2X1XR

Crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2 in a tetragonal crystal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
201
Chain Sequence
RSPFIASDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINSYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/signaling protein
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR C
publication title Structural Determinants of Growth Factor Binding and Specificity by Vegf Receptor 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 201
sequence length 205
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1xR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1xR01
5F96L 3BRGC 3ULVH 3W9DB 3OXRA 5ENWA 3DI3B 4PRNA 4ZOBA 2YEZA 3LHPL 1INEL 5CJQL 5A2KH 3T65B 4JREB 4PV9A 3GKWH 3FQUB 2HT2C 4Z7VF 3VXSB 4APQB 3V4PH 2DRUA 2P47B 3IF1B 5C92A 2ICWJ 1GSMA 3U7YL 4HJ0C 5IESL 4LSQH 3MGOA 1AP2B 5DJ2A 2VQTA 5J6GB 1YNTB 2CRIA 4WUUD 4HWBL 4PPTA 4FQ1H 2DDQL 1SQ2N 1E28B 1HN1A 2AXGA 1JPTH 2X4TB 1TVDA 3TBWA 1BD2A 4FQIL 5HYJB 4XC1L 3JV0A 1UVQA 2W60A 5LXGH 4YLQT 3G6DL 4JQXA 3ARTA 4MA7L 5JIKA 3UBXB 2R56H 4LEXL 5TF1H 2ED8A 3HNTL 3BEVB 2VAAB 1KTLB 5J8OA 2HAZA 4RGND 5ID0A 1Q9LA 1SM3L 1C5BH 3H3KA 1RVFL 3ILQC 1B0RA 4CW1B 2EXWC 4KROB 2ADFH 1NFDF 1OAUL 1NGPL 4IMLA 3GHBL 1T1ZB 2E3VA 4AY0A 4X80L 1IFHL 1MJ7L 5GGQL 5I74C 4S0TD 1DBBH 1RHHA 4DUXA 3KJ6H 1UM6L 4PGJA 5C0BA 4I0PA 5EU6D 3KR3L 4I8DA 2DTSA 3CZFB 3T77B 2P8MB 4CU8A 3MOQA 4OZHA 4IJ3C 4Z8FH 2GAZA 5JQHC 3U4AA 5GGSY 3QAZB 4NSKA 4XZUB 5D96C 5DJ0B 1I7RA 3ARBA 3SQBA 5C0NC 4NZTH 3G5VB 2VLME 1IL1A 1P9MC 1GOFA 1G6RL 2Q7NA 5C7XH 1S9XA 3T4YB 4LSRH 5IJVA 2JCCF 4URTB 3WXVL 5GS1B 4EZMA 1G9NH 1D5IL 4QXWA 5DK0A 1EZVX 3H7BA 4ONGH 5DHYA 1F8TL 3MV9D 4QT5A 4V1DB 4XMLH 2NY4C 5D2NE 3SDXF 2VC2H 3CSYB 5CD5C 2W07A 5C2BH 3CVHH 2ZOLA 4BFIB 5TFSH 3HPJA 4KMTL 1S5IH 1YPZB 1UZ6F 2BNQA 3BMVA 3MXWH 3I2CL 5F3BA 1RU9L 4WU5B 5FCUH 3I50L 3IJSB 3H9SE 2NXZC 3O9WA 4HKXB 3RL1B 3QUYC 3D9AH 5DMIL 1UM4L 4S1RL 3ARPA 3PL6A 2M2DA 2GJZB 4UTAL 4Q9QH 4HS3B 4KZDH 1ZHLB 2OSLA 4HH9B 4OZGE 3ZE2F 5J1AB 3VXPA 2V2WB 4ZSOA 5FGCE 1KYOJ 4PR5B 5ANMA 1ONQB 2YRZA 3RDTB 4QOKB 2DQTL 4OD1L 2Y4SA 1A3LH 4Y4KB 2YPLB 1XIWC 4QRSB 2H9GB 3B4NA 3EAKA 3FB5A 5HY9A 4EN3D 5FYKL 6FABH 4LLDB 1QPPA 3BEWB 1V05A 4U1IA 4PBVC 5JPNA 1DLFL 2BOCB 4LIQE 3WYRA 2Q86B 3SGKC 3FN9A 5CLWA 1ZTXH 3PJSB 5IT2H 1NCNA 1I1AB 2BSTA 4PJ8A 2OCFD 3QDGB 5IBLC 3SDCC 4HW6A 2KPNA 1U8KB 3TO4A 2QADC 3QNXA 2R2EB 4O00A 4FFVC 5E00B 2Q3ZA 3OR6A 3SE9L 4GG6B 2YD2A 3UX9B 1BGXH 1KB5B 1XR9A 3CSPA 3Q3GA 1NSNL 2XIDA 4AEIH 2A6DB 4P5TB 1UH2A 3EYFB 4Z7WA 1LNUA 1REIA 5EU5B 4C59B 5GRWA 5LAXA 1S78D 2C1PB 3RVVD 2J6EL 1CFBA 3X13B 4YHMH 4XTRC 3BPOC 2VLRD 5FF6B 2E7LC 4NQCB 3RWCB 1BPVA 3UZEA 4Y5VC 5DLMH 1RSFA 1J0KA 4LASH 3VFWB 4OZFG 1NC2D 5D2NA 2HFEA 4D3CH 1R3LA 4WEMB 4YPGB 2R69H 4E5XA 4GAFB 2PO6D 3SGEH 1RIHH 1N64L 2FR4B 4Y2OA 4M61A 2FEDC 5IB4B 3H9SA 4WU7A 3NZ8B 1S7RB 1T66D 5HDBE 2CO6B 2Q1EA 3LEYH 3ZT6A 3E6FA 2R0LL 4S1QH 1JHLH 3MLUL 2E9IA 4PUBL 4H1LA 3SO5A 1NCWH 5ICYB 3NFNB 1DN0B 4EJ1C 4OZGA 2H2SD 4OV5A 3TPUA 3WIHA 5DT1H 4B7IA 5I15L 4JG0L 4KVNL 2PCPA 3CXDL 3VJ6A 4ZXBC 3T0EC 4GH7B 4YDVA 1MRFL 1NCCH 1VKXB 3L3KB 1ZSDB 2FLBT 3JBG7 4KY1H 3BHBA 4P99A 3EUUA 4DGIH 3K2UH 5C0IB 3HN3A 4WDIA 3EFDL 5SV4A 5HPMA 4L8DB 1R3IH 2YBRA 3NFPB 3U2SA 3WIFA 3QFJE 4JZJB 4O9HH 5DZOA 1I7ZB 5IMMA 1GOHA 2FDBP 1D3CA 2EH7H 2OP4H 1F4AA 1BECA 1T0MB 3IFOA 3MXVH 4LPYA 4OLUL 4KJPD 1BD2D 5E08L 3GBML 5EPMB 4PY7B 3VXMA 2C3WA 4O2EB 1UA6H 5JHDB 3TBTA 3P9LA 3MX0A 1DEEB 2ESVE 4PJ9B 3WKNA 3QXDB 2AI0H 3IS1X 4RMRA 5KN5B 4O5LH 5BXFB 2C9AA 1U8IA 1FP5A 4OUOA 3FT2A 5I1GH 3FQRB 5FKAB 3DIFB 4XNYL 1KN2H 4W4OC 1OTTC 4QEGA 5SWZB 5DHVB 3OKYA 4MQTB 4NM4H 3WD5L 2W1NA 1J8HA 1T5WA 1TNNA 2VDRH 5LGJB 3BE1H 3S98A 2XG4A 1R3KA 4N8VG 4U7KA 2DM3A 4LNVA 5C0BD 4HXBL 4ERSH 4OQ1A 2VLKE 5KJRL 1VADA 5T3XH 4Y5YB 1AJ7H 4TSCL 3I3EA 2X4QA 3H9ZA 4PJAE 4PJFA 3V6OA 2J5LC 2VERN 3IKCB 4KKNA 5DFVC 4Z7NF 2Y5TA 4N0UE 1I1YB 2N4IA 3WS3B 3LKNA 3P73B 1YJDH 2VDKL 3HAEA 4JKPL 1BFVH 3ARBD 5HHVL 4AH2A 2JLLA 2EDXA 2XA3A 1B2WL 4IRJC 4LHUB 2PYED 4K2UH 3ORJA 1EV2E 4HIIB 4JFXB 3TN0A 3VXTA 1SYVA 3O2VH 3JWDC 4HJGB 1HHJA 5EBLB 1UJ3C 5DHXB 1BIHA 1QYGL 2XFXB 1IAOB 2CUHA 1PYWA 1NBZA 2W9DH 1NMCB 2D9QB 5JO5B 1IBGH 4CRPA 4RDQG 4Y4HC 2CDEB 2QBWA 2QEJA 2UUDK 5BOPA 1QZ1A 3ZKND 4LU5L 3TBSA 3OKKA 1BQSA 2XQBL 5IVNA 5KVDH 3JWOH 4NRYA 2BNQD 4G8EA 4G6MH 3HB3D 2XOTA 5D1XA 2XTJE 1JZ6A 3DXAE 2AJ3B 2Q76B 3O9WD 2FNBA 2XRAL 2ZCKH 3CXHK 5JA9A 3D87B 5CS7A 5C6TL 1E4XL 1WLHA 3MOBL 4PJEE 2ADJA 5FB8B 1FV1B 5DVNA 1OD9A 1R5VA 1MAML 1I7TA 2DJUA 4TQEH 3WNMA 4R96A 3NACL 5ERWA 2VIRB 2OJZL 4HUUA 1X5AA 1MCOH 5KVGL 1NBVH 4YIQB 5B39G 4E0RB 2AV7A 2FJFA 4R97B 1J1XL 3BDBA 4M3KB 4OGAD 4EDXA 1CLZL 1U8NA 4L8SA 4PJDF 1WCQA 5L0QC 1A1MA 1BMGA 2A77H 5D1QC 1OAYH 1S8DB 5F89B 1PVHA 3MLVL 5C9KA 3CCHB 4QO1A 3ELAT 3HE7D 3V6FA 3ARDA 3PP3K 4I2XB 4Y1AE 1YA5A 1G6VK 4PJ8D 4X4ZA 2VLKA 3OKMB 1WZ1H 4UTBH 2NY6C 1JP5A 2XA8H 4PJAA 4PJCE 4PRBA 1GRWA 1SMOA 1MEXH 3BP6A 4L4TE 1OHQA 4N0UA 5C08A 2VMFA 1Q94A 3ROOB 3M1BB 2HKHL 4TTDC 4HJJL 3EYSH 2NW3B 4CN4A 2Z31D 1LE9A 1IGML 3PWUA 3T2NH 2XPGB 2BVOB 5K9OB 2A0LC 4RQQA 1NKRA 2UVEA 3ALXA 4PIRF 1KIUA 1HYSD 1AD9B 2QLVB 1JNLL 5DJ8A 2R29H 3HG1A 4ZMAT 4BUHA 4RWHA 1NGQH 3S9DB 3LB6D 4KK5D 2VZ3A 3N1GC 4MJ5A 2FH8A 5JOPD 4XWGH 5DXWA 1WBZA 4WTZA 3VGHA 2GJ6B 3B6SB 5BO1H 2HVJB 1I9RL 4R0LC 4OLWH 4FQQB 4BQ8A 5CEYA 3DXAA 4J1UA 2IPKB 3HZMA 5EOCH 1ZHBA 2I60L 3H9SD 5F8QC 4HPOH 4MQ7A 5B38A 4O51B 3BN9C 2YC1A 4M8QA 1ZT4A 4M6MH 1G7MB 1VA9A 5HHME 1BFOB 4TOYH 3ZDYE 3B9DA 1GC1C 3H3PH 2GHWB 4JPWL 4DN3L 3GI8H 2GYSA 1IAKB 2X5PA 1FRGL 3QDMD 4IMKC 1H15B 2V9TA 4M7JL 3HI1A 2OR9H 1T0NA 1FAIH 2BHZA 3FTGA 5F9WB 1YDPB 2X9XA 2YA0A 3PG2A 3UJTL 2PW2B 4OCRL 4A6YH 3BPCB 4QYOA 4JM4H 3O3BB 4OB5H 3N1FC 4FN0A 1TNMA 1N0XL 1N4XL 4LSTL 3GBLA 4W6XB 2ZNXA 5F6IC 3SO3B 2R1YA 3VXMD 4Y1AA 1JZ3A 4LLUB 5GGTL 1KC5H 4XAWH 5HYSB 1EPFA 4JRYD 3TT1L 5C1MB 2EE9A 3WIHL 1DQDH 2ORBH 3L9RB 4PJCA 4XCCH 5HGBB 3C5JA 1NH6A 3VFUB 1AGCB 5FOBA 2ZOKB 4O2FA 1QR1B 3TIDB 3FJTA 4EEEA 3QEQB 1LP9B 3D69A 4X9GA 4LOUD 5BZDB 3MBED 4MDIB 3DMMB 2VDQH 4JVUA 2H1PL 3QBTB 4F7EB 1J8HD 4PJBA 5TDOB 3UDWA 3IDGB 1YEJL 5DD6B 4ZAKB 4NJ9H 4HPYL 3EOAB 2EZ0C 4XX1G 2DQJL 3GMPB 5IW6A 1DBJL 4Y5XA 4FZEL 4LIQL 5C2UB 1A6PA 5FAAA 1LO3L 5CSZB 4NQTA 4CNIA 4KUCF 2ZUSA 1C1EL 4XVTH 5AZEL 4X98B 1S9VB 3EYOA 5D70H 3MNWB 1QFWH 4CVXA 3D18B 2H2PC 4N8PA 1NDMB 2Z9TA 3IJYB 4Y19E 2XZCL 3TN0D 2OQJB 3CFCL 2ADGB 4F8TA 4IBLT 4FFWD 1CVRA 3LH2L 5F1NB 5ITBL 5GRVK 5FGBA 1GHFL 1IC7L 2E27H 4X5WB 2H26A 2X41A 4YBQC 5J1SC 4JM2B 5E5RB 4K7PY 1TCRB 4L1DA 2HLAB 4XAKD 1LILA 4I48B 3MA9L 1EBAA 5IJKC 1UXWB 3CD4A 2Q7YA 4JFEE 5JZ7C 3LKRB 3PHSA 1Q9OA 2CKBL 5FO9A 4NDMB 3LV3A 3U7AA 5IR1A 5D1XD 4UQ3A 5GPRA 5CILH 1TJHH 1BOYA 1BX2B 1KACB 3AY4A 1CLCA 3IJHA 3HI6H 3BQUC 3V6ZA 4JN1H 1NMAL 1GH7A 3HCVB 2Q8BH 5BRZB 2DQFB 4WFHE 2F8XC 4NZUH 3T1FB 4JPVL 1N26A 1HHKA 1JZ2A 3AREA 1RJZB 3P0YH 5DRWA 2YPVL 5D9SB 3LN5A 2NY5H 1A4JA 5K59F 3HMWL 5CCKL 2OYPA 3PXHA 3ZKXB 3P0VL 3DRTA 1CGSL 3V52L 3F6LA 3NN8A 1I9IL 4DKDC 1I3RB 3T09A 3DX8B 5DJZA 3S4SA 1CFTA 3L95B 4LCWB 2UZIH 3NGBC 3QUXA 5HVFB 4LCUA 2X42A 1D6EB 2LAGB 3GGWA 4X7CC 1YMMB 4ZO9A 4HWUA 4ZO7A 4N0FB 3C5ZA 1A7QL 1BF8A 1K4DA 2AJZA 3MLXL 1MJ8L 3LN4B 4MB5A 5CP3A 3DUUB 1H8NA 1X7QA 3PHQA 3OZ9H 3ARDD 3ZTJG 5I9QC 1FL3A 3L3OA 1QVOB 5D6CB 1OGAD 2R23A 4OZIF 3OKOB 3RVUD 4OLXH 5DJCA 4JZNA 5C8JA 1MFDL 3MJ9A 1U58B 3BKMH 3BH9A 5C08D 4I4WA 15C8H 4ODWB 1DP0A 3VXOA 2EDRA 2ICWI 5I1JL 5MEND 4GKOA 4L4VB 4PB9H 3IRPX 3O0RL 5IBUG 2DLFH 5IMOB 4Y19A 1CGUA 1DQQB 3U4BH 1JGDA 1MRCL 1GGIL 2BVEA 1EEQA 3RP1A 3HG1D 4AIOA 4P9HH 1I9JL 3SGDI 2DQEH 1CIDA 2G75B 3MLTB 3IS0X 1LEIA 3O8XB 4FQCH 4WEBH 4NKOB 1CGXA 1IM9B 1MRDL 4U1SA 5JIHA 1WWCA 1CFQB 5IROC 4KQ4H 3A6CL 1K3IA 3FQTA 4XVUC 3VD7A 4P48A 3T3PE 4JFEA 1DBKH 4M62L 1LO0H 2NY0D 3RVWD 1U8OB 5CBAB 1YQVL 3GSNA 3MV8E 3X3GL 4TSAH 1S7SA 1FFRA 5FKPB 1ES0B 3X14B 2NY1C 1WISA 3HZYA 2BNUB 1KLUB 1M4KA 5IB1A 1R5WB 3MRRA 3N1MC 4NHCL 1FLRH 4C58B 4QXTB 5JQ6L 1T03L 1F3DH 5DRZA 4LRIC 1P7QA 4ISVB 1J86A 2YD5A 2DYPD 1A7RH 2APXA 3TWCH 2FGZA 2ICWA 4P5KB 1RK1B 1WVZA 5HD8C 1RZFL 4XP5L 4ZNEE 3T0VA 4LLWB 3L3HB 1XIWB 3N9GH 1I8IA 4L29B 3SOBH 2GCYB 4ELKA 1DSFH 4UI2A 1XGUB 1U3HC 2PTUA 3KPRD 1R0AL 4F37K 1FZMA 1FNGA 3V4UH 4D0DA 3BO8B 2NX5E 3O6ML 4LLVA 2YXFA 4MMXC 4XPTH 1BQHB 5IFJA 2CGRL 3GNML 4JY6A 1DUYB 4LLMB 4HIHA 4DUVA 3GK8L 1FFPB 3ULVE 3LKOB 1RUQH 2HJLB 3RWFB 1JPGB 2WWMD 3VH8G 2QADB 2DLTA 4TRPL 2FX7H 4IOFC 1BWMA 4LPCA 1XF2A 3Q1SL 3HAEG 4DCQB 5GSRB 2XKSA 4WW2B 4M1CC 2M8XA 2CK0L 5KVEH 4GOSA 1UGNA 3MFFA 4N0YL 3QUZA 1J12A 1OVZA 4ZS6D 4J6RL 4KK6C 4LAQL 4IRSA 1KPVA 3I6KA 2YK1H 3IFPA 4D9QD 4EUPA 4L8BB 3RGVB 4XCNA 3WFDH 3ULSA 4ZS7H 5I8CA 3WE6B 5EO0A 4U3HA 4Y5VB 5IF0B 4RFOL 5F97E 2OMNA 2P8LA 1AXSA 3CFDA 5JHLH 3QXAB 4LVEA 1KG0B 3O41A 1NUFA 3RWIB 3SDDC 3SDAD 5FUOH 3DVNB 1FBIH 2V7NB 1HE7A 5A2LH 4DW2H 1F4YH 4NQVB 3EIFA 4XBEH 3WUWA 2DM2A 4C4KO 4DZ8B 1EH9A 3BKCH 3FT4B 4JQIH 1FN4A 3CFBB 4RAUB 4KHXL 4Q2ZA 1YUHB 2AK4B 4YPJA 1H0DB 1RY7B 1WTLA 3DHJA 3FAWA 1A4KA 1OD7A 4PJHF 4OFVA 4UOW0 3AB0B 1EERB 4ACPA 3TIEB 5L2KE 1G9MH 1PG7X 3A67H 5FA3A 4Z0XB 3P9WB 2Q8AL 2EEBA 1F45A 1JCKA 1X5KA 2F19L 3B5GA 3WJJC 3RZCB 3QSKB 2WBJA 4AL8H 4ZNCD 4PJGE 3OKNA 5ABDE 2OI9B 2P5WB 4RMTA 5EORL 4J3TA 5CINL 3WNKA 5E2UL 3TNNB 3VGAB 4PJXE 5HTSA 1G7LB 32C2A 4DAGL 3OG4B 4QHLB 5CKGA 3OGOE 5E8NA 3CFEA 3TYFA 2W0FB 5HHOB 5CGMA 4X5XB 3WHE0 3QIWC 1D5XA 3BP7A 4G8FB 3MCLH 4OD3H 1XF4B 3BDYH 1MCEA 4TNWK 3FB6A 1F3DJ 3IAQA 4JFOB 3HS0A 4POYA 5AG9A 2MCG1 1CIUA 1ADQL 3C60C 1AR2A 5ICXB 2VDMH 4G7YH 4M7LH 5IOPA 3EJZD 3F7VA 3Q6FA 4U3XA 3MMEA 1KB9J 4N9GA 2Q6WA 1A7OL 3KJ4C 2VLLB 3CMOH 5E8OA 1JN6B 4EI5A 2H3NA 1OAXH 3WXWH 4Z6AT 3B9VA 4OCWL 4BZ1L 3SHSA 1PD6A 3LKQA 4YH6A 2AJVL 1ODAA 4KTYA 4HUMB 2WP3O 5CLTA 5CJ8A 2VE6B 1QO3A 1RUKL 1ACYL 2BJMH 4JKKA 4YGVB 1UWGL 4NFCA 4X6FB 3MNVB 4NP4L 2DIJA 4P2OA 4WV1A 5FV2A 4OI9A 3MRPB 3MPCA 3L5WB 1KCVL 3OSKA 4FTVB 3V95A 5I17B 4RX4A 4LGPB 3WN5B 5B38G 3F8UB 1A5FL 5A16B 3QHFH 1U8QA 1S9WB 1SEQH 4AQOA 3Q0HA 4GRMB 4NN6C 2GT9A 3PP4H 1CK0L 4GRLC 2F15A 5FOJA 4QTHB 2ZSWA 3VFSB 1AGEA 4K3EH 1JIBA 1QSZA 1AHWA 4KXZI 5EUOF 2F5BH 2IMMA 4XNMB 1FG2A 4V1DD 5L2KA 1P5VA 2PYFA 4PREB 3GRWL 3CDCA 2JJSA 1TZIB 4YHOH 3UPAA 3W11C 2PTTA 1T6WA 4HC1A 1G9EA 4POZD 2GSIB 5T1DH 4LRNH 3AVEA 4AENA 4AMKH 8FABB 1WGOA 1HZHL 4ODBD 4OZ4B 2X7LA 5T1KB 3HC0B 2J8HA 4JPKL 4YFLI 3DTXB 3AAZA 5T5NF 2CXGA 4UT6L 4OTXL 1QRNB 1J05B 5JW3H 5I1KL 4U1MB 3HTLX 5C0AB 4OZHF 4PJXA 5IUSA 1HHHB 3QJHB 5E2JA 2IG2L 4YAQB 4G6KH 2HLFD 1SBBA 4QRTB 5IKCA 1P7QD 2GK0A 2ZSVB 3C6LA 4CVZA 4PGCA 4GXVL 4ZPTB 1MHPL 4TULH 2FO4A 1ZLVH 4G8GB 3W81A 3CFKB 4BZ2H 3ULUH 1XT5A 4KI5F 3D0VB 5E5MB 1NGXB 5T33L 1CL7H 1OP3H 4M93C 2QQKL 1YY8B 1AD0A 4M9PA 1TQCC 4Y4KD 3T8XB 2E5EA 2YPLD 1G7PB 3DX7A 3OJDA 1UT9A 1FPTH 4X7SL 1IEAB 3HNSH 4WI6A 5CIPB 1EHNA 3CVHA 3AMLA 4BK4A 5MI0C 3RI5K 5TDPB 1U6AH 3EDDA 4FFZH 4HG4J 3QQ4B 1PX4A 4GAJH 3GSVB 4OAWB 4GW4A 4U1NB 3IKKA 1FL5B 1NCTA 3SN6N 1UZ8B 1Q9KB 1A1OB 4JY5H 1DBAH 1XR8A 4M1DL 4HIEA 5LQBH 1K2DA 5I66B 3QDGD 4P57B 7FABL 3OHXB 3WBDA 1VFBB 1CT8A 1KENH 4X7TA 1QFUH 3G5ZA 1W0WA 4P2QB 1M6OB 1D9KD 1CXKA 4MXVE 1FE8H 4Z7OE 2FL5B 4TVPD 4M7KL 4GS7B 4P5TD 1UEYA 5E2WH 3QZWB 4JFZH 4DKFH 4PGBA 3VGEA 2WV3A 2Z92A 1RD6A 4KC3B 2VWEE 4XNZC 4ZDHB 1EAPA 3QG7H 3FO1A 3LPFA 1YMHB 3CK0H 1U42A 2KUTA 5HGAA 3TZVA 4YXKH 2AVGA 4K8RL 4R7DB 3H3BC 1SJHB 2DQCH 5IFHL 3FO9A 5MERA 4P0DA 3LSOB 3S34H 3TA3A 1S7QB 3W39B 3WS6C 3RPIB 3X3FL 3CX2A 2NLJA 1ZLVK 3RBGA 4AK1A 2FB4H 4XXDB 4JQVC 3HE6C 3AGVA 3GB7A 1J1OL 4FQXA 4JKWA 5DQDL 2HFGH 3DRQA 2A6JB 4HWZB 4LLQB 2R8SL 3TP4A 1KT2B 4ELMB 2XWTB 1K8IB 4PTUA 4GAGL 4HS8H 3HMXH 3ISWA 4QF1B 4YXLL 2P1YA 4WTWA 5EN2B 5D1ZB 2DBLH 3MBXH 5H37H 1MFBL 2B1AL 3WDIA 3DX6B 1VSCA 1KYOK 3UBXG 4TNVF 2BSED 4LARL 3V0WH 3S36H 3G04B 1UEMA 2WBJD 4JKMA 3S4SG 5T3XE 5DD1L 3G6JE 4GBXB 4ODXB 1A1NB 4JHAH 1C16A 2P5EB 3BZ4B 1RZ7H 3VD5A 3HUJA 4WTXA 1KUMA 4LKCA 4RFNB 3WLWD 1KIPA 3OQ3B 4R90L 2NNAB 5I30L 4CBPA 1KPRA 1NBYB 1Y18B 3VWKA 1JFQH 1Z9SA 4WY7H 5DYOB 5F6IB 4JVWA 1GGBL 3NTCH 1FGNL 4LBEB 4KJWD 4ORGA 3O2DH 5J56B 3HFML 4YHIA 3TJHD 2CDGA 3EDJA 4HUWA 5GSVA 1Y6KR 1AGBB 3PNWA 1ZANL 2O5ZH 3TVMA 1MWAL 4OZGF 1RJYB 2XWBB 1UXSA 3DUHA 4NWUH 5JW5B 1T4KB 3VRJB 3PWLB 4X6CB 5E8EA 4EI5D 3TT3H 4KTEH 5I1LB 1F6AA 1MLCB 3MO1A 1AC6A 3KYMA 4K9EL 4K8RC 5EU3A 1B0GA 2VKWA 4EBQH 5KSAC 5DUBA 3EDKA 3FT3A 2QV2A 1YEGL 1TIUA 1HQRB 1U2HA 3BZEA 1LEKA 3ZMRA 1A3RH 4S2SA 1OLZA 5T3ZH 4Z5RB 4G6FB 3ULVL 3D6GA 5I1EH 1LK2B 3ET9F 3DYMA 2CLVB 4CDHA 4PLKD 5A1AA 1FFOB 1VFMA 3IDMA 3B8SA 4JRWA 4K55A 4YNYB 3GKWL 5DRNA 3GMRA 3RUGA 1M7DA 3QDHA 1BVLB 2YUZA 1H3PH 1S7WB 3QQ3A 3UPRB 1NBQA 4G42A 3U0TB 1IC1A 4LHUD 3QIBA 5EOTB 3SJVA 3TCXA 1W8OA 4X9BA 5J12B 3OG6B 3DV6B 4Q6IC 4PRDB 3RY6A 4LSQL 1GZQB 4I9WE 4NC2B 2CUMA 4AM0B 4QHUA 4OFYD 5DMJB 4HZAA 1ZV5A 5F7LB 4PRIE 5HHXH 4RCAA 4YUEH 2IAMA 7CGTA 5DUMH 1ZA6B 4FQ1L 4XGZB 1MH5B 3ROLB 5DJAA 1JPTL 3KPSA 1GOGA 3FFCE 1YNLH 1A6TA 1C5DA 4GQPH 5LXGL 3W5NA 2R56L 5F7EH 5EU7C 3MV7A 1NEUA 3SDXB 2EO9A 5TF1L 3X11B 4KMLB 1IGCH 1C5BL 4IIQC 3ZYIA 2VN7A 1I8LC 2B4CH 1PZ5A 2ADFL 4YHNA 4BSVA 1RPQA 1OARH 5HDBF 1CYGA 4P59H 5KOVC 5ISZE 3C6SA 4U1JB 1DBBL 1ZT1A 1T3FB 3KJ6L 2Z4QA 3MYJB 3BFOA 4ZFZB 5SWSB 1NDGB 3OX8A 4EUPG 3CAFA 4B53A 4Z8FL 3LRSB 2P7TA 3TNMA 5JUEH 4F7TB 2DQUH 2WUCH 4X4XB 2AGJH 5I9QB 4YR6B 3ULVC 5C09A 1I8KA 1LK3H 4NZTL 1ZVSB 1T83C 3OV6A 3O4OC 1XGPA 1GPOH 4LSRL 1G7QA 5BS0E 2EIBA 3I3BA 3WUWG 3S8WA 5E9DB 1CR9H 1G9NL 1CXFA 1XFPA 1BOGB 4ONGL 4MJ2A 2R2HB 4YC2B 2QSVA 4XMLL 5KS9E 2VC2L 4OGYH 4K94H 1TCMA 3CVHL 4JFYB 4JFQA 5D7JC 1HQ4B 5TFSL 1S5IL 3MXWL 4OJFH 3EDEA 2QKIA 5CEZH 4PG9B 3TZVD 5FCUL 4NHUA 1BHGA 2F53E 4FMFA 4CADA 3D9AL 4KFZC 4CDGC 1WQVT 4PTTA 5CHNB 2VNCA 1JRHH 1INDH 4G43A 3VFNB 4Q9QL 2JIXB 1WBXB 3GMOB 5FO7B 3TA3D 3QCVH 2GJ6D 3PWJA 2ZUWA 3MRBB 3FFCA 2HFFA 3PUCA 1U8PB 2NY1B 2UWEA 1ZT7A 2E7HA 2ZCLL 3REWB 4EN3C 2ATKA 4PJAF 1A3LL 5DC9B 1KJVA 3VWJA 3KDMA 3FONB 4R4BA 5MEQB 4XCFH 2VZOA 1N8ZA 1HYRC 4HKBB 6FABL 1WCBA 1T7VA 5CBEA 1ZLWK 4NRXA 4GW1A 2DI8A 4JFDE 3OXSB 4XH2B 4WFEE 5DVKA 1OT2A 2IH1B 5E6IB 3ESUF 3FB8A 1ZTXL 1K8DB 5HYQA 3U6RB 3ETBF 1WWAX 3HLAB 1CFSB 1MQKH 2H8PB 5H2BA 2V7HA 3K0WA 3QUMA 4JZOA 3S36X 3V6BR 4ALAH 2IAND 4NQSA 4XXCA 4LCCC 2EEAA 1A0QH 1S78C 2I24N 3VWKD 3RVVC 5KSUB 2ICES 1BGXL 5IK3B 3I84A 3NCEB 2ADIA 4LP5A 3WDJA 5HI5C 2APWA 2PXYB 4MNHA 4AEIL 5F7NC 4S1SH 5J13C 1NEZA 3M17A 1WT5A 5C0EB 5FYJU 1AO7E 1CE6A 4M7ZC 4Q97A 3QCUH 3T4AB 3B9KB 4YHML 4F9PA 5BS0A 1IGJA 1VERA 2FEEI 2XZQH 3BP4A 4F58H 4PJEF 5DJDA 1RZ8B 4ZYKA 5DLML 4LASL 2DJSA 4OCNC 3PV7A 4F7PB 3ZTNH 2ATPB 5T1MB 4LHUG 3QFDB 2VQ1B 2E9WA 3RWGA 4L3EE 5MEPB 4D3CL 3PDDA 3NZHH 3DMMD 1KJ2A 1OP5K 2DLEA 1T66C 3P4NA 1HILA 1RIHL 4ZAKD 5KVMC 4A6YA 1LMKA 1UB5A 2C4FT 5CEXA 4F7CB 4EQ3A 1T0PB 2E6QA 3V0AC 1Z0NA 5LKNA 1L7TH 2F53A 4I5BB 1N7MH 3DVIA 5JDJA 3LEYL 4LPXA 4ODUA 3EYVB 3BZFA 1JHLL 1KLGA 4JG1H 4S1QL 3SE4C 5IEKA 3QEUB 1NCWL 2X4RA 5ACLA 4WWKA 1YEDB 5LCVH 2XNAA 2BK8A 5DT1L 1BLNB 2CD0A 2ENSA 3ZKSD 3SJVD 3VGFA 3ZT7A 2OLDA 1I1FA 1P5UA 5D6DC 1NCCL 2IEPA 4JFHE 3C2SA 5IHUH 4PJCF 1YECH 4KY1L 3VFTB 4DGIL 3K2UL 3F62A 2DL9A 1R3IL 4EOWH 4JM2D 4KJPC 4O9HL 1CDBA 3E2HC 3SE3A 3U0PB 5D2LE 2IAMD 3GJEB 3GMLB 4X6DA 1M05B 4JFDA 2EH7L 2Y7QA 2OP4L 4U7SA 1E6OL 3KPSD 5SX4I 1ORSB 3MXVL 3K80A 4HWBH 4K7FB 4E41B 1SVCP 2JJTC 2FLRT 1JWUB 1ND0B 1ZGLB 2X9WA 1UA6L 2IH3B 1IKNA 4MQXD 4MAYB 1T89A 3D25B 4W68A 5L8JB 3MV7D 3O81A 2AI0L 1EFXA 1N5YH 3MCG1 4O5LL 4WNQA 1OAQH 4M48H 2YZ8A 3BI9X 5ESVA 1KCSH 5I1GL 4U6XA 1KN2L 1JYXA 2PW1A 3NOIA 2XQYK 5E1AA 4DQOH 2NY3D 3SKNA 3LPGA 1AO7A 3MRGB 4J3OC 4NM4L 3DROB 3UROR 5TF0A 3L7EA 2EXYD 5BZWA 3AS0A 2VDRL 3BE1L 1IAIH 4XHJD 4DVBB 1NGPH 3OKLA 3O4LB 4YDIH 3LS4H 4Q9CA 4MJIB 4ERSL 3ZDYF 2O26U 4XB8A 1N3NB 3I3DA 1L6XA 3D39A 4LCWD 3ARBC 3IDJB 5FA4B 3TCLA 5T3XL 5M7QA 1AJ7L 3LKSB 5ETUA 1RJLA 3OAUH 3MJ7A 2VL5A 5H94B 3NCFB 4U6VH 2VLJE 4L9LB 5EZJA 5CJXA 3BIKB 1ZGLP 3MRFA 1VFUA 4GKZA 1YJDL 3ZHKA 3BP5A 4X9FA 4BFBD 1RZIB 5C09D 4P2RD 3NPSB 4K2UL 2WW8A 3F5WA 1BIIA 1OL0A 3O2VL 1KGCE 5CAYB 3QB7C 4QHMB 1JGLH 3VXSE 4U2ZA 3ZKNC 2W9DL 1IBGL 4P4RB 4DGVH 2CH8A 1EDQA 3B83A 4MD5A 3GBNH 3TESA 5DS8A 2X70A 1CDIA 5ADOH 3QNYA 1X44A 1FCCA 4XMKH 5F1KC 3NVQA 2VWEC 3PABB 5D7SH 5F72S 5KVDL 3JWOL 4G6ML 2BHYA 4Y4FA 4JB9H 3HZVA 3U83A 3M8OH 4FXGB 5C0CB 2ZCKL 2GTZB 4KMTH 5C0FB 4WCYH 5D2LA 4MYWB 3T0AA 5HYJE 3OJ2C 3ZO0A 3AU1A 1QTYT 5IGXH 2ITCA 1MVFA 2ZUQC 2RFXB 2FJGB 4YHPA 1TETH 1JMZA 3BW9A 4TQEL 5LJYH 4OGAC 3CIQA 2KZWA 1MCOL 3DGGB 5I1HH 3FRPA 1P84J 1ULVA 1MCKA 4Q9RH 2EECA 2XN9B 1NBVL 2V2TA 1HXMA 3FAXA 3MRLB 3VWJD 5DGRA 4HBCH 5DVLA 5KSBA 4HGWB 2G2RA 5FYJD 3HE7C 4K23H 4LVOC 4YDJB 2A77L 2BFVH 2P46B 4PJ8C 5J9PA 5EFIB 1OAYL 2I9TA 4M93B 3ARGB 1VACA 4WHYG 1NL0H 2RHEA 1A9EA 4MMZC 5GRYA 4JDZB 5IW1B 1FZJB 3SKMA 3QWOB 4HIXH 5KAQF 1WZ1L 4UTBL 3GMQA 2Z31C 2R2BB 4AJ0A 1P4IH 2XA8L 5A2FA 4ESKA 3MFGB 2MQCA 3BESR 1MEXL 3WL9B 2VLJA 3MRKB 1HYSC 1EXUB 1ACZA 3VXNA 2VH5H 4YHLH 3EYSL 1U9KA 1QFHA 3SE9H 2I26N 3T2NL 1G7HB 1UQSA 5L2JB 2VXVH 1HHGB 3LB6C 3Q6GH 2A9MH 4KK5C 1T80A 4Q74A 2CRYA 1JMXA 4AEHH 3PQYB 4EI6B 1H3WM 2R29L 1OSPH 4C56B 1N59A 2YD4A 2XKNB 3JWOC 2D31B 3SKOA 1YQ2A 4IDLA 5IIEA 1T1WA 4XWGL 1JNHA 1S9YA 4M4RA 4GKSB 4OI8A 1NCDH 4XNZB 5BO1L 4MVBD 1VGEH 1BF2A 4MSWA 4OLWL 3HRZB 2YPKA 5TH2B 3V5HB 5ICZB 3JVGC 5EOCL 4WO4A 1QFWM 4HPOL 2F53D 1RK0A 2FGWH 2X4TA 5ID1B 2E8YA 4JFPA 4O58H 2WSKA 4M6ML 5HYJA 2E9JA 3P77B 4WWKD 4Y2DA 5F88A 2HMID 3BISA 1MPAH 5M95B 4Z7UA 4MD4A 5DSCB 3H3PL 3VXRB 3GI8L 1B90A 3K74B 5I0ZA 1NAMA 3JWDH 3DJ9A 1WZMA 2NZIA 2OR9L 2EDTA 4RZCA 4KKLD 1FAIL 4JG0H 1T2JA 2OXGA 3MREB 3IVKA 1FNEA 5GRVL 4NCC2 1QHPA 2CIKA 4CJ0A 1M71A 3BGMA 3TBYA 1EVUA 2R0KH 2GSGA 4A6YL 3EFDH 5HYEA 5C0DA 1DQJA 4JM4L 4OB5L 3QUKB 3LQAC 4ZOAA 1DANT 1FG9C 3O6KH 1X5XA 4U1LB 3SCMB 3RZCD 4MX7A 4HLZH 5IMKA 1Q0YH 3BPNC 3FZUD 2P8MA 1KC5L 4XAWL 2LAAA 4IHOB 1F2QA 2P5WD 4UT7H 4Z7VA 1EHXA 3T3PF 1DQDL 1JBJA 2ORBL 3MBEC 5GRJH 4QHNA 4XCCL 4JPIA 1W72L 1ZXQA 3G5VA 4FABL 1T6VN 3CDGA 3IU3A 5GJTH 4ONHB 5JW4Q 3VFRB 5A40E 4NQCE 1S5HA 2X10A 4YEFA 2VDQL 4GUPB 3GSWB 5DO2D 3OGCA 1IEHA 3V6OC 2FIKB 2FSEA 4NJ9L 1ORQB 4R2GC 3D39D 1OGTB 1HHIA 1TJGH 1ZVHA 2DWEB 4TPRH 5F1SA 1QSFE 1XF3B 1UH4A 3TN0C 1CG9A 3HPLB 4P9MH 1Q1JH 1U8LB 5D70L 1D5ZB 1Y0LB 5HVHB 3CPLA 1HOCB 1QFWL 2B0SH 4N1HB 1CCZA 1OW0A 2HJKA 3RA7H 4HS3A 5K9JH 1B2WH 1H5BA 3A6OA 4M6OH 1JK8B 3ARFA 3BYYA 2E27L 3MLZH 1NFDA 3ULUE 9CGTA 3JTSA 5I1IH 3ULVF 1FVEB 3KYOB 4MLIA 1B6UA 4OZIB 4RGMB 2EIZA 4DZBA 4WUUB 1K85A 2J2ZA 4NQUA 5BW7C 4JFHD 2H9GA 1KEGH 3QA3B 4F9LA 4LU5H 3BPLB 1A7PH 1TJHL 5CILL 2VITB 5IB5B 3MA7B 3HI6L 2VABB 3BEWA 2ICEA 1R24A 2PNDA 4JANA 2ITDB 2Q86A 2Q8BL 3O3UN 1JWMA 3IDNA 5D7KD 1QUNA 4M5ZL 4JE4B 4NZUL 3CSBA 5JHDE 3TEUA 3WUZA 2QQQA 1MCWW 2JCCA 2JK5B 3QHZH 3P0YL 4RGNB 3D2UA 5C6TH 5C0JA 4MD0A 1CGWA 2NY5L 2WIIA 2WINB 3T2QA 3N06B 4IEFB 1CN4A 4L8SC 4BUGA 2R1XB 2FBJH 1ZEAH 4UIMB 3ECBB 3L5HA 4IM8A 1NJ9B 2R4SH 1BQHG 2EKSB 1UCTA 5SWZE 3MNZA 1NEZG 3MRQB 2UZIL 2D0HA 1GC1H 5EBWA 5SWQB 3QO1B 4J4PC 1CS6A 4ODVH 1J1XH 5JOFB 4UILH 2K1MA 1QR4A 2BY2A 1BP3B 3RVUC 4HAGA 3L3DB 5BVPH 5F7KC 3OZ9L 3GUTB 4CGTA 2ED7A 2IQ9H 4FQHA 2F8VA 4FG6D 4M02A 5FGSA 4QXUH 3TYGH 5LGHH 4YPGA 4FXKB 1P2CB 4OLXL 3D3VB 1QSFA 4B5EA 3BKML 1JHTA 5GGRB 4JFFB 4OFIA 15C8L 3KLHC 4JCMA 5K9KB 3GEWB 4PB9L 4PJGF 4KK8D 1CXHA 3G08A 3L3IA 2DLFL 5DMKB 1KFAH 3DO3A 4GKNA 3U4BL 4HS6B 3MV9B 4HKJA 2P8PB 4X4YA 3CFJA 5DQJA 4P9HL 4PJXF 4Y16A 2NY0C 4OIAA 4FQCL 2YSSB 4WEBL 3U36A 5JMOC 4PJIB 4Z18A 2B5IC 2QHLA 4P2QD 3OKEA 3RWHB 3CH1B 4KQ4L 5I2IB 1M7IB 4G80A 2EC9U 1DBKL 1LO0L 2BNRB 3QDJB 1JUFB 1OB1B 4BSWB 4TSAL 4JHZA 5IB2A 1IGYB 4WO4D 5CSGA 1I9RH 4YO0A 2CJUH 1NFIA 1JL8A 1FLRL 2BP3A 1P4LB 2NY5C 2DMCA 1IQDA 2DD8H 4MNGA 3FCTB 4O2EA 5HXMA 5IWLC 5DEFA 1A7RL 2KQNA 3K46A 4PJ9A 3JV4A 5ESQA 4MDJA 1M7XA 4U6YB 1ZHNB 1K4CA 1LEGA 3DHMA 3CC5B 5I8OH 3N9GL 3SOBL 4LCYA 2VJXA 1DSFL 3V0VA 2B2XL 1HWGB 5JPMB 4U1HB 5LGJA 4AT6B 1B9ZA 4I2XE 5AEAA 4G9DB 4OCRH 4U1KB 5T1LA 2V5TA 3V4UL 2WWMC 4HKZA 12E8H 4XPTL 3RRQA 3WO4B 4HUKB 1FQ9C 2C7UA 5DEGB 2V6HA 3R06A 3C8HA 3MRDB 4NQXB 5B39B 5T3ZE 4GBXD 2Z8SA 1N4XH 3KS0J 1RUQL 4MA1B 5TPWH 5I71C 3VFPA 5CD3A 2FX7L 3VFGH 4NNYA 5E8DH 4F3FB 1IT9H 1F90H 1NCAH 4BFEA 2KKQA 1CBVH 2VLRB 4ZTPH 3TO2B 3STLA 5J13B 5KVEL 5KTEH 2R0WH 3VRIA 4P9HC 4UU9B 3ZLQC 4U7MA 3BT2H 5I73C 2W65B 5EH1A 4ZUVA 3EFFB 2B1HH 1NC2B 4BH8A 2YK1L 3SDAC 1KIRA 1JPFA 3WFDL 4ZS7L 4OM0H 5DK2A 2PO6B 4P3WA 3WHE1 5JA8B 4YDLC 5JHLL 1ZLUH 2DQIH 3DV4A 5FUOL 5ACZB 4L3CB 1FBIL 3IRZA 3PWVB 2MHAB 2OL3B 4DW2L 1F4YL 4XBEL 2X4PA 5KSVB 3HHRB 4RAHA 5ENWB 1MJUH 2YEZB 1QEWA 3FFDA 4OCXH 3GSRB 2UZYB 4PV9B 3BKCL 3S97C 4HCRH 4JREC 3RVXD 2YKLL 4P46A 2AQ3A 3GSXA 2ZPKH 4JLRA 5F6HI 4APQC 3ARFD 4UAOB 1BZ7A 3RZWA 2FX9H 4MXQD 5A3ID 5E99H 2HVKA 3MGOB 4F80A 4H8WC 3FQNA 5DJ2B 3HR6A 1G9ML 4ZUTA 3A67L 3FRPG 4HSQA 1D5MA 4OKVA 4AL8L 2AXGB 5KW9H 3GMMA 3TBWB 1WK0A 4MXVF 4Z7OF 1BD2B 2HG5A 3E2HB 4OSUH 1QBLH 1UVQB 2W60B 4XPGH 4J7RA 4G6JH 2V2XA 2CSPA 4I2XA 4OM1H 3PDOB 1Q9LB 2I07A 3MCLL 4OD3L 3EJZC 1FVCB 2N56A 3BDYL 1B0RB 3WLBA 4WEUD 3EO0A 5I1AA 4IMLB 3FHAA 1MF2L 5JXEA 3QEQE 1XGQA 2VDML 1LP9E 4G7YL 4M7LL 2MQ3A 1JNJA 5EC2A 4J23A 4FOMA 2MOVA 1KELH 2Q20A 1TZGH 3DECA 1RHHB 1UKQA 3CMOL 4D0BA 2GW5A 5C0BB 4I0PB 4UNUA 4LSUH 1OAXL 3WXWL 5CEZE 5J06A 4M4PA 4TVSa 4OZHB 1EHLH 2IC2A 1ZA3A 2GAZB 1S7VA 1UACH 5I1CH 4OQTH 1YEKH 1I7RB 2BC4A 3ARBB 4KDWA 1IL1B 1X4ZA 2BJML 4P4KA 1S9XB 5KG9A 5IJVB 1MCSA 3C8DA 4NQDE 4MGXA 1FO0A 3G6JF 2EH8H 5DK0B 5FO8A 5TGBA 3H7BB 1S7XA 3QI9A 5DHYB 4QT5B 1WZKA 5I1JH 3QHFL 4PJDA 1SEQL 4WW1A 1HH9A 3W2DH 1G9MC 5HVGB 1WFNA 2YXMA 3PP4L 5HI3C 5A2IH 2ZOLB 1N6UA 1EEUA 5E9DD 4HHAA 4POZC 2BNQB 4K3EL 4GG8A 5B4MD 3TF7C 1HCFX 4H25A 5F3BB 4AG4L 1RUAH 2IADA 3O9WB 5IW3A 1N2RA 1MRDH 1KV3A 1ZKAA 4YHOL 1P1ZA 3PL6B 3O3DA 4LRNL 1RIVH 3SPVA 4AMKL 3MODH 3QPXH 4OCYH 4XVSH 2HLFC 3VXPB 4ZSOB 1HH6A 5GS0D 5ANMB 5JW3L 1A3QA 4LLAA 2IBZY 3ARQA 3PDGA 2BDNH 4G6KL 3RDTC 1X5JA 4JHBA 4HUVA 5DA4A 2QSCH 5AAWA 2X1QA 5FECA 4Y4KC 1HK6A 1U2CA 4TULL 2FJHA 1U41A 3FB5B 2E7MA 4OF3A 4BZ2L 4CU6A 3RNKA 1CL7L 4U1IB 1YMME 4G9FE 5JPNB 1OTUD 3SY0A 3PWNB 4XP5H 1LP9A 5DJXA 4PGEB 3RFZC 1FPTL 3UTQA 2Y6SD 4LVOB 3HNSL 3S37H 1FZOA 5FXCH 4PJ8B 2Y23A 1FC1A 2B8OT 3O3EA 5CGTA 2P44B 1U6AL 1DEDA 1DVFA 3P30H 1I1AC 3ES6A 4FFZL 4I0KA 3TO4B 3QNXB 1C7SA 4GAJL 3VXQA 5L88H 4JN2A 5E6ID 2NW2A 3OR6B 3L3GA 1XR9B 3U0WH 3Q3GB 4ZUWA 4JY5L 1QFPA 2DQGH 3UJJH 1D9KC 1AH1A 1MI5A 5LQBL 4Z7WB 4OD2A 3MRHA 1LNUB 2Z31B 2ARWA 4P5TC 5LAXB 2AERT 2FRGP 2EDHA 4L4VE 1WWWX 1KENL 3D18A 1QFUL 5B8CA 3VRLE 1SBSH 1L9MA 1MCWM 1TVBA 3F6IA 4I3RH 4P2CG 3TV3H 1FE8L 4NQDA 2PXYD 1DBMH 5F3HA 2C1OA 5F1NA 1U92B 5E2WL 4JFZL 1X5LA 5HJ3A 4X5WA 5DEZA 1U93A 4QWWD 5D2NB 2HFEB 4KVCH 1R3LB 3QG7L 4HMDA 4E5XB 4BSJA 3CK0L 5DD5H 4GLRI 2A83A 3IDIA 3QEHA 4YXKL 4UUJA 1OQOA 3H9SB 4WU7B 5F93C 2MSPA 1QBBA 1SJVA 5IBUB 5F9DC 3E6FB 4QXGH 3S34L 1CXEA 4H1LB 3C5SA 2DQFA 4OZGB 4OV5B 3TPUB 2FB4L 5FM5M 2P24A 1IKFL 4P46D 3IGAA 2HFGL 2PCPB 3VJ6B 4FQPA 1LO5A 4L5FL 4YDVB 5SV3A 4Z7QE 3T3ME 3BHBB 4HS8L 3HMXL 4NRZA 3DYPA 2DQHL 4WDIB 5HPMB 4AYFA 2LU4A 2YBRB 4OV6F 4Z76B 2DBLL 1EVTC 3MBXL 3U2SB 3WIFB 4DTGH 3OKDA 3WLWC 3WV0A 3T0WA 5IMMB 3V0WL 4JZJC 3S36L 1KBGH 3DVGB 3VE0A 4G9FA 4BM7A 1MLBA 3IFOB 1T7XA 4EDWL 2F19H 4JHAL 1RZ7L 3S96A 3C8KB 3VXMB 5DVOA 1FYTA 5KS9F 5DRXA 3RIFK 3TBTB 3P9LB 4KJWC 1TQBB 4JRYB 1JFQL 3TJHC 1DL7H 4WY7L 1GYAA 1U8IB 2LU7A 5IV2A 3MQIA 1WV7T 3BPNB 1MY7A 3FT2B 3NTCL 1U58A 2R4RH 3O2DL 4GSDH 1YZZA 4CL7A 3WFEH 4KZEH 2HYMA 2O5ZL 1J8HB 1T5WB 1P9MA 1R3KB 4NWUL 1KCRL 5FYLD 5FFLA 1VADB 1C08A 5AUMA 3TT3L 4KTEL 1OF2A 2X4QB 4PJFB 3VA2C 1QSEA 2Y5TB 4EBQL 3LKPA 3D0LA 2LABA 1Z9OA 4MZ3A 1FVDA 3LKNB 4ORZC 4PLKC 3HAEB 3D1MC 2D3VA 2XG5A 3OBAA 4MJID 4AH2B 4TUJA 1MIMH 4EQ2A 1A3RL 4HWBA 4P4KD 2K3TA 3TN0B 3VXTB 1SYVB 5T3ZL 2HFTA 1HHJB 5I1EL 4ZPVA 1T21A 1NANH 3QUYA 1Z5LA 1PYWB 1TPXC 4JKLA 1NBZB 1BQLH 4S1DD 2F54E 3NA9H 1H3PL 3QI9D 1PFCA 1NMCC 4LPUA 3BXNA 3WIIL 4ISVA 3OKKB 1BZ9A 2H6PA 4OF8A 5I8EA 4NRYB 2ZWLT 4G8EB 4QRPE 5AWNH 5D1XB 3T0EE 5FYKE 4YX2H 5HHXL 3P40A 4YUEL 5DUML 1JNNH 4UDUA 5F7DA 1ERNA 4QRRE 4PJ7E 2ADJB 1QSVA 1YNLL 5E56A 4PJ5A 3UTPD 1R5VB 1I7TB 4TUKH 4M3JA 3SGKA 5F7EL 3T1WA 5ERWB 5JMRA 4HUUB 5HHOE 3GHEH 5I1DA 5F9AC 1IGCL 2HRPH 4PFEA 3X17A 3SDCA 1LD9A 3RWFA 2AV7B 1JPGA 2FJFB 2MKLC 1XAUA 2B4CL 4KK9C 1RMFH 1MFEH 4EDXB 1VHPA 1U8NB 4L8SB 4R97C 5E1HB 1DCLA 4TTGA 5C3LD 1A1MB 3WFHA 4J3WA 1OARL 5DI8A 1AGFA 3PGCA 4G8IA 1N5AB 2LTQB 4P59L 1FZKA 5F9JA 3SKJL 4RAVA 3V6FB 3ARDB 2EKJA 1OQXA 4M03A 1A9BA 3WHXA 1PJ9A 3QCTH 2E7LA 2MKWA 1DVFD 2VLKB 3RWEA 5JUEL 2ARJA 5IF0A 4GMSH 2DQUL 4PRBB 4PJAB 4YQXH 3BP6B 2AGJL 3ARGD 5C08B 3MUGA 2MMXA 2Z35B 1LK3L 4FQJH 1MI5D 4HXAH 3WMSA 1LE9B 3P4LA 1GPOL 2O5YH 2VISA 3PWUB 5D2LF 3G5XA 2L7UA 3U7WH 4RQQB 4Z95H 5IBTH 4FTVE 1BBDH 3GM8A 4U6HA 4OKDA 3N1PC 4F7MA 1CR9L 5F71A 1KEMH 5DJ8B 3HG1B 4F33A 2RQ8A 4N5ED 3X12A 2AXJA 1CD0A 3NABH 4HFWA 1BEYH 2F54A 4F37F 4OGYL 4NN5B 1KF9B 5DJYA 2RBLA 3JV6A 5H8DA 5C07D 4MJ5B 4L1HA 2HT2D 1AFVH 3SDYH 1WBZB 2NY0B 4OJFL 5KANG 3RVTD 3PQYD 3VXUE 4JRXE 5CEZL 1UM5H 3ZSTA 1UWEH 4C56D 4QRPA 3DOSA 4ZXBA 3BVNA 5CEYB 2XTJB 3T0EA 3DXAB 4J1UB 3HZMB 1ZHBB 5FIEA 4HJ0D 4DK3A 1TVHA 3QULB 1JRHL 1INDL 1SVZA 4MQ7B 5B38B 1ZHKA 2YC1B 1XGTA 4HK0A 3QCVL 4M8QB 1T2QL 1ZT4B 4QRRA 1QRNE 4QRUA 2BXZA 2GITB 4PJ7A 5C0AE 5EO1A 1YC8A 2B7DT 1EO7A 1IEBA 1VGKA 5FM4A 4OZFH 2VR9A 3EZJB 5HHOA 1CD9B 3HI1B 1T0NB 3G5YB 4G8GE 3FTGB 4MA3A 1A6AA 2RB8A 1Y6MR 4XCFL 5F9WC 2WBKA 3FMGH 1JZ7A 1N6QH 5FYKU 2A38A 3UXFA 2AXFA 1MJJA 4X83A 1X4YA 3I75A 4JO4H 3V5DA 5EC1A 4QYOB 4W4OA 3NIDE 4ONFH 1F3JA 1PZUB 3GMNA 3VWKC 2BVPA 4LMQE 1Z0MA 4NKDA 1MQKL 4Y1AB 5TE7H 1FYTD 1T7ZA 3SO3C 4ALAL 2DKSA 4NBZB 2EYTA 4Q6YA 1A0QL 3EYQD 3ARRA 4ZQKB 4I0CC 3MACH 4OF5A 3DVFA 4PJCB 3RWDA 2JB5H 3C5JB 3HA0A 4H5SA 4XBPA 3SCMD 3ZZ1A 2MPAH 5FOBB 4S1SL 4V2CB 3SEPA 4O2FB 3RL2B 2XI9A 4PJHA 1SJXA 2EYRA 1T20B 1AIFB 3VFOA 3BWUC 3QCUL 3D69B 1URLA 1XGRA 4C54A 1C12A 1WEJH 4FTVA 2XZQL 4PJBB 3GM0A 4IRJA 2B20A 3DMMC 4F58L 2WMPA 4NBYB 1IAIM 3RTQA 4KJYA 1VEOA 4ZAKC 3LMJH 3ZTNL 1CZ8H 5IW6B 1MWAH 1UJ3A 3UTSE 5JTWA 4OBRA 5JR1H 3NZHL 4QTHA 3EOBA 1MCBA 4CNIB 1QSED 4PRHA 4Y4HA 3FOLA 1F11A 1QP1A 4W70A 5D7LE 3VXUA 4UIKH 4UDTA 4JRXA 2R1WB 1W0VA 4CVXB 2FATH 1MQ8A 1L7TL 3DYOA 5EZIH 1N7ML 1J9CT 4XCEA 4JG1L 1JGVL 1I4FA 3JTTA 3QUYD 3UTTE 3RY6C 5LCVL 5E8PA 2BSSA 3U82B 1PEZA 2H26B 3EO1A 4YHYC 5HHMB 3VFVA 1QBMH 1PEWA 4ELME 5AAMA 1FFNA 4JM2C 3V7AG 2Q7YB 4I1NB 3LQZA 2HWZH 2FHCA 3IXAA 5IHUL 1YECL 4NPYA 1Q9OB 4N5UA 5FO9B 4UMGA 3LV3B 3RKDD 5IR1B 4QNPE 4UQ3B 4OI7A 3C87A 4EOWL 1AY1H 2NTFA 3IJHB 3PV6A 3V6ZB 2B39A 4NM8H 2A73A 4MCZA 4MQXC 2P5EE 2GTWA 2A6IA 5D5MA 1XF1A 5GHWH 1J0YA 1QLRA 1HHKB 1Z3GH 4XWOD 4PJ5D 3IFNH 5D1QA 4AQ1B 2O5XH 3AREB 1AR1D 5DRWB 5FDWA 3DX9A 3LN5B 1E4XI 4ETQA 1A4JB 3KHQA 3I85A 1N5YL 2NY3C 4HGMA 5HHPA 3DRTB 4KU1A 1OAQL 4M48L 3ZKXC 5IBLD 3NN8B 2EXYC 1KCSL 4HT1H 4XHJC 5DJZB 1BBJA 1O7SA 3S5LA 3S4SB 1CFTB 1UWXK 1WF5A 3QUXB 4JY4A 4LCUB 4DQOL 3GGWB 4M6AA 2NZ9C 5GRZA 2XTLA 2ICCA 3C5ZB 5EUOA 1K4DB 2AJZB 1IAIL 4X6CE 4YDIL 4NNPH 1X7QB 3LS4L 3PHQB 1VPOL 2NMSA 4RA0C 1FL3B 3L3OB 2X89A 3UTSA 3OAUL 3BUTA 3AM8C 4JZNB 4RIRA 4U6VL 5C8JB 3STZA 1G0XA 3UPCA 2X4OA 5DF0A 4I4WB 5INDA 1XZ0A 2CDFA 5D7LA 3VXOB 1TTUA 2XY1A 1NC4D 4K3DH 4MLSA 4R0LA 4WFFE 1JGLL 3D3VD 1JGDB 1VDGA 2FEDD 2HTLD 1LGVA 2YR3A 1EO8H 4JFFD 1UCBH 4DGVL 4XXDA 3UTTA 1IE5A 5IMLA 3GBNL 4K71C 5ADOL 3JV5A 4U1SB 3O8XC 5E5UB 1IILE 4XMKL 1F6LL 1U8MA 3FQTB 2YD3A 3L5JA 1EGJH 5D7SL 4JFEB 4UINH 5D4QA 3KWWA 3GSNB 3LEXA 4JB9L 4ZXBD 4WI4A 3M8OL 1J5OH 5DJ6A 1S7SB 5FYKD 4WCYL 3HZYB 2F9BT 3J7HA 1NPUA 3O3AA 5IB1B 1Q0XH 3MRRB 4MNQE 1JE6A 2BNRD 3QDJD 3RJQB 1VFAA 5IGXL 1KOAA 3KYAA 5A43C 1TETL 5DRZB 3VWJC 2WLYA 1P7QB 5GISH 2J8UE 5IB3A 2FYYA 5I1HL 2ICWB 3EJYC 4H88H 5MHSD 4Q9RL 2ZCLH 4RGOH 3MTRA 5HHNA 5EZLA 3CLEH 4HBCL 3FQWA 2GK2A 1I8IB 3E3QE 5C0RH 3H2WA 4K23L 4ELKB 1IGTA 2BFVL 2EDYA 3S7GA 3O6FA 1BJ1H 4OGXH 4XPBL 2YUVA 3LDBB 1FZMB 1FNGB 1OTTD 2VSDA 4D0DB 5SWSE 2QR0A 3SGJC 4LLVB 1NL0L 5IFJB 4X6CA 3ULUF 4PRPE 1WSST 4JY6B 4H26A 3C9NA 4LLYB 1R3HA 4HIXL 4HIHB 2NYYD 4Q9BA 4DOHE 1P4IL 3B3IA 2DF3A 1XF2B 1JHKH 2VH5L 2IPUG 4YHLL 3K8KA 4OGZA 2UYLA 1D9KB 1L0QA 2VXVL 4LHJB 3MFFB 4WW2C 4RMWA 2IMNA 2CLVA 3QUZB 3Q6GL 2A9ML 1WIPA 2V5MA 4IRSB 4MAUH 4AEHL 3ESVF 4ODHH 4IRJD 1KPVB 3I6KB 1OSPL 4EUPB 2QL1A 3FO0H 4XCNB 3ULSB 3RTQD 3BKYH 5I8CB 5EO0B 2E9BA 4AZ8A 3RGVC 4NO0A 2P8LB 1AXSB 1L0YA 3CFDB 2HTKC 3O41B 1Z6JT 4HUXA 4PRHD 4Y4HD 3RJDA 1NCDL 1VGEL 3C09C 4Z77A 5IJKA 1JGEA 3VXUD 2Y07H 3B9AA 3QXUA 3WUWB 4P3DA 2CR3A 2HMIC 4WWKC 1VB9A 5FV1L 2WIMA 2FGWL 1FN4B 4YBLB 4Q2ZB 4O58L 1A4KB 1Q9WB 3BQUA 4S10A 4MNQA 1MPAL 3KHOA 2GI7A 4KKLC 1LO2H 3REVA 2YN3A 3MLPA 2MNUA 1RUMH 4L9DA 5GGTA 3MCKA 4OUUA 4PV8A 2J8UA 3AB0C 1J10A 3JWDL 5FA3B 2WK2A 1J0HA 2QSQA 1HKFA 5GRUH 3U9UA 4LEOA 4B7LA 3RWJA 2WBJB 3E1F1 3KXFE 2DMBA 1L6ZA 4OFKA 3OKNB 3RZCC 4DJMA 1FDLH 4KRLB 2R0KL 1SY6H 5TJWK 1OM3H 1TENA 1G1CA 1T89C 1MCJA 2OI9C 3O6KL 5EIIA 1JVKA 4RBPK 2Z93A 32C2B 2UUDH 4N90D 3VGAC 1Q0YL 1E6OH 1XMWA 5E8NB 3CFEB 4PRPA 1PKQE 3ARYA 2PUQT 3T08A 1D5XB 5HI4D 4UT7L 2JF1A 4LF3A 5GRJL 2WNGA 3FB6B 1S7UA 4ZFFB 3HS0B 3BRFA 2BMKA 3K1KC 5GJTL 1FSKC 1MCQA 5BV7C 1L7IH 3F7VB 1ZWIA 3Q6FB 3UYOD 3MMEB 4N9GB 5L6YH 3QH3B 2Q6WB 1OWWA 5E8OB 4EI5B 1MFCH 2H3NB 1BOGA 1PBYA 5EIQA 1G7IA 3OAYH 3K8MA 3LKQB 1TJGL 4TPRL 5DC4B 2X89D 1BJ1J 2CK2A 2GUOA 2IBZX 4I0PD 2WQRA 4P9ML 3DI2B 2CKBA 1Q1JL 3MJ6A 4P2OB 5IROA 3DURA 4WV1B 1LO4H 2B0SL 1MUJA 3RA7L 2EIEA 1PKOA 1CVSC 4MQSB 5K9JL 2VDLH 2X4NA 4M6OL 4QCIB 1U8QB 3PP3H 1CICA 3MLZL 3WN5C 1A6UH 4IOIA 4KI5D 3PWPE 43C9A 3UYRH 2H32A 1TPXB 5ACMA 3TFKD 4AEEA 2YWYA 5I1IL 2ZSWB 1CFVH 1AGEB 1EEZA 2YD1A 3ZTJH 1BJMA 1AHWB 2BRRH 5C70A 3EO9H 1ETZB 1FG2B 2Z91A 5L2KB 2PYFB 4LRIA 5DURD 1FNHA 1KEGL 3QT2A 2G5BA 2PTTB 1A7PL 1CE1H 2YD9A 4AENB 3VMNA 4NQEE 5JNYA 3KXFA 4PYGA 4PGDA 3KLAA 4NGHH 3AAZB 4E41E 5EA0H 1UYWH 4NJAH 2A1WH 3U6RA 3QFJA 1KXQE 4OQTA 2BY1A 4WFGE 1FC2D 3QNZB 3UO1H 3PL6D 2HT4D 1U3HA 4PJXB 3QHZL 3GJFA 5IKCB 4CVWA 2GK0B 3C6LB 3DUSA 4CVZB 3FN3A 1PKQA 1I3GH 2FBJL 1ZEAL 4PGCB 5IP4A 2FO4B 4HX1A 3OAYK 4O2CB 2UV3A 3BIBX 1KJMB 2R4SL 4PG2C 5EWIH 1AD0B 2ESVA 1H3UA 3H42H 1GC1L 3DX7B 3OJDB 4ODVL 4TN9A 4UILL 3O4LE 3O6FD 4ZUSA 3BN3B 4NO3A 1Q8MA 4ODSH 1Q72L 1DUZA 5BVPL 2PTVA 4F7PA 2IQ9L 4MWFA 4S11A 1I8MA 4GW4B 4QXUL 3TYGL 5LGHL 4XRCA 2GQHA 3TH2T 4KK8C 1XR8B 4TNVK 2EZ0D 2D4FA 4HIEB 1K2DB 4YBHA 4X7DC 5TDNB 3LQAH 3TO4D 1CT8B 4X7TB 3G5ZB 3SDDA 1W0WB 5I75B 1VEPA 4N8CH 4ZOEA 1KFAL 1PY9A 3B2VH 3L6FA 4XNUH 3QEUA 3EW3B 4R4NC 4PGBB 4GS7C 2H2PD 2VLMD 3ARVA 2QSTA 2Z92B 2VKXA 1YEIH 5ADPH 4J3UA 3PWPA 1EAPB 3FO1B 4XNXH 4WHCA 1M1SA 4NO0D 2AV1A 5EU4A 3TZVB 5J3HD 4WO4C 1UKSA 4NO5A 1KTDA 4YBQD 4YFDB 1XH3A 5C0CE 3FO9B 2P43B 5D71H 5MERB 5ALCH 1LP9F 3BAEH 3TA3B 4NQEA 3HAEH 4FZ8H 2NLJB 1ORSA 2CJUL 3FRUA 1J11A 2EDFA 3GB7B 2DD8L 4FQXB 2MJWA 3LS5H 3DRQB 1ND0A 4C83A 2DKUA 5GIRA 4PTUB 5F7MC 4WGWB 1EA9C 4HV8A 3O11A 2XN9E 3DNKA 5B21A 3GKZA 4PJEA 1NGWA 1HDMA 5TE4H 2Y36H 1DQTA 3KG5A 3L5XH 5D1ZC 5I8OL 2YRPA 3QIWA 2DWDA 1DE4A 1F00I 1C16B 3AMKA 3HUJB 4BZYA 4LKCB 3C60A 4GBXC 1KIPB 2VB5A 4X99A 5I19H 3IETA 4RFNC 4LVNB 1KPRB 2EC9T 2DI7A 2O61A 12E8L 2IANB 2G5RA 3VWKB 4LL9A 3P2TA 4PRPD 5TPWL 1WAAE 1YEEH 1LDSA 2ZUXA 1P7KA 3VFGL 5T5NG 4YHIB 5E8DL 1IT9L 1F90L 1JJUA 1NCAL 2CDGB 4HUWB 5GSVB 1CBVL 4PLNC 3PNWB 3TVMB 4ZTPL 3FOMA 1FLTX 3MLRH 5KTEL 2R0WL 4F15C 2EDDA 3BT2L 3VGGA 2AXHA 4L4TA 1W72H 1U91A 1UXSB 2VAJA 3K4DA 4FABH 1DR9A 2B1HL 1QRKA 5E8EB 4P4RA 2AS5M 3GSOA 1KIQA 1F6AB 4OM0L 3KYMB 5EU3B 1B0GB 5DUBB 3FT3B 5SX5H 3KYNA 2D7TH 2DQIL 3BZEB 1NGYA 4GRLA 1LEKB 4S2SB 3B2UD 1QFOA 1JPST 3MRIA 1IZKA 4UV4H 2D03H 4JDTH 3E8UH 1F58H 4DK6A 3ARFC 1MJUL 2BVYA 3IDMB 4MXQC 4OCXL 1AKJA 1DDHA 5A3IC 1NANI 4PD4K 3RUGB 5DRNB 3GMRB 1M7DB 1CGTA 1QD0A 3QIUA 4HCRL 3QQ3B 2ZPKL 3QIBB 4YZFE 1CICD 2FJGA 3SJVB 3VXRE 5DQ9A 4HMCA 2FX9L 3CU7A 2FO1A 1WIUA 4H20H 5E99L 1PG7H 4U0RC 1CGYA 2V17H 5J12C 4YHYB 4QHUB 5T5FH 3W0WE 1CD8A 1E4KC 3MJGX 5J0BA 4KJQD 2IAMB 3BYTA 2P42B 4HGWA 3IDYB 4M43H 1ADQA 5DJAB 3KPSB 5KW9L 3VRLF 1IZJA 5HD8D 5CMAA 2AKRA 4X6EA 4OSUL 1A6TB 4J3XA 1QBLL 1T22A 1D6VH 1FL6A 1C5DB 4XPGL 4G6JL 5K9QI 4IS6A 3QFJD 3MV7B 4OM1L 4GW5A 1KLFA 4JDZA 2UY6A 3QWOA 4U3CA 4M5ZH 4PP2B 2X4SA 1WWBX 3EKCA 1RIUH 3MV11 4I3SH 4NIKB 4OLYH 4G5ZH 5EOCJ 5DR5H 1WAAA 1PZ5B 3DBXA 4YHNB 2NY3B 4BSVB 5CKAA 3BUYA 2MCPH 2ESVD 5SX5K 3E3QC 5DMGD 1KELL 1TZGL 4U33A 3C6SB 3V4VH 2QHRH 1F02I 1ZT1B 4ENEC 3GZKA 2Z4QB 1G0DA 4EI6A 3GSUA 3QXWA 4LSUL 5D93B 1RUPH 1JI1A 4DWHA 3GO1H 2P7TB 1NCBH 1GAFH 3TNMB 1EHLL 4Z7QF 3T3MF 2GFBA 4KK6D 1UACL 4RMSA 3U4EA 4OQTL 5I1CL 4RFEB 4LGRB 5F8RC 3RX8A 1YEKL 3WSQH 2K7PA 5C09B 1I8KB 1KJ3H 4P2RB 1ZK9A 3KLDA 1ZGLM 4ZOCA 3GRWA 1XGPB 5E95B 5TH2A 1A7NH 2VLKD 1G7QB 1I7UB 4JEGB 4WHDA 1PSKH 3MUY1 5IHZA 5BVJA 5F21B 2EH8L 3I6GA 5B4MC 4OT1H 3BSZL 3ZL4H 1MELA 3WS6A 4YC2C 3W2DL 4OCSH 1EJOH 4QY8A 3RHWF 3CJJA 4JFQB 4JQVA 3HE6A 4X9IA 4H1LG 4JJ5A 2QKIB 4WUUE 3ZE0E 1F42A 3O45A 4K71B 4NHUB 1RUAL 1MCCA 4GAYA 3W0WA 4Q0XH 4CADB 2XWJA 2IJ0C 2FCBA 4PTTB 1RIVL 3CNKA 4G43B 4KHTH 4KV5E 4O4YH 3CDFA 3MODL 1CLOH 4NUGH 3QPXL 2CO7B 3P4MA 4OCYL 1IM3A 3PWJB 4XVSL 5FUZH 1KULA 3FFCB 2CRZA 2XTJD 2UWEB 3DXAD 5F44A 1ZT7B 3U1SH 5BCAA 3F12A 1FORH 3PIQA 4YWGH 1GVIA 1JTPA 2ATKB 5DWUH 4CMMA 2HRLA 2BDNL 4F2MA 1XCTA 4KRPD 4BKLA 4LPWA 1DZBA 5EU7E 5E4IA 2QSCL 1KJVB 3VWJB 3P11H 1OTUC 2FHBA 3KDMB 4R4BB 2R0ZH 2A74A 2I9LA 1N8ZB 2JB6A 1WCBB 5CBEB 1V3LA 4NRXB 2DMKA 2YHGA 3FB8B 5EU6E 1UB6B 2APFA 5HYQB 5E6IC 3BD3A 4H8WH 3S37L 1T1XA 4P23A 4D0CB 3ILPA 4H0HB 3P30L 1E27A 4R4FH 2AAVA 2B2XH 4WJ5A 5H2BB 1ZLSH 2V7HB 3QUMB 4JZOB 4NQSB 1A22B 2BOBA 5L88L 2DWEA 2AW2A 2FWOA 3U0WL 1LQSR 2ADIB 1PQZA 1XF3A 2DQGL 4MNHB 3UJJL 5C0GA 1NEZB 3M17B 2PXYC 5C9JA 2DLIA 4Y1AD 1AGDA 5KSAA 4NO2B 1CE6B 3RKPA 3R8QA 4LDOB 4QWWC 2BZDA 5BS0B 1IGJB 1SBSL 4I3RL 3TV3L 3AXLA 3B9KC 3MV9E 3BP4B 4PJ7F 5DJDB 5CFHA 4L4TD 4OZFA 4ZYKB 1DBML 4F8QA 1HEZA 2D2OA 3OJVC 2Y72A 3JXAA 4NWTH 1TITA 3RWGB 4PJIE 4XVJH 1YN7A 1H3TA 3U46A 4KVCL 5KZCD 3OAZK 1KJ2B 2E7CA 5CP3H 3P4NB 1HILB 2IFGA 5DD5L 4P5MA 4A6YB 1UB5B 4BQ9A 5CEXB 2XY2A 4Q6IA 3H8NA 1FNSL 1DLHA 2F53B 3C09B 3MJ9H 4ODUB 3BZFB 4L8CA 1KLGB 4QXGL 5FCSH 5IEKB 4PLJD 2X4RB 1AE6L 4WWKB 2COQA 3KPOA 3QRFM 3WFBH 2XNAB 1RURH 3BGFB 3QIUD 4JO1H 3MV8A 1WBYA 3RIAF 4OF6A 2VOTA 1MAJA 2QQLH 5F7YC 1I1FB 2YKLH 2APVA 4GRWB 2AEQH 4BQBA 2J4WH 2XZAH 3R0NA 3F58H 3UYPA 5HHMD 4DTGL 2FZ3B 4U2YA 1BFSA 4IIQA 4KTDH 4X6DB 4WVRA 5AD0A 3MRQA 1KBGL 2QTEA 4JFDB 1I8LA 2Y7QB 5IG7A 1MWAA 4JAMA 1S7TA 1WITA 2HJFA 2VRAA 3GSNH 3AC0A 1LDPH 3VG0H 1HI6A 5EU6A 4ZNEA 3QRGH 4R26H 1X5ZA 3CH8A 3I02A 1EFXB 4MAYC 2J8OA 3RNQA 1DL7L 3BDXA 1P2CA 4WNQB 1CU4H 5ESVB 4MCYB 2NX5A 2R4RL 4U6XB 4GSDL 5GGRA 3ARED 2PW1B 3A0OA 5E1AB 2VLRE 3SKNB 1AO7B 1TZHA 5GGVH 1PAMA 3L7EB 2APTA 3UMTA 3WFEL 4KZEL 3F7YA 4M6NL 1T83A 4N8VA 3EBAA 1FSKB 3W5MA 3MRCA 3P4OA 1MF2H 5GJSH 5BV7B 3VGBA 1PDKA 5EUKA 3SGDH 3D39B 3QUXD 3NH7H 3TCLB 1OAZH 5ETUB 1JTOA 1RJLB 4KMQA 3MJ7B 4P4KC 2VL5B 3C5ZD 2ID5A 5EZJB 4FS0A 3MRFB 4GKZB 3BP5B 4L9LC 3K2MC 4HF5H 2EDBA 3NCYS 1D5BB 1NGZA 4LCIH 4S1DC 1MIML 2VO5A 5D7JA 3F5WB 3NPSC 4BSWA 1MCIA 5ECJE 4KAQH 1B3JA 1IGIH 2NY7H 5D5MF 4YFEA 4BK5A 4I77H 1A21A 3NIDF 2F58H 2IALA 4WTZG 3L5IA 1E6JH 1BQLL 3NA9L 4MD5B 1ED3A 1KB5H 3MRNA 5E6YA 1F13A 4OLZH 4TVPH 5DS8B 3UZQA 2F5AH 3QNYB 2G9HA 3V79C 3K8LA 1BAFH 3KPNA 4M1GH 4Y19D 1Z2KA 4EUPH 1PY4A 3EDFA 5AWNL 1T5XA 3BJLA 4EN3A 5IVZA 3K81A 4YX2L 1H8SA 2OS7A 2H45A 3HC3H 3S35H 5B22A 5GZOC 1JNNL 4YE4H 5D2LB 4XI5C 4AG4H 1V7NH 1BD2E 2DL2A 4JFED 3AU1B 1RULH 5DA0B 2ITCB 2VR5A 1WUNT 4JO2H 4YHPB 4TUKL 3BW9B 4PJGA 4BQCA 3MROA 5DEGA 1J0JA 1WC7A 3GHEL 1XCQA 5JXAH 3Q5TA 2HN7A 2ERJB 4HUNB 2HRPL 2V2TB 3RX5A 1KPUA 1FJ1A 4WFHD 1NUGA 5D7IE 2X1PA 1RMFL 4TYUA 4HIJA 5DVMA 5KSBB 1MFEL 4LCCA 2G2RB 5HGDA 3H7LA 4IOSD 4MB4A 4R9HA 3WNLA 2NXYD 3B5TA 4U1GC 4CUCA 5J9PB 3F7PC 2AEIT 1DVFC 2C3HA 2I9TB 1DJSA 1OCWH 1HSAA 1YN6A 5C0BE 4FFYH 1VACB 3C08H 3R0MA 1R5IA 2YD6A 3D5OF 5F1IA 3ARGC 4P23D 3QCTL 1Y6NR 4GQ9H 5HDQH 3D85A 3GMQB 3VI4E 4GMSL 2WBWB 4YQXL 2VLJB 2PYEE 4QNPF 4FQJL 4HXAL 5MEOA 5BQ7A 4N5EC 2O5YL 5KSAD 1UQSB 1JV5A 2IFFH 2WUBH 4Z95L 5IBTL 3U7WL 4NKMA 5HHQA 2X4UA 1BBDL 3GIVA 1ZVYA 3GSRA 4HZLA 4XX1E 5EOQL 1QA9A 2ZKHH 1KEML 3PHOA 4PP1D 1N59B 3RVTC 2OZ4H 3NABL 5TQ0H 1BEYL 4LVHB 3SE4A 1HSBA 2DM4A 3MR9A 3SKOB 4B50A 5IIEB 2BNQE 1T1WB 3QUZD 3SDYL 1AFVL 1JNHB 1S9YB 3FQXA 5DHVH 4IRSD 2XKUA 4JGUA 1QLFA 1UM5L 4MSWB 1UWEL 3VD3A 2YPKB 5EB9A 3QG6B 3EOTL 4OFDA 4X8XA 1OSZA 5D6DA 4OFPA 4WO4B 1RK0B 3SGEI 3SBWC 4UNVA 4NYLA 2Y06H 3OTTA 4ZSOE 4JFPB 1NQBA 4X6CF 4YHZL 4OIIH 5ANME 4Y2DB 5F88B 4Z7UB 3KPLA 4MD4B 5DD3H 3LOWA 3MV8D 3ZDZE 1H9VA 3PXJA 2HA1A 3PDOA 5F1OB 3FO2A 1NAMB 2JJTA 1IKFH 4RZCB 1FVCA 3IVKB 3MLWH 1FNEB 5D7IA 2CIKB 4L5FH 1M71B 3BGMB 2ENYA 3FMGL 1LE5A 1RQ5A 2ILLA 1N6QL 3TBYB 4WENB 2GSGB 2DQHH 4JO4L 1JZ8A 5C0DB 3VG9C 1DQJB 4ONFL 3CVIH 4HC1H 3EYQC 3UTZA 3KNBA 4MX7B 3SCMC 5IMKB 5TE7L 3NCBB 1I1CA 4GXUN 4J3SA 4EDWH 2AP2A 3KLSA 4K7PH 4BH7A 3ALPA 3QO0A 5JW4N 4Z7VB 2N1KA 2G60H 1SEBA 3IB4A 3MACL 4QHNB 3S3SA 4Z7WE 2JB5L 4JPIB 2MPAL 1CF8H 1O5DT 2PYEA 3CDGB 3IU3B 2NX5D 4V2BA 5JIIA 3QWQB 1SJEA 5JLZB 4KKBD 1S5HB 1F4WH 1WEJL 3ULVD 5K9QG 2Y25A 3OGCB 2FSEB 4F15B 2AJUH 3LMJL 1CZ8L 2CMRH 3STBA 1MVUB 4ZO6A 5JOPE 2J8UF 1HHIB 5JR1L 3UC0H 3A6BH 3L7FA 2KQMA 3UP1A 3VGDA 4KXZH 3TC9A 1CG9B 4WIQA 1KCRH 2O93L 4UIKL 3CMGA 1SY6A 1E0OB 3CPLB 1CQYA 1BM3H 3IXTA 2FATL 3MGAA 5D7JD 5HVHC 2YUXA 2HJKB 5EZIL 1FIEA 4YEEA 1EJ6A 4XNQA 5KAQG 4BQ6A 2ARJQ 4TSBH 1UC6A 4GT7A 1H5BB 4DN4H 5JOEA 3ARFB 4D2NA 4CN6A 1NFDB 4NOBA 5ALBH 3NCJH 4P2OD 3QDME 3RKDC 2RJMA 1QBML 3JTSB 4N0CD 1QQDA 5E94A 1X6NA 4MHHI 2CLZA 2I5YH 4RX4D 2HWZL 3VA6A 1MHHA 5FGRA 2EIZB 4DZBB 2CPCA 3CSGA 1CTNA 3DSFH 4MJ6A 4RGMC 3K1DA 4U0RB 3WIIH 1AI1H 1AY1L 3CGTA 4XWOC 1JF1A 3BPLC 2ICEB 4C55A 1I85A 1CFNA 1AR1C 1A6WH 1R24B 4JANB 4NM8L 3MGTA 3PWNA 1JWMB 3IDNB 2C4FU 1JI2A 4PGEA 4NUJA 3UCRA 5L2KD 5GHWL 3HE7A 3VXME 1Z3GL 3IFNL 5IFAH 5DTFA 4JRYE 2JCCB 3S35X 2O5XL 3D2UB 1IJ9A 5C0JB 4YHKL 4MD0B 3V5KA 5E7FA 2WIIB 3G6JA 4RGNC 2QQNH 3FL7A 1PX3A 2D0GA 4WHTA 4HT1L 2Z31A 1A64A 4Y89A 3MNZB 4IDJH 1B0WA 5EBWB 3C6LD 1J8HE 2AJYH 2CIIA 3MSPA 5HI5D 5CUSH 2Z8WC 2XYCA 3VI3E 5J6HA 2EE6A 5MP6H 4JJHA 1U92A 4NNPL 4FQHB 2VR4A 5I16A 4PJFE 3V6OE 2JTDA 3L3JA 1BREA 4X0KA 2ZG2A 1F6FB 1T1YA 4GMTH 1F5WA 3SKJH 2VDPH 3D85D 3FHQA 4JDVA 1QSFB 3MRJA 5IVXE 5EO9A 3ARSA 1JHTB 3B9EA 3BJ91 4TUOA 3WJLC 4E42A 2HTLC 5LG1A 1KNOB 1ZLWH 2AEPH 4K3DL 1PG7W 4WUKH 2DAVA 3G08B 3L3IB 2W91A 3FB7A 4FXLA 5H35A 4X8JA 4GKNB 3JVGA 4HKJB 3DLQR 4X4YB 3CFJB 1EO8L 1F97A 4XAKE 1UCBL 5DQJB 4Y16B 4R3SA 2D7NA 3U36B 1T2XA 5J4MA 3OR7A 4WHYH 3KAAA 2JELH 3QDMA 5HGHA 3OKEB 3ZE1E 2NTSP 1X5IA 1A6ZA 1L4IA 4NC1C 4G80B 2E6PA 1EGJL 3RU8H 4UINL 1T7WA 3L1OH 4Z76A 5CWSA 4XPHH 43CAA 5EULV 1J5OL 5CP7A 4LGSB 5IB2B 3DO7A 1GZPA 2VXTH 3DVGA 1MCFA 1A2YA 4YO0B 2OR8A 4LSSH 1Q0XL 1NFIB 2OL3L 3HKFA 4PRIA 1GCFA 1IQDB 3C8KA 4MNGB 3WKMH 3EJJX 2X1XR 4R8WH 1RZGB 3QWRA 5GISL 4JRYA 2EYSA 5DEFB 1T2QH 3JV4B 5ESQB 2EICA 1OP5H 4MDJB 4ZUUA 2AJSH 2NCMA 5FUCC 3WNOA 3HI5H 4H88L 5CZXD 4EIGB 4RGOL 4QRQA 1K4CB 1AQDA 1LEGB 2L7JA 4FQXD 3CLEL 4RNRA 1K5NA 1X4XA 2VUYA 5C0RL 4LCYB 3MBEA 3V0VB 2EDKA 3BWAA 2P45B 4XC3H 4FQLH 3AROA 4OGXL 2NYYC 1ITCA 4D8PA 3MRMA 5T1LB 2A6KA 3G6AA 4HKZB 3VFMA 1OGAE 5DZNA 2Q3AA 2C7UB 3R06B 4U6TA 3WO4C 3H0TA 4X7FC 5ISZA 4KWUA 4NT6A 3VH8A 5C08E 3VFPB 5C71A 1I1RA 1N6VA 5CD3B 4MA1C 5MENE 4NNYB 1JHKL 5IVXA 1ZS8A 1G7JA 3STLB 4K7PX 3RTQC 3VRIB 2F74A 5ESAA 3RY4A 1MCPH 3HG1E 4J8RA 5JORA 5CZVH 1P4BH 4ZUVB 4MAUL 4ODHL 4YJZL 2VZUA 4BH8B 1CGVA 2IQAA 1KIRB 3FO0L 4BFGA 1JPFB 3BKYL 4B41A 4F57H 3TVMD 5DK2B 4UV7H 2FX8H 3RIFF 2PO6C 3DV4B 4NZRH 5KS9A 2Y07L 3GSQB 4BELD 2CLRA 2X4PB 5GGVY 1CD1A 4HDIA 3IDUA 1CLYH 1Z9MA 1QEWB 3FFDB 5BW7A 3AS3A 1F4XL 3EGSA 3R1GH 1VESA 2IPTH 5FK9A 3EHBD 4P46B 2H2SC 3GSXB 4O02H 1QFWI 4JLRB 4B0MM 2BSRA 2DICA 3IAPA 1BZ7B 4UAOC 5C6WH 1JGVH 1LO2L 2HVKB 1RUML 1R3JA 5J11B 2W0LA 1MHCA 3FQNB 4ZUTB 2FECI 3E0GA 4U31A 4X6BA 1D5MB 4OKVB 5GRUL 4D9LH 1FIGH 3QIBD 1TJIH 4OBSA 1W72A 4AIZA 3MJ8A 4C57C 1FFQA 1JWSA 2D0FA 5LBSH 1MIEH 3HZKA 1X5GA 2OMBA 2ZZUT 3KPRE 3GMMB 1CI5A 1FDLL 1HKLH 4LNRA 2HG5B 1N5AA 1SY6L 1OM3L 25C8H 5I6XB 2QJDA 2VDNH 5FHBH 2V2XB 5HI4C 5I76B 3INUL 1EEYA 2YWZA 2VXQH 3AUVA 1KTRL 4J4PA 4JQXC 1WFUA 1ROWA 3LAFA 1OGAA 4I18A 2I07B 4Y8DC 5T3XD 2K7QA 3WLBB 3EO0B 2J12B 1FH5H 5I1AB 4M5YH 2Z35A 3QHTC 3P9MA 5MENA 1XGQB 4M9OA 4EVNA 5EC2B 1L7IL 3RAJH 1XF5A 1NUNB 5L6YL 4PJBE 5FYJH 2Y5EA 4D0BB 4D9QE 2V5SA 1W2KT 1J1PH 2C3VA 5EIVA 1MFCL 3HRPA 3PGDA 4I0PC 3E6HB 1FNFA 2NQCA 5GGUA 5AZ2H 5GGSA 1ZA3B 2JKXA 1U8HA 3V8OA 1S7VB 3BH8A 1V3JA 2BY3A