4RRPG

Crystal structure of the fab complexed with antigen asf1p, northeast structural genomics consortium (nesg) target pdr16
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
219
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVSYSSIHWVRQAPGKGLEWVAYIYPSSGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYSTKLAMDYWGQGTLVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab antibody, light chain
publication title Crystal Structure of the Fab complexed with antigen Asf1p, Northeast Structural Genomics Consortium (NESG) Target PdR16
rcsb
source organism Homo sapiens
total genus 41
structure length 219
sequence length 222
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2014-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rrpG02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rrpG01
3A6OA 1X5AA 1QEWA 5JHLL 1REIA 1AGCB 2H9GA 4W6YB 3TPKA 5HHPA 4ODTH 2I9TA 2WINB 5LJYH 4IMKC 3FMGL 3DO7B 1A6VH 3FFDA 5D72L 4ZUWB 3B9EA 3TEUA 2XNAA 1R3KB 2YKLH 3MUHL 4RSVA 2A73B 1XGUB 4KKNA 1FAKT 1JVKA 4MJ6A 1HOCB 1I1FA 3R8QA 5CBEB 3PE9A 5ERWB 5GGRB 4JFZL 5IWLA 4O2FB 3MX0A 2QSTA 3DV4A 3CIQA 5SWZA 1MCPH 4HAGA 3BQUA 4WI6A 3VXNB 3JTSA 2AI0H 3H9SE 1PAMA 3PNWB 3ELAT 1M7DB 2AJSL 4S1SL 4Y16D 3PGDB 3WFEL 4PV9B 3CFJA 3BVNB 5TE4H 3RWIA 1F4WH 1A4KA 4ZUVB 3QUKB 2HJLB 1J0YA 3EO0B 4QRRD 1FL5B 1R3JA 2OK0H 2AXFB 3CX5K 1OAKH 5GGSY 3O6FD 4GW5A 4KZDH 2JCCF 4P9HH 3TYGH 1OD7A 4XC3L 3UAJC 3X3GH 1OARL 1F5WA 1RJYB 1YZZA 4R4BA 2FJFA 4H0GA 3E0GA 3QIUA 3LHPL 5EWIL 3PWPA 3B43A 2PNDA 1FBIH 3L3IB 1DE4A 4GRLB 1S9VA 2J6EA 1IAIL 2VH5H 5C0AB 1KN2H 4OGYL 1FE8H 1H8SA 5D1XD 4KKAC 2CLVA 4PJFB 2BVUA 4FQXD 4ODBD 5KW9L 1FFOB 1XIWB 3T2PA 1GGIL 2NXZC 3H9HA 5H94B 2LU4A 4QCIA 5IJKC 4WJ5B 1BP3B 2CK0L 2X2YA 3BGFB 2P5WE 2W9LA 2AJZA 3SDCD 3ARPA 3J8F7 4NFCA 4LMQE 2YBRA 3O6LL 1SBSH 5IBUG 5DD6B 1DTUA 3WJJA 1TZGH 1YJDH 1EMTL 5T1LB 1T1XA 4MCYA 1QLRB 5CSBA 4R7NB 5C07B 4KH2A 2EE6A 1IFHH 5DHVB 1JRHI 3PIQB 3NGBC 1UENA 2ZPKL 3S97C 3P4NB 4TUJB 2AK4A 2D7TL 4PJ5D 2EZ0C 4PRHB 3NIFF 2WQRA 3LKRB 4HC1L 1Z3GL 4XVSH 4CNIA 3RL1B 4Q9QL 2XXCB 3E6HB 1GJIA 1IAIM 4ZQKB 4HUNB 2D7NA 4RMUA 4QHUA 3E2HB 3PWUA 3U9PH 1OVZA 5CEXA 1CQKA 3SDXB 1U58A 4NQEA 4DGIL 1D9KB 1S7WA 4KI5D 4KUCD 3SE4C 5L2JA 4QRTA 4OZIB 3B8SA 1B90A 4UT7H 1KJ2B 4AEEA 3SBWA 4F33B 1FFNA 2V5TA 5MHSE 2Z31A 1WISA 4L4VA 1G6RB 2A6KA 3QISA 1L7IH 4U3HA 3ZDYE 1S7RB 3DGGA 4KXZH 1DL7H 3DBXA 3DRQB 4TPRL 3KPLB 4Q6IC 3FCTB 5TPWL 4OLEA 2HFGL 4NCDA 2A9ML 1CGVA 2CUIA 3E6FB 4PJBA 2X1WL 1FVEB 3GSOA 3V4PL 1UWGL 1KSRA 4O2EB 4OD3L 3DV6B 3HC0B 3NAAH 4GW1A 3M8OH 4LSSH 4M8QA 4MDIB 4PJ8C 4QXGH 4P2OA 2WP3O 1Q94A 3O4OB 4LSRH 4FTVD 4G80A 5MERB 4W4NA 4MA3A 3X12A 4DTGL 3MLXL 4UAOC 3G5VB 4JFOB 1UJTA 1QHOA 2R1XA 5EU5A 1CFVL 4LQ1A 4ODWA 4NBZB 4Y19D 1AKJD 3LKQB 4XNUL 4Y4KD 5SWSE 4DOHE 1XGPA 1MNUL 5KBNC 4XWOC 2Y5EA 3MRQA 1I1YA 3M07A 2CIKA 1I8LC 5E8NB 4N68A 1QP1A 2HTKC 4LPXA 5ESVB 3D3VE 2IEPA 1DBKH 1IZKA 3B6SB 1ZA3A 3PQYA 1YC8A 2BY2A 3BZ4B 1JBJA 3PWLA 4JO2L 4U6HB 1PYWA 4K9EC 2JELH 4RISH 2BOBA 1YEEH 1M7IB 1OTTC 4M5YL 5DMJB 1KTKE 5C0EA 1KELL 1HHJA 3WS3A 2BDNH 2PW1B 2BSSA 3FQWB 3NIDE 5GS0C 3QP3A 3KGRA 3P4OA 5K9KB 4BZYA 1NCBH 1P4IL 4WNQA 3AM8C 4J3TA 4X6DA 1JN6A 4XP6H 1I8MB 1A1NB 4KV5F 3QXAB 1BAFH 4CVZB 4M5ZL 4CAGA 2E8ZA 3QFDA 2KKQA 3PJSA 2H8PA 4BFIB 4GRLC 4LSVH 4P5TA 5TDPB 3ARFA 5FAAA 5JNYA 2WANA 4JR9L 3D0VA 4BQ8A 4S0SD 3AU1B 4PJGA 4HJJH 2IBGA 1TNMA 3W2DL 1NMCB 2IH3B 5J13C 2Z35A 4N0FB 3TM6A 2DQHL 5HHNB 3GI9L 3FO2B 1OB1A 5D7JD 2GSIA 4PJ9A 1RJZB 4XHJC 4PYHA 1DN0A 2FL5A 5FKPB 3C09C 4YXHH 3LS4L 5HGDA 3UYRH 5B8CA 5E0QA 2X05A 1PEWA 2VSDA 5IMMA 4KY1L 1CE6A 4PJIB 1KTLA 1CXKA 1KJMA 3GKWH 1OPGL 3HB3C 1W8OA 1XFPA 2CO7B 3C2AH 1H0DB 3I50L 5TF1L 4KHTH 1QBMH 5GGUB 1WBZA 4O4YH 5BCAA 4L3CA 3K3QA 3KXFA 1UKQA 5EZOH 2QR0B 5FUZH 3H7BA 1MQ8A 4P5KB 4YE4H 1BQHB 2R2BA 4HMEA 4APQA 3LN9A 2AK1L 2Z91B 3PL6C 2EH7L 2Q7YB 4BJLA 2OTUB 2DM7A 1I8KA 1YEKL 1I3UA 3RFZC 3EIFA 5FXCH 1N59B 1MHEA 1KB5A 2X4RB 3IJSB 1KB9J 4H8WL 4RMTA 3E2HC 3VXSD 1KIUA 2APTA 3QQ4A 1X5HA 2IPUG 3MBEA 3B3IA 1H3VA 2HVKB 3ULVC 3GO1H 4XXDB 2IBBA 4HGMA 1F3RB 3RGHA 3ZT7A 3QHTC 5B21A 2P42B 4PJ7F 4WENB 1OAXH 4XNQA 4QO1A 5B4MC 4M62L 5C0JA 1N0XL 3VRJA 2FHCA 3VFOA 2CRZA 5DZLA 1MJJA 3RDTA 4KHXL 4FQIL 3TCLB 4P2QE 2GTWB 1AXSA 2DI9A 3OKEA 5D7KE 3ARGD 2F5BL 2GITA 1RZ7L 3RVWC 5T1MB 1UT9A 3MJ9L 5GGTH 2AJSH 3GI8L 1HDMA 4ZFOL 3FONB 1A9EB 3O4OC 5IW6B 4HWUA 1QQDB 3WFEH 4MJ2A 4U1IA 4JFFA 2RFXB 3WL9A 1WWCA 2X4SB 3DMMD 4NQSB 4Y5XB 3I75B 5T33L 3HRPA 3RIAF 3HE6A 3OXSA 5BZDB 4PJHE 4Y8AA 4CVXA 5SWSB 2B7DT 2QBWA 4HULB 3FKUS 3OR6B 1U92A 5C0GB 5ID1B 4LEXL 1PKQA 3HI1B 3MO1B 4HGWB 4KUZH 4KRPC 5HVWA 2YK1H 3PGCB 1OARH 1G0YR 5D2LE 1A7NH 4F7MA 3HUJF 3IXTA 1EIBA 5D5ME 1NJ9A 1IAIH 3IU4L 2KZ1B 3RTQA 5I8EA 1A7RL 5FM4A 2Y1VA 4OGYH 2DWEA 2BNUA 5AEAA 1SJHA 4GH7B 5C08E 1GGIH 1VACA 3DXAE 4HMDA 5FO7B 3BZEA 4LEOA 3CJJA 2JJTA 3MFFA 1NKOA 3QPXL 3LKSA 3VGAC 5ICZA 5DK0A 5EA0H 5IR1A 2G9HA 1RZFH 5HDLA 3LKPA 3BAEH 5C8JB 2OX5A 2C3VA 4Z7OF 1VFBA 3K8MA 5IB1B 2P1YA 5INDB 1LDPH 1MCFA 3W81A 4AM0B 4I0PC 1AFVL 2MNUA 2VLJD 2WBKA 1EXUB 4KDVA 4OZ4B 3EOYG 3BWUC 4HEPG 1FVCB 3BH8B 2GIYA 4CN4A 1PFCA 4EBQH 1Z3GH 2B5IB 3QCVL 1DEDA 4OAWA 4Q9QH 1UWEL 4XI5C 1NMCC 3AXLB 3VFPB 3AFLA 4K3EL 1DBMH 3MNWB 4ZMAT 5L2KD 2AGJL 1G7HB 2CKBA 2IQAA 3NFNB 5KS9A 4OI9A 1XGYH 3O41B 1ADQA 5IIEB 25C8L 3B9KB 1C5DA 2VXSL 4I5BA 2IG2L 4MCZA 1BJ1J 1PY9A 4ISVB 4GRWF 4JGJA 2R0KH 4ZG1A 5D1ZB 1NFIA 4EN3C 3WHXB 2WWMC 2XA8H 1SHMA 3HMXL 5FHBL 4JFHE 4N9GA 3Q5TA 4WTWA 3KJ6L 4JFYA 5GS1C 4EI5B 1ED3B 4MQSB 4YXKH 4OF3A 2Z4QB 4JPWH 1XMWA 1IC4L 5TPWH 4NQDB 5I71B 5BV7H 2HT2D 3Q5YA 1LQSR 1NANI 3FHAA 3V4PH 1UWGH 2NY5H 3QG6B 3GMPB 2B2XH 4GS7C 3ME0A 4J3XA 3T0ED 1LEKB 4PG2C 1A7PL 4HDIB 1WIPA 2R9HC 3GIVA 2BCKA 3TO4B 4RFOL 4H5SB 4DTGH 5I1EH 3MLXH 3Q5OA 1TFHA 1T3FB 1XCTA 4K71C 4QXUL 5IP4A 1AO7D 3MRNB 4HPOH 4L4TA 3S96A 1V7ML 4A6YH 1I9EA 4A2LA 2VDQL 2YPKB 4XTRD 4HWBA 4LOUD 1ND0B 4Y89A 4P2QB 4NKQB 3UC0L 2AJUH 5DA4A 4G8IA 2YZ1A 4U1SA 3S88H 4B50A 4ORGA 2XQYK 3RWDA 2NX5D 1JTTA 2BHUA 1FLRH 3LSOB 1IKFH 4D8PB 3E3QE 4UB0H 3BKCH 4HIEA 3K2UL 4KUCF 1KCLA 1YEGL 1WEJH 3EYVB 4PR5A 3TNNB 4U1KA 3SGDH 5DUML 2MQCA 1UGNA 2IAMA 3RKPA 3BYYA 1DQJA 4Y5XC 3MOBL 3BPCB 1PKOA 3QNZA 1YUHA 4XNXH 5EU6A 3JV4B 1JZ4A 1WZKA 2Y5TA 2UWEF 3EYSL 3U2SA 1JPTH 5I16A 1MFEH 1PG7L 5EOTB 2G75A 1NKRA 2BSRA 4UOW1 3WO3B 4QLRA 1O7SA 5DO2D 2C4XA 2AJXH 2NYYD 5I1LA 2FSEB 4YAQA 2LABA 5TDNB 5D2LB 2XTLA 4OCYH 1MIEL 4M5ZH 4M7ZB 3TP4A 3OX8B 1QVOB 2FX8L 1WBYB 3WD5L 1XR9B 3WCYA 3JTTA 1L6ZA 3NMEA 3GEWB 3O3UN 3U46A 3U36B 1FVDB 5C08B 3DXAB 3BO8A 3L95A 3NA9L 3O11B 1NGPH 4S2SA 3RWJB 5C0DA 4PJCA 3Q1SH 5E8OB 3FN0L 3GI9H 2DKSA 3U4EB 1SYSA 4PJDE 4R0LA 1FAIL 4MNGE 3QUYB 4WU5A 1I8IA 4IDJH 1CD1A 3MUGA 4L4VD 5EU3A 1IJ9A 2V2TB 1UXWB 2SEBA 2XWBA 1OGTA 4UT9H 3HC3L 3MV9A 2VDRH 4KY1H 4QRPD 4WFHD 5HYSG 2NZ9D 3RU8L 5J4MA 1K4DB 4Z7NF 1FG2B 2Y6SC 5TF1H 3BRGC 1KENL 1QG3A 1P9MA 2FJGA 4NJAL 2KZWA 1K2DB 1KCSL 2JE8A 2GK0B 3MRGA 2G60H 2I60H 3WIIL 4IRZH 4QWWC 5F7EL 1RZJL 4M93C 1ZEAH 1MUJB 1I9RL 5C70A 1CG9A 4UOJA 5J1AB 2QHLA 3QEGL 4H20L 3SGEI 3LEYL 4DZBA 4AMKL 2X89D 4M1GL 4HJGA 4JKKA 43CAB 4FOMA 3ZSSA 4KKLD 2WBWB 4OGXL 1JJUA 4PRIB 4YHNA 1BJ8A 2DWDB 4JB9H 1KG0B 1U93A 4Z8FH 3OWEA 2YEZB 3U30C 5F97E 5EPMA 4FQJL 3U4BL 1M6OA 3O9WB 1BWMA 4YIQB 4UOW0 1IAOA 3DO3A 4NYLB 5T3ZD 2Q87A 1F00I 5JPMB 4KHXH 2DKMA 1EPFA 4FQIH 4DAGL 2GUOA 1MFAL 3DSNA 1MRCL 2XN9A 1T7YA 2N56A 3F58L 2DLIA 2C9AA 4PGEA 4ZFGH 2H2PC 5LVEA 4QGYA 5TDOB 5A2LH 5F88A 1L9MA 5DK2B 1KXQE 2ZWLT 1EFXD 5HHME 2I27N 3TO4C 4GKSB 4N0UE 1FFQA 1UB6A 1CIDA 1QSED 1OF2B 1ZSDB 4PPTA 3DETC 2RAMA 4IRSA 3SDDD 3IDUA 5J12B 3QAZC 4Y2DC 1MHHA 2VDKH 5DFTA 3EBAA 2K7PA 2AJ3B 1U2CA 3C8KA 5EUKA 1LO5A 3DUUA 4YQXH 5IK3B 3V8CA 3CVHL 1AQDA 2YXMA 5CIPA 4XMPL 4BQ6A 4PS4L 1IT9L 2PYED 3KYAA 2NR6C 2R0WH 1RK1A 5EIIA 1U8QA 1U8MA 4PJ9D 2GQHA 2E6JA 5IF0A 1IC1A 2VXTH 3HA0A 1IC5H 5EORL 4JREB 2IGFL 2Z93A 3CSPA 4PRAA 3K4AA 4XP4L 4WTXA 4PP1C 4NOBA 4MB5A 4RWHA 4WW2B 4F9PA 4PTTA 2EH8H 4O2CA 5IVOA 3D1MC 2VYRE 2QQNL 2OR9H 3ARYA 4AQOA 4APQD 4YHIA 1A6AB 2PCPB 3ORJA 4OFDA 1A7OL 1GC1H 4YX2L 5ID0A 5BV7B 2DOCA 1T4KA 5TH2A 2ADGB 4HK3N 5LCVH 1FRGL 3ALPA 3IRZA 3KYNB 3TBWB 3V8OA 5KVEL 1NAKL 3BFOA 3FO9B 3OAZK 4M7ZC 3OV6A 2FGWL 3TF7C 4OD2A 5IUSA 2EDQA 3TVMB 3S5LG 2VLRE 1AD9B 4F7EA 3P4MB 1I7TA 1UWEH 2XPGB 4KZEL 5DVMA 4KRMB 5KOVC 3CPLB 4P3CL 5FK9B 4I2XE 3JV6B 3C9NB 5EOCL 2CD0A 3FFCA 5B39B 3VDAA 4V1DE 4MNGB 3QUYC 4A6YB 1RQ5A 4PGCB 1D5MB 1RUAH 1FYTD 5I74B 3IDXL 1JPSL 4YHOL 2ZUQB 5C09E 3CFKB 3TO2B 1P4BL 4HD9A 1YPZE 2JB6B 4AH2A 3KJ6H 3CXDH 3GJEA 3MGOA 4M4RA 1MJ7H 4LKCA 2BSTB 3MUY1 2DRUA 5BRZB 5FYKL 4MAYC 5EDXA 3UDWA 1OTSD 4KKBD 4YC2B 4JFDB 4CW1B 1BVLA 5I17B 2WZPD 1A7PH 1G7JA 2O5ZH 4ZSOA 1T20B 5F7DA 1FDLL 1DUZA 1KPVA 4JFED 5E00B 1KLUA 4XWGH 4O58L 5EBMA 3FB5A 1GGYA 3GSNL 3PV7A 4D9RE 3RGVD 4P23B 4ODVL 1WGOA 5FO8B 5TQ0L 5D2NE 4JO1L 3WN5B 4TRPL 4G6FD 2F54A 1BX2A 2ADJB 1AP2B 1P84K 4G9DA 4Z7WF 4DZ8B 2DJSA 1IGJB 2RCSL 3QIWB 5JORA 4U2ZA 4NT6B 1A6UL 4UILL 1RZKH 5C7XH 2OP4H 3MYJB 2HWZL 2QKIA 3QFJE 5JMRA 4X6CA 1NUNB 3NABL 1MHPL 2VQ1A 2Y7QB 3MOBH 1V8HA 5GZND 1VFAA 5JDSB 4LSPL 4X4XB 4LNRB 1QFWH 4HJ0C 2BVTA 5GQBA 4ZPVA 4YR6B 3NFPA 1S9YA 2MOVA 4L5FL 1NMBL 1R6VA 4J4PC 1JYNA 1PG7H 5GRJL 2ICEB 3H3KA 2H3NA 2ZG3A 1A4JA 8FABB 3QXDA 2J3SA 2VITA 1FZKB 1I85A 1IC7L 4OGAD 4Y4FA 5I8OL 3IJHB 5J6HA 3TN0B 1U8OB 3FZUD 3RNQB 3ZTNL 4ACPA 1UYWH 3UTSA 5JOPE 2XRAL 1CK0H 5C9KA 4F7TA 3RBGA 4HGKC 3IDYB 4JJ5A 3PDOA 2FX8H 3Q3GA 1HNGA 1NDGA 4NHUA 1IQWL 4YBQC 4Z7UF 5AZ2H 3O6KL 2GCYB 2CR3A 3HZKA 2AXHA 3LRGA 3SE3C 1CL7I 1NC4B 2DQGH 2CGRL 4JJHA 4U2YA 1RJCA 5GGRY 1XF4B 1HN1A 2FEEI 3T2NH 4ALAL 2FECL 1LO4L 1FAIH 1KEMH 2FX9H 1B4RA 4L29B 1OCWH 3QB7C 5DJ2B 1M05A 5D96B 2X4OB 3X14A 1FL6A 4NUGL 1MPAL 3LOWA 1UM4L 1B88A 4FXGA 4XPTL 5JOFB 4NO5A 15C8L 1U9KA 3BPOB 2Z8VC 3CZJA 2R0ZL 3OAZH 1QFUL 2YC1A 4PY8I 1FHGA 1KJVB 5KVFL 1KENH 1JGEA 1OP5K 3QDJE 4XPFH 3WNPA 1RZJH 2VLRB 3QEUA 1QACA 1X5FA 2EYRB 4CU6A 4ZAKB 1TTUA 4LIQH 4ELKB 1Z9LA 1F2XK 2APXA 4I2XB 4V1DB 3LEYH 4ETQA 5D7IA 4M1GH 1ZXQA 1F90L 1TJIL 4NNXA 2OSLA 3CLFH 2YPLE 2JK5B 5HYJB 4GG6E 3SKUD 4LCYB 5T1DL 4IOFC 3X17A 2EIZA 3SCMC 3I6GB 3MNZA 3EFDL 4BUHA 2B4CL 2XY2A 5IFHL 4MD4A 4YGVA 2Q8AL 1EVUA 4P2RE 1YPZB 4JHWL 2FDBP 3MTRA 3HFML 5JQ6L 3T65B 3X11B 1U3HA 4KJPD 1AHWC 1YEJH 2IAMD 3GMNB 5L7XH 1MEXL 1BREA 3BRDA 1C16A 5ESAB 1HH9B 3CNKA 3W5NA 4U1LA 1RUQL 3WFCH 2X6MA 3TJHC 5EU6D 3KPOA 3BESR 5CINL 1CFTA 1E6OL 2BXZA 5D7KD 1VHPA 1XF3A 3ROOB 3Q6FA 3UJJL 1YNKL 5C0NC 4LGPB 2GSGA 4NNYB 3WNNA 3UBXB 4G6KL 3WFHA 2A83A 1UH4A 3V6OA 4MB3A 4PTUB 2A9NH 3L3KA 3SKMA 2PXYD 4P23C 4JM2C 4N0YH 3X3FL 2CLZB 5D2NB 1OSZB 5IJKA 4QGTA 2FD6L 4KTDH 3H9ZA 1J05A 1Q72H 3BZFB 2ATKA 4LPYA 2E9JA 1J9CT 5IQ7L 3G04B 5BW7C 4HIIB 1VGEH 2CKNA 1YYLL 3O2WL 4UMGA 1Y0LB 5DRWA 4LIQE 5DVLA 3BIKA 1KXTB 4ZTOL 5J56B 4JRXD 3MODH 4XX1E 1FLTX 3MC0A 3KPNA 1UFUA 1FFRA 3DVNA 4NPYB 3RKDC 4E5XA 3O6MH 1FV1A 3L3JA 4PGDA 3ZT6A 1JF1A 4OJFL 1LK2A 3MRKB 3MSPA 3MJ8A 2GY5A 2IWGA 4RDQG 3JVGA 3MV9D 4OB5L 2JTDA 5JIKA 3MCKA 4AEIL 1IGYA 4H25B 2J5LB 4OCWL 2F58H 3CUPB 3TA3B 4NBYB 4PG9B 4HKXB 3RZCA 4WEBL 1B9ZA 1J0IA 1RIUL 1TENA 4K2UL 3D0LB 3L5WB 4KVCH 5E5MA 3QBTB 3SJVE 5I66A 2E7MA 1V3MA 3MLWL 3SKNB 4K94H 2E27L 2JJSA 1A7OH 1PG7X 3L5HA 4GRMB 1FCCA 5IG7A 3GNML 4BZ1H 3TN0C 3ARXA 1Z6JT 5EU7E 4H8WC 5E9DA 1C5BL 1G9NL 2FGWH 4K3JH 3INUH 2GT9B 4I4WA 4HF5H 3TT3L 4KROD 5FCUH 5GRUL 1D6EB 2BC4A 4G8GD 4P3CH 2K3TA 3CSYA 1AR1D 3MRPA 5DJ6B 5JW3H 4K8RL 1MY5A 4K23L 1CLOH 1JUFB 2VLKA 1PW3A 3MUZ1 4PJ8A 3S37L 5HHQB 4MXWH 1AGCA 5CWSB 3WFDH 3VWJB 3ZMRA 5MENE 4HLJA 2XZCL 2WINA 4Y4HB 3LRSB 2ESVD 2VXQH 3DO7A 2HKHL 4ZUWA 1J18A 1MFCL 4ENEC 1OP5H 4R2GB 4LPVA 1P4BH 3BKJL 4OBSA 1O5DT 1XGUA 5I1JL 1V7NH 3MRCA 2XKNB 4RFNB 2HH0L 1HOCA 2HJFB 4POZD 4NWTH 2ENYA 4NN5B 3HNVL 5IVZA 4KTYA 3KR3L 5ERWA 5GGRA 5CBEA 5K93A 4M00A 2XQYG 5HGGS 3QI9C 3SEPA 3UJIL 4XBPB 4NZUL 4O2FA 1HWHB 2W0FB 5LWYH 3BSZH 3RVXC 1VESA 3BKMH 5JZ7C 3ULUL 3VXNA 4F2MB 1E4WH 1KCUL 3PNWA 3P4LA 1LHZA 5BO1L 1M7DA 1CE1L 5BMFL 3OR7B 4GG6B 3PGDA 4PV9A 3BVNA 3B9DA 3G6DL 4O58H 4X4YB 3P30H 1NEZG 4ZUVA 4XBGB 3QUKA 1DLFH 1S7UB 2HJLA 2BNRE 2DQFB 4TRPH 1FL5A 1T2JA 3ZTJH 2RJMA 5I1HH 4PJEB 4QHLA 3B5TA 3ZE1E 2MMXA 3NACH 5DHYB 2MCPL 2X70B 4I1NB 2A6JB 2ZSWB 1RJYA 1A6WH 4XVJL 1XGRB 3VXTB 4H1LH 2DYPB 3L3IA 4GRLA 4WGVB 5C0BD 5C0AA 1SVCP 5I8CB 4PJFA 2GI7A 4P0DA 5L8KB 4L8CB 1FFOA 1XIWA 5JHDB 2Q86B 3ARDB 5H94A 2O93L 1A9BB 2GAZB 4KAQH 4WJ5A 1IGTB 5B38B 1A2YB 3DVFA 4KMTH 3KYMB 3VCLB 4P5MB 2ZG2A 5HI4D 3GSQB 3BDXA 4AEHL 3ZDYF 3LAFA 5T1LA 1JYVA 2R2HB 4MS8C 2XRAH 5C07A 5DHVA 4WDIB 3PIQA 1F3DJ 3W0WE 2E6PA 3P4NA 4TUJA 5EZLB 2WK2A 5GJTL 4LFHG 3ZKMC 5HJ3A 3O81A 3G6AB 4GG8B 4X7TB 1H3PH 3LKRA 4LVHC 3RL1A 2FIRT 1NBVL 5DJ0B 1ZLWK 1MI5E 1JGUH 3JWOC 3TA3C 1JNLH 1CGSH 2PW2A 4KJYB 4TTDD 1FPTL 4J1UB 4MNHA 1X5JA 1LE5A 1Q1JH 3SJVB 3BP6B 3OGOE 2AXGB 4LU5L 4NUGH 4XVTL 1UM4H 2Q8BH 3SDXA 2AEQL 1OGAE 5F70A 5KSAB 1D9KA 5MI0B 3ARVA 3ILPA 3QZWB 4OZIA 2PR4L 2P8MB 2FBOJ 1KJ2A 1OY3B 3H42L 4FFZL 1HYSC 2DLEA 4F58H 3AS2A 1G6RA 4NZTL 3PV6B 3BP4B 4FQCH 1M71B 4LHUB 1S7RA 1YEIL 1SEQL 3DRQA 1UM6L 1J12A 4AG4L 3KPLA 1KB9K 4X9HA 5DQJB 4RA0C 3FCTA 3ARQA 3OKOB 4JZNB 3VMOA 2YZ8A 3E6FA 1FVEA 3DROB 4O2EA 3DV6A 3HC0A 4BH7B 4MDIA 5DQDH 3SQOH 3EOTH 4OLZL 4Q58C 2BP3A 4OUOA 5A40E 3CVHB 3NIDF 1F13A 2F54D 2F19H 5MERA 3C5ZB 2F15A 1S3KL 1A8JH 4WI5A 1HZHL 3G5VA 2B4CH 5IFHH 4JFOA 4HXBH 4LSTH 3LCYA 4KK9C 1QUNA 5I2IB 3FL7A 1I1AD 4YPJA 4MZ2A 5JQ6H 2HFEB 3LKQA 1WLHA 4OM0L 1N5YL 2OYPA 1C08B 3QH3B 4O5LH 4ZS6D 3RX5A 4JPVH 4MX7A 4XXCA 1JMXA 4WI4A 4QKXB 5A43C 1T7VA 5E8NA 5IFAH 2BNQD 1EA9C 3H9SA 5ESVA 1MREH 2EKJA 1MCOH 3O4LD 4BYHA 1DBBH 3B6SA 3NCYP 3RVVD 1NCNA 5ENWB 5JXAL 3CCHB 3BZ4A 4UQ2B 4RIRB 3R4DA 5FIEA 3QIBC 4U6HA 4S1RH 4DUWA 1DQML 5E6ID 2DLFL 1CF8L 2RGSA 4J12A 3WXWH 4WFEE 3VFRB 4YWGH 3PDGA 3U6RB 1M7IA 5C86A 4HS6B 5GS3A 3X3FH 1WVZA 1CR9L 3UTSD 2FD6H 3FQWA 1GIGH 4JCMA 5I8KL 5IQ7H 1IAKB 5K9KA 3V4VL 4F3FA 4KJWD 4HW6A 1QYGL 3WMSA 5DC0A 5E2WL 1I8MA 3IDGB 3QXAA 4P4KA 2X42A 1E6JL 1SVZA 4CVZA 4WI7A 4WWKB 2IMNA 2ZCKH 3GMQA 5F72S 1RIHL 3EHBD 1J8KA 1P1ZB 5B38G 4JAMA 3HRZB 1P7KA 1GZQB 3MGAA 3C60A 3HTLX 3EJJX 2EXWC 3AU1A 3BYTA 4MJIE 4AEIH 4WUKL 3N85L 5HHNA 1ZMYA 5GXBB 4WEBH 3FO2A 3VXUB 4WHDA 1RJZA 4HT1L 4G7VH 5FKPA 3DGCR 4R4FH 2J12B 1BHGA 2VLMD 4B41A 4RGOL 4Y1AD 3N50A 3DLQR 3WL9B 4PJIA 2VUYA 3EFFB 2EDFA 4LSDA 1A3RH 3DPBA 4GOSA 5M95B 1KGCD 5GGUA 3OB8A 3W0WB 3WXVH 2QR0A 4G9FD 1E4KC 5GRUH 1BQHA 2J8OA 1VFMA 5EBWB 5D71H 1ZLWH 2Z91A 2J4WH 3FRPA 4JQIH 3H8NA 5L6YL 2OTUA 4PGZA 2CDGB 1MIMH 1MI5B 3GSNB 1JHLH 4Z7VE 5D1QC 1N59A 3QJFB 2X4RA 1K85A 3RIFK 2R1WB 3L1OL 3IJSA 4NO3B 3KPSD 1CLZH 4PJHF 5E8EB 4BFEA 3ISWA 4DN4H 3QUMH 4BQCA 2HVKA 5FGCE 4XXDA 4Y8DC 3MV7E 1DLHB 5MI0C 1H3GA 1VFOA 3LRHA 4MMZC 4NN7C 4CUCA 3NN8A 4PJXB 3UAJD 1NQBA 5I9QB 3QEQD 3BDYH 5CEZH 4JGUA 1QRNE 1WZ1H 3IS1X 4R4ND 5C09D 4KGJA 2H26B 3QULB 3OKYA 3QSKB 5JIHA 3UJIH 3TCLA 1L7TH 3BXNA 5GSVB 4DW2H 3HCVB 4QHKI 1AY1H 4JO4H 4KKAD 4XNYH 2BVQB 2GTWA 4E41B 2WQ8A 1YN6B 2D31B 5FUCC 2NXZD 2R2CA 1CVSC 3RAJL 4G5ZL 1TZHB 4K7FB 1MCLA 4M7LT 3D2UD 4EDXB 3FONA 2NY0B 3QUZB 5IW6A 3SDCC 1I3RB 1S5HB 4JRWA 1YY9D 3N06B 2QADB 1YY8B 1INDL 2X4SA 4NQSA 3LDBC 3I75A 3T3ME 2VZUA 4YDLB 5BZDA 2X44D 4WI8A 3AS0A 5FOBB 4HX1B 5SWSA 1A0QL 1F02I 4X6EB 2DN7A 1D7FA 3OR6A 5C0GA 2EZ0D 5ID1A 3HI1A 3B2UC 4HGWA 1J7VR 5CD5C 2KH2B 4WCYH 3PGCA 1FN4B 2CJUL 7FABH 2DJ4A 3FQXB 5FHAL 5H37G 2W0PA 3SDAC 4FQ1L 1G7LB 2DQJL 4UTAH 3QHFL 1J88A 3WUZA 4KI5C 4HHAB 1I9JH 4OF0A 2AW2A 2X4TB 5I1IH 5FO7A 1CICB 4HCRH 5CEZE 4I3SL 4RRPA 1U8IB 3HI5H 2VN4A 1RMFL 2X1XR 4M3JA 1FH5H 1KCRL 5H2BB 4AEHH 4LF3A 2ADFL 2BZDA 3NZ8B 3ZYIA 4LAQH 5IB1A 5C6TL 5INDA 4XRCA 4L8SB 4AM0A 4WWKC 5IEHB 3H0TB 4MA1C 2R2EB 2FGZA 4OZ4A 2XXMB 1EXUA 4U3XA 1NC2B 3BH9B 4HS8L 4PJ8D 5GJTH 1YMMD 1FVCA 3BH8A 1Q0YL 4GAGL 3OZ9L 3BDBA 4MJIB 1NBVH 2J8UE 1F58H 4TNVF 2NLJB 3AXLA 3VFPA 1QFPA 3MNWA 1E27B 3RPKA 1G7HA 2BFVL 3DX6B 3EOBB 3I9GL 4LPTA 1Q9WB 4LU5H 5LBSH 4XVTH 3O41A 1MQKH 2DKUA 3B9KA 5IIEA 5CJBA 4JHZA 4O00A 4MAUL 4HG4J 4HWBL 1OAUH 4XWOD 4ISVA 5D1ZA 4KTEH 3BMVA 2VB5A 4HZLB 3WHXA 2HTKD 1T1YB 1V5JA 4JPKL 3AREB 5CBAB 4XP5L 3FJTA 3VGDA 4NZTH 1YEHH 1T83C 2H32B 4L1HA 4MXVE 1ED3A 4RGNE 4YBLC 4EI5A 2Z4QA 1SEQH 3IDIA 1BBJB 4ZUSB 1N7ML 4Z7VB 1ZLUK 4NQDA 1D5IH 1ZT1B 1KXVC 3ARBB 5DI8A 2KL6A 3TWCL 1BJ1H 1OTTD 4Y88A 4LLWB 3QG6A 1X6NA 1DSFH 4UINL 5DWUL 4HUKB 4H1LG 5CCKH 1S7TB 4IM8A 4OLZH 5H35B 4K3DH 4JGMA 1LEKA 1N4XH 5FGCB 5GS0D 4HDIA 4WHTA 1RV6X 2VABB 3MV7B 2QLVB 4H5SA 4F7PB 3VFGH 3G08B 1CIUA 4LCUB 5I9QC 3QQ9C 2YPLD 1P6FA 3VI4E 3V4UH 4XAKE 2IAND 1QRNB 1BFOB 3GSWA 4LPUA 2AV1A 5AZEL 3MRNA 3C6LC 32C2B 3S35L 3PXJA 4GRLD 1SM3H 2YPKA 4KPHL 3BD5A 1KJ3H 5LGKA 1WZMA 2DI7A 4P2QA 1XAUA 4NN6B 4UTBL 3LIZL 4C83B 4JM4L 4BK4A 2ED7A 2V5YA 5EH1A 1FZOB 5D7JC 4X80L 1J86A 4M7LH 1YYMH 3CH8A 4XHJD 2NY0C 3BPNB 1RUPH 3LSOA 4PJDF 4D8PA 1VSCA 4IOIB 1DBAL 3EYVA 3TNNA 2DLFH 4P46C 3QDAA 4ZUUA 2QADC 2JF1A 4LKXB 4ZTPH 5DYOA 3RY6A 5JMOC 1EEYA 3HB3D 5FF6A 5IQ9B 3JTSB 3JV4A 1YQ2A 1CS6A 2Z0BA 2F5AL 3D39E 3MJGX 3DARA 2DIAA 4J3WA 4NQCE 5HI5D 5EOTA 4PRHD 5TE6L 2EDWA 3V4VH 1J1PL 5LQBL 1QYGH 3PL6D 2X9YA 1NGQL 3DWTA 2FSEA 2QQKL 5TDNA 5D2LA 1J1XL 4QOKE 4MA7H 1W0VB 1RIHH 3MV8B 5D5MA 5D7SL 3QUMB 1QVOA 1WBYA 1H3TA 2FBJH 1XR9A 1QSFB 3ULVD 1FZJB 5DD0L 1Q9KB 1D9KD 3P0VL 4GW5B 4RCAA 3U36A 1FVDA 5C08A 2DIJA 3DXAA 3U7YL 2XKUA 3O11A 3RWJA 4ZD3H 5F7FA 4R4BB 5E8OA 2FJFB 3U4EA 3EOAB 2FB4H 4HT1H 5B4MD 4NKMB 2DQIL 2NW2B 4ODSH 4UDUA 1JNNH 3LVEA 2V2TA 4CADB 1UXWA 1I3GH 3FT3A 2MPAL 4MQ7B 1HXYB 1WQVT 3G5YA 1K4DA 1FG2A 4QXWA 1EGJL 1UACL 3DX7B 1TJHH 3MR9B 2H1PH 3LQAL 5GGTA 1QBBA 4QCIB 1U8PB 3RVWD 5IJVB 1K2DA 2APFA 2GK0A 2HJKA 4LK4A 4Q74A 5AG9A 3VXMD 2AJZB 4TVPD 2YBRB 4OLUL 5BOPA 3DI3B 4TULL 4U05A 2OCFD 1MUJA 5ANMB 4BSJA 1QFWI 1T1XB 2ZUSA 3MFGB 3LQZB 5K9JL 1WAAA 5J1AA 5J1TC 3I6KB 3EDFA 3VFMB 1N8ZB 4PRIA 5T3XL 2JCCE 4JY5L 3BISA 1KG0A 2QEJA 4WUUE 5IVXF 2VOTA 2YEZA 4Z6AT 1NEUA 4O02H 2QQLL 4ONHB 4KRPD 5JW4Q 3O9WA 1R3IH 4YIQA 1E28B 3GDBA 4FXKB 2V9TA 4PRBB 1UM5H 4OI7A 3PWUB 1KBGL 5JPMA 1CI5A 1ZLUH 4OZGB 4NQEB 1B3JA 4TQEH 3ARBC 1P7HL 3MXVH 1F4YL 4GFTB 2YR3A 3DTXB 2NMSA 3Q6GH 4CL7A 4PGJA 4MD5B 5TDOA 1ZHKB 2Z31B 4WI3A 5L88L 5B3JE 2V6HA 1X5YA 4NFBA 1MAMH 3OG6B 5FM8A 1NDMB 4GKSA 4KK8C 4M48H 4RNRB 1INDH 1CU4H 4BSWB 3WS6A 1OF2A 1ZSDA 4Z9KB 4LCIL 1PJ9A 4I0PD 4IJ3B 3VD5A 3RIAK 4KFZC 5DR5H 4N90E 3NIFE 5J9PB 1BIHA 2AJ3A 4HC1A 4JE4B 5IK3A 3PP4H 4XI5D 3DIFB 3VW3L 3TC9A 1BEYL 3CFCL 3VH8B 2ZJSL 3ZDXF 2XTJE 1NUDA 4ODWB 3QRGL 4UUJA 4GMTL 1FNSH 4OV5B 5ABDE 5IWLC 3HI6H 2OJZL 5IB3B 5I1KH 1MCQA 1ACZA 3BQUC 1G9NC 4WW2A 4EN3D 2FZ3B 2WWMD 1KEGL 1RVFL 5E08L 2DMCA 1RMFH 4NQCB 4NWUH 2YUXA 1T6VN 1PQZA 3QXVA 5HGHB 1MELA 1MH5B 4G8EA 2PCPA 3QDME 2X4NB 4K8RC 4HXAL 4MNQE 4EIZC 4QOKB 1MCCA 2ADGA 4AT6B 1QFOA 3KYNA 3TBWA 1S5IH 3RVUC 1W0YT 5IBTL 3FO9A 1W72H 1JNHB 1K8IB 5BVPH 2YD6A 2UZIH 4GAGH 4HEME 1P5VA 3TVMA 1HI6B 2R9HD 3P4MA 2XPGA 3MLVL 1JN6B 9CGTA 2GJ6E 3U0WL 5F89B 3CPLA 4FXLA 1TPXB 3JV6A 3C9NA 5I0DA 2VC2L 1GOHA 3T08A 5B39A 5FYJL 2O5XL 2J88H 3QIUC 1VKXB 4MNGA 3E8UH 3WSQL 4UV7H 4WO4B 3ZKNC 4A6YA 1YQVL 4PGCA 1UQSB 1D5MA 4P5TB 3TT1H 4LLUB 1S9WA 1ZHBB 3CDGB 5JLZA 4ZFFB 3IKKA 3ULUC 3X13B 4NHCL 1OGAD 3OMZA 3FRUB 3N1PC 4KJQC 4RFEA 4N8CL 1T0MB 2VIRB 3CFKA 3TO2A 5GGSB 3KWWB 4XP5H 4KQ3L 2KBGA 2LTQC 2VMFA 4YH6A 4FRWA 5B8CB 3LKNB 2ARJB 4PV8A 4Q9RH 1QRKA 6CGTA 3WJJC 3CFIC 1CE6B 2ORBL 4JN2A 2VQTA 4ZXBB 2UVFA 3IAGC 4X9GA 1B0WA 3TWCH 5BRZA 4XB7A 2MFNA 2ERJC 2VERN 4DKFH 2YOCA 1B2WH 2Y4SA 3UTQB 5C0CD 4JFDA 3H7BB 4CW1A 5JR1H 4XZUB 5I17A 2AV7B 2JCCB 4LCWB 1T20A 2IMMA 4WUUB 4B53A 1TVHB 1G9ML 5E00A 2OXHA 4ZS7H 2AAVA 2L4OA 4PJAE 3UTTE 1DVFB 4FQQB 3ZE2F 5FO8A 3VMNA 2OR7A 3G5XA 3WN5A 4RAHA 2V9QA 3GK8H 3KPRB 4G7YH 3QQ4B 5CJ8A 1YEFL 1G0XA 2ADJA 3EYUL 5DC9B 3MRJB 3DYMA 4DZ8A 1V05A 1IGJA 3QIWA 4D9QD 4DCQB 4HIXH 5ACMA 3KAAA 5C0RH 3MYJA 2N1KA 2X5PA 2Z31C 3VFOB 2UY7A 3QDGD 4JRYE 5SV4A 4N0UA 3ULSB 4HWEH 2Y7QA 5JDSA 5HHVH 5D93B 4X4XA 1NBZB 4LNRA 3OKEB 2Y6SD 4HIHA 2GITB 4YR6A 1JRHH 4G6ML 4P2OC 1HSAB 4S1QL 1IM9B 2ICEA 3HR5A 1LE9B 4QWWD 3FO0L 1J1PH 8FABA 4R26H 5LQBH 1NGQH 1T21B 1AJ7L 4G8FB 2I07B 4A2MA 4D0CB 1J1XH 4IDLA 3IJHA 3TN0A 1U8OA 3RNQA 2XTJB 3KS0J 2DM2A 3PWJB 3K1KC 4HZAA 2O5YH 4PLNC 4U31A 5DD0H 4XNMB 3P0VH 1PKQB 4BA8A 3K81A 1T7XA 4M6MH 2GCYA 1NCAL 4AL8H 4N1CA 1NC4A 4U1JB 2EDDA 3BT2L 2VDNH 5I1DB 2R29L 2W38A 3QXTA 1XF4A 4F7MB 1RFDH 5J89A 5DGRA 4L29A 3U9UB 1I7RB 3IFOB 3FQUB 5DJ2A 2X4OA 1PSKH 5JOFA 3EJZC 5AUMB 2EIDA 3NH7L 1NLDH 3LMJH 4D3CH 5I73B 1EGJH 4NQDD 1CT8A 1NCDH 2PO6B 1VACB 3SE8H 3BZEB 3W9EB 1KJVA 1CDUA 4C58B 2BK8A 3VFWB 2H2PD 4H88H 3V52L 4X5WB 5IROC 1LO2H 5J11B 5ICZB 2F53D 2VLRA 1FL3B 1JP5A 2FO1A 5ADPL 3TO4D 2GJ6B 4M6AA 2C3VB 2EYRA 4U1GB 4ZAKA 1H8OA 4ELKA 1TPXC 1FNLA 2E5EA 4L3EE 4I2XA 3LB6C 1INEL 4V1DA 4OM1L 1NFKA 1UZ6E 4YHKL 2ICWB 2D4FA 4WO4C 5F1OB 5DZNA 4DK6A 1BPVA 4Y2DD 4P5TC 5T3XH 4GSDH 4YEEA 3ARFC 4JY5H 5F1NB 4H26B 5D7LD 3GM0A 5HYJA 2DF3A 1D6VL 1OAZL 1KIPB 3C5SB 4HUUB 4OIBA 2QQLH 2YD1A 5GRVK 2NNAB 1OSPH 3I6GA 3A6BL 3PUCA 3HUJE 5HI3C 1JK8B 4PRDB 1A5FH 2NR6D 2PKDA 3QO1B 3NCJH 4NKIL 4PJ9C 1YPZA 2IQAB 1K6QH 1UA6H 5CSZB 3ULVF 2A38A 4F15B 1C5DB 2DLTA 5ALCL 3T65A 5B8CC 3X11A 1FORL 1MJ8H 1OAQL 1J5OH 1BFTA 1D5BB 1ZHLB 3MA9L 3GMNA 4ZXBC 3OKMB 5ESAA 3ARSA 4UV4L 5A2KH 4PP1D 5FM5M 4WI2A 4R96B 2C1PB 1P2CB 5FYLD 5HGAB 3CDFA 4IHOB 1RUMH 2O26U 1EV2E 4NNYA 2XI9A 2DB8A 2R4SH 4PTUA 4FZEL 4MSWB 2CLZA 3QHZH 1OSZA 1W72B 5D2NA 2G2RB 3BZFA 3LZFH 3MBEC 35C8L 2OJEB 3NZHL 2IFGA 3S35X 2JIXD 2B1HH 3G04A 4ODUB 4G42B 4QRRE 1WZLA 3RZWA 4NP4L 5KZCD 3VGHA 4NPYA 2RQ8A 2BVPB 3QUYD 1Z0MA 4JRYB 1FYHB 3RDTC 3EYFB 3P3YA 1JV5B 3MQIA 4GMTH 3MRKA 1JFQL 4HV8B 4D9LH 2YD5A 5BXFB 2ZSVB 4FFYL 5CFHA 5I18L 5I1GL 4H25A 5T1KB 4X7FC 3HMXA 3CUPA 4M1DL 3RWDB 4PG9A 4HKXA 4JLRB 5E08H 2Q6WB 3UTZB 3D0LA 4X9IA 3L3DB 3MRDA 1G7MB 4C56E 3SKNA 5AWNH 5F6IB 5ALBH 4GRMA 4GW4B 2AJYL 2FHFA 1DQJB 1CXFA 4KMLB 5F9OH 1N6UA 3HE6C 4PRNB 4MAYD 2NY3C 2GT9A 3FOMB 1IEBB 4BH8B 4PRID 5SV3A 4QHKJ 4EDWL 5J06A 1KLFA 4PJ7B 1OP9A 4JDTH 5DJ6A 4M6OH 1X4XA 2R0LH 1JUFA 4PJ5E 4RAUB 3WSQH 1A21A 1CXIA 3IAPA 3MLSH 1BIIB 3NCFB 1OM3H 3RTQC 3SGKA 5HHQA 2DD8L 3JTTB 5CWSA 4ZO9A 5EOQH 2OL3L 3VWJA 4Y4HA 2MSPA 3MCLL 3LRSA 3L95B 2P46B 2C5DC 5GS2D 4PRPD 4MWFB 4CDHA 3NCEB 4R0LB 1C5CL 1UADC 4MQTB 4U4BA 4KI5E 5J11C 4LVNC 5E2VL 2HJFA 5IV2B 4OFYD 4UBDC 3VG0H 1ETZB 4XBPA 2W0FA 4L3EB 3SN6N 1C12B 5DJXB 4RWYL 4KK5C 1B0GB 1GRWA 4HJ0D 4NZRH 4F2MA 5JIPA 7CGTA 2UWEE 3QUXB 1GPOL 2OI9B 3MRGB 1ONQB 1AI1L 2FYYB 4J4PD 5DJZA 4GG6A 4FQHA 4X4YA 4YDVB 2AABH 3HUJB 2YD8A 4NZJA 4XBGA 2VXUL 3S34H 1JGLH 3MJ7B 4P2RA 1U8KB 1S7UA 3V0VB 2DQFA 4L8BB 4FP8L 1R3HA 4F15C 1HCFX 3MACH 2B8OT 4PJEA 1U93B 1KOAA 3WO4B 3VFTA 1UC6A 5DHYA 4Y19E 4ERSH 2X70A 1B4JL 5AYUH 2ZSWA 1DQDL 4NJ9L 1XGRA 1IAOB 3VXTA 3NBNA 5F7KC 1JI1A 2DYPA 4F57H 4DUXA 2R23B 1IKNA 4PY7B 1MAJA 5I8CA 3TV3L 2ZKHH 1MF2L 4Y5VA 1RULH 2P5ED 1U3YA 2YRLA 4L8CA 1DQTA 5JHDA 2Q86A 4X5LA 1MJUL 3ARDA 5FFLA 1F4XH 2OZ4H 4OCMC 1HHGB 2GAZA 5FEBA 4LVOB 5B38A 1A2YA 1MRDH 2D03L 2W1NA 3KYMA 3VCLA 3FO0H 4P5MA 4XPAH 3GSQA 5FECB 1UB6B 4R8WH 1DEEB 5DSCB 1G6RL 4QRRB 1Z9OA 3CMOH 3SO3B 2R2HA 5BS0E 1GGBL 4OCLC 1R5WB 2YN3A 3O6FB 4IMLB 1FGNL 4WDIA 4C4KT 3HAEH 3HHRB 4U6VH 2CDFB 5EZLA 4WY7L 1NGXA 5JPNB 3HNSH 4HSQA 2FLBT 4GRWB 3G6AA 2YA1A 4GG8A 4X7TA 4QNPF 2ZUTA 1NCAH 4IOFD 3CDYA 4EUPH 1WCQA 5DJ0A 1FO0H 3SCMD 3ALXA 5ITBL 5E4EB 4HUVB 4JY6B 4X4ZA 1IVLA 1BM3L 4KJYA 1KV3A 5EIIB 4WGWB 1U8QB 4J1UA 5D1XB 3PHOB 3SJVA 3BP6A 2AXGA 1F3DH 4IIQB 5KSAA 2ITCB 1QBLL 5MEOB 5DRXA 2IAMC 3KYKH 4WFFD 3QZWA 5AD0B 4ZOAA 5BRZD 5L0QB 1NANH 3WFBL 1CD0A 4N0RA 5E03A 3TJHD 1PLGL 4JFDD 4U7SA 3KHOA 5DUPL 2BHYA 4TUKH 3F7VA 3PV6A 3BP4A 3OKNB 5C0ND 1M71A 4LHUA 1IEHA 4N0CC 5HHOB 3OKOA 2EKSB 3QT2A 4JZNA 4WEMB 1NAMH 2Y06L 4P23D 1ZANH 4JM2D 4PP2B 3WIHH 3DROA 4GQ9H 4BH7A 2D4DA 3B5GA 1RU9L 4LVEA 1ZLSH 1SBBA 5ETUB 4UT6H 5K33A 1BGXH 3L7FB 5FDYA 3RUGE 4UIKH 3C5ZA 3BE1H 3IKCA 3SOBL 3S36H 4OF7A 4UIMB 3VXSE 1FIGL 2MKWA 3CVIL 4NKIH 3RKDD 2YMXH 4R0LC 3HG1D 5I2IA 1CGTA 1CVRA 3SY0A 2HFEA 5ALCH 2MJWA 1C08A 3QH3A 3FB7B 3KJ4B 3QJHB 3OKKB 4MA8H 3ETBF 1TVDA 1A6VL 3MYZA 2UWEB 2YKLL 1H9VA 1P7QD 4OTXL 5ENWA 3PGFH 2FH6A 2AQ3A 3CCHA 4UQ2A 4RIRA 2NY1C 5CJOL 1OT1A 3MJ6A 3UZEA 4FZEH 4JFQB 4LL9A 5TFSH 1MCBA 3U6RA 3VFRA 5CKAA 3AMKA 5HVHB 4HS6A 1MCPL 4FTVB 3TN0D 5HDBF 1U6AL 2BNRA 3D5OF 4FNLH 2AI0L 4YLQT 3NCYS 3NZHH 4WHCA 1DFBH 1IAKA 1DUZB 4I0KA 1ORQB 2YA0A 1OD9A 5TE4L 1NC4D 1AKJB 2B20A 5IHUH 3VI3F 4J3UA 4Y4KB 1AIFB 4WWKA 4J6RH 4GKOA 2FEEL 3MA7B 2YUWA 1XF2B 1MLBB 3HRZA 5JXEA 1GZQA 2R1YA 2OK0L 2XZAL 1OAKL 1TIUA 1BX2B 4KZDL 4ELME 4G9DB 3TYGL 5SWQB 3LQAC 1PZUB 3DNKA 1WTLA 1ZE3C 5I18H 5D6CB 1HCVA 2IPTH 3FAXA 1TQCC 3X3GL 4ENED 2JLLA 2R56H 3VXUA 3T4YB 3GSVB 1DBJH 3CGTA 4WRLA 1FBIL 5IHLB 1G6VK 2VH5L 5FM5O 3T1FB 1KN2L 5DURD 2AJYH 3QI9D 3QPQC 5DVNA 3RI5F 4JFXA 4ZAKD 2VXVL 3SO3C 4XCFH 3RVXD 3HPLB 4I18B 5JZ7D 4IRSC 5DHXB 1BD2D 3W0WA 4MNQD 3VXPA 3SGEH 1A14L 4EDWH 2C3XA 5EBWA 5HYJD 1NMAH 5IW3A 1OHQA 3I2CH 2VLJE 2CDGA 1JHKH 1MI5A 3GSNA 5MEPB 5E7FA 1EJOH 3QJFA 5HPMB 2J6EH 4JG0H 3T3MF 2R1WA 4HG4K 4X8XA 1IFHL 3MRBB 1XF1A 3EJYC 4NO3A 4R97B 3W39B 4JJ5B 4NQVB 2QSCL 5E8EA 3DURB 2VLLB 5IT2H 1DLHA 2A2QT 3T04D 5L2KE 4XVSL 4UNUA 1VPOH 2NY6B 2NY7H 4F9PC 4WIQA 2V2XB 2E7LC 3KLDA 3K4DA 4JQVC 2Z8SA 3EGSB 3GMOB 2H26A 1M05B 3QULA 3HLAB 3U9PL 4NO5B 5GSVA 3HCVA 4I3RH 3DUSA 3ARTA 3LPFA 2BVQA 4E41A 1UWXK 1YN6A 2D31A 2YD7A 4BFBD 5IBLC 4UT7L 3QA3B 2FNBA 1TZHA 4K7FA 4CN1A 3QUZA 1E4JA 3GBLA 2IADA 1I3RA 1S5HA 3EO9H 3REVA 1L7IL 1YY8A 2VWEC 4U1NB 4YXLL 1HHKB 3VXSB 2VXUH 4MS8D 3T0EE 2W60B 5LG1A 5K9QG 2DQUH 2RIKA 4LSSL 5FOBA 4HX1A 3CSBA 1NCWH 3M8OL 3R8BB 3ZHDA 4QXGL 4Z7UE 4YHYB 5DMIH 3UTTD 3ZKMD 3S8WA 1FNGA 4LSRL 2HRPH 4U0RB 1F2QA 1FO0B 3HC4H 1AO7E 2J8UF 1B4JH 3FQXA 5F71A 3TA3D 1HH6B 4C59B 4E0RB 2AS5M 5EN2B 4TN9A 4NC2B 5F1IB 1G7LA 1U8NB 1LEGB 2XFXB 1MF2H 1TVBB 2R4RH 1JYWA 4OCNC 1C16B 5HVHC 1BZQK 1CICA 3UDWC 4GUPB 2Q20A 1HYSD 1U8IA 2D03H 1DBKL 3DMMB 4MGXA 4GMSH 4C4KO 3VXRD 3MUJA 2W91A 1UJ3B 5H2BA 4XCYA 2GSGB 3NZ8A 4MXVF 2VDML 2JELL 1BECA 1ZAGA 2NW3B 4RISL 4L8SA 1KIQB 4TSAH 2AK4E 3H0TA 2LVCA 5IEHA 2R2EA 2X1OA 1H8NA 1FSKB 1NC2A 3BH9A 4WY7H 3EZ8A 1J05B 3D85B 2ATKB 3SDYH 2BDNL 2BHZA 3BIBX 1MY7A 1UZ8B 1JZ2A 4MJIA 5F3HB 1O7VA 1NCBL 5DRWB 2NLJA 5HHXL 4XP6L 2Q3ZA 5T3ZH 1R0AL 1E27A 3WUWG 1BQLH 1BAFL 2VE6A 3VI4F 3DX6A 3BRFA 3EOBA 4KK9D 4M7JL 1Q9WA 5GZOC 5IEKB 2EDKA 4LSVL 2FH8A 2X9WA 3G5ZB 5IBUB 3VWKB 1Q9OB 4RA3A 3WFBH 4HZLA 4L4VE 1ZGLP 2WLYA 4DQOH 1PLGH 1T1YA 2EYTB 5CZKA 4WFHE 3AREA 5CBAA 2YUZA 4QRPE 1G9MC 3S98A 5J1SC 3AS3A 3SKJH 1NUFA 3RWGB 1U3JA 4YXHL 2VKXA 3QIBD 3EZJB 4PJBE 4ZUSA 2VLJB 5T5NG 1I85C 4Z7VA 4Y4FC 1T1WB 2BRRH 1LP9F 1ZT1A 3GKWL 1AD0B 3GUTB 3C2AL 3OKLB 5GGVH 4LLWA 4KHTL 1QBML 4O4YL 2YD2A 1YN7B 1S7TA 4LARL 5EZOL 2C26A 2ENSA 4I4WB 5H35A 2CMRH 4ODXB 2VABA 2VL5B 3MV7A 4Z7WB 5L2KB 2YD3A 4DJMA 4F7PA 1OWWA 5C3TA 3MRPB 2NY6C 3CMGA 5CLWA 2HLAA 3RIFF 3CVIH 1QRNA 1BFOA 5DD1L 1N64H 3I3EA 3NFSH 5D4QA 5GGQL 4X5XB 1BFVH 32C2A 1CZ8H 1EZVY 2EXWD 3GO1L 1UWXH 2BMKB 6FABH 1FNFA 5H8DA 5T3ZE 1WC7A 4C83A 5JHDD 3OXRB 3HAEG 1FZOA 1OAXL 3OG4B 4OTXH 3MRCB 3ZE0E 1LK3H 4IOIA 1WV7T 3ECBA 5IVZB 2WBJB 5DVOA 1BBDH 4EUPG 5CJOH 4LKXA 2VZTA 3HMWH 1U6AH 3TBYB 2VJXA 4KRNA 5IQ9A 1QTYT 5K9OB 4OCXH 1P4LA 5GGTL 5IGXH 4X6DE 1QSEE 5J7CC 3T0VA 2W9EL 1AO7B 3MMEB 4XB8A 1CL7H 4JM2F 5D1QD 1RJLA 3ABZA 1W0VA 3IYLW 1YEDB 3MV8A 43C9B 3LN5B 3TIDB 1AC6A 3QUMA 4HUWB 4PJGE 3V0AC 2OL3B 2XZAH 1QSFA 1FZJA 1S7XB 5KSAD 1Q9KA 1H5BB 1U3HC 2PYEE 3STLB 2NX5B 4KUZL 4QHLB 4XP1H 2YK1L 3H2WA 4DFHA 1Z9SA 1A7NL 3MLYH 1U95B 4R4NC 3EOAA 5EC1B 4KQ4H 1IL1B 4NKMA 2LFGA 2NW2A 4CJ1A 4R90H 3KLAB 4CADA 1RY7B 4LHUD 4MQ7A 1HXYA 3UJTH 2VXVH 3V6OC 3KXFE 2JJWA 4C56D 1ZVSA 2APBA 3R1GH 1FFPB 3DX7A 3MR9A 3C08L 4LDLB 3CC5B 4ONFH 4IEFB 1U8PA 4RMRA 4HQQH 3LS5H 5IJVA 3T0DA 1A14H 1WCBB 1YY9C 5EA0L 4CMMB 5KVDL 3JWNC 5B3JF 3ZYZA 1RZFL 1NCTA 3BAEL 3A67L 4IRJA 5CJXA 5ANMA 3JUZA 4W70A 3LEVL 1LDPL 4Y5YB 3LQZA 3I6KA 4P4RB 3VFMA 2QSCH 1N8ZA 4UU9B 5HJ3B 3MRMB 3JVGC 4EBQL 3MLZL 3B2UD 3VWKC 4HUMB 4ONHA 5CD5D 5FYJU 1IGIH 2ITDB 1DBML 1G0DA 1WTGT 1E28A 1FYTE 2PW2B 3NPSC 4FXKA 3RZCC 5IM7B 4QRPB 1NGZB 3SDAD 3VG9B 1EHLH 4PRBA 4Z77B 4MNHB 2UY6A 2RR3A 1LE5B 4E42A 3HS0A 1XGYL 4URTB 4OZGA 3OF6D 1OP3K 2JJSC 4NC1C 3ILPB 4P2YA 2R0KL 4HCRA 3SKOB 1BOGB 4P59H 4Z0BH 3DTXA 4EKXA 3P11H 1GSMA 5LAXB 2VDPL 2XA8L 4L1DA 3BEVB 4MD5A 5EZJB 1ZHKA 1NCCH 1HNFA 1ORSB 4U7KA 1F42A 1NDMA 3CU7A 2CXGA 4RNRA 4YXKL 1SJEB 4JPWL 5D6DA 4DUVA 5ICYB 4LSQH 2EC9T 3K74B 4NO0A 1L9NA 5D70H 4TNWK 4YXLH 4BSWA 3L3GB 2CKBH 3U79A 4FFVC 5BV7L 4GXVH 1LD9B 4WWKD 3UPRB 2NY5L 4O9HL 2B2XL 4JFEE 5GRXG 5KSBF 5J9PA 4DGYH 3BZDA 4MVBC 1J8HD 2ZOKB 5F6HI 5I1EL 4U6XB 2PTUA 3DIFA 4WV1B 2WIMA 3G6JF 3BWAA 3VH8A 4M1CC 2DDQH 2AQ2A 4JO3H 1ES0B 4HPOL 4A6YL 2WBJC 2R8SH 4MX7B 4R7DB 4OV5A 4WTZA 1TXKA 1SJXA 2VR4A 1GHFL 5FYKD 2GFBB 3O3DA 2AJUL 5IB3A 1TZIB 5IMKB 2AVGA 5HDQL 3VDCA 3S88L 1EFXB 2FZ3A 3GIZH 3H9SB 5DEFB 3LQMA 2Y72A 2X40A 4NQCA 1FLRL 4X7DC 5HGHA 1IKFL 1PX4A 4UB0L 5E70A 3V5HB 3BKCL 1MH5A 2OXGA 2VDMH 1WEJL 3SDDB 2X4NA 5A1AA 1R24A 3ARUA 4L9DA 2ZCLH 4QOKA 4AT6A 1W0WB 2E3VA 1C1EL 2L0DA 1NBYB 2ZUVA 4XNXL 5ISZD 3BUTA 5IROA 1JNHA 5BS0D 1K8IA 2HN7B 2X4PB 1T1ZB 5GJSH 1JPTL 1F6LL 1HI6A 1MFEL 1H5BC 5HGBB 4F3FB 2AJXL 3O2DH 5F89A 5HHXH 2Y07H 5AYQA 3ZKXB 1IGFH 4NC0B 4P4KB 4TNVK 3QQ9D 5C9JB 5KS9E 1R0AH 4OCYL 1G84A 3WNKA 2HT4C 3EDDA 4M7JH 2XV6B 3GMQB 3OBAA 4PJAF 1VKXA 4WO4A 1HHHB 4JAMB 1P7KB 1UQSA 3GM8A 1CQYA 3C6LD 4LLUA 4GAYB 3C60B 1ZHBA 3CDGA 5F8QC 3RRQA 4Z7QF 2IBZX 4DWHA 4XNZB 4ZFFA 1RPQA 1XIWC 3X13A 4E41D 3FRUA 4OKDA 5IB2B 1T0MA 1NGPL 2WW8A 4EVNB 2F74B 2VIRA 2M26A 3I3DA 3Q1SL 1YNLH 2I5YH 5GGSA 4DKEL 2P5WB 3BGFC 1O0VA 3KWWA 1BFSA 4X7CC 3F5WB 4IDJL 2NY0D 4DGVL 4XBEL 2Z9TA 4H0HB 3LKNA 2ARJA 4UT9L 4P46D 4M4PA 2VDRL 2QADD 3T0WA 1JIBA 4ZXBA 5C6WH 4HFWB 1JTOA 5I0ZA 3D25B 1QR1B 4NNPH 3UTQA 5K9QI 1CDIA 2BY0A 4LARH 4XZUA 4EI6B 1G7IB 1HSBB 2AV7A 2JCCA 2G60L 4LCWA 5HI5C 2I60L 4WUUA 4LASH 4IRZL 1TVHA 4TYUA 2P8PB 2V7HB 3GKZA 1SEBB 1ZEAL 4X0KB 5DD1H 4YDIL 1FYTB 3DX9B 1DVFA 2YD9A 4FQQA 5GGQH 3VG9C 4HKJB 1D5ZB 2LV4A 3KPRA 2V5RA 3RX7A 5JTWA 1D9KC 4JB9L 1DDHB 1ITCA 1T7WA 4Z8FL 1J87A 2D0FA 4Y2OA 3B2VH 3NN8B 1GGTA 2D7QA 3MRJA 1GL4B 1RAMA 4DCQA 3GBNH 2BVOB 2DJUA 1IZJA 4Q7DA 3MREB 4MLSA 2EDTA 4KU1A 3N1MC 4IBLT 3B4NA 5FOJA 3PWNA 4ETYA 3ULSA 3CXHJ 3BXNB 5C0FB 2F8XC 5EU6E 2WIIA 1NBZA 5EUOF 4QY8B 2XICA 2E9BA 5TE7H 4C57C 2CLRA 4ZFGL 1QO3B 3LD8B 4JFEB 4JHAH 5INCB 1ZLVK 1HSAA 1IM9A 1LE9A 1BVZA 3B5HA 2W9EH 4BUGA 3RGVB 1MHCB 4HH8A 1T21A 4G8FA 2ZUXA 2I07A 3BKYH 4Z5RB 2A1WH 4D0CA 4Y0GA 1KACB 3TFKC 3PWJA 1UZ6F 4DOHB 4XPBH 2VDKL 4JRXE 4XNMA 1JWSA 2AEIT 4JVPA 4LLYB 3KVQA 4XXCC 3FN9A 4X9FA 4PJCE 4YQXL 2BRQA 2IFFH 4U1JA 3QNXB 5I1DA 4J3OC 4IS6B 2L7JA 1PDKA 4Z95H 3D3VB 3CU1A 5E6ZA 1L4IA 2R0WL 2WLZA 3BHBB 3U9UA 3MV9E 3KS0H 1I7RA 3IFOA 3FQUA 1PBYA 3QXUA 3OJVC 4WU7B 5AUMA 2VXTL 1JWUB 1IC5L 3GB7A 1NL0H 4F8QA 4Y7MA 4YJZL 4JDZB 5KTEH 2PO6A 4LDEB 3ARBD 5IKCB 3C08H 3W9EA 1EK3A 4OSUL 3VFWA 2EH8L 4X5WA 2EC8A 4OIIH 1JYXA 1KN4L 3HE7A 5KVDH 2OR9L 1FL3A 5L9DH 3G9AB 4LF3B 3A67H 2GJ6A 4KK8D 4NZDA 3I84A 1A22B 1GC1L 3LEVH 4P4KC 4LCCB 4XRCB 5LCVL 2W0KA 5CILL 2ICWA 4NKOA 3WEXB 4AENA 4M03A 4G8GE 3C60C 1EBAA 5F1NA 4H26A 3MLZH 1EUTA 2FECI 3C5SA 4NRZB 1KIPA 3F7RA 4HUUA 4OZHF 2ILLA 5HYSB 4YK4B 2NNAA 4LDOB 4MDJB 2D9CA 1E4XI 1JK8A 4PRDA 3QO1A 1UEMA 3U1SL 4AQ1B 5CSZA 1F6AB 4GBXB 5A16B 1RUAL 3BJ91 2ESVE 5KOMC 2A74B 4HPYH 4F8TA 1P53A 1D5BA 1ZHLA 2QL1A 2VUOA 3IF1B 4OLYL 3OKMA 5SWZD 3K2MC 3NA4A 3BQUD 2A77H 2AEWA 2VDPH 1UKSA 1AGFB 1I1CA 4R96A 1AE6H 2C1PA 1P2CA 5HGAA 3T0XA 1R5IB 3CXDL 4IHOA 3NVQA 3IDIB 1ZVHA 1MJ7L 1MCJA 1K4CB 1GZPB 3CSGA 4MQXC 4K8RD 3N9GH 5DMKB 5DI8B 5LGJB 3JWDH 4MSWA 4G3YH 4O9HH 3RVUD 1W72A 3MV8D 4K3GA 2G2RA 2DQDL 5JOEA 3O8XB 2OJEA 4WHTB 2O5ZL 4P9HC 4GT7A 4ODUA 4G42A 1OL0A 3D9AL 1MCHA 4XWGL 2YS4A 3GSWB 1KT2B 3A6CL 2AV1B 4OV6F 3QIUD 3RWCB 3PWPD 2BVPA 4OFVA 4JRYA 1K3ZA 3ZKND 3EYFA 1JV5A 2OQJB 1EHAA 4HV8A 1GHFH 1QD0A 2ZSVA 4FG6C 5BXFA 3ULUD 5HDQH 1II4E 3F65A 4KJQD 5FUOH 1ZLVH 5T1KA 4ZOBA 5C0BE 4JLRA 1RZKL 2Q6WA 3OSKA 5C7XL 2OP4L 2YXFA 3T77A 3UTZA 3CFDB 1IGMH 4KI5F 3L3DA 1G7MA 2AEPH 2PXYB 4CU8A 4ZUUB 3RNKB 1YJDC 3V79C 4GW4A 4L9LA 1CN4A 1HE7A 5DYOB 1CTNA 1EEYB 2AQ1A 5LKNA 3TJEH 1C1EH 5FF6B 1YDPB 4PRNA 1QFWL 4PJHB 1P5UA 3RL2A 3W9DA 2DBLL 3FOMA 1IEBA 4BH8A 3BPLB 2AK4D 5E95B 5F96H 2R69H 1JGVH 1S7SB 2VWEE 1ZGLA 1T2QH 2BXYA 1J0ZA 1GGCL 2YPVH 4PJ7A 1KTDB 5CP7B 3C5JB 3SGJA 3KYOB 2HT3C 4PB9H 4RAUA 5F9WB 1UYWL 5BZWB 1I9IH 1CK0L 1BIIA 5D5MB 3VD4A 4M3KB 4NQED 5AZ2L 4U1HB 2AP2A 4M43H 5DJCB 4YFEA 2DQGL 4OCRL 2D7PA 4OFKA 4DKEH 4RAVB 3O2VH 3ZL4L 4MWFA 3T2NL 4UDTA 3WDJA 2LVEA 3BJLA 1QOKA 1KEML 2FX9L 1PVHA 2Z31D 4KDWA 4UDUB 1OCWL 4JFPB 4X9BA 4PD4J 4DGVH 5IV2A 4XBEH 2A6IB 3FT3B 1QFWM 3S5LB 2HFFB 1ETZA 1DQLH 1QPPA 3G5YB 4L3EA 1C12A 5DJXA 3P73A 1NLBH 1JGDB 3V6ZB 1B0GA 5E6YA 4XCCH 4P3WA 4ZDHB 4S10A 2ATPB 3QUXA 4G8GB 5CEYA 2HJKB 1TNNA 3DECA 4P2OD 1ONQA 3VFUB 2FYYA 2P8LB 1JL8A 4XPFL 5DC4B 3TIEB 2B5IC 3ESUF 4YK4C 2YWYA 1WICA 4YDVA 3HUJA 1T7ZA 4LIQL 4YDIH 5DT1L 3MJ7A 3TBVB 1U8KA 3V0VA 2F54E 2PTVA 4GBXC 4L8BA 2Y36H 3F7QA 4Z76A 1F97A 4NM8H 3B9KC 2ESVB 2QTEA 5DJ8A 4X7SL 4MZ3A 1T03L 3CLFL 4GLRI 1BLNB 4OKVB 3U4AA 4LRIA 4WHYH 5D1ZC 5JW4N 3UCRA 4KDTA 4R9HA 4BQ9A 3DSFH 1UH2A 4CMHB 3PQYD 3JXAA 2R23A 4PY7A 3KHQA 4EI5C 2ZOLB 2BNQE 1EX0A 3EJZD 3BW9B 4R3SB 4JG1H 1EGJA 4AZ8A 5I71C 1YEJL 3O4LE 5L7XL 12E8H 2VZVA 5T5NF 3CFEB 3MRHB 3PP3K 1DZBA 3WFCL 1HHGA 1IRAY 3DVGB 5KSUB 5DRZB 4J23A 3RWFB 4JDVB 5FECA 1DEEA 5DSCA 3ROLB 3UTSE 5TGBB 4QRRA 1C7SA 5GSRB 1CBVH 1QLEH 3LB6D 2A9NL 1R5WA 1H3UA 3O6FA 4IMLA 1RHFA 2VZ3A 4N0YL 5JO5B 4WO4D 2CDFA 2J1KA 4OLVH 4KTDL 3STBA 5JPNA 4P5TD 1Q72L 5IVXE 3ARFD 1AGBB 1N5AB 1Q0XH 5ELIA 3ZO0A 3RUGF 1VGEL 1MWAL 4H0IA 4JQXA 4XMKH 3MCG1 3MODL 4TSBH 4HUVA 1YECH 1IGCH 4JY6A 4Q0XL 5HI3D 2XZZA 5DUBB 4G6JH 3O6ML 5D1XA 3BN3B 3PHOA 4FQXA 4UUJB 2HP4A 3FN3A 3IFNH 4IIQA 4B7LA 5IOPB 2ITCA 5MEOA 3T1WA 4OLWH 3RY6C 3KPPB 4ZXBD 5AD0A 4OSUH 1NPUA 4M9PA 5F7MC 4K55A 2CR6A 2VLME 2F58L 5CGTA 2E7LA 3KXFD 2P4AB 4Y1AE 4JQVA 4LSUH 1KN4H 3SO5A 1PQZB 1T22B 4LCWD 1IM3B 4QXTB 3SQBA 4KVCL 1JPGB 3OKNA 1KGCE 4K94L 4G8EB 3QO0B 5HHOA 1QR4A 3P2TA 5D7IE 2EKSA 2VNCA 4G9FE 4BZ1L 3P9LB 4FS0A 5CILH 5F9WC 4PP2A 2ZG1A 4K3JL 3INUL 5ETUA 3KPRD 3QWRA 3MBED 4HF5L 3L7FA 4TOYH 3U0PB 5FCUL 2FWOB 3STZA 2VN7A 5IFJB 3KPSE 3M1BB 2GTZB 4JZJB 4UIMA 3ZDXE 5JW3L 4I8DA 2B1AH 4PJDB 3U1SH 1CLOL 4GKZB 1BQUA 3SE9H 1S9WB 3RDTD 4L4JA 3FB7A 2M8XA 4MXWL 3H7LA 3QEQE 3WFDL 5JLZB 4DN3L 3QYCA 4OLYH 3DYPA 3OKKA 3QJHA 5HVGB 4RFEB 4ELMF 2VXQL 2UWEA 1VENA 1KULA 3NIGF 4YDKL 2ZNWA 1V7NL 2COQA 4OCSL 4NWTL 3QCUH 5GRYA 4PV8B 4JFFD 3BGMB 4JN2B 4JFQA 5LWYL 3BSZL 4G43B 4FTVA 3BKML 2JKXA 3HE6D 4YHZH 1E4WL 4HMCA 1HIMH 2NY3D 1JTPA 2DQDH 5BQ7B 1I7UB 1JZ3A 4P9MH 2IH1B 3RPIB 2WUCH 1NFDF 1ORQA 3D9AH 1Z2KA 1I1AB 3O9WC 3P30L 4Y19A 2HYMA 1AKJA 4P2CG 4Y4KA 4YNYB 1AIFA 4M8VA 3A6CH 3AY4C 3ZSTA 5E5RB 5T5FH 1HKLH 1DLFL 3G5XB 1HHIB 3MA7A 1XF2A 1MLBA 4KVNH 2CH8A 3RTQD 4U33A 5I1HL 3AAZA 4DVRH 3IFPB 3MGTB 5C2BL 2HLFC 3O4LB 5SWQA 1YNTB 3PP3H 2PO6D 1B6UA 1W8NA 3D69B 5D6CA 3NACL 5AG8A 1QNZL 1VFUA 1A6WL 2JJUA 4TSCH 5E6IB 3T4YA 1V3JA 1JCKA 4K9EH 3GSVA 5HHMB 4OF8A 2XZQH 4N0UB 5C6PB 4UBDD 2AJVH 3T1FA 4UI2A 3WS6C 5GISH 4KKCC 4NQXA 3OPZL 2Y9RT 2MKLC 4G6AC 3O3AB 4KK5D 3HPLA 4HBCH 4I18A 4HIHB 5GS0H 3CLEH 2DBLH 5J12C 4KAQL 1N6QH 5IVXB 3VGFA 4KMTL 3HR5B 1GGCH 3I3BA 5MEQB 5GHWH 3TLRA 1ZTXH 1SMOA 5MEPA 3ZE2E 1YMME 1ULVA 3T2QA 5HPMA 2GEEA 2FX7L 3MRBA 2FATH 3W39A 1WFOA 5FA4B 3E3QC 4NQVA 5IW1B 5KN5B 4XPGH 3DURA 3QWOB 4C55A 4FABL 5ITFB 2VLLA 4XMLH 4JREC 3K46A 4KRLB 1H3PL 2FCBA 5CZXC 4OCRH 1RUKL 4WW2C 1EEZB 1A6ZB 3ZL4H 1JGUL 2EICA 2V2XA 4Y1AB 1JNLL 1CGSL 3U48A 3EKCA 5EFIB 3QCTH 5JA8B 3EGSA 4AIZB 3GMOA 3VE0A 1Q1JL 3HLAA 1L0XA 2Q8BL 5C92A 5F6HJ 3R0NA 4KMQA 5BV7C 1Q8MA 4S1DC 2EEBA 1CT8B 4G9FB 3VGEA 1KIRB 2NY5C 2VDLH 3QNYB 4ZPTB 2OZ4A 4JKPH 3O0RL 1AC0A 5C3LD 4OUUB 4YHMH 5JUEH 3QA3A 4EEEA 1NSNH 4F58L 3H6JA 1KNOB 3TVMC 4FQCL 1OAYH 1X5XA 4U1NA 1HHKA 3VXSA 1EAPB 5DT1H 5I75B 3HAEA 3ULVH 2O61B 2W60A 5HD8C 2N7BA 4L4TD 2VO5A 5DQDL 3SQOL 4JKMA 4X7SH 3EOTL 5I74C 3CD4A 3DYOA 1T03H 5KSVB 3QEQB 4NUJB 2ZUQC 1KJ2H 2F19L 2IANE 1U2HA 1FO0A 5C09B 3UTPE 1RURH 5CJQL 4HXBL 1HH6A 4E0RA 1IEAB 1EHNA 5EN2A 4LSTL 2GJJA 5I30L 5C71A 2GYSA 3KLSA 5F1IA 5EO9B 4PJFE 3PF2A 3GJFK 1U8NA 1LEGA 2XFXA 2DTMH 2NXZB 4O5LL 5IHBA 4JPVL 1TVBA 1NEZB 4BM7A 3D2UB 3UZQA 5IFAL 4BQBA 1XZ0A 3C87A 4GUPA 4YO0B 3F12B 4YC2C 3N0PB 3GRWH 1MREL 1MCOL 4OQTL 3DMMA 4M7KL 1DBBL 3QDHA 1UJ3A 4N0CD 5C07E 4S1RL 5IMOB 3NGBB 4PJBF 3WXWL 1NAMA 2NW3A 4YWGL 1KIQA 4FQLH 3OAUL 3WIHA 4HIJB 3BOVA 4PRHE 2DL2A 3WN5C 5DMGC 2NTSP 3D85A 3VDBA 3QG7H 1GIGL 1UZ8A 5ADOH 5F3HA 1T0NB 1MWAH 2CUHA 1DQQB 3QIWC 4Q0XH 1CGYA 5TQ2L 3ULVE 2ZCKL 3QFJB 5EOCJ 2OMBA 1J1OH 5IB4B 5IEKA 5SX4I 2W65B 1WT5C 4OZIE 1BVKB 2A6DB 3G5ZA 3WYRA 3EO1B 8CGTA 3VWKA 1OW0A 1Q9OA 1EEQA 3MLUH 2L7UA 2I25N 2EYTA 3QUXD 3T09A 5DTFB 1VEOA 2ARJQ 4G7VL 4LRNH 3RWGA 1FC1A 3MRDB 4R4FL 3ZE0F 2NY1D 2WWKT 4WHYG 2VLJA 3MXWH 3MV11 1T1WA 1UXSA 4B7IA 3LEXB 1YMMB 1AD0A 3GUTA 1SYVB 3MLTB 1A3RL 3OKLA 1A6TB 4ZOEA 3VXME 4OBRA 1LILA 4ODHH 5H37H 5C0IB 3IDYC 4TVPE 3WXVL 1YN7A 3KPMA 4UAOB 4PLJC 4ODXA 4X6DF 2VL5A 4Z7WA 4NDMB 5D71L 5L2KA 2J4WL 4JQIL 4POUB 5J6GB 1MIML 1JHLL 5HPOA 4X7EC 1OQOA 4X5XA 1U8HA 5D96C 5FA3B 4F9LA 1CLZL 2XIDA 4GXUN 4DN4L 3QUML 4PJGF 1EERB 4DN3H 5E2TH 1AQKL 3BPOC 3GBMH 2BMKA 4XC1L 1J0HA 5FB8B 2XN9D 1X5KA 3BDYL 3OXRA 4UNVA 5CEZL 2UZYB 1WZ1L 4YDKH 1TTGA 3QDJB 3OHXB 2V7NA 5GGVY 2ZP0T 4OCSH 2DQCH 2WBJA 1TMCB 4LBEB 1L7TL 4ZAKC 4DW2L 3QPQD 1AY1L 4JO4L 3C8HA 4XNYL 1IE5A 3TYFA 1HINH 2NY2B 2WUBH 3CH1B 3T0EA 3TBYA 5I75C 4JVWA 4IRSD 5K9OA 1PY4A 4R6UA 5HDOA 2XOTA 5T3XD 1Z5LB 3IXAB 2W92A 4Z7UA 3W11C 1MFDH 5DJZB 2YPLB 5E1HB 1X3DA 2IANB 4FQHB 2QV2A 1AO7A 1RHHB 3MMEA 3GZKA 2DQTH 4P2RB 3GJFH 2KDGA 4L8DB 3WE6B 1YEDA 5EZIH 43C9A 5D8JH 3LN5A 3TIDA 3EJYD 1R3HB 1MVUA 4HUWA 4XH2B 1Q38A 5J13B 2OL3A 5C2BH 1S7XA 4YUEH 1X4ZA 1H5BA 3UPAA 3STLA 2NX5A 1VA9A 3VFTB 1JZ5A 2P45B 4UNTA 4WCYL 3C09B 7FABL 5EO0B 3H9YA 1QNZH 4BZ2H 3WKNA 3TZVB 1U95A 5EC1A 1IL1A 4X8JB 1I75A 4W81A 3KLAA 4PJIE 4UTAL 1GC1C 2HMID 2GHWB 3P0YH 1BF2A 4Y5VB 5HHOD 3OPZH 4LGRB 3QEHA 3RI5K 3BN9C 1I9JL 2VZOA 1FFPA 2R39A 5I1IL 3CC5A 4NO2B 4PB0H 4HCRL 5IBLD 5D2NC 2GJZB 3PL6B 1KLGB 4M61B 5FO9B 3HI5L 3QWRD 4NOFA 1WCBA 2NXYB 5DEZA 1FH5L 4CMMA 3FO1A 3EUUA 3E1F1 1FIEA 1ZS8B 4OLXH 4LAQL 2XWJB 4NRYB 4LLAA 1ODAA 4Y5YA 2VL4A 3FFCD 3HKFA 2FX7H 1G7QB 4P4RA 1NGXB 4NBXB 1KCVH 4FABH 2V5MA 5J8OA 2GY7B 4UU9A 1KF9B 1LO3H 3MRMA 2IBZY 2XWTA 4JN1H 4YHPB 1V3LA 1F58L 1RUKH 2H41A 2ITDA 2J5LC 4K7PY 2XG4A 1KC5H 1RZ8A 4QRPA 1NGZA 5IM7A 4Z77A 5LBSL 1MQKL 5DRXB 1OAUL 4U6YB 3SKOA 4KTEL 1BOGA 1F8TL 3O0RH 3VXMB 5LAXA 3I6LD 3BGAA 4S0TD 3BEVA 5EZJA 4I48B 5FGBA 3WJLA 3V95A 2XQBH 1ORSA 3F7VB 2OLDA 1YEHL 2X7LA 1I1RA 5ICYA 1SJEA 3GFUA 3L3GA 2X89A 4PBWD 5C0CE 4OGZA 3K1DA 1D5IL 1MFBH 3D18B 5FYJD 1LD9A 3UPRA 5DLML 1DSFL 2DIBA 5LGHH 5CCKL 4KRPB 3C6SB 3SGKC 4QNPE 2FR4B 4K3DL 5D9SB 1N4XL 5MENB 3VWJC 1MWAB 4BELD 1IARB 4Y4HC 3IKCB 2ZOKA 1QSZA 4NFDA 3VFGL 2DMKA 4U6XA 4K3HA 1RZKC 4WV1A 1T80A 1WWBX 5CJQH 2NZIA 3UROR 3P9WB 5KS9F 4R2GC 3V4UL 1A3LL 5I30H 1NBQA 2YHGA 2PETA 3CXHK 3MRRB 4GAJH 3SY0B 1ES0A 4RFNC 3EYQC 5GZOD 4NN5C 1SM3L 1KJ3L 2K9UA 4D9QE 1KYOJ 3AB0B 1TITA 4R7DA 1H3WM 2GFBA 2GK2A 5IMKA 1TZIA 2NY2C 3T4AB 3VGAB 1EFXA 1XH3A 3QDGE 3A0OA 5DEFA 2HAZA 2P7TB 5KJRH 4OQTH 4M7KH 3L3OB 1QSEA 2CIIA 1EAJA 2C3GA 4M7LL 1YYML 1RUPL 2EEDA 3V5HA 2VRAA 4I0PB 3SDDA 3FQRB 4Y4FD 4ZTPL 3UYOD 1RIVH 4QHNA 1ZKAA 3OAUH 1W0WA 1WJ3A 4ZFZB 2BNRB 1NBYA 3WV0A 1N3NB 1M4KA 2HN7A 2X4PA 4QTIH 4CU7A 1T1ZA 4YHLH 5DGQA 2PYEA 5HGBA 4V2BA 2BJMH 4Z0XB 5I15H 5DD5L 3GHBH 2NY6D 5C9JA 4QRSA 2ZCHL 5TQ2H 4MA7L 3TZVC 1L0QA 3BUYB 1GYAA 1NCUA 1U8JB 5F3BB 1HHHA 1IKNC 4GAYA 2R1YB 3T3PE 2FBJL 2BSED 4EN3B 4Y5VC 4NGHH 2FEDC 2WWKO 5KVGH 5FYLH 3ARDC 5IB2A 5GS1B 3LH2H 4EVNA 2F74A 4LQFH 4ZD3L 4FZ8H 2P5WA 2FB4L 1RZJC 3F5WA 4ODSL 4NQDE 1JNNL 1S8DB 2NXYC 1B6DA 3EAKA 1I3GL 1XGTB 3MRLA 4JFXB 4M02A 4GS7B 2WNGA 4RZCB 5HDBE 3RA7L 2G5BB 4HFWA 3ZYOA 5JHLH 1TJHL 3D25A 2F53E 2H1PL 1QR1A 1H15A 3VXPB 4EI6A 1G7IA 1HSBA 1ZWIB 3FMGH 5D72H 2F9BT 2P8PA 3VI3E 1HQ4B 2V7HA 4K71B 1WIUA 5FDWB 1SEBA 4FN0A 3AVEA 1CLYL 4X0KA 2R15A 1FYTA 3DX9A 3GJFB 2MQ3A 5D7LE 4JFZH 4HKJA 1D5ZA 4J8RB 1XGQA 1OGAB 5DZOA 4GO6B 3EDJA 2BY1A 5KSAC 4PLOB 1AQKH 4AYFA 2H6PA 1DDHA 4P48A 1U3HD 4UQ3B 4XC1H 3ZKSD 1CYGA 4O02L 4S1SH 4PJCF 3V6BR 5EU7C 3TNMB 4ONGL 1R3IL 1VEPA 4F37F 2BVOA 3LPGA 4KGLA 3V7AE 2EDJA 3GSXB 3MREA 3S3JA 5DDHA 4H1LB 1S9XB 1UM5L 1WFNA 4I9WD 2D2OA 4YEFA 3RWEB 3DUSB 4HK0B 3B9VA 5C0CB 5C0FA 1VERA 2CRIA 3REWB 4TQEL 4QY8A 3K8LA 3WLBB 3MXVL 5FYLE 1QO3A 3Q6GL 4JFEA 5DFVC 4XC3H 5INCA 1AR2A