1IL1B

Crystal structure of g3-519, an anti-hiv monoclonal antibody
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSVGEKVTMSCKSSQSLLYSRNQMNYLSWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVKAEDLAVYYCQQYYHYRTFGGGTRLEIRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords monoclonal antibody G3-519 (heavy chain)
publication title Structure of an anti-HIV monoclonal Fab antibody fragment specific to a gp120 C-4 region peptide.
pubmed doi rcsb
total genus 51
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2001-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1il1B01
3CJJA 4PJAA 4WHTA 3S7GA 1FIGL 1HCVA 2O26U 2C7UB 5IMKA 4KY1L 5HYQA 4PR5B 1CK0H 3MRIA 4KRMB 3VFVB 4XMLH 3SGKA 1ITBB 2VC2H 3DRTA 1ZGLA 2R39A 4YHKL 5CZKA 5A16B 4WGVB 3TN0A 5E6IB 4LVOC 3MUGA 4BZ1H 3QDMB 2DLHA 1L7IH 2EDOA 3BIKB 4R7NB 1XF3A 1UT9A 3S88L 3WIFB 2C3VA 4JR9H 1JZ5A 2XY1A 1N3NB 4PV8A 1NFKA 3BKML 3MR9B 5BRZD 4GMSH 3A6OA 4PFEA 4PJCE 2CJUL 3UZEA 2R2BB 5F93C 2XZAH 3PGFL 2EC9U 1SY6A 3DETD 3ZYIA 4OLWL 4LCUA 3A6BL 5DD6A 3VXOB 4HGMA 3IKCB 1S7SB 2A77L 3PWPE 4OZGF 1UCBL 3O2VL 3ARRA 1ZHLA 1BWMA 2E6PA 4ODXB 1G7LB 5IK3B 3GHBL 4PLNC 4TQEL 2WBJA 3C5SB 3EZJB 1QOKA 3MRRB 3BPLB 1XGQB 1WCBA 3B9KC 3GMQA 1F3JA 2ZKHH 4HIJB 2NPLX 1QFUL 1MY7A 2VZTA 1W0VB 5E8PA 3BWAB 4BZ2L 1T66D 4ZUUB 4U1NB 2DICA 1FJ1A 3FQNB 3BGMA 5D7JC 5FV2A 1SYVA 3GJFH 1VB9A 2NTFA 3HFML 3BUYA 1S9VA 1S7TA 2HMID 1F2XK 2ENYA 2UWEA 3T1FB 1D5IH 3RNQA 3KPSA 1GCFA 1G1CA 1NFDB 2QSQA 5FF6A 2IBGA 3F5WB 2PO6B 3BRGC 5C6WH 3BDYL 4ODUA 3VGAB 5ID1A 2AERT 1IT9L 1ORSA 5EIIA 2OI9C 1D5BA 3G6JF 2DBLL 1U3YA 3ZDXE 4I0PD 1EUTA 4L4TE 5DJDB 3B6SB 1HEZB 2QHRL 4F7MB 2EYRA 3U82B 1CICC 3MREB 1P53A 4IOIA 3WFBH 3GRWA 5ISZA 3EDFA 4MA1B 3QIBB 4P2RD 3ARFB 4XPAL 1RJLB 2AEPL 3ELAT 3VGEA 1ZT7B 2VLRD 3NN8B 4MJ6A 1DP0A 1ZHBA 3C08H 1AXSB 1MH5A 5FK9B 5I71C 4XX1G 1FG9C 4JKMA 5F96H 4RMSA 4MNGA 3HR5B 4LHUA 1HYSC 3HAEH 2IGFL 5F3BB 5DJCB 1OHQA 1U0QA 1P2CA 4L1DA 4CW1B 5BZWB 1OGAA 1PKQE 3L7FA 4IRSB 3QUKB 3WL9B 4XP4L 4KWUA 4MAYD 1K2DB 4IJ3C 3EJYC 5LQBL 4UT9L 1EFXA 1K8DA 2H1PH 1FAKT 4KK9C 1N8ZA 3TF7C 2NY0C 5DK2B 3A0OA 1JZ8A 4ZUVB 2AK4B 2DQGH 1U42A 2NY6C 3LKPA 3T65B 2AS5M 2PCPB 3S4SB 5C07E 4ZPVB 2F8OA 3QDGD 3FZUD 3P9MA 5T33L 4RNRA 1AO7B 1V3KA 2QLVB 3CVHL 5TDOB 2Q8AL 4ZXBD 1U8JB 4IHOB 1UADC 4J8RA 4HXBH 3TVMD 3QFJD 2GSGB 4M7JH 4MZ2A 4CVWA 1RJZB 1TVBB 2XRAL 2APBA 2D9CA 3ILQD 5LAXB 2ESVB 3UDWA 4BUHA 3JVGA 5D96B 4QRRA 5MI0B 1EAPA 3VDAA 2RFXB 3O6FC 2BC4A 2X44D 1NCNA 1B0RB 3B5TA 3IU4H 4RGMB 2QV2A 3MJ8B 5JHDB 5CD3A 4YZFE 4CVXA 2XZQH 3VFWA 4JM2B 5JPNB 2X89D 1KJ3H 4X6FA 4PGBA 4NQEB 4YR6A 1ZT1A 4NJAL 5DFTA 5I66B 3S34H 5F9OL 3VCLB 2IAMB 3RGVD 5BO1L 1IAKB 4LASH 5E8OB 3DXAB 1BP3B 2VZSA 5B8CA 3RNKB 4RMTA 4ZUSB 3VGHA 4RDQF 1HWGB 1MFCL 1I1AA 1MFBH 4YHNA 4PRHA 4XVSL 2CXKA 5HVHC 5D7KD 1AE6L 4OT1H 4LCIH 3LKRB 1QKZH 5ESAA 2IPUK 2VXUH 1HHKB 5KSBF 1MCHA 1H3PH 2BSED 1R5IB 5KOVC 4PGDB 1VFBA 2OCFD 2HTLC 4MAUL 4JFFD 3PP4L 2F15A 3QG6A 2AJSH 3U6RB 3ARDB 2VO5A 3O4OC 2BVYA 5B38A 1LO0H 1HINH 3SE4C 4HX1A 4X0KB 3CU7A 4KTEL 3HMXL 3VRLE 2JB5L 1T1YB 1F90H 3BMWA 1DBJH 4O58L 4YPGB 2LU4A 4N0UB 4UV4L 4PGZA 1BZ9A 1I8IB 4JO1L 1KACB 3LQAL 1Q9KA 4OZFA 3VXUB 4X5WA 4JRYE 5IW6B 3UC0L 1CD0A 1CL7H 4G5ZH 4LDLB 1HH9B 4X6DF 3LH2L 3IVKB 2D0FA 5C7XH 3R8QA 3NFSL 3SOBH 3DI2B 4RQQB 4L5FL 5E6ZA 5HYSB 4WTZG 2DTML 4KJQD 5TF1L 2RCSH 1IJ9A 5EO1B 3FQWA 3T0EA 4LU5H 4R97C 4WUKL 1MWAB 5DRNB 2J8UF 4JFYB 4OIBA 1QBBA 8CGTA 5HHME 1XCQA 1I9JH 1A14H 1LDPH 5IVZB 4EOWL 3P77A 1EVUA 3JWOL 5JOFA 1HOCA 5JIIA 2X1XR 1MRCH 3HKFA 4P4KC 5HI4D 4U33A 2ZSWB 5EZIH 5MEOB 4CMMA 4MNHA 3EJZC 5BOPA 1A7OH 2H8PA 4MXWL 2FX8H 1YN7B 3PWPD 3BAEH 5FA4A 1XGRA 4PJHA 3OSKA 4JO2L 4M1GH 5I76A 2DN7A 3MV8B 5I73B 1OPGH 1L0YA 4V1DA 4JG0H 2BXZA 2C4FT 3MJ9H 1D5MB 5ID0B 4A6YH 4MX7B 4WIQA 3WN5B 3MA7B 3MLVL 1QRKA 5TGBA 1PAMA 5F70A 3TGXA 1QG3A 3OZ9L 5JQ6H 5B21A 3ALXA 4JLRA 4OZIB 4NN7B 1LE9B 1IBGL 2VAJA 2AV7A 1KIPA 1S78C 3QQ9C 4GW1B 4GW5B 4LCCB 5I1GH 2BCKA 3PABA 1HKLH 3C6LC 4YE4L 4OIIH 4NZTH 5E8NA 3U2SA 3VG0H 4P46D 1AR1D 1IFHL 3FB6B 4OLXL 4ZFOA 3MV7E 5D2NC 5DD5L 4QNPE 4JPVL 1A5FL 3FQUA 2KKQA 3HCVB 2ERJB 4L4TD 2I9TA 3VJ6A 4P5MA 3P73A 4AYFA 1H15B 1I9RH 2Q86A 1ROWA 3CLEH 4WW1B 2CK2A 4WEUD 1ODAA 1S9KC 2VXTL 4Y1AB 2DQTL 3LD8C 4AIOA 1BQHA 5I1AB 4U6HB 5JUEH 3DO7A 1DQQB 4JHWL 4JRXE 3MOBH 5FV1L 4FFWD 2UZIL 1XF2A 1INQA 4MDJA 4FQ2H 1YPZA 2BZDA 1J8HA 4J4PA 5I19L 2VZ1A 1TTUA 2N56A 2DL2A 5IB1A 5ICYA 5ITFA 1IC7H 2NX5E 2FO4B 2XKNB 4U1JB 1F58L 3ZKNC 5E1HB 1F42A 5DS8A 1BX2B 1X44A 3VXSE 4NSKB 1FCGA 4WGWB 5C07D 1WITA 4ODWB 4QRPE 5F3HA 5HYEA 4CNIB 1D9KD 2ADJA 4U3XA 1ED3A 1LO5B 5HGAA 4NHCL 1TFHA 3RY6C 2HWZL 5JORB 4GRWB 4H25B 1AR2A 5D71L 1I8MA 5DK0A 2Y07H 4MNQA 1XF1A 3W0WA 2GSIA 4XNZB 1DQML 1LE5B 3DYMA 2I9LB 3GEWB 4JVUA 2O5XL 4M9OA 1L9MA 3V4UL 1SM3L 1IMHC 2J88L 4QGYA 3RWHB 5HPOA 4I77H 2BK8A 4MJIA 3FOLA 1LVEA 3LDBB 2X4RB 5B4MD 4FNLH 1H3XA 3T4AB 2EH8L 4HH9A 3WEXB 5D2LF 4EN3D 3MUZ1 1X5YA 2DQIL 2F5AH 2X4UB 3TBTA 1T1ZA 2B39A 2H26A 1QSFB 5TQ0H 1QO3B 4U2ZA 1W8OA 5EBWA 1SEBA 4C83A 1OTSC 4G3YH 2HJLA 3GIVA 4Y5YA 3FN0L 2DL9A 3C5JA 1P4BH 2RHEA 3BP6A 4C4KT 2DQHL 3MRFB 4F7PB 1X5ZA 3D3VE 5DMGC 4GUPA 1BAFH 3MRQB 3QJHB 5BCAA 1E6OL 3D48R 2E9BA 2W0PA 2I5YH 2HVJB 4HIEB 1IGTA 4K3EL 4NC1E 5FAAA 4Q9RH 4AIZB 1BOGB 5BV7C 1FYTA 3QFDB 1MFEL 1YQVL 4D9LH 1QPXA 1P5UA 5DHVB 4NUGH 4J3WA 2JJSC 5DD3L 2CRYA 4PTUA 1AGBB 3AM8C 3HC3L 5CBAB 4POZC 1FO0L 3FOMA 1WLHA 1CN4A 4LEOB 4HIIB 3TWCH 3F8UB 5KTEH 3M1BB 3CCHB 2NY7H 1AQDA 1NGZA 1S7VB 4QRQA 5J0BA 3O2WH 2BP3A 3K4ZA 1FVEB 1G7QA 1FZKB 3H3PH 1U91A 2YRPA 4EI6A 3C09C 3O4LD 4ISVB 4HD9A 1JPTL 1NBVL 1IC5L 4L8CB 3LKNA 1SY6H 2NY2B 1PBYA 4JFED 3MRCB 4RGNB 2KZ1B 2XZCH 3VE0A 4R96B 1J1XH 3VFOB 3V6OE 2CDEA 4YHOL 3LN5A 1MI5E 3MLRL 4JM4H 5KVDL 1T1WB 1IQWH 2C7UA 1FZJA 4RISH 4PR5A 4JFDB 3L9RA 4OZGB 5DD0L 1BGXH 2J4WH 4TULH 1PG7X 4GKNA 1WIOA 5HHMD 3JSSA 2VNCA 3VFVA 4CN6A 1EBPA 3ARBB 5I15H 1N7MH 1KTDA 5A16A 2AXGB 5CJQH 3PG2A 5ESVB 1J87A 4R7NA 2YD1A 1F4YH 2XI9A 4Z7QE 3WIFA 5E08L 1OAXL 1U93A 4MXVE 4JHAL 4IRZH 1N3NA 2E8ZA 1UEYA 4X98B 2AI0L 4G42B 4N1CA 1NEZG 1N6QL 4QEGA 1V3LA 4RRPA 3ZKXC 2X1QA 5DJXA 3QEQA 2G9HB 1IQDB 4HG4J 2XQYG 4XP9L 3QI9B 1MHHB 3FO9B 5DVKA 3VXOA 3S98A 3IKCA 4Z78A 3KLAA 3E8UL 2VR4A 4KI5E 3GRWH 1EMTH 3O3DA 3VFPA 1RJYA 2DI7A 5IK3A 3SDYH 1NC2A 5E6IC 4D0CA 5J6HB 3PL6A 1UC6A 2MHAB 3O2DL 5I1KL 2A6IA 1MVFA 5MP6H 1QZ1A 4EVNB 4P23B 3BWAA 3H0TB 2GJ6E 3LQMA 4X7TB 3AS0A 4ZUUA 2GTWB 4U1NA 1A6WH 1Q72H 3FQNA 12E8L 4PV9B 3UO1L 5MENE 3SPVB 4O5LL 5C09A 4FQLH 1ORQA 2D7OA 1RIUL 2VDRH 4FS0A 1UWGH 4KU1A 5DGRA 3F5WA 1LNUA 4APQD 2V2WB 5SWQB 3F58H 4P99A 3CX5J 4P2OA 3QCUL 1FGNL 1S9XB 3CXDL 4ONHA 2Z4QB 4GRMB 4JQVA 3BPLC 3B6SA 1HEZA 4F7MA 3LZFH 2QQKH 2LV4A 3MREA 3SDXE 3ZT5A 3CH8A 2D2OA 5SWSA 2PYEA 3ARFA 5MHSE 2NXZB 1RJLA 4QHMA 5E94A 3WJLA 3MCLH 1IKFL 2ZCLL 3NN8A 4MWFB 4NKDB 1ZTXH 4HS6A 5CSGA 4D8PA 3VXSD 5JXED 1FL3B 3L95B 2ZP0T 1F2QA 1G7JA 2E8YA 3ALPA 2PO6C 2PTVA 3VGAC 4G43A 4CW1A 5BZWA 2MQ3A 2VLJB 3K2MC 1MQKL 3HC4H 2CQVA 4IRSA 5J9PB 2PN5A 4EEEA 1JF1B 4OJFL 1MCOH 1GOGA 1JI1A 5EBLA 2NR6C 2DJSA 2WUBH 4UNVA 1N6UA 1ULVA 3HB3D 3GHEH 1X6LA 1WBYB 5DK2A 1HI6B 1KTRL 3HUJF 2FYYB 4MA1C 4PD4J 2PCPA 3QIBC 4OKDA 3S4SA 3CVIH 4KXZH 3ZL4L 3SJVB 2FATH 2NNAB 2VIRB 4UV7L 4K23L 2WLYA 5ANMB 2EDDA 4RGOH 4NQDA 4WWKD 1MFAH 2EXWC 3H9SE 1T0NB 5DWUL 1OAUH 5D7IA 1GGIL 1RUPH 3Q6GH 4CU6A 5KSBB 1NCAH 1JPSH 4NZRH 2XKSA 5LAXA 4N90D 5AD0B 1MF2L 2O61B 4Z7NE 4Y2DA 2HFEB 1NKOA 3D3VD 1DE4B 5JDSB 2B20A 5SWZA 4OUOA 3GIZH 4P59L 5C0BB 4ELME 5JPNA 3BRDA 5H37G 4GAJH 4R3SB 1I4FB 1ZSDB 5DYOA 3WUWB 5I1CH 1FHGA 5I66A 2CIIA 2IAMA 3VCLA 4OZFH 1X9QA 3VH8B 1IAKA 5E8OA 3RNKA 1QLEL 1WT5C 2ADFH 1YNTA 5J6GB 1Q9OB 3UBXI 2DRUA 4RMQA 3MGAA 3RKPA 3QHZL 5B3NA 4BA8A 2FNBA 2F5BL 3LKRA 4KKNA 4X6DB 3HE6A 5T1KA 4N0FB 1HHKA 3BZEA 5MI0C 3GB7B 1U8PA 4PJ5A 1G7IA 4PJ8D 3TBWB 3S5LA 3HI1B 4RGMC 1R5IA 5KJRL 3FHAA 1IE5A 1B9ZA 5A2KH 2X1WL 2J8UB 4JM2C 1BM3H 1RUMH 5D7SH 1G9MC 3ULVH 2BNRB 3IFNL 3ZE2F 1CE6A 1MI5D 5IF0B 4XPFH 3WLBA 3IJYA 2KBGA 1T1YA 5B3JF 5C0CB 4HXAH 3QXAA 1TETL 2K7PA 2E7MA 5E5MB 4HJJL 3VXRB 4IRJD 1A6AB 4PJ7B 3MUY1 1Z2KA 5HHOE 3WS6A 1I8IA 1FFQA 3TIDB 1CLOL 4M4RA 2DQEL 4K2UH 4S1RH 4K9EH 2M1KA 5IT2H 2YD6A 4UINL 5IJKC 1T6VN 4MCZB 3IVKA 4L4VD 5C3LD 4HHAB 3W11D 3B5GA 1QEWB 3GMLA 5EU4B 3BUTA 5HYSA 1KELH 4NGHL 4HIXH 4HWBA 3ARDC 3KVQA 3SKMA 4OCWH 4P3DB 4DWHA 3MV01 2D7PA 2F58L 1MWAA 5DRNA 1EFQA 1JWMB 2EYTB 3FQXB 2ZUYA 5IVZA 3OHXA 3D39E 3ULUF 4OGYH 1IEBA 4Q7DA 1ZA3B 4JJ5B 1TPXC 4GKZB 3BZFB 1RUAH 4I2XB 2NY5L 3QBTB 4C56E 5MEOA 4UT6H 1DN0A 4KRPD 4YZFF 3PQYE 3UTPE 4WFEE 2FH8A 2EYSA 4KI5D 3IGAB 3DV4A 2FEEI 5D6DA 5GSRA 2B1HH 1QRNB 1YC7A 4ZO9A 1AKJD 1CK0L 3KPOB 4NO3A 2OBGA 4BKLB 4JY5H 4XMLL 2VC2L 1QSZA 3V7AE 3WS3A 5CEZH 3NZ8B 4U7MA 1ZGLM 2H2SD 2X7LB 5FUCC 2M26A 1U8KB 4BZ1L 4NCDA 2HT3D 4JR9L 1ZWIB 5MEND 2JTDA 2W1NA 3ZDYE 4GW5A 4LCCA 3K3QA 4G6KH 2H6PA 3FFCA 1D3CA 4GMSL 1DFBH 1JNNH 1N5YH 1U3ZA 1JF6A 2XZAL 1IAIH 1FVCA 4LQ1A 3VDCA 4DJMA 1G9EA 3BPOB 5D6DC 3A6CH 1YY9C 2FX9H 1HH6A 4IOSD 3CFBB 2BY2A 5I73C 3LV3A 3WN5C 3FB7B 2RB8A 5BW7C 4I18B 1CI5A 3LKQB 3KPPB 1QFWH 4KGJA 3ORJA 1T03L 1QHPA 2WP3T 2RIKA 5GQBA 3FT4B 3M8OL 4OZHB 1FLRH 2ZKHL 5H35A 2IQ9H 1K5NB 5EZJA 4WW1A 3X17A 3OJMB 3WKMH 1JHTB 5FGBC 3K2UH 4JKLA 1HDMB 3E3QE 1DQQA 4DEPB 3VFNB 5BV7H 4Y4KD 5IG7B 4CADB 2JIXB 4PJEF 5E8DH 1MRFH 5D9SB 4AQOA 1D5IL 3Q5TA 1X4YA 5IOPB 1LO3L 1WBXB 2LVCA 1I3RB 3QUYB 3MBED 1S7XA 1JV5B 2R9HD 3QDHA 2K1MA 3N50A 3V6FA 2CK0H 1HNFA 3LAFA 4FQXB 1JMXA 4GXUM 2ERJC 4WVRA 4NC0B 5D2LB 1RZIB 4NCC2 3HPLA 1UB5B 4M61B 5GGVY 3MRKB 2IC2A 3MOAH 4LHJB 5D1QB 4LSRH 1K9TA 2FDBP 3C87A 4U6YA 1J12A 4BQ9A 3WFBL 4AY0A 3Q1SH 5JORA 3TPUB 4NQUA 1CF8L 4PGJA 2Z92B 1DZBA 3JTTB 3H9SD 5JW4Q 1JN6B 3P3YA 1LE5A 3C08L 2I9LA 3EW3B 4E41E 1KJ2B 2X4SA 2VOTA 2VQ1A 5B22A 4U1IA 3O9WC 3PV7A 5F96L 3I6GB 5DVOA 1SYSB 1UWXH 1MCLA 2BMKB 5JLZA 2X4RA 4KROB 4M5YL 3KYAA 1J0KA 2JB6A 2QQLH 1CXEA 3MO1B 3L1OH 4PJBE 4N5UA 2PTTB 4UZGA 1A7QH 5DR5H 1PLGL 3ZE1E 4E0RB 5DMKA 2X4UA 5GGRY 4DZ8A 3OXRB 3E6FB 1QSFA 3QDJA 2H1PL 3IYLW 1QO3A 5AZ2L 3GMPA 3MACH 3LPGA 2GJJA 3OJVC 2FBOJ 5EFIB 5C0AA 3KDMB 5CP7B 4PTTB 3MRQA 4LSQL 4HXBL 2R0ZH 4LGRB 3F7YB 4M7JL 4JGMA 1BHGA 2P8MB 4HV8A 4P5TC 2J5LB 3ARZA 3HG1B 3LDBC 3V2AR 4G6FB 3BQUA 5IHUH 4AIZA 1YUHB 4RMUA 4R2GC 3PHSA 4N0YH 4RWYH 1F11A 5AZEH 1WCQA 4BFIA 5ACMA 3VRJA 4WV1A 5K9KB 3REWA 5IV2B 3IU4L 4G7VL 3TP4A 1R24B 3OKLB 1XIWC 4I0CC 1KFAH 4HIIA 1TJHH 2XZQL 3UMTA 3BYTA 2V6HA 1KJ3L 4NWUH 3HZVB 5IFHH 4RFOH 4W6WB 4OB5H 1FZKA 4NRYA 3KXFE 1VFOA 4XNXH 3S34L 4PJGE 4ISVA 5HHOD 5D7LB 4LASL 4L8CA 2F53E 1XGTA 3MRCA 3RAJH 3RDTC 5C08B 1VPOH 5GRVL 1MFBL 3GI8L 3FMGH 4OT1L 4LCIL 2QSCH 1TVDA 4D94A 3GKZA 1Q9WB 2VXUL 4N0CD 4ETQB 5JMOC 3QIWD 4WTZA 1MUJB 4JANB 4XCFH 1M05A 1H3PL 2FZ3B 3NA9L 4OZGA 2YPLA 4A2MA 1T04B 4K3DH 4K94C 5D72L 5D1ZC 2AJSL 5GS0H 3D39D 3W82A 2ZOKB 1LO0L 1IC4H 3L7EA 4UBDD 3C60A 1XMWA 1KXTB 2NZ9C 4C56D 2O5YH 5ESVA 1F90L 4WO4D 3PQYD 1DBJL 4WFED 1YEKH 3WFEH 3RL1B 2NY2C 3PWJA 2C4XA 4M6ML 3O11A 4RGNC 4JZJB 1RMFH 5IVXF 3RPIB 4G42A 1DQJA 3NPSB 5C0EB 4KV5E 4KMQA 5GS1C 5FB8B 1TQBB 4MNGE 5EIVA 1HILB 1KCKA 2ADGA 2D0HA 2XT1B 1W8NA 2G9HA 4G5ZL 4NWTH 4OD3L 5C7XL 1OGAE 4EDWH 4OF5A 1BQUA 1QD0A 3L5IA 3SOBL 5KVEH 3G6JA 4PGCB 4F2MB 5CGMA 2RCSL 4MQSB 4YHIA 4MYWB 3JZ7A 3ARBC 1DSFH 2A73B 4LU5L 5SV4A 5EC1B 3UP1A 3DV6B 5I6XB 1A14L 3MUHL 2I07B 5IB2B 1XGYH 1TNMA 4LOUC 1F6FB 1XCTA 4G6MH 4EVNA 3GKWH 1ZANH 1S9WB 2HFGH 4WW2F 2WSKA 1MRCL 4S1DD 3WFCH 5EZIL 3T4YB 1P9MA 3QIUB 3ULSA 3L3HB 5KVFH 5CD5C 2AV1B 2GTWA 1U3HD 1A7OL 5B39B 5L88H 2FX8L 4PV9A 3ZSSA 3BAEL 1WBZB 1P1ZB 3B4NA 2XXCB 5E03A 3K1DA 1JI2A 4FQJH 4R4FH 3IFOB 3PHQA 1OPGL 3QI9C 1CGSL 3SDAD 5JW3H 2YBRA 5GGTL 4JG0L 4A6YL 4QRRE 1C5CH 5DSCB 4WUUD 4OCRH 3C8KA 1SHMA 2G2RA 2PKDA 2Z4QA 2VLLA 4PJIE 2X1OA 4XPBL 3D6GA 3WO4B 4NKIH 1F00I 3SGJA 3FHQA 3HUJB 2XQBH 5I1GL 4P23C 4ZAKD 1HKLL 5IQ9B 2DB8A 3VMOA 2ICES 4OIIL 4NZTL 3VG0L 2LE9A 3CMOH 2IQAB 1RIHH 2BVQB 2VDPH 4F37F 3SE3C 1FNSH 4OZ4A 2R0KH 5E24E 3K4DA 5CHNB 3L95A 2HJFB 1DBKH 5KAQG 3DMMB 4Z7QF 4X6CF 3IFPB 4YHLL 2XG5A 2HN7B 4BFEA 4U3CA 1I9RL 1G9MH 4EDXA 5LBSH 3T0DA 3P0VH 5J9PA 2Q7NA 1RZJH 2VL5B 4FA8A 4K7FB 3QYCA 3WFHB 2MCG1 4QRSA 3CLEL 1CWVA 4QXTA 4RCAA 5C71A 4E41D 1JNLL 4KKAD 4GRLA 4G7YH 3VWJB 5EN2A 1LEKA 4PLKD 4R4BB 2FYYA 3E6HB 4WU5B 1GC1H 2HKFH 2NXZC 3MOBL 1KCVL 3KPRA 1YMMA 2NNAA 5JZ7D 3LN4A 3OAZK 3CSYB 5ANMA 2QSTA 2FO1A 4FQ2L 2AJXL 1FFOB 2KQMA 2Y5TB 3OKKA 3LRHA 4FP8H 2PXYC 2VXQH 3FFDB 3CFEB 1QUNA 4YXHL 1IC7L 3DX8B 2X2YA 4Y0GA 5FM5O 2VXVH 3TN0D 1JK8A 2QQQA 1VFUA 3CZFB 1JTTA 1IAIM 5KSBA 1P6AB 4TUOB 2BDNH 2O5ZH 3BH9B 3T0EE 5KSAA 3HI5H 1KCSH 1IRAY 1KG0B 2HFEA 1DE4A 5JDSA 2NY4B 4LLUB 3HNSL 3S35H 6CGTA 2Y07L 4R3SA 1ZSDA 2A83A 3WUWA 1QFWM 5C0IA 3MV9B 3VH8A 4R26H 3FO0L 4YH6A 4KKLD 1HQ4A 4I77L 5GJSL 1Q9OA 3D2UA 1UH3A 2VLMD 1MCDA 4FNLL 5AAWA 2OX5A 2WBJD 3VXQB 4MA8H 4GG6B 4HWBH 5KN5B 3U7AA 3MUJA 4X6DA 1MWAH 2F5AL 4N0FA 5C3TA 3WD5H 3V4PH 4ZD3H 3TBWA 2P24B 1FH5H 3HI1A 4Q2ZA 5C0FB 4TNVF 4G3YL 4ZUWA 1P4BL 3BKYH 5F7YC 4DGVH 1OF2B 4DW2H 3KPSD 1S8DB 5A2IH 1BAFL 3IDMA 5IF0A 3L3JB 5DURD 1IEAB 3MRGA 1R0AH 1KEGH 1JZ6A 1ZVSB 5A2FA 1NGPL 2IANE 5E5MA 3VXRA 4CVUA 2I5YL 4Q9RL 5LVEA 3LVEA 3BPCB 5EOCJ 1A22B 2P7TB 4D9LL 3RVVC 4ZFFA 2ICEA 2UZYB 4NUGL 3PGDB 4F57H 3QJFB 3H7LA 5EUOB 4UIKH 1HZHH 1JL8A 4MCZA 5TE7H 4C58B 5ISZD 4HHAA 3TWCL 2Y6SD 5KTEL 1QEWA 1W2KT 3O2WL 3BT2H 2YR3A 4LAQH 3WSQL 4P3DA 1D6EA 3QXUA 2B7DT 1SY6L 1Q94B 3FQXA 4LHUD 2XZCL 4JN1H 1J1XL 4HBCH 4KHTH 4JJ5A 5DQDH 3BZFA 3G5VA 5GGQH 1OGAD 4NKOB 4LSPL 5HJ3B 4IM8A 4JM4L 4GXVH 1IQWL 2ZJSH 1OTUC 2BNUA 2VABB 4RBPK 5E70A 5I30H 5GRJH 2AAVA 4ODHH 3NBNA 1BGXL 2J4WL 5EPMA 5BZDA 4BKLA 1C5BL 1YJDC 4NP4H 4O2CB 4XGZB 5I15L 1N7ML 3FCTA 5A3IC 2G5RA 3HZKA 3QB7C 2BVOB 3LEXB 3SN6N 4WDIA 4LBEB 5CJQL 1VENA 4RMVA 1OT2A 2AEQH 3P4MB 3UCRA 1R3HB 2WIIB 3QISA 2DD8H 2NYYC 5JPMA 3RTQC 3PGCB 4MNQE 1VKXB 3W0WE 3QWRA 2WW8A 4XP5H 4IRZL 1IGFH 3K4AA 4YHZH 5JHLH 4ONFH 4M1CD 3EYVA 4PJEB 5HGGS 1NEUA 4LLMA 2EKSB 1A3RH 1U58A 4QRRD 4MJIE 2DF3A 4UTAH 3MC0A 3S3PA 3QEUA 1G7PB 3IAQA 3QT2A 5E4EB 1MCBA 2W60B 3G08A 4WFGE 3IDYB 1V7MH 4PP1D 3U79A 1BBJB 5J57B 3GRWL 1EMTL 1P69B 2XA8H 4GRWH 4OCXH 3SDYL 5DJ0B 5GGRA 4I18A 1I8LC 5AYQA 3LKQA 3RWIA 4ZOBA 3T08A 2P8LB 1ZVYA 5TDPB 1I1AD 1K5NA 2HKHH 2N7AA 3TIEB 4PRHD 3OKMB 4OGAC 2VR5A 1MELA 5FUZH 1Q72L 2HA1A 3CK0H 4NRZA 2CMRH 4HF5H 3ARSA 4ALAH 2HRLA 3DPBA 3GGWB 5IIEB 1TLKA 1WF5A 5D9SA 4LSUH 4UB0H 4QRTB 4FQLL 3BPOC 2VDRL 4D0BB 3QNXB 1WBXA 4GH7B 1UWGL 1MJ7H 1V7NH 4M3KB 4PS4L 1JTPA 4QHLB 4PJXE 4FQXA 4N8VG 5D2LA 5KANI 3CPLA 5FYKH 3F58L 1E4JA 1RZIA 2YSSB 3EYFB 3GSVA 1MLCA 5E2TH 1UB5A 3CFDA 3R0MA 5DO2D 5FECA 1JGDA 4K8RC 3MRKA 2HYMA 1QA9A 4GBXB 3I50H 5DJ6A 4ZDHA 1KN4L 3LZFL 2QQKL 3KLDA 5EU6E 4W81A 3AB0C 4PG9B 4M6NL 1FV1B 2YUZA 4MHHI 2C9AA 3IDNA 3IF1A 1UKTA 4L8DB 1K3IA 4DEPC 1JN6A 3MCLL 4JDZB 3BEWB 3V0VB 5EA0H 1ZTXL 2LQRA 4JFZH 5CP3A 1D7FA 4QKXB 2AJ3B 2FSEA 3QUYC 1P7QA 2BMKA 5ADOH 5I17B 1F4WH 4Z95H 3ZZ1A 1DCLA 3T0ED 3TA3B 3DRQB 1H3WM 3I85A 3NGBB 3HC4L 1EUUA 2DWEA 1C08B 2BNQA 4OFYA 2PTTA 2QJDA 3EYSH 2XIDA 1MCOL 3ALWA 3GMOA 2WUBL 5D1QC 3GHEL 4PBWD 4HLZH 4J1UB 4YO0B 3QDME 1LO4H 5DMYA 5J13B 3ULVD 5FA3B 4TNVK 2BOBB 3CVIL 1NMAH 1TIUA 1I1YB 1NLDL 2OQJB 2FATL 5TF0A 5BXFA 3T3ME 43C9B 5ICZB 4XXDB 4RGOL 2CDFB 4M93B 5CP7A 1MFAL 3S97C 5HYJA 1N64H 4BH7B 4V1DD 4HSQA 4GG8A 1GL4B 1T7WA 3QXDB 3OJ2C 4HIHA 3Q6GL 1RUPL 3GBML 5T5FH 2YA1A 3LS5H 4KROC 1JWSB 1BZ7B 1TITA 1KN2L 1CVSC 1NCAL 1JPSL 4X7DC 4EJ1C 3D69B 4NZRL 4DOHB 1KGCE 4HK3N 3PV6A 3DVIA 3C2AH 5K9KA 2GK0A 2YXMA 3MODH 3UTTA 1RURH 5IV2A 4MJ4A 2M8XA 1A7PH 1R24A 3OKLA 4LLWA 3RUGF 3HMXA 1KTKE 3GIZL 1MAJA 5CILH 2Z31B 5J1AA 2AKRA 1YY8A 2KZWA 5D7LA 3IDXH 1LK2B 1TJGH 2ADFL 5IVXB 1NANH 3O8XB 5C08A 5DFVD 1ADQA 3MNZB 3ZKMC 5C09E 2J5LC 5F88B 3PXHA 4XT1C 1YN6B 4NT6A 1NFDE 2A9NH 1DVFB 5I1HH 4PRNA 1H0DA 5EORH 1VEOA 4M43H 5ETUB 1CU4H 5DVNA 3HPJA 1YYLH 1U3JA 1I9EA 4ETQA 4PRBB 4W4OA 4HAGA 1HNGA 2FZ3A 2AXFB 5CEZD 1A1OA 3SDCA 5D6CA 1C12A 3BO8B 5D5MB 4XC1H 1WC7B 2X4QB 1KCLA 4JB9L 4MDIB 5L2JB 2ZOKA 1RUML 3MQIA 5D7SL 1FFNA 1WVZA 4WI6A 3G5ZB 3DX6A 2UY6A 1J8HD 2IPTH 3T3PF 4J4PD 4PJBF 4XPFL 3VFGH 4J23A 4WW2B 1UJ3B 1DQTA 3AREB 2XWTB 3QXTA 1OAYH 4F9LC 3DSFH 3E0GA 3STBA 4YQXH 1NSNH 5JO5A 3RPIA 3AAZB 5C0EA 4H88H 1DANU 4D9QE 1FIEA 4K2UL 4S1RL 1A9EA 4KJPD 4K9EL 1KB5B 5CKGA 1MEXH 5IT2L 2EDYA 1RUKH 1U41A 2NXYD 5CLTA 1AIFB 5F89B 4M7LT 4OLEA 3S96A 3UJJH 4S1QL 4PYHA 2EEBA 4MNQD 5FFLA 3W0WD 4HIXL 5F1NB 2V5MA 1K6QL 4OCWL 1U8MB 2IWGA 4FRWA 3UPRB 4HK3J 4ZFOL 5DJZB 1S7UB 2AK4E 5F7WC 5F1IA 3BZ4A 3VFSB 5IMOA 4OGYL 4MJID 5D1XA 2R69H 1S9WA 4AL8H 1AO7E 2DLTA 4JZJC 4NQSB 1RUAL 5IKCB 2X9WA 4UT6L 3UAJC 2XYCA 1FC1A 2AV1A 2HLFD 4OFIA 3NPSC 5B39A 4EIGB 1TQBC 4P49A 2B1HL 1MHPL 2VWEE 4Y88A 2W0FB 3W5MA 3L6FA 3S36H 3U0WH 3IFOA 1GGYA 3NIGE 1F97A 4X6CB 5ADPH 4JY5L 2ESVE 2V2XB 3P4OB 5CEZL 1CDUA 5DSCA 5HHNA 1DUZB 3S6CA 1HSAB 1OP5K 1HE7A 1PSKH 1EHAA 1LMKA 5JHDE 2V5SA 3P9LA 5I6XC 2YZ8A 5T5NF 4PG2C 2VDNH 4NQEE 3HUJA 1ZMYA 1EXUA 2XWBB 4G6KL 3PWPA 2AJZA 4LLDA 1FYTD 3DXAE 3QIUC 3EYUH 3F7QA 1DFBL 2BVQA 1JNNL 2PR4H 3EO0B 3OGOE 3MRLB 2V5YA 1IAIL 3V0WH 1XGPB 4JFOB 3LEYH 4S0SD 1I85C 4MA3B 3A6CL 4TUJA 1HHIB 3V7AG 4CL7A 3UJIH 1QFOA 4M62H 2YUXA 1INEH 1SJEB 4LRNH 1SJVA 1K3ZA 3NCFB 3H42H 3OL2A 1RZ8A 1QYGL 2CKBL 1HHHB 1VSCA 3IFPA 4PB0H 5JDJA 1RUQL 4OFKA 4L3EB 1IL1B 4EZMA 4L3CA 4KV5F 5DTFB 1FLRL 4P2QB 4K7FA 3I6KB 4D9RD 5JW4N 1OD9A 2IQ9L 3WFHA 1S5HB 4Y4FA 2Q8BH 4DZBB 1TCRB 4LMQI 3WKML 4DCQA 1CLYH 3K2UL 2OTUB 3E6HA 5CSZB 2MPAH 5BV7L 5CS7A 4YFEA 5E8DL 3GUTA 3RWFA 1Y18B 3U7YL 1KPRB 4N0UE 2B5IB 2Y25A 4BFGA 3E2HB 1FFOA 2H9GA 3OGCA 5LGJB 4OLVL 3RWCB 4WHCA 1JYXA 4E9LA 2Y5TA 4UDTA 2CK0L 4XTRC 5CJBA 3VXUE 3FFDA 4H0HB 1ZV5A 3DMMC 1X5KA 3BZDA 1N2RA 4Y16C 4D3CH 3MOAL 4GW4A 3DGGA 4BSVB 2OL3B 5GZND 4WJ5B 2SEBB 3VI4E 4AQ1B 3MCKB 3MLYL 1S5IH 3ARXA 3TZVA 4PJDB 4JN2A 5HD8D 5FUCE 3GSXA 4LSRL 3VD9A 3BH9A 1IAOB 3RIFF 3GSQA 2JLLA 3LKOA 1D5ZA 3EGSA 4OCLC 5E2WH 1AY1H 5CJOL 5IB5B 3Q1SL 1HXYB 4JCLA 3SY0A 3VWJC 4EBQH 4MSWB 1CTNA 2E7CA 1PKQA 2CIKA 2FIRT 1CGXA 3QEQD 2L4OA 1T0PB 3GMNA 4FZ8H 5E2JA 2BSRB 3RU8H 5L7XH 4L29B 1XF4B 4HC1L 4PJIF 1QBAA 4XNUH 15C8H 2YZ1A 4DN4H 3SGEI 1YJDH 2QQLL 3MV8E 4KK6C 1NC2D 3L1OL 3VXQA 5FKPB 5J11C 3IXAA 1A7QL 3PL6D 5KN5A 1UB6A 5JIKA 4N9GB 5IFJB 4OQTA 3DVFA 1E4XL 4K71B 5GS0D 5MERB 3IDUA 1J1OH 1L4IA 5H8DA 4XCEA 1DLHB 1CG9B 3MACL 4OZIE 4XBPA 3PGFH 5D8JL 2NY4C 1Y6KR 1MFNA 3DROB 3VWKA 2Y1VA 4OBSA 3CDCA 1OF2A 2D0GA 1PFCA 5C09D 4S10A 2FJFA 1JPGB 3O2VH 2IH1A 4YAQB 2R0ZL 4JZNB 1ZVSA 1HN1A 2D7TL 1K8IB 3CDFA 1UYWH 5HVWA 5GGVH 4P2OD 5IHUL 1XEDA 1JYNA 2G5BB 1U2HA 4N0YL 4RFEB 5AZEL 5GIRA 2X4NB 3KPTA 4G9FB 4IMKC 3GSRB 2H2PC 3ECBB 2I26N 4CJ1A 3QJFA 2QEJA 4V2CB 4X83A 3KYNA 2ZUWA 1X5XA 3G5YA 5SWSD 1KFAL 1TJHL 2PYED 1IM9A 3ARFD 4XAKE 3DVGA 3U7WH 3TESA 2MJWA 4JHBA 2YPKA 1B0GB 4RFOL 1FVDB 1J1PH 2VR9A 4R4NC 2ED9A 4XNXL 1HXMA 1RV6X 4NO2B 1IARB 1WISA 2B1AH 4Y1AE 2VLKB 2ZUUA 3TO2A 1JZ3A 1Q94A 3RWEA 3RAJL 1GHFH 2DBLH 3MRMA 1L7TL 1VPOL 3SKOB 1LO2L 3ZE0F 4HJGA 3U4AA 4I13B 1KLGA 3AGVA 3FMGL 1BOYA 4F7CB 4HS8H 4IRSD 4YNYB 5EOCH 1CFQB 1BPVA 2VABA 2CR3A 4XCFL 4Z7VB 5HDLA 4K3DL 4WENB 1CGWA 5DGQA 1XZ0B 5GS0L 1P4IH 3NH7H 1A4KB 1MVUA 1RI8A 4HFWB 2GAZA 4O2CA 4XGZA 3NCYP 3BP5B 2IADB 3P0YH 3LEXA 1G9NC 1YEIH 4L8SA 3QUZC 4NQDD 2O5YL 4JRYA 5DRXB 3P4MA 3AU1B 4E42A 1TXKA 3BI9X 1R3HA 4GRWE 5IQ7L 2IGFH 2CH8A 1HHGB 3WE6B 1YEKL 3ROOA 3WFEL 1L0XA 3WIHH 2CR6A 1CT8B 1I1FB 2A6JA 4KH2A 1A4JA 1Q0XH 1RMFL 2L0DA 3RVUD 3V5KB 4MMXC 4XP4H 4LVNB 4PJEA 4TSCH 3UBXA 2OS7A 3PNWB 4XCCH 5GRWA 5T3XH 3V0AC 5HGDB 2HT4D 5BRZB 1R5VB 4RAUA 1CDBA 5DEGA 1E4XI 1P84K 4X9BA 4Y2DD 2W60A 2G60H 4EDWL 5SWZD 5J12B 4HWZA 2B2XL 1QP1A 2C1OB 5KVEL 1BVLB 2FX7H 5T33H 1UG9A 3DUHA 5CSBA 3G5XB 1QSFE 5K9QG 1A7RH 2IAMD 5IHZB 2OM5A 3QH3B 4JVPA 5LGHH 3MX0A 1XGYL 2ED7A 3RWJB 3GSWA 1V8HA 5IB3B 2IALB 2P8LA 4G6ML 5CP3H 3GKWL 1ZANL 5TDPA 2HFGL 4JFXB 4LHUG 2WINB 4JY6A 3RIAK 5KVFL 4AM0B 3RZCA 3MFFA 4G6AC 5FYJH 5HGHA 2YRLA 5L88L 3OKNB 3HE6D 1MCPH 5T1KD 5HHQA 1LEIB 5IIEA 1LD9A 3G6AA 2D7NA 2XKUA 4U1GC 4XHJC 2CSPA 2OP4H 4PJ5D 4FQJL 1EVTC 4R4FL 1U8LB 4W70A 4HDIA 2A74B 4HWNA 5JW3L 2KH2B 2WWMD 4QHLA 1E0OB 3ARDD 1C5CL 5GS2H 5LXGH 1W72B 4OCRL 3EYFA 3WJJC 1SMOA 4XRCA 5FM8A 1CDCA 3SCMA 4Z7WF 3RWDB 3MV7A 4YBQD 5FYLE 4GBXA 5DK3A 5E1AB 3KLHC 2VDKH 1MCRA 2WUCL 4I0PB 2XQBL 4I4WB 3RIFK 2ICCA 4ZFZB 3D85A 1FV1A 1EO5A 1CCZA 3CMOL 5DXWA 3BESR 2VDPL 4RGNE 1AP2A 3MLWL 1VESA 2YXFA 3BEWA 1QACA 3ZHDA 2R0KL 4Z0XB 3FT3B 2N4IA 1OWWA 4PY7A 4XAWH 2VLRB 3D18B 3KGRA 2BY3A 3ROLB 3O41A 1DBKL 1PKOA 1EHXA 1ZA6B 3DRQA 1X7QB 4JRXA 4JFDE 3VFUB 4OZGE 3WO3B 4HWUA 4BQBA 1G9ML 2NW2A 3P0VL 5EU7C 1NGQH 4XH2B 1RZJL 4HEME 1MCFA 2FLRT 2HT2D 1OAZL 3RUGB 5C8JB 3SDDC 3BWUC 4I5BA 4MAYB 4J1UA 5I1EL 4YO0A 4G7YL 3F6IA 1F4HA 2Z91B 3EOTH 3BEVB 2NX5A 2BOBA 1GC1L 3KPNA 5EBMA 2HKFL 1ADQH 3EOAB 3L5XH 1I1YA 2OQJA 4KVNH 4FFZL 3QDGB 1AGEA 5CJXA 4L5FH 2CDFA 4QRPA 2C4FU 4OM1H 3OXSB 2X4OA 2Z93A 4FP8L 4M8QB 1SVZA 2VXQL 3VFTB 1I7UB 5I0ZA 1CFTA 3UJTH 3U4EA 3QXDA 5HHPA 5TE6H 2HFFA 5CZXD 1OCWH 1Z5LA 3TA3C 1BZ7A 3NGBC 3MBXH 3GSNB 4D0DB 5DA4A 1TENA 3B8SA 4NQTA 4YHPA 5CLWA 2BDNL 5AG9A 2HVKA 2O5ZL 3HI5L 1KCSL 1CD1B 2A0LC 2GUOA 1BLNB 3NPZB 1KJVB 3S35L 3FFCD 5J13C 1M7IA 5E8EB 3H3BC 4G80A 5INDB 4JO2H 2Q1EA 1NBYB 1T89A 2Z31A 4OZFG 3LN9A 4E5XB 1GPOL 1VGKA 4POYA 5C2UB 4R26L 1CGUA 4M93C 3V6ZA 1LK2A 3RGVB 4TTDD 4ZOEA 5IVXA 3BJ91 4UI2A 5JW5B 3L5WB 3LY6A 3O8XA 4I48B 3OPZL 1KIUA 3MNZA 1PQZA 1YN6A 4MA8L 3RWGB 3T2NH 4C57C 1DVFA 4FQHB 1AXTH 5ETUA 1MWAL 1PYWB 2FWOB 3WD5L 3V4PL 1CFSB 4ZD3L 1E28A 5D7JB 1IFHH 2AXFA 4OSUH 4KFZC 4OLXH 3HZMB 3RVTC 4FFVD 4CN4A 4HKBB 2ARJB 4NBZB 1T21B 2X4QA 1RZ7H 3BKYL 1UM4L 5F9JA 1H8SA 1A5FH 3KWWB 4DW2L 1J05B 4UDUB 3KJ4B 2P45B 2EDQA 1AXIB 1R0AL 1KEGL 5E2UL 3MNWB 2NQCA 2OR8A 1UJ3A 4G8EB 1EDQA 2XWTA 3MPCA 4XZUA 1ZHNB 4MS8D 4UUJA 2K7QA 3EFFB 4P9HC 1O7SA 3QEGH 4UIKL 1HZHL 2VLJE 1FCCA 2VTFA 4Q6IB 4RX4A 5F89A 2I60L 1MY5A 1GH7A 3MLSH 5FOBA 5IBUG 3BT2L 4LAQL 1MLBB 1PZUB 2BVPB 1C16B 2YWZA 4NPYA 2HG5A 3NTCH 1BIHA 3HMWH 5DJZA 4ZNEE 2DLGA 2DLEA 1HQRB 2IG2H 1I7ZB 4WW2C 3SJVE 4UQ3A 1W0YT 2OJZH 3A67H 3MRDA 4HBCL 4KHTL 3AREC 1WAAF 5ANME 5DQDL 1J8KA 5GGQL 4C54A 5INCA 1JWUA 1OARL 4HW6A 2P5EB 2GFBA 3CFIC 3TFKC 4GXVL 2NY0B 4N8PA 2ZJSL 2NY6B 5DZOA 2HWZH 1QSFD 3C9NB 3QDJD 2W0FA 5I30L 4ODHL 2ZG3A 3IB4A 5FYKD 5DJ2A 4FG6D 4KQ3H 5KSBE 3BHBA 1S7RA 3RP1A 5T1MA 2RAMA 2VUYA 3OV6A 4NP4L 1BQHG 2V7HB 4P5KB 5C1MB 3U1SH 1GGUA 1A7BA 1DUZA 1OAKL 2DI9A 5C0AD 3X3GH 2IMMA 3TO4A 3VA6A 2AEQL 1FFPB 4KUZH 1A64A 2V2TA 1R3JB 2DD8L 2OK0H 5C0BE 1UZ8A 3NCYS 4QT5B 4KK5D 4ZODA 4BM7A 1N26A 2EH8H 2JKXA 4XP5L 1IGFL 5K9OB 3BQUD 3NFNA 5J3HC 5JHLL 5F8QC 3PWNB 3Q5OA 2A2QT 5F7DA 1IVLA 4HT1H 3EO0A 3T0AA 4KC3B 1A3RL 2R2EB 1XGPA 4O2EA 5JTWA 4UTAL 5MEQB 4P46B 4M7ZC 5IB4B 1TTFA 5DT1L 4QYOA 4RA0C 1V7ML 3V5DB 5E7FA 3O3EB 4YDLB 1UXWB 4X6DE 4YDJB 1E27B 2GJ6A 2XA8L 1B90A 1CTOA 2D7QA 3LPWA 4YXKL 1N5AB 1IL1A 3U46B 4MQXC 3IJSA 3QQ4A 2J8UE 5F6IB 2RBLA 3IDIA 3RVXC 1S5HA 4WHYH 2BNRE 1TCRA 1YQVH 3HE7A 4NO5A 4X8JA 5FUZL 3CK0L 2CMRL 4HF5L 4ALAL 5C0CE 1PDKA 4DN3H 3VXRE 4FQIL 4LSUL 4UB0L 3PWLB 4JFDD 1DDHA 2YPLD 4OQTH 1MJ7L 5J06A 4LRIC 4WY7H 1V7NL 3L3KB 4NN5C 3RX8A 3SDXA 5HYIA 3QWOB 2R1XB 4NQCB 4L9LB 5FYKL 5DJAA 3C60D 1NBVH 5E2TL 4S2SA 4H5SA 3DIFA 5HDBF 3IKKA 3MGOA 4X5XA 2XV6B 4UU9A 2PW1B 4BSVA 3I50L 4WJ5A 1AGDB 3ULUH 4ZG1A 5C07B 1IAOA 4G9DA 1P6FA 1D9KB 5IB5A 1T1XA 1I3VA 2HTKC 1NAMB 3QNZB 1QPPA 5AUMA 1TZGH 1KIRA 5EA0L 4JFZL 1GGTA 4I2XE 2B5IC 2A9MH 3E2HC 4LIQE 4R97B 2BSRA 4TYUA 4L29A 3KYMB 3O6MH 5ADOL 2JK5B 3QA3B 5EU5A 1GZQA 1F4WL 4Z95L 3BJLA 1U8NB 3RBGA 5FYLL 1QRNE 4OLYL 2A6DB 5I8EB 4TVPE 1CQYA 1OP9A 4XWOD 3UPCA 3EYSL 5F7HA 4P4KB 4JHAH 4QTHA 5C9JB 1MFDH 3DI3B 4NM4H 3UEZA 3MLUL 4GO6B 1BJ8A 4S11A 3T2PA 2XG4A 3IS0X 5MERA 1F4AA 1WUNT 1G0XA 1DLHA 5IW1A 1H3UA 1P7KA 3MGTA 4S1SH 1NMAL 4OKVA 4L9DA 5K9JH 3DROA 3DX9B 5IESH 1JNHB 5A40E 4Q9BA 2FEDD 1F6AB 1GOHA 3W2DH 4PIRF 5K59F 4F58H 1FSKB 4YGVB 1OQOA 1JPGA 1N64L 2EDTA 3C5ZB 1YDPB 3MXWH 4GAYA 3U9UB 1K8IA 5T5FL 4KK8D 5ELIA 1D5XB 3LS5L 4P57B 4CKVX 4ELMA 1HKFA 3B2UD 4H8WH 1RK0B 3GSRA 3C2AL 3ECBA 3C6LB 1UXSA 3NCMA 3MODL 1IKNC 1RURL 2R1YB 3O6KH 4XCYB 5DZNA 4K71C 4OTXH 1A7PL 5BQ7B 4XMKL 5D2NB 3C6SA 3OR6A 1ES0A 4OZHE 4O5LH 3NAAL 5DI8B 1TTGA 2EDRA 5C2BL 5HY9B 3QCVH 1SBBA 4X8XA 4RRPG 5DEZA 2LABA 4FXGB 3O4LB 3IDXL 1CIUA 1TJGL 3VI4F 2XPGA 4DK3A 3S3JA 4U7KA 3QPQC 1FGNH 4UNUA 5FUOH 3SKOA 4JFEB 1GAFH 2EZ0D 2DM3A 2D03H 1Z0NA 2JE8A 1FNAA 2VDML 1JGEA 4F7CA 5EORL 3GMRA 4M43L 4OGXH 1CU4L 5IMLB 4ENED 4WFFE 2Z0BA 1YYLL 3LD8B 5D2LE 2QBWA 1A2YB 2XFXB 4PJ9A 3ARGA 1MPAH 5T3XE 4YFDB 4GRLD 1O7VA 4NQXA 5CGYD 5FXCH 4Y4HB 5FHAH 4PBVC 4HFWA 3KPRD 1YMMD 1KTLB 2IADA 5D70L 4JCMA 4HJ0C 4N0RA 2IPTL 3VFGL 5IEKB 1QR1B 1M6OA 3QUXC 1HHGA 3WE6A 1MHCB 1OAYL 4YBHA 3P40A 4EI5A 3DSFL 3VRIB 5GJTH 4YQXL 3L3IA 1NSNL 1NBZA 3ARYA 4HUMB 3V5KA 4JDVB 1P5VA 4OJFH 4OZIF 4OQ1A 2EDXA 1OQXA 4MJ5A 1OSZB 4J3UA 5GGTA 5ACZB 4ZS6C 5HGDA 1R5VA 5FYJE 1B2WH 2JJUA 5KSAD 4I3GA 2LTQB 5DC0A 5FYJU 4LEXH 2YC1A 3QUMB 2AXJA 3UJJL 1A6TA 4G8GB 2IPKA 3OAZH 2VDQH 4GKSA 4Z7WB 4DK6A 5IHZA 4J6RH 1VDGA 1CVRA 5EC2B 2F8XC 1UKSA 3T8XA 1NFIB 3VMNA 1GGIH 2WQRA 1L6XA 1NC4B 4FQ1H 3D2UD 5IB3A 1MCNA 3DTXB 4KKBD 4AL8L 5GZOD 1GGBH 2X05A 1A1NB 1U8QB 1MF2H 3OKNA 5TDNA 2VSCA 5E99H 3VA2C 1LEIA 1RK1B 1OT1A 3HG1E 4GXUN 4XMPL 3DURA 4HKXB 1J0YA 3S36L 1PY9A 3U0WL 2A74A 5ADPL 4RMWA 4HKJA 5J12C 2YEZB 4HGKC 1K4DA 1U8HB 3OKEA 4MVBD 1TJIH 1VFAB 3S4SG 1W72A 4WI4A 1EO7A 4JPIB 3Q48A 5CBEB 3U83A 4APQB 1PSKL 1C1EH 2F74B 3RWDA 2DLFH 4F9PA 5E1AA 3BH8A 2GY7B 4U1MB 3IDJA 4Y5XA 3MFGB 5AEAA 2DWDA 3L3GB 3RVWC 3VXRD 2PYFA 1NMCC 3LQZB 1T83A 5D7LE 1KLUB 1N4XL 5EULV 1JZ7A 2PR4L 1HHJB 1NLBH 4U1LB 2B4CC 3LEYL 3I75B 5DMIH 3W39A 5C08E 4IBLT 4BZYA 5T1LB 1T66C 2GITB 1W0WA 4Z0XA 4XC3H 1VERA 1INEL 3D18A 2ZPKH 4LRNL 4ZTOH 4H26A 1T3FB 2Z8SA 3B83A 2ZG1A 4PB0L 2P5WB 4JQXC 4K3HA 4FXKA 4P3WA 1X7QA 1VEMA 3IJHB 1HCFX 4HJJH 4H0IA 1CLCA 1LQSR 5KS9F 3CC5A 1FNGA 3BYYA 4I0PC 2QKIA 2R8SH 4HK0A 1CLYL 3MRHB 3M17A 4F15B 5DJ8B 3QPXH 1WK0A 2MPAL 4B0MM 3EOAA 1RZFH 5DC9B 5F71A 5C6TL 1G6RB 4JY4B 1ZHKB 1T80A 1YNLL 4X80H 3CSPA 2JJVA 3QAZB 4EKXA 5J56B 5C0JA 3FO2B 3OXSA 4XNQA 3S5LG 8FABA 3VFTA 3WNPA 4PRDA 2W65B 4QF1B 4AT6A 2ITDB 3I3DA 4K3JL 2NLJA 2AJYH 5F7NC 4TVSa 2QTEA 4KDVA 4X9HA 3TH3T 43CAB 4HUVB 5KBNC 4D3CL 4NYLB 2ZCKH 4PLJD 3EDJA 3KYOA 1NJ9A 3QWRD 3CFJB 1Q8MA 2R23A 1BLNA 5E2WL 1AY1L 4KPHH 1KJVA 4MAYC 1IILE 1I1CA 1Q9LA 4TUKH 4EBQL 3FB5A 4ORZC 5INDA 4F3FA 4R8WH 4PJBA 4RBPH 2Y7QB 1P84J 2NY3D 4QXWA 2OSLA 2YD7A 4FZ8L 4OCSH 3FZUC 3RU8L 4PJAF 4QHUA 3RY5A 5L7XL 4XNUL 3EYOB 15C8L 5JW5A 4DN4L 3L5WA 4ZXBC 2CGRL 3TBSB 4XCNB 1SJXA 2CUHA 1YJDL 5HYSG 3B9KA 1MJ8H 5AAMA 3LOWA 3TVMC 1NPUA 3P9WB 1FZOB 5EDXA 4FQHA 1YMHA 3O3AA 1EK3A 1PYWA 1FNHA 2D31B 5J1TC 4EUPA 4IOFD 1RULH 4O4YH 3ILQC 5D7JA 5IMMB 2CDGB 2GJZA 1J1OL 5HI3D 3V6BR 5GS3A 1KT2B 4HKBA 1PVHA 1T21A 2PF6A 3LHPL 3H9HB 1ZLSH 1OTTD 3HUJE 3KHOA 2DAVA 4LIQL 1NCCH 2DMBA 4XI5D 3MNWA 3VG9C 4G8EA 3L3DA 4FQXD 1TVHA 4TVPL 3RGVC 3JWOC 1XH3A 2QHLA 1UYWL 4B7LA 1IZKA 5GGVL 1T03H 1NCWH 5T3XD 1CICA 3M8OH 4IRJB 3L5HA 2RGSA 1WIPA 2QL1A 4L1HA 3KXFA 3SKUD 3EFFA 4PJGA 1SMAA 1WJ3A 2Z35B 4R6UA 4DGIL 2F53A 5J8OA 3G6DH 1F4XH 5EU3B 2QR0B 3U7WL 5CKAA 1NUGA 4GQ9L 4QOKB 4ORGA 4L4VB 1J1PL 1EPFA 4MB5A 1LO3H 5DRZA 4FZEH 4OV5B 2BVPA 1C16A 1U8OA 3AC0A 2B1AL 2VITA 3KJ4C 3V5HA 2CLZB 4DKFH 4DUXA 1G84A 1HQRA 1P7QD 1GHFL 2PETA 1VCAA 3I3EA 4GLRI 5EO9A 3MNVB 2XN9A 2BJML 2BNQD 1FE8H 4HS8L 5EOCL 4OFYD 2P5EA 1A3QA 3GJFB 4MQ7B 4KJYB 2VAAB 3FQRB 2QADD 4PUBH 4QY8A 3MYJA 2H41A 1J9CT 1JYWA 1EV2E 2PTUA 2YA0A 1CF8H 4OF3A 5I1DB 1UZ6E 5GS2D 3SO5A 5GGUA 4RAHA 4Q6IC 3ZYOA 1P4IL 1AKJB 1LEGB 3MROA 3NH7L 2DYPA 2RR3A 5I8CB 1IGIL 1T22B 3P0YL 1A47A 1YEIL 4KJQC 3QNYB 5HYJD 1BFOB 3ZE2E 1LWRA 3AMLA 4M5YH 4QT5A 3WIHL 3S37X 1VFMA 4OLUH 1Q0XL 4LARH 1EHNA 4MA7H 5B3JE 3MV9E 1RZGB 1PLGH 1AC0A 3O6FA 3PWNA 4F33B 3VGDA 2E6JA 2E9WA 3PWUB 2Z8VC 4FQQB 2BRRH 4TSCL 4XCCL 2IBZY 3STLB 2J3SA 5AZ2H 5T3XL 3TT1L 3CFKA 4R0LB 4WNQB 3UTTD 4CJ0A 1CBVL 4QRUA 1E6JH 1HSBB 5JW4M 1JF5A 4OAWA 2WP3O 2G60L 4I0KA 4YXLH 4GG6E 2FX7L 3HAEB 4NIKB 1E27A 4TOYL 3JV4B 1H8NA 4LPYA 1A7RL 4LSQH 4R7DB 1JPFA 5D7LD 2FJGA 3DVNA 5LGHL 1IEHA 1V05A 3U46A 2ICWB 4JQIH 3OR7A 5C08D 1AGCA 4RSVA 5IW3A 2GT9B 4Q0XL 4Y5VB 3EAKA 3ULUE 1AGFB 2DM2A 4PRIB 4K7PL 5FYJL 3D9AH 4LFHD 2XTJD 4G7VH 1MCPL 4JZOB 2DQJH 3HC0B 4JFQA 2OP4L 4OF7A 4P46C 1AR1C 1G7MA 4PJIA 3Q5YA 3SE4A 3SDCD 4LPUA 4MD0B 3QWOA 2R1XA 2H45A 4BSWB 5LXGL 2ADIB 4YDLC 1C8PA 3CNKA 5EUOE 1U6AH 2YK1L 3WHE0 4I3RH 5FKAB 3TNMA 1TZIA 2PW1A 3HRZA 1GVIA 3QZWA 5FO9B 2A6KA 3ZDZF 1AGDA 2VDKL 3QULB 4U1KB 4I1NB 3GI8H 5DQ9B 3WV0A 5F6IC 1J0JA 4AEHH 3DBXB 1NAMA 2IPUG 2VZ3A 3NA9H 4PY8I 2NW3B 4X99A 4YEFA 5D72H 1FN4B 4XAWL 1RD6A 3WLWD 2VJXA 1T7XA 4YIQA 1S7WA 1U36A 4PREA 5ESQA 4G8FA 3GSOB 2IH3B 4L9LC 4NC2B 3HRPA 3NOIA 1N59A 2A6DA 5I8EA 1NUFA 3KJ6H 3V52H 1FL5A 5A1AA 4M6MH 1TPXB 1NGQL 4NZDA 4P4KA 5C9JA 5FCUH 5D1XD 1CR9H 4HLZG 1EERB 3EOTL 4M7LH 1D9KC 4P4RA 3VI3F 1ADQL 1OW0C 3L5XL 4KVNL 2X70B 3D0VB 4OD3H 4JO4H 3X3FL 4UT7H 5ICXB 4WU7B 5ERWB 4OM1L 4PJEE 4YGVA 3DUUB 1MCWW 3C5ZA 5SX5K 4HPOH 3C8DA 1KENH 3UJTL 3X14B 4NNXA 2GCYA 5IROC 5TE6L 4L3AA 3GMMB 3D0LB 1OCWL 5L8JB 3OKYA 4QO1A 3UTZB 2WQ8A 3ARVA 4XX1E 3EHBD 1F5WA 3MBXL 5B4MC 1KV3A 3DX7A 3C6LA 3BW9B 3DSNA 3IXTA 4JDTL 2MTPA 3KPQA 3VFRB 3LRGA 4JHZA 3VD4A 4LP4A 4XCYA 3MJ7A 4PJ7F 5BQ7A 4AH2A 2W59A 5D2NA 2WAHA 4U6XB 1XGUB 4XWGH 5EOTB 1HWHB 1KPUB 4YHYB 3MLZH 2XWJB 4LPCA 4DUWA 3BVNB 3DLQR 3VFMA 1CGSH 1KJMB 5GGTH 1BECA 3ULVF 4JKKA 1FSKC 3C5ZC 1CFNB 4EQ3A 1EJ6A 5JMRA 4Y8AA 2D4DA 3ZHLA 4OLZL 3RL2A 1N0XH 1OP5H 4ZO6A 2NZIA 4XPBH 3T2NL 1NGXA 2BSSB 4HH8A 3TBVB 1AXTL 5JXAL 2EO1A 1I8KB 5LJYH 1UACH 1A2YA 2XFXA 3IDGA 5L9DH 3WDJA 4ZQKB 3L5JA 4X4YA 4Y4FD 3QG7H 4KTDL 4OSUL 4WFHE 3DUSA 5J89A 5EUKB 1J88A 4ZOCA 5E00A 3UYPA 1EBAA 3QEHB 2IANA 4Y4HA 4A6YB 2Y06L 2ATKB 5EZOH 3NABH 1RZ7L 3N1MC 1CIDA 4J3SA 4IMLA 3D39B 2B4CH 1DR9A 1OB1A 1MHCA 4YHLH 5DDHA 3VRIA 3VDBA 5IR1A 4RWHA 1PW3A 5BVJB 4ZUTA 2ZOLB 2CO7B 4Q74A 3UTSB 3CX2A 1W72H 2GTZB 3QO0A 3U36B 3JWDH 4UILL 3RY6A 3TZVD 1JNLH 3CUPA 3QEGL 2JCCB 3ZT6A 4X4XA 4XNMA 1KCVH 3EOBA 3QUMA 3F12B 3MLSL 3AUVA 3OQ3B 4Y4HC 1ND0B 2AJXH 2VE6A 4ODVH 5DLMH 1J7VR 3O9WB 4Z7WA 3MRNA 3NTCL 3HMWL 5EC2A 4YXHH 1A9BA 1NFIA 3EYQD 4POUB 2IG2L 3ZSTA 2H32A 1NC4A 1YEDB 2OJZL 3A67L 1INDH 1YPZF 7FABH 2QQNL 1EZVY 4ZPTB 4LKXB 5E5RB 1U8QA 1EEZA 3B9VA 4OZHF 1U3HB 4ZYKA 1SVCP 2CKBA 3HNSH 2JELL 4HKXA 2CLRB 4YDVB 4NHUB 2LTQC 4KQ3L 5C70A 4KTYA 5GXBB 1IGML 3U48A 1AD9B 3PDOB 3TYFA 3SKJH 4DOHE 2YEZA 1O5DT 3VWKD 1U8HA 3V95A 2OR7A 3U1SL 3O6LH 4NQVB 5JOPE 1QHOA 2VH5H 3X3GL 4KDWA 3FO0H 4OV6F 4WUUB 4KUZL 6FABH 1ETZA 2F74A 4P5TB 5GJSH 5JW4R 5KS9B 3ULUD 4JAMA 2OK0L 2AABH 3QR2A 3UX9B 4R2GB 5GRXG 4MLSA 1BFVL 2JJSA 1XR9B 3R4DA 1KLUA 3AM8A 3X12A 3EO1A 4HT1L 1ONQB 1XIWB 2V5RA 1DUYB 5IVXE 2W0LA 3FQTB 1OSPL 5T1LA 3ILPA 1MIMH 4TSBH 2GITA 5ECJE 3GSNH 1K4CB 4RZCA 1IM9D 5A43C 5IHBA 4M02A 1KNOB 3ET9F 2ZG2A 1T3FA 3NFPB 1RZKC 2E9JA 2ZSVB 1T7YA 2ATPB 1KC5H 4M5ZL 2P5WA 1BVKA 1VACB 3RDTB 4KKCD 3IJHA 2R1WB 4APQC 4Z76B 3WUWG 2OMNA 1NGPH 5D5ME 3VH8G 2YOCA 4PJFB 1G0YR 5JA8B 1GIGH 4PJXA 2XNAB 5DJ8A 4E41B 4HC1A 4LAJH 2JF1A 1G6RA 1ZHKA 4DN3L 4M7KH 1PZ5B 3VXNA 5D1ZB 1A6UH 2P8PB 5DEFB 1SBSH 4PJAB 4OQTL 5CINH 5HGBA 5IMKB 4MD5A 4WY7L 3FO2A 5ENWB 5EU6A 3WSQH 4BSJA 4EUPH 1NGWB 2W65A 4QF1A 2EIZA 1E4KC 3MRIB 3TYGH 4QXGH 3N9GH 43CAA 5JXEC 3DRTB 4M3JA 1ZGLB 1XFPA 4JRYD 4K55A 4Z77A 3P4LA 4KJWD 1VHPA 3N0PB 4IS6A 5BJTA 3ULUL 5GS1B 1ZT4B 1XF3B 2NY1D 5EH1A 3SBWC 4LSPH 2C3VB 4J3VA 1AHWC 2Q3AA 2CRIA 4F15C 3HB3C 5JQHC 5IGXH 5IEHB 1TZGL 4PYGA 1B6DA 1C5BH 2A9ML 3QAZC 3MA9L 3BD4A 4MLIA 5E6IA 3EYOA 3O6ML 5DD6B 3QDMA 4WWKC 1BEYL 3EKCA 2D3VA 3BIKA 1ZHLB 3WXVL 4X6CE 1MFDL 4HFUH 4NM4L 1WCBB 2Y23A 1DL7H 3F62A 2WBKA 3MR9A 3GMQB 2CDGA 2V7NB 2R2BA 3RZCD 1KT2A 4S1SL 5K9JL 1MRDL 5IESL 2AJUH 3RI5F 4LCWB 1PD6A 3H9HA 4ZSOB 1AI1H 1UENA 3T0BA 1CDIA 1FJ1B 2EC8A 5HBBA 1S7SA 3W2DL 1OM3H 4KGLA 1ZGLP 1SYVB 3BDBA 2NTFB 4F58L 3BUYB 1S9VB 1S7TB 2UWEB 3RNQB 2YMXH 3KPSB 4ODXA 3MXWL 1G7LA 5AWNL 4NC1C 1KLFA 2DDQH 5FF6B 1TMCB 3C5SA 5HYFA 3MRRA 4MJ2A 1XGQA 4ODUB 2NY5C 4J12A 3SCMD 1ORSB 4HIJA 4H8WL 3MV7D 4GBXD 1NGYB 1W0VA 3AY4C 3O6KL 4OTXL 3TT3L 2EYRB 4LLQB 2ZNXA 3D85D 3ISWA 2QR0A 4L3EE 4IOIB 5KSVB 5IVOA 5ISZB 4QOKA 3T1FA 4PJ8C 4P2QE 4LK4A 3QCVL 1NFDA 4OV5A 1QVOB 1KXVC 4PS4H 2PO6A 4MJ6B 1ZHBB 3V6OC 5FUOL 1FAIH 1GAFL 3MNVA 2D03L 4LCYB 4JRXD 5DJDA 1KN4H 4OGXL 1I7RB 1P2CB 4IRJC 3L7FB 2VAAA 2KUTA 3QIBA 4M6NH 5KW9H 5K93A 4AMKH 5I1DA 1MPAL 5GRYA 1JBJA 1EFXB 2NX5D 1N8ZB 1ZT7A 5FHAL 1LEGA 1X5GA 1AXSA 5FK9A 3LKPB 4PJDE 4DAGH 3U0TB 1M7XA 3W11C 2KQNA 2F54B 2PXYB 3W9DB 2HRPL 1NCDH 1FBIL 4QRPD 3HR5A 2IBBA 4RNRB 5F3BA 5DJCA 5F6HI 3ZHKA 4YFLI 2LAAA 5GJTL 4J8RB 1NH6A 4FQCH 3QUKA 4F33A 3WL9A 4C59B 2Y9RT 1K2DA 4FQQA 4MXQD 2EH7H 5JOPD 1B2WL 1L6ZA 4ZUVA 1T2QL 2AK4A 3H3KA 4KRPC 1DLFH 1WZMA 2VERN 3T65A 3IRPX 5BS0B 4ZPVA 3RVTD 1NLDH 4OIAA 4LEXL 3WKNA 5CD3B 1AO7A 1DN2A 5TDOA 3VW3H 2VDQL 1U8JA 4IHOA 4PP2B 2W92A 2Z31D 1WT5A 4CMHC 4X6FB 1NAMH 4J6RL 4PGBB 2GSGA 4HEPG 4YR6B 1ZT1B 1T7ZA 3GBMH 2H2SC 1JTOA 4FQ1L 5AYUL 4PRPB 3O8XD 4HZAA 1RJZA 1TVBA 1KN2H 2FEEL 3S36X 2GT9A 5F1OB 1GGBL 2HT3C 2ESVA 3B2VH 1I1AB 1I7TB 1DVFD 4PRIA 4YHNB 2RFXA 4PRHB 1JIBA 3VD3A 1B0RA 2N1KA 5E99L 3TBYB 3MJ8A 4JZOA 5JHDA 1WZKA 3HC0A 1OY3B 5ESAB 4JM2A 4R0LC 3TJHD 2HJKB 4JVWA 4O2FB 4NQEA 4G9FE 4NM8H 1VFBB 1MNUH 2GK2A 1TJIL 2ADIA 3DXAA 3OJDB 1A6ZB 4QTIH 1C1EL 4Z5RB 5B38B 4ZUSA 4YBLB 4GMTL 5MEPB 1SJHB 2DLFL 1B4RA 2V5TA 5I16B 3P11H 3TH2T 1DQDH 3WHXB 2Q6WB 1X4XA 1UZ6F 2EDKA 2VLKE 4Y5VC 3R1GL 5IJKA 5T1DH 1BZ9B 2OMBA 4YLQT 1KXQE 1NLBL 5DMIL 4PGDA 4OZFB 4X5WB 4XC3L 3JXAA 1FN4A 4MB4A 4JB9H 4RX4D 3U6RA 3ARDA 3NCEB 1T5WB 4ZTOL 2ZPKL 3QO1B 1MJJB 4X0KA 3GSOA 4KHXH 4Z7VE 3MBEC 5F8RC 2R9HC 2Y4SA 1CZ8L 3FQWB 1G7HB 3QXWA 5C0ND 4YPGA 3F7RA 1L0QA 4N0UA 1MCEA 1RHHB 2EO9A 4HPYH 3EUUA 4KDTC 3P77B 2R8SL 4MQTB 3VXUA 5E2VH 5IW6A 5JOFB 1QLRB 4OBRA 3QPXL 2MFNA 4GG6F 3RFZC 1RZFL 3NA4A 1HH9A 3NCJH 3RI5K 4LFHG 1H8OA 4P9HL 4X80L 4WU7A 4RQQA 4UNTA 5FA4B 4S1QH 4XPGH 1XGRB 4PJHB 5ERWA 5HI5D 5EO1A 5I76B 1K6QH 3ESUF 5C0RH 4HAFA 3OAYK 4JFYA 2AJYL 5BRZE 4V1DB 3GMMA 3RTQB 3D0LA 3TO4D 4KVCH 1JRHL 4XPHH 5TGBB 2ZCKL 1RFDH 3HS0B 4DVRH 2YUWA 1RY7B 3BW9A 1XR8B 2ZSWA 3VFRA 2AV7B 1Z3GH 5EG6C 3R06B 1FNEB 4KPHL 2EDJA 1BJMA 2EXYD 3AXLB 1YN7A 4JO3H 4TUKL 3N1FC 1MHPH 4ESKA 5EOTA 3GNMH 3PABB 2FIKB 5IBUB 1EGJH 3B5HA 4R8WL 3MV8A 4YFLF 5CUSH 5E8NB 3U2SB 1CGYA 5JNYB 1KJMA 5EUOF 4ZFOB 4WI3A 4OCSL 3SGEH 1D5MA 5ID0A 1FPTH 4MX7A 2X42A 2VRAA 4OF0A 3MA7A 3WN5A 3VD5A 5BW7A 4HGWB 2GJ6D 4OZIA 1LE9A 1WIUA 1MJ8L 3QUMH 2I9TB 2KDGA 4JG1L 3T0XA 2HAZA 3VJ6B 3CD4A 3MLXH 4P5MB 4GW1A 1I8KA 4R90H 4QHKI 3CAFA 5FGBA 4LSDA 4XXCC 1RULL 1UM5H 4O4YL 3HE7D 2BFVH 3SGDI 4Q6YA 3FB6A 2H32H 2ATKA 3E1F1 5TJWK 1BQHB 3JBG7 1ZLSL 2FL5B 1I1RA 3DO7B 1I3UA 1NCCL 4YHYC 5B39G 3HCVA 1ZKAA 1JHLH 3W9EB 2WLZA 1XF2B 4MDJB 2E7LC 1QYGH 2CKBH 1YPZB 1J8HB 3OB8A 1H15A 1BMGA 1JE6A 1RUQH 3V4VH 5MHSD 5IB1B 1NCWL 4OCYH 2JJTC 1GXEA 2Z9TA 3UTSA 2VLRE 3VMPA 2EDHA 2GTZA 3AB0B 2BOCB 3QQNA 4XVUC 1KYOK 5DS8B 4HCRA 4Y1AA 2V9RA 4W68A 3SE9H 5I1AA 2NCMA 4U6HA 1QFPA 3G6DL 4NN6B 1F4XL 4H1LB 4N0CC 2ADJB 4JRWA 3VXMB 5DUMH 3QIWC 4U3HA 3VGGA 1RSFA 1ED3B 1NL0H 5HGAB 3U7YH 1U92B 1YEJL 4FZEL 3RUGE 3O9WA 2H3NB 4OLVH 2MKLC 1I8MB 5DK0B 1UEMA 3PDGA 4DKFL 4UBDC 4U49A 5F44A 2FD6L 2FO4A 1GYAA 1J0IA 2XKNA 4U1JA 1YEGH 4AEIL 1BX2A 3QDGE 4NO0B 4NSKA 4WO4C 1MAKA 3FOLB 4ODWA 3MLYH 1FE8L 4CNIA 4LKXA 1AH1A 1ZEAH 4HH9B 1JRHI 1LO5A 4M9PA 4PUBL 5CJOH 4HZLB 4H25A 2CLRA 1QFHA 4YDVA 3TBTB 1T1ZB 2AGJH 3WFZA 1AD9A 3PDOA 4JKPL 5EBWB 1SEBB 4C83B 3ETBF 4LNRB 1JMZA 2HJLB 3GIVB 4Y5YB 3C5JB 2FB4H 3BP6B 3RWHA 4HC1H 4P5TA 1G6RH 5FM5M 1QNZH 1AFVH 2J7LA 3T4AA 3FT2B 4GUPB 3WEXA 4OLUL 3T3PE 4LARL 4MA7L 4NNYB 5I1JH 1XR9A 3WFDH 4YUEH 4Z18A 5F21B 1NCUA 1JHKH 1E4XH 1CFBA 1IGTB 2BRRL 4LGPB 2VZVA 1XIWA 1DUYA 4S1DC 1FYTB 3BN9D 3FQTA 3RX5A 4AEEA 4JEGB 1E6JL 1BVZA 1U3HC 5D8JH 4PTUB 4YXLL 3BP4B 3L3OB 5D7KE 1KNOA 3MRFA 4F7PA 3LCYA 4HJ0D 1AQDB 3QJHA 4QXUH 1NGZB 3SDAC 5C0GB 4QRQB 1CGVA 1VACA 5F7KC 3RDTA 1G7QB 4KQ4H 4Z76A 2X41A 1OP3K 4JQIL 2D7TH 4Y89A 3TM6A 2HVJA 4HIEA 3LKNB 4WHYG 1BOGA 5J7CC 1MQ8A 3QFDA 3GSUB 1I3GL 5DHVA 2CDEB 3ZTJH 3D9AL 1AGBA 3F6LA 5CBAA 4OF8A 4ZAKC 2DQJL 4QWWD 4LEOA 5FGCB 4PJ9D 5D1ZA 2P8PA 3ARGD 5DEFA 3M1BA 4J7RA 1HYRC 3CCHA 1FZJB 1S7VA 5ENWA 1FVEA 2AP2A 4HS3B 2R4SL 3L9RB 4I3SH 1NGWA 3RA7H 4GKNB 2APFA 4MZ3A 1U6AL 4I3RL 5KZCB 1KTDB 2FRGP 3MXVH 1L7TH 4R96A 3VFOA 1LO2H 3RX7A 4EI5D 5GS1A 1ZT4A 5GISH 4AEHL 3RKDD 2DIAA 4K7PY 1U93B 1T1WA 3HI6H 1E4WH 5GSVB 1REIA 5CCKL 4OCMC 2YHGA 4KKAC 4JFDA 5IEHA 4PLKC 2XN9E 4N5ED 5DJXB 5C9KA 3QEQB 3ARBA 3TNNB 5JZ7C 2P5EE 5E6YA 3N85L 3WNMA 2AXGA 3LSOB 3TH4T 5E9DB 3WXWH 4Z78B 3KLAB 5IBLD 5IQ7H 3UTPD 3O3DB 1X5IA 3VFPB 1RJYB 3SGKC 1I75A 3KJ6L 1GOFA 3HN3A 2NTSP 3V52L 4BQ6A 4YDIL 2DIJA 2YPVH 2ZWLT 3TN0C 1NC2B 5FCUL 3AS2A 4X98A 3RVWD 4D0CB 1WTLA 2WANA 1CR9L 3PL6B 1B3JA 4P2CG 2A6IB 5CIPB 1J11A 4FFYH 2V7NA 3QQ3B 4GOSA 4M7LL 5CZVH 1KCRH 2OJEB 1IQDA 2EDWA 4LCWA 4JO4L 3QI9A 1MHHA 3FO9A 5DVLA 4ZSOA 1AQKL 4UT7L 4ZTPH 5D4QA 2B2XH 4ZO8A 1YQ2A 4K3GA 4CRPA 2AK1H 1ZXQA 1JYVA 4HPOL 5C09B 1ORQB 5D5MF 1J86A 1KENL 4HWEH 5HDOA 5BVPL 2F8VA 4KZEH 1LNUB 5J6HA 2MHAA 4KKLC 2X4PB 3FKUS 2YD8A 4P2OB 4P23A 5I1IL 1NGYA 3H0TA 4ONHB 3K80A 3BKCH 4X7TA 2WBJC 2YRZA 1ZLWK 3X11B 2VISB 3SE3A 3EFDH 5IFAL 4LLQA 3RBSA 4XWGL 5KSVA 5SWSB 3SPVA 2PYEB 3B9DA 4UAOB 3MLZL 1JGVL 3UBXG 4QHMB 1QVOA 5F7UA 5E94B 3PP3K 5AG8A 2V2WA 5SWQA 1Y0LB 2E7BA 3OX8B 4HQQH 5DQJB 2J8HA 4TPRH 4HS6B 4D8PB 1S9XA 5E7BA 1DQLL 1N0XL 1G7JB 4YK4C 4GRMA 4LCYA 2Y36H 5DHXB 4G43B 1I7RA 2WUCH 4Z7UF 2XXMB 2CRZA 4NQCE 1UACL 5L9DL 1XT5A 1CDYA 5EBLB 3QG7L 3WYRA 3MLWH 1GGCL 5ILTH 1TZHB 5EZOL 3NABL 3T2OA 4MWFA 4NKDA 4M00A 4JREB 5LCVH 3U0TA 4Q9CA 2Y6SC 5F97E 2F54A 2PXYA 3W9DA 4UOW0 3N06B 3HZYB 1FL3A 2B4CL 3Q3GB 3D1MC 3LEVH 2CO6B 1IGYB 4NQDB 2ILLA 4Y16B 2VLJA 1S9YB 2PNDA 2W38A 1JF1A 5D7IB 4CU8A 5BOZG 2BX5A 3BKJH 1OAZH 1W72L 2VN7A 3JWDL 4W6XB 5I1EH 1J0HA 3H7BB 1WBYA 1MREH 3M07A 1HI6A 4ZNEA 3OBAA 5BS0A 3O0RH 3SJVA 2VIRA 4Y2DB 4FFZH 5SWZB 2LFGA 4ODVL 2OZ4A 5DLML 4PP2A 1T0NA 5DYOB 3BXNB 2CIIB 3SQOH 5J11B 3HNTL 1INDL 3DWTA 2DJUA 4PRPA 3MRPB 1YNTB 3B9KD 1LP9F 7FABL 1OWRM 1JGLH 3U0PB 1YYMH 5ALCH 4CBPA 4KUCD 5AD0A 4JGUA 1I7TA 1CD9B 1YZZA 4QCIB 3ZE0E 2VKWA 2O61A 1C5DB 2J2ZA 3TBYA 4M1CC 1ACYL 1X6NA 2CD0A 3HE6B 5T1KB 5D7JD 5C0BA 2HJKA 3UDWC 3JVGC 3BZEB 1U8PB 4PJ5B 1I4FA 4O2FA 4PRAB 1G7IB 3B43A 3SKJL 3S5LB 4X9IA 1GPOH 1B4JH 3O6LL 3Q0HA 3FRUB 2VH5L 5TQ2H 4PP1C 3OJDA 3F65A 1A6ZA 4Z5RA 6FABL 5J6GA 5MEPA 5D2NE 2AABL 1N6VA 1SJHA 4I9WE 3OPZH 5I16A 1CE6B 2BHZA 3ARWA 3WLBB 3IJYB 5FDWB 3WHXA 4LMQE 5B8CC 3QXAB 1P7HL 2Q6WA 1EEYB 1CICD 3O4LE 1I1AC 3KXFD 3GB7A 2W91A 4F7EB 4PJDF 4TSBL 1MIML 4JFEE 4AK1A 1PJ9A 3AS3A 4TRPH 2F53D 4M6OL 3GSNL 5FEBA 4ZS7H 2J8UA 3IAGC 1T5WA 4N8CH 3QO1A 1Z9MA 1UM4H 1OAQH 1OLLA 1MJJA 3V8CA 2BNRA 1NMBH 3CDGB 3GMLB 4CGTA 1KC5L 1KBGL 3F7PC 1HYSD 5E2UH 1FLTX 5C0CA 3SKMB 1G7HA 2UZXB 4Z8FL 4YBLC 1L9NA 1VEPA 1A6AA 4PJ7A 5DO2C 1RHHA 1OL0A 3HLAB 3TIDA 4PY8J 3OHXB 4NNPL 2XN9D 1OVZA 1IEBB 1GIGL 3EJYD 1QLRA 2P5ED 1RQ5A 1UQSB 4KK9D 2P49B 2NY0D 4X4ZA 1DN0B 2NY6D 4M7KL 5I18H 1A6UL 2FLBT 1SBSL 2I60H 2EYSB 4G8IB 5EU4A 2VDOH 3DV4B 5CINL 5GSRB 1KOAA 4UIMB 4TN9A 3WUZA 3WIIH 3AMKA 1MOEA 4EQ2A 2DS4A 3QUZB 4NO3B 2DYPD 1A0QH 3J8F7 3S3SA 1JWMA 3TYGL 2EYTA 3N9GL 4QXGL 3RTQA 3WS3B 4GQPH 4X7EC 4ELKB 3HS0A 1ZA3A 3T0EC 4BH8B 4GKZA 4G8GE 3THMH 1XR8A 4I2XA 3G9VA 5L2KB 2V9TA 1OARH 4Z7WE 2ORBH 2OLDA 3R06A 1FNEA 3O6FD 3AXLA 5I8OH 2CLVB 3INUH 3IGAA 1KCUH 3PWVB 2FIKA 1LHZA 1A21A 1PG7W 1QRNA 5IGXL 2H6PB 3KPOA 3FFCB 4U1HB 4KMTH 5JNYA 3ULVC 2LAGB 3O45B 1FVCB 2O93L 5ITBH 4HCRH 2LU7A 3NZ8A 5CMAB 1HH6B 1OAKH 2X7LA 4HGWA 1I8LA 1U8KA 4JFPB 3PDDA 5GRUH 1T2XA 3LV3B 4H20H 3IETB 2OXGA 1ZWIA 4HFUL 3MV11 4K9EC 1DL7L 1RVFH 4ONOA 3RPKA 2EDEA 5H35B 4U1GB 1B88A 5EZJB 4F37K 3BOVA 1NQBA 2AJUL 4LLVB 2HTLD 1AI1L 2FL5A 4NZJA 3AS1A 3CFBA 4XHQA 5DT1H 4Z7VF 1DTUA 1OM3L 2PUQT 1F3DJ 2X9YA 2X40A 3W9EA 3MLTB 1A6VH 2YMXL 2G75B 2L7UA 4NQCD 5J4MA 2DDQL 2ZNWA 1S7XB 3FB7A 4YXKH 2APXA 2VKXA 1KEML 3KPPA 4LQFH 3T0WA 3V6FB 1BZQK 3LRSB 3FT4A 1U9KA 4OZHA 3B9EA 1IGJB 3HPLB 5DFVC 3NIFE 2EDLA 2BOCA 1S7QB 3ARPA 4O02H 1JHTA 2P5WE 32C2B 1BD2B 1HDMA 5F9WB 4H1LA 4RAVB 3VFNA 3VXMA 4U6YB 4CADA 5IG7A 2JIXA 4P9MH 4FQIH 4PPTA 1U92A 4X9GA 3WIHA 5IOPA 1ZS8B 1I3RA 2H3NA 3QUYA 3O81A 3V8OA 1JV5A 1F13A 1F02I 2X4SB 2VQ1B 4FMFA 4M61A 4U1IB 1FAIL 2GY5A 4J4PC 4O51B 4NO0A 3AVEA 3KR3H 5JLZB