1VEMA 4GIOA 4HA1A 5L2KB 3QEUB 1IEAA 4Y2NA 3OMZA 3T4YB 2NX5E 5I15H 4H88L 2F8IA 2JB6A 1IKFH 2AI0L 3P2TA 3U9PL 3JWDL 4M7LH 4NO0B 1H5BC 5JOFA 2R0ZL 1X5ZA 4KX9A 3CGTA 4KJPC 1UH2A 1MNUL 1CXIA 4WAFA 1BHGA 2YD9A 5H4ZA 1G87A 3NJJA 2GY7B 1VPOH 3FQXB 5FYKH 3SBRA 3P0YH 1CDCA 4P4KB 3MLVL 5FYKD 4N2MA 4LNVA 2P80D 5DHEA 2YHGA 4ABVA 3V6OC 4MQXD 4MQXC 4X6BA 4KXZI 1UM4L 1KEGH 3EYOA 4LNRA 5E6ZA 3BSZA 4PGEA 2HT2D 3KPRD 1J5OL 1VKXA 1ITCA 4NAMA 1DBJL 1YHPA 4WO4D 2IAAC 3FPYA 2B1HL 1KB9K 2OMNA 1QG3A 1WT5C 2B5IB 5F1NA 2DJMA 2A38A 4G7SB 3QEQA 4WWKC 3TIEB 4UCFA 4PRPA 3DOSA 3KVQA 3OG4B 4TTGA 4PJXA 4UIMA 3N9GH 1CI3M 3S97C 3RA7H 4H8WC 5FM4A 4PGJA 1W9XA 3IXAA 3HI1B 4MJ4A 4KX7A 3T2QA 2EEDA 1JVOA 1L4IA 3V95A 4NQEB 4TUKL 4RIRB 3NH7L 5I74B 5AW2B 1MCRA 1KENL 3EYVA 3IF1B 4JJ5A 4PS4H 1AQ8A 4CL7A 5TGBB 5C09E 2BSED 2QMJA 2O6DA 4X9YA 1M05B 2NMSA 4NSKB 3T0ED 4HV8B 1R6VA 1QHQA 2J71A 1ET5A 3VXOB 3HE7A 4WI3A 3HZVA 5DMJB 1KTDB 1FVDB 4PJHA 3NJIA 4WHTB 4BK4A 3WTTA 2IMMA 5JPMC 3GDBA 5JO5B 4ANVA 3HS9A 4JN2A 5LN8A 1K4DA 2XRAH 4QXGH 2DTSA 5AZEH 1QD0A 1TETL 2EDTA 5AB1A 2YD6A 1S5IH 3TCLA 5CGTA 3W39B 3HG5A 1QZ1A 4Z3JA 2GK0B 3HHSB 1QPPA 4UYQA 3V5DA 4EEEA 1S7WB 4DP1X 3MXWH 3A4FA 1LQSR 2Y5TB 3K7UA 2YOAA 3FFCE 1KIRA 2CRIA 2P5WD 1F4YL 1NFDF 2XC8A 4OQTA 3SE4C 3L3JB 5F9JB 4DN4H 1JJUA 2OMYB 4YHZL 2HRGA 3N1GC 4HWBL 1R47A 3PU7A 1S7QA 4TSCH 5KG9B 1IX2A 2GTWB 5KVGH 4YE4L 3DSNA 3V0VB 3NCMA 2B20A 1PLGL 1HS6A 3V4PH 5L0QB 2CO4A 3T2NL 2X87A 4PGCB 5C9KA 3RILA 3FZUD 2X5PA 3NFPB 1Q1JH 5H35B 4GJTB 2PETA 1TEGA 2YD4A 1SYSA 2G60L 4BYHA 3UTTB 4KHXH 2DYPA 3WGVB 4NQCB 3VU1A 4NUPA 5BUPA 5TPWH 4DIXA 3AS2A 2BZDA 4GBXD 3QORD 1N6QL 3QORC 2C26A 3QDJA 3D69B 1BBDH 2HYMA 3HUJB 4GG8B 2DQJH 4MHHI 5D7KD 3BHBA 5DUJA 1E8ZA 1S7VB 5D93B 5KSUA 1JZ3A 3LMJL 3EG9B 5C0BA 5EZJB 3GMMB 2QPEB 3AW5A 3BAYA 2X4QB 1MJ7L 2FL5A 1G9NH 1CYXA 4NO5B 5GRUL 1E4WL 4YDKL 5CINH 5DK0A 5FR3A 5C07D 2VDMH 5F6IC 2H1PH 1BVKA 3BGAA 4ODTL 1KNOB 1MFBL 1G84A 5FOBA 3TWYA 2FYYA 2F8OA 4F7CA 25C8L 1YY9D 4LLMA 4P2RA 4X99A 4GRWB 1PL3A 1NCAH 1GYUA 1YPZB 1HKFA 3DVIA 1PS3A 4PLJC 3RKDD 3ES6A 2VDLH 2RJMA 1WZMA 2XQYG 3DPDA 3SBWA 1FV1A 3IDNB 1JDAA 3GD1C 5BVPL 1E5UI 3MRNB 4ZFOB 3CC1A 5JQ6H 1U93A 1T5WB 5K9QI 32C2B 5EEWA 5A7EA 5H37H 5I19L 3OKKA 5ADPH 1PFOA 5EOTA 2RR3A 1F4WL 2LW3A 3FB8B 4OSUH 9PCYA 3ARTA 5C0EB 7PAZA 4UILL 4LCCB 5IVNA 1IMHC 1JAEA 5HI3D 3AY4A 3VFPB 3IBOA 5LBGA 1K5NA 4K94H 4P2OC 2J8UA 1MFVA 4IBUA 2VLKD 2V3FA 3DX8B 3DPBA 3L16A 4PP1D 5FECB 4FFWC 4PP1C 1NC2A 2NY2D 2XWRA 4OZGE 4OAWA 3CJJA 4IIQB 5FPIA 5DJCA 4JDVB 5G4OA 1G7QA 1URZA 2EINB 3MRJB 1N10A 3DETD 4X98B 5IJDC 3HE6B 2A83B 1LEGA 4YXLH 3F7VA 4GKSA 1D5ZB 3UGUA 4GOSA 2P52A 5I8KL 2WB7A 1OZUA 1U8HA 2LR4A 4G8GE 5EN3A 5F88B 4XC1L 5C0GB 1V3KA 3QJTB 4I0PD 4QOKD 2Q1EA 1KPUB 4B0MB 1DVXA 2DB8A 4P2YA 1XD1A 3UBXG 5INCB 3BP6B 4R7LA 3ZMEA 4ATWA 4OZIE 4L29A 5LWYL 5MENE 3V6ZB 1W72A 3REVA 1P7QB 5JHDA 3LY6A 4QRQB 3OLEA 1Q9LB 1KXVA 1ND0A 2DQFB 1MAJA 3RI5K 3KD4A 1P7KB 4F9LA 5J57B 1GPOL 1EJFA 2J57A 2NUTB 3C5SA 4AOFA 5B7MA 1ZGLA 1E5YA 1NBYB 4IOFC 3VXNA 5T3ZE 1CPUA 4OZGF 5JXAH 4S1SH 4YWGH 2QQQA 2VWEC 4FQLL 2XVGA 2AV7A 1CDHA 1AGEA 1AZRA 1PG7W 3G6JE 3NDYE 2QZQA 1J9SA 4N20A 1IC7H 4RGND 5PAZA 4U1MA 1F8TL 2DI7A 5BUAA 1J12A 3BZDA 3GHPA 1ES0B 2AAVA 4E41E 1U92B 4F9PA 3B1UA 5CEYB 2PF6A 2YLKA 4GW1B 5LCVL 3FPXA 4DEPC 4N0UE 1BZ9A 4NQDB 4OBSA 1WEJH 3GKWL 3KYNA 4OZIF 2X7LB 4X7CC 1CL7I 3DV4B 1JF6A 2D7PA 5E2VL 3ZTCC 2DJSA 1B2WH 2QGBA 3D4CA 3DGDA 4MJJA 2UZIL 1ID5I 4Q4IA 2BNQB 1PZBA 3SKOB 3OF6A 4MJID 2X2HA 5E8PA 2YSTA 5GSVB 1EH9A 3APMA 5D2NC 5AYUH 5MEPB 4B9YA 1S7UB 1R34A 4XCNA 3BP7B 1BF8A 1BXVA 1FI8C 3IMBA 3CH8A 5FW7A 5HGDB 1JCKA 1I1AA 1FZMB 2YRBA 4N22A 3G6JF 4YJZL 5KEZA 3QZBA 4ZFGL 2DLFH 4MRCA 4GG6F 3ZYIA 1JXKA 3C08L 3KPSE 4PFEA 3B3IA 4V11A 3OJMB 5BPPA 1JZEA 2F19H 3B8SA 5JA8B 1THAA 4PRHE 2ZXEB 5HHNB 1TYRA 4WFHD 1DSYA 2J25A 4H1LH 5EC1B 4JFTA 2DM4A 1YEFL 3PWPD 4N0CD 1ZRUA 4FDWA 4N0CC 1JG9A 1WA0X 5DT1L 4N8VB 4Q8BA 5SWSD 2ZOWA 1IEBA 1L9QA 2YD8A 3ZIYA 3FAXA 1FNGA 4EXPX 5C6TL 1ZJBA 4NCDA 1RUKL 3L48A 4OCNC 5I5MA 2YPLD 1KC5H 2RMNA 8PAZA 3EJUA 3FU8A 1EAOA 4FNTA 1OAZL 5G5DA 3CFKA 3JTSA 4IHBA 4LIQL 4HIHB 4Z78B 5EZIH 4PJEB 1AE6L 5J11C 3QFJE 2OCFD 1I1FB 4HIQA 4UQEA 4Q9QL 1I8AA 2VDKL 3HPJB 4DPBX 4HZLB 2PPAA 4XR8C 1R3JB 1DEEA 4PJCA 4QYOB 4XCYB 1ODUA 1ZXQA 1RXLA 3AU1B 2KPWA 4KX8A 1OP3H 3AT0A 4HXBH 5LGJB 2ZAHA 1H15A 1ERNA 1TTCA 4FTVA 1CZ8L 1G7IB 4R5TA 4YEEA 2VZOA 3BISA 2Q8BL 3QUZD 5KSBA 3QUZC 5AUMB 4PBWD 1ID2A 4JFWA 4R7DB 1AR1B 3VG9C 3N04A 5C08D 3SOTA 4WO4B 3IJHA 1FNAA 1MFAH 1SXNA 1LQBC 3DMMC 1HSBB 2XV0A 3ETBF 3PL6C 4DKEH 1IKNC 1SEBA 4AYFB 3FQ1A 2DWDB 3G5VB 5KJRL 3EJQA 4PB0L 1CIUA 4DWHA 3GQFA 3ARFD 5HYJA 4G7VH 3VFNA 1ZLWH 1I7ZA 2Y2YA 3VSQA 3S3DB 1F13A 1PFCA 3L13A 2XA3A 4BEIA 1CDIA 3DJRA 4L9LB 3QCTL 1GW0A 2GTZA 1FAIL 4GRMB 2J43A 1YNKL 1RHFA 4KKQA 3II1A 4ZQKA 2Q76A 2E7CA 3T0EB 3NEEA 4KNTA 5I1HH 1VJSA 2DL2A 3QAZC 4HT1L 1RJCA 1BFTA 4D0DB 1SVZA 1CGSL 3HAEA 2QZ5A 3KPPB 4N85A 9CGTA 2OK0L 3MRDB 4F20A 1K8DA 4KGLA 3FONB 4NJ9H 1NMBL 4FFYA 2D0GA 3JUZA 1XZWA 2EXSA 1FG9C 3NDZE 4Q2ZB 2H3NA 4S1DC 4UOW0 1TEYA 4QTIL 3TNNA 4ZO8A 3HC4H 2HFTA 3IMSA 4QTFA 1W8OA 2ZF8A 4L1DA 3EOBA 1AI1L 1S46A 4ODXB 1GTNA 4NZUL 4Q89A 4XO5A 4A63A 3UROR 4A2LA 2N59A 2QVIA 2E3VA 3GBNH 2WZPD 4U6VL 5EWIH 5ERWB 5DHVA 5LG1A 3ATAA 5G55A 3QXUA 2X41A 1CDJA 3LYRA 3B6SB 5ETUA 3VVVA 4JZNA 1EHAA 2QTEA 2J6WA 2O6PA 3DX6A 2P5WB 3WFDL 5E8EA 1RUAH 3TPKA 3I02B 2VQUA 5E94B 3LKPB 2IDQA 4KMTH 5DVOA 3RL1B 4PJ8A 1JZ6A 2WQWA 2OSYA 3OGCB 4W9CC 3CSFA 3TFBA 1RIVH 2NXZD 2R2BB 2QADD 2NXZC 4UT7L 2CIKB 3P77B 5IHZA 1NLDH 3V4PB 4X8CA 5HHPA 4F8OA 1WD9A 2X9ZA 5DZOA 1J0IA 3U1SL 1BG1A 4DN3H 1NUNB 4OCWL 4P0DA 2A77L 4H25B 3T0AA 5I1GH 2YS4A 1FJ1B 3F62A 4Y19B 2PW2B 1UURA 4U1KA 2BLFA 1HEJC 4GBXB 3WE1A 3X13A 4NX0A 4BIKA 1NDTA 2BP8A 5FYJH 1J1OH 5FYJD 1EMTH 2YD0A 4N25A 3EGDA 3E6FA 3TO4D 4XWGL 1UWXK 3NCWA 4PJ5D 4D2NA 2Z7UA 1N12A 1U91A 2F74B 2Z1KA 4G9FE 5EU6D 5HI4D 2XN1A 5C07B 5BW7C 3GXPA 4FC3E 4UIKL 3CLFH 2VDMB 4PJFA 2GFBB 5BZDB 4WUUA 3K2UL 1YA5A 1ZLVK 5LDSA 2WXIA 2AJYH 5HDLA 5CGYC 3BDYH 3L9RB 1MHEA 4XNXL 1TJMA 2OI9C 4UTAH 2HCZX 2VR3A 2VDLB 4BHUA 1A9BA 3R06A 2WUCH 1V54B 2OSWA 3IGAB 1C12A 1AXTL 3SOBH 2RCSL 4HIIB 4HJSA 4I5BA 4B9GA 1CS6A 3FT0A 1OP5K 4HMEA 1OGTA 3AABA 4XMLH 5B8CC 3KPOA 5CCKL 2F54A 2PR4L 2ROYA 3LXCA 5K1NA 2Z31D 2EDKA 3FHEA 5I2IA 4F2ME 2Z31C 1UGKA 4ZX3A 3AUWB 1GTFA 3KJ4C 3WN5B 4BFRA 1IFHH 4JX0A 3SKJH 4AV0A 4TNWF 4HBCL 1QNIA 1Z9NA 5FO7A 2WWKT 1TYEB 3H56A 4J23A 1UCTA 5AVUB 4QRAA 1X5JA 2HG5B 5FC9A 3N44B 3RWDA 4DTGH 1ADQH 1DUYB 1TEFA 5TH2B 1MJJA 1FVEA 4N2KA 3AJ7A 5GRVK 1Z2KA 2J20A 4Y1AE 2NY2B 5FGBC 1P6WA 1W0VA 4NZFA 2HAZA 3P30L 2EDNA 1XCQB 2J4WL 2O5XH 2EDQA 4Q6IB 3VM5A 1OHQA 1ZCRA 4C83B 4QHPA 3SZKC 4BRJA 4EXKA 3HMXH 5E1GA 1OANA 1RUQL 5HHXL 3BESR 4M00A 1CF8L 4ZFFA 5K9KB 3FB6A 5EBLB 5IOPA 4RMBA 4QOKB 2X0WA 2WC7A 3FQRA 3BKYL 4I4WA 1ECYA 1DFXA 4W9DC 3KL3A 4H88H 3STBA 5I6LA 3DRQB 3U9PH 2AI0H 3QT2A 2XXMB 4AENB 3T9WA 3JWDH 3PP4L 4PS7A 2OYLA 5AQ0A 4JMNA 2R0ZH 3WNJA 3KWUA 2M2DA 3QIUD 1OIOA 3G04B 4LCUA 1WIOA 2P8LB 2KLRA 1U8CA 3EOYG 3RJQB 3GMLA 3NQKA 1U2CA 1MNUH 4CMMA 1L7TH 4Y2LA 4AH2A 3RDTA 4BJLA 1AQHA 1S7RB 3QWQB 4KI5F 2OMWA 4ORGB 2C3VA 3VXMD 3MLVH 1DQQA 1T0NA 1SOQA 4PWKA 2FIKB 2FUTA 4HUVA 2WAHA 2YBGA 3G5ZA 4ZO6A 1YUHB 3PABB 4WFED 4PRBA 4KNQA 1B0RB 1J5OH 1TVHA 4PRIB 5EFIA 3WIFA 4EUPH 1EZSA 1AQDA 2QT6A 4RGNB 1DQIA 3HR6A 1JF1B 5C2BL 5C2UB 3TT1H 1TZAA 5IB1B 3RB7A 3K6IA 1DBJH 1BAFL 1X7QB 2J6EL 3MLTA 4NERA 4XZUA 3LX9A 2B1HH 1QLFA 4P04A 4DVBA 5IWLA 3SGEH 4OF3A 3TASA 2GSGA 1O9ZA 5DZ9A 2Z91B 3BWAA 2G9KA 3KDMA 2FZ3A 3QUML 1O75A 3DRTB 2UWEB 4AYDC 5DJXA 4OGYL 5I9QC 4HJUA 1K2DB 1AZCA 2AQPA 4PD4J 1P5UC 3RTLA 2C4FU 2CBTA 3QQ9D 4M1DL 4KRPC 5LB1A 1JWSA 4GPVA 5BOJA 3CXHJ 4TUKH 5CS7A 2B9AA 2W92A 4TV3A 2HVKB 3NH7H 4MJIB 3K80A 3UG3A 5C1MB 2VCOA 2E27L 3TH4T 2PCPA 4H0GA 1IGTB 1XSKA 4NQSA 3WD5L 3TA3C 5J9PB 1LGVA 3V5KA 1MI5D 4RZKA 4UI2A 5EIQA 4R97B 3UIYA 4XPBL 4AYBA 1GGIL 3GJFK 2NY5C 4MS8D 3MKGA 4N6RA 2A73A 3CDFA 2GC7C 4UAHA 3DVNB 1ZHLA 1ZTXE 3Q6GL 2AK4A 4PYHA 3RWCB 2R1WB 1MN4A 3UYRL 4H40A 1Q94A 2MEJB 1HIML 3G5XA 4MCZA 4PUBL 1C8PA 3X14B 4H8WL 3WLBB 4HUWB 1CFTA 3PAYA 4JQVC 1DJIA 1SM3L 1TETH 4MWFA 4FXTA 1ZDSA 4EZMA 1MKFA 4TRPL 1T03L 1Y0LB 4H1LB 1RK7A 1NKGA 2HZHA 4QRUB 3KS0J 5DC9B 2ITDB 4JFEE 1QSEA 3C5ZC 3PWPB 3X11A 5SWSB 3HEIB 5CSZA 3RTQA 2X4OA 3GZPA 4LF3B 3NA4A 3MRPB 5KVDL 3M8OL 4N2FA 1HC1A 1JPFA 2BHYA 2HJLB 4ZOBA 5IB3B 5GQBA 5IROA 1BP3B 1N3NB 4YHZH 3SKNB 4G11A 3RPIA 2YPLB 4HWBH 2CRZA 4GRLC 1S9XB 2OTUB 1U36A 2BM3A 3C6EA 5FDYA 1DVFD 3X17A 2QVMA 1DVFC 3KPTA 4G7YL 4YE4H 2CHNA 4YGVA 2Z64C 1PLGH 4M9OA 1E6OL 3T2NH 4P23A 5AALA 2CLVB 2ENJA 1N19A 3ILQC 1QQDB 3RNQB 1HN1A 3F84A 3ZL2A 2NZIA 1T22A 2O72A 3UCQA 3IK2A 2G60H 4U3HA 1U2HA 3DNKA 4KK9C 1T89C 3ARVA 5CXPA 5D7SL 4L3FA 1XIWC 3WKYA 1FE8L 2JKRM 5F1KC 1N6QH 3SO5A 1DCEA 5LVEA 5IB2B 4B95C 3QB7C 4BFOA 2WOYA 3TN0C 2ALWA 1T1ZB 3ARWA 4DT2A 3LMJH 3LQAC 3ATFA 2YUXA 4FG6C 3CSYB 1Z5LB 3QZWA 4LOVA 1BQHG 5D7JD 4A2FA 5DJ2B 5GRUH 3Q43A 5GGTL 1E4WH 4YDKH 4G71B 4YDMA 4OV5B 1EJOL 5E24E 4ODTH 3ARFB 1MFBH 4DGVL 1DQJB 1G7JB 1WBZA 1KDIA 4CNIA 1DBKL 25C8H 2P49B 4G8AC 5EUOB 1U8NA 4ODWA 4IKLA 2VLJE 3V0EA 3FH8A 4O9HL 2EH7L 1VIWA 3BEWA 3D4GA 1HAUA 3TBSB 2EE0A 1ZV2A 3K4DA 3QUXD 4NIYE 2D4DA 3QUXC 4KO6A 3SKMA 1KCWA 3M45A 2MSPA 2M8XA 5BVPH 1MFCL 5BVJB 5EO9B 4Z8FL 2FJGB 2X89D 3BC9A 4GO8A 5IQNA 5I8OL 1PZSA 1CFSA 4DQAA 3ABMB 3ROOA 1UUSA 2P5ED 4MNGA 3D39B 5IJKC 1DZ0A 5CBEB 1NJ9B 1BJ1J 5I19H 4FXKC 1BWWA 1UD6A 3ISRA 2YK1L 3B56A 1QO3A 1UJTA 5B1CA 1F4WH 1EEQA 3HI5L 2FWLB 4NKDB 2Y1AA 5JPNC 3QRBA 5E4IA 1XEDA 5HHQA 3EO0A 4UILH 3P4MA 1R19A 1A7QL 3EUDA 1AHMA 3DUUB 3LZOA 3NSJA 5EU3A 1ASOA 1EEUA 1N70A 4YC2B 3G7TA 1HNGA 2DEYX 2XKNB 4IHOB 1F02I 5HDWA 1FLRL 3IPFA 1G1CA 5FGCB 5EIIA 3K3QA 1SXAA 4R0LB 4D8PB 3UJTL 4PBDA 4L4VE 5C0AA 5A6MA 2A6DA 2CO7B 5K9JL 3FTYA 3JSSA 3SDDA 5MI0C 1MCEA 5I8KH 1P1ZB 1QPXA 2WKOF 4NO3B 2KUTA 4XC1H 3SE8H 4JCWA 2QADB 4M62L 1L3NA 4RDBA 4X5XA 4L3AA 4I1PA 4CN1A 1JXJA 2YQ2A 1XB8A 1CMOA 4GKNA 2MCMA 2B14A 5LWYH 3VXRD 2Z6FA 3RHWK 1CICC 3O45A 4MD0A 3MR9A 3EFOB 3QJVB 1D7DA 3ZKMD 4J3SA 3QNYA 3ZKMC 1SN2A 3ASOB 1O6TA 4UM9D 5B1KA 1NANH 3SGDH 1CE6A 1GPOH 3BUQA 3N1FC 3IDMB 5AAPA 2EYTB 1G5GA 5HHOE 1I3VA 3NZHL 4NQXB 3WOVA 1I9RL 3VWJC 3KWWB 2YEVB 4JG0L 3TEWA 3TO4B 4KUZH 1UM5L 3UTZA 1JZ7A 4AQ1B 3B83A 4JE0A 4XRCA 3RGHA 5L8JB 3DXAD 1E9QB 4Z76A 3WS6C 5EU6B 3LRHA 1F8TH 4U6YB 4S0TD 2CWRA 3MLUH 2C9QA 2OMBA 1OALA 3QULA 4M3JA 5LCVH 3GSWA 4Z18A 5HVFB 3GXMA 3MZGB 3GKWH 2EDOA 4P3DA 1KCBA 1G6RL 4HOMA 3QHFL 1AHWA 3KHQA 1PKQB 5E2VH 3UPAA 3WDIA 3MJWA 3QRFM 3LB6D 4BCXA 1E3XA 4HIJA 5I18L 2UZIH 3LB6C 4PJDE 2IDUA 3BPOC 4PB9H 3ZDYB 4NKOB 2UY7A 1HEZA 2O5ZL 2XG4A 1IBHA 3VDCA 3NIDB 4U2YA 1HYSD 2ZSVB 2XTJC 4QHUA 1TU2B 2OXHB 3AITA 4MJ6A 3OM3B 3T6WA 2DD8L 1I3RB 2DH2A 3WMPA 3PQYD 4ZFGH 1NAKL 4YHML 1FYTE 3C08H 1H3TA 1RZ8B 4K0OA 3VWKD 2L04A 3GGWA 3D50A 3GJEB 5L4MA 3D05A 4K7FB 2YSSB 5D1QA 1EDYA 3NP4A 3O2DA 2EEAA 2I07B 3BGMB 3T3MB 1KGXA 4TL5A 5EF1A 2YJLA 4OV6F 1YEFH 5DT1H 4PJDF 4YSRA 1NFDA 3HCVA 3NABL 1UXWA 2YAMA 2YN3A 3X12B 1X5GA 3QI9A 3AM8A 2OAAA 1SXSA 3RLSA 2J3SA 3D12B 1M7DA 2UY6B 3ESOA 2CDEB 2NYYC 4MDJB 5I1EL 5C6TH 2VSDA 4WQOA 4X6DE 5AOIA 1RUKH 3QWNA 3RFRA 1WQVT 2ZX8A 1R5VB 2X1XR 3F12B 1CI5A 3C12A 2KBGA 3C8DA 3S37L 1FZJB 3L5JA 2XZAL 4LIQH 3W37A 5DO2C 4U6HB 3QIUB 3QK0A 1AE6H 5IKCB 1AIFA 3UAJD 4AC4A 3FTGB 2PCFB 3VFRA 3N50A 4H5SA 3VYNA 4Q9QH 2VDKH 2PMZA 1J8HA 2Y36L 4BUHA 1UZ8A 1AFVL 2QV4A 4KY2A 5TDOA 4QDGA 4JKNA 1PJ9A 4ICXA 4B3EA 4QF1B 5L2KE 5EV7A 2DY2A 5KN5A 4IDJL 4FHKA 2IDSA 2F6AA 4R4NC 2A4EA 3PV6A 4LHJB 4WKZB 1QKZL 2NY4D 4ZSOE 2Q8BH 3ULUC 3B2VL 2NY4C 5CZXD 5F9DC 3UZVA 4JFVA 4TNEA 5GGQL 1G7HB 2GSIB 4JFDD 4PW3A 3I3BA 1EZVY 1YRKA 2BWIA 4EUPB 5DMGD 5B7FA 3L4CA 4LCIH 4N9OB 4X6DF 1J0KA 5CN3A 1OCOB 4TYUA 2JLPA 2E0PA 1N59A 4GXFA 3T8XA 5KJRH 3MTXA 5DFWH 2AQ2A 2YGPA 3C6SA 3HE7C 4ZUUB 3BP4B 1Z9LA 1JHLL 4K8RD 3MRGB 3WDJA 2IBZY 4K8RC 1BZ8A 2MNJB 3VXUA 3PNRB 4RX4A 3UMTA 4XAKE 3D0LB 1DANU 3GHBL 3MLSL 3VFOB 5FHBH 3QCTH 3UMNA 2YQ3A 1HNYA 3S5LG 3U0PB 3QR2A 1FAIH 1KTKE 3KBPA 4D0BB 5LAXB 3CDZB 3CCHA 4RESB 2NTFA 3BWUC 4XB3A 1BLNB 3BKCL 4LLWB 1MI5B 4HT1H 4LASL 5F6HJ 2XWBB 1CGSH 5EU5A 2OK0H 5J89A 1KSRA 4CKQA 1SDYA 3SDCA 1JWMA 3ZMRA 2F61A 1NMBH 3BDXA 3OVUB 4WU5A 2ISDA 1BIIA 4QTIH 4K55A 3QWRD 4DP0X 3PJSA 4NQEE 5GHWL 2KDYA 3PYCA 1L5GA 3A21A 3FQUB 2XN2A 2YIHA 4IGBD 2BFGA 3KLDA 5DYOB 1AI1H 1Z1WA 3MC0A 4NZUH 2H9GB 4PJBE 1OAQL 1GZHA 2D2OA 5SWZD 3SPCA 4AE0A 3EDJA 4ALAC 4HG4K 1CFQB 3CVBA 3ZOAA 2GC4C 3NEOA 2ITCA 2ICEA 2E76C 1HOCB 1DJYA 5HXMA 2VISA 2WLJA 1F41A 1EX0A 3HZMB 4G8EA 4M8RA 5FWQA 5F3BA 3QUYA 2APBA 1AVAA 3WFDH 3DIDA 4MHHG 3QISA 4MX7B 2YGVA 1ITBB 4MXWL 4KY1L 3C9NA 3AB0C 4UT6A 3UTQB 3ZSTA 2R1YA 2DYSB 3VRIA 4Q52A 1ECZA 3FT2A 4JO4L 4UT7H 3MUUA 2VKWA 4MNQA 3RWFB 3L3HB 1OKEA 5EUKB 1ORSB 2WCPA 2IOIA 2H41A 5EU4B 3CHXA 2BSDA 1FQ9C 1SXCA 2X10A 1U21A 3LIZA 1MCOL 3LKNB 2R9HD 2NW3B 1NBZB 4UT9A 4OCWH 2A77H 2H5UA 3IAGC 3N3EA 4QRPA 4PJBF 4GT7A 3S3JA 4L8CA 4LEOB 3MGOB 3VDBA 1U4FA 1KIPB 3L2LA 4B9KC 1NKOA 2VDNL 2H26A 3PAUA 5FOJA 4Z3GA 3EBAA 3BW9A 4ISVB 3L5XL 2CIIA 4UQBA 4P5SA 3K8KA 4ZMWA 4XWGH 2VM3A 4JZJB 5K9QG 4HFWB 1INQA 5F93C 5I8EB 3ZTJG 4UIKH 3D06A 2E4FA 3ELQA 4OD3L 3K2UH 1ZHNA 1HVXA 2E56A 2ZNXA 2IH3B 3LKSA 1BOGB 4NQCE 2KL6A 2FJFA 1K5WA 1K72A 3PWVB 4IK6A 5J1TC 1BD2A 4XPHL 2ESVA 5DEGB 4XNXH 1PX4A 1XR8B 3MA7A 4MMYA 5DA4A 1ESOA 4PV9A 3SJVB 3MX0A 1AXTH 3AY4C 3GZOA 4MXQC 4M61A 4CADA 2RCSH 4AT6A 4DJMA 4PWEA 2BOBB 4PW4A 5J6HA 1JVLA 4X8JA 2RFXA 3AG1B 5CCKH 1TFHA 2PR4H 5AVTB 4RSYA 5CHNA 1EGJA 2VRKA 3FUJA 3K5RA 4ODUA 3ESMA 3DX2A 4PJ6A 1YPZE 4HBCH 4A6YL 3U36A 4GG6A 2ENSA 3FHQA 4H0IA 2OMVB 4LLYA 2F0CA 4JHAL 3U4EA 5I0DA 3Q5OA 1WSST 1MDAA 2XX1A 5HGAA 4ELKA 3LOWA 1UVQA 1NDMA 1KG0A 3K6FA 3MZTA 1LDPL 2DAVA 4JFOA 4KFMA 4BH7A 3PWJB 5ICXA 4O2FB 4RGMC 3OG6B 2XQBL 2VLRB 3TNMA 5BV7L 2YAEA 4HWEL 4WDIB 3FUKA 1HE8A 1Z5YD 4RMUA 5EC2B 1VFUA 3P30H 2Q7YA 1YC8A 3NRPA 4OI9A 2J4WH 3EF7A 3NCFB 1SDDB 3D2UB 4IOIB 4PJ7B 3V10A 5DTFA 3SDAD 1KXVC 3AUVA 4OIFA 3BRFA 1E4KA 4EI5B 1MCCA 2BPBA 1RUQH 4F9LC 2H0EA 3GRWA 1CF8H 4G8FB 4CN4A 2FEEL 2BCMA 4JLRA 1U8PA 1AGFA 2LLNA 4G1MA 3GXIA 3EDFA 3IGUA 3VXSE 3W2DL 1LE9B 5LNDA 2DBJA 3BKYH 4OQ1A 1DE4A 5ICYA 4A68A 4DCQB 2VITB 3SGEI 2CD0A 3MRIA 1OQOA 1IJNA 2AABL 2GI0A 4GRWF 4K9EC 1YPZF 1PD1A 3PP4H 3BP5B 4CVXA 3ESPA 4GW4B 1H8LA 3TCTA 1N2RA 4LCWA 3MBED 5CP3A 3MBEC 2EUVA 4UOW1 2BNRA 4LRIC 4UM9B 2GEQA 4R2GC 3QO1A 3B7RL 4F9PC 2J5LB 1U8IB 5LBSA 1ICTA 2EYRB 2BRRL 3F7QA 1U8JB 4IIZA 4LVOB 3CPUA 3BKML 4XPTL 5GXBB 3ARGA 3FTVA 4AX3A 1OGAD 5AW0B 5I1AA 1NUDA 1CC3A 4HAGA 5L6YL 1XZ0B 1AXIB 1E8XA 1E40A 3QIBA 5KS9E 3W9EA 2WKGA 5ICUA 5C2BH 2NNCA 3AWGA 5FF6A 1OSZA 4ZPTA 1BAFH 2J6EH 3LN5A 1I8KB 2WGNB 4I2XA 3S3SA 2WTRB 3MV7A 1V7NL 2VE6A 3SY0A 4TSAH 1JNHA 4XBGB 5EN2B 3IAQA 3TEYA 5EO1A 5D7IB 2HPOA 1I1AC 4I48B 3QUMH 4BZ1A 2WAQA 1E65A 4OGYH 4C56D 2Y1YA 1XF4A 1JD7A 5L2JA 1ZT1A 4HOWA 2DWSA 4M1DH 4ZZFA 5BQ7A 3MV8A 1IGYA 1N0LA 5JHLA 2DQCL 4ZW3A 3QH3B 1S6NA 2BP0A 1F1GA 3HFFA 1YDPA 3IN2A 3SGKA 2FR4A 5AW3B 2E27H 2V7NB 1XF2B 3H2QA 3VFWB 1B4LA 1I82A 2JKLA 3WD5H 1TZIB 2OX5B 3NK3A 4M4RB 4XPBH 1O6SB 1GGIH 1H3PL 1JZDC 4NQDE 2OSLA 1CGUA 3RUGB 4A2GA 3QPQC 3PQYB 4M4PA 3Q6GH 5KS9F 1UKQA 3WI9A 1CFVH 3VFVA 1FZKB 3A23A 3P69A 3H9SD 3HS0A 3UYRH 4KO5A 1HIMH 1W91A 1Y18B 3VACA 2K6WA 1KY6A 2BNQE 4Z7IA 1LTXA 2MTAA 4O00A 4LSRL 4I8DA 1SM3H 4QHKJ 1FUNA 5C0CA 2DMKA 4TRPH 4F15B 1T03H 1NCOA 1R3KA 3TV8A 2R15A 4YN3A 2MFNA 2YR3A 3OR7A 2YAHA 3Q5YA 4TUOB 3S8GB 1YEKL 5KVDH 5BZWB 3M8OH 4E5XA 4FLSA 2ZP9A 2IPKB 2NY5L 3R7QA 3JVFC 3PNWB 3QNFA 3TURA 7FABL 3E7JA 3V7MA 3DGCR 4G7YH 1RZGB 3N1PC 4QTHA 3ISWA 5DRNA 1NH6A 1E6OH 2CAKA 3UBHA 1FSKC 1DHKA 1J9CT 3TBVB 4LSTL 2FNWA 2XKUA 3BJLA 3FSOA 1VEPA 5AAMA 5IBLC 3THML 3U9UA 3ZRSA 3E38A 2VDKB 5CLZA 1RULL 4KDTA 3WAJA 4NN6C 2MCPL 3UPRA 4K23L 5D7SH 2CR6A 4Y5YB 2HT3C 1YMMB 1FE8H 5AD0A 4FXGC 2X12A 3APDA 5ENWA 1LEKA 5C97A 3VUAA 2UZXA 4M3KB 4TQHA 4WTZG 1OPGL 1WCBA 2J56A 4HS6B 4PJEE 1UADC 4G5AA 1YMHA 1AXSB 3C75A 5HDQL 3NRFA 3SE3A 3ZKXC 4OZFH 3H7LA 4APXB 5GGTH 4RQQB 2A74B 5F3FA 1JFQH 1BECA 3UTPE 1OAKL 1EJOH 3NVQA 3CPLA 4HHWA 4B7IA 3CQPA 4DGVH 2GTQA 1DBKH 2AJZB 5BOPA 1D6EB 3VI3A 2WQRA 1X6NA 1AC6A 4UBDC 2EH7H 5KTEH 3Q05A 1UWXH 4CBPA 3DV6B 3T4AB 4A2DA 3GO1L 4O2EB 4EZKA 1MFDL 2WTOA 3R4DA 1U3HA 1MFCH 5DJ8B 4Z8FH 1Y7VA 3T09A 4M7ZB 3RGBA 1E28A 3ZKND 4BFGA 5BJTA 5I8OH 2WNGA 3BD5A 3CLEL 2JXMA 3MUHL 4YDLB 5CJQH 8FABB 2NUPA 3OHXA 4J3WA 2D73A 1AYRA 1M6UA 2PCXA 4PJEF 4ZMLA 3IVKA 3S2AA 3TFKD 4AMWA 2YK1H 4Y4KA 3TXAA 3S34H 3M1OA 1H0DB 3MFFA 4FZEL 2YO3A 3RVVD 1JMXA 4S0HA 2AMUA 1AH1A 4PJ8C 1FDLH 2IAND 2ZF9A 3QCUL 1A7QH 4P5KB 3ZQ9A 4XN7A 2V9UA 4AM0B 2GK2A 4EDXA 5SWZB 1JTTA 1S5HB 1QR1A 2EXWD 1NANI 3SGDI 1TCRB 5DC2A 1LK3H 2FHBA 3MRKA 3ZX1A 1S7TA 4V1DB 3WTUA 3MJ9L 5DU7A 1Y6KR 1HDMA 3UJTH 4Z3FA 1LD9A 5EG6C 1N8OE 3SPIA 5K9JH 2ZICA 3OC8A 2B3RA 4CRPA 4F7EB 4C55A 2YZ1A 1FL5B 1G7MA 4U1HA 5ESAB 1A2YB 4DPCX 1BVNT 3FSWA 3N1MC 3DTXA 2HFGH 2B3IA 4HLZH 4KTYA 4M62H 3LZNA 4L3CA 5T1LD 1A02N 3L8QA 3ZR6A 3E8VA 2WLIB 2MHAA 3GLZA 4NN5B 4D9LL 1HHHA 5TE4L 1WHPA 4H8HA 5JXED 1E5CA 4GUQA 1EUUA 2XPGB 1JRHL 3TCXA 3NFNA 2PUQT 5IFAL 3DJSA 3H3BC 4JY5L 3W11C 2OV0A 4MB3A 5FFLA 1OTTC 3GZQA 3NZHH 4N90E 1I9RH 3L54A 1MCPL 5HYEA 4JG0H 1XSOA 1PBYA 3RX7A 1UM5H 2KC0A 2G2RA 2GJPA 3GI8L 4FNLL 2ZXCA 4FJYA 1ZHBA 3TEUA 3DURB 1CGVA 3LH2H 4Y1TA 3QWOB 5IJCC 3U1PA 3QRLA 1NGQL 4L0YA 1TQVA 3BZEA 2HG0A 3TVMD 2MQGA 1ZT7A 2CBQA 2R69A 3JWOC 4Y19E 1C16A 1XGYL 1UZGA 3RFZA 5ITFB 5HJ3A 1A9EA 5E8DL 3AREB 5DJZA 5DQJA 3HJ0A 2WO4A 1G6RH 4JK0D 2RBLA 3QHFH 3FB5A 1KY7A 4LHUD 4MD4A 2CM6A 3ZGIA 3BT2L 3LV3B 3VXTB 5I18H 2IPTL 1UATA 3FH5A 4EJ1C 4XC3L 4HUXB 2VC2L 1KTCA 1A7OL 1CD8A 5IK3A 1ETZA 2O5ZH 4TQPA 4CDHA 4ZXBD 2Q2EB 3AACA 1HXMB 3IDYC 4Y2DA 4Q9RL 2ICWJ 1NGYB 3RU8L 4RA3A 3N06B 5FEBA 3L4WA 1F3RB 1J05A 4IRSD 4NPYA 3DECA 1FH2A 2DD8H 3HBGA 2AEQL 3HC0B 4HK3J 4P2CG 4YHMH 1OP4A 2NQDA 3C5JB 5E23A 3P73A 1IL1A 2W0PA 5IVXA 3QQ3B 5I75C 2X3BA 3EYSL 4A1IA 1Z9SA 2QL1A 4GAYB 3I6LD 3W0WA 5ICZA 3HG1D 1D9KD 1D9KC 1XGPA 3GJFH 4WFGD 4ACPA 1O7SA 2YKLL 2HFFB 3TTYA 1Q38A 1A7PL 1HXKA 2ZWSA 3EJTA 4RDQG 5E1IA 3QIWA 3SDAB 3T0WA 4AG4L 1WBYB 1SBBA 3NABH 1NCHA 4D9QE 4PCSA 2PYFB 4TUUA 4N0FB 3RDTC 4PBXA 2WQ8A 3MJGX 5I1EH 4RVBA 4AQAB 5BS0B 4NNYB 4KC3B 3U2IA 1I31A 1IGJB 5F97E 4B41A 1SJEA 3FFDB 1NGPL 4D0CA 3LJ3A 5EU7C 1BXUA 3TPUB 2C4XA 4ZUWB 2C9RA 4QHMB 3S37H 2IH8A 3AXLA 3EO1A 1KBGL 2XZAH 4BSJA 2BWQA 2NY1C 5D7LD 2XN9D 3UJIH 3MROA 3UP1A 4LEXL 5DJYB 1VLXA 5GS2D 5GISL 5AG8A 2CO2A 4MSWB 4HCRA 2KKQA 4P46A 5IWLC 3BAKA 1W80A 2D7MA 1AD9B 1Q9WB 3M17B 2Y36H 1AFVH 1U42A 1BOYA 4B9PA 4PU2A 2NCMA 4IDLA 5CZVL 2LT9A 4IDJH 1JUFA 2PW1B 4M1CC 4X6FA 1QKZH 1RJYA 3B2VH 3ZTEA 2V5RA 5ID1B 2FB4L 5GGQH 3K0WA 3REWA 5CMAA 3OKDA 3DVGB 2Y4SA 3SBPA 4FABL 4NHUB 1WDAA 4QRRD 4UNIA 3N44F 5F2FA 4QLRA 2D4FA 3BSZL 2GJZA 4Z7OB 2MCG1 2X0VA 4ZAKD 3WFBL 4AZUA 5T1JA 1H5BB 4HEPA 3RIKA 3S4SB 1D5XA 5FM5M 3QUMB 1ZK5A 4C56B 3RX8A 5HHMD 2TRHA 1JHLH 2AXFB 4HKJA 5H2BA 1SHSA 3ZYZA 4NFBA 4HJGB 2WKLA 1YAIA 2XPYA 3GHBH 3MLSH 4XMZA 3GSNL 1EVTC 2R7EB 3PXJA 4PRIE 4QIRA 3O6FB 4P2QD 1VFOA 5EBMB 3GXTA 3BKCH 1R1CA 4UWQB 4PRNA 1BM3L 3MLYL 1QSED 2ERJC 5GS1B 5JDSB 4TMPA 3N0PB 3PDOA 1AO7E 2GIYA 2UWEE 1R3LA 1AY1L 4U6TA 3RWIA 4F92B 1DQML 3B3BA 3EFDL 5C70A 4XP9L 2NY6D 3O4LA 1A1OA 4O2CB 3D0VB 4GSRA 1V3MA 2UXFA 4Y9FA 3H9SB 5EO0B 1EUTA 1HSAA 5GHWH 2YRLA 5AENA 1I7UB 5IROC 5F1IB 4HUCA 4HKBB 3MACL 2ZOUA 4ZUSA 1VEOA 4U1GB 5DEFB 1OAQH 4HISA 4EE2A 4ZRGA 1G9MC 1R24A 3MJ8A 2X6VA 2ZKXA 1QP1A 4R3SA 4BKLA 5KOVC 3QDGE 4P23C 2WK2A 1H3VA 3IFOA 3LHPL 4JFYA 2B2XL 4XVUD 5AYTA 3JV6B 3ROLA 2WB1A 4DAGL 2NW2A 1AZBA 3FU6A 1NAML 1XGUA 1XCTB 1T21A 4KY1H 4MXWH 4XXWA 3MMEA 1TNMA 1JHTA 2VRQA 5DJAA 2Z9TA 3KW7A 2CK2A 4A66A 1WFOA 2AXJA 3QA3A 3FOLA 3LXAA 2EXYD 3ZE0B 3KPLB 2UWEF 4JDZB 4JO4H 4OQTL 1ZLDA 4YNYB 5I1KL 2OJEA 2MJWA 1HH9B 3O3EB 2NT0A 1BFVL 1JPSH 2NSQA 3B9KA 5E2WL 3LPPA 4L3EE 1MCOH 1UA7A 2A0LC 3MRQB 4HEMA 4W6YB 4ALAL 1Z0MA 2WVUA 1JNJA 2YD2A 3HFML 4G2AA 3WEBA 1T66D 2OMTA 2N7BA 4NN7C 4L4TA 2VDNH 1LO3L 1SYVB 5GJSL 1NEZG 2A6IA 2MTZA 2WCSA 2ZUXA 5T5NG 3V0HA 1W0WB 5EMYA 5IIEA 1LO5A 4JHZA 3L5XH 4YHIA 4GSQA 3TV3H 1FORL 3B2UC 2XNAA 4J6RL 1T1YA 2DLEA 3UGXA 1G9EA 1ONQB 2DMCA 5GRYA 2APTA 4HD9A 5CCJA 3T77B 4KITB 4OZFB 4FAAB 2QKIA 3LKRB 4HJIA 3EYUH 5AG9A 5I73B 5DQ9A 1PMYA 3RWHB 1ZS8B 1TJHL 4OD3H 3VSTA 1VZHA 3OHMB 2VR4A 1KACB 2L4OA 3Q9QA 4ZMNA 2PNDA 5FKAA 1O5DT 2CE6A 1X5KA 3ZDWA 4XPHH 2W0LA 4RWHA 4X4ZA 4QR7A 3DDGA 2JIXA 4AZ8B 1JIBA 2J21A 3GEFA 3TZVA 3PP3H 1UOWA 3AS1A 3WTVA 3JWNC 1WH0A 1XH0A 2ZCKL 1TJGL 1O6VA 4YHPA 2CNYA 5E00B 2IADB 1ED3B 2NY0C 2E7LC 2ZT9C 5KAQF 3ZKQD 3GLDA 4JRYD 2CHXA 2VXSL 4A6YH 1OLZA 3E3QC 1FHNA 3CN4A 4FLHA 3N85L 4X7FC 3SDDC 4EI0A 4JHAH 2WXKA 2IANB 1VHPA 2ATKB 1EK3A 1LM8V 1DBBL 2F53E 2OL3A 2Y07L 4KKAD 5CD3A 4KO7A 2AEOA 1KJ2L 4QHNA 1LDPH 1EO5A 1BZDA 2ZXDA 4XVTL 2XQBH 5JDJA 5DD0L 2APWA 5BV7H 4IRZL 4HWEH 2AKRA 1MWAH 2IAMB 1IM3D 2LHAA 4G7QB 3D39E 1BXAA 2Q3XA 4DUWA 4A7GF 2P8PA 1U58B 1IM9D 3PPSA 3IYLW 4W4OA 4TPRL 3MRFA 4OIAA 4OFDA 5I30L 1EFXB 1EQWA 1MXGA 3TIDA 4JKPL 3W2DH 2H2PD 2UYLA 1DVUA 2H2PC 4QYAA 5TD4A 3HMWL 2P44B 3U0TA 5EUOF 2AABH 4OCXL 2R2EA 4FG0A 1FNHA 5GGRB 1RAMA 2WW8A 4FLQA 2EUWA 3RIFF 3KLAA 1W8NA 4N2EA 3GSQA 1MHHB 2VTFA 2NX5D 1Z9PA 3I2CL 3WNKA 1ZSDB 4RFNB 4NC1E 1YEDA 1RJZB 1WIPA 2BRRH 1W72L 2EIZA 3FBQA 4YDVA 3BKMH 2QVKA 4XPTH 3W1ZA 4AIEA 5MEQA 2GJ6E 3IE4A 4Y4HD 2EUZA 2A4ZA 4OCSL 4G9DB 4MKMA 5L6YH 3KXFE 1TSHA 3RJOA 4C4KT 2DQUL 4MCYB 2JK5A 3OB8A 3ARBA 4L1LA 4Y1SA 1P84J 2LTQC 3ECBA 3M1BA 5GZOA 3U48A 2V2WA 1OE2A 1V7NH 2Y2TA 4PWIA 5ABAA 4QT5B 1B90A 3SPGA 3WNMA 1MELA 4WI6A 3COOA 5I5RA 4PN6A 1AMXA 1G6RB 1EPFA 1UM6L 2O26U 5DFAA 2EECA 3E0GA 4DH2A 4NZ8A 1KIUB 4UM8A 1R0AL 4QHLA 3L9EA 4MBOA 4PP2B 2B39A 3C60B 5DRXA 3KPQA 2FO4B 4LFHD 2DQCH 5I66B 4PG9B 3WCYA 3FOMB 3MLZL 4FD0A 4K5OA 5AYQA 5DXWA 5KBPA 1KTRL 2D3NA 2FVNA 3T4YA 1IIIA 2PXYB 2Z8RA 1NGXB 2DQIH 5D1QC 3VFUB 4NO0A 2XFGB 2UXVA 4QXUL 5AW9B 1UD2A 3FTWA 5T1MB 4CVUA 3H9HB 5IJVA 1F4HA 1H3PH 4HDIA 5JORB 3GSVB 1DUZB 5C09D 4KI1A 4Z7VA 3QO0A 3U30B 3QI9C 4PRAB 3AM8C 4YL4A 1PKQE 4D7BA 4ZYKA 2Y2WA 4A52A 3FTSA 4K3JL 3FQXA 2DBLL 3ZZLA 4P4KA 3O8XB 4TF4A 1NGZB 3ZDYE 4LGSB 3LS4L 1J88A 4XMKL 4IBVA 3NA9L 3NIDE 2I24N 3OLDA 3EHBD 3GJFB 2BIOA 3EHBC 5HI5C 3ZTNL 3KMDA 1BF5A 4NO2B 5F72S 2BSTA 4N3TA 2W9EL 4LPUA 5DRZA 1RUPL 4JM4H 1UXSA 1OW0A 4TS6A 5GRWA 3BFOA 4EDWL 4DKDC 1EA9C 5B39G 2WQSA 3TIEA 3CHSA 2AZAA 5CEZL 1WV7T 2NY5H 2FYVA 1UEMA 1JN6B 3T1FA 1NFAA 3V5HA 2E8YA 1HJBC 2R0KL 5TK4A 5F89A 3FFCD 3HI1A 7FABH 4HWNA 4ADIA 4DZBB 1A4KB 5D7LB 4EKJA 2F15A 4RIRA 4U6XA 5IHUH 4EIZC 4YQXL 4M6AA 5TGBA 3THMH 3ZDYF 1U8KB 4NSKA 4B0MM 2C4FT 2C7UB 1RULH 1ZLSL 3HZKB 4EQ3A 3ZT7A 3KCWA 5DS8B 3WJJA 2MCPH 3NIDF 3VI4B 2O1AA 4FULA 4K23H 4G6JL 3VXOA 3TJHC 2FEDC 2IWEA 3HG4A 4QMEA 1W15A 1YEIL 3IDGB 3RGVD 1FVDA 3CC5B 5CCGE 4WHTA 4Z9KB 1P4LA 2AXHA 3F7RA 5L4FA 2P4AB 5GS0C 1OPGH 1U41A 4Y5VB 5IFJB 4WNJA 2IGFL 5HDQH 4QRRB 4G83A 1V10A 1SY6A 4KK5D 3U2SA 4KK5C 4ZAKB 3IMVA 3W39A 1W16A 4YVNA 1BYOA 1OAKH 2X42A 2GK0A 3HHSA 2CA4A 5J11B 1MCWM 1T0MA 2Q6WA 4Z5RB 3QARA 3SDCC 1S7WA 3T3MF 5K39B 1K4CB 5HPMB 1BVLA 1DDHA 2OJ1A 2Y5TA 4X50A 3FBKA 2WO2B 5EZPA 5I1CH 3V4VL 4OFYA 3PUCA 4BA8A 4PLNC 3L3JA 3MA9L 5F9JA 2OR7A 1NBVL 1MVFA 3VFMA 4MLIA 4JPVL 5I24A 1ASQA 3GO1H 3NEXA 5HD8C 2YMXL 4GQQA 1MFDH 5KG9A 1A66A 4PJ9A 4PVBA 4JFFA 4QCIB 2ICEC 3VG9B 3CLEH 2H6UA 5E4EC 4PGCA 3QUYC 2NY6B 3NFPA 4YX2L 3D52A 1FN4B 1D3CA 4AIOA 1QWUA 1UH4A 2PO6A 2VQ1B 5IBUB 2HUHA 4FZEH 2EYSA 4TKWA 3UTTA 5KSAB 5DI8B 3LAFA 3O81A 3SCMD 1GZPA 3QCUH 4YHYB 3SCMC 5BOZG 4H20L 4Q7DA 4Y9BA 4CJ1A 4I0CC 1QHPA 4F1SA 1TQUA 4BQBA 1N8ZB 1BIHA 3Q1SL 3D69A 4GG8A 3HUJA 1U0QA 5E1AB 1RHHB 5I1LA 1LE5B 3FC8A 3GTVA 5D2LB 2C1PA 2IOMA 3BUTA 4FMKA 1HHKA 1XCWA 3EG9A 3IXTA 1L9SA 3HN8A 2UZYB 3MJ9H 4GQ9L 3V9CA 3ESNA 4Z7QB 2X4QA 4FQQB 1M7UA 4GMTL 4YSUA 2QHLA 1KNOA 4TNVF 3SYOA 1RK1B 5FFGA 4AKPA 4WW1B 3PGCA 4BD4A 4RFOL 3HJEA 5ACMA 5DJ0A 2XZQL 3DK0A 1T1WB 3KEHA 4G8GD 2JCCB 5D1XE 4D9LH 5AKRA 5TE4H 3H54A 3MRNA 4ZFOA 4U33A 5IW1B 4U3XA 1JRHH 3TONA 4NB7A 5IFAH 5MEND 2ATAA 4XP6L 4EN3D 1L9RA 3C6LB 4JS7A 3S35X 5ACZB 2VRAA 4IBQA 4JB9L 4K4KA 4M7KL 5DQDL 2VDNB 1LO0L 1XF1A 1QNZL 1YG9A 3RVXD 4XBPB 1MCPH 1FFOB 5CO1A 4FNLH 1TT6A 3GI8H 3GIZL 4LQFL 2BXYA 5DUML 5T3ZD 3GUFA 1B6UA 4AIXA 4U0QB 2YC1B 3VFPA 2W60B 1NGQH 4LVHB 2FRGP 3AQDA 1Y1DA 2V8MA 1WPCA 4MKTA 5E03A 4EAEA 1WJ3A 1F11B 3DX8A 3GBML 4F3FA 5FECA 1HNFA 5J56B 3DYMA 1CK0L 2EDRA 1XGYH 2NNXA 4IIQA 2GHWB 5ACLA 5E8DH 3NN8B 4LK4A 3MRJA 1V05A 1SLVA 3E2HC 3HE6A 2A83A 4J4PD 5EBWB 4G1EB 1R5WB 2JVUA 4E41D 5IW3A 1BSIA 3OR6B 4B27A 3BT2H 1ULVA 5DGRA 2IPTH 2FJHB 1GS7A 2VC2H 4HEPG 5E6ID 1A7OH 1HCYA 2NZ9D 4RNRB 4KQ0A 2NZ9C 3ET9F 1KPUA 2WUBL 2AQQA 1QFWH 3JV4B 2I85A 1CT8A 1G1OA 3HVDA 4J8RA 4Q9RH 3CFDB 3RU8H 3V6ZA 3H0TA 4QRQA 3U0WL 4U4BA 5INDB 3U6XA 4AL8L 1Q9LA 4JVWA 1Z5HA 4A6YB 2DQFA 4WWOA 2VSMB 4C8XA 5MP6L 2AEQH 5H94A 1P7KA 4LAJH 3BUIA 4I87A 1CD1A 2NUTA 3SJVE 2X6CA 3C09C 4FEIA 1UB5B 3SBQA 3EYSH 4FG4A 4PJGE 3NSFA 1TLMA 2EDLA 4U1IB 5D7HA 4XN4A 2OMUA 2J7LA 5KBMA 2FQGA 2VR5A 3KPSD 5BV7B 4JRXB 5HYSG 5I8CB 2BY0A 3B34A 2QPFA 1MWAB 1IM3B 2YKLH 1WAAF 1A7PH 4A38A 2VIRB 3MNVB 4HWUA 4AG4H 1IM9B 1HCFX 3QJQB 2QPDB 2OYMA 2ZUSA 4Y8DC 4NRYB 4YHOL 3ZZQA 1U92A 4XCCL 4GW1A 5EF0A 2UXGA 5BMFL 5IB5B 2VL5A 3KJ4B 1NGPH 1UYWL 2PPFA 3ARGC 2X7LA 3NFSL 3WUWA 3DV4A 3HHMA 3MRLB 4BK5A 2VLRE 2P48B 4HC1A 4UZSA 1KBGH 1KTLA 3LPFA 4XTRC 5SWQB 4ANUA 2XTSA 2GVYA 1UB6A 3QIBC 5T5FA 2JTYA 4LEXH 2NX5B 3SKOA 5A6LA 5HY9B 2E4TA 2BFVL 2IBBA 3GS7A 5GISH 1XF3B 5F8QC 4UQCA 2CO6A 2EVGA 3CNKA 3BP7A 3QFJD 3FTXA 1BPVA 1F4XL 5D9SB 2EIEA 3NESA 5CZVH 3V0JA 5E8OB 1VRSA 1IUZA 4O02L 1TTAA 4UDTA 4X6CA 2AVFA 1EZLA 1TZHB 2AMGA 2X4NA 5FX3A 4P4RB 2FB4H 4LARL 4MLSA 1GOHA 4P57B 4RRPM 4FABH 4YXKL 3SGKC 1NM9A 1KXTA 3UABA 4GO6B 2DKSA 3BSZH 3OKOB 1KCKA 1TJXA 1JMZA 2P1YA 4BUQA 4DKTA 2NSMA 3D08A 4GMSL 3WFBH 4OUOA 4Q4EA 4W9EC 2V2TB 5T1KD 1KIQB 1WAEA 1FH5L 3KM1A 5DZPA 1SN0A 2B0SL 4J7RA 1WZ1L 2AXGB 1U30A 5CR1A 1I9IL 1ZSHA 3TF4A 4PY7B 3D8MA 3PHOB 3W82A 3QJSB 4LPYA 4KAQL 4X0KA 3HS0C 4KKBD 3GSNH 3FF7A 3BCFA 2UV3A 4FQ1L 4EF3A 4XP1L 1AP2B 3DX9B 5C86A 2OMXB 3RWJA 2I9LB 2R23A 4LSQL 1KPVB 2HLEB 2GITB 1BM3H 3D85D 3MLYH 4HIHA 5CGMA 2AJVL 2B77A 1UA6L 3CDGB 3ASWA 1TPXC 4YIQA 1I1FA 5C09B 1AY1H 4G43B 3T2LA 1DQMH 1SF3A 5IMOA 4KMQA 4PEEA 2Z7ZA 4J3OG 4HZLA 3RRQA 4OGZA 1NC4B 1R3JA 3MDJA 1MFMA 2BIHA 4OD2A 3AU1A 2P80A 1N5AA 1EBPA 3MACH 2OSXA 1KJVA 3ECUA 5SX5K 2B9BA 2ZX5A 3BZ4B 2BVOB 3VGFA 3MVSA 3RZWA 2NXYD 5AUMA 3KPRA 2NXYC 4R7DA 2V5TA 3C8KA 3IFLL 1OM3L 4WO4A 3IDXL 1W2KT 1S4IA 3RUGE 2EDFA 5AAMC 3LHPH 2B2XH 1HSBA 3B7SA 4AYFA 3BH8B 2AF2A 5AZUA 2DWDA 1NAMH 3G5VA 4GIAA 4KDTC 5DMKB 5K9OB 3ULVE 2HVJB 3FFCB 4N68A 3UBXB 5D7IF 5IZ7A 4PWJA 4TLSA 5EA0L 2MPVA 3C8HA 1C08B 1TZGL 4OQTH 5I1KH 5GGVY 1BFVH 1X9LA 4JPSA 4XCFH 4ZMQA 1CL7L 1BVZA 3SE3C 2BSEA 3T0EA 5A3IC 3CN1A 5FUCE 4PR5A 1QFOA 5DK3A 1NDGB 3HFMH 3CWGA 5AVZB 4D0DA 1PPIA 3KPPA 4OZHE 5A2JH 2VN3A 2XXGA 4X5PA 2NTSP 2ETWA 5GJSH 1LO3H 3FONA 3RGVB 5FB8B 3RUGF 1QSZA 4XP4L 1J11A 3I6SA 5GGSY 3GHEL 1BG9A 4J6RH 3UADA 4I7ZC 1BLIA 2QPUA 3S6CA 3TYFB 5KSVA 2OXGB 1XH3B 3KWTA 4MZ3A 4ODXA 4HOXA 3MTRA 3APNA 3ERXA 4U1NB 4ENZA 4DNLA 3N42B 4KK8D 1GGYA 2ENPA 1TJHH 4KWUA 4OJEH 2AEWA 2WTPA 2WWKO 1QRNB 3B6SA 3PGDB 4MAZA 1YMME 1SJHB 2FQEA 5TFSL 2P5WA 4I3GA 4U3CA 4X9GA 5EOQL 4Y4KC 3E1F1 3OXSB 3UYPB 3I02A 5E94A 5C0IA 3FFOA 4UQ3B 2GAZA 1U95B 2DICA 2BNUA 3OGCA 4H8QA 3NSDA 3HKZA 2ZCKH 2VLME 1TJGH 2BK8A 4B60A 3V4PA 2FEEI 1E42A 3LSOB 1BBJA 3VJ6B 2ED9A 1IKOP 5A2AA 1E3ZA 2EIBA 2VXSH 2W65B 3UEQA 1YC7A 3NJNA 4H25A 3N85H 3HB3B 1VACB 1FJ1A 2D3LA 4AK1A 3FUDA 1EHLL 4RRPA 1DBBH 2Y07H 4KHTH 4Z7NB 5D1ZB 5M94B 1TTFA 4GBXA 1KJ2H 3QORA 3KCPB 1BVOA 4XVTH 1ZVHA 5GS3A 5DD0H 3C87A 4O5LL 3QQ4B 4IRZH 1LP9A 1IAOB 1OARL 2DLTA 2F74A 5C07A 4KI5C 4Y1AD 2O5YL 2HLAA 4XGZB 4TPRH 5BZDA 5I30H 4JKPH 4QUOA 3UO1L 4LPQA 4PVMA 5J3HD 3VFGH 3HMWH 3L9RA 5B3NA 4M5YL 1R75A 2W80C 4OCXH 4P9ML 2WCGA 4XO4A 4NOFA 3RBSA 2AJXL 2X70B 3IGAA 4Z3TA 4V1DE 4HIIA 5B38A 2DIBA 4Q6YA 4Z3IA 4JL1A 1UA3A 4PM1A 3I2CH 1QSFE 1R3IL 3QG6B 4FKHA 4XPFL 5ILTL 4EN3B 3EJSA 4Y4FD 4PJIE 3RFZC 4WI9A 4XXCC 3U4KA 1RUML 4LL9A 1QYGL 1BFOB 2WIIB 1CCZA 2IH1B 3NAAL 4HETA 4OCSH 4DHLA 5MI0B 1CFNA 1Q0XH 3LRSB 1ORQB 2DQUH 2HG5A 3CFBB 4LOEA 1L9NA 5TDNB 1DUYA 1JNLL 5L88H 2F08A 3MRMB 4JY6B 2F68X 3TBTA 5BXFB 3G6JB 1SOXA 2D7TL 3LEVL 4Y2DC 1XR9A 3VGAC 1OAJA 3DI3B 1CICB 1XCQA 1QVOA 4NPJA 4ABQA 4RFEB 3F6JA 5IR1B 1UM6H 4E41B 3FSVA 2WBXA 3K6DA 4XBEL 1R0AH 1UT2A 4TVPE 1X9RA 5K9KA 5E6IB 2VC2B 1X9QA 4K3HA 2KHAA 4XMUA 4I0PA 1NPUA 3MLZH 2ZOTA 4GW5B 4QOKA 3DWTA 4Z3HA 1GYAA 4KJQD 3LZPA 4ZJ9A 1NICA 3BZFB 3SO3B 5IBTH 3QZNA 4X8GA 4AYMC 3MCLL 2J12B 1NMCC 3PFUA 4QXUH 3P4OB 3UJJL 3OAUL 1N7ML 3QIWD 2MNWA 4R9HA 3QIWC 2P8LA 1S78D 2M26A 3U4BL 3UBXI 4FP8L 2QQLL 1G0XA 3FO2A 4D7PA 3PHQB 4E36A 3BAXA 1AACA 4K3JH 2Z4QB 2DBLH 3MREA 4HHAA 3K2MC 1Y7MA 1EAPB 1ZTXH 1QLRA 2D0FA 4P3CL 2FIKA 5B7EA 4L0PB 4NIKB 4XN8A 4ZNCD 2CCVA 4XMKH 2GIXA 1YUHA 3PABA 1HHJA 4I89A 3IBEA 1UZ6E 2YN5A 3NJVA 1S9VB 2OULB 5HVHC 3ZTNH 2ZXAA 4PRHB 3BPOB 4JPIB 3HN5A 3PF2A 1JF1A 3BN9D 3FJTA 2W9EH 5EZLB 2X3AA 1RUPH 3BN9C 4JPKH 1X7QA 4P46C 1MCWW 4Z0XB 2XJLA 4PVLA 3O2DL 4W9IC 4ZPVB 4EDWH 2Z91A 4JFED 4P48A 3IFPA 5FUOL 4AGQA 1SQMA 5CEZH 2YZ8A 3DC0A 3DRTA 1QR4A 3Q06A 1GRWA 2Z35B 4PRDB 2R0KH 1GAFL 1K2DA 1S8DB 3QS2A 3RNKA 4A39A 2JB5L 2X4TA 5I1DA 2FAUA 3P9WB 4N2GA 2QDVA 4RZCB 4BKTC 3EJZD 3BQUD 5J6GB 2E9GA 4NKIL 2HVKA 3BQUC 4MJIA 4U05A 5DD1L 4F91B 1BGXL 1MFEL 4YQXH 1II4E 2FX7L 3NPSC 3DTUB 5EULV 4GP5B 5J9PA 1UFUA 1ZLSH 2YKKA 2Z3FA 1YYML 1H6UA 1UZ6F 4G6JH 2ZAGA 1YEEL 3ZE1B 3NIGE 4ELME 1H9VA 1YEIH 3QR0A 3L1EA 2F7RA 2VUKA 4G80A 3MLXL 3RWCA 5F7NC 5KVEL 3CD4A 1H3WM 4D8OA 1JGIA 1BM7A 4G6AD 3X14A 2Y25A 3L4YA 3WLBA 1RZJC 2IGFH 4HUWA 2IGLA 4X6BB 1PF3A 3EYOB 3H3KA 3GSXA 4LNRB 2KH2B 2W5PA 1BZOA 4MA1B 1T2JA 1Y0LA 1LLAA 1IC1A 4U1LB 4QRUA 4Y16D 2ITDA 2VERN 3I3EA 5T1KB 3VD1A 1AKJD 3PWPA 4FS0A 1HQ4A 5D1ZI 4XO3A 1VKXB 5SWSA 1MWOA 1S2EA 3MI6A 1M9WA 4LDEB 3V4VH 3STZB 4PRPB 2ADIB 2R2CA 5CJ5A 3GSNB 3I6KB 3SDXE 3SKNA 2YPLA 5E5UB 1S9XA 4FADA 2VLJD 2YMXH 3EJPA 5FGSA 2W94A 4BQ8A 3D85B 5L8LB 3PHSA 1WC7B 5F1OB 2HLFC 3MOAL 4LHQB 2FH6A 4YBQD 3WEAA 4YBQC 4YAQA 4K2UL 2BS71 3EYVB 3IMWA 2YA2A 3LRMA 1QQDA 1QFHA 3SYPA 4YX2H 4KRMB 1YN7A 1WBXA 3WN6A 5I71B 5IB4A 4C59B 2L7EA 5AKVA 4XXWC 3K6OA 4J1UA 4NKQB 4MJ2A 1X5MA 1NCDL 4DGYL 4E2OA 2H47C 3I9IA 3VFTB 3V6OE 3HZVB 4WEEA 4B97A 4H20H 4U0RC 1XB3A 2BDNH 3QUZA 4OTXL 2CZNA 3Q1SH 4ABUA 3RURA 3BPLC 4ZMXA 5C08A 1K4DB 3B9KC 2JCWA 4JFXB 1WICA 4A2EA 1J86A 4KXZH 3TTSA 4GQ9H 4FF9A 1Z5LA 3SDXF 1MCSA 4DF9A 4OI8A 4CC4A 3TCLB 1ACCA 2XBTA 1TENA 4GMTH 1XGQB 4OV5A 1NAMB 3CFMA 2XV2A 2HRPL 3ARFA 2HJKA 4YSSA 1G7JA 3HG0A 2MWCA 3LPOA 3O9WD 4L4VD 4RFOH 5EUOA 3UGEA 3QNZA 1FP5A 2XZQH 4PQXA 5E5MA 6TAAA 4DGWC 2OJZL 2YMTA 4XODA 1QFPA 4HGWA 2A4CA 1S7QB 2D2CC 2XVLA 1GJWA 2HTKD 2QKIC 5BVJA 2HTKC 5EO9A 3WUWG 4MVBC 3M7OA 1KELH 3LXBA 4XP6H 1A6PA 1RZQA 3KPNB 3E9UA 3WIAA 2Y6SC 5ISZE 4M7KH 4P05A 4JB9H 4J3TA 3LIZL 4LBEB 4WSJA 5DQDH 5CBEA 2DZEA 4UT9L 1LO0H 3ZE0E 4WI0B 5FO8B 3WHXA 2K4AA 1SYSB 4IS6A 1JZ8A 4MTMA 4TOYL 2D3JA 3GIZH 4LQFH 3TBCA 2P7TA 5E7FA 2VDOL 2WHVA 1CD9B 5HHOD 2ITFA 2ODIA 5DURD 4WK4B 5J6SA 1G1KA 1XAKA 3QDJB 2WZPA 1A0QL 2XKNA 4IHOA 2NY3D 3BHBB 1IEHA 2NR6D 3GBMH 4AIZB 5T1DL 1CK0H 4X7DC 4R0LA 1KUMA 2E6PA 4G9FB 4WW2A 4EI6A 2APXA 2FL5B 3HI6L 5FS5A 4WWPA 1AC0A 4JFHE 5AVYB 1MCHA 3S48A 4WTWA 2VUYA 1P1ZA 3ZRCC 4F7CB 4U7MA 4LLMB 4TNWK 2H1LM 3L3IB 4PVNA 2R29A 1PJWA 5BZXA 1NCCL 2WUBH 3ES6B 4UNTA 3ZE0F 1YYCA 4FEMA 5HJBA 5BRZE 2EE6A 1B4JL 1FV1B 1XMEB 5A2FA 4TXVB 2C1OB 2WXRA 3U0WH 2A7BA 2WSKA 1BJMA 4AL8H 4RAVA 1DQDL 2DM7A 2E59A 5MP6H 1I8MA 2VUOA 4F2MB 1U93B 4HPOL 1EGJL 2B7DT 1P69B 3QYCA 1ODAA 2EYTA 1DJWA 4G59C 3LNGA 4NT6A 1KJ2B 3RZCD 3L5WA 4NQXA 3P3SA 4MAYD 3PJLA 4HSCX 4L8BB 1FYTD 4PY8J 3TO4A 1AANA 4PJ5A 4RMSA 4DP7X 4AQ1A 2X6BA 4K3EL 1E9QA 3EJYC 5BW7A 5J1AB 1LP9E 5EU6A 4LGRB 4M5TA 4Y1AB 3O11B 4ZMYA 1WUZA 1N4XL 3KBHE 3F5WA 4YHOH 3KLHD 2VSKB 1YQVL 4RMRA 3KLHC 4YDJB 3QDMD 5F7HA 4XCCH 3NTCL 3X3FL 5DJCB 3CDCA 5A16B 5BMFH 1G7QB 2YAOA 2HPTA 2YUWA 1YUKB 3NFSH 1V3JA 2K3HA 3F7VB 2RB8A 4O51B 4R7XA 4HSQA 1WWWX 3AT8A 1IJ9A 4NKOA 5E4OA 4YSPA 1CU4L 2BFVH 5B8CA 5GZOC 3SQOL 4ERSL 5LXGL 4KKLD 4WI7A 2P28B 5C7XL 3CSPA 1HWGB 2Z31A 4LLQB 4Y4FB 2ZSVA 1CBJA 1VFMA 3K4AA 1W72B 1DL7L 3NIFB 1F4XH 4LSUL 1E27B 1TU2A 2OXHA 1X5YA 5D7EA 1CTMA 5JHDB 1NGWB 3ARRA 5DVMA 1I3RA 1ND0B 1V55B 4JPWL 3F7YB 4O02H 3F83A 4IKNA 3DOIA 1MREH 5LBSL 3OKMB 4LARH 3C5SB 1HI6B 1ZGLB 5L2KD 1BQHB 1RZ8A 1SBSL 4K71B 5BS0D 1ADQA 3FUHA 3EO9L 2X0UA 4YXKH 3ZTJH 1A14L 4ODVL 4EBQL 3GJEA 3T2PA 1AGBA 4K7FA 2AV7B 1HYRC 2VLKE 1AGEB 2I07A 3BGMA 4GMSH 2X09A 2UXTA 1FH5H 3NCCB 1F5WA 5I6OA 2Y7MA 4KJYA 3BJ91 2B0SH 1JV5A 1QA9A 2I7OA 1RLWA 1I9IH 1KCSH 3HMXA 3V0WL 3WBDA 2V8LA 3LS5L 4UQ2A 2CDEA 4BELD 3EBIA 4KAQH 4P4KC 4XOCA 1RZ7L 5C7ZA 3VQLA 4BZ1L 1IVTA 3H7BA 3FB7B 4FQ1H 1R5VA 2APFA 4PTUB 4XP1H 4MB1A 4XAKD 2Z8SA 4KTEL 2CUAA 4LSQH 4NS0A 5AKTA 4GI9A 4E9TA 4Y8AA 5D55A 2AJVH 3OZ9L 3QIUA 4U6HA 5MHSE 1FAKT 2DQMA 1UA6H 2WWNA 1H8SA 4PD4K 3VW3L 2QLYA 3FTGA 1HWHB 3CU7A 1WFMA 4NRXB 1OW0C 2BZCA 1LVEA 2IC2A 3CXHK 4QO1B 2HX7A 3WV0A 1AYOA 1HK6A 2L7JA 1P4UA 5KVFE 3VXMA 4NOBA 3WFCL 1GS6X 4QF1A 1UT1A 3U79A 2ZONA 1CLVA 2DDQH 2ORBL 4WI4A 3MRBA 5D4JA 2VWEE 2V33A 2XV3A 4NQED 2P46B 1D5MB 1IBYA 1VGEL 3MRRB 2XTLA 4EUPA 5I74C 3IFLH 3GRGA 1OM3H 4RRPG 4OJYA 5EIVA 1M1XA 4CUCA 4PCKA 4ZQTA 3QCVL 4JFEB 5JNYB 3T65A 5DHYA 4KV5E 1S3KL 5IHHA 4JO3L 2OCCB 3WJJC 3E6HB 1HQRA 4ZUUA 3BP4A 1WFTA 2CRMA 2WP3T 3BVNA 3MRGA 1GHFL 3P0VL 3PWUB 5AW6B 3IDJA 1FNGB 5EA0H 1TZGH 3D0LA 2ED6A 3IWUA 1T20A 5DFTA 5EDXA 1F6FB 2BVUA 3U0PA 2O5NA 1CL7H 5LAXA 6FABL 4LLWA 3CN2A 5LHDA 1MI5A 1BVNP 5D2NE 5DA0B 1EAJA 2XWBA 2XWTA 2K45A 2IPUG 1NZRA 4YSDA 5C0RL 4FNUA 4LZKA 2Y6TE 2X28A 5B38G 4HUKB 3FCSB 4PJCB 3GMQB 4HKXA 4XP4H 4CGTA 3GHEH 4J3BA 5E0QA 3FQUA 1K85A 2CGYA 4N2DA 4IKJA 4KV5F 1H15B 1MH5B 4FTVB 1U8QA 1N5YL 5DK2B 4PJ9C 3VYPA 2XSKA 2VL4A 4WFHE 1CFQA 4Y16B 5IUCA 4Q9BA 4JHWL 1AKJB 2JLLA 1A6AB 1UQSB 3O41B 5L0QC 3ATBA 3ECVA 1HOCA 1RU9L 4G70B 1VERA 4RH4A 3IJHB 1FSKB 4Z7UA 3LPGA 5DZAA 1LJMA 5TFSH 5EOQH 4BFJA 1ZGLP 2PO6C 1SEBB 4H8PA 3V4VB 4BFFA 4MX7A 2J1WA 4B7LA 5DDHA 4NQCD 4F5CA 2MPAL 1EZVX 1I7ZB 2VAAB 4WWID 1DVFA 1IBGL 2GB2A 2JI3A 4ICWA 4AYID 4DZ8A 3RWFA 1BV8A 2V5YA 1CUOA 3FMGL 2EH8H 3HVNA 5D5ME 5D93C 5T33L 1WGOA 3S2CA 5GZND 4ZQKB 1UJ3A 3LKNA 4DQOL 5JIMA 2IBZX 1YJDL 5FUZH 1BCIA 4YSTA 2CJUL 2WJ7A 4QWWC 4F7TA 4FQXD 3WY3A 1TIUA 1EHLH 4LEOA 3T2OA 3P54A 1K8DB 4WNSA 5K59F 4POUB 3VI4F 1F6AA 2H3NB 4CGUB 3F7KA 3FUNA 4XPGL 5J12B 4ISVA 2WVVB 1FPTL 1WAAA 1ZLEA 3TNNB 2AV1B 1MRFL 2OKMA 2P43B 4I18A 4O5LH 3WY2A 4GUCA 4OR1A 4JZJA 1IB5A 1DN0B 4IEFB 1OARH 4DKAA 1FC2D 2YPKA 5D7JA 2C9SA 4Q97A 3EYQD 3L3KA 4NXSA 3EYQC 4PYGA 1HHIA 4OGAC 2O5YH 1P53A 5E9DE 2ZCZA 3HZ3A 1I7RA 2JKTM 1BOGA 2WSPA 1XL6A 3I3DA 1QHOA 4OCRL 1K8IB 5DEGA 4M5YH 1JGUL 4P9MH 3N43B 2IJ0C 3RAJL 1WAPA 2IFGA 1UOKA 1HHGB 4PJ8B 4ZFQA 3VXSD 3MAWA 4LCCC 2AJXH 2CHWA 2PYEE 1PZDA 3MUY1 3WE6A 3G5YB 2X89A 1UOLA 2XWEA 4J3XA 1R3IH 5ILTH 2ILLA 4XPFH 1YQ2A 4APQD 4PW9A 5HHPB 4C4UA 3BLBA 1WA1X 2P5EA 3T08A 4IIQC 3RYMA 1OT4A 1RUMH 3HOGA 4LP8A 1OLLA 4ONGL 3HE6C 4K9JA 1QYGH 1HH6B 3NAAH 1MCIA 4Y7OC 2PKDA 1AQKL 3MNZB 2TAAA 3FO0L 2BVEA 3K6SB 2JCCE 4JM2D 1G0DA 3H9ZA 4JREC 2AITA 5DURB 4HHGA 1JNLH 2AERT 2BP8B 4BE6A 3QXWA 3PWJA 2NY3B 1RZKL 4RISL 2D7TH 1FFNA 5FKPA 3LEVH 4WDIA 3TYGL 1GY1A 4X5WA 3WYRA 1P7QD 4YFDB 2ZKYA 2ARJA 4PJ7A 1MCQA 1SDDA 2VO8A 2WPGA 5D2LF 1MY7A 1U91B 4GI6A 3GINA 2YXFA 3RWGA 3CZLA 2GHZA 3PWLB 1I3UA 2X40A 4PJFB 3S5LB 4Z7QF 2R69L 3VGBA 1UCBH 5E70A 1NUGA 3LD8B 5AFAA 1LE9A 4S2SA 4X80H 4BUGA 1RV6X 2WSDA 4GP8B 4N28A 5IQ7L 1EEYA 1MHEB 3U6RA 4DCQA 2VITA 3B9VA 4YS4A 2PLTA 1XGRA 3MCLH 3VXRA 4AVHA 4F93B 3UJJH 1C12B 1QW9A 1N7MH 3OAUH 4FZ8L 4GW4A 4N1HB 5JW4M 3RJDA 1JBJA 4I5BB 1SHMA 3U4BH 1OGTB 2JCCF 4FP8H 5ECJE 3FU7A 2QQLH 4UM9A 2E7DA 2F54B 4MA7H 1CFMA 5IQLA 1OTSC 3BH9B 4L2YA 2EYRA 2W38A 4X6EB 1U8JA 4XZ4A 4NQDD 5DHDA 3RZCB 2V3DA 4MAYB 3K1KC 4P3CH 1DJHA 3ILPB 1DQLL 1FYTB 3R19A 5FO7B 1I7TA 4BK5C 1XZ0A 2BO0A 3BIBX 3WS3B 3ZJAA 2BNQD 3DXAA 5C0DB 4CKVX 1CG9B 1WWBX 3VQ2C 2VGLM 1UH3A 3O0LA 7TAAA 1I8KA 2WTRA 4G42B 2DQDL 1GMEA 1S9WB 3CVHA 3OPUA 3OZKA 2X6MA 5FUOH 4XBGA 5EN2A 2BCKA 3F8UB 5LCVA 4B5ZA 1J9RA 1P9MA 5D7IA 4JKKA 4PJAE 2DQEL 3A6CL 2OLDA 1MRDL 1MLCB 1GAFH 4JFPB 4X6DB 2JB5H 1AS7A 4JRXE 2HKFL 1A6TB 5EDSA 3OC5A 4ONHB 5IOPB 1DJSA 3QH3A 2PWDA 4NKIH 5DD1H 2OW7A 1BGXH 1MFEH 2JQZA 2ZKHL 2V7NA 2YUZA 4ZMAT