2X1XR

Crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2 in a tetragonal crystal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
201
Chain Sequence
b'RSPFIASDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINSYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR C
publication title Structural Determinants of Growth Factor Binding and Specificity by Vegf Receptor 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/signaling protein
total genus 35
structure length 201
sequence length 205
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1xR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1xR01
4CJ0A 1JFQH 2OM5A 4V2CB 5J8OA 4PB9H 2XFXB 4FMKA 2IMNA 2X42A 2YA1A 2FGWH 1G0XA 3R06B 5IBUG 3IDIB 43C9B 1LDPL 1NCDH 5AEAA 4BFGA 5JQ6L 2YA0A 4U33A 2XG5A 4FNLH 1Z5LB 3UPAA 3AS0A 3AS2A 5B3NA 1JZ4A 3FZUD 3X11A 1X5YA 3BN9D 2F5AH 5HHXL 3B8YA 3S37L 1N6QL 1OGTB 5CZXC 3W2DL 1T83A 1N5YL 3DMMA 2OBGA 1AQKL 3GGWB 3O8XA 3DUSA 3MREA 3Q1SH 1F90H 5DRZA 4KMTL 5JXED 4MDJB 2I60H 4R4ND 2Z0BA 4IIQA 2H32A 2Z9TA 2HA1A 3S3SA 1CLZL 1VEPA 2HLFD 4JRWA 4DWHA 5DUBB 1BFSA 3HRZA 3V6FB 5E7BA 4MNGE 3U2SB 4DW2H 2RHEA 3C5ZD 4YC2B 1SJHB 3KS0J 2PNDA 3G6AB 3GK8H 4OCMC 4P5MB 5JHDD 4JG0L 2YUVA 4XB7A 1MFNA 3SE9H 3FQXA 1T7ZA 3RY6C 4Y16C 3TO4C 2HT2D 4U6YA 3QUZC 3HNVL 2D4FA 2C9AA 2PXYD 4MS8C 4JLRB 4XMLL 3I9GH 2CO7B 5DD6B 2VYRE 1KJ3H 5IJVB 3DV4B 4S1DC 1HXMA 1JGVL 3QIUB 2DIJA 2QHLA 3OXSB 3MA9L 1YEFL 3JVGA 1YN6B 5DUPL 1S9YA 4H88L 3ULUE 2NY0C 3L5XL 4J4PA 4LDLB 2F74B 4PRDA 3WEXB 5L2KE 1KIUA 1G6RA 1F2QA 2AJSL 4G6FB 4UB0L 3VXNB 2JJTA 1TNMA 3DVGB 3GHBH 4WHYG 5T1KD 1XZ0B 1KF9B 2WUCL 5TDOB 3VJ6A 4U1HB 5JOEA 1RPQA 4X5LA 2EC9T 5EOCL 4BZ2L 5C0CD 3PL6A 1QFUH 5I1KH 1J1PH 5DI8A 1UJ3C 5DRXB 4U05A 3D39E 3O2VH 1HQ4A 1UXWB 3HZVB 2P5EE 3NCMA 5SWSD 1BQUA 3LEVH 1A7RH 2ZG2A 3S4SG 5KG9A 4GAJH 4ZUSA 2Q7YA 1UZ8B 5J13C 2VLJA 1JMXA 3TT3H 5HYJD 4PLKD 4XNZB 4WFFE 3QUYC 4F37F 1CDUA 2Z92A 3NFPB 5FOBB 4PJFB 2OZ4L 3GM8A 3RKPA 1JL8A 3FJTA 4LRNH 5KOVC 2Q6WA 4OLWL 5AD0A 4GOSA 3DXAB 4Y1AA 2RAMA 1BAFH 3MLUL 4RMUA 2CDFB 5FA3B 3TBYB 2BY3A 4HG4J 2R1WB 3C5JA 4WVRA 1MHEA 3RI5K 3SGDH 4XWOC 4PRIE 1ZLVK 4PYHA 2X4RA 1K4CB 4AL8L 4E42B 4YDJA 2VUOA 1QFWI 5T3XD 3NCYP 1UB6A 1M7IA 1RFDH 2P24A 3ARZA 1V7MH 5E0QA 4X7EC 5SV3A 3T65A 1EERB 2X4OA 1OTUD 4D9RD 2O5XL 4JZNB 1JPSH 1B4RA 2J88H 3MRQA 4TSCH 4OKVA 4D0BA 3RKDC 1IGIH 3MUHL 3V4VH 3PP4H 1F11B 2ENSA 2H41A 5CJOH 1JGLH 4X7SH 4TOYL 3QCTH 2BSSB 1C5CH 5H2BA 4ZFOL 1MHHA 2C3GA 1KPVA 5IMMA 2Y6SC 4LHUB 4GG6A 2V17L 3VCLA 2XY2A 3WSQL 5EZIH 4EQ2A 5JIIA 5E94B 3EYFA 4GG8A 1W72L 3OGCA 4TSAL 2V7NA 2P7TA 3VXSB 3WNLA 2ZUVA 1K2DB 3LQAC 3V6OC 4F7TA 1R3LB 1D5BA 2FLBT 4NM4H 4F9PA 1TZGH 2IADA 1DLFH 3PHSA 2WLYA 4CVXB 1DDHB 3KS0H 1LEIB 1GYAA 5F7HA 4GKNA 1XGQA 2P1YA 4OIAA 4RWYH 4B7LA 3DETC 4PUBH 3BKYH 5JNYA 1J5OH 3L3HA 1OGAD 3RWIB 1JZ3A 1C16A 3MR9B 4PJGA 1CR9H 3F7VA 3RGVA 1AD9A 3MGOA 3QQ3B 2FECL 3QNYA 3X3GH 2OTWA 4G9FE 2WINB 4RCAA 1LK2A 4ELMF 4KDTA 4YGVA 3GBLA 5HY9A 3GMOB 3SJVD 1XCTA 1TJHL 3V5HA 43CAB 5M94B 1BX2B 2YMXL 4X99B 3RP1A 3VI3F 3T2QA 2FEEL 2BFVL 4ZD3L 3ABZA 2VLKA 4QGYA 3TPUB 3GI8H 3GSUB 3C6SA 1R3JB 5C8JB 4KHTL 4BUGA 3V5DA 1RZFH 4ZDHB 1EK3A 2QSCH 1RAMA 3Q5TA 1EXUA 4R26H 2XG4A 1EGJH 2NY1B 5FO9A 1KYOJ 2HYMA 3OKNA 3QQ4B 3BDBA 4Q7DA 1RUML 5ALCL 1GSMA 4DOHB 1NAMB 1WFOA 5TE6H 5D71L 4UTBH 4NWTL 2A38A 3LB6C 5LWYL 4O2FB 3DSFH 1P1ZA 2YPVH 4WW2A 4YHNA 4DZBA 4RBPH 3ULVC 4J1UA 1TVBA 1WEJH 5I66B 1CDJA 5L9DL 4L5FH 3P73B 3TYGL 2CDGB 2KKQA 4LLQB 3WFHA 1FJ1B 1MLCA 4QRUB 5F1KC 5DJDA 5M95B 1PAMA 1F8TH 1AGFA 4U31A 2I27N 5DRWA 3LD8C 3MYJA 3K2UH 4FQIH 2GJ6D 3NACH 2YC1A 3QUML 4BK5A 3CDGB 1EEYA 5CMAA 4OCSL 3B3IA 3QR2A 4OKDA 2YD5A 3VRJA 3O2DA 1IGFL 5C0RH 1M05B 3IFLH 2P8PA 5HPMB 3O4LB 2YD8A 2D7MA 2YPLE 4KJQD 3FFCD 5ELIA 3C5SA 2VKWA 3DTXA 1N2RB 4E41A 4J3SA 5FM8A 4OLXL 3RVXD 4OCWL 3JWNC 1R5VB 2A9NH 4ONFL 3BEWA 1A5FL 2R2EA 2ZG3A 3JUZA 5TQ0L 4NQDB 1JGUH 3IYLW 1JYXA 3MV8D 4XPGL 4TRPH 2IAND 1E0OB 3PHOB 5D1XC 1CZ8L 2VXTL 1MLBA 3IDGB 3SE4C 4XVSL 3UTSE 2NXYC 2FJGA 3INUL 3WXVL 4CDHA 2I24N 3S36H 4LSRL 3LN4A 2BCKA 4BSWA 4TNVK 5E8PA 1K5NA 1F13A 2XACC 1BBJB 4MJIA 5I1EH 2JIXB 4YHPB 4YDVA 4NN5C 4NQXA 3S5LA 1KCSH 4PJ9B 3S96B 1I1YB 2MSPA 1TZIB 1BWWA 1TJGH 2YD3A 1YQVL 1OLLA 2HN7A 4GO6B 5C0AA 5L7XL 4Z7UF 5ESVA 4MJ6A 5IESH 1JGDB 4TUJB 1CD8A 2IPUK 4F57L 3KR3H 4XNYH 1R3IL 4APQD 4XCYB 4Z95L 2Y36H 4PRNB 2GITA 1OQOA 1CGSH 2X89A 5DURD 3B9KB 5IGXH 5LGHL 5F93C 3S34L 3WIHA 1BZ7B 4I2XA 3PWNB 4HF5L 5BVJB 4M7KH 1QQDB 4JRYA 3IJHA 2BNUA 4U1MB 1HXYA 1P5UA 1F6AA 4PJIA 1WGOA 3CGTA 3BZFA 3VXTA 5C0FA 4MCZB 5C09B 1HH9A 4PJ5D 4P2RA 4HIIA 3KYNB 2E27L 4G8IB 5JR1L 1J11A 1I1RA 1EX0A 2GAZB 3HS0A 4LASH 1IBGH 3D1MC 5JPNB 3T3PF 1YEDB 4CRPA 1K3IA 4I18B 2H2PD 5DYOA 5IB4A 4XNQB 1PFCA 3BO8B 4G7YH 1YNKH 3BUYB 5JPMB 4ORGA 4OCYH 1ZA3B 5DTFB 3LKSB 1CFVL 3MODL 1RJLA 5GPRA 4Z9KB 1LWRA 3VXUD 1D5ZB 2GT9A 1NQBA 3QXWA 5B38A 3LDBC 4X6CF 3CMOH 4JRXB 3HUJE 1ZGLB 4PG9B 1FGNH 1VACA 1Q94B 2BSTB 1RUPH 5IHUH 1A14L 2BK8A 5HJ3A 1U8JB 5D9SA 1XGPA 3SDAD 2HT4D 5JDSA 3BP4A 3MNVA 4IRZL 3WFZA 3QWRD 5IWLC 5DHVH 1PEWA 2CR6A 3LHPH 3MJ8A 5A2LH 4GS7C 4LSPH 4YDLC 1YPZB 4OZHB 4CMHC 3VXRD 3MXWH 3QDMD 3QEGH 3JZ7A 4IJ3C 3NFNA 1B0RA 4OGAD 4JZJB 4YBQD 5MERB 3EHBD 3PDOA 1XFPA 1I7TA 5HHME 2VZTA 1D7FA 2YD1A 2HFFA 4CVWA 4ODHH 1TQCB 2IH1A 4HJ0D 1QRNE 2FL5A 3S8WA 1ZT7A 3AC0A 4UBDC 5EFIA 2MPAL 1NDMA 2F8VA 2P46B 3P77A 5IFJB 1Q72L 1PQZB 4FQXA 4PV9B 1HH6B 1HHKA 4CVUA 4EN3D 2O93L 5ACZB 5C0IB 3F62A 5HI5D 2X4TB 1KTKE 5GGSB 3CXHJ 3ZO0A 4JQXA 5E9DD 2XQYK 1N7ML 3IFPA 3RTQB 1KELL 4PGCA 1Q9KB 1OSZA 2C26A 5EZOH 4IRSC 2HH0L 5IVXA 5FGCE 4PREB 2VERN 3O6MH 4NJ9H 1J8HE 4KKAC 2ATPA 3L1OH 1A6ZA 4K71B 2FZ3B 2P5WE 2XWBA 1IGCH 5T5FL 4KAQL 2DBJA 5E5RB 1A4JB 4ELKB 4NM8H 5E2WH 1DBKL 1DVFA 1S9VB 1B3JA 3RUGE 1TMCB 4WWKD 2GUOB 1I8LA 5I8CA 1KTLB 1MPAL 2X4SA 4FQCH 3REWB 1QRKA 2HKFL 2EDEA 3RZCB 1RZGA 2ZCLL 5SWZD 3V7AG 2ARJA 5HVGB 3DX8B 3G5YA 2C7UA 1D5IL 2VJXA 1QSEE 1I85A 4XBEL 1BBDH 3V6OE 5IEHB 5FGSA 5MEOB 4WJ5A 1IC1A 4M6NL 5JXAH 1OSPH 4FOMA 4MHHI 5BS0E 1ONQA 1KEGH 4JQVC 1FZJB 5D2LE 3LN9A 5I1GH 1RVFL 2JKXA 3T0EC 1T5WA 1NSNL 2PO6B 1EH9A 1CVRA 2ICES 5E8OB 4G43A 3STZB 3RNKA 1TZHB 3TBTA 5HVWA 4KHXL 4ZPVB 4OV6F 5FUOH 3FQRB 4L8CA 1NBZB 1MCFA 4P23C 5GGRA 1CLCA 1MNUL 1LD9A 1XR8A 4NKDB 3AS1A 1YY8A 4HKXA 3ZT7A 1NAMH 3SY0B 2P5EA 4O2EB 4JZOB 2H2SC 4OCNC 4JFDE 4XP4L 5E00A 4O9HL 1T5XA 3QFJB 4G3YL 1RHHA 4WUKL 4YIQA 5D1ZD 4DEPB 4N9OB 4UU9B 4U1IB 3UTZB 2CPCA 1IEAB 3O3UN 1CFTB 2K7QA 1OPGL 4MA8H 3V0WL 3BZ4B 4UT9L 1RIVH 5SV4A 3S98A 3L5WB 3TA3B 1IC5H 4WFGD 2DLFL 2UWEE 4OD2B 2VO5A 2NCMA 4PJBA 2DDQH 1V3LA 1DQDH 3UYRH 4LKXB 4PBXA 1RMFL 4ZAKB 5C2BL 4H0IA 2DQGH 1T03H 4GSDL 4N1HB 3PGFL 3ULVE 4WO4D 2CLZA 1UWGL 3DPBA 2ZOKB 1FQ9C 3E3QC 4JFYB 2FGZA 1XGUA 1LK3L 4OUUB 3L3OB 2HWZH 3BPCB 3FT3A 3ARYA 2DI7A 4CMMB 2V7HB 4PRAB 1GGUA 1EHNA 2DWEB 5T1MB 3V2AR 4DKFL 5D7LE 3EJZD 1GGBL 1HKLH 3FQNA 1XH3A 4P4RB 4A6YB 1A4KB 5BV7C 4XVTL 4LPWA 3VGAB 4PJXE 3RDTB 3SGKC 4HK0A 2ICWJ 2VC2L 2FATL 1H3VA 1IKNA 1JJUA 4CADB 3T3MF 3U6RB 1MHPL 4WI7A 4LOUC 2B4CC 1MWAA 1FYTE 4N8PA 5CBAB 4M3KB 1MCDA 2XN9E 5D7IE 1SVZA 2E9BA 3BH9A 1Q9LA 1HHHB 5DC9B 5LQBL 4DGVH 2CDEB 1KB5H 4JHWH 5CGYD 4P5TA 5DLML 1J1XL 1CT8B 1L7IH 2XTLA 5KTEL 4DGYH 3CFBB 1L9NA 2HRPL 5B39G 2IAMC 1BFVH 5CJXA 1D5XB 1UWXH 2Y23A 2VABA 1DEDA 5HI3D 2JJWA 2NTFA 4AEHH 3A0OA 2KPNA 2ZNWA 4QXWA 4JPIA 3CFIC 2B1AH 4YXLH 3VXPA 2NYYC 1WCQA 3D3VE 1JPFB 3OKOA 2DLTA 1UH2A 2NX5E 5DD3H 3EO0A 1INDH 3VH8G 1YEIL 3BYTA 5IT2H 2LTQC 5E6IA 1X5ZA 3FAWA 2J5LB 4OI7A 1XIWA 4DVRH 1U95B 3HCVB 1AC0A 2PYEA 1OAKL 4E5XA 5IB3B 4UV7L 3SE3C 3UX9B 4ODWA 4WI2A 3MBEB 3U9UA 1G0YR 1F3JB 2ZKHH 1YEJL 4JKWA 4ETYA 3D39B 3F58L 3Q0HA 4MYWB 1AR1D 4MXVE 5DQ9A 2Y1VA 4R2GB 1IJ9A 1T2XA 5HHOE 5CBEB 2O61A 3FB8A 3FO2B 2ZCHH 2N4IA 5FO8A 1E4WL 2VNCA 3WS6A 1ZA6A 1U8PB 3E6HB 3BPNB 1T20B 1ZHKA 2PN5A 4TNWF 1OAYL 3C2AL 3NAAH 1FC1A 1OAUL 6FABH 2L7JA 4F3FA 1CFSA 1HHGA 1KNOA 3KPLA 3IRZA 4LPTA 3N1PC 4LCWD 1CFQA 1HQRA 2Q8AH 1DBJH 2CLRA 5E2VL 1ZLWH 4P4KB 4HKZA 4F33A 5FKPB 5H94B 1I8MB 1WWBX 4NZRL 4WFHE 1I9IL 3BT2H 4NSKA 5B8CC 1MAML 4Y88A 4NKMB 2YPLA 3GUTA 1KLFA 3E2HB 1JPGA 1OF2A 4MA3B 3UPRB 3OJVC 3WDJA 3U0TB 5IF0A 1UEYA 2IBZY 2JK5A 3MRKB 5D6CB 1NUDA 1BQLL 3WNPA 1N64H 3TVMD 3FO0H 3KPQA 4RZCB 5JA9A 3TN0C 1BD2B 1NGQL 5F3BA 4S0SD 3B5GA 2AEPH 5CEZE 5EUOE 4Z7WE 3K8MA 1I7ZA 2YKLH 1S7WB 1IQWH 1IAOA 1XF3A 3GDBA 3UTSA 4XMKH 4PJ8A 1S7QB 1DQLL 3ZE2F 1EFXD 4Z0XB 4QTIL 3H9SB 2JB6A 4G6AC 4NZUH 2VAJA 3A67H 2OXHA 5DVKA 5IVOA 3ZKXB 3DMMD 1Y6MR 1CD0A 5GGTA 1G84A 3O8XD 3P4LA 4U7SA 1T22A 4HWEL 1EA9C 4J6RL 1CK0L 3BESR 1FAIL 3L6FA 2W9DH 2XA8L 2AJZA 2BY2A 1QLRB 3MRBB 4OZFA 4PRPA 5ERWB 1BQHA 4GLRI 3GBMH 5I1DA 1S8DA 5I8KL 2W59A 4RFOH 3VFGH 4PJGF 1A9EA 1RZIA 4IRJD 4PGEA 3NCBB 3P4NA 5AYUH 2ADJB 1V3KA 4K9EC 3TT1L 1MCWW 2XZQH 1A7NL 1IAIH 3DUUB 4EBQL 3U36B 4U1LB 1FVDA 5ITBH 3O41A 1WFUA 2DKSA 5IUSA 3OG4B 2AXFB 4JHBA 3FL7A 3NZHL 4NNYA 4IDJL 4JO1L 5C86A 1HOCB 2A0LD 4HWZA 2AABL 4DQOL 5DK0B 1HK6A 5I74B 1CICB 1BPVA 4HUWA 4NUGL 2BERA 2Z31B 1YNTA 4HMEA 2QADB 3ES6A 3NABL 3NCJH 1FNEB 4JY4B 1I3GH 5KANI 4YX2H 5J6HB 3TIEA 3WBDA 4UIKH 2A6DB 3BP7A 4FFWD 1IFHH 1DBBL 3EO9H 3ME0A 3O0RL 3GSRA 5GGVY 1Y0LB 1FFOB 5D5MB 4LLUA 4TVPL 1F4HA 1MOEA 2I26N 4MNQE 2QSTA 3JV5A 1FG2A 3O3DA 4GW5A 3VRIA 5FUCE 1DANU 2BVOB 4KROD 1XGRB 3CVHB 4ZSOB 2VLJD 2IPTH 4HUXB 4QHUB 5GRVK 4ZUUB 5D1QC 1OP3H 4AMKL 1G7JA 3ARFA 3O9WC 1QA9A 4HULB 3T0EE 4RA3A 4OV5B 2BOCB 5MP6H 3F12A 2C1PA 4Y1AD 4KKCD 4P49A 4HHAB 3D18B 1Q8MA 5DJ8A 3G6DH 1U91B 3HUJA 2YZ8A 3BXNB 4L29A 1ZLSH 5EBWA 3MUY1 5HHVL 5D7KD 4QXGH 2OQJB 1X5GA 3B9AA 2FO4B 5I19L 2VTFA 5JW5B 5FYLD 43C9A 5DVNA 4O5LH 5E8EB 3V52L 2R8SH 3ARRA 1Z5LA 5C3TA 5D6DA 4PRBA 1Q9OA 3B4NA 4ODUA 3U7AA 3FO1B 2R15A 1DN0A 3QDJA 5E4EC 3U46B 5BRZD 3ARBC 1G7QB 2F9BT 2UV3A 5C07B 4RMQA 4FQPA 1A8JH 3S37X 3GGWA 5FV2A 3O6KH 4Y4FA 4MDJA 3I85A 5D2NB 2GK0A 2FO1A 2DIBA 1LDSA 1AO7E 5CHNB 5DUBA 3VA2C 2B0SH 4A6YH 3U2SA 2X7LB 3MUGA 1AKJA 3CLFL 4LQ1A 3KYMA 1Y18A 4M93B 3QRGL 3DO7B 1DL7L 4LP5A 4P3CH 4G7VH 1N4XL 3OAYK 3G6JE 1J8HA 3QCVH 2X5PA 4MQ7B 2RGSA 2ZSWA 3VWKB 1OWWA 1WBXB 2RJMA 1W72B 1ZGLP 2P5WA 4WV1C 32C2B 4JLRA 1AGCA 5DD6A 3D5OF 3NA4A 3Q6FB 1PLGH 3ARUA 5IJVA 4OM0L 4GW4A 1NCCL 3DV4A 3RUGA 4I77L 1U93A 1T66D 2NXZD 3QIUA 3OXSA 4ZO8A 3RGVD 4JKMA 4DZ8A 1N59B 1TETH 1MCPL 3MMEB 2F74A 4OF6A 5EPMA 3VXNA 3I3EA 1PSKL 2R23B 2ESVE 1BZQK 3GSVB 1MHCA 3DVGA 2ZPKH 4G5ZL 4GT7A 1GC1L 1NEZB 5EBLB 5GS0H 3P11H 3UO1H 5C08E 4U1HA 1E6JH 3MRNB 5C7XL 4JCLA 3WKMH 2QQKL 5DD5H 1GZQA 4M02A 4NQSB 2Q86B 1UXWA 2F58H 5IHBA 1IQDA 4PP1D 5D2LA 3C08L 4OBSA 1UZ8A 3LN5A 2EECA 4JE4B 4GKZA 1A1NB 5F89B 3RL2A 3NFPA 8FABA 5FOBA 15C8H 4PJFA 4Y16B 4M6OL 3V9FA 3ARDA 3QUZB 1N0XH 4XCEB 1QPXA 5BJTB 4NN6C 1MFEL 1I7UA 3WFCL 2QTEA 1QSFE 1JWUB 1CTNA 3CFCL 3VFVB 5FA3A 3TBYA 1R5WB 4EXPX 2VDKL 2A74B 2MCPH 2Q76A 2W91A 4HLJA 4JFDA 1FE8L 1NCUA 4KK5D 4XNXH 2NY0B 4M1GL 4U2YA 3QI9C 2X44D 3PWPE 4YDIL 4MAYC 1AJ7L 5J6GB 2WWKO 4HAFA 2MMXA 4PRHE 2HMID 1UM6H 4KJPC 4YWGL 5EIVA 1U8HB 2YD7A 4OD3L 5INCA 3QUMB 2HFEA 3CK0H 5AG9A 4M7ZC 4RFEB 1A7PH 2GEEA 4ZOAA 5BCAA 1EVUA 3BD3A 3DX6A 3SGEI 4K7PY 1JTPA 1S7VB 3EIFA 4XCNB 4DKEL 1VENA 4E41D 5J13B 5HDBF 4JDVB 1CL7I 4POUB 1F11A 4RAVA 1YYLH 3QUYB 3DYMA 2BSSA 5ENWB 3EJYD 4JR9H 2O5YH 4W4OA 3K46A 1F4YH 3OJMB 4PY8J 4K8RC 4LCIH 4LHUA 4OAWB 3V5KB 5E94A 3QIWA 3QCUH 5TF1L 4JPVH 4KTDL 1GCFA 4ZFZA 5D7LA 1OW0A 3K2MC 1RURL 1K8IB 2YR3A 5K59E 3OHXB 5KS9F 5IVXF 4PJXA 2VQ1B 4G8GD 4DN4H 1DDHA 4MJID 1YMMB 1NKOA 1L4IA 1NGPL 3HE6D 5KZCB 3KPTA 3LSOA 4LIQL 3KLHC 1ZLVH 3RWIA 1LDPH 3ARWA 3J7HA 4K2UL 1J12A 2XN9A 2XTJB 4U6HB 4UI2A 3FRUB 4DUWA 1JRHI 5C1MB 5IOPB 1SY6H 4JPWH 2GSGA 4UOJA 1RUQL 1HZHL 4KJWD 4R4BB 43CAA 4X99A 3ROLA 1QHOA 3NOIA 3MCG1 3PGDB 2X89D 3D9AL 1UQSB 3VXQB 4OSUH 3FZUC 4YFLI 3D69B 4HT1L 1H8OA 3VG9C 3UZVB 1R3JA 5D8JL 3JWDL 5FYKE 4JRYD 1IVLA 1IEBB 3FMGL 2NR6D 2ZG1A 3MA7B 4M6MH 1NAKH 3QQ4A 2HLFC 3QEQE 1N8ZB 4XNUL 5ADOH 2P43B 4NO3B 2E7LC 3P30L 3B43A 2NX5A 5BS0B 4JDTH 2FX8L 1DSFH 4HC1H 5F7EL 1XT5A 4P2RD 5MHSE 1X4XA 5DQDL 5EU6B 5IBLC 1EO7A 1QLEH 2CDGA 4LLQA 1J8KA 3A6BL 4QRUA 4TQEH 3SO3C 1U58A 2HT2C 4OLZH 2ZUWA 3V7AE 1J05B 5CILH 4M3JA 2XWJB 3OB8A 3CDGA 1S5HB 4NKQB 1EZVY 3C8DA 4YHIA 4XP1L 3LMJH 3LPGA 4JGUA 1YEHH 2EIZA 5F97E 4LCYA 2HT3C 3NIGF 4M62L 3QEHB 3CVHH 1A3RH 4PJBF 3TBSB 1M05A 1QR4A 5HPMA 3O4LA 4K94L 1FCCA 3WMSA 1MVUB 5DJCB 4P2OA 2VLME 4HS6A 4AEIH 2APWA 4BH7B 1FPTL 3KPOB 3X13A 5HDOA 1JF1B 1YY9C 3VD7A 4M7LH 4YHZL 3B83A 5LXGH 1TVHB 1CQYA 4NT6B 4OLWH 3L5JA 3BI9X 4M43H 1FN4B 3VXME 3MLUH 3OR6A 5D7JA 4YFLF 1BWMA 4JFZH 5HD8C 1BJMA 3LD8B 3U0WL 1X44A 4FQXD 1LNUB 3UJIL 4HFWA 3WIIH 1BBJA 1P2CB 4KQ3H 1L0YA 6CGTA 3MRHB 5I2IA 4YHPA 5F96H 4ESKA 1NCWH 5EUOA 5I1CH 4GUPB 1AQDA 1RZJL 5F70A 1KCRH 3BW9A 3ESVF 1JZ8A 3S96A 1MFDL 1RZKC 4WY7L 4PJCF 5CZVL 4IS6B 3HMXL 5DO2D 2BHZA 3Q3GA 1ES0A 1F97A 3SDDC 2EEBA 4W6WB 3DRTA 3AREB 4X0KB 1RJZB 3MLSH 3NTCL 4XCYA 3R0MA 1MI5E 1OB1B 2A77H 4OBRA 3QUKA 4ONHA 5DT1H 5D1XB 2NY6C 3I2CL 3PWNA 1U3HB 4EI6B 5D7SH 2Z8WC 4ZUTB 2NXYB 2OR8A 4EQ3A 2O5ZH 2VZ1A 3PP3H 3WXWH 3MO1B 2H6PB 5IBUB 4D8PB 3ARGC 3G08B 4NHUA 5FHBL 1JK8B 1HHIA 3OB0H 4YQXH 1BFOB 1PG7L 5ITFB 2EZ0D 5TDPB 3OKDB 1ZK9A 1ZWIA 2XA3A 3X3FL 2WZPD 3RHWF 2BDNH 5ICZB 4AIZB 4POZD 5C09A 3HN3A 4NN5B 2VDNL 4LLYB 2BNRB 3KYNA 4CKVX 1S9KC 4EOWL 3C6LD 5FKAB 2OK0L 5I8EA 1ADQA 2BVYA 4RDQF 2VSCA 2RFXA 1P6AB 5ILTL 4ZS7H 9CGTA 4K3DL 1P4BH 3AVEA 3MUZ1 2EXWC 3HE7D 1FGVH 1IAIM 1NGYB 3IB4A 3MJ9L 4KH2A 4XPTH 1PYWA 4XNQA 4WNQB 5A2FA 5K93A 3BUYA 5JPMA 3PQYD 3LKSA 4PJDB 2ZUUA 2NZ9D 1BMGA 1H5BB 2BFVH 2IALB 2DQJL 4ZD3H 1JYWA 1D5ZA 4YO0B 2X2YA 4MNQA 4RMSA 3IAGC 1KJ2L 4QCIA 1ZGLA 5MEQB 2EDWA 1MFBL 2BSTA 2IG2L 2Y07L 4UQ3B 2VZSA 4KPHL 4ZUVB 4R7NB 4PY7B 3EFDH 3GRWA 1TPXC 4MQSB 1HILA 1LE9A 3CDYA 2R1YB 5EOTB 2MOVA 4BSJA 1YPZA 5EDXA 2P47B 5IROA 1B0GB 5T33L 4KGLA 1EO8H 1GHFL 5MERA 1CFBA 3LZFL 3QWOA 3UYPA 2XQBH 2X1WL 2FEDD 1LP9B 5H37G 2DLEA 1YJDL 2X9XA 5C0BB 4X6FB 3FB7A 5DZOA 3WFBH 4OZGB 1PQZA 2ZJSL 1NBYB 3S4SB 3W0WB 4MWFB 5ACZA 5C71A 3X12A 1NKRA 2X4TA 4OF7A 1D5MA 1MCBA 4WHTA 3D25A 3MLZH 1RJYB 4JG1H 5IFAH 3LDBB 3N9GH 4OGZA 4X98A 3RTQA 2XT1B 2V2WA 1Q9KA 2CIKA 4FA8A 3QJFB 1FO0L 5DC0A 3GKWL 1MRCH 2R2BB 3OKKA 4DCQA 3BQUC 5F6HJ 3IDYC 5EU3A 3VU2A 5EO0B 4GBXA 4Y2DD 4EXKA 4GS7B 3F7YA 4YDLB 3CCHB 2ORBL 4H1LB 1S9VA 1VFOA 4YZFF 4CMHB 3IDMB 2Y5TA 4DUXA 1F4AA 3C60B 5MENE 2X6MA 3Q6GH 1MJ7H 2IFFH 4EIGB 3IVKB 4W6YB 3IRPX 3QDHA 3SCMC 3G6JA 1VESA 2IH3A 4P5TD 3UTPE 2NW2B 3RZCA 1Z3GL 3PWVB 1DANT 4L4VB 3QDGD 4XWGL 4M1DH 4OZIF 1AE6H 2J6EL 4G6ML 4HFUH 5TE7L 3VFNA 1RULL 4YR6B 1T7VA 2LVCA 5EWIH 4YHLL 4NQED 3J8F7 2G9HA 1KLUA 2X1PA 5F7DA 5HDQL 3GMLB 3MGTB 3QJHB 4IRSB 2EKSA 3FB6A 3PWLB 3L3KA 3LS4H 3FOLB 3GMMA 5B4MC 1I1FA 1X7QB 2ESVA 2X70B 3P4MB 2DTMH 1D6EB 4KDWA 4NIKB 1OVZA 5E8OA 2FBJL 4HWBH 1TZHA 3P4OA 1AGBB 1E4XH 1X5KA 4ZPVA 5C08A 3UZEA 3FQRA 3L5IA 5E6ID 5GGVL 5A16B 1YC8A 3WD5H 4HS8H 4KI5F 1NJ9A 3OTTA 3LQAH 3EFFB 1UZ6F 3FRPG 2F53B 3SY0A 2YEZB 3QHZL 2PYED 4JZOA 4APQC 5T1DH 3F7PC 5T1LA 2R1XB 2IBGA 4F2MB 4MB5A 3OR7B 3GMPB 5GJTL 3FONB 1IEAA 2D7TL 3ZKNC 1ETZA 3BZ4A 4QRPB 5GHWH 1KN4L 4FFZL 4R7DA 3KYOA 4N8VA 3OF6A 2DL9A 3JV0A 1IKFL 3KLSA 3BGAA 1R3KB 4YNYB 4FQQA 5GS2D 4DTGL 2VIRB 3CH1A 5DQJA 1QSFA 5DEZA 2F15A 3CAFA 4LKXA 7FABL 1OARH 4NC2B 3UCRA 5CD3B 3HRPA 3EOTH 4HX1A 2D03H 1RZ8A 2BY0A 5D93C 5JHDE 2WW8A 2ZOKA 3MRDB 1I3RB 4HUVA 3R4DA 3PWPA 3UJTH 1B4JH 4OUUA 4QRRD 5I71C 5DMGD 4PRHA 4BQ9A 4PTTA 4JGMA 5ETUB 4XNMA 1CQKA 3IKCA 4OQ1A 4P23B 2YN3A 4R0LC 4Z7OE 3VW3H 2V7HA 3OKMB 1CD1B 2H2PC 5T1MA 3QRFM 4UILL 2M2DA 5LGJB 3T1WA 5CS7A 4MQXC 3WUWB 3MV9B 1BM3L 1IM9B 1BVKB 3QFDA 1MCOL 2HTKD 5CP7A 3ULVH 1VPOH 5I6XC 2AJXL 3W9DB 4RX4D 2CKBL 2VDLH 1J10A 4BH8B 4HXAL 3U6RA 4LMQE 5C0CE 2XKSA 3I6KB 4NWUH 1SEQL 4Z7VB 3SDAC 2HT4C 4X4ZA 5SWSE 5K9OB 5E99L 5E7FA 1XF5A 3LH2H 4N0UB 1AO7B 5EU5A 5HYJE 1CE1H 4JO3L 5TQ2L 3HG1B 3CFBA 3LRHA 2ICCA 3SDXE 4OGAC 3P2TA 4YBQC 2GFBB 3EHBC 4L9LA 1D5XA 1U0QA 2AK4B 1QBMH 4PRPD 2W9EL 1RIHL 4HJ0C 2WBJD 1R5IB 4KGJA 3RWHB 3OZ9H 1B9ZA 3CXDL 5I1HH 1A0QH 3HI5L 3IDXL 3KPSD 4QRSA 4NKIL 1GH7A 1T7YA 4I48B 3QHTC 3W11D 1DBMH 2APXA 4MX7B 1P4LB 2R56H 2K3TA 1JFQL 5DVMA 3SPVB 3CX5J 5AUMB 4PB9L 4NQTA 5T3XE 4UNTA 2FGWL 1NCDL 3O3EA 1CVSC 3ULSB 3VFOB 5KSBB 4FNLL 4UDUB 4KK6C 4CN1A 1FFNA 2LAGB 5ESAB 4CUCA 2H9GB 3BIAX 2Q87A 4D9RE 4LPUA 3OJDA 2ADGB 5L8JB 1UH3A 5IB3A 2F5AL 3HI6H 3HZKB 3I75B 3MBEA 1L0QA 3KJ4C 3Q1SL 1F90L 1BHGA 3QEQA 4B41A 4WWKC 2R4SH 1BLNB 3KPPB 3HLAB 3O4OB 1WSST 4KI5D 4J3UA 5I1LB 5CBEA 4S0TD 5AG8A 3VMOA 4DW2L 4CNIB 3B9EA 1LO2H 4P59H 3GK8L 4HZLB 1HYSD 1W0VA 2ZZUT 1T20A 4NQCD 3SE9L 2RR3A 3QO1A 4V1DB 5HDLA 1HEZB 3ECBB 5E8DH 4LBEA 4ZXBD 4K3EH 2CSPA 1MCQA 4OLYH 1B90A 3I9GL 4PTUB 2Z91B 4Y5YC 5FO7B 1VFBB 1KJ3L 4LK4A 3LQMA 2PF6A 2LTQB 1S7RB 3LV3B 4P4KA 1WZMA 5IB2B 5F72S 5FKPA 5H94A 1I8MA 1OGAE 1RQ5A 4LHQB 4NKMA 1SYSB 2D7QA 3BD4A 4NJAH 5ALBH 3FAXA 3UPRA 3RWCA 3KWWA 5EBMB 3GHBL 1MCSA 2Z35B 5D6CA 3SJVE 2I25N 2KH2B 1BD2A 1QFUL 2X4PA 4WHYH 4Q9CA 1J1PL 5I1KL 1UCTA 3O2VL 5KVDH 1JI1A 1Z9SA 2AEIT 5K9KB 5D1ZC 2Y72A 4NPYB 4L4TB 4F37K 3PV6B 1CXIA 4GAJL 3H9SA 3VXMA 3QDJD 1AHWB 3TT3L 3GZKA 3NCEB 3NBNA 2CRYA 5KVFH 3REVB 2Y06H 2NZIA 4BFIA 5DFVD 2IQ9H 4NUJB 1JNHA 3DBXB 1BAFL 1QLRA 4UV4H 1T2QH 2PW1B 3MRJB 3WIFA 3T4YA 5CEZH 4PV8B 2QKIB 1GOGA 5EUKB 3AXLA 5B8CB 2V2XA 4GAYA 1CXEA 1QSZA 4MNHA 1AD0A 3VD4A 2Z4QB 2JLLA 1ZV5A 1ORQB 2W60B 2Y25A 3VE0A 3DUUA 2DM4A 3EYQD 2GJ6E 4Y5XC 3S88H 1RFDL 2BC4A 4NKOA 1V7ML 2G60H 1AC6A 3F8UB 3TN0B 1IC7H 1MI5A 3AB0C 4D0CB 5I1JH 2LU3A 5EN2A 5IW3A 3EJZC 5HYIA 4IEFB 4XI5D 1G9NC 3QIUD 2J88L 2WWKT 4TSCL 2YSSA 1H9VA 1FVCB 1IGIL 4LEXH 2Z31A 3V4VL 1S5IH 3PP4L 4N90D 2DMKA 3FFCE 5CJOL 1JGLL 4X7SL 2J7LA 3QCTL 1C5CL 1X5XA 1YN7B 4HGWA 2HJFA 1A6TA 3N06B 2BY1A 3HB3D 5J6HA 3QNXA 1J1XH 2A6DA 3MV8E 5EZIL 4Q9RH 4ZQKA 2IANE 2YD6A 4LVOC 5HGGS 1FFOA 4GW1B 1WISA 3MNZA 2MCG1 5CGYC 1XGRA 3RWJB 3TZVB 4NM4L 1MCLA 1TZGL 1DLFL 2H8PA 4QHUA 3FN3A 5J11B 4GFTB 5M7QA 4XPBH 4URTB 4RWYL 1H8NA 5IM7B 4PUBL 2OMBA 3BKYL 4Y19B 1OY3B 5CCKL 1J5OL 4K7FA 1CDGA 1LO4H 3RWGA 4HHAA 3D18A 2V2TA 4HIJB 4G6JH 5DJYA 1CR9L 1A7QH 2DQDH 2KUTA 4BQCA 3DNKA 4RRPA 3VA6A 3X3GL 2OZ4A 4KU1A 4NFBA 4MD4B 1H3GA 4LEOB 2VN7A 4UT7H 2NQCA 4XBGA 1AXTH 5E2UH 2FO4A 4HPOH 1YEJH 3NIDF 3GI8L 4EDXB 2PETA 1RZFL 4FTVB 3OKLA 5E4IA 3DV6A 3IJSA 4NNXA 1EGJL 4R26L 2DOCA 2WMPA 3U46A 3N1FC 1AR1C 3TH4T 4ELME 5TE6L 4KVNH 4UTBL 4PG2C 3LOWA 5J7CC 3VI3E 3DSFL 2YPVL 3ILPB 5D2NA 3O9WB 2E7CA 4LCCB 3VDCA 4LHUD 1LO5B 1WEJL 1DUZB 5BW7A 3IS1X 4L5FL 4PJ5E 3T1FA 3IF1A 4Q0XH 3QIWD 3L7EA 4GRLC 1AIFB 1TLKA 4KK9C 2FX9H 4NP4H 3QG6A 2D31B 1F8TL 4C4KT 4ZFOA 2OR7A 1TTFA 4FQIL 3NACL 3EOAB 2X9WA 3FOMB 3VXSD 3TCLB 3KLAB 3OPZL 5DK2B 5CGTA 5C0JB 4ZG1A 3MFGB 4KVCH 3FT4A 5F6IC 3AGVA 1W72A 3QA3B 3QH3A 3CD4A 3BKCH 3L7FA 4WDIB 1T89A 4ZO6A 4ZO7A 3B2VH 3U4BH 1F3RB 2ZWLT 1F45A 3Q6FA 4QXUH 5C0RL 3VXUE 3IFLL 4AQ1B 2J4WH 2DYPA 5MENA 3MLTB 1N59A 3FB5B 2DS4A 1LEGB 2J8UB 3ARBB 2A9NL 2AK1L 4JFFB 4KTEH 4Y4HA 1UVQB 4O58H 1A1MB 4JDZA 1JGUL 4FG6D 5EBLA 4TRPL 3LRSB 1NEZA 3UTTB 1KLGA 4JFQB 4KJYB 5TGBB 1ZLUK 5CWSA 3ET9F 1P84K 4JCMA 1WV7T 5KANG 2XXMB 3HNSH 3VXRE 4RGMC 5DK3A 3QDME 1T83C 4Y4KA 3DMMC 3S5LG 5BV7H 5C0DB 2BOBA 3O8XC 2CR3A 2DLGA 3BAEH 3S36L 1F58H 2CGRH 3TP4A 1N0LA 3LEXB 4NFCA 2NY1D 25C8H 3H7LA 2FIRT 4B53A 3QUXA 1ZVSA 2VLRB 4IIQC 1W0YT 3L3DB 2VXUH 1GZPA 1I4FB 1LO0H 2B4CH 5I1EL 1IAII 4NO5B 1EPFA 4AIOA 4WV1B 1UA6H 1JHTB 1KCSL 2FJFB 3BHBA 3UDWA 1JWUA 1FNSH 1TJGL 2GSIB 4AJ0A 2ADIB 3L9RB 4Y7MA 4OZ4B 3AFLA 5E9DE 5IESL 3THMH 2GI7A 4O2CA 1Z9OA 4NUGH 4XNYL 5L88H 1PJ9A 5CEYA 2Y36L 2DF3A 3L3IA 5HHNB 2NNAB 4X6BA 4U1NB 5JXEA 4KKLD 5IGXL 3JVGC 1QYGH 1U8HA 2G75A 1N5AB 4M7KL 4PR5B 3QUMA 3HPLA 1YPZF 4J4PC 4OZHF 5BQ7B 2DL2A 2JJTC 3RNQB 3VH8B 3O4LD 1F5WA 3C5ZA 4P2OD 3UTOA 4ACPA 2FIKA 3E6FA 1MQ8A 3PL6C 3HZYB 1WIUA 5SWZE 4NRZB 4QO1A 5ENWA 2OJEA 3QEUA 1IEHA 1PGRB 3QAZC 4NQDD 2ED7A 2YXFA 3WN5A 4H0GA 1U8IB 3MACH 5I0DA 2PXYA 4OAWA 4KROC 3PF2A 4LASL 4NC0B 8CGTA 3MRLB 1NANI 3BDYH 2EXYD 4JKPH 5B38G 2XV6B 5CSGA 3OHXA 4UINH 2XICA 3IETA 3QI9B 4G7YL 1A21A 1YNKL 4OCYL 4PGZA 4MAYB 4C56B 1NMBH 4G80A 1MCKA 2EDLA 2JIXD 1FZOA 4YXKH 5C0CA 4PJ9D 3QISA 4X6EB 4LCUA 3TYFB 4HMDA 4KKNA 3RAJH 3CMOL 3FQTA 3BEVB 4M7ZB 1FGNL 1V7NH 4M6AA 4A2MA 2EDHA 1RUPL 5HGHB 5IHUL 5SWSA 3T3PE 5GGUA 1NC4B 4LVEA 4U6HA 1NLDL 4HIHA 4TTGA 1P69B 4JFEB 1FZKB 3LHPL 1KJMB 4N68A 4R4BA 4LSPL 3SDXA 2RBLA 4M4RA 1NC2B 1QKZH 3SN6N 3MXWL 3VXQA 3QEGL 4MXWH 2BJMH 3GSNH 4WFGE 5JMRA 1KIRA 3B9KD 5ICXB 5JIPA 4X6CE 4YEEA 4Y5VA 2BXZA 4MD5A 4WCYL 1VKXB 2FSEB 2D9QB 1Z0MA 5J3HD 1KSRA 2HKHH 2Q7NA 1N8ZA 1I1CA 2Y7QA 1DBAH 4GMSH 5C09D 1M6OA 1SMOA 3OAZH 5IV2B 3ARXA 1ZMYA 4P9HC 3BZEA 4HUNB 3TBVB 2BVPA 5KSVB 4GKSB 5EZOL 1HCVA 3RWFB 1AFVH 4F9PC 3EDDA 3WJJA 3AAZB 4OI9A 5FYKH 3O6ML 4NJ9L 1OLZA 4Z7QF 3I3DA 4U3XA 3L1OL 2PYFB 2XWJA 4S10A 1IGCL 3BIKA 1U8QB 2HVJA 2B39A 1VFAB 2NXZC 3K7UA 5FGRA 4NM8L 5E2WL 2I9TA 3K8LA 3RGVC 2OS7A 2F54B 4PGBB 4I4WB 4TUKH 3VG9B 4PLJD 2X4NB 4OQTH 4K9EH 1XAUA 4KDTC 4D9LH 3TBSA 4JRXD 3V0VA 2MHAA 1YUHB 3HZMA 4FQCL 1MJUH 1U92B 2C3XA 3RVWD 2R2CA 1IGTB 4ZNCD 5J0BA 1NGZB 2QBWA 3ROOA 2ZCKH 4I5BB 3IJYB 2UUDH 4FZEH 3LVEA 4U1JB 1KJ2B 1BBDL 2LU4A 1JF1A 4PP1C 5JXAL 1OSPL 3R0NA 2XNAB 5DJ2B 4NDMB 3H0TB 3ARSA 1KEGL 1MFEH 5IFHH 1OGAA 4WUUB 5I1GL 1S3KH 2UYLA 3SO3B 2B5IB 2IPKA 3UEZA 1ND0B 4WW2C 1I7RA 1ULVA 4TSBH 2YPKB 3PWUB 5DDHA 4XZUA 1LNUA 3CUPA 3GBNH 3DGGA 1V05A 4UT6H 5FUOL 5C6PB 3VFWA 1DQQA 4FFVD 3E8UH 5BZDA 4KK5C 2FJHB 3AU1B 1NAML 4QLRA 1OCWH 1U3YA 3RTQD 1OD7A 3WL9A 3LS5H 3MNWA 2ITDB 4M5ZH 4MA8L 4HEME 3BGMB 4X5XB 3AREA 4X0KA 1RJZA 1NCBH 4ODTH 1KB9J 2BRQA 3FO9B 4MMXC 1IC5L 3P0VH 4OGYH 3JTTA 1MFCH 3DYPA 1U8LA 1Q1JH 2DDQL 1DQDL 1IAMA 3UYRL 5FDWB 1FO0B 1I9JH 1UJTA 1U3HA 1HI6A 2DJUA 5F1IA 2DQGL 5DJZB 1T03L 1GGTA 3KPNB 5HGBA 4L3EB 3VI4F 2GW5A 1V3MA 2XKNA 4QGTA 5IEKB 5IMOA 1JK8A 1NFIB 1BFOA 3RZCD 1K6QH 1J1OL 1U8KB 2XIDA 4PP2B 1OT1A 1PG7X 3OKDA 3CZFA 2HWZL 1WQVT 3MOAH 3ZSSA 2W0FA 2AXHA 4LCWE 4AIZA 3KXFB 4LLYA 2BNRA 4ZS6C 5CP3H 1KJVB 4LIQH 3ALXA 4LF3B 4XCFH 5FKAA 5TH2A 1JZ2A 1OAZH 1HKLL 1B2WH 3KPMB 3IAQA 3SGJA 1BVLB 1GVIA 3BP6B 5HYSA 1MCRA 5KVGH 3SDDB 4N0RA 4BKLB 3GB7B 2PO6D 4YEFA 4PIRF 4WNQA 1IT9H 3P9MB 3DVIA 1JV5A 1S7XA 3MV8A 4WW1B 1CWVA 3O3BB 1QBAA 1WUNT 5GRWA 3W39A 1H5BA 3NPZB 2PW2B 2IALA 3TNMB 3FTGA 1SYVA 2NY6B 4HT1H 1L6ZA 3WE6A 4DGVL 3IFOA 5ANMB 4X6DB 1KB5L 3MRPB 3ARGB 4JHWL 4QWWC 1CXFA 4UQ3A 1L7IL 3GIZH 4Y89A 5T5NG 4DGYL 1UADC 2EDOA 4PY7A 1BFVL 5I0ZA 2A73A 3NN8A 3TA3D 2GY7B 3H9YA 3BSZH 5EOTA 4IOFD 3STLB 4LLWA 4KUCF 3BD5A 3BISA 4AEHL 4TULL 2HFGH 5F7EH 1CBVH 4Z8FH 4L8SA 4EUPA 4R9HA 5CIPA 2B1AL 4YXLL 2GY5A 4GRWB 4YJZL 3JTSA 3VFRB 5C0GB 2BMKB 5AZ2H 1I1AB 3ZDYF 2FYYB 5C0BA 5FYJH 4AH2A 1W0WA 4X6FA 4OF5A 1PY4A 5DD3L 2IBZX 1INDL 3X14A 5FM4A 3W0WA 4LVNC 4MWFA 1UEMA 3ZTJG 1LQSR 3GSXA 4DVRL 3CSGA 1G0DA 2W0KA 5HVFB 3DROA 1RJYA 5DD0H 3BPOC 3I6GB 4LSTH 3QJFA 4ELMA 3JXAA 2R2BA 4XAKD 1A9BB 1Q9WA 2DQIH 4H26A 4UUJB 1G9MC 3RDTD 5HBBA 1TCMA 4L8DB 2YRZA 2XOTA 2X41A 1WTGT 4TNWK 1MJJB 4H1LA 1MH5A 2ZCHL 4MXQC 1BOGA 2E6QA 1X5JA 3IDMA 5L6YH 3C60A 5KSAC 5HGAB 2CKBB 3NAAL 4N5UA 1UACH 2IF7A 3IVKA 1TQBB 6FABL 4U0RC 5IIEB 3C9NB 2VLJE 2E7BA 2NW2A 5A3ID 1HHJA 4L4VA 2F19H 5FUZH 3QIBA 4YLQT 1DBJL 3GMRA 1U8OB 2LQRA 3PJSB 2IEPA 5IJKA 1EJOH 1LGVA 3N1MC 3GSOB 1C08A 4Y1AE 1A6VH 3SKNB 5DVOA 3IXTA 3KPRB 5GS0D 1KTDB 5I18H 5J57B 5KBNC 2EH8H 3BT2L 5EC2B 4FQXC 1FSKC 2ENYA 3FQWB 1HIMH 1ZT4A 3WNOA 5IW1B 4U4BA 3GMLA 2VLLB 4AEEA 2APBA 3PWLA 4K8RH 5D7KE 1N64L 1X7QA 3FO0L 5C0EA 5I75B 3TBWB 3BQUB 1QZ1A 3QWRA 2AEPL 1NL0H 4JQXC 5FOJA 2YKLL 1P4IH 1IQWL 5DO2C 5FYLE 5C3LD 4OCXH 2IGFH 2R0LH 5IB1B 4XMKL 3V8OA 3VXRA 3QDMA 5FECB 5D5MF 2F53A 4NZUL 5KW9L 2YEZA 3A67L 4OZFG 1BQHG 2AQ3A 2ERJC 3G5VB 1SBBA 1IM3B 5BRZE 4F2MA 4YDKH 1T1YA 3MBED 1VCAA 2H1PH 3GMPA 3FHAA 3SCMB 1NMAH 1T7XA 1DVFC 1DZBA 1CDCA 2DIAA 3PG2A 3EYOA 2HP4A 4OD1L 1R3KA 4MDIA 2W9DL 1I8LC 4EN3A 4R2GD 4JJHA 4F7MB 5ACMA 4HCRH 3OV6A 4CGTA 5CJQH 4G9DA 2FBOJ 3GBML 4KRPC 2WWMD 2EYTB 3MCLH 4M8QB 5L2JA 1UT9A 3VFGL 5A2JH 4BYHA 5AYUL 3BOVA 2R29H 2XZQL 1IAIL 1I85C 3ARPA 5ITBL 3W5MA 3MRDA 4P2QB 1VB9A 2FECI 5IQ7H 1VFUA 2VDRL 4JY5H 5K33A 3WKNA 4QT5B 3OXRA 1JWSB 4KUCD 5ETUA 1URLA 2DN7A 3PXHA 3BWAB 3M1BB 4P4KD 2IPUG 3ULUC 3O11B 2NY3B 2DJ4A 4PJGE 4YBLC 4Z7UA 1PD6A 3CX2A 1EVTC 1EEQA 3DGCR 3NCJL 4H25A 1C7SA 4QOKB 3WUWA 4X4YB 4YXHH 1I3GL 1AGDA 3VGEA 1IM9A 2NW3B 4YX2L 3TV3H 4NO2B 4YPGA 2AJVH 1PKQE 4UIKL 4XPHH 1IFHL 4XP5L 2ICEA 3EO9L 2GTWB 5EIIA 1BD2D 3KNBA 4LSDA 5L8KB 3LEYH 1LE5B 5DSCB 3I6KA 5JOPD 3UPCA 1DQMH 3H9SD 2EC8A 1IL1A 4OCLC 2J8HA 1T0NB 3MXVH 1GPOL 2IPTL 4JB9L 5D93B 1I8IB 1JGEA 3DX9A 1M7DB 4N0UA 4Z78A 3Q48A 1KGCD 5DRNB 4AENB 5I71B 5MP6L 3SDYH 1EUTA 2GFBA 1A1OB 2KZ1B 1J0JA 3G6DL 2EDDA 2FEDC 4U49A 4Q2ZB 4ZYKB 1ZLSL 4FZ8H 3H3BC 3HAEA 4I48A 5EB9A 4MX7A 4QXGL 1P4LA 3M17B 4M1CD 3RWEA 3RVVC 1DN2A 1HSBB 2OL3B 4GAGH 5I6XB 4RGNB 2CK0H 3MZTA 5BOPA 4O5LL 2CJUH 2CIIA 1LVEA 3CFEA 2R8SL 4KMQA 5ESAA 2C4FU 3CSYB 4X6CA 5JZ7D 3P9LA 1VADB 3T08A 1CICD 1C12B 5CJ5A 2Z31D 3HZKA 1FAKT 2QADD 5DMYA 3N85H 1IKNC 1MUJA 4RIRA 4E41E 4WO4A 1FDLH 3O6KL 4F7CB 1IZKA 3WHE1 5DMKB 1DLHA 1RZKH 2PCPA 2B0SL 5T3XH 3D85B 4A6YL 1HINH 4ZO9A 1FNGB 3DVNA 4P5TC 4P3CL 4G7VL 4HZLA 5FK9B 5J12C 5D72H 2OR9H 5DEFA 3QCVL 1QTYT 2XZAH 4UIMB 1HEZA 3ECBA 3GJFK 5AYQA 4KZDH 4U6XB 4I3GA 5DJ6A 4O4YH 3DX7B 3BE1H 3CVIH 4G8GE 1LMKA 2HJKA 5FO7A 2XQYG 2Z91A 5KN5B 1PLGL 3CFKB 4MJIE 5E5MA 3UTQB 3TJEH 1CG9B 1ERNA 3LV3A 4JHZA 1E4XI 4LU5H 4N5EC 4PBWD 1JYNA 2JELH 3LIZH 1TETL 2GJJA 1KPUA 3DURA 4NQVA 3CDFA 3UBXA 3VFTA 1SYSA 2JTDA 2WUBH 3TIDA 1BJ8A 1IAKB 1DQJB 3EYVB 4I0KA 5HGDB 3RL1B 5E6IC 4R96A 1RU9H 2ZPKL 5F9OH 3KJ4B 5GS0L 1ZOXA 3P11L 2AQ1A 3UO1L 1XIWC 1E6JL 2D7TH 1KN4H 3WKML 5DD5L 1T3FB 4GRWH 2BNQB 1FFPA 2F58L 1K4DB 4NPYA 4GQPH 4HWNA 4ALAH 4D9QD 5GSRA 3WFDL 3T77B 3FT2A 2QQLH 4JRYE 1AHWA 3OSKA 3G9VA 1FZMA 3BVNA 5DUMH 2H3NB 15C8L 4X9BA 5C07D 5JW4Q 4C83A 4FP8H 4PJIE 5DJ0A 1N0XL 2AXJA 1G7HA 4Y5YB 2YK1H 3WS6C 1OT2A 5I1IH 4P2RE 3MRJA 1KG0B 1BIIB 2MCPL 4XCCH 1SJXA 1D9KB 2CKNA 4PV8A 2P49B 1RUAH 3KG5A 4XNXL 1JCKA 4AM0B 5JMOC 1ORQA 5EZLB 3QQ9D 3VWKD 5E8NB 5F1NB 1UM6L 1I8KB 3GI9H 3DRQB 4JFPA 5IBTH 3MV7B 1NPUA 3WHXA 3CK0L 4R97C 1A7PL 3BUTA 1S7UA 3G5ZB 2J1KA 4LHUG 5F3HB 5DGRA 4O51B 1G7IB 5F6HI 1KPRB 1IRAY 1YYLL 4ZPTB 4LSSH 5CZXD 3MRMB 1OTTC 4AT6B 1YN7A 3QNZA 4JR9L 2O5YL 1LEKB 3HHRB 1F4YL 3T4AB 1QEWB 1KFAH 4LCIL 5TQ2H 5DZNA 1RK1B 4PJ8C 3VFPA 4BQ8A 5E70A 5C6TH 4HS3B 2C3WA 5DHYB 3QCUL 4RAUB 4GW1A 1KACB 4JPVL 4DVBB 3OKEB 3BKJH 5C6WH 1CXLA 5HDBE 3QUXD 4BZYA 5C2UB 3GIVA 3TZVA 4X7TB 1O7VA 5IVZA 4IMKA 4JVPA 1QO3A 4ZNEE 4Y5XB 4JHAH 4DN4L 1L6XA 3PABB 1EZVX 1SEBA 3TVMA 5IM7A 3QUZD 4OGXH 2OMNA 2CXKA 3AB0B 4JAMB 1X5HA 2GJZB 2X1OA 1F2XK 1G7LA 5GJSH 3W11C 4HIJA 4PJ7B 4GRMA 4S1DD 2QQNH 4HW6A 1YC7A 3QO0B 3WLBB 4F80A 3WJLA 1EFXA 4MD4A 4RMTA 3PE9A 5IMLB 3RX5A 4EZMA 2VZUA 1IGJB 5MI0C 5KS9E 2NY0D 5DXWA 2WK2A 1SY6L 5IVXE 5F7WC 4JPWL 2X4QA 5I9QC 4HPYH 1KBGH 3CZJA 1N3NB 1P7KB 4OSUL 4G6KH 2W65A 1NFDB 4D0DB 1JN6B 1WBZB 4LVOB 4EDXA 4LSQH 2EDBA 4M6ML 1OAXH 1NAKL 2P8LA 4IRJA 2A6IB 3BJ91 5I1AA 2W1NA 2UZIH 5AZEH 4IDLA 5ADOL 2BXYA 4JDTL 1DSFL 4HC1L 1P9MA 3ILPA 3LKQB 4LCCA 2ZUQC 5FB8B 2NY4C 1V3JA 4MJ5B 4ZUWB 2BVEA 1QLEL 5I15H 3MROA 1FORH 2ZUXA 3IGAB 5ID0A 4XRCA 5ISZB 4TQEL 2N7AA 4OLZL 5GIRB 1CCZA 5CILL 5IR1B 4K7PH 3LKOA 5CJ8A 3FOMA 3ARFC 4XWOD 3TCLA 4QRTB 3KLAA 1WIPA 5F7MC 4H5SA 1NDGB 3LMJL 3MRFB 1U2HA 1YEHL 1B6DA 3JV6A 2X1XR 1YMMD 3Q5OA 5KZCD 3U1SH 3PQYE 3SKMA 3WO4C 3CVHL 4G8FB 3V4PH 1A3RL 5JHLH 1QFWH 3IU4H 2G5BB 3MJ6A 4C57C 1YEEH 2XTJD 2ATKA 3C8HA 4QHKJ 3X17A 3FB5A 2OP4H 2FB4H 2ZSVA 3RRQA 4AEIL 2VQTA 3RKDD 4IOIA 1HSAB 4JFFA 1XR9B 1XF2B 1U8MB 2ILLA 4KUZH 1UB5B 3NZ8A 1ROWA 1T0MB 2WAHA 5IK3B 5FA4A 4AQOA 3UTTA 2VISB 3P0YL 3EBAA 2P45B 4KJYA 5D6DC 4M7LL 4LLVA 3NIGE 5LXGL 2Y6SD 2MKLC 4M43L 4PJBE 4GRLB 5DHVB 4ENED 5CLTA 4N0YH 4JFZL 1D3CA 2C5DC 5C0DA 4QKXB 2OL3H 4X7DC 4Y4FC 5JORB 3S36X 3N1QC 3UYOD 4P3WA 3L3DA 4FQLH 4OFKA 3WIIL 5FFLA 1TXKA 1I4FA 4PJHB 4HDIA 3K1DA 4KQ3L 3K74B 5F96L 4KZEH 1NCWL 5I1CL 5KVMC 1S7TB 1KCRL 3VFSB 2HAZA 4PJDF 1WWWX 3STBA 3OWEA 1EEZA 3PNWA 3MOBH 5EU6D 4UDTB 5E2TH 4J3TA 1ZVHA 4OZ4A 5CINH 3QXVA 1OAQH 5CGMA 3D48R 5BRZA 2EO1A 2Q8BH 1OM3H 4H8WC 3MLSL 3DUHA 2EDFA 2XZZA 3CPLA 3JSSA 5HHNA 5JW4N 4DAGH 2A77L 3QIUC 3SKUD 1L7TH 5DT1L 1GGCH 5CZKA 2MJWA 3X11B 4W6XB 5D7SL 1CGYA 1QOKA 1A47A 2O5ZL 3IDUA 4PJCE 3WXWL 2MFNA 1NGXA 3ALPA 5BZWA 3HB3C 3DUSB 2G2RA 3MREB 1ZLUH 4YQXL 5D96B 3RHWK 3VWJA 3H42H 4IIQB 5GRZA 2H32B 5CAYB 1LP9F 4NRZA 4HEPG 4HUUA 1S7SA 2BDNL 3QDGE 4Q6YA 2NLJB 4OZGF 3LB6D 1U8IA 3U83A 3V6ZA 2PR4H 5CCKH 2XWTB 4NQEE 1LO3H 4ZS7L 2C3VB 1P4BL 3DIFB 3EJJX 1FGVL 2KZWA 3ARDC 4U6YB 1WC7A 1XCQB 4XPTL 2X9YA 1EV2E 4NOBA 1XEDA 1PKQA 1Z2KA 3VD3A 4Z7WF 1HXMB 2YZ1A 4C56A 3RGHA 3CSBA 5K9JH 12E8L 3ZTNH 3BEVA 4PRDB 3B5HA 2OTPA 4TUOA 2BP3A 5HGHA 4ZOCA 2PYEE 4F7PA 4KY1H 3VJ6B 3EFDL 3ARED 3PL6B 4JFEA 1I75A 5DI8B 4IOSD 3BPLC 3EGSA 3K1KC 3HMXA 4R8WH 1NLBL 2V5YA 3ZL4H 5ICXA 5KG9B 2APFA 1Z0NA 4ZUSB 2Q7YB 5D1XD 3G5XA 1EO8L 5F7FA 1U3HD 2HJLB 3NCCB 3TO2A 2NXYD 4UAOC 2XQBL 2Z92B 5GGQH 1WT5A 1V5JA 1ZT1B 1BZ9A 4W4OC 1PX3A 1OP5H 5H37H 3WFBL 2Q6WB 4FQ2H 1JBJA 5TE4H 4Y1AB 1IE5A 1MCCA 3OPZH 3ESUF 3QIWC 2E6PA 4QRRE 1HKFA 2IQAA 1LILA 2VXSL 2BNRD 3C5JB 3MLZL 4JG1L 5IFAL 35C8H 3N9GL 4JM4H 1FL5A 5FF6B 3WS3A 5LVEA 4GKSA 4YDJB 3RWFA 4Q6IA 1MRCL 4QYOB 2PYFA 2AK1H 3RU8H 2PTTB 2F54A 4PGBA 4ZOEA 4PGDA 2X10A 4OKVB 1REIA 3MJ9A 4RQQB 1S78C 3CIQA 3Q6GL 2PKDA 1A7OH 1MJ7L 2IFFL 2ZUSA 4PD4J 4FG6C 2EYSA 1YUHA 1MHHB 1KPVB 4GG6B 2QHRH 4M1DL 3VCLB 1AE6L 4JQIH 4HFUL 1G9NH 4G8GA 4U1JA 1KJ2A 3EYFB 4UZGA 5EU7C 4GG8B 3HE6A 4XXDA 4YZFE 5EWIL 1KB5B 5IHLB 2XNAA 2NY1C 4RBPK 3MLRH 5F9JA 5DMJB 1N6VA 4NDMA 2P7TB 4PRPE 5GRXG 5LAXA 2QLVB 1CF8H 5DWUH 5TDNB 4PJEB 2VDMH 1D5BB 3KPSE 4LFHD 2IADB 2R9HC 3LS4L 2DTML 4X5WA 5C0BD 4HWBL 2OTUB 2V9QA 5JNYB 1E4XL 3NPSB 3O45A 1JNLH 4HG4K 1KENH 1C16B 1WAAF 3W0WD 3BMVA 1ZHLB 3WD5L 3F7VB 4PJAB 3GJFA 4HS8L 4N8VG 3MGOB 3LQAL 2CMRH 3QNYB 2FJHA 3AU1A 3H9HB 5T1DL 1PY9A 1LK2B 4YGVB 4HV8A 3T8XB 4Z7VF 3SBWA 5HY9B 2OX5A 1X5LA 3F65A 3TH2T 2C4FT 2FWOA 3V5HB 2ITDA 5GHWL 4X5XA 4LDEB 2VLKB 3CDCA 4XP9H 4P48A 3R1GH 1MIEH 2I07A 1CGUA 4N1EA 1C1EH 2EEDA 3VXOB 4MD0A 4KI5E 5FO9B 4P2OC 1OARL 1FO0A 5EOQH 3LPFA 3OKNB 3UBXI 1UZ6E 1IARB 4LQFH 3EOTL 3C60D 1MRFH 2D03L 3U7YH 4MCYA 4NQCE 3WNMA 1AY1H 4DZBB 1P1ZB 1B4JL 1U8KA 2VDQL 2AV7A 4WW2B 3UJTL 1MCJA 4UBDD 5F88A 4L4VD 4PP2A 3DI3B 3R8BB 1C8PA 4J1UB 1TVBB 1DE4A 3QIBD 1A6UH 3A6CH 5D7JC 1HCFX 1MLCB 3VW3L 5DJDB 1AGEA 1VHPA 5KSBF 1AGFB 5DRWB 3N0PB 3MYJB 4JY6A 2YC1B 2AXGA 3NGBC 1EEYB 5E1HB 3KPMA 4R3SA 3FN0H 4A2LA 1A6AB 2J6EA 2YHGA 4IRSD 5CFHA 1CLYH 1VPOL 3ULVL 4BKLA 3GB7A 1NLDH 3K0WA 4KKAD 2VDLL 4RMRA 3MTRA 1JMZA 3B6SA 1X6LA 3VRJB 4AZ8A 1ORSA 2Q3ZA 4WW1A 3QYCA 4JO4H 2P8PB 4NWUL 3DTXB 3ZHDA 5F7KC 4E0RB 1RY7B 2F53D 1BEYH 3QDJE 3BEWB 4QHMB 5ANMA 3MRPA 3LH2L 4NRXB 3DLQR 3MRCB 4WCYH 3BH8A 1CE1L 3MLVL 4NYLA 3LKNB 2ICWB 4ZNEA 1DUYB 4QRPD 4JM2B 1MLBB 1UWEH 1KYOK 1QBML 3ZDZF 3VFMA 4OCRH 5E56A 4JPKH 3RY4A 2NY2D 3OZ9L 5DA4A 5B21A 5I1HL 3LN4B 1A0QL 2BCKB 1MEXH 4BSWB 1DBML 1AI1H 5E8PB 5DF0A 2APVA 2R56L 4YHOL 1O0VA 3VFRA 2Y4SA 5KS9A 1I1AA 4QHNA 2FYYA 4YDVB 1F4XH 3S5LB 3MFFA 3OG6B 5FCUH 3SO5A 4OB5H 2HN7B 4P23D 5C0AB 1BREA 1F6FB 5ESVB 1R24A 2B20A 2H32H 1EBAA 3HI6L 4OJFH 5FGBA 2VITB 3MV9D 2ED8A 4N90E 2R2HB 1IM9D 5J4MA 1B6UA 3JWOC 1X5FA 4RGOH 4PLJC 2R4SL 4I2XB 1SJVA 2OLDA 5E08H 4FABH 3PIQB 3QB7C 5FUCC 1MJJA 4DK6A 3IJHB 1LO2L 3UAJD 2DKUA 2BNUB 4P59L 3C6LA 3FHQA 3G9AB 1F6AB 1GGYA 1UCBH 4PJIB 2CKBA 4ZFFB 4LAQH 2DM3A 3VXTB 4WHCA 3C9NA 5E8DL 4Z6AT 5JTWA 1AO7D 3HE7A 4K3EL 5C0FB 1AP2A 4NZTH 4OLYL 4MB3A 2DD8H 4P2RB 5IROC 5GRUH 3HG1D 4X9IA 4PJFE 1MJ8H 5IMKB 3PJSA 1G6RH 3HS0B 3PQYA 4LARL 2ZNXA 1QNZH 3MRRA 5B22A 2AK4D 1T0PB 3MRGA 1TQCC 4K07A 4YK4C 1F4WH 3FQUB 4LPCA 5DC4B 4QRQB 5EC2A 4QXTB 5IB4B 4JFOA 4NJAL 5ALBL 1VGKB 2HLAA 5IW1A 5LKNA 2QR0B 5H35A 1RJLB 2X40A 2EDKA 3TBWA 4F15C 5GZNC 2GT9B 5KVDL 3RTQC 1VACB 5BVPH 4YE4H 4XT1C 1QFWM 2JF1A 5FECA 5HJ3B 1QR1A 5D9SB 2VH5H 5SX5H 2FX7H 3D87B 5JDSB 5KSAB 5ESQA 3MNVB 5AWNH 2IC2A 3SDCB 3G5VA 5KVFL 1IM3A 2GHWB 3MJ8B 4GBXC 4U0RB 2Y06L 1DR9A 1FG9C 4V2BA 2JCCB 5EORH 3P0GB 1J1OH 2IQ9L 3W9EA 3V0AC 3NFNB 4F7MA 3PDOB 4UV4L 1T2QL 1I7TB 2LAAA 1YEKH 4Z7NE 4S1QH 5CEZL 4HKBA 4M8QA 2IH1B 3D0LA 2D2OA 2FL5B 3BX7C 3RZCC 2IBBA 1ZT7B 5EFIB 1NDMB 3P77B 3HMWH 4L4JA 5EU4B 1FSKB 3WNNA 4AG4H 5BOZG 3S88L 1EO5A 3VXSE 5JUEH 4V1DD 1G7PA 2VL5A 2G60L 5F7YC 4I0PB 2A6KB 1IC7L 4TVPD 5JOFB 2EIBA 2NMSA 5I1JL 2ZP0T 3NH7H 1JWSA 1U8NA 3IFPB 4Y2DA 1T21B 3ARTA 4PGCB 1FL3A 3TJHD 3ILQD 1OSZB 5FM5O 1BVZA 1XGYH 2VAAA 3ARVA 3K8KA 3O11A 4PJCA 4X7CC 4LEXL 1ZHNB 5F1OB 3O6FB 1S5IL 3HC0A 2ATPB 2NY5C 3WO3B 5CSBA 4QOKA 1A6ZB 1MRDH 2XWBB 3HKFA 3H8NA 1DVFB 3QDGA 3MQIA 4Q9RL 3I6LD 3K4ZA 1ZS8A 1JF5A 3QZWA 4MNGB 4P9HH 4L3CA 4KRNA 2E9JA 3NIFE 4C59B 1GAFH 3V4UH 4KRPB 4L4TD 4NQEA 5J89A 4TULH 4MA1C 5EU7E 3U4EB 3G5YB 2C7UB 2WNGA 5I17B 4RRPG 2FNBA 4XPBL 4DOHE 5DRNA 1ZXQA 4X9GA 4AENA 5ICYA 5ADPH 1JP5A 1LO4L 1ONQB 4G6JL 1A1OA 4QHLB 1A7QL 1VEMA 2DQDL 4WFED 2XZCH 3S9DB 1T5WB 1NBVH 5L2KB 2MKWA 4U1SA 3TGXA 1ZVYA 1A3QA 4YBLB 2XPGA 4G43B 3RNKB 4UT7L 4JANA 3TBTB 5IHZA 2MNUA 1WTLA 3PWJA 2J8UF 1AXTL 4XP6L 5E2UL 1OTSC 4HPOL 3CXHK 5C9KA 3NMEA 1HSBA 1LD9B 1XR8B 4Z0BH 1YY8B 3TN0D 4JFXA 2P5EB 3D0VA 1C5DB 5E00B 1KT2B 1RHHB 4YIQB 3CSYA 1FNFA 2CRIA 3RVUC 1C12A 3VGAC 1S9WA 4G6AD 3O4LE 3DHMA 4KVNL 5BO1H 2Z93B 2KQMA 4UNVA 2AEQH 4PPTA 4F7CA 5E6YA 2A1WH 1DP0A 1BECA 4NQDE 4QRRA 2GTZA 3D85A 1MREH 4Q0XL 1UWXK 1XF4B 2FX9L 4NP4L 1FNGA 3ZKSD 1JPTH 4PRIB 4IHOA 4JN2B 1AXSA 5A3IC 4P2YA 1PVHA 1G6VK 3M07A 3KYKH 2JJSA 1XGUB 3O2DH 1CXHA 3TNNA 3TZVD 4L9LC 4KVCL 4GLRH 3ISWA 1CLOH 1KXVC 4U6XA 4RFNC 5GS1B 3EO1A 3FT3B 3BKCL 3ZT6A 3DX7A 2DWDA 4RX4A 3B2VL 1W2KT 3C8KB 3U4BL 1E27B 5KN5A 3B2UC 4QXUL 3CJJA 4Y19D 5IQ9B 4MJ4A 1NEZG 2FHBA 4KQ4H 4F9LA 3FQNB 2AGJH 2J4WL 4G8EA 3IDJB 4P9MH 3IFNH 5KW9H 4JO2H 4KTEL 3PDGA 1DQJA 4O58L 3N50A 4GMTH 3BIBX 1FRGH 4P46B 1CGXA 3OL2A 5MEPA 4HIXH 3HNSL 5EO1B 2BNQA 3BH9B 4OD1H 4CU8A 1Q9LB 2V9RA 4YHKH 4FTVD 5BV7L 3MBEC 4EDWH 3BAEL 1F58L 2G5RA 2CGRL 2WBJA 4LNVA 25C8L 5SX4I 5J12B 3KPSA 4M8VA 1NFKA 3IAPA 2VXUL 4XTRD 1LO0L 4R2GC 2B4CL 2VB5A 4P5KA 3IU3A 1JWMA 2CO6B 5F9WB 4OZIA 2WWMC 3F6LA 1UA6L 2GYSA 1GGIH 2VABB 2OXGA 1EGJA 2NTFB 2WQRA 4EJ1C 4MZ2A 1IZJA 1C5BH 2VDRH 1FNSL 3HI1A 5C09E 4JPIB 2ZUYA 3VFUB 1KG0A 4U1KA 1ZLWK 4G9FB 2HTLC 1D9KA 1CS6A 2GCYA 3THML 5JW4M 3WIHH 3HPJA 1HDMA 5L88L 2Q3AA 3EO0B 1CDBA 4B5EA 3P3YA 4P4KC 5JW3H 3U30C 1XIWB 5E8NA 3DRQA 1QYGL 5IW6B 3IT8D 1YNLH 2DMCA 4HKJA 3MV7A 1U42A 4XP5H 1E4KA 3QULA 3G5ZA 3H7BA 3U9UB 4ISVA 5J1SC 2NY7H 3QHFH 4JRXE 5HXMA 1TCRA 4Z77A 4U6VH 4FQHB 3ARBD 4NQCA 3QG7L 1JHLH 4JFFD 5T3ZH 1GPOH 3GSWA 4JB9H 1LEKA 4ZXBA 3T4AA 2O61B 1BF8A 1QEWA 3MACL 3UTTD 1FV1B 1RK1A 5FO8B 4FXGB 4HS3A 2DQTH 1ZA6B 4XC1H 5DHYA 1U6AL 1YPZE 4OZHE 1ZHKB 4OLVL 2HG5A 2FRGP 1ZTXH 3BDYL 4G42A 4JKPL 1G9MH 2L4OA 4P57A 1HHGB 1KNOB 4UINL 3KPLB 4N0CC 2VLRD 3EOBB 4X7TA 1CFQB 5CD5D 3RX8A 2CLRB 4CW1A 1NGWB 1S9XB 2YUZA 3EKCA 4L9DA 4HKZB 4M7JH 1ED3B 1NMBL 4EI5B 4F33B 4LRIA 4YXKL 3KAAA 2XFXA 5SWQB 1FCGA 3R06A 3RAJL 3IDIA 5INDB 4R97B 3MJGX 1AXIB 2YPLB 4MA7L 7CGTA 3QXAB 1V7NL 3GUTB 4ETQB 3WLBA 1JPGB 1OF2B 3NCFB 3QO0A 1JHKH 3V6BR 2JK5B 4F58H 3KPQB 1JF6A 1K85A 4OLUH 1OGTA 1I3VA 4BUHA 5LBSH 1RK0B 1IAOB 1QKZL 3IDNB 1CIUA 3UTSB 4MXWL 4PJ8B 2BJML 3GSNL 4NFDA 5FYJD 2Z31C 4M61B 3KDMB 3V6FA 1QFPA 2LFGA 4XHJC 1SJHA 2R0KH 3G6AA 2HKHL 4P5MA 3VWJD 2C1OB 3E0GA 3L6FB 2AJZB 4OZFB 2D0FA 1BQHB 5I1DB 1DBAL 4GMSL 1S8DB 3FCTB 3W82A 4U6TA 5FB8A 2F5BH 1JYVA 3KJ6H 1Q0XH 4HXBL 4PGEB 4U3HA 4ZUWA 2AEWA 3L95B 3EAKA 4Q9QH 4KFZC 1AFVL 3BRGC 1ACZA 2IWGA 1FNHA 1FVDB 2CUHA 5FYKL 5IR1A 1YN6A 4Y8DC 3O41B 4OT1H 1OP9A 3S35X 3WEXA 1U9KA 3GHEH 1KN2H 3QI9D 4ERSH 5I9QB 4HWZB 4MAYD 1RUKH 4C56D 1XZ0A 5TDOA 1J0YA 4HUWB 4TUKL 4I0CC 1YA5A 4OQTL 4K9EL 1FNLA 5DRXA 4D9LL 5I76B 3ES6B 3PHQB 3HZVA 3ZKMD 1MJUL 2CRZA 5CUSH 4XVJH 3UJJH 1NC4D 4Z7QE 3TIEB 3WFDH 2ZCKL 3BP7B 1XR9A 4JFED 1UB5A 4FZEL 2BX5A 1UYWH 3PV7A 3ULUH 4LLUB 4RSVA 3SGEH 3TO4B 1NC2D 2O26U 1WJ3A 1FG2B 3O3DB 4GW5B 2NY4B 3VRIB 1CL7H 3DXAA 1PDKA 2AW2A 3RPKA 5IFHL 3UXFA 4WTZA 1S3KL 5DHVA 3CH8A 3HFMH 2CDFA 1KIQB 2WP3T 3MYZA 1T04B 2R4RH 2R1WA 4GXVH 3MLWH 4HJJH 5D2NC 3ARFB 4TSBL 1ITCA 5BW7C 1K4CA 3GBNL 4PS4H 4E42A 4UT6L 1TENA 1K9TA 3MCKB 3AY4A 4U3CA 5DJ8B 4HBCH 1CDIA 4X4XB 3HUJB 3WO4B 1KCVH 1S7TA 4M93C 1YDPB 3E8UL 4KMLB 3VFSA 1OCWL 1UJ3B 2QEJA 2VDOH 4HK3N 5E6ZA 1QFOA 4JZNA 3LS5L 4M5ZL 4X6DF 1NCBL 1T89C 4ODTL 4XAKE 3P0VL 4OGYL 4F8TA 3VRLF 1JZ7A 1B88A 1MFCL 1Z9LA 1Q1JL 4PRBB 1Q9OB 4ODUB 2F54D 1JRHH 1I9JL 1TTGA 1ZE3C 1DN0B 3QDJB 5HHMB 1QRNB 4Y4HC 1YECH 2VZVA 2FHFA 4HK3J 1EEUA 4Y4FB 1K6QL 4GRWF 2MQ3A 3VXSA 2GK0B 1K2DA 5HYSG 3MOAL 2DI9A 1R3LA 1E4JA 2W07A 1H3WM 2NLJA 4Y4KC 4CVXA 1LEIA 2JJUA 3MUGB 3BP5B 4XXCA 1AKJB 2DI8A 3KYMB 4K23H 1Y18B 4XCFL 1Z6JT 2V5SA 1MFAH 4OM1H 4YH6A 1OAZL 3QUXC 2XWTA 3I02B 5IBLD 2LVEA 1B2WL 5FGCB 4WUUD 3MR9A 3VI4E 1J8HB 2C3VA 3DIFA 2ZSWB 4DKAA 5FHAH 1MWAH 5KVGL 3QQ3A 4YUEH 2P5WB 1XCQA 2AVGA 4PFEA 5DMIH 4CJ1A 1AGCB 1YQ2A 2WINA 3D6GA 3WHE0 1IT9L 3B8SA 3GMOA 4GW4B 3UDWC 1J0KA 4FQJH 3RUGB 1U93B 1IILE 1ZHBB 3ZE1E 1BX2A 2YD4A 4HH8A 1T6VN 1FIGH 4DZ8B 2HT3D 3CU1A 3TPUA 4GQ9H 4HH9B 4OF8A 3BN9C 4Y0GA 3GSUA 5C8JA 4ZTOH 5EPMB 1H8SA 3BZDA 4ZDHA 3VGFA 3T2OA 1MHCB 1EAJA 4EUPG 3GIZL 1QSEB 3ZYOA 5JXEC 4R4NC 4S2SB 1YEGH 4LFHG 4WI9A 5EA0L 1NAMA 4XAWH 1GZQB 3BSZL 3AMKA 4C4KO 1YY9D 4O2FA 5FM5M 5I30H 2HFGL 1IQDB 3QT2A 4XB8A 1CBVL 5D2LB 1T1WB 3C5ZC 4Z8FL 1F3DJ 1TJIL 3LN5B 5I66A 1GIGH 5LCVH 2HJLA 4GKZB 4UTAH 3P73A 4YBHA 1FJ1A 4L3ED 3RL2B 8FABB 1ZT1A 5AZ2L 5HD8D 5FYJL 3ARDB 3WN5C 4XC3H 2PXYC 2JB5H 3RJQB 2AJYH 3S35H 3T0BA 2YS4A 1I7UB 5JLZB 2DM7A 3EYSH 3ZTJH 2Q76B 2Y9RT 4F8QA 3KXFD 4JFDB 1ACYH 1R0AH 1HN1A 5DD0L 2VE6B 5I8OH 2FD6H 2RB8A 5FF6A 1A6PA 5GS2H 4H1LG 5ABDE 4DUVA 4LSTL 3GMQB 3ZDYE 2DQIL 4QYOA 1N2RA 3SDDD 1R5VA 2UWEB 5J1AB 5INCB 2HFEB 3QXUA 3BPLB 4NQDA 2AI0H 1BD2E 2PTTA 4M9PA 5DR5H 2XTJC 1CN4A 5BMFH 3DX6B 3P0YH 2VXVH 3LAFA 3PHOA 3F7QA 5C70A 5L6YL 3MJ7B 4RQQA 2NY6D 5JOPE 3IDGA 2R0ZH 4PLKC 4RAVB 1UACL 2J8OA 4NHCH 4UAOB 3H9SE 1JE6A 3U9PH 3U79A 3ARGD 4YFEA 1XMWA 2F19L 2SEBB 2I5YH 5FUZL 3SGDI 5KVEH 1EJOL 1KGCE 3QIWB 4Y5VC 4ENEC 2E8ZA 1A6VL 2JIXA 1KB5A 4ZFZB 5D7LB 3RQ3A 5I18L 2EH8L 1SQ2N 4BELD 4PJ9A 1J0HA 1G7MB 3EZ8A 1I1YA 5A43C 1TZIA 1HIML 4PJEA 4PJXB 5TDNA 1RHFA 4K8RL 3DECA 1H3XA 1JGDA 1I1AD 2EXWD 4TUJA 2VSDA 3LSOB 5F71A 2OTUA 2UZXB 1NL0L 5DJXB 4XPFH 3RA7H 1OTUC 1P4IL 1FYTB 4PRNA 1ZHLA 5GGTH 4OCXL 2IGFL 2R0LL 2XN9B 4PJAA 1BFTA 5D7IB 3EDEA 3WJJC 4KXZH 3B9KA 4JFHD 3H9HA 1BZ7A 1JI2A 5BVJA 5TPWH 3T8XA 1QQDA 2D3VA 4OZFH 4X4ME 4YDKL 3S3PA 2GSGB 2H1PL 2YD9A 1NMAL 3ROLB 4U1MA 1JTOA 1FH5L 4HLZG 4HCRL 5CJQL 2E6JA 4DN3H 1P7QB 3VXOA 3MCLL 4MCZA 2OJZH 3KHOA 5D5ME 2D0GA 4G8IA 3D3VB 2GAZA 3WV0A 1A6WH 2R29L 4PB0H 1DFBH 1IMHC 1KULA 2NX5B 5GSVB 5JPNA 4ZSOE 1YEDA 1KIPB 1F3DH 1CIDA 1KC5H 4I18A 3LQZB 3WUWG 5IQ7L 2Q1EA 4JY5L 3ZE0F 2JJVA 3SE8H 1UKQA 3BO8A 5IG7B 1ZA3A 5DTFA 1U58B 3FKUS 1E6OH 3KPRD 1D6VH 3OMZA 12E8H 1O7SA 4NC1C 1UENA 3DHJA 4FFYH 4I9WD 4JRXA 4YXHL 5KJRH 3ARQA 4PG9A 4YHIB 1Q94A 1A6AA 3TV3L 2AJVL 1U8JA 2EIZB 1G1YA 4XPHL 4LCYB 3FFDB 1CD9B 5HHOB 3ZHLA 3BQUD 5DVLA 2IMMA 3LEYL 1JNNH 4QHKI 4D2NA 4EKXA 4OZHA 1DQML 1M71B 1NLBH 3F6IA 4HS6B 4P2OB 2DQCH 4Q74A 4Z76B 1F6LL 4E0RA 3AREC 4D9QE 4JZJA 3MXVL 3SOBH 3KGRA 1KXTB 2EEAA 4QHMA 3PP3K 4NRXA 3MRCA 3X13B 2QSQA 3SCMD 3LKNA 3HAEG 2ICWA 3OB0K 5C07E 4X8XA 1DUYA 2DQUH 5A2IH 5IFJA 4U1GC 3SDYL 4JM2A 4PV9A 1RZ7H 1HH6A 1U3HC 1WWAX 5D2NE 1QD0A 5C0IA 2UVFA 3OR6B 5D7JB 4LLDB 4Y8AA 5GGSA 4R4FH 1QBLH 2VXSH 4FZ8L 3C2SA 5F7UA 4L8BB 3O6LH 3NGBB 3H2WA 4WGVB 4HFWB 1BJ1J 1FHGA 3JBG7 4NGHL 3SKOB 5A2KH 4P2QD 5I2IB 4RWHA 3BWUC 5B4MD 4GAGL 4PREA 2KDGA 2CK0L 5EUOB 4Z7WB 1AQDB 4GAFB 3BW9B 2CJUL 3CFJB 2FZ3A 1FVEB 3WFEH 4QF1B 3IKKA 5DZLA 3SGJC 1A4JA 3Q3GB 4ELKA 4KJQC 4KV5F 1ES0B 4RISH 5FCSH 3UP1A 4XGZB 2NY3D 3RVXC 4IJ3B 4WRLA 3DRTB 2VITA 2GUOA 3HC4H 1VA9A 3E1F1 3N85L 4QOKD 4LSUH 1EMTH 1KTLA 1CTOA 1FDLL 1NCTA 2R2HA 2ID5A 3OKYA 3REWA 3ZKND 3QUKB 1H5BC 4KRMB 4ONHB 1RZKL 4OFDA 3DX8A 5T3XL 1SM3L 3PIQA 1HINL 4YFDB 1ZSDB 1MIMH 4WEBH 5MEOA 5IEHA 2EE9A 4NHUB 1HHIB 4H8WH 5D72L 2OR9L 4ZFFA 1FZJA 4J2XA 2XZAL 1ZWIB 1YYMH 2DLIA 4O02H 4KZDL 3K80A 3UBXG 4O4YL 1EBPA 3ZSTA 3BE1L 3CVIL 3QDAA 2PO6A 3STZA 5GRJH 1QLFB 2H45A 5IMKA 3TJEL 4L8SC 4NN7C 4Z18A 4LU5L 5I8EB 2JELL 1SBSH 2VDPH 3ZYIA 3TESA 1NBZA 2RFXB 2P44B 3LIZL 4YHMH 3FQUA 4NKDA 3AS3A 4QRQA 3MUJA 2WUBL 4QXTA 1PYWB 4O2EA 4OF3A 2QV2A 1VGKA