1IL1B

Crystal structure of g3-519, an anti-hiv monoclonal antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSRNQMNYLSWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYHYRTFGGGTRLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody G3-519 (heavy chain)
publication title Structure of an anti-HIV monoclonal Fab antibody fragment specific to a gp120 C-4 region peptide.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1B01
4RX4D 2YD7A 1Q0XL 4RISH 4Z0BH 4JFFA 4XNQB 3BE1L 1QNZH 2EKJA 3ARFA 2NY3D 5D1XD 2GFBB 3RNKB 2EYTA 2A77H 2DTSA 2ARJA 5C92A 1X5YA 5K33A 1J12A 1JNNL 2ED8A 1E0OB 1ZTXL 4P57B 3FZUD 1C16B 1KNOB 1OT1A 2OTWB 4TSBL 3RGVD 3D2UD 4OGYH 3SDCD 1LO5A 1KB5L 4QEGA 5DS8A 3IS1X 2WLZA 1ZSDA 4JKPH 5FOJA 3CLFL 4X6BB 4R0LB 4UBDD 2NZ9C 3QEGL 5F8RC 2C3WA 5A16B 1G7MA 3MV9A 5FA3B 4KKBD 5FHBL 1WISA 1IZJA 4LAQL 4G7VH 3QULB 3IFLH 3MRDA 4HKJB 1URLA 1WEJH 4IRJB 5CBAB 3SDDD 1MF2L 1ORSB 3HLAA 4ETQA 5ACZB 2XN9B 1WC7A 4K8RD 2FEEL 5FM5M 3BZFA 1ZA6B 5D7IA 2J12B 5HXMA 4E0RB 3ARED 4NZUL 2H26B 5DMKA 3QHZH 4XH2B 1PSKL 1YJDC 4NRXB 3TO4B 4NDMA 3W0WB 1XGPA 3T0EC 1L7TL 1U3HC 4LKXB 4WCYL 1TZHB 3AFLA 1DP0A 1FVEB 1NFKA 3QQ3A 3BW9A 1MHEA 3RJQB 2GCYA 1LO4H 4MD0B 2BOCB 3ZDXF 1X5JA 2PXYA 1A4KB 3BPNC 4CVZA 4PJAE 3C6LD 4XX1E 3MLXH 2D7OA 3CD4A 3U7WH 1DQQB 3DRTB 4KI5C 4JFEE 1NAKH 2H41A 2IG2L 1QBAA 4YFLF 2MSPA 4Z77A 4C56E 1OHQA 4YAQB 1YC7A 3KDMB 3GM8A 2WBJD 1NDMA 3RKDD 5H35A 5IMKB 4XNYL 4W4NA 1BFOA 3QJFA 4X0KA 1W0VA 1OM3H 4KRPB 4BSVA 1VGEL 3CXHJ 3ZL4L 2R69H 2GK2A 3MRPB 2AV1B 1XIWA 3MLUL 1P5VA 1M71A 1EAPB 1T20B 2ZUTA 2VO5A 3KNBA 4OM0H 4XPHL 3MLZH 2M8XA 3CIQA 4EKXA 3V6FA 3H7BA 4Z7UA 1BAFH 2WINB 3ARQA 3PWVB 4KQ3H 4Q9CA 3R06A 5DMYA 3TF7C 4R7NB 1KEGL 1C8PA 1YEHH 4PJCF 4YEEA 4MA7L 4Z7WF 5E8EA 1SEQL 3U4BH 5IBLD 3O2WH 1F2XK 3BWAB 5I1HH 3EYUH 5LGHL 3V6ZB 1EGJA 2MPAL 1T80A 4K8RH 1I9IL 4TNWF 3VXUB 1IEBB 4HWZA 4YR6A 4YHKH 5LBSL 3VFPB 2IGFH 3HI5L 4HGWA 4ZAKB 4QHNB 1UENA 4M6AA 4NJAH 1AD0B 4M48H 5SWSE 4GRWE 5E94A 1T0NB 4ONHB 4UDUA 4M03A 5AYUH 1X6NA 4EI5A 1MFEL 4OV5A 2V2XB 3BGMB 4X7DC 3FO9B 3WD5L 3X11A 3VXTB 1NH6A 4M5YH 1T1XA 4YHYC 1TIUA 4ZOAA 1MNUH 5DEGA 5IOPA 3QIBA 4NFDA 4QHLB 2BC4B 3WNLA 4C57C 3GSXA 4XP9L 1FNHA 3CXHK 5E6ID 5J0BA 4IRZH 4Y5YA 5TH2B 1PZUB 3MBED 1EBAA 3NCFB 4LASH 2CRYA 5MERB 3QUMH 4BH7B 3C5SB 2AJZB 4R7DA 2RJMA 3RVVD 2W0FB 4LVHB 5C6TH 1KEMH 1OAQH 3B5GA 5I19H 3MXVH 4Y4HA 3STLA 3RL1B 4HW6A 5D70L 1I75A 5J4MA 2EE3A 3WE6A 1NLBL 4XHJD 1LO3L 3KWWA 3UAJD 4XPTH 5EU6E 4XBGA 5DUBB 1IE5A 5GRUH 3JWDC 2ZCHL 3GNML 2DQIL 3UYOD 3QI9B 4G6KH 4ZSOE 1JGUL 2D31B 3V6OC 5D9SA 4Q9QH 1RZIA 1Q9KB 4YC2C 4A2MA 2ZOLB 5INDA 4Y4FB 2L7JA 3S9DB 1EEZB 1UM6H 5IFJB 3O3AA 4FXLA 4YFDB 3O6FA 5MENA 3CVIL 4HHAB 3O11A 1YEKH 3LRSA 5FKAB 3HZKA 4GG6F 1K85A 3QDGE 1HHJB 1XF3A 4L5FL 4J3VA 3MV7B 2HJLA 4K3JL 1DBKH 4P2RB 3SBWC 5DRNB 5FO8B 3VGAC 2V7NB 3NN8A 3TC9A 3VXOB 3D39E 3K4AA 4OB5L 4MHHG 2YUXA 5HY9B 1OGAB 4FQHB 4UTBH 4ISVA 3HMXL 1T5XB 5IW6B 3DO7B 2MWCA 3PGCA 1U95A 5J3HD 1IBGH 3A6CH 3F7VA 4XPFH 3WL9B 2VITA 3GFUA 1AI1L 2VIRA 4PR5A 4WUUE 3B9KB 5JZ7D 2BHZA 2BNUB 4Y2DD 3MRNB 1TCRB 3BHBA 4QXTB 15C8H 4N0YH 4Z0XA 5C0JB 2ADJA 1T7VA 2HTLD 1UFUA 4ZS7L 3FOMB 4HS8H 2NY0B 2Q6WB 3VD9A 2D9CA 4NYLA 5E4EB 5DVLA 3T65A 3NCBB 1D6VL 2IFFH 4X7FC 3H9ZA 1VENA 3T4AB 3QIUC 2OS7A 5F7WC 5AZEL 1EUUA 3T0XA 1V8HA 2VAAB 5DQDH 4Z6AT 1NLDH 3KPSE 3MNWB 3S35X 5ETUB 5F7NC 1JMXA 3T08A 1E4XI 3SY0A 4G9FA 3WFDH 3WCYA 5ISZA 2UVEA 3U0TB 3WEXB 1ITBB 1FO0A 4M43H 5C86A 4NNXA 1Z5LA 1AE6H 4GSDL 4C59B 4JRWA 1CFVH 4NQUA 4MD4A 4QGYA 1DL7L 3GSQB 1AC6A 2VDQL 1S7XA 5GGVY 4V2CB 1JPSH 5HI3D 1HQ4B 3VXRA 1ZGLA 4RNRA 32C2A 3I3BA 3MRBA 4YXLH 4QOKB 5CWSB 4ALAL 1YECL 5D7KE 2MNUA 1NCWH 1MRFH 2IQAB 3C2AL 3S96A 3QCUH 3LV3A 4JKKA 3G5XB 5E9DE 1CE6A 3IDJA 2ESVB 5EFIB 3IGAA 3TEUA 1MH5B 2ZJSL 1YEDB 5EUKA 2DRUA 3HN3A 5ERWB 3DTXB 1ITCA 1NAMH 1DVFB 3B4NA 3QEQE 2FIRT 1NGPH 4JRXE 5DF0A 4NZDA 4LSVH 2ORBL 1FNEB 1XEDA 4X6CB 1LHZA 2IAMC 4LCIH 3RX7A 1BZ9A 1NSNL 3FL7A 4L8DA 1LP9E 3ARDB 2JJSC 3LKRB 3GMRB 5D7LA 5IK3B 1J0HA 3FFCB 1HINL 3T3ME 3H3KA 5A2JH 2I60H 2ZSWA 3VXME 3OF6D 2BSTB 4JO3L 2IF7A 4ZFOB 3CFBB 1DBJH 1XF5B 2GK0A 5BV7H 1CICC 1IC4L 4PTTB 5J56B 3NH7L 2FB4H 3NVQA 4JFZL 2PO6D 2C7UB 3GUTA 5EULV 1S7QB 2XKUA 3CPLA 5FYKE 1KLGB 1L0YA 1QLFB 2W65A 5IR1A 4WU5B 3QYCA 2VLJD 3O6ML 5L2KB 1G7JA 4LLUA 1Z9OA 2AEQH 3IS0X 1M7DB 5D7JD 5DD1H 2LAGB 3MOAL 4LVNC 3Q6GL 3V4VH 5KANG 3VXSA 4RAVB 3RBSA 3MXWH 4LGSB 3B8YA 3CUPB 3P2TA 5FYKU 3WNPA 4MCZB 2GQHA 4X9IA 4X8XA 2X70B 2HLFD 3QCVH 5J1SC 5KVGL 4YE4L 3PL6A 5DJXA 1FPTL 3HI1B 3ZLQC 2IMNA 3K2UL 3MLWL 3FOLA 4NC1C 2IBZX 1NBQA 5D1XC 3MBXL 5AWNL 3GHEH 5HGBA 4UOW1 5CLWA 3F7RA 4JFPB 5CD5C 3FZUC 5E2UL 1XR8A 4IMKC 5KSAD 3PHSA 5B4MD 5HVHB 1K8IB 2EDFA 3KAAA 3BPOB 3RGVA 3D2UA 3SDCA 4KQ4L 4BKLA 1N8ZA 2OTUB 4KKBC 4JJ5B 4NBYB 2C3VB 1D5XA 2GJZA 3MJ7B 4QCIB 5AG9A 3BD3A 4P4KC 1T1WB 1ZT1A 1MJ7H 2K7PA 4H5SA 2W07A 1MVUA 1B0RA 1QLRB 3SDDA 3QEHA 3LIZL 4B7IA 1A7RL 3QUXB 4HFUH 3AREA 3SDAB 5C0IA 1K9TA 5I17A 2JJUA 1GGBH 4XP6L 1NEUA 1IT9H 4QO1A 4WEUD 4JN2A 1BBJB 2HN7A 4FOMA 3L7FA 2EDJA 3CZFA 3C5ZA 4JZJA 2WUCH 4RFOH 2XKNB 3IDMA 4HUWA 1T66C 2AXFA 4JFYB 5ADOH 1Y18A 5CCKH 3G5VB 2WBWB 5GS0L 3C6LA 4WU7B 1KTRL 3I75A 5H94B 4OFVA 1CF8H 4LEOB 3OWEA 3QO1A 5FYJU 3RKDC 4UDTB 2WBJA 4XHQA 4FTVB 5DVNA 3N1MC 5ELIA 4FFWD 2Y5EA 3L3DB 1IZKA 1SJHB 3O45A 4KMQA 4LRNL 2APFA 4MAUL 3O2DH 5I9QB 2R23B 3D87B 3LD8B 4OD3H 3WNKA 1W0WA 2ARJQ 4RMTA 2AAVA 4K3EH 4XX1G 1YNKH 5IBTH 1JI2A 4S1RL 3F5WA 4GBXC 4Y16B 4U1HA 4FQ2H 1AC0A 4O2FA 4N8CL 3B5TA 1UACH 3K8MA 4JAMB 4P9HL 1A2YB 3K7UA 1D5MA 4MJ2A 1BQSA 4H25B 1KPRA 2BERA 2CMRL 2NY6D 5ANMA 2I9LB 1JPTH 4WHTA 3SDYH 2YWYA 5IB5B 3SKJL 1NCDH 3EOBA 1INQA 1AHWC 4NQSA 4XC1L 4YK4B 2DLGA 1OP9A 5DRZA 3OR6B 3TWCL 3WIIH 2BNRA 2IALA 2PW1A 1N0LA 3F7YA 1SQ2N 1SMAA 2P42B 2B0SH 5CIPH 1TVBB 1GGCH 4H20L 43CAB 4IIQA 4HFWB 5IJKC 1SJEA 3CSGA 4C58B 3SGJC 1F13A 1MJUL 4PG9B 4Y5VC 2X9WA 3DGGB 4L4TD 3RX5A 4NFBA 3F7PC 3S7GA 3BIKA 2YK1H 1FIGL 3VXNB 5ESAA 1EH9A 5L88L 4ZNEA 1BWMA 4F37F 3DI3B 3L3HA 3PP4L 4IJ3B 3PQYD 1DCLA 4LHUD 4UILH 4U1GB 2BNQB 2DBLH 5E6IC 4FFZL 2VLLA 3LKNB 4MA1C 1CYGA 1S5IH 4X98B 3GSNB 2GY7B 3DX7B 2VL5A 4NN7B 3MBEA 3L3KA 5A3ID 5KVEL 4NGHL 3BP4A 2ENYA 3DX6A 3R0MA 1JRHH 4P2QE 3RVVC 3L5WB 3S36X 4J1UA 2R0WL 1IL1A 1VACA 4ELME 3E3QC 4ODWA 2BDNL 2YD1A 4XVUC 1NKOA 1E28B 5EO9A 4DVBA 5EDXA 3MACL 3L9RB 3BP5B 2FCBA 5IGXL 4Z5RA 2JJWA 4PJCA 2NR6C 3LZFH 4OF3A 3TJEL 5IMOB 5TF0A 3GO1L 1TETH 2J2ZA 4YLQT 5GGUB 4OLUL 1S5HA 4PJGE 3VG9C 1JWUA 4P5TD 4PRIA 3VH8G 4X8JB 1H3VA 3IFOB 1EMTH 5C1MB 5F1KC 1LDSA 1CD1B 1K3IA 1B3JA 2XWBA 4Y1AE 2OZ4H 4PRPB 4KPHH 5FKPA 2FNBA 1P9MA 4M7JH 3FRUB 5DGQA 4NZRL 4O2EB 3V7AE 1WCQA 3PP3K 2OXGA 1TVHB 5JPMB 4GFTB 4X7CC 5DD6B 3ARSA 1UM5H 2DQHH 2ATPB 2FO4A 3FO1B 3C5JB 1U2CA 4YHMH 4I9WE 4A2LA 5JOEA 1C5BL 4PBWD 5J1TC 4K55A 3P0YH 4NKIL 4YBLB 5DEFB 3BEVA 4K07A 1FAIL 3CK0H 2FZ3A 3IAGC 3UZEA 2ILLA 4IRJD 5C0BA 2XN9D 2QQNH 3NTCL 3X17A 3BMVA 4GXVH 3FQTA 1J8HE 1NGWB 4XMPH 4AEIH 5F9AC 1RZ7H 1BQHG 4FQJH 4Y2DA 5CJOL 5F70A 5KJRL 3T8XB 1BECA 1N4XH 4ZG1A 2VH5H 5CUSH 3QUKB 5C08A 5BMFH 4G6MH 4I0PB 3MRKA 4LFHD 3SGKA 4EN3D 4PJ9B 3RPKA 1C7TA 2ITCB 5DLML 4WI6A 5KSUB 1YY8B 3UX9B 4R90H 4G8EB 1ZANH 1DE4A 2Z31B 1MUJA 1P84J 5BV7C 2I07B 3GSVB 2DJUA 5EN2B 5T3ZD 3E6FA 3OXSA 4QNPF 4FQQB 1DLHA 4XAWH 2CH8A 4Q9RH 2DI8A 1KACB 3B3IB 1LEGA 1OGTB 2A74B 2X4UA 3O4LE 4U6VH 2Z4QA 1E6OH 4JPIA 3E0GA 1VFAB 1JGVH 1XT5A 1GOFA 1IAOA 2ATKA 5DQ9A 1NCCL 1PKQB 3D0VB 3TVMC 5HI3C 3F8UB 1FYTD 1FZJA 1NANI 3AB0C 4LDEB 2HLAB 4GG6A 3QO0A 5C09B 3PJSB 3JTTB 3HI6H 3ROLB 3G5ZA 2P4AB 1NCUA 3M8OH 2F5BH 1G7IA 5E1HB 3X13A 2I25N 1V7ML 3BI9X 4FNLL 4RQQB 4YDIH 5I1JL 4APQB 1BD2E 4DQOH 3OJDB 2HVJA 1FN4B 4UTAH 4M7ZB 4J4PA 2V7HA 1CDIA 3D0LA 1MHCA 1INEH 3EZJB 4AEFA 3GMNB 1EBPA 2H8PA 3REVA 4HKBB 5ENWA 4FABH 1YEIH 2ADFH 1BM3L 3RIFK 4NPYB 3WIFA 2ZUWA 5TDPA 3BX7C 3DGCR 4DW2L 2FSEA 4NP4L 5F9WB 1DBML 2NCMA 4GMTL 1VFOA 2LU3A 4XCEA 2O5YL 5GISL 1P84K 2KQNA 1R6VA 3RVWD 4F57L 1EGJL 1S7SA 4XMKL 4ODTL 2YC1A 5A43C 5EO0A 1SMOA 3BEWA 4HC1A 4G3YL 3D48R 3FT2B 1QVOB 5J12B 2I24N 2IADA 3MRHA 3WUWA 5F9DC 5CFHA 1FORH 1T0PB 5T3ZH 1R3IL 2YOCA 1HQRA 4G5ZH 1T1YB 2IBGA 2PO6A 3S5LA 1NEZG 2VRAA 3HAEA 4B7LA 1IC7H 2VDOL 4JFEB 5HDLA 4OGAD 5IKCB 1N0XL 2BHYA 3C08H 1CFQA 1EPFA 3FQUB 4FXGA 4C56B 5K59E 1UJTA 5CZVL 4NT6B 5D1ZA 3MNVB 5IEKA 3IDNA 5BRZA 3GMLA 2AJXH 3V9FA 2VLJA 4X9FA 4WV1C 5D7JA 4H1LA 5FCUL 3BWUC 3SO3C 3CU1A 3LH2H 4JFFE 4CVUA 3WFHB 4JZNB 3DARA 3HMWH 1WIUA 2NYYD 3VFNB 4NHUA 3RL2A 4XAKE 3QIWB 1JI1A 3FFDB 5IROC 2R2EB 4GKSA 1K8DB 5TQ2L 4PG2C 5BZWA 1PYWA 1NBZA 2A6IA 5KS9F 4M62H 1X6LA 4EJ1C 3NBNA 1PLGL 5JDJA 1Q9OB 3JV4B 1MJ8H 3QI9D 3DVGB 3W5MA 4AMKH 3HTLX 2C1PA 3IU3B 4F7EB 3G04B 4EUPB 3NABL 3SQOH 1U8QA 2RFXA 5EBMA 1FL5B 5KSAA 3U30C 3HG1B 3REWA 2R0LL 2Y5TA 3UJTH 2ZSVA 2OK0L 2I5YH 5D7IE 1A6UH 1V3KA 2HKFH 1K2DA 3BJ91 3NIGE 5LWYL 4GAGH 5ITFB 4BYHA 2X4RB 4FQXB 1UEMA 5I66B 3DNKA 4LPCA 2MKWA 4PJFF 3ARBB 4GRWB 4E9LA 3MLVL 1MCCA 2AK1H 2APBA 2EH8L 2VDLL 4EDWL 5CSZB 5HHPA 1B90A 4LKCB 2GTZB 2NY5H 4JKWA 4RWYH 5CIPA 3HR5B 2NY4D 5IQ9B 1QBLH 4OTXL 2NY0D 4DGIH 1C5CH 2E5EA 4ZDHA 3VI4F 5I8CB 4TUKH 4EEEA 1WTGT 4F9PA 1R3KA 2W9EL 3D1MC 4XWGL 2IH3B 4JVPA 4NQVA 1LEKA 1U8JB 5LQBH 5D6DC 1RZJL 1UKQA 4PJBA 3BPLC 3AAZB 1F4XH 1KB5B 5IFHL 4BQCA 2JE8A 3GSOA 2DWDA 3GI9H 4ENED 1KCVL 4RFEB 3NZHH 1KG0B 3R0NA 1T2QH 4QXUH 4MAYC 1WUNT 4M1GH 1JUFB 4WWKA 3QFJE 4Z7UE 2F5AL 3OR7A 4J23A 1QYGH 3X14A 4PJXF 4XP1L 2DOCA 5EU6B 4WFGD 2OSLA 2WAHA 1UA6H 5BO1L 2X4QB 4P5MA 1J05B 4OFDA 4OGXH 4QRRA 2OJEA 3O2VH 3W39B 1EIBA 5GGSA 3G5YA 4XNZC 5JQHC 4LP5A 4CVXB 1HCFX 3SEPA 2H32H 4J8RA 4M61A 1AH1A 3BP7A 5DI8A 3WKML 4ZUTB 3JSSA 1FO0L 3OB0H 2R0ZL 1TTUA 3VFMB 4K71C 2Z9TA 2V5YA 1H8NA 2NY6C 3ZTJG 1MCWW 3QDGB 2XY2A 3X3GH 1QR1A 1CIUA 2P8PB 2OZ4A 2CK0L 1R24B 2X4OA 3QWOB 2Z92B 1PG7X 2Y4SA 1CFSB 1JE6A 5JLZB 1OSPL 4G8FA 3T1WA 5FM4A 4X6EA 3D39B 3LY6A 3V95A 5GZNC 5FHAL 1XR9A 4QF1A 5GSRA 5E8PB 4PRAA 4F8TA 4I1NB 3U9PH 4JLRB 5GRZA 5B8CC 4KJPD 4ODXA 5DD0H 2ICWB 3BZ4A 4WUUB 2R1YB 3HC0B 3VXQB 2M1KA 4Z0BL 2KZ1B 3ARDD 3P4NA 1T3FA 1MCWM 2FJHA 1QZ1A 2JB6B 5F9JB 1JNJA 1ND0B 1FCGA 1Z3GH 3PQYA 1QKZH 2ZOKB 1OAKL 5HHNB 4HT1L 5I8KH 3QXAB 2YUVA 5LGJA 4OGYL 1A6AA 1DQJB 1EX0A 2UYLB 3M45A 4Z7QE 5HSFA 4JKPL 5CEXB 4GQ9H 3KPSB 4DGYH 3LQAC 4QLRA 4U1JB 4NN5B 3RX8A 3SPVB 4G7VL 2P8MB 1MIMH 3EOTH 5IV2A 4D9QE 1U8IB 1WEJL 2ICEB 3I02A 5T1LD 1DEEA 3BPCB 2AXHA 1JNHB 5HPOA 5F1NA 3WXWH 3AMLA 2YPKA 5L2KD 3NFNA 3T1FB 4HIEB 4X99A 4PRDA 2E9BA 2I26N 3QHZL 3TLRA 3U7YH 1G9MC 1E4WH 4LIQE 2KBGA 1P69B 3RWDA 4P5TC 3LKQA 1LDPH 2XTJD 2HP4A 1S9VA 5MENE 1I3RA 2WQRA 2VB5A 5F9WC 2Q3AA 4HUVA 1OQOA 3RZWA 1ZHBB 4F15B 5F6HI 4LSTH 1LO4L 4G6AC 3NIFE 4PS4H 1D6EA 2DQUH 5E9DB 2V2TB 3OKKA 3DUSB 4NO3B 5CJ8A 3ULVL 1YPZA 2QADD 3PXHA 1CFTB 3MLXL 3A0OA 1VADB 2EZ0D 1EEUA 1NAKL 5C2BL 1S9KC 5TE7H 1ZT7B 3O0RH 5DUMH 1D5BA 4X6DF 3KLHD 3QEQB 1RI8A 2FWOB 4JRXB 2R2HA 5FF6B 3T0EA 2R69L 4UIKL 3PXJA 4IRJC 4S2SA 3S37H 3U46B 2GUOB 4UT7H 3UJIL 4KUZH 1AQKH 4L3EB 2YEZA 1LP9B 1MSPA 1UXSB 3KYMB 3SE3C 5TF1L 3QA3B 1KCUH 4JRYD 1TJIL 1BAFL 5CBEA 2B1AL 3D9AL 3TO4C 4IEFB 3TBYA 4D0CA 1XF2A 1EDQA 4KQ3L 2XRAH 1S9WA 3S4SG 3PWJB 4IBLT 1HHKA 3QUZB 1AGDA 4HWEL 3VXMB 4P5KA 4OLEA 3U4BL 2VZSA 3O2WL 4IOFD 5TFSH 4XCNB 1MCSA 2L0DA 4LLMB 1MFAH 3AU1B 2CK2A 4EN3C 3EYUL 2BX5A 1D9KB 1ZE3C 1TZGH 4K8RL 5ISZE 1P7KA 4U1SA 3ULSA 2HVKB 5DJ6B 2XV6B 1LE5B 1UC6A 1G1YA 1WBZB 2XI9A 1GAFH 3FO0L 4YHKL 5BZDA 2IGFL 4IRSB 3L3IA 4X4YA 1I8LA 3PWLA 3JTSB 1ES0B 4XPGL 2H9GB 3MUGA 2PR4H 3CLEH 2QR0B 4OZHA 1F4AA 4FTVD 4KRPC 3WSQL 1EHLH 3K3QA 1MFCH 2V5RA 4PV8A 3G6AA 4NQED 5E2WH 1I1CA 4Y5XB 5J7CC 3GIVB 1IQWL 4UT6H 5ACMA 2NNAA 5DC4B 1FYTA 4KTYA 5E8OA 4OLXL 1UZ6F 3DETC 1TNNA 1LO0H 3S8WA 3S35H 1NMAL 3KXFA 4Y16D 1UQSA 4S1QH 3SKMA 1AIFA 1JF1A 4KK5D 1P4BH 1ZS8A 4MJ4A 1N5YH 2AV7A 1KFAL 3GSRB 1I8IA 5L2JA 3P3YA 4I48A 4W68A 1IAKB 3SOBL 1II4E 5DFTA 1WVZA 4YHPB 5C6TL 1KEML 1QSVA 3QRGH 1OAQL 1YYLH 1S7TA 2HT2D 4YBQD 3MGOA 1QD0A 5I19L 4WVRA 4KZEH 4HMDA 5KN5A 4C83A 3MO1A 5ITBH 5EBGA 4OSUL 3TT1H 3OHXB 1TPXC 5TQ0L 3JV6B 5D7LE 4L3AA 4ZAKC 1M05A 3Q5OA 3WDJA 4PLKD 1A8JH 1ZVYA 6FABL 4XPTL 4PRBA 3MCLH 1OW0A 3BUTA 5B38G 4WFFE 4R97B 3RVWC 3P0VH 4YHOL 2GHWB 3QHFH 4D8PB 4WO4A 2E7LA 5D93B 4Q9QL 1F4YH 3OKMA 2WSKA 5I1EH 1G9EA 3U4AA 5DRXA 5EOCH 2Q8BH 3SO5A 4KVCH 2VZUA 1YEKL 4HBCH 1EHNA 4GRMA 2WQ8A 1F6LL 4ZFFB 5DGRA 5SWZE 2GITA 5I1AB 1HKLH 1C7SA 2J6EH 1DBKL 2YHGA 5I1DA 1LEIA 3P11H 4XVTH 3SGDH 5MEPB 1TFHA 4HJ0C 1XMWA 3VXSE 3BH8B 4N68A 4NQDE 1H0DA 4PP2A 4LVHC 5DYOB 3DVNA 3WNOA 1RY7B 2E9JA 5I1IH 1BQLH 3LQMA 1WCBB 1IBGL 1M7XA 1PKOA 3KPRE 3A6CL 4XPFL 3RVXC 4DKEH 3G6DH 1Q72H 3EFFA 3VD4A 4L8CA 4F9LA 4JPVH 4F7CA 1HXYA 2B5IB 2NYYC 3LSOA 3O3EA 15C8L 2OCFD 2P5EA 4N0YL 4LBEB 4HS8L 3HRZB 5SV3A 2V9QA 3EHBC 4BQ8A 3QI9C 5IG7A 4ZFGL 4CJ0A 2DQFB 3D25B 3DMMD 4Y4FC 3T0BA 3HE7B 4PRPD 1KGCD 3GB7A 4XZUA 3MOQA 1RAMA 3ESUF 5INCA 4LOUD 5CGYC 5ID0B 4WUKH 1NLDL 2IMMA 4GLRH 4R3SA 3RWHB 4KZDH 1KJVA 3B2VL 2YBRB 3VFVB 1QACA 4O9HL 3WS6C 4JDVB 3HZMA 4M43L 3LRHA 1EHXA 2W60A 4GOSA 2YKLH 2J8UB 4HV8B 4MNHA 1CFVL 4C54A 1IGFL 3TBSB 2X40A 1NJ9B 2GT9A 1EO7A 1VGKB 1AO7A 4I3RL 3TYGH 1OP5K 2OP4H 1S7RA 5IEHA 2VLMD 3VA2C 5DTFB 2GSIB 4XBEH 3B9KC 3DBXA 1U36A 2NY1D 2P7TA 1MRFL 1F8TH 5FOBA 1DQMH 3QCUL 4XNXL 1Y0LB 2NY0C 5GIRB 3MFFA 5E4EC 5D4QA 3WN5B 4KDTA 2AJUH 3VWKB 2D2OA 2X89A 3MJ8A 2R29L 1P4LB 4I0PD 4MD5A 2DLIA 2VUOA 3GSWB 4CVWA 4YBHA 1CGWA 1IQDB 3HPLB 1QFOA 1MJJA 3U6RA 2R9HD 1FFPA 2ICWI 3JWOH 2VN7A 4ZTPH 4KRLB 1ZHLB 4R26L 4KJWC 4P2QB 5E08H 2FD6H 3G08A 4AK1A 1B2WH 1E27A 4Z7NF 2E6PA 3U0PA 5KS9A 2I27N 4ELMB 4XCYB 3TNMB 2PUQT 1WSST 5CZXC 1XCTA 3TT3H 1GGYA 2ITDB 3NFSH 2OJZL 4OD2A 1FVCA 3L95A 1RFDH 3LS5H 3RZCB 4AJ0A 3LAFA 5JDSA 4OFPA 4ELKA 4DUXA 2AQ1A 1CXHA 4U0QB 4ZUUA 5I2IB 4HG4J 1R3HB 1IGIH 4FZ8H 3IETA 3W11D 2DM3A 4PJGB 2DD8L 1PFCA 4FXKB 4Y7MA 1KIRA 3BGAA 4DZ8A 4QHMB 1NCBL 1BJ8A 3V0VA 3MRFB 3MROB 3SE9H 2I60L 1F6FB 3AS2A 1S9XB 3KLSA 4CADB 5ANME 1FGVH 4QRTB 4Y1AB 3O8XB 1JN6B 4PJ8B 4BZ2H 2FB4L 4K9EH 2MOVA 4APQD 4HWUA 2AEPL 3DX9A 1RIVH 1MCEA 4PJFA 5EC2A 1RIUL 3BO8B 3I6LE 1T2XA 2NW3A 2JELH 5JNYB 1AGEA 5C6WH 1HXMB 4XPBH 4PJ7A 3BJLA 3MRRA 3QPXH 1OSZB 2IQ9H 4N8VA 4NRZB 3RY6A 3ZDXE 4BK4A 2AEQL 4MSWA 3GK8H 2DYPA 5DD1L 3S3PA 2BRRH 1U8OB 3ARVA 3V4VL 3BAEL 3GBNL 3MXWL 2HFEB 4MX7A 3OPZH 4ZNEE 4NCC2 3QCVL 3ZHKA 1BREA 3LKOA 3FQNB 1QLEL 4NBZB 1RK1A 3L3OB 3ARDC 1YQ2A 1JCKA 3VE0A 3DV4A 4HIIA 4JFQB 3Q0HA 4YX2H 3O3DB 3SE4A 1HOCB 3FQXB 4E42B 5E1AB 4P2OA 5CP7A 4OZFH 4JPKL 1QUNA 4NM4H 4OFYD 4GW4A 3QXWA 3TGXA 1MAJA 4UV4H 2C3XA 5C07A 3FB7A 4BQ9A 4HG4K 2FEDC 1BBDH 1JGEA 1IC1A 3IF1A 3NIDF 2OMNA 1RHHA 4H8WH 5E5MB 4L29B 5HVWA 4GRWF 1L0QA 4GW1A 4PJXA 5D1QA 2DDQL 2Y7QA 4M7LH 4PJCE 2LU7A 4OCSH 3ARXA 1MJ7L 3DI2B 5F97E 2H6PB 2E7BA 1KT2B 3O4LB 4G8IB 2B1HL 4HC1L 3V52H 1JF6A 2VL4A 5I30H 4HFUL 3CDFA 3GSUB 4TSCH 4N9OB 5ALBH 4G9DA 4NKMA 2OI9B 2Y07H 5TDOB 4V1DB 3DIFA 3G9VA 3QIWD 5C0RH 1UZ8A 3FMGH 5E03A 3HC3H 3OAUH 3IRPX 4OLZH 4FFYH 4I18B 2VLKD 1A6TB 5FGBC 3PG2A 1VPOH 4HK0B 2VXTL 2WUCL 3W2DH 3IYLW 4RFOL 1BD2B 2X4TA 1XGQB 3S36H 3UPRA 5IFAH 3UO1H 1GXEA 1OB1B 2FIKA 5ADOL 4K7FB 1I85C 4LP4A 3N85H 1TITA 3PWPA 4HWBH 2E9WA 3KJ4B 4MQXC 2GJJA 5H2BA 3ULUC 1KN4H 4WNQB 4L9DA 4LNRA 1YNLL 4GUPA 5HVHC 2P46B 3BPOC 3MLRH 4TULH 3ARGB 3HG1D 5C0BE 4RZCA 4HX1B 4NCC1 4WJ5B 3F12B 5HYQA 3KLHC 5KOMC 4HS3A 1I1AA 3ARUA 5GPRA 3U4EB 5JO5A 3KPPA 1A14H 3H0TB 1CBVH 3K74B 4FZEL 1BGXH 4FQXD 4TRPH 3OJVC 4YGAB 1U41A 5CP3H 1YEJH 4I2XA 1CT8A 4JFXB 4OD3L 3QUXC 2DQDH 2HG5B 1WFTA 5DR5H 5F44A 3SDAC 4MDJA 1MOEA 2EYRA 4WI5A 1IGTB 4JRYA 5IESH 1OTUD 1U8PB 3VFRA 1G0DA 2P5WA 1FZMA 5GJTH 2L7UA 5DVMA 3O41A 4CAGA 5EOQH 2AJ3A 4NO5B 3PV6A 3QUYB 4JY5H 4XXDA 3BD5A 1OP3H 2A83B 1AXSB 1JPTL 4K2UH 5IW1B 3SDYL 3RHWF 5CJXC 1HDMA 2VDPL 3WHXB 4JQVA 1NCDL 5GZOD 1JWSA 2YXFA 4JO2L 1GSMA 1I3GH 2DMCA 4YHZH 4J3XA 2CRZA 5IB3B 4JM2B 5AAMA 3WIIL 2HYMA 4NUJB 1OLZA 3BISA 4RAUB 1Z9SA 3S88L 4LVOB 1MAKA 1RJZA 2B0SL 1N64H 1GGCL 4YDJB 4GG6E 1YEEL 4PJDA 2GJ6D 2J6EA 3P4LA 3EDDA 2GY5A 2ZUQB 4ETYA 4JFFB 3BKYH 3QZWA 3ARFB 5HDQH 3P30H 4FQLL 4KKAD 2H2SD 5B22A 3CX5J 4NQEA 2EYTB 2ARJB 5EU6D 3GIZL 4PB9L 5IF0B 1ZEAH 5I9QC 3LD8C 4E5XA 3QISA 4UILL 3ZT6A 2DBLL 1MHPH 5J89A 4NN6B 1MCQA 1CK0L 5T1KD 4X6DA 4Y16C 1V3JA 1LO5B 1TQCB 5DS8B 5LCVH 2ZNXA 1ZSDB 1G7MB 1T1ZA 4ZFZA 5FECB 1B9ZA 1NUDA 1TJGH 3MRDB 1MQKL 5EBLA 1JRHL 5DVKA 1OAUH 1OY3B 4ETQB 1NBVL 3HLAB 5IJKA 1WC7B 1QSEA 3BZFB 4NO0D 4YBQC 1WFOA 3VI3F 4URTB 1KC5L 5D7IB 2H2PD 4GRWH 3AGVA 1WAAA 4BJLA 3LEYH 4YK4C 1T89A 2XZZA 2VDRH 3H9SA 2CUHA 1J1XL 4NDMB 1RVFL 1XGPB 3LZFL 3OX8A 3EOAA 1N3NA 3BT2H 4H26A 1JZ7A 1XGUA 4KVNH 4NBXB 1BX2A 1U3ZA 3QQ3B 3B2UC 3BW9B 1MHEB 2GCYB 2FGZA 1Q0XH 2ARWA 4WUUD 2PXYB 1U3YA 4CVZB 2RAMA 4IJ3C 1BIIA 5FUOH 4U1GC 1JNNH 3CFDA 1CDUA 5JXAH 3P4OA 1WJ3A 4Z77B 1NGYA 4TSBH 1WWBX 3CX5K 1UM5L 2DQHL 3ECBB 1NDMB 3OKYA 3ZE0F 5BRZE 5H35B 1BFOB 4HUKB 3QJFB 3QEGH 2VLJE 1NGQH 1WWAX 4NN7C 1W0VB 4X0KB 4OI8A 5FHBH 4KRMB 2XZAH 1U8LA 4BSVB 1X4ZA 2KUTA 3NA9H 1D5ZA 1GGTA 4RDQF 2WWMC 3EDEA 3CK0L 2FLBT 3QH3A 3IKKA 3TBTA 1M71B 2PCPA 2QQNL 3KYKH 3JWOC 3KNBB 1OWWA 3VGGA 2OLDA 3O81A 4GXVL 3FO2A 4JY4A 3H7BB 4Z7UB 4XMPL 4JZOA 3TBWA 4AEIL 4WENB 1PSKH 1RZ7L 4FQJL 3R06B 3TBVA 2CDEA 4EI6B 2WANA 3FB5B 1YY9C 1OP5H 5E8EB 4I5BA 2D7PA 2R0KH 1OQXA 5D7KD 3CX2A 5E8NA 2XQBH 5A2KH 5CUSL 2GAZA 2RHEA 3X12A 1DN0A 3MV01 1QRNA 2H1PL 4DZBA 3WFCH 4Z8FH 3O6LH 4LOUC 1H15B 5C3TA 4HWZB 1Z6JT 3HC4H 4MWFA 3WJJC 1TENA 4YR6B 4R90L 1ZANL 2IG2H 3ZKQD 3CC5A 5IB2A 3TIEA 3UTOA 5E94B 4UDUB 4Q9RL 4LPWA 3VJ6A 4EI5B 1AGFA 4OV5B 4WHDA 1QG3A 1TTFA 4BZ1H 4YBLC 3QEQD 4JQXA 3Q5TA 1E6OL 3X11B 2OM5A 1T1XB 5DEGB 1CGSL 3RWJA 2UY7A 4RFNB 1EJOH 3MLUH 3QIBB 1J87A 1PY4A 1ZVSA 3UZQA 1JP5A 1T2JA 3CSBA 2EC8A 4N1EA 4N5ED 4L3ED 4BFEA 3GSXB 3KYOB 4QYOA 3ZKMD 1JPGA 4Y5YB 3WHE1 1D7FA 4RMUA 2BFVH 4DQOL 1KEGH 1FFRA 5B39A 4MA7H 2X4SA 4R7DB 3STBA 4LRIC 4UTAL 1UM4H 4XRCA 3V0AC 4I0PC 1Z9LA 2HRLA 3G6JF 1S78D 2MPAH 1D9KD 1CTNA 4PJ9C 1DBBL 2R9HC 3STLB 3QHTC 4OZFA 1ZT4A 3WE6B 3DV6B 5FFLA 1KIUA 2AI0L 1YEIL 4RGOH 2ADFL 2Z31C 3KWWB 5LBSH 4H0IA 4H8WC 4KFZC 5A2LH 4AENA 4XBGB 1KUMA 4IRSD 5ICYA 5JHLH 4BFIA 2Y1VA 2ZUXA 5I1LA 2YPLD 2OTPA 1L0XA 4OGZA 5SX4I 2XA3A 5D9SB 1RZIB 3W11C 1U8MA 4H0HB 5INDB 2IWGA 1DR9A 3T2QA 4L9LA 2Z8SA 1EXUA 3O3AB 5DC0A 3O6FB 5MENB 1A21A 2PTTA 4QRQA 2KL6A 3O11B 3LRSB 3HZKB 4OAWA 4NWUH 2G60H 1DQLH 1FORL 5T3ZL 1XF3B 4L8SB 4CUCA 2HJLB 4APQC 4I3SH 4QTHB 4DTGL 2EECA 2EEAA 3NN8B 4U1NA 1FG2A 4M7ZC 4ODSL 3C08L 5ESVA 2BOBA 1RSFA 5GXBB 4ISVB 1CLCA 2A6DB 3PGCB 1U95B 4LK4A 1F5WA 5DZNA 2AJXL 4OZ4A 3F7VB 2VITB 4G8GA 2VIRB 4PR5B 2HKHH 1P1ZA 4HWBA 4O2CA 3QWRD 3BHBB 1EV2E 4L4TE 4Z0XB 1U42A 3LH2L 2ADJB 2VDNL 2XZQH 1JZ2A 1LO3H 3HMWL 5F89A 1KPUA 4IMLA 1A7NL 5ESQB 3PQYE 4NYLB 4K23H 5L9DH 2ZCHH 3WFEL 5I16A 4M62L 2NZIA 2CSPA 5FO7A 4L1HA 4AMKL 4XVSH 1LO2L 4Y4KD 5CP3A 4RIRA 2J8UF 4QRUA 1PG7H 4X9GA 5J12C 1CXIA 5HHMD 2EDOA 3QQ4A 1K6QL 4G9FB 1RUQH 4P0DA 3SY0B 4Y89A 5ISZB 1FO0B 2EKSA 4L5FH 3I2CL 3UJTL 4K3JH 5F7MC 3E2HB 2ENSA 4BUHA 3SE8L 9CGTA 5KVFH 1S7XB 4OB5H 2A9MH 3LN4A 3EJYD 1MQ8A 3VXRB 1VFBA 1N59A 1ZGLB 4WDIA 32C2B 4WRLA 3MRBB 3GKZA 3OJ2C 3V5DB 1AI1H 5K9KA 5FM5O 3S96B 4BFGA 4QY8A 2NY5L 3LV3B 3QIWC 4WW2F 3T0AA 1FNLA 3P9LA 4RWYL 3IDXH 1QBLL 1CE6B 3IDJB 3IGAB 5A2IH 4G42A 4LQ1A 2VLKA 4DGIL 4EDXA 1WT5C 1C5CL 4FMKA 4MJID 4S1SH 4TUKL 1TVDA 5FA4A 4GQPH 4PGDB 3JWDL 5EUKB 5I74B 1QHPA 5E7FA 3K81A 3HNVH 3L5XL 1JHKL 1ZHNA 5M7QA 1C08B 1VSCA 1X5IA 4WI4A 3QQ9C 1SBBA 2GYSA 3KLAB 3QCTH 4DAGL 1BZ9B 1IM3A 1JGDA 1MI5D 3GI9L 1H3GA 2WUBH 4L8DB 4GSDH 4R2GD 1T2QL 2FX9H 1OAZL 2QV2A 5D96B 4M1GL 4ZUVA 2PYFA 5HI5D 5D7LB 3IVKA 1RZKL 4FQXC 2FR4A 1QBML 2VDQH 1QYGL 3HFMH 3N9GH 4KXZI 3ARBC 1INDL 1UA6L 4UNTA 4F7PA 2ZSWB 1FJ1A 4OGXL 4OKDA 2F54D 4F58H 2Z0BA 1YECH 1EA9C 2GK0B 2E9IA 3FB6A 4LSPH 4BZYA 3OBAA 1MCNA 3C2AH 5SX5K 2X4NA 3GUTB 5GGRB 5CJ5A 3VFGL 2W65B 4XTRC 3GJFK 5IR1B 4JHBA 1ED3A 3FRPG 3QXTA 1EZVY 2AVGA 1YN7B 4CW1B 2ZJSH 5T3ZE 3BRFA 1G7JB 4LLUB 3VRIA 2VXQL 5GZOC 1A02N 3SCMD 2VXSH 1BP3B 1T04A 3VRJA 3LDBB 3VXSB 2G5BB 3MZTA 8FABA 2CDFA 2YUZA 2ORBH 5DJAA 3O3UN 3PL6B 1FYTE 3RZCD 2GJ6A 5KTEH 5J6GA 2AKRA 1NSNH 4LSSH 4KKAC 5HJ3A 2H2SC 3VA6A 2NLJA 5HGBB 5I6XB 2NY3B 3TCLA 5DMGD 4POZC 3PWUA 1HINH 1OD9A 1QKZL 4I8DA 3KPNA 4YH6A 1XR8B 3V4PL 5I8KL 1KCSH 3GJEB 5T1KA 3D2UB 3RGVB 3SDCB 1T21A 1IC4H 1MCKA 4K94L 5AEAA 4BKLB 2MFNA 1N8ZB 4JFZH 3M1BA 1D5XB 2GJZB 4GQ9L 4OBSA 1J9CT 1ZT1B 1D5IH 4PFEA 4XCCL 5F6IB 4H5SB 1MIML 3EOTL 3EOYG 3SDDB 2BHUA 2BXZA 3BKCL 3QEHB 2H2PC 2V5TA 3EYOA 5KSBA 4NO0A 5HYSA 3MZGB 4KJQD 3WXWL 1HK6A 3AREB 1L7IL 3IAPA 5L6YL 5I17B 4L1DA 5T1DL 5EU4A 3ES6A 3CFJA 2WP3O 4U1IA 3U7YL 3TN0A 1E4WL 4JN2B 4Z95H 2HN7B 4MJ5B 4AY0A 2Y25A 3L7FB 3OAZK 3CZFB 3D69A 5KVGH 4YE4H 4JZJB 4QNPE 3PABA 4LVEA 4D3CL 3MLWH 2X7LA 3IXTA 1JYXA 5KOVC 2COQA 3IDMB 4HUWB 4BQ6A 4LSTL 3GMQA 1A1MA 1Y18B 2A73A 2DQUL 4OZIA 3MYJA 5HD8D 3C6LB 3I75B 5I8EA 3NFPA 1JFQH 4W4OC 5DO2C 2VSCA 5H8DA 4GAYA 2OBGA 3UTTD 2VNCA 2VZVA 3QO1B 5TE7L 3TYFA 4QRPA 4KQ4H 3O0RL 2WBJB 4HJJL 4R4ND 2V6HA 1ZOXA 4NN5C 1BOGA 2WW8A 5E95B 4Q6YA 4NNYA 4TUJA 4TVSa 3F6IA 2P5EE 3O3BA 3Q48A 4CL7A 4HKZA 1G9NH 3LIZH 5JXED 1W0WB 1H5BA 5T5NG 4P49A 1AQKL 2WWKO 3O4LD 4Q9BA 3F5WB 8CGTA 2IH1B 1QSFD 4U1HB 4X5WA 3O4OB 4O2FB 1KCUL 5C7XH 4O4YH 4BFBD 4V1DD 2XRAL 1RJLA 1D5MB 4P57A 4EZMA 1KPRB 5ANMB 1YEGH 4I0CC 4JM2F 2LE9A 4WHTB 4OF5A 4F15C 4CDGC 3EYSL 4R0LA 4ZOCA 5GGSY 4RMVA 4UMGA 1TZGL 3MRJA 1INQB 4NQSB 1FNGA 2EDKA 3FT3A 3QULA 1UWGH 1S8DA 2BNRB 2IALB 1RUPL 2PW1B 3F7YB 5HDBE 5GJSL 1CVSC 3FTGB 4IIQB 3ZDZF 1SJEB 25C8L 3ABZA 3OKEA 5IB1A 1HEZA 1GIGL 3CLEL 4LCWA 1VHPA 3QDAA 3MRLA 3BIKB 4MNQA 4KMLB 1JF5A 3A6OA 5E2WL 3MNZA 1OAYL 3L3HB 4ERSL 2ZKHL 4LRNH 1FP5A 4MAUH 3B9VA 4UT6L 4HXBH 4N5EC 3UP1A 1NPUA 3ZKMC 4PLNC 5D72H 2BXYA 3GEWB 4TUOA 3SJVA 4D9LH 3S35L 4N8CH 5KVMC 2X9XA 4Q0XL 2DIJA 2VL5B 5D7SL 3DRTA 3MBEB 4PRNA 3L3KB 3RDTD 3QUZC 3P4MA 3BP4B 4LLVA 3DX6B 2FX7L 4M6ML 3QUYD 4J1UB 4Y19D 1RUAL 5KS9E 1IL1B 1VACB 4ODWB 3KDMA 1KJMA 1D9KC 1AKJD 3SKJH 5EO9B 4DVBB 1YYLL 1JIBA 4JHWL 1RPQA 4XC1H 3HPJA 4Z5RB 4PJCB 1L6XA 3TWCH 3TT1L 3VCLA 4JM2D 4PJEA 1S5HB 1JWUB 4D94A 4PRIB 4IRSC 4PLOB 3B9EA 4WFGE 1RU9H 5HHVL 1ZLUH 1QFHA 4WFHD 4XMLL 1MJUH 5B21A 1I3UA 3T77A 3PWNB 2YPLA 4D0BA 2XWBB 2A0LD 1KV3A 3P0VL 5FKPB 5L88H 3QHFL 4Y5XC 1J18A 3UTQA 3QJHA 1DQDL 1F4YL 3BIBX 1A7QL 4ZODA 1CDGA 1J5OL 4J6RL 2DQEH 4PJFE 5BJTA 1T83C 4KVCL 4FFZH 3MX0A 5C6PB 2FO4B 3WBDA 2WIIA 1HKLL 1QFPA 1AY1H 2J6EL 3FN3A 4KKCD 1JTPA 3MV9D 3P11L 5KVEH 3BEVB 3I50L 3BXNB 1I7RA 4NGHH 2HAZA 3LS4H 2FZ3B 2Z35A 3UDWC 1UB6B 1YYML 2ZG2A 4OCNC 1FC2D 4W6XB 5C0BB 2YUWA 5BVPL 2WNGA 4ONHA 4PLJD 3VI4E 5I1IL 3MACH 3OKNA 1BQLL 1FL6A 2V2XA 3BN9D 1KENL 4DKEL 3RIAK 4CJ1A 2O5XH 5HVFB 4YO0A 3IFPA 4Y2DB 3VXTA 3TJEH 4JPVL 2DLHA 1RURH 3HCVA 4O00A 5AAWA 3LPFA 3EZ8A 3G6JA 3RVTD 4R97C 5C08B 5C07E 1LVEA 3MRKB 3VGEA 5IHZA 2O61A 2PXYD 4LLDA 1G1CA 5D93C 4Y4KC 1RUKH 4P46D 2OR9L 5MERA 4PJXE 4TSAH 3C5SA 4L3CA 1DE4B 1FDLH 1MUJB 5IVZA 4WUKL 3OSKA 2VR4A 3B9AA 4X80L 2EDEA 3E6FB 3OXSB 4YDLB 4KZDL 3TCXA 1DLHB 1X7QA 2IPUG 3P40A 3UTSA 4JG0H 1KOAA 2YA0A 2Z8WC 2X4UB 1PQZA 1C5BH 5L2KE 4JPIB 4LHUG 4NKIH 2ATKB 1IAOB 3C60D 5DQ9B 2ICWJ 3MA7A 1YMMD 1HIMH 4GG6B 1FZJB 1XIWD 3N50A 3TH3T 1NGXA 3QO0B 3TYGL 3JWNC 3NTCH 2XTJE 1PAMA 3G5ZB 3RVUC 1H3UA 1G7IB 4K3DL 3X13B 5I0DA 2B5IC 3IXAA 1CGUA 3T2OA 3OXRA 4X9BA 1NC4D 2OQJA 3ZYOA 4OI9A 2HVJB 2ADIB 3TIDA 4U6YA 5EG6C 3LEXA 1MFBH 3D0LB 4PV9A 1MHCB 1G84A 2AJUL 2DKSA 3ZDYF 3MV7A 4MJIA 4FFVC 1RJCA 1DLFH 3HE7C 1UG9A 3D3VA 2V7NA 3REVB 3K1KC 3C8KB 3UBXG 1AD9A 5ENWB 1OF2A 3TO2A 3WIFB 4QRSA 1B2WL 4FQHA 5TDPB 3BVNA 1KB9J 2FH8A 1DTUA 1PX3A 4TTDC 2A9NL 2FSEB 3TT3L 1UWXK 3IDIA 4BA8A 3EJZC 3LS5L 3WJLC 4I2XE 4FHBD 1H8OA 4XCEB 1MI5A 3B9KA 4EI5D 2VAJA 4NQCA 3PNWA 1EHAA 1J1OH 2X5PA 2EO1A 1IGIL 2QSCL 4JRYE 3CXDH 2YC1B 3FOMA 5EO0B 3BEWB 1U58B 5DT1L 4XWOD 5J57B 3NZ8A 3SE9L 2FYYA 3MRHB 3WUWB 1SM3H 4DUVA 5HI4C 4FNLH 1HQRB 5JOFA 2CR3A 3ZYIA 4BZ2L 1I8MA 2PO6B 3S5LB 4K9EL 1X4YA 1CFQB 1RIVL 1T5WA 3WN5C 1F97A 1ORQA 5DJ8A 3VWKC 3MUZ1 4HCRA 2JELL 2KQMA 5D1ZB 5IEKB 3IDNB 5BRZB 3GMLB 3WDHA 2R1WB 1T7XA 4XPBL 2VLJB 4PGBA 4AG4L 4PJDE 4YHIB 4Y4HD 2ZUVA 4WW2A 5D7JB 2NX5A 4H1LB 3C6SA 3SCMA 3GK8L 5C9KA 1BM3H 2BRRL 4JE4B 3GSQA 4XP4H 3RWIA 3NMEA 3RL2B 4GKSB 4NQEE 4DKAA 3OPZL 4JB9H 5BZWB 5C71A 3I84A 1PYWB 5KZCD 3RZCC 1NBZB 2A6IB 4BK5A 4GMTH 1FLRL 1R3JA 1X5ZA 4HEME 4LPVA 1IM9D 2IQAA 5T33L 3LHPH 5GISH 5C0AA 4X6DE 4TNVK 4UZGA 1KB9K 5A1AA 2C1PB 1EGJH 4FQ1H 2WBKA 4ZTOL 1T22A 2HJKA 1QOKA 4RMWA 1QSZA 1A7BA 2D7MA 2CR6A 1FNSH 2RFXB 5EBMB 1JHTA 5KSAB 3REWB 3O8XC 4PJ8C 2Y5TB 2FHCA 2ZSVB 1YEDA 5ICZA 3S98A 2DQGH 1K2DB 1VESA 1DVFA 1WV7T 3GDBA 4PJIF 3RJDA 4LSUL 3VW3H 4NQTA 4JHZA 4M7LL 3AY4C 5E4IA 4AYFA 4OCSL 1KIPA 2F58H 5CZVH 1QHOA 4M9OA 1MWAH 4X6CA 2UUDH 5CAYB 5GS0C 5I30L 5HHPB 5FCUH 3RIAF 4TSCL 2R2CA 5ALBL 2D4FA 1FBIL 3FFCA 2Y07L 5CIPB 3OMZA 5TQ2H 1G7PA 3EYQD 4OLZL 2YD6A 2C3HA 4YPGA 4OCYH 4ZDHB 1PLGH 1F11A 4PTTA 4K7PX 5TDNA 3W2DL 1R3KB 3BYTA 4GKZA 1JZ4A 3L5HA 2G75A 1WFNA 3S36L 5IFAL 4F2MA 4NQVB 4LLYA 4Q6IB 3ARTA 3MYZA 3N85L 2VXVL 4PY8I 4HWBL 2XXMB 2BMKA 4MA3A 5I1KL 3EO1A 1RULL 4PJBB 1T6WA 4KK6D 3RY4A 1UZ6E 3MR9A 3UTTA 4YFLI 4G9FD 2FHFA 3MLRL 3GSOB 2DWDB 4P9HC 1BF2A 5DJCA 3TV3H 4RAVA 4WWKB 3OR7B 2EEDA 3X14B 3L3GA 1DUYA 3TJHD 5SWQA 2OSLB 1BGXL 4TRPL 3H3PH 4HPOL 4P5MB 4WTZG 5I76A 3MLVH 3VXRD 2OJEB 5IWLA 5JXEA 2F15A 1CXKA 2N7BA 4Q7DA 5GGSB 2EH8H 3G5YB 3W9EB 1GC1L 2DQDL 2VDLH 3ALWA 4S1DD 5C70A 4EDWH 2R39A 1MFDH 3U36A 1QSFA 1NUGA 4I77L 4J8RB 4M61B 2OI9C 5IESL 3QDMA 3ULVF 1QRNE 5GJTL 4JFPA 4PRPE 2EIZA 1KGCE 4I18C 5EOQL 2FJGA 3GMMA 1K8IA 4JY5L 1MLBA 2CLVA 1AR2A 2IPKA 2UZXB 1QR1B 5D2LA 3GI8H 2W9EH 2X4OB 2P8LA 4XWGH 2H3NA 2C3VA 3HUJF 4G8FB 3KJ4C 4X6EB 1XR9B 4FN0A 4QF1B 5J8OA 4KUCF 1S7VA 4PRAB 4KAQH 3EKCA 3ARGC 3MCKA 4ODXB 1WBYA 4LNVA 3V7MA 1KCVH 3BZ4B 2CJUL 3TPUA 1A3QA 2VLME 3BKYL 3P4NB 4RRPG 1T3FB 2FJHB 1VEPA 1U2HA 3ILPB 5DHVH 1HSBA 3PQYB 4LHUB 5BO1H 1R3LB 5DK3A 4MXQC 3CVHH 1MHPL 3SKUD 5LGJB 1O0VA 2F8XC 1HHIA 2GTWA 3HE6D 4KROD 5LCVL 3RU8L 2R0ZH 1U9KA 5H94A 3VFSA 3V5KA 3RDTA 3VFUA 3QUYC 2BSSA 4EXPX 3RNQA 2EDDA 2EICA 5IV2B 4Y19A 1OAUL 3I02B 4CN4A 1DEEB 2YN5A 4HXAH 5F1NB 2YPKB 3NFNB 3ULVD 4OKVA 4X99B 3U48A 1MREL 4PRDB 3LEYL 2AJVL 3BH9B 3NAAH 2Y06H 4KI1A 1SJHA 4JM2C 4FG6D 3RWDB 5F88A 3IJSA 4LVOC 1OTSC 3BT2L 3UBXB 3LKQB 3K4ZA 1LMKA 1PKQE 4XXCC 1S9VB 5D8JL 1I3RB 3OJMB 4KVNL 5C8JA 4FQCH 4HJGA 5HHOD 4KV5F 4HUVB 2ZUQC 1J11A 4GKOA 4NWTH 3ARFC 2O5ZL 3CU7A 3T0VA 1EVUA 1D6EB 2G9HA 4KUCD 4DN3L 3OKKB 1A2YA 1FZOB 5DJ2A 1ZKAA 5FUOL 1OAKH 2LQRA 4NN6C 4HT1H 4HUUA 7FABH 5JXAL 5KAQG 3R8QA 2QSVA 1TQCC 2BY1A 5I15L 2HTKD 1NGQL 4HUXA 1DSFH 3BDYH 2R2HB 2XZAL 3NA9L 4S2SB 1GCFA 1PY9A 2AS5M 4Z78A 2P43B 3MA9H 2X42A 2YEZB 3LCYA 3BN9C 5F7DA 3KYKL 4P99A 4TPRH 1N6QH 1GZPA 4D9RE 3TBYB 4D0CB 1XF2B 1S9WB 4Z7NE 3GJFA 1HHKB 2X1PA 1AGDB 2A1WL 5FGSA 2IPTL 1W0YT 3V4UH 3C5ZD 5GRXG 3WKNA 2R0KL 4ZS6C 4S11A 1A6PA 2PXYC 2XQBL 1XZ0A 3GSNA 4EN3B 2Z91A 2CPCA 1AP2A 1P7KB 3ULVH 3ULSB 4P46A 3WFCL 4Z8FL 3O6LL 4NUGL 5DMIL 2F9BT 3HC4L 3L5WA 3RRQA 1BIHA 1UWEL 1IEHA 5C2BH 5BZDB 4X4YB 2EIDA 3L3IB 3CFCL 3BDBA 2C9AA 2CIIA 5KSVA 3PWLB 3LB6D 1JBJA 1A3RL 2YA1A 3MUGB 3OG4B 4OZHB 2QBWA 4EQ3A 1W8NA 2Z8VC 2CUMA 1X5LA 4PV8B 4BZ1L 2LTQB 2FATL 3IJHA 1ZLSH 3C60A 5GGUA 4EXKA 4UIKH 5EU3A 3SDXF 1YMMA 2J8HA 3TH2T 2NNAB 1FYTB 2RCSL 1EJOL 2FRGP 4X8JA 5E8OB 3UJIH 2VLKE 4KK8D 1CD1A 4JO1H 5TF1H 3KXFB 1HHHA 2EDXA 1TJIH 4UT9L 2B1AH 3D9AH 1WQVT 1UQSB 3SKMB 1AIFB 1JF1B 1ZS8B 5C0NC 3RFZC 5L7XH 1NC4A 3O6KH 2BFVL 4O2EA 3ARPA 4LU5H 4HWEH 1I8IB 5L2JB 4I48B 3EBAA 2VDKH 2APXA 4G43A 3WIHH 3F62A 1UM4L 2ATPA 1S7TB 5HHQA 3MGOB 1T03L 3NCYP 3FAWA 3HG1E 3MC0A 4C83B 3MO1B 1MPAL 1Q8MA 1H3TA 5T3XL 3I6LD 4CU7A 2BNRD 4RGOL 3I3EA 1KXTB 1TPXB 3FO0H 4HDIA 1M05B 3GM0A 3MRQA 5F3BA 2HH0H 4PRBB 3NIDE 2B7DT 5JHLL 4XPGH 4EI5C 3WSQH 3AXLA 4WO4B 3DRQA 1MCDA 4LPYA 1JNLL 2JKXA 4UV7H 4RFNC 3OKMB 2ZNWA 3QIBC 2GI7A 1KSRA 1IQWH 4HAGA 1MWAA 5DRXB 2G2RA 4NKDA 1JL8A 4OLXH 3N06B 5K9QG 4YHLH 2C1OA 5DJZA 4GRMB 1CXLA 3DSFL 4Y5YC 4AT6A 4NWUL 2G60L 1NMAH 4M5ZH 1DQLL 3IU4H 3VWJA 4FQIH 4I3SL 3L6FA 5I1DB 3TFKD 1LEIB 4NKOA 2Z31A 4X7EC 1KFAH 2B2XL 2I07A 1GRWA 1BLNA 3SOBH 1H0DB 2A2QT 4PP2B 2IBZY 4PP1D 2AJYH 1J1PL 1B4JH 3DVNB 4PB0L 1D3CA 2Y23A 3KS0H 5F3HA 4XI5D 5DFVC 1I9RL 4KK9D 3OGCA 3EFFB 2GJ6E 1BZ7A 5H37H 4L8CB 2PN5A 4UIMA 2AJSL 3F58H 2HKHL 4F7CB 4OSUH 1JZ5A 2FGWH 3O3EB 1KTKE 2ICES 3LSOB 2P5EB 5TPWL 3BOVA 1AR1D 4HGKC 5FUZL 5TQ0H 2XZQL 2YSSA 3H7LA 4W81A 2DF3A 6FABH 4PRID 5GRJH 1NUNB 4K23L 5L9DL 2VQ1A 5JHDD 2R4RH 4LCUA 4HUMB 1IM9A 3B6SA 2EC9U 5IG7B 2NXZD 4HH9A 3B83A 2R2BA 4ZO7A 4YHOH 3GB7B 1UH4A 4XZUB 2P44B 5GRVK 4XVSL 3O6FC 1HH9A 3KHQA 5INCB 3CAFA 5LXGL 5BOPA 4R3SB 1RV6X 1JRHI 5ICXA 1PG7L 2ZCKH 4HIJA 1KJVB 1XAUA 3UPAA 3GMNA 4NQXA 1RUQL 2H32B 4L8SC 5IUSA 5KSBE 3HZMB 4HKBA 2PW2A 2W60B 3VMOA 4MNHB 5KVFL 2GT9B 4ESKA 1RZ8B 4U1MA 2A9ML 2BVYA 5C0BD 3RTQA 1S7RB 5IEHB 1A9BA 3V6BR 2HT3D 3RQ3A 3DBXB 4G6FD 1RZJC 2P7TB 1NL0H 5ALCL 3FQRA 3WHE0 5FOBB 5DJYA 2CUIA 3Q2CA 1R5IA 1OCWL 4UUJA 4J3SA 2XTLA 3EYQC 2NY4B 5FYJD 4OZIE 1BJ1J 5I1CL 1ZWIA 3IDXL 1QVOA 5EC1A 1XH3A 3MJ8B 4PJAA 1FRGH 5C08D 3IDUA 4MD5B 4S1SL 4ZFGH 1LD9A 5E2JA 5DHVA 1MJJB 5E00A 3U6RB 1CD9B 1FFPB 1GOHA 3UYPA 3OL2A 1H9VA 1T4KB 3G08B 2QHRL 3LKSA 1E27B 3U0PB 4C56A 4LARH 5KS9B 3HNVL 3CVHA 1IFHH 1M7IA 3MNVA 1XCTB 3F7QA 4OD2B 3B2VH 1QO3A 1FVCB 3L95B 4GXUN 3Q1SL 5JDSB 1SBSH 4ELKB 4O9HH 1RIHH 3QCTL 1V3MA 3E2HC 2WUBL 4ZUUB 2FX9L 1IGFH 2AK4D 4LAJH 4MVBD 4EVNA 1KIRB 2P1YA 4CMHB 4I3RH 4M7KH 4DZ8B 3HFML 2NY7H 3N9GL 1UJ3A 3V0VB 3VI3E 1ONQA 4S1DC 2WP3T 4NHCL 4F58L 5EZOH 1KPVA 2V9RA 4PJIA 1UADC 4OQ1A 4UQ3A 4LSPL 2EYSA 3CFEA 4EBQH 3OGOE 2DJ4A 3DX9B 4RBPH 4XNXH 4PJFB 5EC2B 2D0HA 1Z2KA 1F3DJ 4J4PD 2NW3B 1ACYL 2VZ3A 1AGEB 5IHLB 2R29H 3UBXI 4PJ7B 2Q1EA 4N8VB 4MSWB 2DYPB 5I74C 2VXSL 4NM8L 4R26H 1MCPH 4LCWE 4MX7B 5HVGB 5SWSA 2OJZH 3BQUD 5E2TH 3LKOB 1NUFA 5FYJH 3SQBA 1RK1B 2FBOJ 5KTEL 2VZTA 3ZE0E 3VE0B 3DV4B 4HIIB 4L3EE 5D96C 4LSSL 4RMRA 2VC2L 2BJMH 4WHCA 4DVRH 4WIQA 4P2OB 5CP7B 2DD8H 4GW4B 4JM4H 4PD4J 2WWKT 3V2AR 4WWID 1NCBH 2X1WL 5C07B 3FB7B 1G7HA 3VH8A 1JGEB 3IF1B 1RHHB 3ZTJH 1TQBB 4JPWL 1KCSL 4CMMA 2IH3A 1JJUA 3VDAA 2Q7YA 4P23A 3HE6A 4GW1B 4PJXB 1DEDA 5D1QB 3MGTB 3QR2A 2AEPH 2Y7QB 4XBPB 4DN4H 1RIUH 3C2SA 2EE6A 5C0EA 3RI5K 1D5IL 5JIIA 5T1LB 4CDHA 5D1ZD 5BRZD 4RFEA 5CKAA 3ULVC 4OI7A 5MP6H 4UNUA 4MB3A 4U4BA 1F3RB 3BD4A 5FO9A 4BM7A 3LDBC 4NKMB 2YPLE 1KELL 3ILQC 3BAEH 4GRLA 3GBNH 3DIFB 4Z95L 3M07A 1UZ8B 2XTJB 4ZSOA 3PL6C 4MLSA 5JIPA 1CDCA 5HHOA 1QLEH 3HUJA 2N7AA 4F7MB 4PJBF 4HCRL 2X4TB 4QHKI 3UPRB 5I6XC 1EAJA 1WLHA 2FIKB 2NY3C 1A5FL 2OYPA 4QGTA 4JPKH 1BQHA 2QADB 1IKFH 1Y6KR 2Z93A 5H2BB 1MCIA 2X9YA 4DK6A 5C9JA 4LNRB 1JFQL 3QDGA 3H9YA 2XPGA 4GUPB 1CQKA 3RGVC 3SDCC 3EYFA 3SGEI 4RZCB 1V3LA 5HYQB 4UBDC 4PD4K 2DTML 5FYLL 4HS3B 1I1AB 5JO5B 3KPPB 2EC9T 2UY6A 2DDQH 3TESA 3WIHA 1J10A 5F6IC 5DA4A 5FGRA 5HBBA 3SDDC 4K8RC 3QG6A 3QDJD 4I2XB 1CT8B 1G9NL 5D71H 3ZE2F 3AREC 2B1HH 3G6JE 1CGTA 4HC1H 4MDJB 2K9UA 4KU1A 1U0QA 4DGVL 1M1SA 3C09B 4JRYB 2CGRH 1VEOA 3VFRB 1FZMB 1I7TA 3O41B 4HLZG 3QBTB 3CMGA 4O4YL 5E2VH 5C7XL 1MIEL 2DLFL 4XP5H 3WYRA 2R56L 3HAEH 1E4KA 1AGBA 2AJ3B 1RUMH 1CXEA 1Q38A 2B4CL 4JZJC 3PV6B 4OUUA 1CDYA 1JZ8A 1YEGL 2VXTH 4JANA 4LDOB 5DRWA 5HHME 5FV1L 1HDMB 2JB5H 4YQXH 1DQTA 1JWSB 3C6LC 4U1JA 1GOGA 5D6CA 1UWGL 1MHHA 1VFUA 4Q2ZA 4H1LH 2V17H 3NGBB 1CL7H 5F9OH 5F7LB 4EQ2A 1YNLH 1I9EA 1RJZB 1GZQA 1DJSA 4PJDB 4X7TA 2WBJC 5JMOC 1W72A 4OZGF 4KMTL 3QZWB 4WWKD 5FM8A 4NQEB 4FZEH 2XNAA 4U3HA 1IRAY 4E5XB 2D7QA 4HXBL 4QRRD 2FECI 5ID1A 1IAIL 4X6DB 1FE8L 5D72L 3O4OC 4D9LL 2EDLA 4MJIE 1NDGA 3W82A 1K4DA 1T1ZB 3LEVH 4OIAA 1CFTA 2I9TB 3D3VE 3AM8A 2AW2A 5IBLC 5EBLB 2NXYD 3TP4A 1GGIL 2VERN 4AEHL 1QSEB 4GMSL 5E99H 1F00I 2VDPH 3CDGB 3H9SB 4GT7A 3T09A 4JO2H 1MI5E 1G6RH 1KJ2A 3OX8B 1NEZA 2O26U 3EOAB 1N3NB 5JW5A 3OG6B 2J8UE 3U46A 4H26B 4JREB 3S88H 1YPZF 4IIQC 3W9DA 1B6UA 3OTTA 4IM8A 1YEFH 1XGUB 3ULUL 1P7HL 1LP9A 1YEEH 1BX2B 1RU9L 4KHXH 2J1KA 3IDGA 2F54E 3U9UA 3RA7H 4B50A 4EUPG 4FQLH 4WEMB 3GIZH 4HIHA 2F19H 4PB9H 3NPZB 3CFDB 3BMWA 3P4OB 2DQEL 3AU1A 1CK0H 4Z7VF 2XACC 4NFCA 4M1CD 1L4IA 1GGUA 2F53D 5TE6H 4LCCA 5JW4N 1QFWH 5DJ6A 1AY1L 3SDXA 3MBEC 1G7QA 1VKXA 4RGND 1U8LB 1YUHA 3BDXA 1CZ8L 1MQKH 1D5ZB 1X3DA 4PP1C 5F72S 3D18A 3LS4L 3QH3B 1NGZA 1NBVH 3TBTB 4KI5F 2PCPB 1KC5H 4XI5C 4KK9C 2V5SA 3FO2B 4JY4B 1U8KA 2AXGB 1HH6B 4Q97A 4JZOB 3TBWB 3VFOA 5A40E 1CFNA 4ZPTA 2GKIA 2O5XL 1J1XH 1AR1C 1RVFH 4XHJC 2ZPKH 4P2YA 1Q1JL 3GIVA 3TBVB 1RURL 2CDEB 1FZKA 3UAJC 4I5BB 2XWJA 4RMQA 5D2NA 5JHDA 5E8NB 1GH7A 4WTWA 3EW3B 2DMKA 2GAZB 3X12B 1DN0B 2DKMA 4IOSD 1QRNB 2NZ9D 4DZBB 3DMMB 4KDWA 1P9MC 1A3LH 1RUKL 4OZHF 4MWFB 5DMJB 5GHWL 3VD3A 4TSAL 3CH1B 3TNNA 4KTEL 1FDLL 3CC5B 5IB2B 5J9PA 3TIEB 2BRQA 3EFDL 4JG0L 3VJ6B 2EE9A 3ROOA 2HRPL 3OHXA 4M9PA 5JA9A 5E56A 2HFTA 2MCPL 3T0ED 1U3HD 3MSPA 1NFDA 2CQVA 3RWJB 1HIML 1ZVSB 4XC3L 4Z76A 5KG9A 4QHUA 5J3HC 2HT3C 1C12A 5IVXF 3RAJL 4QYOB 1JPGB 2VN4A 4W6YB 5JZ7C 4Y2DC 2NY1B 3RPIA 5HHXH 2HTLC 1MCFA 5B39B 2DIBA 4KI5D 1F6AA 2X4SB 2QQLH 1OT2A 4XRCB 2RGSA 2ZUUA 1MFBL 4HEPG 5I8OL 3SGKC 3UTTE 4PBVC 4OZFB 1EEQA 2H1PH 4HLJA 1DLFL 1ZT4B 2E6JA 5JQ6H 5DHXB 4OCXH 4X5LA 3AROA 4OLVH 3RWEA 3K4DA 2QSQA 4E41A 1H3XA 4AENB 2FJFA 4Z18A 4YDLC 1WIOA 4BFIB 3O9WA 4GAFB 5E70A 5IBUG 1X4XA 5I1LB 3D85A 1X9QA 5JORA 4YGVA 5CGMA 4QTIH 3MRMA 1U8MB 4MVBC 1J1OL 1QSFE 3GSNL 3BZEA 2AK4A 4K7PH 3CXDL 4LBEA 1EXUB 3VFWA 1CGSH 3CSPA 3MUY1 1MLCA 2PTTB 4QRQB 4L4JA 4V1DE 3RWCA 5BVJA 5F7KC 4OAWB 4H88L 2BVQA 1SM3L 2LVEA 3KXFD 3MV8D 2YD9A 3UMTA 3PGDA 3PDOA 2XFXA 4U1NB 4J4PC 1LILA 1YJDH 5ESVB 5DK0A 2BOBB 4N9GA 1ZHKA 1YDPA 4GJTB 3EIFA 4OZ4B 1DBBH 1FSKB 3FCTA 3TA3A 4O2CB 5AUMA 4N0UA 4RA3A 2AI0H 4XP4L 1NFIB 5F89B 1OTTD 1KPUB 4IMLB 4JO4H 5GQBA 3PGFL 4XGZA 2VABA 4JB9L 2DM7A 4JDZA 2X6MA 4LLQA 1JHLH 3BQUA 3ALXA 4RGMB 2Y36H 2UWEF 3GBMH 1U8HA 5I16B 4YNYA 1O5DT 1OWRM 5FO7B 4PJ5A 1DFBL 1RZGA 4B5EA 3LHPL 2R8SH 4WO4D 3QEUA 4FQ1L 1Y0LA 5K9QI 2DIAA 4RIRB 5HDBF 1MY7A 4QRUB 3B9DA 2SEBA 3I85A 4HULB 1FNSL 2CDGA 1RZFH 3QQ4B 5EIIA 1A6VH 4Y19E 4OBRA 4OCRL 2EKSB 2Q8AH 2PO6C 4DTGH 2DQGL 4PJHF 4XNUL 4ELMA 3EO0A 4ODSH 3VW3L 2UZYB 3LN4B 5D1ZC 2F58L 4PY8J 4QT5A 1VFBB 1N59B 3SGEH 1MWAL 4WDIB 5JR1H 1EEYA 3QPQD 4ZXBA 5GS1A 5D7JC 2RB8A 4WHYH 4RDQG 4WFHE 5K9KB 5CZKA 4MCYA 5IVNA 3MRIA 4QY8B 2VDNH 1MEXL 5AD0A 2EDRA 2P5ED 3KJ6L 3P9LB 3I6GA 2HLFC 3ZKND 1A7NH 3MRFA 35C8H 4G42B 2VLKB 4QRTA 3ZDZE 3WFEH 5JOPD 3FONA 4OCYL 4K3HA 3STZA 3Q5YA 4M00A 3ZKXB 5FA4B 2BVUA 4L8BA 3AS1A 1NBYA 1LO2H 2EEBA 4LCYA 4OD1H 3SGDI 3C87A 3MV9E 1ZHNB 3DYPA 3MLYL 3S4SA 3T04D 5KSAC 5B4MC 1T7YA 1K6QH 5BQ7A 4NJ9H 4NRZA 1JGDB 1IM3B 1U91A 3I2CH 1CWVA 3LQZA 4ZUVB 3TV3L 2FH6A 3SE8H 2YMXL 3IVKB 2J4WH 1AO7D 1J8HA 3S34L 3H3PL 3QDJA 3JV5A 2BZDA 2VR9A 4ODVH 1G6RA 1MFDL 3FB6B 3QIUD 1U6AH 4PJ7F 2X4NB 1P53A 2CRMA 4POUB 4M4PA 1EVTC 4YIQA 5BW7A 4PY7A 5HGAA 2NQCA 2GW5A 3NCCB 4GLRI 1ED3B 2X89D 4F9PC 4L29A 1Q9WA 3ALPA 4OLWL 3VFTB 1BVKA 3GI8L 1LNUB 1WK0A 2GSGA 3JWDH 3RWGA 1B0WA 1PEWA 4Q6IC 3VRJB 4JG1L 2KDGA 2ICCA 3B43A 3L5XH 1JHKH 1CQYA 8FABB 2O93L 2CDFB 3OQ3B 4KAQL 4ONOA 3U0WL 1YMME 5DJAB 1FL3B 3PV7A 3S97C 1TZIA 2GJ6B 4DAGH 5J6GB 1JYNA 2AKRB 4U3CA 3BFOA 4WWKC 3KVQA 4X6FA 3GKWL 1OAZH 2D7TH 5AG8A 2NLJB 3PIQA 4FFWC 1BJMA 1RZKH 3TCLB 4AH2A 1QBMH 3PWUB 1INDH 3KPNB 4L4VA 3HA0A 3KG5A 5ACLA 3CVHL 1S7UA 5T1KB 2JJTA 5B38A 5GSVA 1JYWA 4K7FA 3M1BB 4TNWK 5TGBA 2K3TA 4ZPVA 1UEYA 4U3XA 3U2SA 2EH7L 1YC8A 4OFKA 3KPQA 3HR6A 3VFGH 5KVDH 4KTDL 1CDHA 3SKOB 3OKDA 2G5RA 2AGJH 3LKPA 2ERJB 3EYOB 4WJ5A 5KSBB 1MFNA 4NO0B 3TZVA 1S9YA 4HXAL 4ZUSA 2IAMD 2VXQH 4JVWA 4W70A 4U31A 3VRLF 2MQCA 4M93B 3ES6B 1CD0A 4RMSA 5EU4B 3CFJB 2DYPD 2K7QA 3NAAL 1JK8A 3TN0B 2Y06L 1R5VA 4GS7B 3RIFF 1UB5B 5EU5A 2Q87A 3FQWA 2KPNA 1OVZA 3D69B 2CKBH 3WS3A 1FIEA 2NW2A 3JVGC 3PABB 1JWMA 3N1FC 4FQCL 2X7LB 3IXTB 4X4XA 5EB9A 5MEOA 3T0DA 4WGWB 1CICD 2WV3A 5HYJD 1U8PA 4PTUA 5M94B 4NWTL 3GMQB 4HS6A 1A1MB 1OLLA 4KGJA 2A73B 4IS6A 5IBUB 3Q6FA 4P2OD 3H42H 4I4WB 3MYJB 4OZIB 1B0GA 5I8EB 3NFPB 1QPXA 4GAYB 5C07D 2C5DC 4OZGA 2OX5A 3V4PH 4M1CC 7FABL 4PGCB 3TYFB 4QRPB 3MTRA 4K94H 2OL3H 2EDNA 2F53A 1Q9LA 3MODH 3V5HA 1BOGB 5D1QD 5A3IC 4U6HA 4NNYB 1P7QD 1DSFL 1Q94A 3IRZA 2XZCH 4TUJB 3BDYL 1IKNC 3LN5A 5KW9L 4XCCH 3PP3H 4GG8A 3P73A 3O3BB 2C3GA 4HKZB 3LPGA 3BKCH 1U3JA 2MMXA 5AYQA 3ZT7A 1ODAA 1H5BB 2BVOA 3MA9L 3KLDA 3ZDYE 1AFVL 3DROB 5CINH 1L7IH 5L6YH 5JIHA 4TPRL 4X5WB 5T1DH 1N6QL 2AABL 3WLWD 4MA8H 1GHFH 2VE6B 1KBGL 5IF0A 1RJLB 5IT2L 5CD5D 1BMGA 3V4UL 3WO4B 4D3CH 2YPVH 2AQ2A 5IP4A 2L4OA 1N5AA 3SKNA 4OLYH 4PJDF 3MRJB 5FECA 1FNGB 3FT3B 5C2UB 4DOHB 3PWPD 1S8DB 4NSKA 4WW1B 4P4KD 3JV0A 3MCG1 4JY6A 1KTDA 2FDBP 3DOSA 3UJJH 5HGHA 1C5DA 4HJJH 4MZ2A 3OKEB 4JDTH 1HEZB 2A6JA 5IB1B 4LCWB 3HRPA 4BELD 4NRYA 3MRLB 1JTTA 4WI2A 4MNQB 1I1AD 1ZLSL 5DD3H 1A1NA 3MNZB 1U3HA 4LSDA 4Z7VA 3NPSB 5J1AB 2B39A 5F96H 4M6OL 4UU9A 4YXHH 4TUOB 3SJVB 3K0WA 1EFXA 2PF6A 1T66D 4JO1L 5E8DH 3V7AG 3EGSA 1P2CA 2P5WD 3CSYA 1WAAF 4PRNB 5J6HA 5JW3L 3P4MB 4LLVB 5L7XL 3O6KL 3ZYZA 4LU5L 2HA1A 4MQSB 3KPOB 2VDKL 1KJ3L 5BXFA 3WIHL 4P4RA 4ODHL 4WY7L 1KJMB 4PRHD 1NC2D 3ECBA 4GO6B 2AERT 3EYSH 4G9FE 4JFOA 3HPJB 3HKFA 5CHNA 2PNDA 1RUPH 2CKNA 4B0MM 3VCLB 1J0JA 4PJEB 5GJSH 1F58H 1N7ML 3N1QC 2HFGL 1I8LC 4NC2B 2HH0L 2X1XR 25C8H 43C9A 3QFJA 4OCWH 3T77B 3VXRE 2YPLB 4GBXD 5JUEH 4D0BB 2P24A 1GIGH 2NPLX 3ARWA 4ZUWB 2LTQC 5DK2B 1ACZA 4PJIE 3UTQB 1OAYH 3QJHB 4EI6A 3FB5A 4ERSH 2ZKHH 4MMXC 4A6YA 4UV7L 3UTZA 4W6WB 2JK5A 4C4KO 5BJTB 1UCBL 2DAVA 4NCDA 4YHLL 1BVLA 4KJYA 3OV6A 2WIIB 3K2MC 4M5ZL 3MV8A 3IU4L 4U1LA 4Q0XH 1H15A 4FQIL 1A7OH 1W72L 5D7SH 4CGTA 1QFUL 4LHJB 1DN2A 1I7RB 3ZTNH 2FX7H 2FLRT 2FL5A 4M6MH 4DCQA 2Z35B 5IVXA 1RUAH 1ZMYA 3INUL 4WI9A 1QA9A 2IC2A 2AJYL 5EZIL 1QSED 1RHFA 1B4JL 1KXVC 5EH1A 3OKNB 1FL6B 1QR4A 4JHWH 3H9SD 2HFFA 3E6HA 4YO0B 3IFPB 4F3FA 3F58L 1A4JA 3HCVB 1OTTC 2FGWL 1HYSD 3K1DA 3G6JB 3JBG7 5HHVH 4J7RA 1OW0C 3KYOA 5GRJL 4XMLH 4XNMA 2R4RL 5IHZB 2O61B 4WTXA 4OJFL 2E7LC 4LLDB 4WO4C 3QXDA 5HYEA 5F7UA 1DQDH 5IQ7L 4Y4KB 1A7QH 5EIQA 1J5OH 4J6RH 1T0MA 4L3CB 3D5OF 5IVZB 1KJ2L 1DDHA 1NQBA 1LK2A 3CMOH 5HHMB 4ONFH 1H3PL 2ZCKL 1X7QB 3UTSB 2NY5C 4XVUD 1HWGB 3BRGC 4U6XA 1PQZB 3DV6A 3HZVA 2Q7NA 4D0DA 3ULVE 3M17A 2NR6D 4RWHA 4OGAC 3VD7A 3KR3L 3I50H 1A64A 1DUZA 3NOIA 3PDGA 2EDHA 1BPVA 3MA7B 1CIDA 3MLSL 1YYMH 5BVPH 1NGXB 1OOAA 4YXKL 4MNGA 1H8SA 3WXVL 12E8L 3QPQC 3QAZB 1OAXH 1GJIA 5K9JH 1S7WA 5L8JB 1KENH 3S37X 5HHOE 4F9LC 3FHAA 3HUJE 3IXAB 3V6OA 3RUGF 3BGFB 1NL0L 3OXRB 4HMEA 1SEBB 2OQJB 3ISWA 3ZKNC 2MHAA 5FYKL 1K4CA 3IJYA 3TIDB 5LVEA 2F74A 4U6YB 1IGYA 3LEXB 4YDVA 4PV9B 1QQDA 1BFTA 1CTOA 4L8SA 4IHOA 2APWA 4MJIB 1FRGL 1RZKC 2E27L 4QTHA 1QRND 2VLRD 3D3VB 1ZGLM 3SBWA 2OR9H 1AD9B 1Q0YL 1OF2B 3DURB 3TO2B 3OKOA 4QRSB 5EUOF 1QPPA 1RK0A 2UWEA 4LARL 3BVNB 3DO3A 4X80H 1IFHL 2A6DA 1U92B 3I9GL 1XGTA 1V7NH 3IDIB 2XWTB 1P6AB 2FEEI 3DJ9A 1FV1B 1SBSL 1MI5B 1RIHL 5HGDA 5F1OB 4NQCB 3PNWB 1H3WM 4EIGB 4R2GB 3T4YB 1KCRH 2E3VA 3OKLA 5ESQA 1SHMA 5IM7A 3GMPA 4JKMA 4M7KL 2FBJL 2NY7L 1J7VR 3NZ8B 2F54B 2FYYB 4ZQKA 2DI9A 4NKQB 1W8OA 4PJHA 5EZOL 4K3DH 4OQTH 2VWEC 5GGTA 5JOFB 3QIUA 1I8MB 4MXVF 5IB4A 2IPUK 1XGRB 1G7LA 2NY4C 5TJWK 4EBQL 1HILA 2CKBA 1T5WB 4KDTC 1FCCA 3BP6A 5K93A 1ORQB 5DJ8B 4ZYKA 1U8NA 4LQFH 4MQ7A 4KV5E 3V0WL 4HPYL 4PGBB 2EIEA 1RJYA 4WW2B 5EZJA 1GVIA 2YR3A 2NX5B 1CR9L 1FAKT 3C6SB 3SCMB 4N8PA 2WK2A 5T5NF 4JN1H 1I7ZA 1FFOA 2AEWA 3RWIB 1CLZL 2X4PA 1MCPL 3TVMD 1AQDA 2RQ8A 3Q3GA 4YZFF 2CLZA 4K94C 4RAHA 2A9NH 2OL3A 1R3JB 3FJTA 5DJDB 2V2WA 4X9HA 5E2TL 5FYJL 4JHAL 3V5DA 4ENEC 4MXWH 4FRWA 4NZJA 2CRIA 5C0AB 1JZ3A 4F7TA 2BJML 3H9HA 3VXPA 2QSCH 4DVRL 4CMHC 1T22B 2HJKB 1JVKA 2IAND 4N1CA 4WI8A 1SVCP 1E6JL 4JM4L 2VISA 5DT1H 2BY3A 3DUUA 1JHTB 1YNTA 3HS0A 1BOYA 3L5IA 1TJHH 4PGDA 1PEZA 5ICZB 1Z0MA 1A1OA 3FT4B 4QHKJ 5I75B 2CIKB 5DA0B 1C08A 4DN4L 4XCFL 1KIPB 5M95B 2HJFA 2BNRE 2VYRE 3KLAA 4JFDD 3RY6C 3KYAA 1CD8A 4J12A 2IAMA 4G8GD 4XT1C 4AG4H 5MP6L 4YWGL 2D3VA 4Z7OF 1K3ZA 1JPFA 3IT8D 3AVEA 2JJSA 1BEYL 4F37K 4ONGL 3MPCA 1BQUA 1ZVHA 3IFNL 2ZG3A 1G7PB 5FK9A 4YPGB 4KJPC 1FLRH 3DYOA 3MRGA 4F80A 2QEJA 4D9RD 4NIKB 1F11B 5TDNB 1MRCH 3EDKA 3FB8A 4GKZB 3T2NL 1CICA 5T33H 5HYJA 2M26A 3SE4C 1IVLA 2G75B 2P49B 1LE9A 3K8LA 4P2OC 4CNIA 3AC0A 4F2MB 5GGRA 4LLYB 1NKRA 4MZ3A 4ZTOH 3SDXE 1IKFL 2BMKB 4MA3B 4ORGA 3EO1B 5SWZA 4WGVB 1QEWA 3MR9B 1YN7A 3UTTB 3I6KA 4XPAH 4CW1A 1TQBC 5EOTA 5FB8A 4HGMA 1EFQA 1FVDA 2CD0A 5D1QC 5DJCB 4LLAA 2ZZUT 2G5BA 1FGNL 4NQDA 4LSUH 3V79C 2DW