3U1PA

Crystal structure of m. tuberculosis ld-transpeptidase type 2 with modified catalytic cysteine (c354)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
285
structure length
265
Chain Sequence
b'RYTLNATAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mycobacteria Tuberculosis LD-transpeptidase type 2
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
total genus 63
structure length 265
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3u1pA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u1pA01
4JMNA 4A1KA 5DZJA 1ZATA 4Z7AA 1Y7MA 4QRAA 5DCCA 3VYOA 4QTFA 5LB1A 4LPQA 5DC2A 4A52A 4GSRA 4GSUA 4HU2A 5E51A 4QRBA 3U1PA 4A1IA 4LZHA 3TURA 5E5LA 4XVOA 4QR7A 3VAEA 4JMXA 3ZQDA 5DVPA 2HKLA 3VYPA 3ZG4A 5DU7A 3VYNA 4K73A 5E1IA 5E1GA 3ZGPA 4GSQA 4ZFQA 5K69A 5DZPA 4A1JA 3U1QA 4HUCA 3TX4A 5LBGA 2MTZA 5D7HA 5DUJA
chains in the Genus database with same CATH superfamily
5A6IA 5JMOC 4GINA 4NN7B 5FA4B 3W0WD 4H1LA 1SHMA 4K94C 4LVOB 1BPLB 2KZBA 5J57B 4LDCA 4TTDC 1GH7A 2FCBA 5B39G 1KELL 4QTHB 1NL0L 4P5MA 5CN1A 4KPHH 2XNAA 3UH8A 2NUPA 3MO1B 2WXJA 3G6JF 3VRJB 3GMRA 1S3RA 1BQHA 4Z7UF 4ZW6A 2EDNA 2R4SH 3BIKA 4R5VA 2IGFL 1C5BL 5DQDL 4N3UA 4OLVL 1A22B 3SBWC 4AW4A 2AMUA 3LXAA 4NRYA 4POUB 4F8LA 5AW1B 1JGVL 5BJTB 2XXGA 4PJEB 3LN4B 3NCJH 4QRPD 1HYRC 4WNQB 4OR1A 1MHCA 5H37G 4DP9X 5IKCB 1HINH 3D2TA 3KXFA 4QXWA 2EABA 2I07A 3T3PE 2J12B 3F64A 4ANVA 5CN3A 1JGDB 5DHXB 3D0VA 5D2LF 1NEPA 3C5JB 4E9RA 4TSAL 1U36A 4M5ZL 2W07A 3S6CA 5FUZH 2WZ0A 6PAZA 1C9SA 1L9SA 4M5TA 3ZUCA 3E0GA 3D3VD 4XR8C 2JJTC 1N59A 1NCAL 2BERA 3O2DH 3SE9L 3MFFA 3ZYIA 4PJ8C 3QWOB 2EDBA 1YN6A 3RFZA 1BEXA 1HWGB 2IVFC 4ALAH 2CK2A 3OBAA 4JKKA 5TQ2H 3RAJL 3WN5C 1DTUA 2BS71 3MV8B 4DKEH 5F3BB 4X6DB 5I6OA 2WC7A 4TNGA 3L2MA 2X42A 5I6LA 3SDXB 1ESOA 3CDCA 5EPMB 1ZANL 4HKXB 4M1DL 5D6CA 2EYSA 4N2IA 3BWUF 4PJDF 3P1VA 3FB5A 1S7XA 2R2HB 3HR5B 4J3OC 2K9FB 3AG4B 3C6LA 1BZQK 2O1AA 4JN1L 4PJBF 2EDOA 5CHNB 2AMGA 4P23B 4ACTA 5AKRA 2WYZA 1DVTA 2FX8L 2OYPA 4I0PA 1VKXA 1IKNC 3OKNB 2WBJB 4JY4A 1FIEA 2HT2C 1OAUL 4UTBH 3B8YA 4RGOL 1WGOA 3HG1B 3GO1L 4I9WE 2ZOLA 4YLBA 1FYTD 3RIAF 4W9IC 3JWNH 4HU2A 1F41A 5LNDA 2C4FU 3L4VA 1T80A 5IW1B 2OAAA 1BREA 1OKEA 1TZGH 2FECI 1S5HB 1YUKB 2BC4B 3L3HA 5H35B 1UTDA 1XH0A 4M3HA 2ZCHH 3MA9H 4ZFFA 5DZAA 2P8LB 4P06A 3V55A 1IM9A 4P9MH 3DARA 3TASA 4NJAH 1MCSA 4L3CB 4L8SA 5JXEA 4N9GA 2DQJH 5E6UB 3JZYA 3L4YA 3Q9PA 1E6JL 2DQ6A 3FCGA 2EVJA 1EO5A 4LCUB 4PJHF 1CICD 5LKNA 2ADIB 5E5LA 4O02A 4G8GE 2CDEB 3UDWA 1KEML 3S0PA 3NJMA 2EDYA 2BIPA 3WUWA 4X2UA 5I74B 1Y1DA 1CLZL 2D7MA 4UB0H 3H85A 2OL3L 1R9FA 3X13A 1A1NB 5DS1A 2Z92A 1N6QH 3N85H 1CJYA 4A2DA 5DJ6A 1TETH 4A6YL 1R3HA 5IFHH 4MA1C 3CXHK 1KYFA 2E9JA 1NGPL 3LS5L 2P8PB 3DMMA 1ZKAA 4RETB 1KG0A 2AEIT 5E8OA 3PWUB 1E4KA 2VABB 3CN0A 3EBAA 3QDGA 4GXVH 4P2RD 5LBVA 4GG8A 1DSWA 2MCAA 4B95C 3V0FA 4ZOCA 2DJUA 2VR3A 2NX5E 4KKLD 4OFYD 4YN3A 1EFXB 1LO0H 2PXYC 1CL7H 1NAMH 3EOBB 3ARZA 1JN6A 2CR6A 3NQIA 3F62A 4K15A 4TOYH 3C5ZD 4LARL 1MFBL 1FNLA 4DW2L 4LKCA 1MJJA 1LXMA 1QBBA 4NT6B 5KVEH 3QUGA 4NWTH 3DXAB 5C08A 2YD1A 1AKJB 1J0YA 2DQDL 2WINA 5E4IA 1OCZB 2A9CA 2BSED 1KOAA 5FC9A 5GZNA 5E1AA 3MI6A 4BK5A 3SPHA 2HLAB 2D2OA 2MCPL 3QFJD 4A66A 2CO7B 1OP5H 1YSOA 3ARFD 3RWGA 4DP7X 5FYJU 4AG4H 4WW2C 5FWRA 2QTEA 2VMCA 2VLKE 2YD7A 3CGTA 3P73B 4B9ZA 4P48A 4F2MB 1ZAGA 2ZCKL 2YRZA 2GAZB 2HWZL 3GIZL 1FFPB 1A4JB 1NBCA 2AQTA 1UZ8A 3G9AB 2IALB 3LH8A 4OJCA 1VENA 1KXHA 3BCFA 5D1QE 3WJMB 1MJ7H 4IBTA 3G04A 3OR7B 5AVSB 2YPVA 1OGAA 3RNQA 3KYMB 5C9KA 4GSRA 1XL4A 2QVKA 5CBAB 1BQLL 3ULSB 5K39B 4TLSA 3KPPA 5E24E 4QRTB 2I9LA 3BZFB 5E5RB 3HN5A 2FNBA 2Q3XA 1IGTA 2WWKT 1T2JA 1VEPA 5CUSH 4Z7QE 1GY2A 1FVDA 1RZPA 1U58B 1JGLH 2QLVB 4TTDD 1K3IA 4XB7A 3M7OA 1IM3D 2CDFB 5BQ7A 3BP7B 1A7BA 1GY1A 1R5IA 3TBSA 1HZKA 4ZRGA 3IRPX 1LP9E 1TITA 1MCKA 3TEZA 4RRPM 2WXFA 5F7FA 1RPKA 3D33A 4WFFD 5ABZA 5TD4A 3T4YB 2B2XL 4C4KO 2VT0A 4OD3L 1ZSDB 4NERA 2Y5TA 3CUPA 1P5VB 1XGPA 3DBSA 2BH0A 4WDIB 1HXYB 1JZEA 5JHLH 3MV7A 2HZHA 5IHUL 3RVTC 3JV4A 3N43F 1GZPA 1O9WA 4UQ3B 2HRGA 1N8ZB 5ID0A 4HGMA 2J2ZA 2GTWB 4KJYB 1SJVA 1MCPL 3VGBA 4FI6A 3VFPA 5C0AB 3EDDA 4ONHB 1IGFH 2YC1A 2X1PA 4LCCC 1X9RA 1ITCA 2HRLA 4IKIA 2BDNH 4M4PA 1CT8B 2ICWB 5TDNB 4BFEA 4PJ8D 5GS2H 1NAMB 2BRRH 4DQOH 5AL0A 1BXUA 3WFBL 3DX8A 5ESVB 1FH5L 4D9RD 1DQML 1FGNL 4A7SA 1WC7A 5EO1A 2AQ3A 2J20A 5K9KB 4UQBA 3ULVL 1QSFA 1S9KC 4M7LL 2J8UB 4M9PA 4DP0X 2MCMA 3MLRH 4XAKD 3TO2A 4XNAA 4ZNCD 5C3LD 5I1EH 4ES9A 3VFGL 3WIHA 4ODBD 2UUDK 1KTLB 1P6FA 1AXSA 1F1AA 3GXUB 1AXTL 4J3OD 1NMBH 4EMZA 3AT9A 3FCTB 4UINH 4LEOB 4AZ8A 5EA0L 4KJPC 5I6XC 1QR1A 4ZFOB 6PCYA 3LN9A 5TTRA 3P2BA 4DESA 3L6FA 4N1HB 2DWDA 2VMDA 1J88A 3KGTA 2AJSH 1OP4A 3SIKA 2HT2D 5CSBA 5LGJA 1MCRA 4OFKA 1MN4A 1ULVA 4KHTH 4PRIA 3V6OC 4N0YL 5IMLB 1I7TA 4WEEA 1NGYB 5ICXA 3HI6H 4PJIE 2ORBL 3MRFB 3VFVB 3PWPD 3SPCA 4OJDH 1ZTMA 3FT2A 1LM8V 5L9DH 4G6MH 2N4IA 2WUCH 1OM9A 1ORQB 3HG3A 4L8DB 4OGQC 3BYTA 2X0WA 3ZDXE 4XBGA 5E70A 3TXAA 3L3GB 2AI0H 2ESVB 5FGCB 5I26A 5HYSB 3A6CL 4X8JB 2DH2A 2OJZL 4HV8A 2FX7H 4P9HL 3BKJH 1QUNB 2BVOB 5E9DA 4NQEB 4JG9A 4HA1A 4DVRH 3NMEA 4GS7B 1KMGA 1I8UA 2QPUA 2ZKWA 3SGEH 5CEZD 3RU8H 1ASOA 1HHIB 4JKLA 4LCWB 2AITA 2JMRA 2Y1AA 2YD2A 3TC9A 1U8HA 4F7MA 3PPSA 3BWAA 3FO1A 3L1GA 4FG6C 3VXQB 4EI5C 1J5HA 4OGZA 4EBQH 4Q6KA 4QRUB 3UPAA 2RHEA 1N26A 1AVAA 1R19A 2GJ6B 4CVZA 1NCHA 1W8OA 3QULB 4WW1B 1AZCA 3O3AA 5EDXA 1OCWL 1KJMB 1TJMA 1MI5B 3NCFB 3NRQA 3F8UB 1A3RL 1YPZB 3FU6A 2ZG1A 3IFPB 5FYLE 5BO0D 2AS5M 2OMTB 2HX9A 4TVPH 1CLOL 5IIEB 3WFDL 1WV7T 2C5DC 1D3CA 5JO5A 5L8KB 3RIFF 1FPTL 2LFEA 3CZSA 1Y18A 5D7IE 1AQ8A 1EH9A 4J8RB 2X6BA 1QUPA 4MB5A 5C0BB 3BSGA 4NZRH 4WY7L 4LK4A 1XL6A 5IVXE 5I6KA 3GC3A 5KANG 4ZTOL 4F92B 4OCNC 4G9FA 4HK3N 2D3VA 5E1QA 5JZ7C 1YO4A 3SBQA 1KXTB 3I6LD 1Y7VA 1MHEB 4NLHA 1ASPA 4HBCH 4QAWA 5EC2A 2JKWA 1PKQA 1J5IA 3BVVA 5IJVB 3BUQA 4RMVA 3ROOA 2GCYA 2J1ZA 1F5WA 1M7IA 1O7SA 1FORH 4R83A 1HHGB 4JZNA 2HTKC 1AAJA 2YBRA 1AHMA 3KPOA 4F27A 4JY6A 4IOSA 3GRWH 4KTDH 3Q3GB 3CXDL 4PS8A 2P8MA 4LSPH 4YX2H 1CGWA 3CFJA 5GRYA 4NNYA 1G1KA 1PYWA 1USQA 2V2WA 4IBSA 2GUYA 1D5XA 3F5WB 5ALCH 5GRWA 5E9NA 5J9PA 2FYYB 3F12A 2Q7AA 3U1SH 4Z7NF 5T33H 1F4WH 3CN3A 4FQPA 3TA3C 3EAKA 1M53A 3L3KB 5EEYA 4ELMB 5IB1B 2ZSVA 4GP4B 1LE9A 4RZCB 2I60H 2X4QB 4AK1A 3P0YL 3GYRA 3ESVF 4G80B 1NEZA 5F7EH 3CSPA 3IDGB 3NN8A 4GBXC 3V4PL 1VZIA 2GSIB 3PQYB 4BGLA 1I7ZB 3KLHC 3SYOA 3MRCB 4LSVH 1ETZB 1I8IA 1T4KB 3MRHA 4XO8A 5ABAA 1CC3A 5EU5B 3NJVA 3RVTD 5TQ0L 4UU9A 2DLIA 2B15A 5E08H 3HG0A 4Z3HA 2P28B 3L3OB 4NUGH 2WXGA 2W92A 1F58H 4NDMB 2XZAL 1NDMA 2QSCL 3MCG1 4L3FA 1S9VB 3GMNA 3ECBB 4YAQA 5C9JA 3BO8B 4FHJA 1FZKB 3GRGA 1IEBB 2PYEB 4IS6A 4LEXH 1IE5A 3Q43A 4YHMH 2G5UA 3QQ3A 4NN7C 43C9A 5T1JA 4AC4A 3CZNA 4KGLA 4RFOH 3CU1A 4M6OH 2JCCE 2FT7A 1Q9LA 2Q10A 1HYSC 5EBMB 4L1HA 4J3OF 2V2XB 4PVLA 5A2AA 2GITB 2HH0L 5EZJA 1MFEL 2NSMA 1Z3RA 3MYJA 1T1ZB 4FCAA 2J25A 3NABL 1I3RA 3FRUB 1LWRA 3HAEG 2JV6A 2FBJH 3L4WA 1N3NA 4KJPD 4OFPA 1UEYA 4TUJB 4DTGH 3MCKA 2QADB 1PDKB 1IGIH 5FO9B 3NJGA 4JL2A 5GRUL 4AV4A 3PHOA 2OMYA 3EHBB 3GKWH 3HUJE 4X6FA 4BUHA 4NNPL 4LPXA 3SJVE 4KVCL 3FUMA 5BRZA 1QR4A 2V0AA 1FNGB 4YGVB 2IQ9L 4PJCA 4X4ZA 2FD6L 2X0UA 3SGKC 4N68A 1E5YA 2DDQH 3BIBX 4NJ9L 1EHLH 4L37A 4JDTL 1QW8A 3L3DB 4JNXA 1KDJA 3KDPB 4G71B 3UJJL 5MERB 4ADJA 2Q20A 2XVGA 3DK2A 4OBSA 3IF1B 5AW2B 1FGVL 5K9QG 1ZLDA 2E27L 3OJDA 4H4NA 5AZEH 4GSDH 4MSWA 2BXYA 3QZNA 4G8EB 2DM4A 1MLCB 1TJIH 4DSYA 4E2OA 2PTUA 1KB9K 3S88H 2HX7A 4YHIA 3CQFA 4H88L 1NCIA 2ZPKL 1T66C 5CXPA 3TGXA 4OCLC 3IDIA 3QZWB 1SN2A 1ADQA 3GJEA 3VXNA 2QEJA 3QHFL 4WO4B 4OV5B 2VE6B 3FO9B 3LZRA 4JE4B 3SSGA 1E2WA 4EI5D 4FG6D 4DGIL 1JXJA 4P23C 1BYPA 1S7VB 4MYWB 5TPWL 3V95A 3NCYS 4Y16B 3NIFB 3TT3H 3U0PA 3L13A 4GRLC 3OAYH 1A9EB 4GI9A 3MR9B 1G6RA 3GXIA 2HFGL 4MLSA 4U6VH 3A67H 1NDGA 4HIJA 5HYQB 4QXTB 5IREA 4NO0A 3BFOA 4X8CA 5CKAA 1WHOA 2E8YA 1UM4H 1JF6A 3C8DA 3COOA 3NA9L 4CC0A 2QGDA 3GMOB 1KCBA 1IAMA 1AQDB 1XF4A 4UQIM 4MJID 1H9VA 4XBPB 4AEHL 5BV7H 4I3SL 2ADGB 3GQFA 2XQBL 3QNFA 3L95A 3QDJA 1KYOJ 1FL6B 5E8NB 1XF2A 1FZJB 1Q1PA 1GGUA 4ZODA 4MAUL 5EU4A 4JE0A 3NCMA 1F6FB 2PPDA 5E2VL 3ZL4L 2YD0A 3EGXA 4OZGA 2ZICA 3DIFB 2FL5A 3V0VB 5KG9A 4FNTA 3QQ9C 2EO9A 1PZ2A 3LRMA 3I2CH 1SDYA 3P77A 5IV2A 3SE4A 1JUFA 4FL4B 5GIRA 1Y1UA 3UAFA 3H9SB 2DQFA 1WRFA 1DBML 5JZ7D 4F3FA 4AXWB 4XP4L 4UIKL 2V7NB 4IMKC 5DJ0B 4AUJA 4EOWH 5F1NA 3O8XA 2JVUA 3AY4A 5I74C 3VXUA 5ILTL 4CMHB 3CNKA 4Q6IA 1GGCL 5HHVH 3ZE1B 5C0RL 2QQNL 1AGBA 2BRQA 3KL0A 1GZHA 3ZHDA 3DVFA 3ARSA 4X80L 1H15A 2GUOB 1EJOH 2AVFA 2HTKD 4DVBA 2UWEB 4KQ0A 4ELKA 5EUOF 5GRJH 5HHMD 5FEBA 3DV4B 5IQLA 3HW7A 4XNZB 3EOAB 1OPGH 4D7BA 2ZX9A 3FXIC 3B7SA 4ABQA 1PX8A 3F7VA 3HLKA 2WIMA 2GABA 4U0QB 5ESAB 1YJDL 5KZCD 2WLIA 2D0GA 1VGEL 2YMXL 3SYQA 3TA3D 5I75B 2VZUA 1QLFA 2X38A 1JD9A 4S11A 5AOKA 5IWLC 1F97A 5GGTH 3PE9A 3VTMA 4K73A 2LW3A 3PLYA 2K0RA 4GKLA 4L3EB 4Y8AA 5CS7A 1HNFA 4X7EC 1CI3M 1OEZW 1CE6B 5TDPB 1KELH 4NFBA 2ZP0T 1GJIA 3W37A 1NL0H 3NJKA 4GBXD 1VF5C 2CRMA 3EGSB 5FR3A 3FONB 4A55A 4DO6A 4GUPB 3S4SA 1KTDB 4FTVA 4MWFA 3VM7A 4XVTH 1UADC 3KLHD 3BLKA 2IGFH 4NQDB 5AOMA 3R7QA 4OLVH 4LZHA 2XDHA 2LABA 4GSXA 1E5BA 4DZ8A 3OG6B 4WWKA 5T5NF 4N6RB 2AV7B 3BZ5A 3FQWB 2NY5L 1C08A 5MEOB 4E5XG 2R2BA 1J0JA 1KJ2L 1W72B 3DYPA 1IBZA 4JFVA 2KZWA 2YZ1A 1JWSA 2C9QA 1P9MA 4JFHE 4PRHA 1YEEL 2PUQT 5C8JA 1G4MA 5BV7B 2BHUA 4TSAH 1XF3B 2XTLA 4PWEA 3ATBA 4ES8A 2H26B 2R56L 4Y19D 1CGXA 3TVMB 4K7FB 3VWKB 4TLKA 2HJFB 4QXVA 3HRPA 4CBZA 5C08E 1YQVL 1NCBH 3MXVH 2XWBB 2YZ8A 3SE9H 5J89A 4X6CF 1EVTC 4PLJC 1IAII 2WLYA 3GKZA 3MCLL 3O3DB 5FGBC 5TFSL 1HYSD 2V5TA 3X12A 2CMRL 1SBBA 2BY1A 2ICES 2CCVA 3W3BA 1DJSA 4PGCA 3KWXA 3HC0B 2RFXB 2OP4L 1FG2A 1VACB 4K9EH 2BVQB 1ZANH 2GQHA 4M1DH 5J1AA 5IESL 1ZXQA 5JPNA 2PP9A 2YPKB 4EIBA 1ZY9A 4OM0L 3ZT5A 5FA3A 2I9TA 3VXSB 1MXGA 4DN4H 2YKLL 2YIHA 5I8EA 2MMXA 4X7DC 3V0DA 3REVB 3UZEC 1M6OB 2X6MA 4EJ1C 5GQBA 2F7OA 3OV6A 5KVFL 4TSBL 3EJZC 3QCVH 3QNYA 1WTLA 4QPEA 1YMMB 3IJSB 3QH3A 5GGQH 1HL8A 4LIQE 3RWFB 3U0TA 1JZGA 3NK4A 3BSZL 3LZFL 1CZ8H 3ZZLA 1UGKA 4N8VG 1NCUA 1ECZA 2YFNA 2WPGA 2FR4B 3GHBL 2VLJD 1CFNB 3MA7B 4DGVH 3EFFA 1CTNA 1U4FA 3GI8L 2JKTM 5E8PA 3NP3A 3OLDA 3MV8D 1CK0L 5KTEL 1N8OE 1T66D 4PR5B 3FQRA 3VG0L 4Y2DB 5EBWA 2IAMA 3II2A 1KTKE 1UOVA 1AACA 3UYPA 2D7NA 2NDGA 1R4XA 2H2SC 1QI4A 3HE7A 5DK0B 4P23D 4UTAA 3WLWC 1RZ7L 2MTAA 4DUWA 4POYA 5GISH 4PTTA 2SODB 4H20L 4GRLD 2QGCA 3MV7E 3MMEA 2FT6A 2WBJD 5H2BB 5TE6L 2OL3H 5EUKB 5KSUA 1KEGL 2X2JA 3LD8C 3VXMA 1MWAA 4GSUA 5EC1A 2PR4L 1T7YA 3HG1D 4RIRA 1A1OA 4N0FB 2BK8A 3NIDE 3PHAA 4JPIA 1HXMB 1NGPH 2HVJB 3BGMB 3CSFA 4KDVA 4PJ7F 3VYNA 2GBAA 2XYCA 1L6PA 1XR8B 3L8QA 5DFWH 4ONFL 3ZKQD 5FPIA 2A6IA 4GQRA 3SQRA 2OMZB 3L4CA 2X0VA 4PJFF 1JYXA 1QSFE 3QQ9D 1PX3A 4GW5A 1GHFL 3G5ZB 1MFBH 4MZ3A 5DK3A 1GIGL 2HJLB 5B1KA 3KR3H 4AQZA 2YGVA 4DW2H 2B9BA 4GS7C 1OT2A 4P2QB 5FV2A 1MWOA 3UTQB 5IJKC 3IJHA 1JPEA 5FLVA 2DQDH 2MEJB 4P4KA 5GJSL 2AXJA 3NPSB 1A6TB 1TIUA 4NRZA 3BQUB 4D8OA 4KV5F 5A2JH 1Q9KB 4O5LL 4RAVA 2OXGB 4KDWA 4U1NA 3IDMB 2OTUB 3S3SA 1TZIA 1G9NC 2GHWB 2OMBA 2XCMC 4IU3B 4JGNA 4PRIE 2CDGA 4A2EA 1P7QB 3F01A 2CM6A 1J7VR 4QJ5B 2PYFA 1DQJA 5B3JF 2H47C 2ZCKH 5DJXA 2ICWJ 1QFUH 5FXCH 3VGHA 2DLGA 1M9SA 1XMWA 2HWZH 3UROR 3ULUE 4QDGA 3VI4B 3KAAA 4JJ5A 3CPLB 4Z7IA 5FO2A 3IFLL 5KEZA 5D7JC 4AGLA 1ACCA 5IB2A 4Y1SA 1EFXD 1OV8A 2R15A 3BN9C 4DCQB 4CNIB 4IBYA 3PABA 3IGUA 2WW8A 1PIFA 2NQCA 4L3AA 3ALXA 3X3FL 1BQLH 5AVYB 4XN7A 5E9DE 1V7MH 1U42A 3PP3K 4LHUA 3DXAD 4FLQA 1AKJD 1RJLA 4X5QA 4FNRA 4HJJL 3VYOA 1HHHB 3ZLQC 5CR8A 3PJNA 4JHWH 4Y2OA 1ZGLM 1DLFL 2AK1L 1OGTB 4JFEA 5AVWB 1MUJA 2EO7A 1IRAY 1T2QL 2WAQA 3MNZB 5BVPH 3BAEL 3QJUB 5ETUB 2XI9A 3FFDA 4KROB 4RMQA 4CN1A 5I1AA 3SY6A 3MRRB 3D6GA 5TH2A 1LK3L 5CAYB 3FNKA 2W94A 3HRZA 1E9PA 3BP4A 5DMIL 3MUZ1 2HT4C 4GIAA 1PIGA 1D6EA 1WT5C 3BZEA 1G7JA 5IHUH 4JFDB 4Y4FA 3DX9B 5CD3B 1BM3L 1XF1A 3KM1A 1KGUA 1NGXB 3CDZA 2RBLA 3QO0B 2XWJB 1TZOA 3S35L 3GGWB 3D08A 3VQLA 3X1NA 3LEVL 4NFDA 4YHZH 1CGYA 4YDVA 1H3XA 4OZFA 2IBBA 3FMGL 1PEZA 1A0QL 1N5YL 2GVYA 4HMDA 2QPFA 1DJWA 4PLJD 2IH9A 3U79A 3GXPA 1NBYB 1D7DA 3GSNL 2G75B 1FH5H 2WXNA 3L16A 1NEUA 3QJHB 4G9FE 4B6ZA 5FB8A 1O6SA 2HYMA 1MCFA 3KJ6H 1CF8L 4M7LH 5AW9B 3PG2A 3PWLB 3RWEA 4JLRB 1ECYA 5TF1L 1KACB 4Y9FA 4JDZA 4OM1H 3DLQR 4PJEF 1PKQE 1LEKB 2FECL 4G8FB 1G7IA 1SJHB 4I89A 3TBYA 4XNDA 4D2NA 4Q9BA 1JF5A 3CK0L 5B1JA 5EA0H 1IFHL 1TQCB 1BW8A 4WI8A 5JORB 1TJHL 1R3KA 1A7RL 1TZAA 1VZHA 2C26A 3EJZD 2WZPA 5LLIC 3L3OC 4X9HA 2IANB 4JFFB 2JQAA 1SXBA 2O93L 2XZCL 2Y6TE 5C0AD 1WISA 3Q8FA 2HUHA 2PTTA 3MBWA 3EJCA 1RMFH 2Y69B 4X4XB 4NX0A 2D03L 4KRLB 2WXLA 3AC0A 1J1PL 2YR3A 5SV3A 5B7FA 4YLQT 5E2TH 1UACL 2XTJE 3QR1A 4G1EB 4X6DF 4XNBA 1N68A 1YY9C 4PGBB 3A6CH 3SDXF 3WJLA 3DO7A 1S7RA 1IAKB 2EXTA 4P9HH 5AAWC 2G60L 3IDJB 3ARVA 2A83B 2IDQA 1JIBA 3HBZA 4L5FL 1KGCE 1UA6L 2DJMA 4J4PC 3TBCA 4JN2B 5I1CH 1XCTB 2H2SD 5F7UA 3WLWD 4Y7OC 5FYKE 5J6HA 3WNIA 4B97A 2VO5A 4JPKL 3EHBC 3RL1B 3KYKH 1RUAL 1U8PA 4IMLA 1BDYA 1J05A 1RZ8B 3ES6B 1SQMA 3SPIA 3E1F1 3LRGA 3IMSA 2IIJA 3KLKA 3U82B 4EI6A 4BA0A 3QUMB 4LFHD 2XXMB 2J72A 2KLSA 4L4VA 4LO9A 3KLQA 1MHHA 1XR9A 1KCUL 1V3JA 1MREH 3NAAL 4ZD3L 5T3ZE 5DD6B 5GGSB 4QRAA 5LCVL 5KS9A 4OQTL 3WAJA 5IEKB 3CFKB 4WI5A 1QACA 2CR3A 2ESVD 2P5WA 3LXUX 5CR1A 1CLOH 4L18A 4X83A 2AEQH 3QCTL 2EKSB 32C2A 3QIBB 5HGDB 2FGWL 5E4AA 2B1OA 4JG0L 4LMQE 5B4MC 4NQED 4MD5B 3KM2A 3W9DB 3QZPA 2EDEA 4U05A 1G6VK 2RQ8A 3VFMB 2L3BA 3DJRA 3QHTC 1RURL 3CVIH 2B0SL 2Z93B 4LCWD 3CSYA 4WO4C 1FV1A 3TBTA 3GBNL 3AS1A 1KY7A 4ISVB 4JFXB 1X5IA 3AB0B 2V17L 4OKVB 1BMWA 3VXOA 5E2JA 1QWHA 1D2PA 1WK0A 2JXMB 4Y16C 4ELDA 4UDUA 4Y1TA 1N67A 4YZFF 1MFUA 3BEWB 3EJQA 2EH8L 1MI5D 3ABZA 2QT6A 1F4YL 4PJCE 5D71L 4B9KC 1HOCB 5BOJA 2X70A 4DN3H 3IWUA 5D7JD 4FQHA 1A3LH 3T3PB 1A9BA 3GZKA 5F89A 3BN9D 3CMOL 2HAZA 1C7SA 3RY6A 2DWYA 2DL9A 5D9SB 5DK2A 1WCQA 3QXDA 3A47A 4AUYA 4JO5A 4M43L 5C0BD 4BE5A 3IMWA 4P5TB 1D5IL 1FL3B 3HPJA 3PREA 1M4KA 2XG5A 4FI8A 1SEBA 5B3SB 4HXAL 1LILA 2Y06L 2EC9T 2Y7MA 3WY2A 4A39A 1AHKA 5CP7B 4XE0A 5F1IA 1T1XB 3IFOA 3RJDA 3QZMA 1MCHA 5D7LA 3RIAK 3TPUA 4TQPA 2FSEB 1CDBA 1JF1B 4KRNA 2CBMA 2F5AL 4APXA 4NPYB 3EYFA 3OL2A 4YXKL 3RWCA 4LT7A 3CSBA 1KSRA 5IVNA 5CJQL 5DI8B 1PZAA 2QZ5A 2VZTA 3JVGC 4YOKA 2HT4D 3K8MA 4R3SB 5I76B 1O75A 1CGSH 3LY6A 1HHKB 3S8GB 1XZ0A 4R97B 3HS0B 3QDJE 2NNFA 4XNZC 3VH8G 3WEXA 2MOVA 2FZ3B 3HAEH 3JZ7A 3RBGA 5ACZB 3V5HA 2QSCH 4MNHA 4OZGE 5JMRA 1JS4A 2D3NA 3L4XA 4QLRA 4LLWA 5CIPA 1TVHB 5GGVL 2R1XB 3L1FA 1RK7A 4FZEL 4FULA 3FB7B 4UZSA 4DK6A 1S8DB 4MA3A 4P49A 2IH8A 3PUCA 3K3QA 3VW3L 1T21B 2R39A 3BPOC 1QPPA 2JK5B 5KSBA 4E68A 3MRDB 3EUDA 1OAZH 5BO1L 3BT2L 3EYUH 4PWFA 3VXUE 1KC5L 3BC9A 3NZHL 4C56A 1MFEH 2XKNB 3PQYD 3MFGB 3S37L 4A7GF 1SYSB 1M2OA 1JXFA 1ETB1 4CILA 2R59A 2Y22A 4WHYG 4PJ6A 3S3BB 3QGVA 5GRUH 4RCAA 1WZAA 5DJ2A 5C92A 4HKBA 4WFEE 2PLTA 5HHQA 2XWTA 4FERA 2HMIC 5KBPA 5BV7C 2IQ9H 4TVPD 4OIAA 4LSSL 3BMWA 3HVDA 4CKVX 2Y25A 4FN0A 4LCYA 4NJ9H 3ZU8A 4Z77B 1NUFA 4JDTH 5FHBL 3TVMC 2ZAIA 3ML9A 5DEFA 4BZ1H 3VWKC 4M61B 3ZIMA 3DRTA 2P49B 2J8UF 1YY9D 3Q7JA 1FGVH 2NX5B 3LKPA 4UV4L 1RPQA 1VPOH 3GSOA 2J4WL 2OXHB 3U7WH 1ORSB 5JPMB 3V6ZA 3RHWF 1RIVL 2PXYA 1UB5B 4XH2A 4JO8A 1RUML 1U0QA 4FNQA 4H88H 4J4PD 1WWWX 3VFOB 5DD1H 4FTVE 4WI0A 3SQBB 3KDMA 5T3XE 3EDKA 1SDAB 2QADD 3M8OL 4XT1C 2R1YB 5CO1A 3EHBD 3UYOD 2B20A 1FLRL 4KUZL 3B5TA 3X17A 1EAQA 3BH8A 1MRCL 3L7FA 3AG1B 1CGTA 2VLKB 3LSOA 4LSUL 4WSKA 4PRHE 3PGFH 3W57A 1LEIB 4WW2A 4OFQA 5KBNC 5B21A 3SYPA 4DEPB 3MROB 5SWQB 2G2RB 3CH8A 3MJ8A 2VIRB 4I9XA 2C7UA 2BOCB 4YHNA 4B3VA 4HGWA 5EHFA 4FQIH 4AEHH 3QW9A 4I3SH 3D2UD 2F8IA 2TRYA 4MAZA 5D1QB 4L48A 4BSWA 3WS6A 2C7FA 4YDJA 4CKQA 2XX0A 2PWEA 3ZDYE 4EUPB 2A73A 5B4MD 2CHXA 3QPXL 2FHFA 5IMOA 1O7VA 3TJEL 4DGYH 2FJFA 3T65B 4YSSA 4ZYKA 1JZ4A 2GPZA 5GJTL 3UAAA 1SY6A 1UWEL 4ODUB 1U3YA 2OZ4L 2O6DA 4Y2DC 3EUUA 4IQHA 1PEWA 4HEMA 4WO4D 4XCEA 4YO0A 4RESB 1B6DA 2J1YA 3ET9F 4Z7QB 1A1MB 3KD4A 1GA2A 4XP5L 3VXPB 3NTCL 1CFSB 4GW1B 3FT4A 1GOGA 1HEHC 3T5WA 4S10A 1MFCL 4HCRL 4FEIA 4XP4H 4Y16D 1UFGA 2DD8L 4KJWC 2X3AA 1EO8L 4GO8A 3QS2A 4NQUA 1YPZF 3VD7A 3GJFH 4ZFZA 1GGCH 5LAXA 5C0RH 3TNMA 2FX9L 2QQNH 1I8MA 3FQUB 4MZIA 1TCMA 4P4RB 4X80H 5FUCE 2X7LB 3NACL 1A4KA 3ELAT 1M57B 2Q7YB 2J56A 2VDNL 4AW7A 2L8AA 2H32A 2OX5A 4PAZA 5PCYA 1NCCH 5BCAA 4N26A 1YZZA 3GBDA 3Q8AA 4XCNB 5CILL 4LBEA 1LMKA 5FYLH 1W6LA 3BVNA 2X28A 3UCRA 3EW3B 4RDBA 5CLWA 2EDRA 2F2HA 2O26U 1YJDH 2VQTA 3QRLA 1VGEH 3HE6A 4K3JL 3VB8A 1AR2A 1WLHA 1QLEL 3H9SD 5BXFB 1CO1A 2XACC 3FRPG 2YJQA 3NPSC 1RZGA 3MJGX 1FBIL 1WTGT 3BQUC 3EYVA 3G5YB 2HX8A 3KH4A 1PX4A 3N1MC 1JGEA 3QS3A 1I7UA 2WNGA 3I3BA 3L5JA 5C0EB 3VXME 4OCXL 2NY4C 3GS0A 3BDXA 4N87A 4YIQA 3C2AH 2ITFA 2GEQA 1TKWA 2X2HA 4BH7A 4WSJA 1T5XA 1D5MB 4JRFA 2XXCB 5D4QA 1T0PB 1A21A 5GGVY 1AI1L 2CSPA 2QMKA 4P2AA 1EHKB 4V1DE 5LUMA 2B14A 4P57A 1KJ2H 1SDDA 1CLVA 3CX2A 4JG1H 1D9KC 4HUUB 4J6RH 3EDEA 2AP2A 5D2NA 3BZ4A 1YEEH 3L2NA 1PZCA 2JJSA 2NNAB 2YUVA 3O6LL 1DCEA 4XP6H 3H0TA 2K78A 2B77A 2R56H 4ELMF 4WGKA 5EV7A 2ARWA 3ZDXB 1D5RA 1UCBH 4IRJB 4R7NA 4UM9B 4H0GA 4L3ED 4L1SA 1GVIA 1GKEA 4P3CL 5JOPD 1CBJA 5TFSH 1FRGH 3KEHA 2CMRH 2ZJSL 3RGVB 2UY6A 4QTFA 3L5WA 2FB4H 4HW6A 2N56A 4LP5A 4XZUB 5G5DB 2FJGA 3OZKA 1ANUA 3HHRB 4NQDD 3LX9A 2V5RA 4KROC 3GSVB 5D7SL 2COQA 3CBRA 4AV0A 5IESH 3CCHA 2GSGB 2OTWB 3HG4A 4PW4A 1A8JH 5JIQA 2IXQA 4JGJA 4PRDB 2EXYC 4Z0XA 3GJFB 2VN7A 1MZZA 1IIKA 3GZQA 3U6RA 3F2LA 5CEXA 1X5GA 2HMID 4TSBH 1ZHNA 2VL5B 1K2DA 1KIQB 1PZDA 3TT1L 1A5FL 4OLYH 3ILQC 3OSVA 2NZ1A 35C8H 3L9RB 4KX9A 1OB1B 1G0XA 4GP8B 3TVMD 3UGUA 3VWKD 3BSZH 4KTEL 4F7CA 3Q8BA 1KJVA 25C8L 3KZ8A 2XPZA 5KVMC 1NICA 2OMNA 4HJEA 4YH6A 3CN4A 3IPBA 3P02A 1SM3H 4RH4A 2KI6A 5TK4A 3KPNA 1HWWA 5D7IB 5ALBH 2CO4A 2DQEH 3L3IB 2G9HA 1CK0H 1U2HA 2BSDA 4JFQB 5L8LB 4JFEE 1ZV9A 5DUJA 1B88A 2RACA 3VG0H 4EDXA 4KDTA 1XWVA 5IVXB 4FP8H 2P80A 3GUTB 1N7MH 4ZX5A 3EO0B 2XWEA 2G5BA 4LB8A 4KKPA 1S5IL 1M9WA 4OQTA 3OLGA 1RZ7H 1AY1L 4GFTB 1TQCC 5C3IA 2R2EB 3B83A 3TWCH 1LHZA 3K71B 1HL4A 3FT0A 4HUVA 4ZS7H 1F86A 3HTLX 4HT1L 4LDLB 4MMZB 5TE6H 3ALWA 1WAPA 4BM7A 3DJZA 1ZT7B 4QHMA 1YMMD 3QEUA 5LQBL 2PR4H 1U3HA 1AKPA 3VFSA 4NKMB 2IPKB 1E9OB 1Z5YD 3DPBA 5K59F 3Q06A 4O51B 2EEFA 4ZUWA 5E2UH 3S34H 1UWGH 2VXSL 3S8FB 3VVVA 5B8CB 3PV6A 4ZPTB 1TF4A 4W9CC 5C0IA 3OC8A 2J88H 1XH3B 2CIKB 3LHPL 2IV8A 3MLWL 1J9SA 1ZLVK 3CFEB 2WXHA 4XNYL 5IR1B 3BT0A 1ZEAH 4N22A 5DQJB 4B9CA 3IKCA 4YHOL 1UQSA 1P7KA 4TM9A 4CU7A 3H4FA 4Y2DD 4YL4A 5C0DA 4PVBA 1D5BA 5IFJA 4R2GB 4HC1L 4GRMA 1QTPA 1IQDB 1Q0YH 3J7HA 4R26L 4RRPA 3NIFF 4TNEA 1DUZA 5B1BB 3WFCL 1JGIA 4ZX4A 5GJSH 2AAAA 5EN2B 1JNHB 5GS0C 1VADB 4KJWD 1YAIA 1X5LA 1BBJB 2CGRH 5C0NC 1FFTB 1YNTB 4I5BB 4C4UA 4WGWB 5E9AA 4WHTA 1WZLA 2CU9A 4JQXC 3AUVA 4W9FC 3D30A 1I1FA 1NIEA 4KU1A 3NZSA 1CIDA 2HG5A 1MLBB 3D07A 4XMPL 2GT9A 5MEQB 1DL7L 2OKMA 2R51A 3M17B 2ZE0A 3KPQB 1JWMA 4KOBA 1LQSR 3LH9A 5DXWA 4FXGC 2W59A 4IM8A 1JV5B 2ENYA 3IFLH 3BE1L 1G5AA 2EIMB 1V27A 5DURD 2IDSA 3QIBC 1DBAH 1R3LA 5AYTA 3K8KA 3WSQL 5I1LA 3D25B 4HHWA 4CJ0A 1QQDB 5I1KL 4P2QD 1QA9A 5F6IB 4EDWH 4U1KB 4XX1G 5E5UB 3SDDA 1EHXA 2Q86B 4RFEB 3S7GA 1Y6NR 3VSUA 3DUUA 1O6TA 3BQUD 3HNVH 4IDLA 2JCCB 3AB0C 4I3RH 2QL1A 2AXGB 4H8UA 3ZE1F 1LEGA 2V5SA 2AK1H 3KPSD 1GYWA 1X6LA 4JDEB 4UILL 2EVHA 2UWEF 1VFOA 1ES0A 1WQVT 3LPOA 3HHSA 1JFQH 3BAEH 3UAJA 4L4VE 5IUSA 2ADYA 3JWOL 4M6AA 4GRWH 4G5ZH 3WL9A 1IAIL 5HGHB 2VZSA 3FTWA 5HVWA 1TVBB 2R69L 3HUJB 5KS9E 2ZKXA 3UZVB 3ELQA 4OB5H 3SJVB 4TQIA 1D9KD 3E7JA 3FYIB 1BM3H 4NQVA 4M5SA 2P5WE 4PEEA 2VDMH 3DHJA 4NQQA 4YNYB 2FIKA 1G9HA 3FDWA 3S35H 4PS4L 2APXA 3KHOA 1WF5A 2ZXDA 2HJKA 5DVLA 4WFHE 1RU9H 1BIIA 4HIHA 1I1AB 1LTXA 2VC2L 3OPZH 3FMGH 3PNRB 1A0QH 1RK0B 1YY8A 1N5YH 4FE9A 4NUJA 4H1LB 3TURA 3IS1X 1KPRA 2YD6A 5LGYA 3GSNH 1CVRA 1DE4A 2BW4A 4FF9A 3NCYP 4EZMA 5FCUL 2CO2A 4HZLA 3T09A 4ZNEA 3WY1A 4E9YA 4FA6A 4LSRL 4P5MB 2XNAB 3ETSA 5HHOA 1CF8H 2J5LB 3GMRB 4O02H 1BQHB 4NO2A 1KCRL 3BIKB 4KROD 3MLTA 4UOQA 2OMXA 4NRYB 1QKZH 1FC1A 2EXYD 2OK0L 1HXKA 5K33A 5DC2A 1BLNA 1MHCB 1T83C 4R97C 4JPWL 5E5MA 4X9BA 3X1EA 2MJWA 2ITCA 4AM0B 1ZJBA 3RJQB 4IW4C 3O3BA 2EDLA 4Z3IA 3F3HA 3ILQD 3TV8A 1XD0A 2W07B 3FSZA 1BD2A 2CZNA 3ILPA 2FBOJ 4PJGA 3BH9A 3UTZA 1KGJA 4NWUH 1AGCA 1CU4L 1U8JA 3ZY7A 5JHDA 2V9RA 3KVQA 4KKZA 3IEAA 3MFFB 1CURA 3GBEA 4WAFA 2M8XA 2VXQL 5IG7A 1CFVL 1IVLA 1FP5A 1YN6B 3VA2C 1UACH 2OA9A 3T2OA 3ZKNC 3RFZB 2O5YL 3SKJL 4JFYA 2DF3A 3P0VL 5D7LE 4CGUB 3US1A 2KBGA 2G60H 3TYGL 4G43A 4KRMB 4FFYH 3K46A 5I23A 4LCVA 1OAXL 4BK4A 4GXUM 5BVJA 4E9XA 4L5FH 5D6CB 1UA6H 4U31A 3B9AA 1S7WA 3F7LA 3ATEA 3FB5B 4WUKL 5JIPA 1UD3A 3C6LB 1OTTC 1SLXA 1BIHA 3C12A 1X7TA 2CJ3A 1JPST 5INCA 2X05A 3UZQA 4I0PB 1VKXB 4JY4B 3M1CA 2IAND 3OWEA 5EBLA 4QT5A 4ZTEA 1P5UA 1JHLL 3RVWC 3BPLB 2ZOLB 5DHMC 3KJ4B 3P54A 1KCUH 2ETWA 4R4BA 2YPVH 3IMUA 3FHAA 1BZ8A 2VDMB 3NAAH 4Y0GA 4F1ZA 4ZD3H 5LCVH 2XUWA 5IEHA 4LIQH 3L3HB 4ICXA 4ZFFB 1HZLA 3SY0A 5F96L 4NHCL 1IM9B 3QCTH 1QASA 5KSBE 3BIAX 2FGWH 4M7KL 2F6AA 5JPMC 4HK0A 2AQSA 4R5XA 1JNNL 5BUGA 2GY7B 1JK8A 4L8SB 1CE1L 4P5KA 4N9GB 3QJXA 1SVBA 5KVFE 2Q0ZX 4C56E 1DQIA 5DJAA 1KTRL 4LOFA 3WI9A 3SKMA 1HQRA 1S7SA 1RURH 4WKZA 2B0SH 5A2FA 2NY7L 5EEXA 1KIRA 4EE2A 5JUEL 2DWXA 3GBNH 1OPOA 4O02B 3IXTB 1OTSC 3FS9A 3QUZB 3ZZQA 5IHLB 5J12B 3ASNB 5F7BA 5C0ND 4CC1A 3DSNA 2H3KA 2ZUUA 3WUWB 2W65A 3OTTA 4X9IA 1XXFC 1HC1A 2FATL 1B4TA 3FB8A 4YXLH 3X13B 2Z92B 4M6NL 2EIJB 1J18A 4W9JC 5KVGE 5FOBA 5DJ6B 1SGKA 2EH8H 4FJYA 5CD5C 1R3HB 2NW2A 2NZ9C 5I1HL 4HQQH 1EGJL 1WWCA 4I48A 4DEPC 5E6IA 3DMMB 4JM2A 5EN3A 1XQ4A 1KG0B 5E8OB 4Q9QL 3KNBB 4NO3A 4GG8B 4WCYL 2CUHA 3WMQA 3CMOH 3QIBD 1E7UA 3AWEA 4AC2A 5L4FA 1Z0NA 5DO2C 1JN6B 1ZS8A 4M43H 5IMKA 1MOEA 4LKCB 1MJJB 2GTQA 2RTTA 4LSQL 1EWHA 3LMJH 3RY4A 3IK2A 3GXFA 5C08B 4JB9H 1ZTXL 5AYUL 1ZPLA 2IFGA 2C9UA 4NHUA 5EEUA 4HXAH 2Y06H 3Q9QA 3II3A 3PIQA 1AE6H 4WV1A 5LN8A 4ONGL 2JI1A 1I9RL 4DK5A 5E1AB 3O6KL 2DM3A 4F7PB 3LV3A 4Z18A 1D7FA 3QEHA 1TR7A 3DNKA 4JFOA 3OZLA 4BCXA 1INEL 2N59A 3G5WA 3WD5L 4D3CH 3VI4F 2G4EA 5CJQH 3R8QA 4MAYC 2AQ1A 1UJ3A 2HKFL 1CL7I 2ICWI 4XCFL 4CRPA 4Q52A 3A4AA 3TJHC 1AHWA 1P1ZA 1UZ8B 4RMWA 3A5VA 4ZAKC 3ILDA 5FKAA 1UD4A 2BP5M 4JKMA 1MY5A 3G04B 5SWSB 2YA2A 3FUJA 1Q72L 3QQ4A 3AABA 4JY5L 3NSDA 3RNQB 2C8NA 1DBKL 2ZX8A 3FN0H 4WVRA 1K85A 2KC0A 4P5TD 2I9LB 4X7SL 3HKFA 1IGTB 4HEME 2H1PL 3MRQA 1F0LA 4YSCA 1E28A 1FVDB 3IDXL 4FZEH 2FRGP 5L4IA 5I1IL 2VDKL 2WXRA 4HSAC 1BVNP 5D1XA 5BQ7B 3GT6A 2CJUL 2AAVA 1TOXA 4ZMOA 1LNUA 3KPMA 3TBSB 3PHSA 3KYOA 2WN3A 3WFEH 1KC5H 2A77L 5FLUA 1F6AA 1W8NA 4XE5B 2QSTA 3H54A 4CSTA 3P4NA 1QBML 3DGCR 2XTSA 2IFFL 3V8CA 5GRZA 3S37H 2WP3O 4F9LC 4P2OA 3AUWB 2Y5TB 3CUPB 1KBKA 4IOIB 4BXVA 2FJHB 1XGPB 5GGUA 5J1SC 4XN2A 3SD5A 3MV7B 3QUXA 4KX7A 1ZT4A 2EYRA 5L6YL 4ANXA 2XIDA 3JV4B 5FYJL 1E8XA 5J13C 1GZPB 4JPVL 2R4RL 4AGQA 1XCQB 3MXWL 4I9WD 4WI4A 5ID0B 2J2ZB 4Z78B 2CA3A 2XN9A 4PY8I 4LF3A 2K4WA 4YVNA 3VFPB 3NIDB 2VSCA 2YC1B 3BD4A 4LSSH 3VX1A 4GG6B 4ATTA 3P11H 7PAZA 5KVDE 1M05A 1KN4H 4YE4L 3O3EA 4IRJC 5I6NA 3ZKND 2F5BL 1B2YA 4HU8A 4AE0A 1U91A 3D48R 3K4ZA 1WC7B 3S5LA 5EO1B 2J4WH 5E99L 1QSFB 3I50H 4ZSOA 1USZA 3EDJA 3TO2B 2A4CA 3IGAB 1OCCB 4K94L 2E8ZA 3FKUS 4AL8L 2WXOA 3R06A 1CDJA 2J73A 4PJ9A 1I7RB 4JG5A 3QYNA 1KCLA 1OTTD 1T89C 3T8VA 3PP4H 1RIHL 4GXUN 5D4IA 4AZ8B 4G8GD 4YEFA 3QFGA 1QR1B 1HJBC 5DJYA 5E6RB 3L6FB 2DWDB 1FLRH 3QWQB 3SQOH 5HDRA 2VM4A 2WLLA 3BWZA 3NOIA 4OAWA 5LGJB 4N8UA 5D5MA 4AKOA 4RBPK 2OCFD 4DP8X 2ID5A 3P9MA 2KPWA 4LSUH 2COVD 4PRIB 3MOBH 5D2LA 5D2NE 1I7TB 5DLMH 3RVWD 5ICXB 1BQRA 1ACYH 4KKCC 3HZVA 1MKFA 4LQFL 4G5AA 2DQTH 5EORL 4ETQA 3FT2B 2K9UA 2W9EH 5DD0H 4V11A 1BFOA 4MJ5A 3E8UH 2NX5D 3ZSSA 1HCVA 4MCYA 1DUYA 3LS4L 2VXTL 4HV8B 4IYKA 3ZHKA 5IMMA 4PRNA 2WQ8A 1PGRB 3QPXH 3WTYA 1XBRA 4PG9A 4O58L 5AZ2H 5E9DB 2F54B 3IDNB 4CDGC 4NQXA 1UWEH 2X10A 3V0GA 3K80A 2WGXA 3MLXL 1IC5H 2OZ4H 1HIML 2AQQA 4IEFA 4PJDA 4DP6X 4JO2H 1OTSD 4CBPA 1U8HB 2FEEI 1WZMA 3BWAB 3FO1B 3NTCH 1AJ7H 1Z7JA 3O45A 4HS6A 4PJBA 4CSPA 4WU5A 2ERJC 2KPNA 1NIAA 1OB0A 2HKHH 1JWUA 3FF7A 2DD8H 3IXAA 3ARDA 1KYOK 5EZIH 3UTPE 4CVZB 4MMZC 1DLHA 5AG8A 5CD5D 1IGML 2NZ9D 3O3AB 4WWNA 1MW3A 5D70H 1NC2A 2YOAA 3DO4A 3K5RA 1MAKA 2QDWA 2R0WL 1IGYA 1QSEA 3NACH 4CC4A 1DJZA 1MSPA 1MRDL 4XN1A 3HMWL 3I6GA 5B8CC 2Z7UA 4W9ZA 5D1QD 1DQLL 3E6HA 1F11A 2PW2A 3EDFA 4LDEB 5DO2D 4I4WA 1ZWIA 4FMKA 6TAAA 5JO5B 1Y18B 2VDOH 3RLSA 2VWEE 4GMSH 1IBGL 1L5GA 4R2GC 3OJMB 3O4LB 4LHJB 2K6WA 3OR6A 3LEXA 4W9DC 2Y7QA 3CC5A 4J3OG 1X4ZA 4PJHA 3NZ8A 3FUDA 4JAMA 1AO7A 2R69A 2LAGB 3JV6A 1AMXA 4G9FB 3UMNA 1FBIH 1S9XA 2AV1A 4R7XA 1HEJC 2V2TA 3SYAA 5CEZL 5AENA 5EC2B 1DHKA 5F7YC 4FZ8L 3P3YA 4XOCA 1BMZA 4HXBL 3JBG7 4NP4H 4A52A 4OCXH 2GCYB 1M7IB 2EXWC 3QDMA 3TJHD 4JZNB 3C8KA 2VLRA 3NCWA 3KPOB 1JZ8A 4PWKA 1OOWA 1SXAA 4JY6B 3PL6A 5F0PB 1AI1H 1YEIH 4NSKB 3H6AA 4XAWL 2P8MB 1ZLSH 2DTML 3THMH 3CFJB 2AEWA 1PYWB 2V2WB 5DD3L 5J9PB 1D5XB 1OAKL 2HVKA 1V7NH 2Z1PA 3MRNA 1PPIA 3F12B 1GPOL 1H3TA 5GGRA 1VHPA 4KVNH 3AGWA 2ZUWA 1Q8MA 1I4FB 4RQQA 2CAKA 4AEEA 4BFIA 1KPVA 1M3JA 1F8TL 1CYWA 5PAZA 3BGFB 2E7LC 4X8GA 5J5EA 4O2FA 2ZSVB 5EZOH 1LE9B 2KERA 2YGNA 1ADQH 4H2AA 4HHAA 1EEZA 3ZTEA 3K4DA 3WXWL 2SEBA 4ECNA 5E8DL 1NEZB 3GUFA 4QHNA 3NN8B 4RGNE 3F7QA 8FABA 4UT9A 2AANA 1BYOA 4QRRA 4IIQA 1KFAH 3ULAB 1NDTA 1G6RH 1H0DA 5CSGA 4C57C 1MCWM 1I8IB 2UY7A 3MRHB 5E2WH 4YLCA 3FRPB 4UU9B 1BZ7A 1YYLL 2VXQA 3TN0A 5IF0A 1LL1A 1ZHLA 3WHXA 1KCVH 1NINA 2QZQA 3LKSA 4I77L 1MFAH 1TJGH 1WD9A 7PCYA 4QHLA 5IB3A 1TYEB 1NDMB 4PJ5A 1XZWA 1FFRA 4KJQC 1DVUA 3GMNB 3TT1H 3DIVA 4YAQB 5C9JB 1NZRA 5A2CA 2F53A 4RWYH 4IS6B 4IRJD 4UM9D 2YMTA 2P43B 3GPEA 4AEFA 5I1GL 3QQ3B 43C9B 4Z0BH 1NIFA 2VDOB 4PLNC 1GGBH 2H3NA 1Q9LB 4HUXA 4G42B 5LO7A 3HN3A 4AJYV 1FE8L 5ESQA 1OSZA 2J5LC 5EZJB 2XFXA 3MYJB 4QHUA 1RFDH 1I3RB 3T4AB 1XX9C 1CXLA 1N3NB 4AVKA 4PS3A 5DJ8A 3LRSB 3MCKB 1HL9A 1WG3A 2MQCA 4PGJA 2XJKA 1S5IH 2UZYA 5ECJE 1I31A 2K1MA 3H3PH 3PHOB 1OE1A 2DYRB 2OMYB 5MP6L 4X6FB 4QF1A 1QYGL 1Z32X 1AS6A 2QHRH 2DQGL 4HH8A 1HCZA 3SKNA 4FQXA 1P84K 4KKCD 4TQEH 5LQBH 3MKKA 4PJCB 4Z76A 4W6YB 2KUTA 1UYWL 3VXTA 2J5WA 2HRPL 4QCIA 4L37B 1PG7W 2E6QA 4RA3A 5FYLD 3CZGA 1J5CA 4FYQA 5LJYH 4AM0Q 2B9AA 6FABL 2C34A 2ED9A 1B3JA 3OJDB 4D9QE 3RFZC 3WTXA 1NAKH 4MSWB 3GXDA 3RTQB 3FT3A 4XNYH 4U1JA 4ZNEE 2VLJE 2Z65C 1SUHA 4YHIB 2NUTA 1OT1A 5HHOE 2B5IC 5CBEA 3IDIB 4HC1H 4ZBJA 1J8HA 3GJEB 2CHZA 4DPCX 5BS0B 2R1WA 3OQ3B 2X4OA 2EIDA 1JPGA 3C6LC 1BAFL 2XG4A 4LE8A 3V5KB 2E47A 1CDUA 1L9MA 5B7EA 2Y23A 2BSBA 4I0PC 1OE3A 5FK9A 1G6RB 3UG3A 4Q7DA 1NDGB 4HIJB 2ALAA 5FCSH 5T5NG 4NO0B 2A9ML 4UF7C 1D6VL 3UEZA 4KNSA 2DWTA 3BPLC 4XMPH 1BD2E 2Y1VA 3KJ4C 1EJ8A 4N4YB 5BW7A 4PJGE 1XSJA 4BFOA 2CNYA 2YD5A 4H25A 5JHDE 2GI0A 4IRZH 5C07A 2FWOA 3L95B 3H7BB 1EJFA 3QDJB 5DEJA 4ODHL 4HWBA 4F7TA 1OAQH 2YAOA 4R96A 3QNZA 1XF2B 1XB3A 2DI7A 2ROYA 5HYJA 1V05A 3QP3A 3OKYA 4FA8A 3EGXB 4OZGB 3W5MA 4DUXA 2XZQL 2FL5B 5KAQG 4Z7QF 2OMUA 2VLLA 5KG9B 4L9LA 1C5CH 4R2GD 1HHJA 4L8SC 5JXEC 5KW9L 4OQ1A 5I1KH 5IV2B 1JUFB 4TS6A 4GEIA 5GIRB 4PRAA 3GNML 1B2WL 2DQFB 5LDSA 1AYOA 4N6QA 5J12C 4F3FB 2H1LM 3UDWC 2QQKH 2BOBA 1BGXL 2CO6A 3O8XB 1JCKA 5T1DH 1SMDA 3VXUB 3GD1C 3B43A 4Q6IB 1DFBH 3BJLA 2EXWD 5EO9B 1AGBB 3QWNA 1H15B 4DVBB 4CDHA 1KCWA 4YE0A 3SN6N 3DMMC 4CW1A 3KWUA 3VTAA 5E00A 4UDTA 1E4KC 3DROA 3TLRA 4LLDB 3WKMH 5GZOA 3KHQA 1ET7A 2BVYA 3OF6A 3F7VB 4OFIA 4BH8A 4PS4H 3NCCB 5A1AA 4HIIA 1INDL 3AVEA 4XVJL 2WLIB 4MDJB 3W56A 1YEGL 2VR6A 2DYPA 4R6UA 1QLFB 4JVPA 4YEEA 4JO1L 5D1ZA 4QRSA 1TO5A 3MLSL 1GYCA 5SX5H 5GZNC 4CSZA 4BK5C 5F72S 3DO3A 1NUNB 4N1CA 2XQYK 2JIXA 3NSXA 3S4SB 4MWFB 4FTVB 3W1ZA 1FH2A 1KB5L 2R0ZH 5EU6A 1GOFA 2FYVA 4G6JL 3U7YH 4DZ8B 4WWKB 4GAAA 1MWAH 4GQZA 3PU7A 2LVEA 4S1SL 1C08B 1MRFH 4YHYB 3IGKA 2R2BB 3SJVD 3OKKA 4K7PL 3B1UA 5BRPA 2BSTA 4XMKL 1CXKA 2OYKA 4Z8FH 3QEGL 1JWSB 3BEVA 4Z3GA 5AOZA 4L23A 3RI5K 5HYEA 4PRHB 4KJQD 5CCJA 5CGBA 4MHHI 3ZDXF 1NC4A 1Z0MA 2Z3FA 4N8CL 1KDIA 5B22A 1TTFA 4U1SA 1X9QA 3DV6A 3IMVA 3QUHA 1SOQA 2VKWA 1ED3B 1IO4C 5I8OH 3QQXA 3WLBA 3ZDYB 5EMYA 4BV1A 4CVUA 2O5YH 3QUYA 3SKJH 2YQ3A 2IG2L 1H9DA 4KI5E 3T6ZA 1HT6A 5ACLA 3MN8A 2EDXA 5GSRA 3CV5A 2XYBA 4ZPVA 3MOAH 4PGCB 1JZ5A 3V9FA 3RP1A 2ZCLL 4LPUA 1GGIL 1FG2B 3DRQA 3TS8A 5J1AB 2VISA 2EUXA 3MLYL 3WJJA 5JPNB 3OKMA 2I9TB 4MXWL 4AYFA 1QSZA 2D7TL 4L4TB 1QNZL 3NH7L 2YGOA 3MBXL 5I8EB 4Z3EA 1N10A 3GM0A 3TTYA 1FNAA 3ESMA 3QIUA 2VUKA 3ZKMC 1CDGA 3D4CA 4KMTH 3W39A 3C60A 1JOIA 3QH3B 4YPGA 1ADWA 3MTXA 2HA1A 4P59H 1KZYA 4JVWA 4NUPA 1ZV5A 2JB6A 4NP9A 1GC1C 1NBQA 5D7IF 3T0XA 2EECA 2YXWA 1KIPA 3EFFB 3PHQA 1IC7H 4HLJA 5D1XE 4NHCH 2Z7WA 3B8SA 4K3HA 5E8PB 3I9AA 5IVXF 4M7KH 2E86A 2G5RA 1YECL 5IROA 4PQXA 2YRPA 5AKSA 3FQRB 1GCFA 1UM6L 1BFVH 5EBWB 2IAMB 5D4HA 4YBQC 1KTCA 5KJ7E 3Q6GL 4LU5H 3CFUA 1AP2A 2MCG1 3UYPB 3C6LD 4MB3A 3HE7B 4C58B 5F7HA 4DEUA 1WPCA 3LEYH 4PTTB 5HJBA 2FWLB 3ZRFC 4NRXA 4I0PD 4FNLL 2CO1A 3MMEB 5JW5A 1OD9A 3M6DA 2VSMB 4QIRA 2DQIL 4TPRL 5EO0A 4BGDA 1RZFH 4YXHL 5KSUB 2FATH 2QLYA 1MWAB 4M6NH 5EC1B 1NCWL 1T7VA 4RIRB 2XN9E 1A1OB 5IFAH 4NC2B 4PPTA 3SYCA 4HP5A 2PO6A 2V9QA 3SBPA 4WJ5A 1EGJH 4JPIB 2OCJA 4OF7A 4X5RA 4GXFA 2YN3A 3ULUC 1ZHKA 2OSYA 3CZFA 3MAWA 4V1DB 4XVSL 1N6VA 1R5VB 4M3JA 3SOTA 2DS4A 4TYUA 4AIZA 1F3JA 3N50A 3X1GA 3MYZA 3OKDA 3CVHA 1IM9D 1NKRA 1PTZA 1YMHA 3PRZA 5I30L 2A6IB 2L04A 3RVVC 4M9OA 5CWSA 3D05A 3IE4A 3LPFA 1FYHB 2WYHA 4NAMA 3FO0L 4ZSOE 1WDAA 5JXED 2Y7NA 5E8EA 2R7EA 5FDYA 5CN2A 1LO5A 1OF0A 2BFVL 1WWAX 2DQHH 2RALA 3HMXL 3HKZA 2NTSP 3L81A 1WSST 3IJHB 1ZTXH 3RX7A 4AEIH 1ZIBA 3SOBL 1BBDL 3M1BA 4P4KB 2RGSA 1U3ZA 4Y1AA 1YNTF 5HVHB 3RZCA 3K6OA 4GAGL 4NRZB 4IRSA 4HDIB 1UOKA 4RAVB 1LO3L 1OT4A 3GSQA 1ETJA 1CB4A 3N2JA 3C08H 1XCXA 2B08A 3HFFA 4U1NB 1N0XL 5D5ME 4HIXH 2AERT 3MREA 1NLBH 2CDGB 3GSUA 4M62L 4M8RA 5D2LE 3WD5H 3MRGB 4M29A 4JZOA 2PYFB 1DQJB 2FO4A 2VNCA 2NXYC 3CZKA 1U4EA 1PF3A 3DMMD 5DJXB 3MJ9H 4XCFH 4ZW3A 2R8SH 2YAMA 1K4CA 1PZ5A 1G1CA 3QQNA 4HJ0C 2GK0B 3RE0A 3ZQ9A 2PN5A 1GKOA 4JJ5B 4MBOA 4FOMA 3RA7L 1F3DH 1MHPL 2VR9A 2QVIA 1ZVSA 1BAWA 4NCC2 4JFHD 4QRPB 4M02A 3OSKA 5IB2B 1B90A 3GIVA 4YQXH 4JY5H 3PABB 4OGXL 1HH6A 3GWJA 4QI3A 2CUMA 4K5PA 5DZJA 1T0NA 3S35X 2VRAA 5DCCA 4LHUB 3QEQA 2VR8A 1I3GH 3O11A 4JQIA 2JCCF 5C08D 3VFTA 5IQ7L 3PGDA 1YC8A 2XV3A 4WTWA 4CGTA 2G4GA 2CD0A 2H1PH 4JBSA 4X5WA 4PJDE 2PCFA 2X4UB 4NBZB 2WK2A 2PPFA 3R8BB 2VDKH 5GZND 3DOSA 2O5NA 1FSKB 2LU3A 4PJBE 4Y2OB 3KWWA 5AVRB 4XTRC 1IJNA 4K7PY 1HX0A 4JFEB 1MUJB 5FDWA 3I9IA 1MFDH 4AJWA 3APNA 1BJ1H 3CFDA 2YGQA 4KPHL 5KYXB 4G1MA 3QJVB 3FFDB 3FPXA 5I1AB 3HUJF 1QBMH 1WS8A 2IFFH 2R4SL 3HRZB 1E9PB 3BP4B 1QSEE 5EOTA 4F57H 5EUOA 4JRLA 3H1ZA 1D6EB 3FBKA 2EYTB 3BZEB 4UT6A 4Z7VA 4FXTA 1KNOA 2BOLA 1G0DA 3NCJL 4Y4FB 1L0XA 3CDZB 3AT8A 3OM3B 1HINL 1OGAD 5J8OA 4AKPA 4WI7A 2JNZA 3DI2B 3HNTH 2ZUXA 4I1RA 4W93A 5EOQL 1R3JA 4HJSA 4YDVB 4OZFB 3TF4A 1ZA6B 2WXPA 4KQ3H 4R90L 5EIQA 2CKBA 1XD1A 3NFNA 3BJ91 2JKJA 4YE4H 2CGYA 1QI5A 3O0RL 4L0ZA 2F5BH 1S9WA 2XTJC 2ZXEB 3BGFC 4PJHE 2CLVB 3GSRA 1AO7E 3O2DL 5I8CA 1MIEH 3C6SA 5FB8B 3S5YA 1O6SB 2H2PC 3EFOA 4W81A 1PNCA 1FNSL 1ZHBA 3K81A 4H8VA 5CJ5A 3RWEB 3RY5A 4ALAL 4HEPA 3I6KA 4WK0B 5TQ2L 4K94H 4JDZB 3S96A 5CINH 5B1CA 2WY3B 2Z6FA 4KQ4H 1G7IB 4LCIH 3ZO0A 3TBYB 1V5JA 1F02I 3QDME 1RIHH 2VLRE 3PDDA 3K72A 3MV7D 1SVCP 2F15A 4HJGA 3BP5A 3F7YA 2B4CH 3QZBA 2AKRA 3ZKMD 3RYMA 1TMQA 4CN4A 1GSKA 2YD9A 4FQ1H 3NJJA 2AF2A 1OP9A 4RNRA 5HJDA 1M6UA 4AENA 2XSKA 1AGFA 2Q76A 3PDGA 2G0LA 2ED7A 2PTTB 3MBWB 5FM5O 5ITFA 3KGRA 2ZZUT 3QAZC 4LQFH 4UTBL 2FVNA 3G5VA 3EJPA 1KLFA 4PH8A 1MJ8H 5A43C 4O4YL 1D7CA 2AJZA 3Q2WA 4FXGA 3P3TA 3VMPA 3SKOB 2P3YA 5F9DC 2H5UA 4NXKA 3DO7B 1QSFD 2VXTH 3CJJA 3LS4H 4P2RB 5MENA 3SGDI 4PGEB 3WDHA 5EEVA 4FEMA 1X5AA 4YBQD 3PXJA 3GS4A 2B1HH 2ADFL 1J1OL 4NJAL 3FQXA 4FXKA 1HIMH 3SHSA 4QRRE 5J6GA 2DQJL 3TZVA 2EUVA 2G2PA 2ATKA 5J11B 2JLPA 5J6HB 3QBTB 3WXVH 1NPUA 3OWRA 4FJZA 1AZVA 3O6FA 3QQDA 1HNYA 1SXZA 1U8PB 2ED6A 2V3DA 1J05B 4YHLL 5ID1A 4PRID 4UYPA 4J3OH 1O5DT 3KLAA 2V9TA 4ZW7A 4EI6B 3TO4A 5IZ7A 4UB0L 1P69B 2CM5A 4L4VB 4PJ5E 2UUDH 1MHHB 4R4NC 1UA7A 1XR9B 3N85L 3NESA 4AQ1A 3ULUD 1KBWA 4NZJA 2VDRB 2VERN 1TETL 2F53E 5IFHL 3LQMA 8CGTA 3HIZA 1MRDH 5KS9B 3HMWH 3C6EA 4I88A 3NJIA 3OAYK 4AQOA 1CS6A 4KZ0A 3UGXA 2P5WB 4PBDA 2CJTA 4N2HA 1BSIA 1RUKH 2V6HA 2VN4A 1WWBX 32C2B 4GXVL 4OIIH 4HSQA 4KITB 5AW0B 5E9DD 4ZO6A 1CL7L 1F4AA 4FKKA 1NAML 2GW5A 1FZMA 4TOYL 3SODB 2IQAA 4QOKA 2FO1A 3CSYB 3AFLA 3WTVA 5KVEL 3UMTA 1FV1B 1AGDB 4NWTL 3TBTB 2DI9A 3EH2A 5DUPH 2Y72A 3VXOB 5C6WH 4M7ZB 2OI9B 3BRFA 1G4RA 4OLWL 4CVXB 4G9DB 5EF1A 5IOPA 4LLYA 1HAUA 2CH8A 4U1MA 4QYOA 5CEZH 1B4LA 3BKMH 4BWWA 5CCHE 2MQ0A 4U6YA 4ZFOL 1JYNA 1TDQA 4MJ2A 1WFNA 1ZV2A 2X70B 2WB7A 4HJ0D 4U6TA 5KVGH 2VKXA 3DI3B 2XXFA 4PJ7A 4FQHB 3Q8EA 1L0PA 1Z9PA 3CIQA 1A9BB 2X4SA 1DYZA 2NNXA 1RZIA 2ZXBA 4XAWH 1FDLL 1KV7A 4IBVA 2G2NA 2DTMH 3QXDB 1GPOH 3N40F 4AJ0A 3HPJB 1BVNT 1NQBA 4FGMA 2ZXGA 4Y2LA 2XG5B 1J8HE 1FLTX 1SEBB 4MRCA 4XNMA 3A4EA 5EZPA 3SE4C 4PS7A 3GXNA 1B0RA 1A7PH 5F1IB 4J12A 3IFOB 4G9FD 4XTRD 1YEKL 4OJAA 3T6VA 4PJ8B 3FB6A 1Z5LA 5EZLA 1MEXH 2ZT9C 4F58H 1V55B 3WXWH 3O8XC 3AY4C 1PNDA 4TVUA 2ODHA 4Q6IC 3WN5B 1T2XA 2JTYA 1U33A 2XVLA 5IBTL 4URKA 3CWGA 1GZHC 1R3IH 4Y9BA 4LFHG 4BKLA 3S37X 5JHAA 3K2MC 5C07E 2VCOA 4L2LA 5CP3A 1XZ0B 4IOSD 5IBUB 2CG9X 4A2FA 3T0EA 3WEXB 5JHLL 3D85A 1RLWA 5F88A 3V5HB 2L4OA 5HYJE 2CK0L 4Z7AA 5DLLA 4MNHB 3MV9A 4NLAA 4U1HA 4LLWB 5CIPB 2IGTA 4NM8L 5I1GH 1MJUL 2XTJD 2BDNL 2P7TA 5L2JA 5I28A 5KSBB 2XU9A 4AIXA 2YLKA 2FEJA 4QTIH 5C71A 3RDTA 5F93C 3GB7A 3FU9A 3NSFA 1OLZA 2VR5A 1GL4B 2X53A 3LN5A 1KGCD 3RVUC 1FAIH 3TBWA 4C56B 1BG1A 3MLRL 5I1EL 4AGMA 3DX7A 5FYKD 5AYQA 1NMBL 4WWKC 4NQCA 2ENPA 4PHZA 1TUPA 3ME0A 2ZKHH 4UINL 5DJ2B 2FBRA 2P9RA 4LLMB 1HKFA 3B9DA 5C70A 4RAUA 4RDQG 4KXZH 3NIDF 5HHQB 12E8H 2CA4A 2CO3A 2XWTB 3WS3A 1DBBL 2AJSL 4GG6F 1P9MC 1ET5A 2WLNA 2XIIA 1AANA 2H32H 5LWYH 3ULVC 2KQNA 4W9EC 4LLUA 5I9QC 4LGPB 5FS5A 3VRIA 4ZUVA 4TV3A 1UYWH 1GS8A 1VEOA 3RRQA 5T3ZD 4LCYB 4EZJA 2FEEL 3AQYA 4AE1A 2DMGA 5DEFB 4BFGA 4EZLA 1NBVH 3CX5K 3DRTB 1IT9H 2OSWA 2UX6A 3ZHLA 3LKPB 4PSPA 1E8ZA 2XV2A 4XO3A 5FYJE 3HG2A 3V6ZB 2XLLA 1KLGA 1AIFA 2JELH 2PXYB 4HHGA 4JKWA 4N2CA 4XH2B 4WI0B 1U8KA 2DJSA 5EU6E 1BAGA 3CLEH 3KDMB 4DVRL 4G7SB 4NYLA 1GS7A 2XPYA 5JPNC 3DETC 3RU8L 2HLFC 3STZA 5L88L 3C5JA 1UXWA 2J6EA 3BH8B 1PBYA 3L7FB 2ZXWB 4JQVA 3LSOB 4M93B 4WTZA 2A9MH 1NPNA 4FRWA 4R4ND 1D6VH 3LAFA 4WW2B 2EVIA 5FUCC 4JPQA 1TNMA 5KJ4A 5TE7L 3MJ8B 3QCUL 3HMXA 2C7UB 4YHNB 4MJHA 4HGWB 5HY9A 3VFUB 4BSWB 4OKDA 1IC4L 4EN3A 4ZAKA 4KUCD 4CMMB 2A73B 3NFSL 1RI8A 4TVPL 5HPMA 4OGYL 5IMOB 4ZYKB 4QHPA 4ZQKA 1CFMA 1RZJC 1WBZA 3AS2A 1I9JH 1JTPA 1KLUA 2IAMC 4YO0B 3Q2NA 4XCEB 5EIIA 4PHXA 2QHLA 2X3CA 5HHPA 1G9MC 1MW0A 1R24A 3TCXA 3GDBA 1B2WH 3FT4B 3HE7C 4DUVA 3STLA 4X8XA 1N2RA 1KUMA 1YRKA 4Q9RH 1BA9A 2K7PA 1BGXH 3A0OA 1SF3A 4NO0D 5KVDH 4HISA 4ZFZB 1SHSA 5LAXB 1T6WA 1UKSA 3TNMB 1I8MB 1YNKH 4HBCL 3WU1A 3KLSA 4FG2A 1W6WA 1Y07A 2DPKA 1FORL 3QDJD 1XSKA 2EIZA 1YVLA 3TCTA 2H32B 2OX5B 3VSVA 4KZEL 1DVYA 3V10A 3GM8A 3RZWA 2XVKA 1VESA 1A3QA 3GRWL 1SBSH 4JRXA 2BSRA 1AG0A 2OJEA 2Y2YA 2XKSA 4KTDL 1LWHA 4LLQA 4D8PA 4AH2A 4A68A 4XVJH 5CF3A 1RHFA 3IS0X 4KMQA 4M7JH 2VDPB 3HE6B 3U1SL 1FO0A 3KS0J 4KI1A 4YUEL 3WO4B 1J0KA 2V5YA 5T33L 2A9DA 4XOEA 4P4KC 3UC0L 1F90L 4JO1H 1OQXA 2IF7A 4M4RA 5HVHC 3N1GC 1RZGB 2HKLA 5KN5A 4ADGA 3EYVB 2Z8SA 3O8XD 3FU8A 1JHKL 3B9KA 3VXUD 1JGEB 3OB0H 2IH3A 1I7UB 3WGUB 1XEUA 4NOFA 2I60L 3D4GA 5BQDA 3VQMA 3AAZA 1FL5A 2WYIA 5F7EL 4F9PA 2YD4A 3PWUA 2Y0SA 1TKWB 4BH7B 1JPSL 4JDVB 5LHDA 4K71B 2A4ZA 4N9OB 4WI6A 2E6PA 4A1IA 4P8QA 4LSVL 4WFED 3X1BA 4P57B 1J8RA 1SDDB 3O2DA 4XMKH 2WMPA 2YUXA 3QJZA 4D94A 3QEGH 5D2NB 3BZ4B 1N5AA 3GMQA 5HYFA 4KK5C 1DP0A 3AQXA 1F58L 1RHHA 3CLFH 3H0TB 1JTTA 3DHPA 3FUNA 3DECA 4EIGB 2FEDC 4HS8H 5DF0A 4R7NB 3VD2A 3QZWG 1BM7A 1E9QA 2NR6A 3LQAC 4Y1AE 4YHML 2JF1A 1A6VL 3ARTA 1FSKC 1EZSA 3DKHA 4YBLB 3NEEA 2IG2H 4U3CA 2ITDA 4DGWC 2UY6B 3L5WB 3QR0A 1WCBA 4RFOL 3RVUD 4F2MA 3UXFA 1WHPA 3BHBA 3ZYJA 2FJGB 1OGSA 4FTVD 2ZCLH 2WQUA 5T3XD 4PD4K 1MVFA 1NSNH 5BOPA 5MEPB 2XIBA 1CQKA 4OCYL 3CCHB 4Q9CA 4WWKD 1TCRA 3PAZA 4OSUL 2IXQB 3HRZC 2ROXA 4MXWH 4Z0XB 1HN1A 4PU2A 2D7TH 4DTGL 3MBXH 3PY9A 5ICUA 3ARRA 3KYMA 1G9EA 3D18A 5CBAA 1TTRA 4Y4FC 4H8HA 3ULSA 3OZ9H 2QMJA 5K9OA 3GKWL 4PRHD 3DA0A 5CEXB 1CVSC 5IQMA 4OLXL 4HUWA 1ZHNB 3V0IA 1K2DB 1GZQA 3KGSA 1INQA 4QO1A 4IKKA 1MQKL 3WE6A 4N2AA 5C09A 1X7QA 2APVA 1MF2H 1W0VB 3ZHFA 4BXSV 3QEQE 4F7CB 3D51A 1KJVB 4FS0A 4J7RA 5MI0B 2I5YH 3MKGA 1KCSH 1W9XA 3OMIB 2BP0A 3K74B 1H3GA 3ECUA 2CBOA 3KPNB 1T0MA 3GEWB 2V8MA 5TF0A 4XNQA 2G9HB 5AZEL 4GSDL 3LOWA 1RVFL 1UM6H 4EDXB 1ZSDA 4ORZC 2LVCA 3S88L 1A6PA 3CFBA 3G5XA 1P5VA 4MX7A 4X7FC 4FFTA 4WDIA 2ZOTA 3DETD 4ERSH 3B3IB 4U2ZA 1U8OA 1NWPA 2G5BB 2HLFD 2VR7A 4G2AA 1T1WA 4BZ2A 5B1JC 4N0UA 5EUOE 4Z7VE 4WRLA 2HP4A 4TPRH 2DQIH 4PUBH 1MH5B 2Z31A 4YXHH 3MJ6A 3IJ7A 1MW1A 1U9KA 2BNQA 3RURA 5F1OB 3TT3L 2GG1A 2J8HA 3QEUB 4QHMB 1NCWH 1U3HB 2CBQA 3VFSB 3HS8A 3A67L 2ICWA 3DPBB 5CGYC 5GRXG 4ZUWB 1M7DA 5IBLC 1W72L 2AXFA 4KUCF 4XP1H 1IGCH 3CU7A 4XVSH 3HFML 1KBGH 3TESA 5BV7L 2BVEA 43CAA 2ICEA 4NCDA 3C9NA 1MPAH 2W38A 5HHMB 3EOTL 2BWQA 3WJLC 4AMXA 2QGBA 1PZ3A 1UQSB 1P7KB 3EJYC 5C0DB 3QVAA 2IAMD 4LEOA 5IFJB 4XHQA 4Y4HA 2WQRA 1QHQA 3S9DB 4GRMB 3AU0A 1K5WA 4ABUA 4OIFA 3HE7D 1BBDH 1DUZB 3SOBH 5KZCB 1RSYA 3APMA 5DC4B 1REIA 5J11C 3E6FA 3SE8H 2G3MA 4DP2X 2NZIA 1XGYH 3DGDA 3VFVA 3DBXA 4M5YH 4WHTB 3VXMD 3Q5TA 1H6EA 4U3SA 1I1FB 4J3XA 1GTFA 1U8NA 2HG5B 3IGLA 4M62H 2ZSWB 4AMWA 4L8DA 3FAWA 4GBXB 5HHVL 2GT9B 4P3DA 5DTFA 1EJOL 5HYSA 4E41A 1Z66A 2XQYA 5IJDC 3X3GH 1JNJA 1ZA3A 4OZGF 1QUNA 1MHPH 5GRJL 1BJMA 4DERA 1KTBA 1RKRA 3UO1L 3GK8H 5LG1A 2EUZA 1ZVHA 1N70A 5MENE 1R3LB 3FTSA 1AR1B 3I6SA 4Y5XA 3IJYA 5I1LB 3EO1A 4UV7H 1UZ6F 4NAJA 1QA9B 3AXIA 2ZUTA 1QRNA 5IQ7H 4WHCA 3FAXA 3SDDB 2AQPA 5HPOA 4P4KD 2VZOA 2IDFA 3DUUB 4HKZA 2F68X 3KCPB 1L9OA 5GGTL 2GJ6A 1TZ8A 3QZOA 1LEGB 4WW1A 3QULA 5IW6A 4M7ZC 1EHNA 2OI9C 2P24A 1MI5A 1IVTA 1ES0B 1UXSA 3BVXA 5EULV 3HHSB 4F5CA 1YPZA 1F3DJ 4DJMA 4F2EA 4OJFL 2AK4A 3G6DL 4NUQA 3RG1C 3WL9B 2B4CC 4XVTL 2ZONA 3B9EA 4AZUA 3TH3T 4LZKA 3HC2A 1JGUH 4H8PA 1EAPA 4NQVB 3CXHJ 1F1DA 2APWA 3I9PA 3RY6C 1U92A 1OHQA 4KK5D 2NY1B 3RFRA 2FIKB 4X7TA 4JFZH 2HJKB 5EOQH 4YSOA 2CUAA 3FU7B 4LHUD 1BIIB 3FOLA 1A4AA 4HIHB 4YDIH 4MHHG 4R90H 3ZTJG 1YY8B 3GLEA 3QO1A 1E2VA 4PP2A 4QOKE 5I1JH 1BJ1J 2D9QB 2GJRA 1KPRB 2UV3A 3O0RH 5ICYA 1DE4B 1URIA 1NCBL 1QD0A 2NY5C 3MXVL 1KN2H 1N12A 1RSFA 2WKOA 2VLJB 4GLRI 4HZLB 4WTXA 5KYNA 4JFED 5IJVA 1K8DA 2CPCA 4B9FA 1FNSH 5HHOB 1AFVL 1BVLA 1WJ3A 4KH2A 3LIZA 1TQTA 2HPOA 4NO2B 4N28A 3LTVA 3MLTB 3Q1SL 5F3HA 2QGEA 2X41A 1UB6A 3ASWA 4FMFA 1EEUA 2H45A 3U46A 4K9EL 5JIDA 4ZW5A 4TNVK 1BLNB 1ZXKA 3FHEA 4PJ7E 5K1VA 4Y4FD 3K91A 4HD9A 2HFFA 4OF3A 5E5MB 4DN4L 3MRJA 2ITCB 3RX9A 3UAEA 1WVZA 1AD0A 1ZK9A 3O3BB 4GRLB 1JD7A 3QYCA 3WGVB 2VZ3A 4FQCH 1BD2B 1J87A 1GYUA 3ILPB 3QCVL 3BH9B 4PJGB 3UTZB 2L7EA 5JHDB 1BVKA 1U8JB 2XWXA 1L7TL 4XOBA 4JHBA 2OSLA 3ZDYF 4ELMA 5GGQL 4HWZA 3NJLA 1CZ8L 2XV0A 4O4YH 4TLUA 1QPXA 1FZOA 1P4IH 2FWUA 4XB3A 2QVMA 4G8AC 2ZNXA 3QFDA 3IDGA 4FYSA 4D0CA 4DGVL 5H94A 1KWGA 3B1TA 3UJIH 4G43B 3IMRA 3KPRA 1I7ZA 3HC3L 2IWFA 4F37K 3MRCA 5BVJB 2ADFH 2VDLH 2R23A 1J1OH 2IO5A 3H7LA 4S1QH 1S7WB 5F9OH 3VGAB 3CDFA 1XT5A 1VFAB 4BCZA 3TFKC 4QXUH 4NPJA 3BD3A 3UZQB 4B5ZA 2WQVA 4XVUC 2WZPD 4MMYA 3MACL 5GISL 3T0EE 4YHLH 5EBLB 1DBJH 3LKQB 3V4LA 4QT5B 4Q0XH 3VGGA 1P5UB 2PYEA 5CGYD 1R75A 2V3EA 4LKXB 2WBXA 2WXKA 3MV9E 3WIAA 5IBLD 2DQMA 4R4BB 5E1HB 4O9HL 1GJUA 1ONQA 5IEHB 4DWHA 4OF5A 4ZW8A 5DRXA 2LLLA 2E59A 2UXGA 4W6XB 2YPLA 1WP6A 2YKKA 4BQCA 3VFNA 4AIEA 5INDA 3EJYD 5I0VA 2R29A 1U2CA 1JK8B 4P5KB 3IMBA 4PN6A 4G59C 4PY7A 4IBLT 3GMMA 5CJ8A 2F9BT 1J9RA 3SKMB 1HQRB 1S7SB 4WKZB 3EJJX 3KR3L 4DH2A 1MY7A 1KIRB 2KMWA 4UBDC 5CJBA 3K6DA 4PV1C 3H2QA 2YSSA 4NQCE 3DSNB 1TO4A 2GFBA 4FA7B 5I5MA 1D5ZA 5D7HA 3E8VA 4YGVA 3UBXA 2W65B 4OLWH 2APFA 2FDBP 3FB8B 3I75B 3TBBA 4L1DA 3OXRA 4L4VD 1BV8A 4M93C 5FOBB 1M42A 3L3DA 4JGUA 2XJLA 3WEAA 4JS7A 5DA0B 3GI9H 3U6XS 4I48B 3GLZA 4MASA 3WUZA 1RK1A 4LASL 1QFUL 1U93A 4NO3B 4K0OA 2P5WD 4KKBC 4OBRA 2VSDA 4LVHB 3WS6C 4OFDA 4BBWA 4R8WH 2ZTBA 1FDLH 2NYYC 1PJ9A 5IB4B 1ZS8B 1C16A 4DOHE 4WFHD 4PP1C 1GMEA 1XGQA 3CC1A 5IMKB 4L8BA 3HBQA 3ATDA 2CQVA 4NHUB 1V7ML 3LPPA 1UD8A 4MRBA 4H0LC 4WK4B 4R84A 4ZDHA 4WV1B 4QNPE 4LSTH 2K70A 1O6VA 1OIOA 3L4UA 3EYSH 4C55A 1YEKH 2AEPH 2VDLB 3QEHB 4G83A 1I9IL 3WNOA 3AWFA 4JHWL 4JFOB 5TGBB 3E2HB 1JRHI 1HDMA 4KMLB 4ZXBA 1KZQA 5IBTH 2ZP9A 2ADGA 5BVPL 1UJ3B 5DZVA 3L5HA 2LAAA 4RWHA 2Z8RA 1AHWB 4P07A 2FTAA 3ATAA 1G9NH 3KVDD 4FKEA 2DQUL 1JZ6A 1CDHA 1LE5B 3QUML 3FQYA 2DIAA 4Y4KA 3QQ4B 3MGTA 2CK0H 4YHKL 5LNEA 4J2XA 2YRBA 5LBSH 1NOFA 5B38A 1J8KA 1YUHA 3MX0A 2OMVA 4YHZL 3HE6C 4HZAA 1WFMA 4OCSH 3HB3B 3MRQB 4NM8H 3U4EB 3PS6A 3WO4C 1MJUH 4JM0A 5HJGA 2QKIA 2E7C