2X1XR

Crystal structure of vegf-c in complex with domains 2 and 3 of vegfr2 in a tetragonal crystal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
205
structure length
201
Chain Sequence
RSPFIASDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINSYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Growth Factor Binding and Specificity by Vegf Receptor 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/signaling protein
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR C
total genus 35
structure length 201
sequence length 205
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2010-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1xR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2x1xR01
4WI4A 3BGMA 4RFOL 3G5YB 3RZCA 3JWOC 2YMXH 4KVCH 4NKIL 4JJ5A 3B9VA 1A4JB 3ZDYF 1U92B 4XCYB 5DVKA 4KTEL 4B5EA 4MJ2A 3EGSB 4F58H 3F7YB 2VITA 1TCRB 1A7OL 3V6BR 2J7LA 3GSOA 4PY7B 3L5XL 1JHTB 1BD2D 2EKSA 1ZT7B 4PJCA 3O8XD 4G6FD 1ZGLP 2IC2A 3P9WB 4HCRL 3UTPE 4FQIH 3QNXB 5I1IH 4M93B 2CKBL 4HLZH 3HLAB 4I3GA 1A1OB 3PV6A 2Y4SA 2F54A 4JPKH 1J8KA 3QDMD 5C9JB 4OLXH 4ODHH 4P23D 4G6JL 3T2PA 3ME0A 2ICEA 4XWOD 3F7VA 5JOPE 4OQTH 3FQXB 1E4JA 4QHMA 3AAZB 1I1AC 4IOFD 4ZD3H 3FQUA 4WTXA 2NY2B 3DSFH 4GAFB 4BA8A 4Q7DA 4R2GC 2HRLA 3UBXI 3QA3B 2JIXB 3OJDA 3CLFH 4WIQA 5TDOA 4GW4B 1BBJB 1MHHB 5CSGA 1Q38A 1WBXB 3DVGA 1QSVA 1T0PB 43C9A 4RBPH 3RBSA 3CGTA 2MNUA 5EN2B 3ZE1E 4EEEA 3WHE0 4R4BA 2YPKA 5DD3L 5A2JH 1A6UL 3I9GH 5CZVH 1NCDL 3IETA 4OCRL 1F97A 4F7PB 1ITCA 3SKJL 3SJVD 3WD5H 2ZWLT 4Y1AE 2BMKB 2WP3O 4M43H 3MRIA 4AY0A 1CDIA 1JYNA 4HJJH 3P4OB 4K3HA 3T3MF 5LXGH 1FL6B 4AZ8A 4EQ3A 2R0ZL 4MCYA 1KIRA 1DL7L 2OTUA 1JZ4A 4FQHB 1EX0A 5DFVC 1MCOL 1ORSA 4KU1A 5DSCB 4XAWL 5EB9A 5DLMH 4HIJA 1DLFL 4OLUH 2NY1C 3HZYB 5ADOL 5D1XC 3C9NA 3RP1A 1C16B 1ZA3A 3PWVA 3Q5TA 5IQ7H 1VGEL 3U2SA 2FJHA 5L88L 4KKLD 4WUKH 5KVMC 1S9XA 3T65A 2EIDA 5DR5H 1MRCL 1I3GL 2UY6A 4QO1A 5SWZA 1FVDA 3S3SA 4KVNH 4CVZA 2D0HA 3HNTL 4BH7A 5IMOB 4M1GL 4B7IA 5E00A 1CK0H 2FL5B 3VXOA 5IFJA 3MLSH 2MHAB 2DD8L 4JQXA 4NQEB 3R8QA 5D1QB 4PP1C 3OAYH 5ITBL 3KPMA 5D7JC 3S35L 4S2SA 2IAMB 3EAKA 2NYYC 5GSVB 5D5ME 1ACYL 4MQ7B 4N0UE 2R2BA 3PP4L 4KC3B 3M45A 4GT7A 3EUUA 4XC3H 5FM4A 2VZ1A 4WHDA 1NJ9B 3P30L 4O51A 5IHUH 4X6DF 3IS1X 5J1TC 1P9MC 1IGFH 4FQJL 4MS8D 4F2MB 3QCVH 3TBSA 2DKSA 5CEZD 3L3GB 3HUJE 5D1ZB 3N1FC 4ZQKA 3S34L 4LASL 2X2YA 4GBXA 4BELD 3IFNH 4NHUA 3DXAB 1Y6NR 4N8VG 2ERJC 1U8NA 5D7SH 4FZ8H 1NEZA 2R1XB 3S36X 5IUSA 3U4BH 3MRPA 5EU6D 3IJHB 5T3XD 1NBQA 4B7LA 3VFGH 3BZ4A 4LPUA 5AWNL 3C6LA 5CEZH 2APFA 3WNLA 5DJYB 5C0CE 2PYEB 5GGRY 1FYTB 1V8HA 5GRJH 5HYSB 1UZ8A 2BVEA 3VRLE 3QDGB 1Y0LA 3LV3B 4KK6C 5HGHB 1PG7W 3ZHLA 5T3ZE 5CGYD 4PJ8C 3BKMH 2VLRB 1AC0A 3D0LB 3BPCA 5KVFL 3GBMH 4XHQA 5CP3H 4F15C 2IALB 4PRPE 5ALCH 5MI0B 2I9TA 1KIQB 4FA8A 1F5WA 1MNUH 4NHUB 4MJ5B 4PP2B 5ENWA 3RGVA 1WEJH 4X7SH 5KVEH 2HVKB 3C5JA 2OJZH 4OZFB 2VTFA 2WBJD 1WF5A 4Z77B 4QT5B 5IVOA 4JFOB 3QI9B 1MCWW 3LVEA 3QWOA 4Y4HB 5D7KD 3GJFK 3MRMA 4RFEB 4Z0BL 5HDQL 1QFOA 1LK3L 1WTGT 3QWRD 1A3RH 3CFKA 4QRRE 3E2HB 3QH3B 4OIIH 2CRYA 3EOBA 5KTEL 3HPLA 3HMXA 4N0UB 4XI5D 1OTTC 4LPCA 4LBEB 1OW0A 4OFDA 4OFYD 5EBWB 4F7TB 1MRDH 3P73B 3OB8A 1GVIA 4X6DA 3IDGB 5E1AB 4GO6B 2I5YH 4IRJA 3MXVH 3E8UH 4WO4B 5INCB 2X10A 3BPCB 2Z35A 5IB4B 3V0VB 3QDJD 2F19L 2SEBA 3FQWB 1JGDB 3AREC 5GS3A 5C0BA 1IVLA 3MCLH 5HHOA 1FGNL 4AEEA 2DYPA 1T4KA 2ZSVB 1FNEA 4KI1A 2BHZA 1E4XL 1M6OB 4X9HA 3MREB 3CXDL 4BH8A 1IL1A 1I9RL 3U2SB 5GQBA 4UOW0 2Z91B 4AH2B 1A1MA 3MOAL 1AJ7L 5E6YA 1KELL 1RV6X 2QQNH 5HYSG 3OAYK 2W07A 4ZFZA 2OR9L 5CSBA 4ZFOA 5A40E 4P2CG 1NLBL 1A7PL 2NCMA 1MWAL 3K4AA 1YNLH 4PJXB 4C55A 3U9UB 2OM5A 4NCC2 4GQ9H 1UCTA 1XEDA 2BNRD 4YQXL 2D4FA 4P2QA 2DQUH 1JIBA 1G0XA 7CGTA 4TOYL 3QWRA 2VQ1B 2VLJD 4OSUH 1F11A 3C60C 4JKPH 1FNFA 4BFIA 3HAEH 5IB3A 3HG1B 5EZJB 1UM5H 5T3XL 1FNSH 5T5FL 5CJ5A 1QRNE 1B0RA 4YE4L 1FO0A 1U91B 4OZFG 4MXVF 5D1ZD 3D39E 5KS9F 3O2VL 3QUYC 3CSYA 4PJ7F 4RGMB 4HKBB 1UB5B 4G3YL 2W91A 1NEZG 1F02I 1SVCP 1IGYB 2CKNA 1FLTX 5ANMA 5HI4D 4EN3D 3QXAB 4U1IB 1S78C 4J1UA 5JQHC 4PP1D 4J8RB 4HZLB 3BD3A 4UIMB 4MNQA 1TQBB 2NW3A 3SKMB 4NRXA 4RSVA 5GS0C 5IW1B 1DJSA 4JM2F 3CLEL 1BVLA 3P77B 1ZHKA 3S96B 4KZDL 3VWJA 1T03H 4JO1H 3QQ4B 3UX9B 4X80H 5HJ3A 3T3PE 4O02L 1AXSB 4NZUL 1J0KA 1WZKA 2JLLA 4FNLH 1AQDA 1LO3H 5FGCE 3GNMH 3RWFA 1NGQL 4P57A 5AYQA 1T2JA 1VGEH 3IB4A 1CG9B 3GMNB 4R4FL 4B41A 1QSEA 3G08A 1A6AA 2BSSA 2V6HA 1V7ML 4HEME 5IVXE 2BXZA 2YWZA 1QBAA 2W0FB 3IFPA 2H32H 4IIQB 5CUSH 2W9EL 3N1MC 1H0DA 3VU2A 2RFXA 5E5UB 1PFCA 2N4IA 2EKSB 4MA8L 1CLOH 3MROA 1E0OB 2FEDC 1S7TA 3IDMA 5F9DC 2FGWH 2GY5A 1DLHB 4XPGH 2IAMC 4PJAF 2VH5H 5GGVH 5IVNA 1BZ9A 2DWDA 1F3DJ 1R0AH 1J1PH 4TRPH 3GIZH 4UQ3B 3QDHA 2VL5A 4L29B 1J86A 3QAZB 4MVBC 2Q86A 2J8UB 4U1LA 4M7JH 1FBIH 1AH1A 5GJSH 5C08A 3RGVC 5EIIA 4XP4L 2VDML 3UJTH 4N8CH 2YSSA 3QIUC 4Y4FD 2O5ZH 4KPHH 1MWAB 1SM3H 4W4OA 3CDCA 5JUEL 1MHHA 4AL8H 3SDCD 1ES0B 3CXHK 3S35H 3HS0A 1I3RA 3CFBA 1K4DA 3IFNL 3HNSL 4C4KT 5EULV 4F7MA 2BHUA 3HC3H 2O61A 4UB0L 2VR4A 5EO9B 3NN8A 4K23L 3RVTD 4YPGB 1CLCA 4PIRF 1JP5A 4ONHA 3BUYB 3DSNA 5J4MA 1ED3A 4D9LL 3ULVD 3S97C 5JNYB 4M7LH 2UUDK 1HDMA 4JVUA 1HQRB 1IQWL 5CLTA 3U46B 2QR0A 3QNXA 3T3PF 1KN4L 3HI1A 2ERJB 5HHQB 2YKLL 3WIFB 5CCKL 6FABH 3UAJC 1BOGA 4PD4K 3F12B 4Y2OA 5CZXC 1KJ2L 5I0DA 5IFAL 2CR3A 3Q1SH 4K3JH 3BKJH 3AREB 4D8PA 3V5DB 4HW6A 5DQ9A 1IGMH 1FIEA 1MHEB 3C09B 4Y4FC 4CMMA 1P84K 3K4ZA 4QHUA 3ROOB 3IU3B 5A2FA 1DBMH 5EC1B 4K3DL 4NYLA 3RL2A 4YPGA 3SCMB 1SYSA 4X4YB 1EFXD 4JN1L 2AK1L 1G7PA 3W0WB 3SDAD 4M1CD 1A14H 4JDVB 4M48H 3MJ9A 3SGDI 3B2UC 3WFEH 3T0ED 2VLJA 5IVZB 3MGOB 3VFUA 1JTOA 3LKPB 1F4YH 3DYPA 3MUGB 4M1DH 3PE9A 2YA2A 3MRFB 2P8MA 5TE6L 5M95B 4U1KA 1F3JA 4NUJB 4QRPE 1WZLA 5I9QB 4XCNA 1MFDH 3EDJA 1OAZL 2QBWA 1S5IL 4QTIH 4JY4B 4LARH 4PG9A 3V7MA 3G5ZB 4FQCL 2CRIA 2BY0A 1AFVH 5DGRA 1MCCA 1S7VB 3RU8H 3FTGB 3CXDH 1XGPA 3DUUB 2HJKB 5I6XB 2EDQA 3GSUA 5IIEB 3UJJH 2VXTH 5DD5L 3NAAH 1RHHB 2PXYC 3RWIA 2BVUA 1HEZB 4RFEA 2HFEB 4P49A 4O00A 4I18B 1M05A 1NGYB 3GO1H 3QDMB 5MEQA 4LLDB 4WI6A 1LO0H 2XTJB 3NIGE 4Y5XA 1QA9B 3WDJA 2G2RA 1MY5A 3R1GL 1Q1JL 5HVHC 2VLKB 5I30H 2IQ9H 2FRGP 2E3VA 1NMCB 2QR0B 3BAEH 4DEPC 2IAMA 4CJ0A 5F3BA 2PETA 1F13A 3MOAH 1F58L 5C6PB 1KELH 2H1PH 2QQNL 2Q86B 1SJHB 3D0LA 1T21B 2HWZL 2OR8A 4JZJC 1S7VA 3WHE1 1ZHBB 2X4OB 4NNPH 3RUGF 2GJ6B 5KVGL 1WICA 4HUNB 1OAUH 1U58A 4Z78A 3RWJA 1C5BH 4ZD3L 5IBLD 3QXTA 3P4MA 4XCCL 2E27L 4XPFH 3CLEH 3GKZA 1O7VA 1U6AL 4OD2A 5DJXA 4CVXB 1D5MB 5CEZE 4OAWB 3JTTA 4XX1G 5JIKA 2UUDH 4MAYC 5TH2A 4JZJB 2ARJA 4G3YH 5E6ID 4ZO7A 2DTML 3QZWA 2J4WH 4O9HL 4APQA 1A14L 4M48L 1RZKL 1AQKH 5DC4B 2BNQD 5KS9A 2I9LA 2YC1A 1S5HB 5BXFA 3WSQH 2BOCA 2X70A 1A4KA 3MOBH 4MXVE 4OGZA 4U49A 5D7JA 1X7QB 4HWZA 3IDUA 1IBGL 1JGDA 1BAFH 1D6EB 4OLZH 1Y18A 5J57B 3MLZH 3LKNB 3PHQB 3IAGC 1A7BA 3FONA 3PDOB 2DQHH 2L7UA 3GUTB 5TDPA 4G5ZH 3D2UB 5FGBA 4AENB 1FIGH 3GSRA 3ZE1F 4BKLB 3RRQA 5E70A 2CDFA 3HE7C 4Z7VA 2WLZA 4NRXB 1KPRA 4EVNA 1ZT1B 2MCPL 3QXUA 3TLRA 4R0LA 1CLYL 2LTQC 4HGKC 4YXHH 1J5OH 5J7CC 1BQHA 4FFVD 3VXSA 5FA4B 4OCYH 4KWUA 2R1WB 4KPHL 1I3GH 3N50A 4OBRA 1XGQB 2IMMA 4LEOA 1UM4L 2YD4A 2NXZB 4G9FD 4IRJD 4PJHB 3KDMA 4AM0A 3FN9A 1IEAA 5F88A 4OFYA 3HG1A 3CSGA 2WQ8A 2R0KH 2Z8SA 3DVFA 4N0YL 3MRNA 2O5YL 4G9DA 4JFXA 2DLTA 3OBAA 3HLAA 3X3GL 2JJWA 3BKCH 4POZD 1SBBA 3VWKA 1I1AD 1B2WH 4JO4L 4YEFA 3KYKH 1I9IL 2BJMH 5BJTB 3WNMA 4PRHD 3MRJB 1FO0H 1LEKB 4IMLA 4KDWA 1HOCB 4X4XB 1CI5A 4P46A 4QGTA 1MOEA 2W60A 4LVOB 5J6HB 1W8NA 2OBGA 3CFCH 1UA6H 43CAB 4G6AC 3B6SB 1Z5LA 3HN3A 4PJGF 3V4VL 3QO0B 1OP3K 3DWTA 3HE7B 1WAAA 5EPMB 5KVGH 5F7MC 3TVMC 4HUUB 5C0DA 1KCLA 4XCFL 3BISA 5I1HH 4P9MH 5D7SL 5GS1A 5I16A 3H7BB 4CAGA 3GHEL 1NC2A 4ZFOB 2EC9U 3LQAC 3L5HA 1RK1B 2CUIA 2VLRE 2GSIB 1TVBB 4K07A 3I6GA 1GGYA 2G5RA 3SDDC 3FQTB 2X09A 3SDDD 3O9WB 2A6JA 1XF2B 2W59A 4HD9A 3QUZA 3MUJA 1OSZA 4NT6B 4XP9H 1FFPB 3QXDA 5T3ZH 5C0GB 1RU9H 1T2QH 4K9EC 1UC6A 4U6XA 5EOTB 4LCWD 1XZ0B 2K7PA 5EZLA 4G7YH 4XX1E 1HCFX 1R5VA 5EWIL 3OB0H 4NKQB 4YK4C 1IE5A 4KKBD 1BAFL 5FCUH 2PCPA 4YO0A 1HQRA 1I7RB 4G42B 3STBA 3QI9A 1J0IA 1PSKL 4P4KB 3CMOL 1KENH 4JN1H 5JXEA 1IM3A 3OWEA 2FH8A 3ISWA 5HDOA 1E4WH 1LO3L 1HHHA 1XGPB 4G5ZL 2XZZA 4ZUVA 2NLJA 4LRIC 5IB2A 1S9XB 2DLFL 3ELAT 4H0HB 4MNGB 4I3SH 5KN5A 4HS3A 1F4XH 4BQ6A 4HG4K 1FYHB 2G60L 4FQXD 5EU4A 5L88H 4DZBB 2EH7H 1B0WA 4QKXB 3HMWH 3PWPB 1J1XH 3L9RA 3CJJA 3LD8C 4WHTB 3O4LA 3OR6A 2XQYG 1Q9KB 2P8PB 1JPTL 4HDIA 2ILLA 2NTSP 3UO1L 3OKLB 1BQHG 3HZVB 3D85D 1YDPA 1RJZB 2HKHH 2OMBA 3AROA 2DQFB 3W0WD 3MODH 1PYWA 5IM7B 2AV7B 4AIOA 3QCTL 3E3QC 5DK0A 3F12A 2FCBA 1E28B 3DETD 4KFZC 5DMGD 3GHBL 5EPMA 5EA0H 4Y8DC 4NZRL 4NIKB 5JUEH 3JV6A 3IJHA 1MH5A 1T0NB 4F7CA 1R24A 1RIVL 3HFML 5I8CB 1OF2A 3PWUA 4RQQB 5MHSE 4L4VB 4MA1B 2CK0H 4FQLL 4EUPH 3MRRB 1UM6L 2AXHA 3CDYA 1EEQA 4R7NB 3VXOB 3L5XH 3U0TB 4WNQB 4F7EB 3BQUD 1JWUA 3O8XA 1UACL 1PEZA 1UB5A 4G9FE 4JREB 3WUWG 3MLUH 4ORGB 4J23A 4PRHA 3UTSB 1PQZB 5DXWA 5MEQB 4Q9QL 5D72L 4PJ7A 4HKJB 4OLXL 3VFSA 2HMIC 1D5XA 3CX5J 4UDTB 1AQKL 1MREH 2DWEA 3CU1A 4UIMA 3ZHDA 4MQSB 3S5LG 3OKKA 5I1AA 2BNRA 3D9AH 3MLYH 1E4XI 5JTWA 5TGBB 3TCXA 5IJKC 1TTUA 3W82A 3VD3A 4ESKA 3NPSC 2WIIB 1EUUA 4MJ5A 4DGYL 2ADGA 32C2B 1B0GB 5FO7A 5E8EA 3SJVA 5FB8B 3DURB 3BQUB 4OZ4A 5IFHL 3ZZ1A 1GAFL 4UUJB 1HN1A 2CDFB 3FO1B 4PJFB 3Q6FB 4AIZA 3H7BA 5FF6A 1CICA 3TN0B 2VISB 2BNUB 3B9KC 3GSQB 4ZPTB 3QIUA 4C59B 4LAJH 5HHOD 1GYAA 3U30B 3BO8B 3O6KL 1U8JA 3X12B 4X6BB 5ETUB 1QNZH 3QDJA 5A2IH 3ZE0F 1N6VA 4FTVE 4M00A 2WSKA 3EO1B 2JIXD 1NCCH 2W9EH 5JLZA 4OCXH 2ED7A 1KJ2A 1CLOL 1QSFD 3Q5YA 1DANU 2IAMD 4UTBH 3RFZC 4PLKD 4WI2A 3VRLF 1FNEB 4PJ5B 3WFCL 1JRHL 3LPWA 3O6FA 2F54D 2YOCA 4P5TB 4NQDA 2BRQA 4OFVA 2ITCB 5DEFB 4D0BA 3RPIA 3TCLA 1T3FA 4LCIL 2O26U 3GSNL 5J3HD 2YR3A 4R8WL 1L7IL 2GHWB 4GKSB 4QWWC 4F57H 2DBJA 3QIUB 3K74B 1AXIB 3QPQC 4LSQL 4YNYB 2EZ0D 4ZDHA 3GHBH 4MB4A 3D0VA 3BN9D 2X89D 5HD8C 4G43A 3PNWB 3HRZB 1VFOA 4MNGE 4XNZC 3TZVA 2F53A 1WFNA 4PGJA 1ERNA 2DJ4A 4JFFB 1BJ1H 4AEFA 1ZHNB 1QPXA 4C56B 2H41A 3THML 4DKEL 2EYSA 1AGCA 2PW1A 1KF9B 3VXTA 1HHIA 2R0WH 2RR3A 4HH9A 4E42A 4OI7A 4ZG1A 3TCLB 2Y23A 4YWGH 1OB1A 4H8WH 4EXPX 3IYLW 4YFDB 4OLVH 4POUB 2Q7YB 1EVTC 3CDFA 5ISZB 1YMHA 5D1XD 3WHXB 3NIFF 1CFTB 3A6CH 1T6WA 1IMHC 2EO9A 1W72L 2XZQH 1RZJH 2YSSB 3QT2A 4JM2A 2BRRH 4KKNA 4KROC 2DF3A 4KK5D 4ZFZB 1IKNA 1MCDA 3JWDC 1A7RL 3AMLA 4K7PH 4JFED 4O2EB 3QIBD 2PW2B 3T09A 4QOKE 3DI3B 3MBED 4JDTH 3W81A 1FV1B 3BGAA 1CR9H 3QUML 2P5WB 4HJ0D 5D6CB 1I85A 4PG2A 2RAMA 3VW3L 4ZXBD 3RWEB 5TQ2L 1RUPL 4OGXH 1L9NA 5BQ7B 4XXDB 2QADC 3MRFA 2Q8BH 3OJ2C 1JPFB 4KKCD 5D7IA 2D31B 4NJ9L 3MV8E 5E8NA 3WFDH 5D8JL 2XXCB 1HDMB 3QFJD 2ADJA 1FGVH 2WWKT 4Y4KC 3LZFL 4OT1H 3B8YA 2UWEA 2LVEA 4ZPVB 3PABB 3P11H 4KK9D 1K8IA 2WWMD 1GZPB 3OJMB 1OP5H 3FO2A 1RUMH 1WGOA 1N6QL 1CE6A 3STZA 1AR1C 2VZSA 1FYTE 2E9JA 5IP4A 4OQTL 4GUPB 2YD2A 4XB7A 4OLUL 1AGDB 2ZPKL 5ILTL 3IJSA 1K4DB 2BSRB 3RWIB 4QT5A 1J1PL 1FFOA 3WFBL 1ZOXA 4PJFE 5L2JA 3NPZB 3VRJB 1FBIL 2FATL 3O3EA 4YX2H 2FX9L 2HFGH 3EO0A 5I16B 3FB7B 3HMXL 1QBML 5I75B 3MRHB 5MENE 2NXZC 3ARXA 3NCYP 1WWBX 2B5IC 2ATKB 5K9OA 1VEMA 3WEXA 3HE6A 3OKDB 1G6RB 1X5JA 4L3CB 1U8KA 3SGJC 1JUFB 1UACH 5KS9E 3MNVB 4P5TA 3DOSA 1TJGL 5EBGA 1REIA 4M93C 3S4SB 1FORH 1ZVHA 5J12B 4HC1A 4MA3B 1IKFH 2NX5B 5LXGL 3FB6B 4KJWC 4UQ2B 3MUZ1 5HI5C 4G6ML 3QFJE 4ETQB 2R4RL 3PGFL 5JZ7C 5D2LB 2CK0L 2MTPA 3MQIA 1PG7H 2Y9RT 4HUVA 4OM0H 3NTCH 4P2QD 1BQLL 2W60B 4F3FA 1V7NL 4ZFOL 2R1YB 5EU7C 5FGSA 4NQVA 3BJ91 3L95B 1GGCH 4XPFL 1JN6B 3WJLC 2H26B 5DMKA 2WIMA 3HE7A 4K3JL 3QG7L 5ACZA 4OZGB 2HLFD 5TF1L 2YHGA 4WEBL 3D2UD 5D70H 5DJ2A 2VQTA 1IFHH 2YBRB 1U8PA 4PJCF 2EE3A 3BKYH 4JFFE 4QXGL 2X1QA 3PUCA 1R3KA 4HK3N 5CEYB 4LLMB 2DM2A 3SE4C 1CLZH 3P73A 2XWBB 4LIQH 2A2QT 1D9KB 5B38G 1JGLH 3IFLL 4JY5L 3LKOB 4L8BA 1MFEH 2Z31D 4F8QA 4HIHA 3VJ6B 5E2TH 1NKRA 35C8L 5IKCB 3FQRB 5TGBA 1KEMH 1QSED 3KG5A 1E4WL 1ZLVK 2CMRL 4OCNC 1MCEA 4X8XA 4OCRH 2MFNA 1CYGA 3VI3F 4XBGB 1I8LA 1V7MH 3QEGL 4YXHL 5IVXB 3ECBB 1G7HB 1KPVA 1V5JA 5FGRA 2D31A 2VDPL 2EH7L 5CD3B 3RVUD 1A6VL 3KPLB 1J1OH 4LAQH 3BN3B 5GGSB 2VWEC 4I3RL 4XPGL 1ODAA 1KG0A 5DJ0A 3BT2L 3F58L 4Z7WB 1P4LB 3LKQA 5C0BD 4PJEB 4N5UA 2WNGA 5D7JB 4YPJA 3V8OA 4LCIH 4R96B 1HXYB 4GRLA 5D2LF 1SJHA 4UBDC 2VKXA 4RWYH 5FYJH 1LE5B 4H8WL 1B9ZA 4HZAA 5I15H 3AUVA 1K4CA 5JW4M 5GGTL 3VRJA 5DJCA 4B53A 3O45A 3N85H 1J05B 1FYTD 5ECJE 4KTDL 3QI9C 5CD5C 5GSRB 2CXGA 4LHUB 4JPWL 1RHHA 5LQBH 4GRMB 1UKTA 1RJLB 2NXZD 4G9FB 1A02N 1KFAH 2EXWC 2PO6C 4KRPC 1N2RA 5IQ9B 1OSZB 4YDKL 5DMIL 5FKAA 1EHXA 1RK0A 4EI6A 5IEKA 4NKOB 4OLVL 2W65A 3QCVL 4IRSD 1NBZA 5HHME 3Q6GH 4J2XA 4DKFH 2DOCA 1QG3A 1OP9A 2Z93B 1DZBA 3PDOA 5E9DA 2BP3A 1KIPB 4XVTH 1U41A 2FD6L 2DMCA 2ZUYA 1JGLL 5F21B 3FONB 4H26B 5CSZB 4EI5D 5CLWA 4LGSB 5FUOL 3C6LD 1YJDH 2BDNL 3MX0A 1OGAA 5SWZD 1ZEAH 5CHNA 4E0RB 1ZT4B 4OTXH 3KVQA 4EUPB 4U1SA 1DLFH 2A6KA 2OI9C 3DO7B 1IAKA 1RIHL 3T1FB 1YYLL 2IH3A 2AQ1A 4K3GA 5HHVH 2Z0BA 2IH1B 2Q8AL 1NCWH 5GZNC 3ULUD 4KHTH 1L9MA 2EH8H 3SCMA 2ZUUA 2QQKH 4OF8A 4W81A 3VG0H 4Z7WF 4JVWA 1MSPA 2F8VA 2XZAH 5D7JD 4JFDA 3SEPA 4OF5A 5MEOA 3X12A 4TQEL 3G5XA 3QWQB 4U3HA 4ISVB 2VE6A 5E2UL 4GG8B 2CO7B 1AHWC 5C09B 1LEIA 1HXYA 5JORA 4P3DA 3B9KB 3EFDH 4FTVD 3BE1H 5C07D 3VXMD 3MLXL 4KKLC 1CFSA 1U8IA 5B8CA 1AFVL 1V3KA 5KW9L 2HKHL 4GLRI 4PRPB 1T66D 5EU6B 4NQCE 1G84A 2A73A 2MCG1 3QO1B 3S3PA 3EHBD 4KK8D 5F7DA 5FECB 1EMTL 3NBNA 2XN9D 4WCYH 4BFEA 3IF1B 2R15A 3G6JA 5BO1H 4W6WB 4YGVA 2V5YA 2X7LA 3R0MA 5D6DA 2LU3A 4PLNC 5IBUG 2XKNB 1I8LC 5FA4A 3B5GA 5DRWA 5B39G 1A1NA 2Y36L 3ZMRA 3ZKSD 5DVOA 1JYWA 3QCUH 5EC2A 3WNOA 4JR9H 3VXUB 1T04A 1S78D 3HR5A 2IQ9L 4JRWA 5CEYA 1ZHNA 2RQ8A 3H3BC 1YN6B 2R29H 2RB8A 3C09C 4E9LA 5EZIH 2VL5B 1S7WA 3WS3B 2XWTB 4R97B 3H2WA 5T33H 4J3TA 4J1UB 4LMQI 4CGTA 3OKMA 3KPOA 2CLZA 3V4UL 1LO4H 2OTWA 4MJ6A 1OAUL 4R9HA 4NKDB 1N59B 2JCCE 3DGCR 1BJ8A 1EO8H 3FO9B 3BYYA 4IOFC 5HVWA 5FDYA 3CFBB 1EHLH 1OSPL 1QVOB 2DQJL 4U05A 1CQYA 4NC2B 4X99B 3PHOB 5BW7C 3R0NA 5GGQL 3P0GB 4JAMB 1KB5H 1CR9L 4YHZH 1BVKB 3DMMC 2ZKHH 2CJUH 3B3IA 4D0CB 4CADB 3B5TA 1BQUA 3WO3B 1WC7A 1BD2E 4QGYA 4WFGD 5EOCL 2WANA 4NO3A 4YHIB 3PWLB 4HIEA 5JXAL 1G6RA 1CFVH 1PG7X 3FT4B 4LQFL 3CZJA 3BDYL 1D9KD 5GRWA 3G04A 4HZLA 1BOGB 1J1XL 2XWBA 3S36L 1JRHH 2VLKA 4A2MA 3BZEA 1RZ8A 2Y06L 1WZ1L 1XIWA 1FIGL 1TZGH 5IW1A 5HGAB 1UVQB 1ZV5A 3RGVD 1JYXA 2JCCA 3QJHB 1GPOL 4I0PA 3CVHB 5HYIA 2V2TB 2Z4QB 1DBBH 2DL2A 3CPLB 3HRZA 4KH2A 5JQ6H 1A6PA 3BKJL 4R7DA 4YHOL 5KAQF 3T3ME 3CFJB 1J1OL 4QOKA 2YPLB 1OP5K 2FX9H 2HFGL 3N85L 4RISL 4F9PA 5DMKB 3O6FD 4UINH 3WUZA 1FFOB 5IF0B 4NOBA 5IGXL 2VXUH 5DA4A 4BFIB 4N0YH 3SJVE 2JK5B 1A1OA 2VXQL 5ICXB 4Y1AD 5EU3B 5FYJE 4NO2B 2P8PA 4LLMA 1Q9KA 4OGAC 1A6TA 1OAQH 4XH2B 3SGEI 3KS0H 2C1PA 1XGUA 3KXFD 1QHOA 5I30L 4RMUA 4Z0XB 4DKFL 1J8HE 7FABH 1ZLSH 2AKRA 1FAKT 2X4SA 2E8ZA 1NMAL 3QIBB 3FRPG 5EU5B 3SO3B 2EDJA 4NQCD 2ZSVA 2NTFA 3DTXA 2VISA 5F3HA 5HDBF 4OLYL 4QHNA 3IDJA 5DVLA 2X9WA 4Z7UF 1GGBL 2IH3B 4OKDA 1IM3B 1DVFD 5C0AE 1T22A 3DV4A 3TFKD 3CFKB 5DC0A 1QSEB 1YYLH 2H2SD 5CILH 4X9BA 1NGWB 3C60B 3IXTA 4P0DA 4L3ED 4ELMF 4K7PX 1C7SA 5DEGA 4O4YL 1QLEH 1L7TH 1MI5B 3BUYA 1EPFA 2IFFH 1T83A 2J4WL 3C2SA 4UZGA 2F5AH 3MV8A 3PABA 4HKJA 1KULA 3H0TB 4HGMA 4PD4J 5AYUH 2GAZB 2LU4A 3U46A 1MJJB 2CQVA 3LN5B 1PY9A 1UJ3B 4YH6A 3J7HA 3NFNB 5DK2B 2PYED 1JPST 1PY4A 2BXYA 5C0RL 3WL9B 4PG9B 3UPCA 3P4NA 2H1PL 3U9PH 5A2KH 4XTRD 2CMRH 1HHGB 3LDBC 1R0AL 1E6JL 4AMKH 2MOVA 5KSBB 5E2VL 3KPPB 5GISH 4GXVL 2A9ML 4ODTH 1NFDB 1F4XL 3RPKA 2VDMH 2PW2A 2ARJQ 3BRFA 2OS7A 3FFCA 3EKCA 2YA1A 5KSAD 1CGXA 4UIKL 4P2QB 1IRAY 1QBMH 4JDVA 4JG1H 1G9MC 2J5LB 3IKCA 3BIAX 1OAXH 3OAUL 3BT2H 3F58H 6CGTA 3BMVA 3G5VA 3PP4H 5LAXA 1MIEH 1KXQE 3LAFA 3VFTA 4MA3A 5F89A 2EDNA 4DVBB 2HMID 2EICA 5FYKL 3WSQL 4Z95H 5MHSD 3BP7B 2OSLB 3L3HB 1KIRB 4P2OD 1FP5A 4DGVH 3MV01 4QNPE 3SE4A 5HPMB 4NN7C 5HDBE 3HPJB 4PBXA 1CDGA 4KAQH 3B43A 1IZJA 4YBQC 3NFSL 5IV2A 3C5ZB 1RIVH 3HFMH 3GMMB 1T89C 5D1QC 3CH8A 3L5IA 5IB5B 4GW4A 2VDNH 1N5YH 1ZK9A 3BQUA 1KB9K 4KUZL 3U0WH 3WXVL 2IPTL 4G43B 5E99L 3TVMD 4JRXD 5EN2A 3CSBA 2QSCL 4IRJC 4DK6A 4HULB 3RVXD 4R4NC 4XVJH 4LLDA 3KYNA 4PJIF 1GIGH 3AS2A 4KJPC 1YY8A 2PYFA 3VXTB 4HV8B 3KNBA 5EOQL 3VE0B 2VN7A 5L2KD 2G75A 3D39D 1AR1D 1D9KC 1ULVA 5JHDB 5IR1A 3GJFB 1JNLH 1FFNB 5IK3B 3JWDL 4JO4H 3UJIL 3MO1B 3SDCC 2HN7A 3REVB 4XGZA 3RUGA 1XGRB 3C9NB 5DJAB 4FQ1L 5CMAB 3F7QA 1N3NA 4UQ3A 5I18H 5HYQA 4IRSA 4U1IA 2PN5A 4K9EH 5MERA 2VUOA 3NZHH 5SWZB 1TZGL 4D9RE 3MV9D 4LU5H 3BFOA 1PD6A 3SCMD 4PTUB 3NOIA 4Q6YA 2WUBL 3O3DA 3UZQA 3FQNB 3QIBC 1NCAH 5CD3A 2C9AA 1CGSH 1AXTL 2XQBL 4Y5VB 1EVUA 3BZ4B 3ESUF 1TETH 4X5LA 4CN1A 3WFHB 3OKDA 1BIIA 4Z7WA 1U8JB 2NY6C 2YC1B 5BZDA 4F7PA 4APQB 4TULL 1UWXK 2DQDH 4Q2ZB 3HG1D 2DQEH 1KCUL 2CO6B 3CVIL 4YC2C 1R3LB 3T8XA 2Q1EA 4PS4L 4TPRL 3S7GA 3VWKB 5JDJA 3EYOA 1JK8A 2P5EA 4U1HA 2LTQB 3DIFA 4MJIE 1MJUH 2V9RA 5IHBA 1I9JL 3PQYD 1ZSDA 1UJTA 4MZ2A 4ALAH 4N68A 4F2MA 1GL4B 3MRGB 4X6CF 5TE7H 5KSAB 4MHHI 1J5OL 2YN5A 4M5ZL 1NBVH 2MQ3A 1U58B 3U6RB 4XP4H 5JR1H 3BWAA 8CGTA 5IGXH 3W2DH 3ZSSA 3PL6A 1Z9SA 3V0WH 5L2JB 4QXTB 3TO4A 4YZFE 3MACH 5H35B 4WI9A 3PNWA 5KSVB 4I2XA 4TTGA 3S5LA 5IB3B 2A6IB 1A4JA 3P9LB 1QZ1A 1OT2A 1P5UA 1U8OB 4NCDA 1Q0YL 1OAQL 4P59L 5H94B 2W0LA 4Q0XH 1PGRB 5B22A 1RZGB 3KYAA 2GKIA 3STLA 3BN9C 1MI5A 4JKKA 1J88A 4CDGC 2COQA 1N26A 5IBTL 1JZ5A 4GMSH 3ARBA 4O9HH 3DARA 4PLJD 4Y4KB 1I1RA 1VFAA 3BIKA 4D3CL 1O0VA 5GGTA 2VLRA 1EXUB 1UB6A 4DTGL 4QXGH 3VXQB 3QIWD 4N8VA 5FYLH 5I8EB 5ENWB 2BVTA 1INDL 1TCMA 1IBGH 5DFTA 4PV8B 5C0FA 4DVRH 4XC1L 4MAYB 3TJEL 2DMBA 4HUVB 5LCVH 2HTLD 3SN6N 5I1LA 4PJ9A 1T7ZA 4HQQL 4WO4C 4YDVA 4N90E 4YBLC 1U3YA 3M8OH 2LFGA 2MQ0A 1EJOL 4HBQA 4UV7L 4ELKB 3O3DB 3LPGA 4YEEA 1QACA 3LD8B 2Y1VA 4D8PB 2P5ED 3ULUF 1A6UH 3I9GL 3QUMA 2GJ6E 4F37K 4X6DB 3UTTD 4QHLA 3E2HC 1GZQB 1KTLB 2WLYA 1C1EH 5FYKD 2VXSH 4NP4L 4WU5B 1NDGA 3B2VL 5H8DA 1VFAB 1TTFA 1VCAA 1XR8A 4PJHF 5C6TH 3ULVE 5I1JH 3DXAE 3HNTH 5HHXH 5JHLL 4LCWB 3OZ9L 2AXFA 1AGBA 3U1SL 2XFXA 5DJ6A 4U1GC 1Q9OA 3FB5B 4OZIF 5ELIA 4QRPD 3RDTD 2AJXH 3UAJD 3CH1B 4XRCA 3RZCC 1KIQA 1ZHKB 3QFDA 2QQQA 2X7LB 2VKWA 1NCUA 3WMSA 1QBLL 5J89A 3PL6B 3GSNH 5I1CH 4MD0B 4KK5C 2APVA 1TCRA 4JKLA 1G6RL 4JB9L 3OGOE 3S5LB 2V7HA 3ARDD 1N4XL 4XMLH 5GS2D 4LLVA 1U8MB 2VAAB 1K5NA 1Q0XH 4LASH 3U4EA 3V8CA 5IEKB 4EDXA 2GSIA 2D03H 2ESVE 4K23H 4XMPH 3PQYB 3SKNB 5DD6A 2VDQH 1FRGH 2C4FU 4JPWH 4Z7OE 2E7HA 4CL7A 4MGXA 1KG0B 4KRNA 5DJ0B 3JWOL 3TEUA 3R1GH 1M1SA 5IHUL 2FB4H 4PR5A 4HMCA 1W0YT 5I73C 2DQFA 1T3FB 9CGTA 4XNUL 2M8XA 2OZ4H 4RRPA 4XB8A 1X44A 3MJ6A 4DVBA 1CIUA 3GMPB 5D2LE 2ID5A 2JJUA 4KK9C 4UQ2A 5F7UA 1V7NH 5E8EB 3T4AA 4HT1H 1G9EA 1HOCA 5LBSL 3PXHA 3AB0B 3AS1A 4HK0B 1IGML 4KKAD 3GKWH 1XIWC 4LCCB 3RWGB 3TJEH 3IVKB 2P7TA 1QO3A 1C8PA 1A6WH 1DQLL 4MS8C 4XVJL 3ZLQC 4WEBH 3WN5C 3X14B 3K2UH 2RIKA 4NZDA 3WV0A 3CFEB 4HS3B 1XR9A 5JOPD 2NY5L 3TH2T 2GQHA 1G9NC 2A38A 3BO8A 4FP8L 3EFFB 4ORGA 5DVMA 4WUUE 3EJYD 3KJ4B 2VWEE 4TVPH 3O8XB 4RNRA 2IFFL 2RFXB 4G6KL 3NH7L 4L3EA 5MENB 4I5BB 1NBZB 3B2VH 1NGPL 3VGBA 2ICEB 4UDTA 1F90L 5FO8B 3TBVB 4NO0D 4QXWA 3UYRH 2XG5A 4FZEH 1V3JA 3MYJA 2PTTA 5E2TL 3HZYA 1JPTH 2OR7A 4S1DD 4WHYH 1T0MB 4WWKB 4Y5YC 1OM3H 4G80A 1KBGH 4U6XB 5EOTA 2BCKB 1DSFH 3RWGA 2X4UA 3DRQA 5FM5O 1P6AB 1JHLH 4WFHE 5DK0B 1P7QD 1YPZF 4EUPG 5JIPA 3ZDXE 2IADA 2NY1D 4WTZG 2B2XL 5T1MA 2AXGB 2FWOA 1NBVL 5CAYB 2GTZB 1R24B 3JUYA 4AENA 3BW9B 2C3XA 1JE6A 5DD5H 1PKQB 4JVPA 1EFXA 1JWSA 4WDIA 1D5IH 3RY6C 4I1NB 4NQCB 3BMWA 1MIMH 1G6RH 8FABB 3OGCB 1I7TB 4OV5B 4CN6A 1BFOB 2AQ2A 4GFTB 5JLZB 3FAXA 2BMKA 5A3IC 1DE4A 1EFQA 4XWGL 4HIEB 1SYVA 3GSXB 3MUGA 4F9LA 1JNHB 1OD9A 3KPNA 1RZFL 4XP6L 1QHPA 3BPOC 2FZ3A 4LLWB 3BKCL 4HS6A 1PX3A 4GMTH 1AY1H 5IOPA 4GBXC 5FIEA 3LEVL 5JPNA 3GJFA 1NFIB 4FQJH 4X6FB 5BS0B 3SDAB 2EIZB 1FGVL 3KPRD 2ICWA 4GW5B 4ODSH 2KKQA 7FABL 2P4AB 5FK9B 4EIGB 3WNNA 1CF8L 4LCUB 4YBLB 1IGIH 3BRDA 1N3NB 4UNUA 5F6IC 4KTDH 2QQLL 1SHMA 3ARED 1INDH 5IEHA 1NC4B 4LSTL 5I8KH 3KYMA 3QQ9C 4Y16C 5H2BB 5DLML 4MXWH 1G7LB 4L8DA 1OWWA 3BP4B 1YMMD 1G7PB 2DQUL 1GAFH 5IB2B 5I1HL 1MFBL 2BVPA 1X5ZA 5ERWB 4JPVL 3GSOB 4PY7A 1FZOB 3HE6B 1M05B 3I6LD 5GSVA 2F15A 4YX2L 5KSVA 1MEXH 3F5WB 1E6OH 3SKOA 2RHEA 1ORQB 3O2VH 3UTSD 5EBMB 3PJSB 2ESVD 4Q6IC 3BSZH 5EUOE 4TVPL 5BMFL 1A7NL 4I77H 2VABA 3GBLA 3MA7A 5J9PB 3PHQA 4JRYB 4NKMA 2FDBP 3WL9A 3I84A 1T1YA 3IRZA 2IMNA 4RAUB 3O2DL 4XPHH 4OZIB 2AS5M 3O41B 4OCMC 1PW3A 2WINA 3OKOB 3DYOA 1I7UA 1ZSDB 4KKCC 1CFVL 4JFOA 4EZMA 1YNKH 1IC4H 3FHAA 4LKXB 1TZHA 3QULB 4YXKL 4QTHB 2HJKA 2CDGA 4Y5XC 2BY3A 3X11A 5EUOB 1OW0C 3C5SA 3O11A 3HNVH 4H88L 3R06A 3TA3B 1UYWL 4JAMA 3G6AB 4UNTA 5E7FA 3QRGL 3QHZH 4PV9A 1A21A 2JK5A 4RFNB 2YK1L 1BM3L 2XZAL 4U7SA 2XPGB 4R3SA 4PRDB 1AIFA 4KJQC 1A5FH 3ZYZA 3TBYB 2ZUTA 1KCRH 4EDWL 5ICYA 5I73B 3TIEB 2VLLB 3C87A 5C0BB 4KV5F 5E94A 2VDQL 2GYSA 3BEWA 4TSBH 3EDEA 1MF2H 1Q94B 3KPSB 1YPZB 1GOHA 5C2BL 3BDXA 5FYKH 1B4JL 3MGAA 3RUGE 12E8H 2G9HB 1RAMA 3HAEA 1TZIB 2ZNXA 4FHBD 2CD0A 5EUOA 3H9SA 1XIWB 4Q9BA 1LP9E 3ULUL 4YHNB 3H6JA 1JNNH 1CFTA 4LSUH 1KEGL 3QCTH 1MAMH 5M7QA 5D1ZA 2VQUA 1BGXH 4NN6C 2AJVL 1WEJL 3ARBD 5KVEL 1PDKA 5C09E 1XF5B 1FRGL 4MLIA 5F1NB 1IEBA 3QB7C 2GK2A 1KLUA 3OHXA 1S3KL 2XKNA 1FFRA 4NQTA 2ENYA 2YZ1A 4MWFA 1WSST 4IOIB 5FYKU 1RULH 3O4OB 1AGEB 2QSCH 1DBAL 3VRIB 4MQ7A 4NO5B 1FAIL 4Z6AT 3VXRB 4HBCH 5FGBC 2X1OA 2R69H 4JRYD 4Z8FH 3IDXH 5T3ZL 1GXEA 4Q9RL 4AYFA 3PWLA 3CCHB 3QQNA 4M61A 4DN3H 1FNLA 3WE6A 2NR6C 3D1MC 1KPUA 3NCMA 4OF6A 4OF3A 1NCTA 2H3NA 3LQAH 4KDVA 4U1KB 4Q58C 2FJGA 3MLTB 3GBNH 1DQLH 3TT1L 1G7JA 5DUBA 5EU5A 1TJHL 3KAAA 2GJ6A 1ZLWH 4Z76B 3LEYH 1E4XH 5E0QA 4L4TE 4Y16A 1WJ3A 2R1XA 4HPOH 1DBML 3EOTH 2ED8A 5T1MB 3SPVA 1RZ7H 1U9KA 3CNKA 4L4TA 4YHLH 3SJVB 5C07A 3VXMA 4DEPB 2VDRH 4HK0A 3U9PL 3S37H 1BFSA 4JFHE 3FO0H 5EC1A 4J3SA 4IIQA 4PJFF 3DRTB 2R4SL 4NQED 4X4YA 5HHOE 3D3VA 4QYOA 4MDJB 5EOCJ 1T1WB 1HHJB 1X6LA 2C3VA 4FFZL 5SX5H 3M17B 1DE4B 2EEAA 3I6LE 5DFVD 4PJ8B 3MGTB 2DLHA 4LF3A 3GZKA 1KBGL 2EDFA 4K55A 1PLGL 2VDLL 1OAZH 3ZO0A 4XPBL 2V5MA 2YD6A 4JRYE 2V17L 4LVNB 4L8SA 3BPOB 2VZOA 4ODXA 5FO8A 4XVTL 3GMMA 1OHQA 5B3NA 1WITA 5HGGS 1CFQB 2ZUQB 3FQUB 2D7TH 5JXED 3QUZC 3HE7D 3O0RH 3V79C 3BGFC 4AL8L 3QH3A 5F7EH 3CC5B 1RUAH 1YZZA 3OHXB 4R26L 4Y2DC 5FOBA 1WFOA 1LP9A 4BQCA 3QPXH 4ZUSB 4HS8L 1GGCL 3IDIA 1TPXC 2NY7H 4WWKD 2VQ1A 4M6ML 4YK4B 4KHTL 3V6ZA 2H2PC 1TVBA 3D3VE 3CFDA 4PBWD 2NY2C 3MLUL 1WZMA 5C09A 4U31A 1IFHL 1J10A 3EJJX 3F7YA 4I2XE 5DJYA 5E6IC 2OZ4L 5AAMA 4KRPD 4TSAH 2D0FA 4NRYB 4PR5B 1NLBH 3C5ZC 2I60L 5DTFA 3B6SA 4JRXE 3QG6B 2NLJB 5T1KB 4N8PA 4IM8A 1DQJA 1KGCD 1HH9B 1KB5B 5A1AA 1U8LB 2ZCLL 5KG9B 2JF1A 1DEDA 3QNZA 1A64A 2GTZA 3LKSB 1C5DA 3QA3A 4JANB 2GTWA 3NGBB 5LVEA 1MFCH 2E7BA 1WCQA 3DJ9A 3EO0B 2PYEE 3C2AL 4CMHB 1RZKH 3FZUD 4HAFA 1ZVSA 1EJ6A 2OP4H 1H5BB 2FJFA 1FH5H 2EDBA 2X05A 3E0GA 3K1DA 2FLBT 1PX4A 3ZT6A 2XN9B 2ADIB 4LGRB 3CK0L 3INUL 4LHQB 3C6SB 5C7XH 3G5ZA 4TULH 4LPXA 4M03A 2R56L 4JM2C 3OMZA 25C8L 1DSFL 4GG6B 1CDCA 3NA9H 3QO1A 1MVUA 1H15A 3GK8H 3MC0A 4CNIB 5J1SC 2FGZA 2GT9A 5DHYA 1F42A 1NC4A 4GAYA 3BP6A 3G6DL 1DQTA 4XAKD 1F4WL 3MRCA 4P9HC 3GB7B 4JZNB 3HAEG 4MNHB 4WFHD 4NFDA 4PJXE 5D7LA 4JG1L 2D3VA 4QRPA 3ARPA 4ZFFB 2AK4E 3UTTB 2C7UB 4PGCB 3BJLA 4HWBH 2RCSH 4M9PA 4NJAL 3QRFM 5T1DH 3T2NL 4JZJA 3N06B 4Y4KA 3L5JA 3SQBA 1RURL 2BJML 1CGVA 5ESAA 3ULVC 3DYMA 2VERN 3ES6B 1DLHA 2VYRE 1WBYA 4XVSL 1YMHB 1ZE3C 1D7FA 3UPRA 4PUBH 4A6YL 2WWMC 4QY8A 4Z78B 2ESVB 3DX9A 2E7CA 3MNVA 1D5ZB 2LE9A 4TUJA 1CFNB 1CF8H 4GMSL 5JDSA 4EI5C 2P8LA 4PJ9B 3ORJA 1AGFB 2EXYD 3VWJD 4HEPG 4L8CA 5IMLA 1NLDL 2ZCHL 4MAYA 4M5YL 4LSTH 5I8KL 5DJDB 1IZKA 1I1YB 3JTSA 3WUWB 1A9BB 2L0DA 5E99H 3O6MH 4HF5L 4PY8I 3MA9L 5JW5A 4APQC 2DLGA 3D69A 4Y2DA 1IAIH 3V6ZB 4P5TD 4R97C 4PLOB 2BSSB 4JQVA 1IEBB 4QRRB 3A0OA 1UFUA 1MFCL 4PGZA 2FJFB 1OCWL 3STLB 1B6DA 4ONHB 4OZGA 1P1ZA 4WI7A 5F9OH 2FX7L 3RY6A 5HYJE 4ZODA 5F96L 3ZHKA 3U79A 4UT6L 3VI4E 3T77B 3UXFA 1EO8L 4HLJA 1IGJA 1JRHI 1RVFL 5AUMB 3KLAA 2M26A 2DTSA 3OXRA 3HHRB 1YEHH 3PGDB 2X4QB 1JL8A 4L8SB 3D48R 4F33B 1GJIA 4BKLA 1NANH 1RIUH 4QHKI 3T0AA 4Y19E 1YA5A 1KYOK 1N64H 3VFVA 5IROC 3ZKNC 2VZUA 4QRSB 3T0EA 2XXMB 5D2NE 3HPJA 5DMGC 5CIPA 3QIUD 4BK4A 4YFLI 3RWHB 4CUCA 4RZCA 4Y88A 5FF6B 2Y6SC 2XQBH 3QO0A 5E2VH 5GISL 4XCCH 5B39B 1YYMH 3PQYA 3N9GL 5AEAA 1BP3B 3MTRA 5ESQB 1CXLA 2VLJB 2YUWA 5IVZA 4CADA 3R06B 1HINH 2NR6D 1U95B 2VDPH 1P4IH 1B90A 1PBYA 5FXCH 4OKVB 1A3LL 4PS4H 3PDGA 3ECBA 1YEIL 4QXUL 1UGNA 1RSFA 3MXVL 1I8KA 5HYJB 2X4QA 3LS5L 4K2UH 3T4YA 2AABH 2B4CC 1EGJH 2KZ1B 1K8DA 2XYCA 4ZXBC 4HKXA 3BGFB 3I02B 1J7VR 4JPIA 1H15B 4I0PD 4QRSA 4ZAKA 1RJCA 4G80B 3QXAA 3UC0H 4OZIE 2R39A 2Q76B 4H1LH 3ZTNH 1MJ8H 4C54A 2Z4QA 2YD5A 1WBXA 2HRPH 4J6RL 3L5WB 1YEFL 3SGEH 2YPLD 3OJDB 2ADGB 32C2A 5FO7B 4BFGA 4ONFL 5D5MA 3W39B 4BZ2H 3JV6B 5D4QA 3X14A 5F9WC 4XCFH 1OTSD 3TT3L 3U0WL 4Q0XL 5J0BA 1H3TA 5DURB 2CIKA 4UMGA 1KLUB 4J3UA 1AR2A 5DEGB 3QDMA 1NFDE 4WFED 1A1NB 3DBXA 1Z9LA 3MRBA 3M17A 3K2UL 2O61B 4J3XA 1ZLSL 2WMPA 2OQJB 2BC4A 1RUQH 1MREL 3GJFH 2J12B 2X70B 1CD9B 3MJ9H 4H0GA 5F6IB 4NDMB 3LN4A 3RY5A 5SWQA 1OD7A 3QAZC 5BRZB 4MCYB 5C07E 3VXME 2FD6H 5I8OL 2AK4B 3MLRH 3BDYH 3UTTE 2MPAL 4YDLB 1CU4H 5HI5D 5ISZA 4WEUD 1I1FB 4L29A 4N8CL 4ODBD 5F9JB 4UTBL 3M8OL 3V6OA 3RWHA 2DJSA 3RIAK 4D0DA 4ZTOH 5GS1B 2XACC 4H26A 5CSZA 1S7SA 5SWZE 1OM3L 3NZHL 3D85B 1LHZA 2DKMA 1EUTA 1F00I 5F8QC 2H9GB 4I4WA 1ZTXL 3DVGB 3WJJA 5BRZD 3WEXB 1YYML 4O5LL 3HMWL 3QQ9D 1NBYA 4Y16D 5I1JL 5C6TL 5I1IL 4MQTB 2F53B 2DLIA 2G60H 2J6EA 2YMXL 4KVCL 2ZSWA 4NNYB 5BVPH 3QEHB 4JFHD 2EDDA 3H42H 5JHDA 1KUMA 4HWBA 4PRIB 4U1MA 4X7CC 4X0KA 4NO2A 4YHPA 4M7LL 4XMKH 5HYFA 4JY6B 2F74B 1YEEL 4HUXA 1C08A 3P9MB 3VXSE 5H37H 1RURH 5GGUB 3I02A 4HKXB 3QBTB 4PJEE 4BSJA 1PQZA 2PTTB 3OKOA 3ARBB 3VWJB 5CCKH 4P5KB 4MVBD 4PJ7B 4XWOC 1F4WH 4X7TA 5CJOL 2OLDA 3WN5B 1FL5B 4FMFA 1J05A 1ONQA 1BFTA 3SDXE 4NM8H 4OCYL 4ZUVB 4HIJB 3ULUH 3UBXB 4L5FL 1ORSB 3RTQB 4XNMB 2EXWD 1XAUA 3MRRA 5BOZG 2OR9H 1MI5D 1OGAE 4DN4H 5D71H 1CFQA 3PGCB 3O8XC 4BZ1H 4OLWL 2D7OA 5EZOL 4LNRB 1T5WB 4EBQH 3O2WL 2FJHB 3D39B 4KXZH 4YQXH 4QRRD 3WYRA 4EN3A 4PJXF 1RI8A 1A0QH 5B21A 5EZJA 2WUBH 1FFQA 1U92A 2Y36H 3SBWC 3F62A 1I85C 1QLRB 1A6ZB 2MJWA 1UM6H 1INQA 1OVZA 2X1XR 4IIQC 5D6CA 5LGHL 5C0CA 5K9JH 1UWGH 5BRZE 4OIIL 1CE1L 1N5AA 5F97E 1NLDH 3SO3C 1NCDH 4PJ5E 1HQ4A 1KLGB 2BOCB 1QFWL 4PJBA 1R3IL 1Q9WA 3DURA 1TIUA 4OZ4B 4XGZB 2EIZA 4X4XA 4KKBC 5T1LB 3W11C 4NQSA 4UAOB 4MD4B 3ARTA 4M4RA 1KTDB 2ZUVA 4LMQE 4L4TB 2W1NA 2XN9E 1ROWA 5C0RH 5IBLC 3K8LA 1JJUA 5DQDL 1S8DB 5TDNA 5IJVB 2GT9B 5CGYC 5DHYB 4ZYKA 2B0SH 3H9YA 2PXYB 2X1WL 3LS4H 3LEXB 2NY5H 1BBJA 1E6JH 3JBG7 3ARRA 4M8QB 3FT2B 4YDJA 3HZMA 5J12C 1QTYT 2A74B 4QRUB 1T5XB 1J0YA 5DRNB 3P2TA 3VRIA 4WV1C 4XXCA 3AVEA 4OV6F 3RDTA 3DX7B 1IT9H 4XCEA 2MWCA 4A6YB 4TVPE 4F15B 2DWEB 3HE6C 4P4KD 3A6BL 3SE9L 4Z5RA 1EERB 2A83A 3P3YA 2P5EB 4U1HB 4ZSOA 2A77L 1EIBA 5JPMB 4FQXC 2CUHA 2F58H 5E56A 1T66C 5HPMA 5BZWA 2JE8A 3H9SB 3UDWC 3V5KA 1PAMA 1URLA 2IF7A 5E6IA 1UXSA 4PJ5D 1BZ7A 2CGRL 2UZIH 4X98B 5D93B 5L2KA 3RX5A 2XTJC 3V6OC 3TZVC 4Y16B 4KQ4L 3C5ZA 4G7VH 4NC1C 3C08H 2QV2A 3AC0A 1KTLA 3GMQA 1JNNL 1SMAA 3SDXB 2HA1A 5B3JE 2UVFA 2AEPH 5BZDB 5SWSA 3EIFA 5C0NC 3QNYB 4BZ2L 4EBQL 1X6NA 3QEQD 4KJPD 1EO7A 1FCGA 3LRGA 5CJ8A 3O4LE 4OJFH 3MROB 3IJYA 3RTQD 1VDGA 2DAVA 3MV7A 3EHBC 4RGND 3VFPA 2CLZB 1EZVX 3SGDH 5F7HA 4HMDA 4TVPD 2EE6A 4HWUA 2FX8H 4OQ1A 3MRLB 5A16A 3U36A 4YHYB 3OSKA 3KXFE 5TQ0L 3KXFA 1XGRA 1BQLH 1G7JB 4ZO6A 5DUBB 4M5YH 3TBSB 4BH8B 4TSCL 2A1WL 1JPGB 2V5RA 4KI5C 2IBZY 1T4KB 2DN7A 2XI9A 5JW3H 3VFOB 2BHYA 1ZA6B 4MSWA 4NYLB 3RL2B 3RVVC 4RIRB 3QULA 3MJ7A 1AHWA 4L9LB 1TQBC 1BQHB 4O58H 5D5MB 4MB5A 5D1XA 1NKOA 4UV4L 3RDTB 2X5PA 4JFYA 2EDEA 5EOCH 2B4CL 2ZNWA 2B1HL 5EBWA 1SBSH 1T04B 4F7TA 1NC2B 5C3TA 2R2HB 3HPLB 4GG8A 3E6FB 4LF3B 1K9TA 2DM4A 4OD3H 2WP3T 3QR2A 3O6LH 4AG4L 4E5XB 3O2DA 4ORZC 1U8IB 5B8CB 1CTNA 3V9FA 1MFDL 5GGUA 3GEWB 4LAQL 3UYRL 3TWCH 1U42A 3WBDA 4YFLF 5LKNA 4MSWB 3BVNA 4JKMA 2CH8A 4FNLL 5C08E 1IQWH 3MV8D 2GI7A 3KPTA 4N5EC 5TH2B 4U1SB 3HS0B 4OCSH 4BUGA 1LMKA 2XY1A 5JIHA 2OJEA 5F93C 2YEZB 2GCYB 3KWWB 3IKKA 4OCXL 5L8KB 3KPPA 3W0WA 2X4NB 3SE3A 1YEKH 4DGIL 1HK6A 2PO6A 3IXAB 3FFCB 2HJLB 1KCSL 3RWCA 4WTZA 3VW3H 5B4MD 4ZNEE 1HH6B 3GIVB 1JHKL 3MCG1 3S88L 1P4LA 3ARFC 2NY7L 3DNKA 1VESA 4NC0B 4CRPA 1MIEL 4NM8L 1AO7B 4G7YL 5HGBA 3HI5H 5GS0H 1PKQE 1YQVL 4XVSH 5I1CL 1CBVH 1TXKA 2EE9A 4ZQKB 1XF1A 4UTAH 1J8HA 1U93A 3WJLA 4QHMB 4X7DC 4YNYA 2P43B 1R3IH 4EXKA 2WINB 1CICD 5GIRA 3V5DA 4M8VA 2CIIA 1QRKA 1YMMB 4EQ2A 2PNDA 4XMPL 4FQPA 4XC1H 2IJ0C 4FG6D 5LQBL 1IAMA 2QKIB 5IROA 3T0EC 3CVHH 4JGJA 4KRPB 5AD0B 4P2RB 4M3KB 4X8JA 4F7MB 4QF1B 1R3KB 4HUUA 4U1JA 1XCTB 4LDLB 4JM4L 4OI9A 1J87A 2VITB 1RJYB 5E6ZA 1NDGB 2V7NB 4CN4A 4A6YA 1SY6L 3ULVL 5D7IB 3WLBB 1X7QA 4HWZB 1E6OL 1IC1A 2X1PA 1P84J 5IW6A 3BWUC 3TNMA 3LHPL 4U0QB 1XGYL 3QEUA 1A7NH 3TIEA 5GGVY 1NL0H 2NY6D 5C0CD 3SQOH 5AZ2H 1MVFA 1P69B 5GZOD 4YJZL 4BJLA 3X3FL 4MDIB 4HJGB 3OKMB 3IFLH 3OL2A 2IG2H 2BDNH 5DMJB 4QLRA 4HFWA 5D9SA 3IVKA 4YHKL 3RBGA 5L2KB 5TDOB 1RZ7L 1WISA 1I1AB 1IC4L 4ZTOL 2AI0L 1JZ8A 4R90H 5BV7H 1UXWA 1JGVL 2E6QA 3G9AB 4MX7A 5GGVL 5EORL 2FNBA 4P2RA 2WW8A 5TQ2H 5DUPL 5FHAH 3CZFB 5DDHB 1A3RL 4MNHA 2KH2B 3MRKB 1RY7B 1YNTA 3K4DA 5EH1A 4Q97A 1MLCA 4O2FA 4YAQB 3WLBA 2F9BT 5DRWB 2Z35B 1LO5B 3PWNA 5IB4A 2FR4B 4GRLC 1CK0L 3BPLC 2F53D 1D9KA 1A8JH 1IC7L 1RMFH 2R2BB 1YEIH 4PRID 5HHMB 4HCRA 2V17H 3LOWA 4M3JA 1NDMA 1CVRA 1ED3B 1ZANH 2R8SH 2PTUA 1KT2A 3VMPA 4GAGH 3REWB 5E9DD 1CFSB 1JTTA 3MNWA 2C3HA 1RZJC 4LSRL 1JGEB 5IFHH 4XNUH 3B4NA 5EBLA 1MCFA 2XTJE 4WY7L 3V6OE 3P0VH 4TNWF 3I6KB 4KJYB 1YECH 3U0PA 3LY6A 2H8PB 3RVVD 2NY3B 4JFEA 2OTPA 4YAQA 4N90D 1UWEL 2DQHL 4RX4D 2KPNA 4IBLT 2RGSA 3ZTJG 4GW1A 2EXYC 2IANE 4FXGA 4X6CE 3VWJC 1F2XK 5FA3A 5IIEA 1INEH 1T5XA 3UEZA 1U95A 1KNOB 3O4LB 3OR6B 1GZQA 4PJBE 1OSPH 3RX8A 1L0YA 5F7KC 1DBAH 1FYTA 5HYSA 1BEYH 2AJUH 2EYRA 1A5FL 1JNHA 4WHYG 1G9NH 3DXAD 5ITBH 2NY1B 5DS8B 5SV4A 1JZ2A 4JQIH 3PQYE 1DCLA 3ZKMC 4XCNB 4ISVA 3UCRA 5TPWH 5FYLE 1KJ3L 5E08H 2LV4A 3RU8L 5HHQA 4KZDH 3EZJB 3K2MC 3IGAA 4PJBB 4KZEL 1IAKB 5I1EH 1I3UA 1MHPH 5E8PB 3CMGA 3QQ3A 2DLEA 4U0RC 5KSBF 1VACB 2IADB 3ETBF 3IJSB 4V1DE 2AXGA 4ZUWB 3A67H 1F6AB 1HZHH 1RZIB 3ZL4L 3LPFA 1P7KA 1NMBH 4R4FH 3C2AH 5E95B 5IQ9A 3BHBA 1AXTH 5DUPH 5FHAL 1WCBB 4PJHA 1IAOA 3OKEB 3G6JB 5ALBL 5J1AB 1F4HA 4QOKB 4BQBA 1I8IA 4U1MB 3QP3A 1XFPA 2QQKL 4NRZA 4W4OC 3BX7C 3EYFB 2WAHA 3WIIL 4W6XB 5HD8D 4MXQD 2NYYD 1HH6A 3GIVA 4Z7VE 2BK8A 5D1QA 4U6VH 3ULUE 2R2HA 3LIZH 1FZMB 3TVMB 3U7WL 2F58L 5F7DB 1LGVA 1RZFH 4DQOH 2W9DH 3GIZL 1YEGH 3NFNA 4ZAKB 4RAVB 3PWJB 3A6CL 1FVCA 3RNQB 1DBBL 1QR4A 2B7DT 3DX9B 1QUNA 2X4SB 2YN3A 3O45B 4OZFA 4R8WH 5JMRA 2VLMD 4WFFE 2JJSC 4NC1E 3C8KB 1IAOB 3OKEA 1ZA6A 3VA6A 1ZLVH 4NQVB 3JV0A 3GMLA 1EBAA 3W5NA 1JN6A 1CZ8H 2J6EL 3RJDA 3L3JA 5BO1L 4JDTL 4DCQB 4NNPL 1J11A 4HWBL 1E27A 2Z9TA 3MV7E 3O2WH 4I8DA 5JIIA 2HT2D 1HWHB 3B2UD 4PJIE 1H3PH 2P46B 5E4IA 1HI6A 3MLVL 4GQPH 1TDQA 2DQGL 2G5BB 1G7IA 4GS7B 3FZUC 5INDB 4WI8A 3WLWD 5MEPA 4KROB 5HHOB 3LN4B 3MA7B 4KUCF 4XP1H 3WDHA 5J9PA 5CILL 4P2OA 1ND0A 1I1FA 4I77L 4PJDE 1QFWH 4Y8AA 2P47B 4DAGL 2E7LC 5BW7A 5CMAA 4U2ZA 5EDXA 5F1IA 3MCLL 3C6LC 5J6GA 1HHHB 1A9EA 5J56B 1CICB 3TN0A 3BZEB 2C3GA 4OF0A 3F7PC 3P4NB 1GGBH 4WW2B 2BRRL 3ZE2E 1CCZA 1KN2H 2ZOKB 4LLQA 4M7ZC 2A74A 4B50A 3G9VA 3DVNB 1CXHA 2Z8VC 3VDBA 1CN4A 5H2BA 1VPOL 3IDXL 4PBVC 1NGXA 2GJZB 3MJ7B 4YHIA 3HNVL 4G9FA 4AMKL 1L7TL 3FMGL 4LOUC 3SY0A 1CGUA 1CDBA 4XZUA 4GRLD 4PTTB 1RUPH 4OGXL 1X5XA 4UDUA 5GRVK 1NC2D 2PF6A 3O3BB 4L1HA 4Q2ZA 4DW2H 1YUHA 4M6OL 5ADPL 1FH5L 1X4XA 1UJ3C 1XGTA 1DQQB 1FL3B 4EDWH 1JK8B 2C1OA 1YPZA 5ANMB 4Z7QF 5JPNB 3MBEB 2IANB 4X6CB 1S9VB 5HI3D 1X5GA 1NSNL 2P24A 1UZ6E 3VFMA 1B2WL 3QDJE 1XF3B 5IMMA 2Q20A 5I8CA 3TESA 4LSQH 4KQ4H 1EHAA 4YZFF 1GSMA 1JFQH 1X5AA 3RNKA 1A3QA 3BQUC 4JEGB 3UTZB 3U4EB 4FFYH 1AD9A 1A6AB 3M1BB 4G8GD 5C71A 4V1DD 1WC7B 1NAMA 2AJYH 2GUOA 1NEZB 1I9EA 2EIBA 3VFGL 2VAJA 5DC9B 2BVOA 4PJGA 4RGNB 5FA3B 2VDLH 4PJXA 4PYHA 2FSEA 3CFDB 2GITB 4D94A 4BZ1L 3EO1A 2VXUL 2FEEI 1ZANL 4KQ3L 3IDYC 2OL3B 4DKDC 5T1DL 3SDYL 5L9DH 5CWSA 3MRBB 4Y5YA 2BNRE 4XNQA 5C0EA 4HK3J 1I7ZA 4HUXB 5JPMA 4DK3A 2BY2A 2Y07H 3WE6B 3CK0H 4HV8A 2X4TB 1U8KB 1FNHA 4LRNL 1RQ5A 4BSWA 4ODHL 1MJ8L 3V6FA 3CPLA 4HGWA 4HIHB 3BP6B 3QSKB 1KN4H 4MA1C 2QHLA 3SKMA 1XCQB 3ARGC 2JELL 4J8RA 2YKLH 6FABL 1WZ1H 4MNQE 2GFBA 2B39A 4LLQB 5IV2B 3EYQC 1P6FA 2EZ0C 4OGYH 1ZVYA 1VGKB 3EJYC 3FB7A 2EC8A 3LN9A 4Z77A 2GSGB 4P23B 2XWJA 2EDKA 3QIWC 5K9QG 5DHXB 4AT6A 2ICWI 2CLRB 1T83C 5BQ7A 1FHGA 1WCBA 3QUMB 3X17A 1RUKL 3NACH 4K9EL 3GSNB 4F57L 2ZJSL 2QEJA 4UT9L 4K3DH 2DQIL 3VH8A 5JO5B 5HBBA 3D18B 5T33L 2HYMA 4M6NL 5HVGB 3D25B 2M2DA 4UB0H 2AGJH 4PRAB 1QR1B 1PZ5B 1FG2A 4WU7B 5FO9B 1H5BC 2XFXB 4OKVA 5D7IE 1U0QA 3L1OH 1TNNA 1W72A 4LIQL 3BD4A 3AY4C 3M07A 1MHCA 1KLGA 2HAZA 5D2LA 1P53A 3RIAF 2L4OA 3O81A 1S7XB 5A2LH 3A6BH 3SE9H 4MCZB 4FXLA 3PIQA 5LGJA 1ZAGA 4JY4A 2R0ZH 1I9RH 1RUML 1N6QH 3PP3H 4PREB 2N1KA 1DQJB 1OAYH 2P24B 1NGQH 4BUHA 1QP1A 2VR5A 1M6OA 3IDJB 3T0XA 1XF3A 1YY9D 1JZ7A 1TFHA 2Y72A 5DO2D 5IT2H 4TUKL 4HUKB 1NSNH 3VD4A 4D0DB 2VSDA 3JVGA 4ELKA 4RMSA 1W0WB 3GMRB 4XNYL 3W9DA 43C9B 1AKJB 2UZYB 4NGHL 1MLBA 1NAKH 3MODL 2HLFC 3TO4C 2XA8H 2VNCA 3Q6FA 3ARDC 4TNVK 4U7MA 1P7QB 5JR1L 4WW2C 4U6VL 4WTWA 2JB6B 5CGMA 1U8HA 3NAAL 2AQ3A 4XBPA 3MV8B 1FDLH 1S7UA 3W11D 3T77A 3AFLA 1QEWA 1JTPA 3AB0C 3GJEB 1AGCB 1NQBA 1Z2KA 3IAPA 4PRIA 1FQ9C 1ZS8A 4IEFB 1RZKC 5FYJU 4KQ3H 3EYFA 2J8HA 3VJ6A 1D5XB 2YRZA 5F96H 1Q0YH 5T5NF 1O5DT 1SMOA 2X42A 3NCYS 4U1NB 3SKJH 1NEUA 2OZ4A 5C70A 2HVKA 2ITCA 4HGWB 1GZPA 4GG6A 1U3HC 5DUMH 4L3EE 5BV7B 2WWKO 3NTCL 4R7DB 4WWKC 4M62H 4KAQL 4KV5E 3AS3A 3FRUB 4X4MA 4GKSA 1QSFA 3RVTC 1JI1A 2D7NA 1A47A 5EG6C 1RIHH 4L4TD 1XF4A 5ESQA 1L4IA 4PGDB 2J1KA 2WM0A 3HZKA 4L4VE 1T0NA 4NUGH 3CFEA 4OUOA 2E27H 4HSQA 4JJ5B 4RMTA 1A7OH 1GC1H 2HFTA 1GGUA 5JXEC 1T1XB 3DHMA 4LSVH 5JOFB 5DWUH 2OX5A 4LRIA 4ODWA 5I9QC 2E9BA 4EOWH 4R4ND 4HC1L 1G9NL 5ICXA 5JMOC 3QJFB 2J8UF 4KGLA 1KSRA 3OR7B 4NWTL 2UYLB 1CDHA 2X4PA 4LVNC 2UWEE 4JQIL 3EFDL 5IFAH 3ZE0E 4YFEA 3BDBA 3K0WA 4FTVA 1IL1B 4UNVA 2BVYA 5DJZA 3BVNB 4F8TA 3OKYA 5C7XL 1S9VA 3RWJB 1G9ML 3CMOH 3ZDXF 3QIBA 3MBXL 1MY7A 3MZTA 1WBZB 2YD9A 3AM8A 3L3DB 4M9OA 5FOJA 3W39A 2R56H 1G7QA 5HYEA 2LU7A 3LEYL 4LGPB 2O5ZL 3Q0HA 5KSBA 3WKMH 1VADA 4UUJA 3MLWH 4LLYB 5D7LD 4JFEE 1MCQA 4MNQB 1UH2A 2AJ3A 1OCWH 1A7QH 1N0XL 3IFOA 2B5IB 3GMOB 1DVFC 1P4BH 3PXJA 3BWAB 4R2GB 5B3JF 2CXKA 2VLKD 4CDHA 4QRQA 5DRXA 4N0UA 1P9MA 2IBGA 2PTVA 2YK1H 2XA8L 1U6AH 2PYFB 5AYUL 4NQEA 2FHFA 2ZG2A 15C8L 3QHFL 4NSKB 4QRTB 1CG9A 1N6UA 5DD1L 1YN7A 5J13C 5IR1B 2VR9A 4JB9H 5ID1A 4YWGL 4TQEH 3FT3B 1KCVH 1H5BA 1G7MB 3OKNB 3H3PH 5AWNH 5HI4C 1FG9C 1KYOJ 2IPUK 4P3CL 4ZPVA 2FYYA 5C9JA 1NPUA 2VB5A 3MRIB 2FO1A 3TA3C 5DJCB 5DEFA 5A16B 4JFQB 3RIFF 4YXLL 3GUTA 3BEVA 3HI5L 2OTUB 3BKML 4FQ1H 5L8JB 3W9DB 4NZRH 4XPAL 1MQKH 4JHAL 3O4LD 3WUWA 1BJMA 4R7NA 4K7PY 4L1DA 5FEBA 4EJ1C 4M1GH 5C8JA 4H1LB 1BIIB 3EOAB 1K85A 1KEML 1YQ2A 4ZYKB 2PXYD 4NQDD 3ALWA 4YUEH 2XT1B 4NOFA 5FV1L 1S7TB 3GHEH 3IDMB 3KPLA 4PRPD 3D3VD 4C56D 2AJZA 5CKAA 2C7UA 1LO2L 5GHWH 3UC0L 4HMEA 4M61B 3OXSA 3MV7D 5FO9A 3VFTB 2CSPA 1FL3A 2AGJL 4FXKB 2LVCA 1FL5A 2DQCL 3C6SA 5D7KE 3X3GH 4YDIH 4N1CA 1T2XA 1IQDB 5C0JB 1ZWIA 4P2QE 2E5EA 5DI8A 2FO4A 1YEHL 5I74B 2V2WB 2A6KB 3DO7A 3I6KA 4WWKA 4QTHA 1PZUB 5IHZB 2ZUXA 4J3WA 1YMMA 1DQDH 2CIIB 3G6JF 4GAYB 4OM1L 3FTGA 3P9LA 3WKNA 4WW1A 1RFDH 3BP5B 4R0LB 3AREA 1NUDA 4ZUUA 4QRQB 3SDAC 5I1KH 4NRZB 3NVQA 3HR5B 1J0ZA 5E00B 1EDQA 1HCVA 1TLKA 3HUJB 3V7AE 4DUWA 3RWEA 1FFPA 1IGTA 1ORQA 3QXDB 4JFZL 3CX2A 1C1EL 4F80A 5ESVB 1IT9L 2HVJA 1TJGH 1XF2A 3MLZL 4AEIH 1KJMB 3QHFH 4NPYB 2R2EA 1P4IL 5I18L 1OP3H 3P30H 1A4KB 3CH1A 1IC5H 4XRCB 1JMXA 5IESH 4R0LC 1NUNB 4TTDC 3U4AA 1WLHA 4D0BB 4YDKH 4GBXD 5E8OB 2V2WA 1C5CL 3FN3A 4RMRA 1ITBB 4XPTL 5KBNC 1W72B 3L3KA 1NFKA 2EDYA 2ATPA 5FYKE 2OJZL 2I9TB 1GC1C 1QSEE 4P5MB 1NCAL 1EV2E 4MAYD 5C08B 4BYHA 3VXNA 4PJAB 3ZT7A 1MJ7L 2XZCH 3FB6A 5MI0C 3TPUA 5FK9A 5DD0H 4I9WE 1MWAA 1ZLWK 1FORL 2KZWA 3WIHA 1JZ6A 3VXUE 3O11B 4PRHE 4CNIA 2DIJA 3EOAA 3VWKC 5M94B 1DUZA 3HUJA 3ROLA 1Q0XL 4KMTL 4JO1L 1EFXB 1JWSB 3QYCA 2HP4A 1HIML 3WNKA 2J8OA 3BPNB 4O4YH 1QSZA 1HILA 1N8ZA 1XCTA 3SDYH 1GGIL 4JHWH 4Y1AB 5JHDD 1HKLL 1V05A 4PGEA 3TVMA 1UQSA 2MSPA 1ONQB 2WBJA 3OF6A 2G2RB 4GG6F 2E7MA 4ZAKD 4BK5A 3W2DL 1UJ3A 35C8H 1LO4L 1P2CA 3MNWB 3MRGA 5E4EB 4BFBD 1NAML 1OARH 3DV6A 3ZT5A 4NUGL 3NCFB 1U2CA 4L8BB 3QNZB 2FEDD 5DF0A 3U0PB 4KJYA 4GXVH 3GSRB 3BHBB 2AV1A 5IKCA 1H3XA 4LCWE 4ZS7H 4GRWE 4BQ8A 3P0YL 1KIUA 3IFOB 1KOAA 3TA3D 4LLUA 1IAIL 5FUZH 2ZJSH 4UILH 3EGSA 5TFSH 2H2PD 3WDIA 2YBRA 1N2RB 1SY6A 1MLCB 3KS0J 2KL6A 5IMOA 5H37G 2VE6B 3NIFE 1XT5A 2C1PB 1I7TA 4PRDA 5HYJD 4HPYL 3QZWB 4DVRL 1BREA 3HC0B 4K7FB 5DS8A 1B0RB 5T1LA 2QHRH 3GSXA 5TE6H 3FOMA 3DIFB 4AG4H 3LKQB 4KGJA 3L6FB 2BVQA 3CFCL 3EYOB 1MCLA 1XH3A 4P5MA 3EJZD 4P46B 1UXSB 4X98A 1HXMB 1N0XH 1RIUL 1KTDA 3D9AL 3MLYL 2FHCA 3VDAA 3MREA 1HKFA 1WFTA 3QISA 4TUKH 2BSED 2Q87A 4MQXC 2VRAA 2YPLA 4HT1L 2CDGB 4NHCL 2YPLE 4RWYL 4ZUSA 5JA9A 1CXEA 3QQ4A 4HWEH 3ARGA 3GRWH 2BY1A 5FOBB 5KOVC 4F9LC 3ZSTA 3OF6D 1Q72H 1BD2A 3TV3L 2HFEA 4FQXB 3RWFB 3E6FA 3IETB 3L7EB 4IMKC 1T1XA 2A77H 1GIGL 1QOKA 5I66A 2R1WA 3DROA 3IFPB 3Q6GL 3VXUA 4IOIA 4GG6E 4LSSL 3TPKA 2AJSL 2NXYC 2I07B 3MUY1 3SE8L 1G0YR 1QNZL 2ZKHL 2XIDA 4MYWB 1XGTB 5DK2A 5FKAB 3SKOB 1PVHA 1SEQL 4YXLH 5JNYA 5F3BB 1UWGL 5BZWB 2P8LB 3S37X 3AAZA 3CLFL 1G7MA 1XZ0A 3OKNA 2F74A 5JXAH 1LNUB 3FB8A 2VOTA 1JPGA 1BGXL 5DI8B 2X9XA 3TH3T 3L3HA 1JMZA 3ZKQD 3UP1A 3CIQA 4ZMAT 4X7TB 1MNUL 3GSWA 1S8DA 4X7SL 5IJVA 2CK2A 1JCKA 3HNSH 1JBJA 4OD2B 5DJXB 2ADFL 5CP3A 4CVXA 4Q6IA 5BCAA 3U48A 4JLRB 1INEL 3GMOA 4KXZI 3KPRE 1UXWB 3IXAA 2B0SL 4FFVC 5HTSA 3TT3H 5SX4I 5IJKA 3JVGC 1UZ8B 1ADQL 3H9ZA 4YHOH 5I74C 1W0VA 3T0BA 2XQYK 3WFHA 1JF5A 4HC1H 4LLWA 3AU1A 1QFUL 4WFEE 2Q8AH 5A43C 2VXTL 4X6BA 4JDZB 4F58L 2EYTB 4NPYA 2UV3A 4LIQE 5FYJD 1YN6A 3T2QA 5J11C 5DHVA 3BH9A 3JXAA 1XGUB 1JPSH 3CCHA 3VD7A 5E5RB 2WUCL 1FZMA 2CDEB 4M7LT 2UVEA 3ALPA 1YEDB 1MUJA 4HAGA 4PJDF 3T0VA 1BZ7B 2JIXA 3VXNB 3BAEL 2JJTA 4Z9KB 1U3HA 2FIKB 2HT3D 4IHOA 2ZOLA 3W9EA 3EDKA 5D7LB 5FDWA 1P4BL 3IDNA 3GSUB 3HC3L 1RD6A 3IU3A 5DD0L 4D2NA 4HKZB 5GS0D 2JB5H 1NGXB 2GJZA 4HWEL 1GOGA 4EN3B 1Z0NA 2X4RB 3MXWH 2Q3AA 3VH8B 2A6IA 2DIBA 3CVHL 4LHUA 4S2SB 2ATKA 4MNGA 2FEEL 5HSFA 5HHNB 1NUGA 3TZVB 1A3LH 4HHAB 3B83A 1VHPA 3MLSL 1MEXL 3OG6B 1Q9LB 4K3EL 3OXSB 4N1HB 4PGEB 4QHKJ 1JHLL 1TZIA 4DQOL 1LE5A 3K80A 4G8GB 1S5IH 4Q9CA 1AGFA 4FQCH 1I9IH 1CT8B 3VMOA 4OCSL 1KJ2H 4P2OB 5AZ2L 3UYOD 1JNJA 5CJOH 1Z3GL 3RQ3A 4DOHE 2F8XC 2BOBB 1MPAL 2C26A 4XPAH 2FO4B 4POYA 2Y7QB 3T2OA 1MCPH 4GLRH 4G6MH 1MCOH 4WY7H 1G7LA 1XIWD 3UJJL 4KKAC 3I50L 2GCYA 4OF7A 5E7BA 4OM0L 3KR3L 4W70A 1S3KH 1GH7A 4Q6IB 5CEXA 3BEVB 3M1BA 4X9FA 4CMMB 5JOEA 4OLWH 1OGAB 2ZPKH 5JA8B 5ILTH 3T0WA 4PB9L 1U8LA 3D18A 3LKRB 4O2CB 3MFFA 3QUYA 4AEHH 1X3DA 2IH1A 5F7FA 2R9HC 1H3UA 3FL7A 2ZCLH 4HIXH 1D6VH 1H3GA 3LRSB 1JUFA 3RY4A 3VI4F 4XP1L 2C4FT 1FAIH 1KB5L 3TNMB 5DD6B 4HXBH 2R2EB 4UT9H 3V5HA 4NZTH 4X5WA 4E5XA 1TITA 4Y4KD 3GDBA 4HH9B 4RGOH 4YDIL 4CVUA 1S7WB 1CLZL 4Z7OF 1NJ9A 2K3TA 4DTGH 5C1MB 5K59F 2XV6B 1OPGL 4W6YB 5SV3A 5FFLA 4Z7QE 3VFVB 1CU4L 1JPSL 1BF8A 1EAJA 1RZ8B 1X9QA 2NX5E 12E8L 1MFNA 1AQDB 4OLYH 3BP4A 3WO4B 5KTEH 5GJSL 4ODVL 1ZGLM 3ILQC 1KEGH 4OQTA 2DB8A 2BSRA 1MCSA 3I85A 3ZKXC 4MHHG 3K3QA 5DJ2B 2EH8L 3DVNA 2CLRA 1ZHLA 1RZGA 1NMBL 4YGVB 2Z31B 4ZXBB 2EIEA 3QDAA 4P46C 4WJ5B 2HTKD 3DX6A 1IAIM 2JB6A 2CR6A 2JJVA 1LE9A 4JFFA 2FBJH 4J4PA 3KPQA 1EK3A 2W9LA 3KPMB 2KQMA 4P9ML 1M71A 4YDLC 4M7KL 4JCLA 1PLGH 3OR7A 3UYPA 4KK6D 4P2RE 3DX7A 5C09D 1BVZA 5E8NB 4WU5A 3OZ9H 5IG7A 2A0LD 5GRJL 4PJ8D 4LOUD 3ZDYE 4D9LH 1LK2B 3E6HB 2V2XA 1EGJA 1JVKA 1MJUL 1N0LA 4V2BA 1JHKH 3KJ4C 3S88H 5GGRB 1UKQA 1KJVB 1GGTA 3GGWB 4XP9L 4YR6A 2DMKA 4YDVB 4NNXA 4WUKL 3GBML 1G1CA 1X5LA 4HXAL 4NQDB 3VFMB 3LSOB 4ZFGL 4L9LC 4PGBA 4D9RD 1A2YA 1RUAL 5ITFA 3SGJA 1WAAF 3L95A 1OLLA 1MCIA 4ZOAA 4LVHB 4GW1B 4LBEA 2ZCHH 2VDOL 4LDEB 1NFDF 1N4XH 4XMLL 3VXPB 5I76B 4TSBL 1EBPA 2OQJA 1I1CA 1DDHA 4PB9H 4LU5L 3VXUD 4YUEL 4QRTA 5TF0A 4Z7UE 4NBZB 3KGRA 4CU6A 3MOBL 3TBTA 2VAAA 3VMNA 1ADQH 4LVOC 5DQJA 2QSVA 5MENA 2Y07L 4RMVA 3VE0A 3KPOB 3LZFH 4OT1L 1UENA 3WIFA 1T03L 5F7YC 5LWYL 1MCRA 5K9KB 2FECL 2R0LL 4ONGL 5E8DL 5KZCB 2NPLX 2YUVA 1I8MA 1X5IA 4K8RL 1I7RA 2DI8A 3SQOL 1MJJA 2D7QA 3NIGF 5JDSB 2QL1A 3U6RA 2EDRA 4LNVA 4PYGA 3RTQA 4ZTPH 3STZB 4DGYH 4ELMB 2V9TA 3KLHD 5D70L 2APTA 3RGVB 2NY4D 3ULVF 1JWMA 2Z92B 2HLAB 1BPVA 4NZUH 3N1PC 5IBUB 4G8EB 2G5BA 2CJUL 2OJEB 5TFSL 2OK0H 1F11B 3IT8D 3LH2L 1I8IB 3VGAB 5CBAB 1TJIH 4KJQD 2B4CH 4FG6C 3FFCD 4Y7MA 1RU9L 3LQAL 3GSVB 3QEHA 5L2KE 4FQIL 2DQGH 4OI8A 1BF2A 4PB0L 4RGNE 4FQ2H 5MEND 1PZ5A 5CUSL 2UYLA 3MPCA 4KZEH 4M7JL 5IWLC 4XI5C 5LAXB 4NRYA 5DTFB 5KJRH 2FZ3B 1AP2A 1Q94A 2NZ9D 5L7XL 3OKLA 2YZ8A 1V3LA 4J4PD